data_4CCZ
# 
_entry.id   4CCZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4CCZ         
PDBE  EBI-58838    
WWPDB D_1290058838 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4CCZ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-10-29 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vollmar, M.'       1  
'Kiyani, W.'        2  
'Krojer, T.'        3  
'Goubin, S.'        4  
'Burgess-Brown, N.' 5  
'von Delft, F.'     6  
'Oppermann, U.'     7  
'Edwards, A.'       8  
'Arrowsmith, C.'    9  
'Bountra, C.'       10 
'Yue, W.W.'         11 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structure of Human 5-Methyltetrahydrofolate-Homocysteine Methyltransferase, the Homocysteine and Folate Binding Domains' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vollmar, M.'       1  
primary 'Kiyani, W.'        2  
primary 'Krojer, T.'        3  
primary 'Goubin, S.'        4  
primary 'Burgess-Brown, N.' 5  
primary 'von Delft, F.'     6  
primary 'Oppermann, U.'     7  
primary 'Edwards, A.'       8  
primary 'Arrowsmith, C.'    9  
primary 'Bountra, C.'       10 
primary 'Yue, W.W.'         11 
# 
_cell.entry_id           4CCZ 
_cell.length_a           166.803 
_cell.length_b           166.803 
_cell.length_c           166.803 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4CCZ 
_symmetry.space_group_name_H-M             'I 2 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                197 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'METHIONINE SYNTHASE'           70523.828 1 2.1.1.13 ? 'HOMOCYSTEINE AND FOLATE BINDING DOMAINS' ? 
2 non-polymer syn '(6S)-5,6,7,8-TETRAHYDROFOLATE' 445.429   1 ?        ? ?                                         ? 
3 water       nat water                           18.015    2 ?        ? ?                                         ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'5-METHYLTETRAHYDROFOLATE--HOMOCYSTEINE METHYLTRANSFERASE, VITAMIN-B12 DEPENDENT METHIONINE SYNTHASE, MS' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMKTLRDEINAILQKRIMVLDGGMGTMIQREKLNEEHFRGQEFKDHARPLKGNNDILSITQPDVIYQIHKEYLLAGADII
ETNTFSSTSIAQADYGLEHLAYRMNMCSAGVARKAAEEVTLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELV
EAYQEQAKGLLDGGVDILLIETIFDTANAKAALFALQNLFEEKYAPRPIFISGTIVDKSGRTLSGQTGEGFVISVSHGEP
LCIGLNCALGAAEMRPFIEIIGKCTTAYVLCYPNAGLPNTFGDYDETPSMMAKHLKDFAMDGLVNIVGGCCGSTPDHIRE
IAEAVKNCKPRVPPATAFEGHMLLSGLEPFRIGPYTNFVNIGERCNVAGSRKFAKLIMAGNYEEALCVAKVQVEMGAQVL
DVNMDDGMLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDDFLEKARKIKKYGA
AMVVMAFDEEGQATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNILTIGTGMEEHNLYAINFIHATKVIKETLPGARI
SGGLSNLSFSFRGMEAIREAMHGVFLYHAIKSGMDMGIVNAGNLPVYDDIHKELLQLCEDLIWNKDPEATEKLLRYAQTQ
GTGG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMKTLRDEINAILQKRIMVLDGGMGTMIQREKLNEEHFRGQEFKDHARPLKGNNDILSITQPDVIYQIHKEYLLAGADII
ETNTFSSTSIAQADYGLEHLAYRMNMCSAGVARKAAEEVTLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELV
EAYQEQAKGLLDGGVDILLIETIFDTANAKAALFALQNLFEEKYAPRPIFISGTIVDKSGRTLSGQTGEGFVISVSHGEP
LCIGLNCALGAAEMRPFIEIIGKCTTAYVLCYPNAGLPNTFGDYDETPSMMAKHLKDFAMDGLVNIVGGCCGSTPDHIRE
IAEAVKNCKPRVPPATAFEGHMLLSGLEPFRIGPYTNFVNIGERCNVAGSRKFAKLIMAGNYEEALCVAKVQVEMGAQVL
DVNMDDGMLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDDFLEKARKIKKYGA
AMVVMAFDEEGQATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNILTIGTGMEEHNLYAINFIHATKVIKETLPGARI
SGGLSNLSFSFRGMEAIREAMHGVFLYHAIKSGMDMGIVNAGNLPVYDDIHKELLQLCEDLIWNKDPEATEKLLRYAQTQ
GTGG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   LYS n 
1 4   THR n 
1 5   LEU n 
1 6   ARG n 
1 7   ASP n 
1 8   GLU n 
1 9   ILE n 
1 10  ASN n 
1 11  ALA n 
1 12  ILE n 
1 13  LEU n 
1 14  GLN n 
1 15  LYS n 
1 16  ARG n 
1 17  ILE n 
1 18  MET n 
1 19  VAL n 
1 20  LEU n 
1 21  ASP n 
1 22  GLY n 
1 23  GLY n 
1 24  MET n 
1 25  GLY n 
1 26  THR n 
1 27  MET n 
1 28  ILE n 
1 29  GLN n 
1 30  ARG n 
1 31  GLU n 
1 32  LYS n 
1 33  LEU n 
1 34  ASN n 
1 35  GLU n 
1 36  GLU n 
1 37  HIS n 
1 38  PHE n 
1 39  ARG n 
1 40  GLY n 
1 41  GLN n 
1 42  GLU n 
1 43  PHE n 
1 44  LYS n 
1 45  ASP n 
1 46  HIS n 
1 47  ALA n 
1 48  ARG n 
1 49  PRO n 
1 50  LEU n 
1 51  LYS n 
1 52  GLY n 
1 53  ASN n 
1 54  ASN n 
1 55  ASP n 
1 56  ILE n 
1 57  LEU n 
1 58  SER n 
1 59  ILE n 
1 60  THR n 
1 61  GLN n 
1 62  PRO n 
1 63  ASP n 
1 64  VAL n 
1 65  ILE n 
1 66  TYR n 
1 67  GLN n 
1 68  ILE n 
1 69  HIS n 
1 70  LYS n 
1 71  GLU n 
1 72  TYR n 
1 73  LEU n 
1 74  LEU n 
1 75  ALA n 
1 76  GLY n 
1 77  ALA n 
1 78  ASP n 
1 79  ILE n 
1 80  ILE n 
1 81  GLU n 
1 82  THR n 
1 83  ASN n 
1 84  THR n 
1 85  PHE n 
1 86  SER n 
1 87  SER n 
1 88  THR n 
1 89  SER n 
1 90  ILE n 
1 91  ALA n 
1 92  GLN n 
1 93  ALA n 
1 94  ASP n 
1 95  TYR n 
1 96  GLY n 
1 97  LEU n 
1 98  GLU n 
1 99  HIS n 
1 100 LEU n 
1 101 ALA n 
1 102 TYR n 
1 103 ARG n 
1 104 MET n 
1 105 ASN n 
1 106 MET n 
1 107 CYS n 
1 108 SER n 
1 109 ALA n 
1 110 GLY n 
1 111 VAL n 
1 112 ALA n 
1 113 ARG n 
1 114 LYS n 
1 115 ALA n 
1 116 ALA n 
1 117 GLU n 
1 118 GLU n 
1 119 VAL n 
1 120 THR n 
1 121 LEU n 
1 122 GLN n 
1 123 THR n 
1 124 GLY n 
1 125 ILE n 
1 126 LYS n 
1 127 ARG n 
1 128 PHE n 
1 129 VAL n 
1 130 ALA n 
1 131 GLY n 
1 132 ALA n 
1 133 LEU n 
1 134 GLY n 
1 135 PRO n 
1 136 THR n 
1 137 ASN n 
1 138 LYS n 
1 139 THR n 
1 140 LEU n 
1 141 SER n 
1 142 VAL n 
1 143 SER n 
1 144 PRO n 
1 145 SER n 
1 146 VAL n 
1 147 GLU n 
1 148 ARG n 
1 149 PRO n 
1 150 ASP n 
1 151 TYR n 
1 152 ARG n 
1 153 ASN n 
1 154 ILE n 
1 155 THR n 
1 156 PHE n 
1 157 ASP n 
1 158 GLU n 
1 159 LEU n 
1 160 VAL n 
1 161 GLU n 
1 162 ALA n 
1 163 TYR n 
1 164 GLN n 
1 165 GLU n 
1 166 GLN n 
1 167 ALA n 
1 168 LYS n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLY n 
1 174 GLY n 
1 175 VAL n 
1 176 ASP n 
1 177 ILE n 
1 178 LEU n 
1 179 LEU n 
1 180 ILE n 
1 181 GLU n 
1 182 THR n 
1 183 ILE n 
1 184 PHE n 
1 185 ASP n 
1 186 THR n 
1 187 ALA n 
1 188 ASN n 
1 189 ALA n 
1 190 LYS n 
1 191 ALA n 
1 192 ALA n 
1 193 LEU n 
1 194 PHE n 
1 195 ALA n 
1 196 LEU n 
1 197 GLN n 
1 198 ASN n 
1 199 LEU n 
1 200 PHE n 
1 201 GLU n 
1 202 GLU n 
1 203 LYS n 
1 204 TYR n 
1 205 ALA n 
1 206 PRO n 
1 207 ARG n 
1 208 PRO n 
1 209 ILE n 
1 210 PHE n 
1 211 ILE n 
1 212 SER n 
1 213 GLY n 
1 214 THR n 
1 215 ILE n 
1 216 VAL n 
1 217 ASP n 
1 218 LYS n 
1 219 SER n 
1 220 GLY n 
1 221 ARG n 
1 222 THR n 
1 223 LEU n 
1 224 SER n 
1 225 GLY n 
1 226 GLN n 
1 227 THR n 
1 228 GLY n 
1 229 GLU n 
1 230 GLY n 
1 231 PHE n 
1 232 VAL n 
1 233 ILE n 
1 234 SER n 
1 235 VAL n 
1 236 SER n 
1 237 HIS n 
1 238 GLY n 
1 239 GLU n 
1 240 PRO n 
1 241 LEU n 
1 242 CYS n 
1 243 ILE n 
1 244 GLY n 
1 245 LEU n 
1 246 ASN n 
1 247 CYS n 
1 248 ALA n 
1 249 LEU n 
1 250 GLY n 
1 251 ALA n 
1 252 ALA n 
1 253 GLU n 
1 254 MET n 
1 255 ARG n 
1 256 PRO n 
1 257 PHE n 
1 258 ILE n 
1 259 GLU n 
1 260 ILE n 
1 261 ILE n 
1 262 GLY n 
1 263 LYS n 
1 264 CYS n 
1 265 THR n 
1 266 THR n 
1 267 ALA n 
1 268 TYR n 
1 269 VAL n 
1 270 LEU n 
1 271 CYS n 
1 272 TYR n 
1 273 PRO n 
1 274 ASN n 
1 275 ALA n 
1 276 GLY n 
1 277 LEU n 
1 278 PRO n 
1 279 ASN n 
1 280 THR n 
1 281 PHE n 
1 282 GLY n 
1 283 ASP n 
1 284 TYR n 
1 285 ASP n 
1 286 GLU n 
1 287 THR n 
1 288 PRO n 
1 289 SER n 
1 290 MET n 
1 291 MET n 
1 292 ALA n 
1 293 LYS n 
1 294 HIS n 
1 295 LEU n 
1 296 LYS n 
1 297 ASP n 
1 298 PHE n 
1 299 ALA n 
1 300 MET n 
1 301 ASP n 
1 302 GLY n 
1 303 LEU n 
1 304 VAL n 
1 305 ASN n 
1 306 ILE n 
1 307 VAL n 
1 308 GLY n 
1 309 GLY n 
1 310 CYS n 
1 311 CYS n 
1 312 GLY n 
1 313 SER n 
1 314 THR n 
1 315 PRO n 
1 316 ASP n 
1 317 HIS n 
1 318 ILE n 
1 319 ARG n 
1 320 GLU n 
1 321 ILE n 
1 322 ALA n 
1 323 GLU n 
1 324 ALA n 
1 325 VAL n 
1 326 LYS n 
1 327 ASN n 
1 328 CYS n 
1 329 LYS n 
1 330 PRO n 
1 331 ARG n 
1 332 VAL n 
1 333 PRO n 
1 334 PRO n 
1 335 ALA n 
1 336 THR n 
1 337 ALA n 
1 338 PHE n 
1 339 GLU n 
1 340 GLY n 
1 341 HIS n 
1 342 MET n 
1 343 LEU n 
1 344 LEU n 
1 345 SER n 
1 346 GLY n 
1 347 LEU n 
1 348 GLU n 
1 349 PRO n 
1 350 PHE n 
1 351 ARG n 
1 352 ILE n 
1 353 GLY n 
1 354 PRO n 
1 355 TYR n 
1 356 THR n 
1 357 ASN n 
1 358 PHE n 
1 359 VAL n 
1 360 ASN n 
1 361 ILE n 
1 362 GLY n 
1 363 GLU n 
1 364 ARG n 
1 365 CYS n 
1 366 ASN n 
1 367 VAL n 
1 368 ALA n 
1 369 GLY n 
1 370 SER n 
1 371 ARG n 
1 372 LYS n 
1 373 PHE n 
1 374 ALA n 
1 375 LYS n 
1 376 LEU n 
1 377 ILE n 
1 378 MET n 
1 379 ALA n 
1 380 GLY n 
1 381 ASN n 
1 382 TYR n 
1 383 GLU n 
1 384 GLU n 
1 385 ALA n 
1 386 LEU n 
1 387 CYS n 
1 388 VAL n 
1 389 ALA n 
1 390 LYS n 
1 391 VAL n 
1 392 GLN n 
1 393 VAL n 
1 394 GLU n 
1 395 MET n 
1 396 GLY n 
1 397 ALA n 
1 398 GLN n 
1 399 VAL n 
1 400 LEU n 
1 401 ASP n 
1 402 VAL n 
1 403 ASN n 
1 404 MET n 
1 405 ASP n 
1 406 ASP n 
1 407 GLY n 
1 408 MET n 
1 409 LEU n 
1 410 ASP n 
1 411 GLY n 
1 412 PRO n 
1 413 SER n 
1 414 ALA n 
1 415 MET n 
1 416 THR n 
1 417 ARG n 
1 418 PHE n 
1 419 CYS n 
1 420 ASN n 
1 421 LEU n 
1 422 ILE n 
1 423 ALA n 
1 424 SER n 
1 425 GLU n 
1 426 PRO n 
1 427 ASP n 
1 428 ILE n 
1 429 ALA n 
1 430 LYS n 
1 431 VAL n 
1 432 PRO n 
1 433 LEU n 
1 434 CYS n 
1 435 ILE n 
1 436 ASP n 
1 437 SER n 
1 438 SER n 
1 439 ASN n 
1 440 PHE n 
1 441 ALA n 
1 442 VAL n 
1 443 ILE n 
1 444 GLU n 
1 445 ALA n 
1 446 GLY n 
1 447 LEU n 
1 448 LYS n 
1 449 CYS n 
1 450 CYS n 
1 451 GLN n 
1 452 GLY n 
1 453 LYS n 
1 454 CYS n 
1 455 ILE n 
1 456 VAL n 
1 457 ASN n 
1 458 SER n 
1 459 ILE n 
1 460 SER n 
1 461 LEU n 
1 462 LYS n 
1 463 GLU n 
1 464 GLY n 
1 465 GLU n 
1 466 ASP n 
1 467 ASP n 
1 468 PHE n 
1 469 LEU n 
1 470 GLU n 
1 471 LYS n 
1 472 ALA n 
1 473 ARG n 
1 474 LYS n 
1 475 ILE n 
1 476 LYS n 
1 477 LYS n 
1 478 TYR n 
1 479 GLY n 
1 480 ALA n 
1 481 ALA n 
1 482 MET n 
1 483 VAL n 
1 484 VAL n 
1 485 MET n 
1 486 ALA n 
1 487 PHE n 
1 488 ASP n 
1 489 GLU n 
1 490 GLU n 
1 491 GLY n 
1 492 GLN n 
1 493 ALA n 
1 494 THR n 
1 495 GLU n 
1 496 THR n 
1 497 ASP n 
1 498 THR n 
1 499 LYS n 
1 500 ILE n 
1 501 ARG n 
1 502 VAL n 
1 503 CYS n 
1 504 THR n 
1 505 ARG n 
1 506 ALA n 
1 507 TYR n 
1 508 HIS n 
1 509 LEU n 
1 510 LEU n 
1 511 VAL n 
1 512 LYS n 
1 513 LYS n 
1 514 LEU n 
1 515 GLY n 
1 516 PHE n 
1 517 ASN n 
1 518 PRO n 
1 519 ASN n 
1 520 ASP n 
1 521 ILE n 
1 522 ILE n 
1 523 PHE n 
1 524 ASP n 
1 525 PRO n 
1 526 ASN n 
1 527 ILE n 
1 528 LEU n 
1 529 THR n 
1 530 ILE n 
1 531 GLY n 
1 532 THR n 
1 533 GLY n 
1 534 MET n 
1 535 GLU n 
1 536 GLU n 
1 537 HIS n 
1 538 ASN n 
1 539 LEU n 
1 540 TYR n 
1 541 ALA n 
1 542 ILE n 
1 543 ASN n 
1 544 PHE n 
1 545 ILE n 
1 546 HIS n 
1 547 ALA n 
1 548 THR n 
1 549 LYS n 
1 550 VAL n 
1 551 ILE n 
1 552 LYS n 
1 553 GLU n 
1 554 THR n 
1 555 LEU n 
1 556 PRO n 
1 557 GLY n 
1 558 ALA n 
1 559 ARG n 
1 560 ILE n 
1 561 SER n 
1 562 GLY n 
1 563 GLY n 
1 564 LEU n 
1 565 SER n 
1 566 ASN n 
1 567 LEU n 
1 568 SER n 
1 569 PHE n 
1 570 SER n 
1 571 PHE n 
1 572 ARG n 
1 573 GLY n 
1 574 MET n 
1 575 GLU n 
1 576 ALA n 
1 577 ILE n 
1 578 ARG n 
1 579 GLU n 
1 580 ALA n 
1 581 MET n 
1 582 HIS n 
1 583 GLY n 
1 584 VAL n 
1 585 PHE n 
1 586 LEU n 
1 587 TYR n 
1 588 HIS n 
1 589 ALA n 
1 590 ILE n 
1 591 LYS n 
1 592 SER n 
1 593 GLY n 
1 594 MET n 
1 595 ASP n 
1 596 MET n 
1 597 GLY n 
1 598 ILE n 
1 599 VAL n 
1 600 ASN n 
1 601 ALA n 
1 602 GLY n 
1 603 ASN n 
1 604 LEU n 
1 605 PRO n 
1 606 VAL n 
1 607 TYR n 
1 608 ASP n 
1 609 ASP n 
1 610 ILE n 
1 611 HIS n 
1 612 LYS n 
1 613 GLU n 
1 614 LEU n 
1 615 LEU n 
1 616 GLN n 
1 617 LEU n 
1 618 CYS n 
1 619 GLU n 
1 620 ASP n 
1 621 LEU n 
1 622 ILE n 
1 623 TRP n 
1 624 ASN n 
1 625 LYS n 
1 626 ASP n 
1 627 PRO n 
1 628 GLU n 
1 629 ALA n 
1 630 THR n 
1 631 GLU n 
1 632 LYS n 
1 633 LEU n 
1 634 LEU n 
1 635 ARG n 
1 636 TYR n 
1 637 ALA n 
1 638 GLN n 
1 639 THR n 
1 640 GLN n 
1 641 GLY n 
1 642 THR n 
1 643 GLY n 
1 644 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              R3-PRARE2 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PNIC28-BSA4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    METH_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q99707 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4CCZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 644 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q99707 
_struct_ref_seq.db_align_beg                  16 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  657 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       16 
_struct_ref_seq.pdbx_auth_seq_align_end       657 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4CCZ SER A 1 ? UNP Q99707 ? ? 'expression tag' 14 1 
1 4CCZ MET A 2 ? UNP Q99707 ? ? 'expression tag' 15 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                 ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                 ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                          ? 'C3 H7 N O3'     105.093 
THG non-polymer         . '(6S)-5,6,7,8-TETRAHYDROFOLATE' ? 'C19 H23 N7 O6'  445.429 
THR 'L-peptide linking' y THREONINE                       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4CCZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.76 
_exptl_crystal.density_percent_sol   55.42 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '2.4M SODIUM MALONATE' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2013-01-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I02 
_diffrn_source.pdbx_wavelength             0.9795 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4CCZ 
_reflns.observed_criterion_sigma_I   2.4 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             39.32 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   21347 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.90 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              13.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           1.20 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.40 
_reflns_shell.pdbx_redundancy        13.3 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4CCZ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     20213 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.35 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    99.93 
_refine.ls_R_factor_obs                          0.22004 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21705 
_refine.ls_R_factor_R_free                       0.27408 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1095 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.940 
_refine.correlation_coeff_Fo_to_Fc_free          0.894 
_refine.B_iso_mean                               74.039 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES WITH TLS ADDED' 
_refine.pdbx_starting_model                      'PDB ENTRY 1Q7Q' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.687 
_refine.pdbx_overall_ESU_R_Free                  0.346 
_refine.overall_SU_ML                            0.309 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             32.779 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4218 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             2 
_refine_hist.number_atoms_total               4252 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        39.35 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.005  0.019  ? 4325 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 3811 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.910  1.968  ? 5900 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.707  3.000  ? 8668 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.391  5.000  ? 607  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.109 24.408 ? 152  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.697 15.000 ? 555  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.291 15.000 ? 17   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.050  0.200  ? 690  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.021  ? 5174 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 968  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  5.730  14.517 ? 2443 'X-RAY DIFFRACTION' ? 
r_mcbond_other               5.732  14.503 ? 2441 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 7.914  22.870 ? 3045 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  6.378  15.541 ? 1882 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.701 
_refine_ls_shell.d_res_low                        2.771 
_refine_ls_shell.number_reflns_R_work             1500 
_refine_ls_shell.R_factor_R_work                  0.279 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.367 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             71 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4CCZ 
_struct.title                     
'Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains' 
_struct.pdbx_descriptor           'METHIONINE SYNTHASE (E.C.2.1.1.13)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4CCZ 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 4   ? ARG A 16  ? THR A 17  ARG A 29  1 ? 13 
HELX_P HELX_P2  2  GLY A 23  ? LYS A 32  ? GLY A 36  LYS A 45  1 ? 10 
HELX_P HELX_P3  3  GLU A 35  ? ARG A 39  ? GLU A 48  ARG A 52  5 ? 5  
HELX_P HELX_P4  4  ASN A 53  ? ASP A 55  ? ASN A 66  ASP A 68  5 ? 3  
HELX_P HELX_P5  5  ILE A 56  ? GLN A 61  ? ILE A 69  GLN A 74  1 ? 6  
HELX_P HELX_P6  6  GLN A 61  ? ALA A 75  ? GLN A 74  ALA A 88  1 ? 15 
HELX_P HELX_P7  7  THR A 88  ? ALA A 93  ? THR A 101 ALA A 106 1 ? 6  
HELX_P HELX_P8  8  ASP A 94  ? GLY A 96  ? ASP A 107 GLY A 109 5 ? 3  
HELX_P HELX_P9  9  LEU A 97  ? HIS A 99  ? LEU A 110 HIS A 112 5 ? 3  
HELX_P HELX_P10 10 LEU A 100 ? GLY A 124 ? LEU A 113 GLY A 137 1 ? 25 
HELX_P HELX_P11 11 THR A 155 ? GLY A 173 ? THR A 168 GLY A 186 1 ? 19 
HELX_P HELX_P12 12 ASP A 185 ? GLU A 201 ? ASP A 198 GLU A 214 1 ? 17 
HELX_P HELX_P13 13 THR A 227 ? SER A 236 ? THR A 240 SER A 249 1 ? 10 
HELX_P HELX_P14 14 HIS A 237 ? GLU A 239 ? HIS A 250 GLU A 252 5 ? 3  
HELX_P HELX_P15 15 MET A 254 ? LYS A 263 ? MET A 267 LYS A 276 1 ? 10 
HELX_P HELX_P16 16 THR A 314 ? LYS A 326 ? THR A 327 LYS A 339 1 ? 13 
HELX_P HELX_P17 17 SER A 370 ? ALA A 379 ? SER A 383 ALA A 392 1 ? 10 
HELX_P HELX_P18 18 ASN A 381 ? MET A 395 ? ASN A 394 MET A 408 1 ? 15 
HELX_P HELX_P19 19 ASP A 410 ? GLU A 425 ? ASP A 423 GLU A 438 1 ? 16 
HELX_P HELX_P20 20 GLU A 425 ? LYS A 430 ? GLU A 438 LYS A 443 1 ? 6  
HELX_P HELX_P21 21 ASN A 439 ? CYS A 450 ? ASN A 452 CYS A 463 1 ? 12 
HELX_P HELX_P22 22 GLY A 464 ? GLY A 479 ? GLY A 477 GLY A 492 1 ? 16 
HELX_P HELX_P23 23 GLU A 495 ? GLY A 515 ? GLU A 508 GLY A 528 1 ? 21 
HELX_P HELX_P24 24 ASN A 517 ? ASN A 519 ? ASN A 530 ASN A 532 5 ? 3  
HELX_P HELX_P25 25 MET A 534 ? ASN A 538 ? MET A 547 ASN A 551 5 ? 5  
HELX_P HELX_P26 26 LEU A 539 ? LEU A 555 ? LEU A 552 LEU A 568 1 ? 17 
HELX_P HELX_P27 27 LEU A 564 ? ARG A 572 ? LEU A 577 ARG A 585 5 ? 9  
HELX_P HELX_P28 28 MET A 574 ? GLY A 593 ? MET A 587 GLY A 606 1 ? 20 
HELX_P HELX_P29 29 VAL A 606 ? ILE A 610 ? VAL A 619 ILE A 623 5 ? 5  
HELX_P HELX_P30 30 HIS A 611 ? TRP A 623 ? HIS A 624 TRP A 636 1 ? 13 
HELX_P HELX_P31 31 GLU A 628 ? TYR A 636 ? GLU A 641 TYR A 649 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            247 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            310 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             260 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             323 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.033 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 39  A . ? ARG 52  A GLY 40  A ? GLY 53  A 1 -9.32 
2 ASN 457 A . ? ASN 470 A SER 458 A ? SER 471 A 1 7.36  
3 ALA 637 A . ? ALA 650 A GLN 638 A ? GLN 651 A 1 8.05  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 6 ? 
AC ? 2 ? 
AD ? 8 ? 
AE ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AB 1 2 ? parallel      
AB 2 3 ? parallel      
AB 3 4 ? parallel      
AB 4 5 ? parallel      
AB 5 6 ? parallel      
AC 1 2 ? anti-parallel 
AD 1 2 ? parallel      
AD 2 3 ? parallel      
AD 3 4 ? parallel      
AD 4 5 ? parallel      
AD 5 6 ? parallel      
AD 6 7 ? parallel      
AD 7 8 ? parallel      
AE 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 MET A 18  ? VAL A 19  ? MET A 31  VAL A 32  
AA 2 ILE A 306 ? VAL A 307 ? ILE A 319 VAL A 320 
AB 1 ILE A 79  ? GLU A 81  ? ILE A 92  GLU A 94  
AB 2 PHE A 128 ? LEU A 133 ? PHE A 141 LEU A 146 
AB 3 ILE A 177 ? ILE A 183 ? ILE A 190 ILE A 196 
AB 4 ILE A 209 ? GLY A 213 ? ILE A 222 GLY A 226 
AB 5 CYS A 242 ? GLY A 250 ? CYS A 255 GLY A 263 
AB 6 TYR A 268 ? ASN A 274 ? TYR A 281 ASN A 287 
AC 1 MET A 342 ? SER A 345 ? MET A 355 SER A 358 
AC 2 PRO A 349 ? ILE A 352 ? PRO A 362 ILE A 365 
AD 1 ARG A 559 ? ILE A 560 ? ARG A 572 ILE A 573 
AD 2 ILE A 521 ? ASP A 524 ? ILE A 534 ASP A 537 
AD 3 ALA A 481 ? MET A 485 ? ALA A 494 MET A 498 
AD 4 ILE A 455 ? ILE A 459 ? ILE A 468 ILE A 472 
AD 5 LEU A 433 ? ASP A 436 ? LEU A 446 ASP A 449 
AD 6 VAL A 399 ? ASN A 403 ? VAL A 412 ASN A 416 
AD 7 VAL A 359 ? GLY A 362 ? VAL A 372 GLY A 375 
AD 8 MET A 596 ? VAL A 599 ? MET A 609 VAL A 612 
AE 1 PHE A 487 ? ASP A 488 ? PHE A 500 ASP A 501 
AE 2 GLY A 491 ? GLN A 492 ? GLY A 504 GLN A 505 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 O MET A 18  ? O MET A 31  N VAL A 307 ? N VAL A 320 
AB 1 2 N ILE A 80  ? N ILE A 93  O PHE A 128 ? O PHE A 141 
AB 2 3 N GLY A 131 ? N GLY A 144 O ILE A 177 ? O ILE A 190 
AB 3 4 N ILE A 180 ? N ILE A 193 O PHE A 210 ? O PHE A 223 
AB 4 5 N ILE A 211 ? N ILE A 224 O CYS A 242 ? O CYS A 255 
AB 5 6 N ILE A 243 ? N ILE A 256 O TYR A 268 ? O TYR A 281 
AC 1 2 N LEU A 344 ? N LEU A 357 O PHE A 350 ? O PHE A 363 
AD 1 2 N ARG A 559 ? N ARG A 572 O ILE A 521 ? O ILE A 534 
AD 2 3 N ILE A 522 ? N ILE A 535 O MET A 482 ? O MET A 495 
AD 3 4 N VAL A 483 ? N VAL A 496 O VAL A 456 ? O VAL A 469 
AD 4 5 N ILE A 455 ? N ILE A 468 O LEU A 433 ? O LEU A 446 
AD 5 6 N CYS A 434 ? N CYS A 447 O LEU A 400 ? O LEU A 413 
AD 6 7 N ASP A 401 ? N ASP A 414 O GLY A 362 ? O GLY A 375 
AD 7 8 N ILE A 361 ? N ILE A 374 O GLY A 597 ? O GLY A 610 
AE 1 2 N ASP A 488 ? N ASP A 501 O GLY A 491 ? O GLY A 504 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    15 
_struct_site.details              'BINDING SITE FOR RESIDUE THG A 1652' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 GLU A 363 ? GLU A 376 . ? 1_555 ? 
2  AC1 15 ASN A 366 ? ASN A 379 . ? 1_555 ? 
3  AC1 15 GLY A 369 ? GLY A 382 . ? 1_555 ? 
4  AC1 15 ARG A 371 ? ARG A 384 . ? 1_555 ? 
5  AC1 15 ASP A 436 ? ASP A 449 . ? 1_555 ? 
6  AC1 15 ASN A 457 ? ASN A 470 . ? 1_555 ? 
7  AC1 15 MET A 485 ? MET A 498 . ? 1_555 ? 
8  AC1 15 ASP A 524 ? ASP A 537 . ? 1_555 ? 
9  AC1 15 GLY A 563 ? GLY A 576 . ? 1_555 ? 
10 AC1 15 SER A 565 ? SER A 578 . ? 1_555 ? 
11 AC1 15 ASN A 566 ? ASN A 579 . ? 1_555 ? 
12 AC1 15 PHE A 569 ? PHE A 582 . ? 1_555 ? 
13 AC1 15 ARG A 572 ? ARG A 585 . ? 1_555 ? 
14 AC1 15 ARG A 578 ? ARG A 591 . ? 1_555 ? 
15 AC1 15 ILE A 598 ? ILE A 611 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4CCZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4CCZ 
_atom_sites.fract_transf_matrix[1][1]   0.005995 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005995 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005995 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . THR A 1 4   ? -75.929 32.435 -5.203  1.00 124.92 ? 17   THR A N     1 
ATOM   2    C CA    . THR A 1 4   ? -74.812 32.093 -6.135  1.00 123.32 ? 17   THR A CA    1 
ATOM   3    C C     . THR A 1 4   ? -74.691 30.583 -6.328  1.00 116.46 ? 17   THR A C     1 
ATOM   4    O O     . THR A 1 4   ? -75.206 29.800 -5.523  1.00 113.27 ? 17   THR A O     1 
ATOM   5    C CB    . THR A 1 4   ? -73.463 32.635 -5.621  1.00 126.08 ? 17   THR A CB    1 
ATOM   6    N N     . LEU A 1 5   ? -74.006 30.186 -7.399  1.00 115.16 ? 18   LEU A N     1 
ATOM   7    C CA    . LEU A 1 5   ? -73.766 28.770 -7.692  1.00 108.85 ? 18   LEU A CA    1 
ATOM   8    C C     . LEU A 1 5   ? -72.849 28.116 -6.652  1.00 105.30 ? 18   LEU A C     1 
ATOM   9    O O     . LEU A 1 5   ? -72.912 26.905 -6.445  1.00 100.14 ? 18   LEU A O     1 
ATOM   10   C CB    . LEU A 1 5   ? -73.164 28.606 -9.091  1.00 109.96 ? 18   LEU A CB    1 
ATOM   11   N N     . ARG A 1 6   ? -72.004 28.923 -6.009  1.00 109.42 ? 19   ARG A N     1 
ATOM   12   C CA    . ARG A 1 6   ? -71.109 28.447 -4.950  1.00 107.65 ? 19   ARG A CA    1 
ATOM   13   C C     . ARG A 1 6   ? -71.885 27.898 -3.753  1.00 105.96 ? 19   ARG A C     1 
ATOM   14   O O     . ARG A 1 6   ? -71.508 26.870 -3.181  1.00 102.79 ? 19   ARG A O     1 
ATOM   15   C CB    . ARG A 1 6   ? -70.180 29.576 -4.488  1.00 113.61 ? 19   ARG A CB    1 
ATOM   16   N N     . ASP A 1 7   ? -72.962 28.588 -3.377  1.00 108.82 ? 20   ASP A N     1 
ATOM   17   C CA    . ASP A 1 7   ? -73.834 28.137 -2.292  1.00 108.13 ? 20   ASP A CA    1 
ATOM   18   C C     . ASP A 1 7   ? -74.401 26.754 -2.606  1.00 103.79 ? 20   ASP A C     1 
ATOM   19   O O     . ASP A 1 7   ? -74.222 25.812 -1.834  1.00 102.26 ? 20   ASP A O     1 
ATOM   20   C CB    . ASP A 1 7   ? -74.977 29.131 -2.072  1.00 112.00 ? 20   ASP A CB    1 
ATOM   21   N N     . GLU A 1 8   ? -75.069 26.645 -3.752  1.00 103.12 ? 21   GLU A N     1 
ATOM   22   C CA    . GLU A 1 8   ? -75.656 25.383 -4.204  1.00 100.11 ? 21   GLU A CA    1 
ATOM   23   C C     . GLU A 1 8   ? -74.600 24.289 -4.385  1.00 96.06  ? 21   GLU A C     1 
ATOM   24   O O     . GLU A 1 8   ? -74.868 23.114 -4.122  1.00 94.18  ? 21   GLU A O     1 
ATOM   25   C CB    . GLU A 1 8   ? -76.416 25.593 -5.519  1.00 100.89 ? 21   GLU A CB    1 
ATOM   26   N N     . ILE A 1 9   ? -73.408 24.680 -4.838  1.00 95.15  ? 22   ILE A N     1 
ATOM   27   C CA    . ILE A 1 9   ? -72.302 23.738 -5.025  1.00 91.46  ? 22   ILE A CA    1 
ATOM   28   C C     . ILE A 1 9   ? -71.818 23.202 -3.680  1.00 90.01  ? 22   ILE A C     1 
ATOM   29   O O     . ILE A 1 9   ? -71.841 21.992 -3.445  1.00 87.08  ? 22   ILE A O     1 
ATOM   30   C CB    . ILE A 1 9   ? -71.113 24.385 -5.768  1.00 90.95  ? 22   ILE A CB    1 
ATOM   31   N N     . ASN A 1 10  ? -71.394 24.111 -2.801  1.00 92.51  ? 23   ASN A N     1 
ATOM   32   C CA    . ASN A 1 10  ? -70.924 23.747 -1.459  1.00 93.26  ? 23   ASN A CA    1 
ATOM   33   C C     . ASN A 1 10  ? -71.972 22.954 -0.676  1.00 93.51  ? 23   ASN A C     1 
ATOM   34   O O     . ASN A 1 10  ? -71.635 22.025 0.060   1.00 92.42  ? 23   ASN A O     1 
ATOM   35   C CB    . ASN A 1 10  ? -70.523 24.999 -0.672  1.00 97.49  ? 23   ASN A CB    1 
ATOM   36   N N     . ALA A 1 11  ? -73.240 23.325 -0.850  1.00 94.84  ? 24   ALA A N     1 
ATOM   37   C CA    . ALA A 1 11  ? -74.356 22.634 -0.208  1.00 98.14  ? 24   ALA A CA    1 
ATOM   38   C C     . ALA A 1 11  ? -74.362 21.137 -0.523  1.00 96.55  ? 24   ALA A C     1 
ATOM   39   O O     . ALA A 1 11  ? -74.305 20.308 0.384   1.00 99.69  ? 24   ALA A O     1 
ATOM   40   C CB    . ALA A 1 11  ? -75.679 23.263 -0.625  1.00 100.61 ? 24   ALA A CB    1 
ATOM   41   N N     . ILE A 1 12  ? -74.428 20.798 -1.808  1.00 93.97  ? 25   ILE A N     1 
ATOM   42   C CA    . ILE A 1 12  ? -74.455 19.396 -2.232  1.00 93.36  ? 25   ILE A CA    1 
ATOM   43   C C     . ILE A 1 12  ? -73.192 18.648 -1.794  1.00 92.14  ? 25   ILE A C     1 
ATOM   44   O O     . ILE A 1 12  ? -73.265 17.485 -1.393  1.00 92.29  ? 25   ILE A O     1 
ATOM   45   C CB    . ILE A 1 12  ? -74.629 19.264 -3.760  1.00 89.48  ? 25   ILE A CB    1 
ATOM   46   N N     . LEU A 1 13  ? -72.045 19.326 -1.856  1.00 91.84  ? 26   LEU A N     1 
ATOM   47   C CA    . LEU A 1 13  ? -70.759 18.717 -1.489  1.00 90.74  ? 26   LEU A CA    1 
ATOM   48   C C     . LEU A 1 13  ? -70.669 18.384 0.000   1.00 92.58  ? 26   LEU A C     1 
ATOM   49   O O     . LEU A 1 13  ? -70.096 17.359 0.372   1.00 94.54  ? 26   LEU A O     1 
ATOM   50   C CB    . LEU A 1 13  ? -69.585 19.623 -1.892  1.00 89.68  ? 26   LEU A CB    1 
ATOM   51   C CG    . LEU A 1 13  ? -69.274 19.748 -3.389  1.00 88.00  ? 26   LEU A CG    1 
ATOM   52   C CD1   . LEU A 1 13  ? -68.230 20.830 -3.622  1.00 88.77  ? 26   LEU A CD1   1 
ATOM   53   C CD2   . LEU A 1 13  ? -68.802 18.428 -3.985  1.00 86.66  ? 26   LEU A CD2   1 
ATOM   54   N N     . GLN A 1 14  ? -71.236 19.244 0.845   1.00 93.95  ? 27   GLN A N     1 
ATOM   55   C CA    . GLN A 1 14  ? -71.254 19.005 2.290   1.00 97.53  ? 27   GLN A CA    1 
ATOM   56   C C     . GLN A 1 14  ? -72.073 17.762 2.658   1.00 99.98  ? 27   GLN A C     1 
ATOM   57   O O     . GLN A 1 14  ? -71.839 17.155 3.701   1.00 103.91 ? 27   GLN A O     1 
ATOM   58   C CB    . GLN A 1 14  ? -71.798 20.231 3.032   1.00 100.03 ? 27   GLN A CB    1 
ATOM   59   N N     . LYS A 1 15  ? -73.020 17.389 1.796   1.00 99.79  ? 28   LYS A N     1 
ATOM   60   C CA    . LYS A 1 15  ? -73.888 16.231 2.021   1.00 103.92 ? 28   LYS A CA    1 
ATOM   61   C C     . LYS A 1 15  ? -73.406 14.979 1.285   1.00 101.63 ? 28   LYS A C     1 
ATOM   62   O O     . LYS A 1 15  ? -73.311 13.905 1.884   1.00 106.29 ? 28   LYS A O     1 
ATOM   63   C CB    . LYS A 1 15  ? -75.324 16.555 1.590   1.00 106.07 ? 28   LYS A CB    1 
ATOM   64   N N     . ARG A 1 16  ? -73.110 15.120 -0.007  1.00 96.16  ? 29   ARG A N     1 
ATOM   65   C CA    . ARG A 1 16  ? -72.759 13.980 -0.863  1.00 95.41  ? 29   ARG A CA    1 
ATOM   66   C C     . ARG A 1 16  ? -71.540 14.268 -1.736  1.00 90.49  ? 29   ARG A C     1 
ATOM   67   O O     . ARG A 1 16  ? -71.311 15.409 -2.138  1.00 87.31  ? 29   ARG A O     1 
ATOM   68   C CB    . ARG A 1 16  ? -73.945 13.613 -1.760  1.00 97.00  ? 29   ARG A CB    1 
ATOM   69   N N     . ILE A 1 17  ? -70.770 13.225 -2.038  1.00 90.67  ? 30   ILE A N     1 
ATOM   70   C CA    . ILE A 1 17  ? -69.590 13.356 -2.890  1.00 87.34  ? 30   ILE A CA    1 
ATOM   71   C C     . ILE A 1 17  ? -70.000 13.368 -4.359  1.00 87.11  ? 30   ILE A C     1 
ATOM   72   O O     . ILE A 1 17  ? -70.447 12.351 -4.885  1.00 90.88  ? 30   ILE A O     1 
ATOM   73   C CB    . ILE A 1 17  ? -68.602 12.196 -2.663  1.00 88.64  ? 30   ILE A CB    1 
ATOM   74   N N     . MET A 1 18  ? -69.843 14.516 -5.020  1.00 86.23  ? 31   MET A N     1 
ATOM   75   C CA    . MET A 1 18  ? -70.217 14.660 -6.434  1.00 85.98  ? 31   MET A CA    1 
ATOM   76   C C     . MET A 1 18  ? -69.340 13.825 -7.365  1.00 86.11  ? 31   MET A C     1 
ATOM   77   O O     . MET A 1 18  ? -68.255 13.379 -6.993  1.00 84.78  ? 31   MET A O     1 
ATOM   78   C CB    . MET A 1 18  ? -70.145 16.124 -6.873  1.00 83.82  ? 31   MET A CB    1 
ATOM   79   C CG    . MET A 1 18  ? -71.185 17.027 -6.239  1.00 84.73  ? 31   MET A CG    1 
ATOM   80   S SD    . MET A 1 18  ? -71.206 18.639 -7.045  1.00 85.71  ? 31   MET A SD    1 
ATOM   81   C CE    . MET A 1 18  ? -72.041 19.654 -5.832  1.00 87.78  ? 31   MET A CE    1 
ATOM   82   N N     . VAL A 1 19  ? -69.828 13.628 -8.585  1.00 90.09  ? 32   VAL A N     1 
ATOM   83   C CA    . VAL A 1 19  ? -69.104 12.874 -9.600  1.00 93.55  ? 32   VAL A CA    1 
ATOM   84   C C     . VAL A 1 19  ? -68.829 13.761 -10.813 1.00 95.34  ? 32   VAL A C     1 
ATOM   85   O O     . VAL A 1 19  ? -69.699 14.511 -11.247 1.00 97.58  ? 32   VAL A O     1 
ATOM   86   C CB    . VAL A 1 19  ? -69.897 11.627 -10.038 1.00 96.99  ? 32   VAL A CB    1 
ATOM   87   C CG1   . VAL A 1 19  ? -69.068 10.757 -10.975 1.00 100.27 ? 32   VAL A CG1   1 
ATOM   88   C CG2   . VAL A 1 19  ? -70.328 10.826 -8.821  1.00 98.04  ? 32   VAL A CG2   1 
ATOM   89   N N     . LEU A 1 20  ? -67.610 13.680 -11.339 1.00 97.83  ? 33   LEU A N     1 
ATOM   90   C CA    . LEU A 1 20  ? -67.234 14.360 -12.578 1.00 100.95 ? 33   LEU A CA    1 
ATOM   91   C C     . LEU A 1 20  ? -67.142 13.308 -13.678 1.00 104.68 ? 33   LEU A C     1 
ATOM   92   O O     . LEU A 1 20  ? -66.764 12.167 -13.413 1.00 103.31 ? 33   LEU A O     1 
ATOM   93   C CB    . LEU A 1 20  ? -65.891 15.072 -12.401 1.00 102.12 ? 33   LEU A CB    1 
ATOM   94   C CG    . LEU A 1 20  ? -65.328 15.848 -13.595 1.00 110.13 ? 33   LEU A CG    1 
ATOM   95   C CD1   . LEU A 1 20  ? -66.238 17.005 -13.972 1.00 113.90 ? 33   LEU A CD1   1 
ATOM   96   C CD2   . LEU A 1 20  ? -63.931 16.357 -13.279 1.00 113.05 ? 33   LEU A CD2   1 
ATOM   97   N N     . ASP A 1 21  ? -67.486 13.687 -14.907 1.00 97.40  ? 34   ASP A N     1 
ATOM   98   C CA    . ASP A 1 21  ? -67.515 12.729 -16.020 1.00 100.85 ? 34   ASP A CA    1 
ATOM   99   C C     . ASP A 1 21  ? -66.115 12.263 -16.435 1.00 101.02 ? 34   ASP A C     1 
ATOM   100  O O     . ASP A 1 21  ? -65.113 12.910 -16.123 1.00 99.83  ? 34   ASP A O     1 
ATOM   101  C CB    . ASP A 1 21  ? -68.299 13.287 -17.227 1.00 98.94  ? 34   ASP A CB    1 
ATOM   102  C CG    . ASP A 1 21  ? -67.567 14.414 -17.960 1.00 95.76  ? 34   ASP A CG    1 
ATOM   103  O OD1   . ASP A 1 21  ? -66.681 15.062 -17.364 1.00 93.06  ? 34   ASP A OD1   1 
ATOM   104  O OD2   . ASP A 1 21  ? -67.898 14.660 -19.141 1.00 90.27  ? 34   ASP A OD2   1 
ATOM   105  N N     . GLY A 1 22  ? -66.062 11.127 -17.125 1.00 105.15 ? 35   GLY A N     1 
ATOM   106  C CA    . GLY A 1 22  ? -64.813 10.597 -17.663 1.00 111.27 ? 35   GLY A CA    1 
ATOM   107  C C     . GLY A 1 22  ? -64.312 11.410 -18.845 1.00 119.01 ? 35   GLY A C     1 
ATOM   108  O O     . GLY A 1 22  ? -64.987 12.336 -19.308 1.00 125.16 ? 35   GLY A O     1 
ATOM   109  N N     . GLY A 1 23  ? -63.123 11.065 -19.334 1.00 119.72 ? 36   GLY A N     1 
ATOM   110  C CA    . GLY A 1 23  ? -62.536 11.741 -20.489 1.00 113.46 ? 36   GLY A CA    1 
ATOM   111  C C     . GLY A 1 23  ? -63.303 11.426 -21.760 1.00 112.23 ? 36   GLY A C     1 
ATOM   112  O O     . GLY A 1 23  ? -63.582 10.260 -22.050 1.00 111.35 ? 36   GLY A O     1 
ATOM   113  N N     . MET A 1 24  ? -63.650 12.468 -22.514 1.00 107.10 ? 37   MET A N     1 
ATOM   114  C CA    . MET A 1 24  ? -64.429 12.314 -23.745 1.00 107.66 ? 37   MET A CA    1 
ATOM   115  C C     . MET A 1 24  ? -63.613 11.671 -24.867 1.00 103.29 ? 37   MET A C     1 
ATOM   116  O O     . MET A 1 24  ? -64.164 10.952 -25.703 1.00 102.36 ? 37   MET A O     1 
ATOM   117  C CB    . MET A 1 24  ? -64.968 13.672 -24.211 1.00 107.20 ? 37   MET A CB    1 
ATOM   118  N N     . GLY A 1 25  ? -62.305 11.932 -24.879 1.00 100.76 ? 38   GLY A N     1 
ATOM   119  C CA    . GLY A 1 25  ? -61.404 11.405 -25.906 1.00 97.27  ? 38   GLY A CA    1 
ATOM   120  C C     . GLY A 1 25  ? -61.542 9.911  -26.130 1.00 98.75  ? 38   GLY A C     1 
ATOM   121  O O     . GLY A 1 25  ? -61.534 9.446  -27.274 1.00 99.24  ? 38   GLY A O     1 
ATOM   122  N N     . THR A 1 26  ? -61.676 9.163  -25.036 1.00 98.00  ? 39   THR A N     1 
ATOM   123  C CA    . THR A 1 26  ? -61.850 7.712  -25.091 1.00 99.97  ? 39   THR A CA    1 
ATOM   124  C C     . THR A 1 26  ? -63.112 7.317  -25.859 1.00 102.29 ? 39   THR A C     1 
ATOM   125  O O     . THR A 1 26  ? -63.098 6.356  -26.629 1.00 106.74 ? 39   THR A O     1 
ATOM   126  C CB    . THR A 1 26  ? -61.916 7.103  -23.678 1.00 101.27 ? 39   THR A CB    1 
ATOM   127  N N     . MET A 1 27  ? -64.195 8.064  -25.650 1.00 101.24 ? 40   MET A N     1 
ATOM   128  C CA    . MET A 1 27  ? -65.464 7.805  -26.334 1.00 102.49 ? 40   MET A CA    1 
ATOM   129  C C     . MET A 1 27  ? -65.398 8.187  -27.813 1.00 102.90 ? 40   MET A C     1 
ATOM   130  O O     . MET A 1 27  ? -65.841 7.421  -28.671 1.00 111.16 ? 40   MET A O     1 
ATOM   131  C CB    . MET A 1 27  ? -66.605 8.563  -25.652 1.00 101.39 ? 40   MET A CB    1 
ATOM   132  N N     . ILE A 1 28  ? -64.846 9.364  -28.106 1.00 97.48  ? 41   ILE A N     1 
ATOM   133  C CA    . ILE A 1 28  ? -64.681 9.824  -29.492 1.00 94.70  ? 41   ILE A CA    1 
ATOM   134  C C     . ILE A 1 28  ? -63.804 8.859  -30.287 1.00 97.11  ? 41   ILE A C     1 
ATOM   135  O O     . ILE A 1 28  ? -64.107 8.554  -31.441 1.00 101.31 ? 41   ILE A O     1 
ATOM   136  C CB    . ILE A 1 28  ? -64.088 11.250 -29.563 1.00 89.14  ? 41   ILE A CB    1 
ATOM   137  C CG1   . ILE A 1 28  ? -65.127 12.268 -29.085 1.00 87.14  ? 41   ILE A CG1   1 
ATOM   138  C CG2   . ILE A 1 28  ? -63.643 11.589 -30.981 1.00 86.26  ? 41   ILE A CG2   1 
ATOM   139  C CD1   . ILE A 1 28  ? -64.542 13.600 -28.676 1.00 84.59  ? 41   ILE A CD1   1 
ATOM   140  N N     . GLN A 1 29  ? -62.724 8.383  -29.671 1.00 97.59  ? 42   GLN A N     1 
ATOM   141  C CA    . GLN A 1 29  ? -61.885 7.350  -30.284 1.00 99.43  ? 42   GLN A CA    1 
ATOM   142  C C     . GLN A 1 29  ? -62.723 6.110  -30.617 1.00 102.56 ? 42   GLN A C     1 
ATOM   143  O O     . GLN A 1 29  ? -62.581 5.529  -31.692 1.00 102.66 ? 42   GLN A O     1 
ATOM   144  C CB    . GLN A 1 29  ? -60.723 6.972  -29.361 1.00 97.40  ? 42   GLN A CB    1 
ATOM   145  N N     . ARG A 1 30  ? -63.602 5.727  -29.692 1.00 104.12 ? 43   ARG A N     1 
ATOM   146  C CA    . ARG A 1 30  ? -64.522 4.610  -29.904 1.00 108.27 ? 43   ARG A CA    1 
ATOM   147  C C     . ARG A 1 30  ? -65.527 4.898  -31.020 1.00 109.13 ? 43   ARG A C     1 
ATOM   148  O O     . ARG A 1 30  ? -65.966 3.976  -31.708 1.00 116.43 ? 43   ARG A O     1 
ATOM   149  C CB    . ARG A 1 30  ? -65.270 4.275  -28.610 1.00 109.86 ? 43   ARG A CB    1 
ATOM   150  N N     . GLU A 1 31  ? -65.888 6.170  -31.197 1.00 104.24 ? 44   GLU A N     1 
ATOM   151  C CA    . GLU A 1 31  ? -66.820 6.578  -32.256 1.00 103.20 ? 44   GLU A CA    1 
ATOM   152  C C     . GLU A 1 31  ? -66.292 6.286  -33.661 1.00 104.53 ? 44   GLU A C     1 
ATOM   153  O O     . GLU A 1 31  ? -67.081 6.122  -34.594 1.00 104.87 ? 44   GLU A O     1 
ATOM   154  C CB    . GLU A 1 31  ? -67.154 8.066  -32.140 1.00 98.72  ? 44   GLU A CB    1 
ATOM   155  N N     . LYS A 1 32  ? -64.966 6.229  -33.805 1.00 106.33 ? 45   LYS A N     1 
ATOM   156  C CA    . LYS A 1 32  ? -64.317 5.930  -35.085 1.00 107.99 ? 45   LYS A CA    1 
ATOM   157  C C     . LYS A 1 32  ? -64.785 6.909  -36.160 1.00 108.75 ? 45   LYS A C     1 
ATOM   158  O O     . LYS A 1 32  ? -65.504 6.528  -37.086 1.00 111.40 ? 45   LYS A O     1 
ATOM   159  C CB    . LYS A 1 32  ? -64.596 4.484  -35.509 1.00 110.80 ? 45   LYS A CB    1 
ATOM   160  N N     . LEU A 1 33  ? -64.370 8.168  -36.016 1.00 107.49 ? 46   LEU A N     1 
ATOM   161  C CA    . LEU A 1 33  ? -64.844 9.268  -36.861 1.00 108.93 ? 46   LEU A CA    1 
ATOM   162  C C     . LEU A 1 33  ? -64.842 8.921  -38.348 1.00 114.83 ? 46   LEU A C     1 
ATOM   163  O O     . LEU A 1 33  ? -65.896 8.707  -38.952 1.00 121.26 ? 46   LEU A O     1 
ATOM   164  C CB    . LEU A 1 33  ? -63.993 10.519 -36.625 1.00 101.81 ? 46   LEU A CB    1 
ATOM   165  N N     . GLU A 1 35  ? -62.339 9.492  -39.107 1.00 88.68  ? 48   GLU A N     1 
ATOM   166  C CA    . GLU A 1 35  ? -62.168 9.909  -40.491 1.00 90.28  ? 48   GLU A CA    1 
ATOM   167  C C     . GLU A 1 35  ? -62.112 11.432 -40.610 1.00 88.47  ? 48   GLU A C     1 
ATOM   168  O O     . GLU A 1 35  ? -62.976 12.137 -40.083 1.00 90.99  ? 48   GLU A O     1 
ATOM   169  C CB    . GLU A 1 35  ? -63.305 9.364  -41.358 1.00 92.79  ? 48   GLU A CB    1 
ATOM   170  N N     . GLU A 1 36  ? -61.087 11.922 -41.308 1.00 87.50  ? 49   GLU A N     1 
ATOM   171  C CA    . GLU A 1 36  ? -60.912 13.349 -41.615 1.00 83.57  ? 49   GLU A CA    1 
ATOM   172  C C     . GLU A 1 36  ? -62.188 13.996 -42.145 1.00 82.91  ? 49   GLU A C     1 
ATOM   173  O O     . GLU A 1 36  ? -62.533 15.105 -41.748 1.00 78.90  ? 49   GLU A O     1 
ATOM   174  C CB    . GLU A 1 36  ? -59.793 13.515 -42.653 1.00 83.65  ? 49   GLU A CB    1 
ATOM   175  C CG    . GLU A 1 36  ? -59.627 14.917 -43.232 1.00 84.03  ? 49   GLU A CG    1 
ATOM   176  C CD    . GLU A 1 36  ? -59.078 15.922 -42.236 1.00 84.22  ? 49   GLU A CD    1 
ATOM   177  O OE1   . GLU A 1 36  ? -58.445 15.510 -41.239 1.00 84.73  ? 49   GLU A OE1   1 
ATOM   178  O OE2   . GLU A 1 36  ? -59.267 17.138 -42.462 1.00 87.70  ? 49   GLU A OE2   1 
ATOM   179  N N     . HIS A 1 37  ? -62.872 13.294 -43.047 1.00 87.57  ? 50   HIS A N     1 
ATOM   180  C CA    . HIS A 1 37  ? -64.082 13.802 -43.696 1.00 88.80  ? 50   HIS A CA    1 
ATOM   181  C C     . HIS A 1 37  ? -65.116 14.302 -42.691 1.00 88.82  ? 50   HIS A C     1 
ATOM   182  O O     . HIS A 1 37  ? -65.782 15.311 -42.933 1.00 85.76  ? 50   HIS A O     1 
ATOM   183  C CB    . HIS A 1 37  ? -64.707 12.717 -44.582 1.00 90.54  ? 50   HIS A CB    1 
ATOM   184  N N     . PHE A 1 38  ? -65.216 13.614 -41.554 1.00 92.01  ? 51   PHE A N     1 
ATOM   185  C CA    . PHE A 1 38  ? -66.250 13.896 -40.549 1.00 96.72  ? 51   PHE A CA    1 
ATOM   186  C C     . PHE A 1 38  ? -66.023 15.164 -39.696 1.00 95.48  ? 51   PHE A C     1 
ATOM   187  O O     . PHE A 1 38  ? -66.698 15.352 -38.681 1.00 94.45  ? 51   PHE A O     1 
ATOM   188  C CB    . PHE A 1 38  ? -66.449 12.666 -39.647 1.00 99.83  ? 51   PHE A CB    1 
ATOM   189  C CG    . PHE A 1 38  ? -67.198 11.541 -40.313 1.00 105.98 ? 51   PHE A CG    1 
ATOM   190  C CD1   . PHE A 1 38  ? -66.580 10.744 -41.268 1.00 109.83 ? 51   PHE A CD1   1 
ATOM   191  C CD2   . PHE A 1 38  ? -68.522 11.276 -39.981 1.00 106.47 ? 51   PHE A CD2   1 
ATOM   192  C CE1   . PHE A 1 38  ? -67.268 9.708  -41.880 1.00 109.80 ? 51   PHE A CE1   1 
ATOM   193  C CE2   . PHE A 1 38  ? -69.213 10.242 -40.588 1.00 109.01 ? 51   PHE A CE2   1 
ATOM   194  C CZ    . PHE A 1 38  ? -68.586 9.458  -41.540 1.00 111.65 ? 51   PHE A CZ    1 
ATOM   195  N N     . ARG A 1 39  ? -65.077 16.018 -40.094 1.00 95.95  ? 52   ARG A N     1 
ATOM   196  C CA    . ARG A 1 39  ? -64.999 17.396 -39.588 1.00 89.94  ? 52   ARG A CA    1 
ATOM   197  C C     . ARG A 1 39  ? -64.741 18.364 -40.756 1.00 90.39  ? 52   ARG A C     1 
ATOM   198  O O     . ARG A 1 39  ? -63.588 18.608 -41.114 1.00 89.89  ? 52   ARG A O     1 
ATOM   199  C CB    . ARG A 1 39  ? -63.902 17.554 -38.530 1.00 85.93  ? 52   ARG A CB    1 
ATOM   200  C CG    . ARG A 1 39  ? -63.806 16.434 -37.504 1.00 88.66  ? 52   ARG A CG    1 
ATOM   201  C CD    . ARG A 1 39  ? -62.770 15.389 -37.905 1.00 89.87  ? 52   ARG A CD    1 
ATOM   202  N NE    . ARG A 1 39  ? -62.679 14.282 -36.951 1.00 89.36  ? 52   ARG A NE    1 
ATOM   203  C CZ    . ARG A 1 39  ? -62.120 14.349 -35.742 1.00 81.94  ? 52   ARG A CZ    1 
ATOM   204  N NH1   . ARG A 1 39  ? -61.588 15.481 -35.287 1.00 78.56  ? 52   ARG A NH1   1 
ATOM   205  N NH2   . ARG A 1 39  ? -62.098 13.267 -34.973 1.00 80.59  ? 52   ARG A NH2   1 
ATOM   206  N N     . GLY A 1 40  ? -65.795 18.875 -41.395 1.00 88.79  ? 53   GLY A N     1 
ATOM   207  C CA    . GLY A 1 40  ? -67.173 18.427 -41.187 1.00 89.09  ? 53   GLY A CA    1 
ATOM   208  C C     . GLY A 1 40  ? -68.010 18.776 -42.402 1.00 92.97  ? 53   GLY A C     1 
ATOM   209  O O     . GLY A 1 40  ? -67.685 18.377 -43.521 1.00 93.83  ? 53   GLY A O     1 
ATOM   210  N N     . GLN A 1 41  ? -69.091 19.519 -42.180 1.00 97.51  ? 54   GLN A N     1 
ATOM   211  C CA    . GLN A 1 41  ? -69.844 20.138 -43.269 1.00 100.16 ? 54   GLN A CA    1 
ATOM   212  C C     . GLN A 1 41  ? -69.380 21.584 -43.435 1.00 98.80  ? 54   GLN A C     1 
ATOM   213  O O     . GLN A 1 41  ? -68.999 22.005 -44.530 1.00 97.48  ? 54   GLN A O     1 
ATOM   214  C CB    . GLN A 1 41  ? -71.347 20.098 -42.983 1.00 101.45 ? 54   GLN A CB    1 
ATOM   215  N N     . GLU A 1 42  ? -69.395 22.324 -42.327 1.00 97.71  ? 55   GLU A N     1 
ATOM   216  C CA    . GLU A 1 42  ? -69.055 23.749 -42.308 1.00 100.37 ? 55   GLU A CA    1 
ATOM   217  C C     . GLU A 1 42  ? -67.735 24.087 -42.996 1.00 100.91 ? 55   GLU A C     1 
ATOM   218  O O     . GLU A 1 42  ? -67.661 25.047 -43.763 1.00 108.47 ? 55   GLU A O     1 
ATOM   219  C CB    . GLU A 1 42  ? -69.011 24.254 -40.863 1.00 98.40  ? 55   GLU A CB    1 
ATOM   220  C CG    . GLU A 1 42  ? -68.567 25.704 -40.724 1.00 95.64  ? 55   GLU A CG    1 
ATOM   221  C CD    . GLU A 1 42  ? -68.867 26.290 -39.360 1.00 96.36  ? 55   GLU A CD    1 
ATOM   222  O OE1   . GLU A 1 42  ? -69.870 25.886 -38.729 1.00 94.92  ? 55   GLU A OE1   1 
ATOM   223  O OE2   . GLU A 1 42  ? -68.099 27.170 -38.920 1.00 97.54  ? 55   GLU A OE2   1 
ATOM   224  N N     . PHE A 1 43  ? -66.699 23.306 -42.710 1.00 97.47  ? 56   PHE A N     1 
ATOM   225  C CA    . PHE A 1 43  ? -65.360 23.602 -43.211 1.00 93.37  ? 56   PHE A CA    1 
ATOM   226  C C     . PHE A 1 43  ? -65.171 23.110 -44.647 1.00 103.74 ? 56   PHE A C     1 
ATOM   227  O O     . PHE A 1 43  ? -65.054 23.928 -45.567 1.00 103.96 ? 56   PHE A O     1 
ATOM   228  C CB    . PHE A 1 43  ? -64.314 23.050 -42.242 1.00 87.38  ? 56   PHE A CB    1 
ATOM   229  C CG    . PHE A 1 43  ? -64.371 23.706 -40.893 1.00 81.34  ? 56   PHE A CG    1 
ATOM   230  C CD1   . PHE A 1 43  ? -63.780 24.942 -40.689 1.00 77.98  ? 56   PHE A CD1   1 
ATOM   231  C CD2   . PHE A 1 43  ? -65.071 23.125 -39.849 1.00 79.74  ? 56   PHE A CD2   1 
ATOM   232  C CE1   . PHE A 1 43  ? -63.857 25.570 -39.461 1.00 75.68  ? 56   PHE A CE1   1 
ATOM   233  C CE2   . PHE A 1 43  ? -65.151 23.747 -38.615 1.00 76.70  ? 56   PHE A CE2   1 
ATOM   234  C CZ    . PHE A 1 43  ? -64.543 24.972 -38.423 1.00 75.42  ? 56   PHE A CZ    1 
ATOM   235  N N     . LYS A 1 44  ? -65.150 21.790 -44.839 1.00 105.24 ? 57   LYS A N     1 
ATOM   236  C CA    . LYS A 1 44  ? -65.158 21.176 -46.178 1.00 102.70 ? 57   LYS A CA    1 
ATOM   237  C C     . LYS A 1 44  ? -63.886 21.414 -46.994 1.00 99.26  ? 57   LYS A C     1 
ATOM   238  O O     . LYS A 1 44  ? -63.276 20.463 -47.484 1.00 98.94  ? 57   LYS A O     1 
ATOM   239  C CB    . LYS A 1 44  ? -66.376 21.648 -46.984 1.00 106.50 ? 57   LYS A CB    1 
ATOM   240  N N     . ASP A 1 45  ? -63.511 22.681 -47.155 1.00 96.23  ? 58   ASP A N     1 
ATOM   241  C CA    . ASP A 1 45  ? -62.345 23.071 -47.942 1.00 94.90  ? 58   ASP A CA    1 
ATOM   242  C C     . ASP A 1 45  ? -61.261 23.713 -47.065 1.00 92.84  ? 58   ASP A C     1 
ATOM   243  O O     . ASP A 1 45  ? -60.611 24.677 -47.471 1.00 93.89  ? 58   ASP A O     1 
ATOM   244  C CB    . ASP A 1 45  ? -62.786 24.036 -49.047 1.00 98.25  ? 58   ASP A CB    1 
ATOM   245  C CG    . ASP A 1 45  ? -64.016 23.540 -49.799 1.00 103.50 ? 58   ASP A CG    1 
ATOM   246  O OD1   . ASP A 1 45  ? -64.046 22.346 -50.162 1.00 106.85 ? 58   ASP A OD1   1 
ATOM   247  O OD2   . ASP A 1 45  ? -64.955 24.338 -50.022 1.00 99.37  ? 58   ASP A OD2   1 
ATOM   248  N N     . HIS A 1 46  ? -61.065 23.168 -45.866 1.00 90.57  ? 59   HIS A N     1 
ATOM   249  C CA    . HIS A 1 46  ? -60.059 23.679 -44.934 1.00 87.65  ? 59   HIS A CA    1 
ATOM   250  C C     . HIS A 1 46  ? -58.677 23.173 -45.345 1.00 86.60  ? 59   HIS A C     1 
ATOM   251  O O     . HIS A 1 46  ? -58.512 21.995 -45.669 1.00 86.34  ? 59   HIS A O     1 
ATOM   252  C CB    . HIS A 1 46  ? -60.388 23.246 -43.500 1.00 85.70  ? 59   HIS A CB    1 
ATOM   253  C CG    . HIS A 1 46  ? -59.714 24.066 -42.442 1.00 81.62  ? 59   HIS A CG    1 
ATOM   254  N ND1   . HIS A 1 46  ? -59.933 25.418 -42.297 1.00 80.29  ? 59   HIS A ND1   1 
ATOM   255  C CD2   . HIS A 1 46  ? -58.845 23.719 -41.462 1.00 80.02  ? 59   HIS A CD2   1 
ATOM   256  C CE1   . HIS A 1 46  ? -59.218 25.871 -41.282 1.00 80.67  ? 59   HIS A CE1   1 
ATOM   257  N NE2   . HIS A 1 46  ? -58.549 24.860 -40.758 1.00 77.15  ? 59   HIS A NE2   1 
ATOM   258  N N     . ALA A 1 47  ? -57.693 24.069 -45.322 1.00 87.53  ? 60   ALA A N     1 
ATOM   259  C CA    . ALA A 1 47  ? -56.349 23.785 -45.836 1.00 86.75  ? 60   ALA A CA    1 
ATOM   260  C C     . ALA A 1 47  ? -55.497 22.949 -44.879 1.00 83.58  ? 60   ALA A C     1 
ATOM   261  O O     . ALA A 1 47  ? -54.460 22.418 -45.276 1.00 80.23  ? 60   ALA A O     1 
ATOM   262  C CB    . ALA A 1 47  ? -55.635 25.086 -46.162 1.00 87.16  ? 60   ALA A CB    1 
ATOM   263  N N     . ARG A 1 48  ? -55.929 22.847 -43.626 1.00 80.78  ? 61   ARG A N     1 
ATOM   264  C CA    . ARG A 1 48  ? -55.233 22.053 -42.626 1.00 80.79  ? 61   ARG A CA    1 
ATOM   265  C C     . ARG A 1 48  ? -56.069 20.836 -42.256 1.00 79.09  ? 61   ARG A C     1 
ATOM   266  O O     . ARG A 1 48  ? -57.293 20.922 -42.221 1.00 81.36  ? 61   ARG A O     1 
ATOM   267  C CB    . ARG A 1 48  ? -54.986 22.896 -41.381 1.00 83.63  ? 61   ARG A CB    1 
ATOM   268  C CG    . ARG A 1 48  ? -53.926 23.975 -41.555 1.00 86.13  ? 61   ARG A CG    1 
ATOM   269  C CD    . ARG A 1 48  ? -52.632 23.618 -40.842 1.00 89.43  ? 61   ARG A CD    1 
ATOM   270  N NE    . ARG A 1 48  ? -51.932 24.816 -40.382 1.00 98.53  ? 61   ARG A NE    1 
ATOM   271  C CZ    . ARG A 1 48  ? -50.928 24.821 -39.507 1.00 105.01 ? 61   ARG A CZ    1 
ATOM   272  N NH1   . ARG A 1 48  ? -50.477 23.686 -38.975 1.00 112.62 ? 61   ARG A NH1   1 
ATOM   273  N NH2   . ARG A 1 48  ? -50.366 25.974 -39.160 1.00 106.81 ? 61   ARG A NH2   1 
ATOM   274  N N     . PRO A 1 49  ? -55.416 19.692 -41.985 1.00 80.60  ? 62   PRO A N     1 
ATOM   275  C CA    . PRO A 1 49  ? -56.171 18.525 -41.520 1.00 79.94  ? 62   PRO A CA    1 
ATOM   276  C C     . PRO A 1 49  ? -56.729 18.719 -40.112 1.00 76.25  ? 62   PRO A C     1 
ATOM   277  O O     . PRO A 1 49  ? -56.021 19.209 -39.233 1.00 71.71  ? 62   PRO A O     1 
ATOM   278  C CB    . PRO A 1 49  ? -55.137 17.391 -41.544 1.00 83.97  ? 62   PRO A CB    1 
ATOM   279  C CG    . PRO A 1 49  ? -53.807 18.063 -41.529 1.00 83.93  ? 62   PRO A CG    1 
ATOM   280  C CD    . PRO A 1 49  ? -53.997 19.374 -42.231 1.00 81.70  ? 62   PRO A CD    1 
ATOM   281  N N     . LEU A 1 50  ? -57.992 18.339 -39.922 1.00 77.15  ? 63   LEU A N     1 
ATOM   282  C CA    . LEU A 1 50  ? -58.693 18.494 -38.646 1.00 75.96  ? 63   LEU A CA    1 
ATOM   283  C C     . LEU A 1 50  ? -58.773 17.190 -37.839 1.00 76.69  ? 63   LEU A C     1 
ATOM   284  O O     . LEU A 1 50  ? -59.047 17.222 -36.637 1.00 73.54  ? 63   LEU A O     1 
ATOM   285  C CB    . LEU A 1 50  ? -60.104 19.034 -38.892 1.00 75.01  ? 63   LEU A CB    1 
ATOM   286  N N     . LYS A 1 51  ? -58.539 16.051 -38.492 1.00 79.97  ? 64   LYS A N     1 
ATOM   287  C CA    . LYS A 1 51  ? -58.607 14.747 -37.824 1.00 78.21  ? 64   LYS A CA    1 
ATOM   288  C C     . LYS A 1 51  ? -57.810 14.788 -36.528 1.00 76.37  ? 64   LYS A C     1 
ATOM   289  O O     . LYS A 1 51  ? -56.665 15.234 -36.517 1.00 76.90  ? 64   LYS A O     1 
ATOM   290  C CB    . LYS A 1 51  ? -58.071 13.635 -38.731 1.00 77.90  ? 64   LYS A CB    1 
ATOM   291  N N     . GLY A 1 52  ? -58.430 14.343 -35.439 1.00 76.99  ? 65   GLY A N     1 
ATOM   292  C CA    . GLY A 1 52  ? -57.788 14.326 -34.129 1.00 76.88  ? 65   GLY A CA    1 
ATOM   293  C C     . GLY A 1 52  ? -58.125 15.535 -33.276 1.00 77.69  ? 65   GLY A C     1 
ATOM   294  O O     . GLY A 1 52  ? -57.902 15.516 -32.065 1.00 80.60  ? 65   GLY A O     1 
ATOM   295  N N     . ASN A 1 53  ? -58.651 16.590 -33.900 1.00 74.80  ? 66   ASN A N     1 
ATOM   296  C CA    . ASN A 1 53  ? -59.048 17.794 -33.175 1.00 73.28  ? 66   ASN A CA    1 
ATOM   297  C C     . ASN A 1 53  ? -60.455 17.614 -32.602 1.00 74.63  ? 66   ASN A C     1 
ATOM   298  O O     . ASN A 1 53  ? -61.431 18.138 -33.145 1.00 73.29  ? 66   ASN A O     1 
ATOM   299  C CB    . ASN A 1 53  ? -58.979 19.025 -34.093 1.00 71.57  ? 66   ASN A CB    1 
ATOM   300  C CG    . ASN A 1 53  ? -59.211 20.333 -33.354 1.00 69.82  ? 66   ASN A CG    1 
ATOM   301  O OD1   . ASN A 1 53  ? -59.157 20.394 -32.126 1.00 71.64  ? 66   ASN A OD1   1 
ATOM   302  N ND2   . ASN A 1 53  ? -59.470 21.391 -34.107 1.00 69.48  ? 66   ASN A ND2   1 
ATOM   303  N N     . ASN A 1 54  ? -60.543 16.877 -31.495 1.00 73.99  ? 67   ASN A N     1 
ATOM   304  C CA    . ASN A 1 54  ? -61.827 16.559 -30.857 1.00 74.31  ? 67   ASN A CA    1 
ATOM   305  C C     . ASN A 1 54  ? -62.676 17.795 -30.545 1.00 73.57  ? 67   ASN A C     1 
ATOM   306  O O     . ASN A 1 54  ? -63.906 17.728 -30.535 1.00 71.37  ? 67   ASN A O     1 
ATOM   307  C CB    . ASN A 1 54  ? -61.593 15.772 -29.561 1.00 75.61  ? 67   ASN A CB    1 
ATOM   308  C CG    . ASN A 1 54  ? -61.026 14.383 -29.803 1.00 77.76  ? 67   ASN A CG    1 
ATOM   309  O OD1   . ASN A 1 54  ? -60.910 13.927 -30.942 1.00 76.21  ? 67   ASN A OD1   1 
ATOM   310  N ND2   . ASN A 1 54  ? -60.670 13.701 -28.721 1.00 79.58  ? 67   ASN A ND2   1 
ATOM   311  N N     . ASP A 1 55  ? -61.996 18.910 -30.289 1.00 73.85  ? 68   ASP A N     1 
ATOM   312  C CA    . ASP A 1 55  ? -62.624 20.189 -29.938 1.00 73.20  ? 68   ASP A CA    1 
ATOM   313  C C     . ASP A 1 55  ? -63.625 20.741 -30.962 1.00 72.78  ? 68   ASP A C     1 
ATOM   314  O O     . ASP A 1 55  ? -64.644 21.312 -30.581 1.00 74.33  ? 68   ASP A O     1 
ATOM   315  C CB    . ASP A 1 55  ? -61.533 21.237 -29.677 1.00 75.66  ? 68   ASP A CB    1 
ATOM   316  C CG    . ASP A 1 55  ? -61.330 21.511 -28.206 1.00 77.03  ? 68   ASP A CG    1 
ATOM   317  O OD1   . ASP A 1 55  ? -62.193 22.192 -27.629 1.00 92.17  ? 68   ASP A OD1   1 
ATOM   318  O OD2   . ASP A 1 55  ? -60.317 21.068 -27.632 1.00 70.90  ? 68   ASP A OD2   1 
ATOM   319  N N     . ILE A 1 56  ? -63.340 20.572 -32.250 1.00 72.38  ? 69   ILE A N     1 
ATOM   320  C CA    . ILE A 1 56  ? -64.191 21.135 -33.305 1.00 70.44  ? 69   ILE A CA    1 
ATOM   321  C C     . ILE A 1 56  ? -65.465 20.310 -33.538 1.00 71.91  ? 69   ILE A C     1 
ATOM   322  O O     . ILE A 1 56  ? -66.399 20.774 -34.200 1.00 71.85  ? 69   ILE A O     1 
ATOM   323  C CB    . ILE A 1 56  ? -63.397 21.320 -34.628 1.00 69.58  ? 69   ILE A CB    1 
ATOM   324  C CG1   . ILE A 1 56  ? -64.054 22.382 -35.520 1.00 70.90  ? 69   ILE A CG1   1 
ATOM   325  C CG2   . ILE A 1 56  ? -63.226 20.003 -35.372 1.00 69.68  ? 69   ILE A CG2   1 
ATOM   326  C CD1   . ILE A 1 56  ? -63.972 23.788 -34.957 1.00 70.99  ? 69   ILE A CD1   1 
ATOM   327  N N     . LEU A 1 57  ? -65.509 19.103 -32.978 1.00 71.88  ? 70   LEU A N     1 
ATOM   328  C CA    . LEU A 1 57  ? -66.680 18.232 -33.108 1.00 73.91  ? 70   LEU A CA    1 
ATOM   329  C C     . LEU A 1 57  ? -67.933 18.832 -32.465 1.00 74.57  ? 70   LEU A C     1 
ATOM   330  O O     . LEU A 1 57  ? -69.043 18.470 -32.840 1.00 77.13  ? 70   LEU A O     1 
ATOM   331  C CB    . LEU A 1 57  ? -66.402 16.850 -32.508 1.00 73.98  ? 70   LEU A CB    1 
ATOM   332  C CG    . LEU A 1 57  ? -65.221 16.082 -33.103 1.00 74.05  ? 70   LEU A CG    1 
ATOM   333  C CD1   . LEU A 1 57  ? -65.026 14.755 -32.383 1.00 75.10  ? 70   LEU A CD1   1 
ATOM   334  C CD2   . LEU A 1 57  ? -65.420 15.866 -34.594 1.00 75.50  ? 70   LEU A CD2   1 
ATOM   335  N N     . SER A 1 58  ? -67.754 19.740 -31.505 1.00 72.89  ? 71   SER A N     1 
ATOM   336  C CA    . SER A 1 58  ? -68.867 20.509 -30.949 1.00 74.04  ? 71   SER A CA    1 
ATOM   337  C C     . SER A 1 58  ? -69.640 21.229 -32.050 1.00 77.21  ? 71   SER A C     1 
ATOM   338  O O     . SER A 1 58  ? -70.855 21.402 -31.946 1.00 80.67  ? 71   SER A O     1 
ATOM   339  C CB    . SER A 1 58  ? -68.363 21.540 -29.935 1.00 74.19  ? 71   SER A CB    1 
ATOM   340  O OG    . SER A 1 58  ? -67.782 20.922 -28.799 1.00 74.32  ? 71   SER A OG    1 
ATOM   341  N N     . ILE A 1 59  ? -68.928 21.647 -33.100 1.00 77.95  ? 72   ILE A N     1 
ATOM   342  C CA    . ILE A 1 59  ? -69.535 22.312 -34.257 1.00 78.53  ? 72   ILE A CA    1 
ATOM   343  C C     . ILE A 1 59  ? -69.888 21.321 -35.373 1.00 81.27  ? 72   ILE A C     1 
ATOM   344  O O     . ILE A 1 59  ? -71.014 21.310 -35.867 1.00 85.09  ? 72   ILE A O     1 
ATOM   345  C CB    . ILE A 1 59  ? -68.596 23.400 -34.825 1.00 75.46  ? 72   ILE A CB    1 
ATOM   346  C CG1   . ILE A 1 59  ? -68.295 24.449 -33.749 1.00 74.42  ? 72   ILE A CG1   1 
ATOM   347  C CG2   . ILE A 1 59  ? -69.215 24.056 -36.055 1.00 76.82  ? 72   ILE A CG2   1 
ATOM   348  C CD1   . ILE A 1 59  ? -67.297 25.512 -34.164 1.00 73.09  ? 72   ILE A CD1   1 
ATOM   349  N N     . THR A 1 60  ? -68.921 20.493 -35.759 1.00 80.21  ? 73   THR A N     1 
ATOM   350  C CA    . THR A 1 60  ? -69.038 19.649 -36.950 1.00 81.37  ? 73   THR A CA    1 
ATOM   351  C C     . THR A 1 60  ? -69.738 18.309 -36.715 1.00 83.28  ? 73   THR A C     1 
ATOM   352  O O     . THR A 1 60  ? -70.139 17.638 -37.671 1.00 84.00  ? 73   THR A O     1 
ATOM   353  C CB    . THR A 1 60  ? -67.649 19.369 -37.553 1.00 82.13  ? 73   THR A CB    1 
ATOM   354  O OG1   . THR A 1 60  ? -66.780 18.841 -36.542 1.00 85.28  ? 73   THR A OG1   1 
ATOM   355  C CG2   . THR A 1 60  ? -67.045 20.648 -38.115 1.00 81.01  ? 73   THR A CG2   1 
ATOM   356  N N     . GLN A 1 61  ? -69.876 17.914 -35.453 1.00 83.00  ? 74   GLN A N     1 
ATOM   357  C CA    . GLN A 1 61  ? -70.548 16.664 -35.108 1.00 85.52  ? 74   GLN A CA    1 
ATOM   358  C C     . GLN A 1 61  ? -71.247 16.782 -33.751 1.00 86.06  ? 74   GLN A C     1 
ATOM   359  O O     . GLN A 1 61  ? -70.986 15.987 -32.846 1.00 83.91  ? 74   GLN A O     1 
ATOM   360  C CB    . GLN A 1 61  ? -69.535 15.516 -35.097 1.00 85.52  ? 74   GLN A CB    1 
ATOM   361  N N     . PRO A 1 62  ? -72.149 17.775 -33.611 1.00 87.95  ? 75   PRO A N     1 
ATOM   362  C CA    . PRO A 1 62  ? -72.739 18.096 -32.305 1.00 89.11  ? 75   PRO A CA    1 
ATOM   363  C C     . PRO A 1 62  ? -73.524 16.952 -31.659 1.00 92.74  ? 75   PRO A C     1 
ATOM   364  O O     . PRO A 1 62  ? -73.369 16.702 -30.463 1.00 95.17  ? 75   PRO A O     1 
ATOM   365  C CB    . PRO A 1 62  ? -73.677 19.275 -32.616 1.00 88.76  ? 75   PRO A CB    1 
ATOM   366  C CG    . PRO A 1 62  ? -73.238 19.797 -33.937 1.00 87.67  ? 75   PRO A CG    1 
ATOM   367  C CD    . PRO A 1 62  ? -72.731 18.603 -34.681 1.00 87.48  ? 75   PRO A CD    1 
ATOM   368  N N     . ASP A 1 63  ? -74.356 16.269 -32.440 1.00 96.21  ? 76   ASP A N     1 
ATOM   369  C CA    . ASP A 1 63  ? -75.168 15.165 -31.921 1.00 102.53 ? 76   ASP A CA    1 
ATOM   370  C C     . ASP A 1 63  ? -74.302 14.085 -31.264 1.00 101.62 ? 76   ASP A C     1 
ATOM   371  O O     . ASP A 1 63  ? -74.683 13.516 -30.238 1.00 102.59 ? 76   ASP A O     1 
ATOM   372  C CB    . ASP A 1 63  ? -76.028 14.552 -33.035 1.00 104.60 ? 76   ASP A CB    1 
ATOM   373  N N     . VAL A 1 64  ? -73.137 13.821 -31.853 1.00 99.55  ? 77   VAL A N     1 
ATOM   374  C CA    . VAL A 1 64  ? -72.198 12.834 -31.318 1.00 99.59  ? 77   VAL A CA    1 
ATOM   375  C C     . VAL A 1 64  ? -71.745 13.232 -29.916 1.00 96.32  ? 77   VAL A C     1 
ATOM   376  O O     . VAL A 1 64  ? -71.814 12.428 -28.987 1.00 97.27  ? 77   VAL A O     1 
ATOM   377  C CB    . VAL A 1 64  ? -70.961 12.671 -32.235 1.00 99.40  ? 77   VAL A CB    1 
ATOM   378  C CG1   . VAL A 1 64  ? -69.881 11.822 -31.566 1.00 98.48  ? 77   VAL A CG1   1 
ATOM   379  C CG2   . VAL A 1 64  ? -71.373 12.069 -33.575 1.00 100.10 ? 77   VAL A CG2   1 
ATOM   380  N N     . ILE A 1 65  ? -71.292 14.476 -29.776 1.00 91.66  ? 78   ILE A N     1 
ATOM   381  C CA    . ILE A 1 65  ? -70.804 14.991 -28.494 1.00 89.07  ? 78   ILE A CA    1 
ATOM   382  C C     . ILE A 1 65  ? -71.923 15.022 -27.450 1.00 91.37  ? 78   ILE A C     1 
ATOM   383  O O     . ILE A 1 65  ? -71.713 14.629 -26.300 1.00 92.95  ? 78   ILE A O     1 
ATOM   384  C CB    . ILE A 1 65  ? -70.186 16.403 -28.649 1.00 85.51  ? 78   ILE A CB    1 
ATOM   385  C CG1   . ILE A 1 65  ? -68.946 16.361 -29.555 1.00 83.25  ? 78   ILE A CG1   1 
ATOM   386  C CG2   . ILE A 1 65  ? -69.825 17.003 -27.294 1.00 85.89  ? 78   ILE A CG2   1 
ATOM   387  C CD1   . ILE A 1 65  ? -67.852 15.419 -29.097 1.00 82.15  ? 78   ILE A CD1   1 
ATOM   388  N N     . TYR A 1 66  ? -73.101 15.492 -27.864 1.00 91.35  ? 79   TYR A N     1 
ATOM   389  C CA    . TYR A 1 66  ? -74.294 15.537 -27.010 1.00 92.23  ? 79   TYR A CA    1 
ATOM   390  C C     . TYR A 1 66  ? -74.616 14.167 -26.412 1.00 94.16  ? 79   TYR A C     1 
ATOM   391  O O     . TYR A 1 66  ? -74.879 14.052 -25.213 1.00 94.15  ? 79   TYR A O     1 
ATOM   392  C CB    . TYR A 1 66  ? -75.485 16.056 -27.825 1.00 94.54  ? 79   TYR A CB    1 
ATOM   393  C CG    . TYR A 1 66  ? -76.821 16.048 -27.115 1.00 97.41  ? 79   TYR A CG    1 
ATOM   394  C CD1   . TYR A 1 66  ? -77.183 17.079 -26.250 1.00 97.76  ? 79   TYR A CD1   1 
ATOM   395  C CD2   . TYR A 1 66  ? -77.737 15.021 -27.333 1.00 101.91 ? 79   TYR A CD2   1 
ATOM   396  C CE1   . TYR A 1 66  ? -78.414 17.078 -25.609 1.00 101.86 ? 79   TYR A CE1   1 
ATOM   397  C CE2   . TYR A 1 66  ? -78.968 15.009 -26.698 1.00 105.47 ? 79   TYR A CE2   1 
ATOM   398  C CZ    . TYR A 1 66  ? -79.305 16.037 -25.838 1.00 106.27 ? 79   TYR A CZ    1 
ATOM   399  O OH    . TYR A 1 66  ? -80.533 16.016 -25.212 1.00 113.62 ? 79   TYR A OH    1 
ATOM   400  N N     . GLN A 1 67  ? -74.585 13.137 -27.255 1.00 96.00  ? 80   GLN A N     1 
ATOM   401  C CA    . GLN A 1 67  ? -74.849 11.763 -26.818 1.00 99.14  ? 80   GLN A CA    1 
ATOM   402  C C     . GLN A 1 67  ? -73.768 11.244 -25.866 1.00 97.05  ? 80   GLN A C     1 
ATOM   403  O O     . GLN A 1 67  ? -74.056 10.457 -24.966 1.00 99.34  ? 80   GLN A O     1 
ATOM   404  C CB    . GLN A 1 67  ? -74.978 10.830 -28.028 1.00 100.58 ? 80   GLN A CB    1 
ATOM   405  N N     . ILE A 1 68  ? -72.528 11.683 -26.066 1.00 94.71  ? 81   ILE A N     1 
ATOM   406  C CA    . ILE A 1 68  ? -71.440 11.342 -25.150 1.00 93.70  ? 81   ILE A CA    1 
ATOM   407  C C     . ILE A 1 68  ? -71.747 11.882 -23.759 1.00 92.15  ? 81   ILE A C     1 
ATOM   408  O O     . ILE A 1 68  ? -71.617 11.162 -22.772 1.00 93.54  ? 81   ILE A O     1 
ATOM   409  C CB    . ILE A 1 68  ? -70.087 11.905 -25.623 1.00 88.92  ? 81   ILE A CB    1 
ATOM   410  N N     . HIS A 1 69  ? -72.171 13.143 -23.693 1.00 89.96  ? 82   HIS A N     1 
ATOM   411  C CA    . HIS A 1 69  ? -72.541 13.767 -22.422 1.00 89.95  ? 82   HIS A CA    1 
ATOM   412  C C     . HIS A 1 69  ? -73.696 13.037 -21.753 1.00 94.37  ? 82   HIS A C     1 
ATOM   413  O O     . HIS A 1 69  ? -73.631 12.744 -20.562 1.00 97.57  ? 82   HIS A O     1 
ATOM   414  C CB    . HIS A 1 69  ? -72.917 15.242 -22.610 1.00 87.08  ? 82   HIS A CB    1 
ATOM   415  C CG    . HIS A 1 69  ? -71.739 16.152 -22.755 1.00 83.40  ? 82   HIS A CG    1 
ATOM   416  N ND1   . HIS A 1 69  ? -71.695 17.171 -23.682 1.00 81.46  ? 82   HIS A ND1   1 
ATOM   417  C CD2   . HIS A 1 69  ? -70.558 16.194 -22.093 1.00 81.39  ? 82   HIS A CD2   1 
ATOM   418  C CE1   . HIS A 1 69  ? -70.540 17.804 -23.582 1.00 79.17  ? 82   HIS A CE1   1 
ATOM   419  N NE2   . HIS A 1 69  ? -69.831 17.230 -22.627 1.00 78.59  ? 82   HIS A NE2   1 
ATOM   420  N N     . LYS A 1 70  ? -74.742 12.747 -22.524 1.00 96.86  ? 83   LYS A N     1 
ATOM   421  C CA    . LYS A 1 70  ? -75.929 12.070 -22.002 1.00 101.10 ? 83   LYS A CA    1 
ATOM   422  C C     . LYS A 1 70  ? -75.561 10.779 -21.277 1.00 104.66 ? 83   LYS A C     1 
ATOM   423  O O     . LYS A 1 70  ? -75.959 10.576 -20.131 1.00 107.63 ? 83   LYS A O     1 
ATOM   424  C CB    . LYS A 1 70  ? -76.922 11.768 -23.128 1.00 103.41 ? 83   LYS A CB    1 
ATOM   425  N N     . GLU A 1 71  ? -74.791 9.923  -21.945 1.00 106.42 ? 84   GLU A N     1 
ATOM   426  C CA    . GLU A 1 71  ? -74.355 8.645  -21.365 1.00 111.70 ? 84   GLU A CA    1 
ATOM   427  C C     . GLU A 1 71  ? -73.746 8.809  -19.975 1.00 112.22 ? 84   GLU A C     1 
ATOM   428  O O     . GLU A 1 71  ? -74.046 8.037  -19.065 1.00 114.59 ? 84   GLU A O     1 
ATOM   429  C CB    . GLU A 1 71  ? -73.343 7.951  -22.279 1.00 112.01 ? 84   GLU A CB    1 
ATOM   430  C CG    . GLU A 1 71  ? -73.953 7.324  -23.522 1.00 115.07 ? 84   GLU A CG    1 
ATOM   431  C CD    . GLU A 1 71  ? -72.973 6.434  -24.261 1.00 116.32 ? 84   GLU A CD    1 
ATOM   432  O OE1   . GLU A 1 71  ? -72.499 5.445  -23.662 1.00 118.18 ? 84   GLU A OE1   1 
ATOM   433  O OE2   . GLU A 1 71  ? -72.672 6.728  -25.437 1.00 115.40 ? 84   GLU A OE2   1 
ATOM   434  N N     . TYR A 1 72  ? -72.889 9.813  -19.821 1.00 96.55  ? 85   TYR A N     1 
ATOM   435  C CA    . TYR A 1 72  ? -72.254 10.093 -18.535 1.00 96.89  ? 85   TYR A CA    1 
ATOM   436  C C     . TYR A 1 72  ? -73.263 10.622 -17.516 1.00 99.92  ? 85   TYR A C     1 
ATOM   437  O O     . TYR A 1 72  ? -73.295 10.158 -16.373 1.00 112.32 ? 85   TYR A O     1 
ATOM   438  C CB    . TYR A 1 72  ? -71.101 11.086 -18.702 1.00 91.43  ? 85   TYR A CB    1 
ATOM   439  C CG    . TYR A 1 72  ? -69.851 10.487 -19.310 1.00 89.04  ? 85   TYR A CG    1 
ATOM   440  C CD1   . TYR A 1 72  ? -69.088 9.563  -18.607 1.00 90.60  ? 85   TYR A CD1   1 
ATOM   441  C CD2   . TYR A 1 72  ? -69.420 10.860 -20.578 1.00 89.40  ? 85   TYR A CD2   1 
ATOM   442  C CE1   . TYR A 1 72  ? -67.939 9.015  -19.154 1.00 91.15  ? 85   TYR A CE1   1 
ATOM   443  C CE2   . TYR A 1 72  ? -68.269 10.321 -21.133 1.00 90.14  ? 85   TYR A CE2   1 
ATOM   444  C CZ    . TYR A 1 72  ? -67.533 9.399  -20.417 1.00 89.04  ? 85   TYR A CZ    1 
ATOM   445  O OH    . TYR A 1 72  ? -66.393 8.860  -20.964 1.00 87.85  ? 85   TYR A OH    1 
ATOM   446  N N     . LEU A 1 73  ? -74.089 11.578 -17.935 1.00 97.18  ? 86   LEU A N     1 
ATOM   447  C CA    . LEU A 1 73  ? -75.080 12.193 -17.045 1.00 101.26 ? 86   LEU A CA    1 
ATOM   448  C C     . LEU A 1 73  ? -76.043 11.156 -16.462 1.00 105.21 ? 86   LEU A C     1 
ATOM   449  O O     . LEU A 1 73  ? -76.357 11.196 -15.270 1.00 107.68 ? 86   LEU A O     1 
ATOM   450  C CB    . LEU A 1 73  ? -75.865 13.286 -17.780 1.00 102.91 ? 86   LEU A CB    1 
ATOM   451  C CG    . LEU A 1 73  ? -75.042 14.489 -18.261 1.00 104.73 ? 86   LEU A CG    1 
ATOM   452  C CD1   . LEU A 1 73  ? -75.805 15.280 -19.316 1.00 108.94 ? 86   LEU A CD1   1 
ATOM   453  C CD2   . LEU A 1 73  ? -74.622 15.384 -17.104 1.00 101.00 ? 86   LEU A CD2   1 
ATOM   454  N N     . LEU A 1 74  ? -76.500 10.229 -17.302 1.00 104.42 ? 87   LEU A N     1 
ATOM   455  C CA    . LEU A 1 74  ? -77.352 9.126  -16.852 1.00 107.67 ? 87   LEU A CA    1 
ATOM   456  C C     . LEU A 1 74  ? -76.556 8.122  -16.018 1.00 106.58 ? 87   LEU A C     1 
ATOM   457  O O     . LEU A 1 74  ? -77.073 7.573  -15.043 1.00 104.93 ? 87   LEU A O     1 
ATOM   458  C CB    . LEU A 1 74  ? -78.003 8.419  -18.045 1.00 110.88 ? 87   LEU A CB    1 
ATOM   459  N N     . ALA A 1 75  ? -75.300 7.891  -16.400 1.00 105.13 ? 88   ALA A N     1 
ATOM   460  C CA    . ALA A 1 75  ? -74.420 6.984  -15.661 1.00 105.86 ? 88   ALA A CA    1 
ATOM   461  C C     . ALA A 1 75  ? -73.881 7.659  -14.405 1.00 100.58 ? 88   ALA A C     1 
ATOM   462  O O     . ALA A 1 75  ? -73.972 7.109  -13.309 1.00 99.16  ? 88   ALA A O     1 
ATOM   463  C CB    . ALA A 1 75  ? -73.272 6.516  -16.542 1.00 103.31 ? 88   ALA A CB    1 
ATOM   464  N N     . ASP A 1 78  ? -73.215 13.911 -10.876 1.00 89.12  ? 91   ASP A N     1 
ATOM   465  C CA    . ASP A 1 78  ? -72.669 14.128 -12.213 1.00 88.76  ? 91   ASP A CA    1 
ATOM   466  C C     . ASP A 1 78  ? -72.293 15.593 -12.441 1.00 87.38  ? 91   ASP A C     1 
ATOM   467  O O     . ASP A 1 78  ? -73.044 16.505 -12.092 1.00 86.94  ? 91   ASP A O     1 
ATOM   468  C CB    . ASP A 1 78  ? -73.664 13.684 -13.289 1.00 86.63  ? 91   ASP A CB    1 
ATOM   469  N N     . ILE A 1 79  ? -71.108 15.795 -13.009 1.00 86.53  ? 92   ILE A N     1 
ATOM   470  C CA    . ILE A 1 79  ? -70.673 17.092 -13.513 1.00 83.39  ? 92   ILE A CA    1 
ATOM   471  C C     . ILE A 1 79  ? -70.092 16.843 -14.902 1.00 86.68  ? 92   ILE A C     1 
ATOM   472  O O     . ILE A 1 79  ? -69.343 15.883 -15.095 1.00 96.15  ? 92   ILE A O     1 
ATOM   473  C CB    . ILE A 1 79  ? -69.610 17.731 -12.600 1.00 76.75  ? 92   ILE A CB    1 
ATOM   474  N N     . ILE A 1 80  ? -70.450 17.687 -15.868 1.00 88.04  ? 93   ILE A N     1 
ATOM   475  C CA    . ILE A 1 80  ? -70.037 17.495 -17.262 1.00 91.79  ? 93   ILE A CA    1 
ATOM   476  C C     . ILE A 1 80  ? -68.964 18.510 -17.677 1.00 85.33  ? 93   ILE A C     1 
ATOM   477  O O     . ILE A 1 80  ? -69.169 19.718 -17.556 1.00 84.19  ? 93   ILE A O     1 
ATOM   478  C CB    . ILE A 1 80  ? -71.247 17.608 -18.216 1.00 83.56  ? 93   ILE A CB    1 
ATOM   479  N N     . GLU A 1 81  ? -67.821 18.010 -18.150 1.00 89.52  ? 94   GLU A N     1 
ATOM   480  C CA    . GLU A 1 81  ? -66.759 18.859 -18.703 1.00 79.35  ? 94   GLU A CA    1 
ATOM   481  C C     . GLU A 1 81  ? -67.147 19.298 -20.100 1.00 76.55  ? 94   GLU A C     1 
ATOM   482  O O     . GLU A 1 81  ? -67.693 18.508 -20.863 1.00 88.91  ? 94   GLU A O     1 
ATOM   483  C CB    . GLU A 1 81  ? -65.435 18.095 -18.814 1.00 77.06  ? 94   GLU A CB    1 
ATOM   484  C CG    . GLU A 1 81  ? -64.772 17.715 -17.503 1.00 81.66  ? 94   GLU A CG    1 
ATOM   485  C CD    . GLU A 1 81  ? -63.550 16.836 -17.715 1.00 85.26  ? 94   GLU A CD    1 
ATOM   486  O OE1   . GLU A 1 81  ? -62.706 17.187 -18.570 1.00 73.48  ? 94   GLU A OE1   1 
ATOM   487  O OE2   . GLU A 1 81  ? -63.430 15.793 -17.032 1.00 95.23  ? 94   GLU A OE2   1 
ATOM   488  N N     . THR A 1 82  ? -66.857 20.550 -20.441 1.00 74.54  ? 95   THR A N     1 
ATOM   489  C CA    . THR A 1 82  ? -66.996 21.010 -21.818 1.00 74.35  ? 95   THR A CA    1 
ATOM   490  C C     . THR A 1 82  ? -65.879 20.404 -22.658 1.00 70.60  ? 95   THR A C     1 
ATOM   491  O O     . THR A 1 82  ? -64.774 20.179 -22.163 1.00 70.93  ? 95   THR A O     1 
ATOM   492  C CB    . THR A 1 82  ? -66.922 22.544 -21.930 1.00 72.31  ? 95   THR A CB    1 
ATOM   493  O OG1   . THR A 1 82  ? -65.780 23.023 -21.210 1.00 79.31  ? 95   THR A OG1   1 
ATOM   494  C CG2   . THR A 1 82  ? -68.183 23.184 -21.374 1.00 70.07  ? 95   THR A CG2   1 
ATOM   495  N N     . ASN A 1 83  ? -66.177 20.147 -23.929 1.00 72.14  ? 96   ASN A N     1 
ATOM   496  C CA    . ASN A 1 83  ? -65.224 19.557 -24.868 1.00 71.03  ? 96   ASN A CA    1 
ATOM   497  C C     . ASN A 1 83  ? -64.208 20.608 -25.325 1.00 68.21  ? 96   ASN A C     1 
ATOM   498  O O     . ASN A 1 83  ? -64.078 20.883 -26.516 1.00 68.17  ? 96   ASN A O     1 
ATOM   499  C CB    . ASN A 1 83  ? -65.992 18.985 -26.067 1.00 71.05  ? 96   ASN A CB    1 
ATOM   500  C CG    . ASN A 1 83  ? -65.097 18.268 -27.057 1.00 74.94  ? 96   ASN A CG    1 
ATOM   501  O OD1   . ASN A 1 83  ? -64.150 17.583 -26.671 1.00 83.84  ? 96   ASN A OD1   1 
ATOM   502  N ND2   . ASN A 1 83  ? -65.397 18.417 -28.346 1.00 71.62  ? 96   ASN A ND2   1 
ATOM   503  N N     . THR A 1 84  ? -63.483 21.180 -24.366 1.00 66.66  ? 97   THR A N     1 
ATOM   504  C CA    . THR A 1 84  ? -62.738 22.420 -24.589 1.00 66.61  ? 97   THR A CA    1 
ATOM   505  C C     . THR A 1 84  ? -61.297 22.335 -24.097 1.00 66.53  ? 97   THR A C     1 
ATOM   506  O O     . THR A 1 84  ? -60.712 23.339 -23.691 1.00 70.89  ? 97   THR A O     1 
ATOM   507  C CB    . THR A 1 84  ? -63.445 23.606 -23.906 1.00 63.00  ? 97   THR A CB    1 
ATOM   508  O OG1   . THR A 1 84  ? -63.690 23.295 -22.532 1.00 66.26  ? 97   THR A OG1   1 
ATOM   509  C CG2   . THR A 1 84  ? -64.758 23.890 -24.576 1.00 66.25  ? 97   THR A CG2   1 
ATOM   510  N N     . PHE A 1 85  ? -60.719 21.141 -24.161 1.00 65.19  ? 98   PHE A N     1 
ATOM   511  C CA    . PHE A 1 85  ? -59.375 20.919 -23.639 1.00 68.35  ? 98   PHE A CA    1 
ATOM   512  C C     . PHE A 1 85  ? -58.300 21.644 -24.449 1.00 62.51  ? 98   PHE A C     1 
ATOM   513  O O     . PHE A 1 85  ? -57.254 21.996 -23.911 1.00 79.38  ? 98   PHE A O     1 
ATOM   514  C CB    . PHE A 1 85  ? -59.063 19.424 -23.590 1.00 73.37  ? 98   PHE A CB    1 
ATOM   515  C CG    . PHE A 1 85  ? -57.804 19.096 -22.843 1.00 74.96  ? 98   PHE A CG    1 
ATOM   516  C CD1   . PHE A 1 85  ? -57.806 19.049 -21.459 1.00 72.25  ? 98   PHE A CD1   1 
ATOM   517  C CD2   . PHE A 1 85  ? -56.614 18.846 -23.524 1.00 73.29  ? 98   PHE A CD2   1 
ATOM   518  C CE1   . PHE A 1 85  ? -56.651 18.749 -20.760 1.00 75.03  ? 98   PHE A CE1   1 
ATOM   519  C CE2   . PHE A 1 85  ? -55.454 18.550 -22.832 1.00 72.05  ? 98   PHE A CE2   1 
ATOM   520  C CZ    . PHE A 1 85  ? -55.473 18.498 -21.445 1.00 76.58  ? 98   PHE A CZ    1 
ATOM   521  N N     . SER A 1 86  ? -58.559 21.858 -25.735 1.00 62.12  ? 99   SER A N     1 
ATOM   522  C CA    . SER A 1 86  ? -57.618 22.544 -26.625 1.00 58.54  ? 99   SER A CA    1 
ATOM   523  C C     . SER A 1 86  ? -58.250 23.755 -27.308 1.00 56.28  ? 99   SER A C     1 
ATOM   524  O O     . SER A 1 86  ? -57.798 24.157 -28.372 1.00 53.45  ? 99   SER A O     1 
ATOM   525  C CB    . SER A 1 86  ? -57.116 21.576 -27.702 1.00 58.11  ? 99   SER A CB    1 
ATOM   526  O OG    . SER A 1 86  ? -56.864 20.292 -27.161 1.00 72.05  ? 99   SER A OG    1 
ATOM   527  N N     . SER A 1 87  ? -59.290 24.332 -26.705 1.00 64.92  ? 100  SER A N     1 
ATOM   528  C CA    . SER A 1 87  ? -60.016 25.452 -27.320 1.00 61.70  ? 100  SER A CA    1 
ATOM   529  C C     . SER A 1 87  ? -59.434 26.800 -26.918 1.00 57.83  ? 100  SER A C     1 
ATOM   530  O O     . SER A 1 87  ? -60.111 27.629 -26.314 1.00 68.65  ? 100  SER A O     1 
ATOM   531  C CB    . SER A 1 87  ? -61.506 25.389 -26.984 1.00 59.72  ? 100  SER A CB    1 
ATOM   532  O OG    . SER A 1 87  ? -62.181 24.558 -27.903 1.00 75.34  ? 100  SER A OG    1 
ATOM   533  N N     . THR A 1 88  ? -58.169 27.003 -27.269 1.00 62.58  ? 101  THR A N     1 
ATOM   534  C CA    . THR A 1 88  ? -57.485 28.277 -27.081 1.00 69.66  ? 101  THR A CA    1 
ATOM   535  C C     . THR A 1 88  ? -56.862 28.696 -28.417 1.00 65.64  ? 101  THR A C     1 
ATOM   536  O O     . THR A 1 88  ? -56.711 27.871 -29.320 1.00 64.46  ? 101  THR A O     1 
ATOM   537  C CB    . THR A 1 88  ? -56.380 28.165 -26.004 1.00 53.14  ? 101  THR A CB    1 
ATOM   538  N N     . SER A 1 89  ? -56.514 29.975 -28.542 1.00 61.13  ? 102  SER A N     1 
ATOM   539  C CA    . SER A 1 89  ? -55.734 30.460 -29.682 1.00 60.71  ? 102  SER A CA    1 
ATOM   540  C C     . SER A 1 89  ? -54.474 29.617 -29.888 1.00 65.17  ? 102  SER A C     1 
ATOM   541  O O     . SER A 1 89  ? -54.213 29.140 -30.991 1.00 64.74  ? 102  SER A O     1 
ATOM   542  C CB    . SER A 1 89  ? -55.323 31.925 -29.475 1.00 52.72  ? 102  SER A CB    1 
ATOM   543  N N     . ILE A 1 90  ? -53.704 29.428 -28.819 1.00 66.02  ? 103  ILE A N     1 
ATOM   544  C CA    . ILE A 1 90  ? -52.430 28.717 -28.915 1.00 71.28  ? 103  ILE A CA    1 
ATOM   545  C C     . ILE A 1 90  ? -52.625 27.334 -29.539 1.00 58.34  ? 103  ILE A C     1 
ATOM   546  O O     . ILE A 1 90  ? -52.050 27.037 -30.588 1.00 61.44  ? 103  ILE A O     1 
ATOM   547  C CB    . ILE A 1 90  ? -51.725 28.592 -27.542 1.00 54.37  ? 103  ILE A CB    1 
ATOM   548  N N     . ALA A 1 91  ? -53.455 26.509 -28.908 1.00 59.23  ? 104  ALA A N     1 
ATOM   549  C CA    . ALA A 1 91  ? -53.634 25.111 -29.330 1.00 61.18  ? 104  ALA A CA    1 
ATOM   550  C C     . ALA A 1 91  ? -54.272 24.944 -30.713 1.00 56.39  ? 104  ALA A C     1 
ATOM   551  O O     . ALA A 1 91  ? -53.933 24.011 -31.438 1.00 62.44  ? 104  ALA A O     1 
ATOM   552  C CB    . ALA A 1 91  ? -54.437 24.339 -28.292 1.00 53.40  ? 104  ALA A CB    1 
ATOM   553  N N     . GLN A 1 92  ? -55.190 25.834 -31.077 1.00 54.31  ? 105  GLN A N     1 
ATOM   554  C CA    . GLN A 1 92  ? -55.902 25.712 -32.355 1.00 56.62  ? 105  GLN A CA    1 
ATOM   555  C C     . GLN A 1 92  ? -55.090 26.196 -33.558 1.00 60.93  ? 105  GLN A C     1 
ATOM   556  O O     . GLN A 1 92  ? -55.459 25.926 -34.707 1.00 67.93  ? 105  GLN A O     1 
ATOM   557  C CB    . GLN A 1 92  ? -57.248 26.436 -32.295 1.00 56.59  ? 105  GLN A CB    1 
ATOM   558  C CG    . GLN A 1 92  ? -58.271 25.744 -31.407 1.00 58.60  ? 105  GLN A CG    1 
ATOM   559  C CD    . GLN A 1 92  ? -58.592 24.335 -31.873 1.00 62.04  ? 105  GLN A CD    1 
ATOM   560  O OE1   . GLN A 1 92  ? -58.716 24.081 -33.070 1.00 70.99  ? 105  GLN A OE1   1 
ATOM   561  N NE2   . GLN A 1 92  ? -58.727 23.412 -30.929 1.00 58.40  ? 105  GLN A NE2   1 
ATOM   562  N N     . ALA A 1 93  ? -53.989 26.899 -33.299 1.00 55.75  ? 106  ALA A N     1 
ATOM   563  C CA    . ALA A 1 93  ? -53.066 27.316 -34.358 1.00 60.22  ? 106  ALA A CA    1 
ATOM   564  C C     . ALA A 1 93  ? -52.545 26.138 -35.176 1.00 61.12  ? 106  ALA A C     1 
ATOM   565  O O     . ALA A 1 93  ? -52.301 26.276 -36.371 1.00 69.14  ? 106  ALA A O     1 
ATOM   566  C CB    . ALA A 1 93  ? -51.905 28.104 -33.775 1.00 55.71  ? 106  ALA A CB    1 
ATOM   567  N N     . ASP A 1 94  ? -52.393 24.981 -34.537 1.00 73.85  ? 107  ASP A N     1 
ATOM   568  C CA    . ASP A 1 94  ? -51.968 23.763 -35.234 1.00 84.86  ? 107  ASP A CA    1 
ATOM   569  C C     . ASP A 1 94  ? -53.018 23.235 -36.230 1.00 83.16  ? 107  ASP A C     1 
ATOM   570  O O     . ASP A 1 94  ? -52.704 22.364 -37.045 1.00 75.48  ? 107  ASP A O     1 
ATOM   571  C CB    . ASP A 1 94  ? -51.596 22.667 -34.223 1.00 71.83  ? 107  ASP A CB    1 
ATOM   572  N N     . TYR A 1 95  ? -54.251 23.751 -36.160 1.00 73.92  ? 108  TYR A N     1 
ATOM   573  C CA    . TYR A 1 95  ? -55.309 23.397 -37.120 1.00 72.62  ? 108  TYR A CA    1 
ATOM   574  C C     . TYR A 1 95  ? -55.827 24.598 -37.923 1.00 69.29  ? 108  TYR A C     1 
ATOM   575  O O     . TYR A 1 95  ? -56.832 24.486 -38.626 1.00 81.31  ? 108  TYR A O     1 
ATOM   576  C CB    . TYR A 1 95  ? -56.484 22.730 -36.398 1.00 71.89  ? 108  TYR A CB    1 
ATOM   577  C CG    . TYR A 1 95  ? -56.086 21.579 -35.506 1.00 74.88  ? 108  TYR A CG    1 
ATOM   578  C CD1   . TYR A 1 95  ? -55.907 20.301 -36.022 1.00 66.88  ? 108  TYR A CD1   1 
ATOM   579  C CD2   . TYR A 1 95  ? -55.888 21.771 -34.140 1.00 77.74  ? 108  TYR A CD2   1 
ATOM   580  C CE1   . TYR A 1 95  ? -55.541 19.245 -35.204 1.00 72.54  ? 108  TYR A CE1   1 
ATOM   581  C CE2   . TYR A 1 95  ? -55.523 20.723 -33.313 1.00 73.55  ? 108  TYR A CE2   1 
ATOM   582  C CZ    . TYR A 1 95  ? -55.350 19.463 -33.847 1.00 72.88  ? 108  TYR A CZ    1 
ATOM   583  O OH    . TYR A 1 95  ? -54.990 18.422 -33.019 1.00 75.43  ? 108  TYR A OH    1 
ATOM   584  N N     . GLY A 1 96  ? -55.146 25.736 -37.828 1.00 70.97  ? 109  GLY A N     1 
ATOM   585  C CA    . GLY A 1 96  ? -55.558 26.947 -38.543 1.00 67.41  ? 109  GLY A CA    1 
ATOM   586  C C     . GLY A 1 96  ? -56.892 27.512 -38.085 1.00 70.49  ? 109  GLY A C     1 
ATOM   587  O O     . GLY A 1 96  ? -57.643 28.055 -38.894 1.00 83.69  ? 109  GLY A O     1 
ATOM   588  N N     . LEU A 1 97  ? -57.182 27.385 -36.788 1.00 66.44  ? 110  LEU A N     1 
ATOM   589  C CA    . LEU A 1 97  ? -58.428 27.878 -36.202 1.00 65.02  ? 110  LEU A CA    1 
ATOM   590  C C     . LEU A 1 97  ? -58.166 28.766 -34.986 1.00 61.10  ? 110  LEU A C     1 
ATOM   591  O O     . LEU A 1 97  ? -58.927 28.754 -34.022 1.00 64.16  ? 110  LEU A O     1 
ATOM   592  C CB    . LEU A 1 97  ? -59.327 26.702 -35.799 1.00 72.18  ? 110  LEU A CB    1 
ATOM   593  C CG    . LEU A 1 97  ? -59.784 25.747 -36.903 1.00 66.81  ? 110  LEU A CG    1 
ATOM   594  C CD1   . LEU A 1 97  ? -60.599 24.608 -36.311 1.00 68.91  ? 110  LEU A CD1   1 
ATOM   595  C CD2   . LEU A 1 97  ? -60.594 26.484 -37.954 1.00 73.18  ? 110  LEU A CD2   1 
ATOM   596  N N     . GLU A 1 98  ? -57.088 29.541 -35.039 1.00 73.83  ? 111  GLU A N     1 
ATOM   597  C CA    . GLU A 1 98  ? -56.757 30.495 -33.977 1.00 76.13  ? 111  GLU A CA    1 
ATOM   598  C C     . GLU A 1 98  ? -57.951 31.409 -33.717 1.00 68.54  ? 111  GLU A C     1 
ATOM   599  O O     . GLU A 1 98  ? -58.391 31.602 -32.579 1.00 59.80  ? 111  GLU A O     1 
ATOM   600  C CB    . GLU A 1 98  ? -55.559 31.368 -34.382 1.00 81.72  ? 111  GLU A CB    1 
ATOM   601  C CG    . GLU A 1 98  ? -54.258 30.622 -34.650 1.00 92.30  ? 111  GLU A CG    1 
ATOM   602  C CD    . GLU A 1 98  ? -54.062 30.240 -36.113 1.00 103.62 ? 111  GLU A CD    1 
ATOM   603  O OE1   . GLU A 1 98  ? -55.057 29.917 -36.798 1.00 96.14  ? 111  GLU A OE1   1 
ATOM   604  O OE2   . GLU A 1 98  ? -52.904 30.256 -36.582 1.00 125.35 ? 111  GLU A OE2   1 
ATOM   605  N N     . HIS A 1 99  ? -58.471 31.950 -34.811 1.00 59.47  ? 112  HIS A N     1 
ATOM   606  C CA    . HIS A 1 99  ? -59.536 32.941 -34.789 1.00 57.06  ? 112  HIS A CA    1 
ATOM   607  C C     . HIS A 1 99  ? -60.879 32.430 -34.262 1.00 56.27  ? 112  HIS A C     1 
ATOM   608  O O     . HIS A 1 99  ? -61.784 33.223 -34.053 1.00 50.46  ? 112  HIS A O     1 
ATOM   609  C CB    . HIS A 1 99  ? -59.722 33.511 -36.201 1.00 56.87  ? 112  HIS A CB    1 
ATOM   610  C CG    . HIS A 1 99  ? -60.220 32.511 -37.199 1.00 58.23  ? 112  HIS A CG    1 
ATOM   611  N ND1   . HIS A 1 99  ? -59.431 31.497 -37.700 1.00 67.47  ? 112  HIS A ND1   1 
ATOM   612  C CD2   . HIS A 1 99  ? -61.431 32.368 -37.787 1.00 62.36  ? 112  HIS A CD2   1 
ATOM   613  C CE1   . HIS A 1 99  ? -60.134 30.773 -38.553 1.00 60.94  ? 112  HIS A CE1   1 
ATOM   614  N NE2   . HIS A 1 99  ? -61.351 31.280 -38.622 1.00 59.88  ? 112  HIS A NE2   1 
ATOM   615  N N     . LEU A 1 100 ? -60.999 31.123 -34.037 1.00 65.14  ? 113  LEU A N     1 
ATOM   616  C CA    . LEU A 1 100 ? -62.286 30.485 -33.754 1.00 64.27  ? 113  LEU A CA    1 
ATOM   617  C C     . LEU A 1 100 ? -62.481 30.088 -32.289 1.00 67.63  ? 113  LEU A C     1 
ATOM   618  O O     . LEU A 1 100 ? -63.485 29.465 -31.953 1.00 78.55  ? 113  LEU A O     1 
ATOM   619  C CB    . LEU A 1 100 ? -62.424 29.233 -34.626 1.00 70.16  ? 113  LEU A CB    1 
ATOM   620  C CG    . LEU A 1 100 ? -63.825 28.906 -35.149 1.00 79.86  ? 113  LEU A CG    1 
ATOM   621  C CD1   . LEU A 1 100 ? -64.234 29.875 -36.247 1.00 76.61  ? 113  LEU A CD1   1 
ATOM   622  C CD2   . LEU A 1 100 ? -63.877 27.480 -35.672 1.00 86.48  ? 113  LEU A CD2   1 
ATOM   623  N N     . ALA A 1 101 ? -61.540 30.461 -31.423 1.00 76.61  ? 114  ALA A N     1 
ATOM   624  C CA    . ALA A 1 101 ? -61.516 29.983 -30.033 1.00 71.54  ? 114  ALA A CA    1 
ATOM   625  C C     . ALA A 1 101 ? -62.799 30.294 -29.265 1.00 68.10  ? 114  ALA A C     1 
ATOM   626  O O     . ALA A 1 101 ? -63.394 29.405 -28.653 1.00 69.22  ? 114  ALA A O     1 
ATOM   627  C CB    . ALA A 1 101 ? -60.317 30.567 -29.296 1.00 69.64  ? 114  ALA A CB    1 
ATOM   628  N N     . TYR A 1 102 ? -63.212 31.557 -29.291 1.00 66.55  ? 115  TYR A N     1 
ATOM   629  C CA    . TYR A 1 102 ? -64.381 32.000 -28.537 1.00 63.57  ? 115  TYR A CA    1 
ATOM   630  C C     . TYR A 1 102 ? -65.621 31.186 -28.907 1.00 67.16  ? 115  TYR A C     1 
ATOM   631  O O     . TYR A 1 102 ? -66.334 30.689 -28.032 1.00 65.90  ? 115  TYR A O     1 
ATOM   632  C CB    . TYR A 1 102 ? -64.639 33.491 -28.779 1.00 61.17  ? 115  TYR A CB    1 
ATOM   633  C CG    . TYR A 1 102 ? -65.928 33.987 -28.163 1.00 64.26  ? 115  TYR A CG    1 
ATOM   634  C CD1   . TYR A 1 102 ? -65.970 34.407 -26.837 1.00 65.12  ? 115  TYR A CD1   1 
ATOM   635  C CD2   . TYR A 1 102 ? -67.102 34.023 -28.900 1.00 60.26  ? 115  TYR A CD2   1 
ATOM   636  C CE1   . TYR A 1 102 ? -67.143 34.857 -26.268 1.00 63.49  ? 115  TYR A CE1   1 
ATOM   637  C CE2   . TYR A 1 102 ? -68.284 34.467 -28.336 1.00 70.54  ? 115  TYR A CE2   1 
ATOM   638  C CZ    . TYR A 1 102 ? -68.297 34.883 -27.019 1.00 67.21  ? 115  TYR A CZ    1 
ATOM   639  O OH    . TYR A 1 102 ? -69.465 35.324 -26.452 1.00 61.31  ? 115  TYR A OH    1 
ATOM   640  N N     . ARG A 1 103 ? -65.862 31.054 -30.207 1.00 64.70  ? 116  ARG A N     1 
ATOM   641  C CA    . ARG A 1 103 ? -67.027 30.341 -30.721 1.00 63.20  ? 116  ARG A CA    1 
ATOM   642  C C     . ARG A 1 103 ? -67.007 28.852 -30.378 1.00 67.86  ? 116  ARG A C     1 
ATOM   643  O O     . ARG A 1 103 ? -68.057 28.265 -30.119 1.00 72.37  ? 116  ARG A O     1 
ATOM   644  C CB    . ARG A 1 103 ? -67.119 30.527 -32.237 1.00 69.28  ? 116  ARG A CB    1 
ATOM   645  C CG    . ARG A 1 103 ? -68.133 29.632 -32.931 1.00 73.86  ? 116  ARG A CG    1 
ATOM   646  C CD    . ARG A 1 103 ? -68.470 30.161 -34.314 1.00 74.79  ? 116  ARG A CD    1 
ATOM   647  N NE    . ARG A 1 103 ? -69.415 29.289 -35.009 1.00 73.30  ? 116  ARG A NE    1 
ATOM   648  C CZ    . ARG A 1 103 ? -69.185 28.654 -36.157 1.00 71.61  ? 116  ARG A CZ    1 
ATOM   649  N NH1   . ARG A 1 103 ? -68.028 28.781 -36.801 1.00 70.03  ? 116  ARG A NH1   1 
ATOM   650  N NH2   . ARG A 1 103 ? -70.135 27.891 -36.675 1.00 73.86  ? 116  ARG A NH2   1 
ATOM   651  N N     . MET A 1 104 ? -65.824 28.239 -30.392 1.00 64.17  ? 117  MET A N     1 
ATOM   652  C CA    . MET A 1 104 ? -65.703 26.814 -30.079 1.00 66.01  ? 117  MET A CA    1 
ATOM   653  C C     . MET A 1 104 ? -66.148 26.540 -28.643 1.00 70.65  ? 117  MET A C     1 
ATOM   654  O O     . MET A 1 104 ? -66.918 25.616 -28.391 1.00 85.67  ? 117  MET A O     1 
ATOM   655  C CB    . MET A 1 104 ? -64.268 26.330 -30.286 1.00 66.72  ? 117  MET A CB    1 
ATOM   656  C CG    . MET A 1 104 ? -63.812 26.322 -31.737 1.00 68.92  ? 117  MET A CG    1 
ATOM   657  S SD    . MET A 1 104 ? -62.078 25.848 -31.915 1.00 71.47  ? 117  MET A SD    1 
ATOM   658  C CE    . MET A 1 104 ? -62.222 24.088 -31.642 1.00 73.90  ? 117  MET A CE    1 
ATOM   659  N N     . ASN A 1 105 ? -65.665 27.360 -27.715 1.00 75.23  ? 118  ASN A N     1 
ATOM   660  C CA    . ASN A 1 105 ? -66.067 27.285 -26.308 1.00 73.23  ? 118  ASN A CA    1 
ATOM   661  C C     . ASN A 1 105 ? -67.551 27.563 -26.108 1.00 76.87  ? 118  ASN A C     1 
ATOM   662  O O     . ASN A 1 105 ? -68.216 26.907 -25.302 1.00 73.45  ? 118  ASN A O     1 
ATOM   663  C CB    . ASN A 1 105 ? -65.268 28.288 -25.477 1.00 68.18  ? 118  ASN A CB    1 
ATOM   664  C CG    . ASN A 1 105 ? -63.821 27.891 -25.327 1.00 67.46  ? 118  ASN A CG    1 
ATOM   665  O OD1   . ASN A 1 105 ? -63.478 27.082 -24.466 1.00 69.54  ? 118  ASN A OD1   1 
ATOM   666  N ND2   . ASN A 1 105 ? -62.960 28.463 -26.159 1.00 69.50  ? 118  ASN A ND2   1 
ATOM   667  N N     . MET A 1 106 ? -68.051 28.557 -26.834 1.00 78.71  ? 119  MET A N     1 
ATOM   668  C CA    . MET A 1 106 ? -69.460 28.925 -26.786 1.00 78.20  ? 119  MET A CA    1 
ATOM   669  C C     . MET A 1 106 ? -70.319 27.725 -27.184 1.00 76.94  ? 119  MET A C     1 
ATOM   670  O O     . MET A 1 106 ? -71.232 27.342 -26.457 1.00 76.41  ? 119  MET A O     1 
ATOM   671  C CB    . MET A 1 106 ? -69.716 30.106 -27.724 1.00 75.43  ? 119  MET A CB    1 
ATOM   672  C CG    . MET A 1 106 ? -71.108 30.708 -27.640 1.00 95.90  ? 119  MET A CG    1 
ATOM   673  S SD    . MET A 1 106 ? -71.302 31.875 -26.283 1.00 94.54  ? 119  MET A SD    1 
ATOM   674  C CE    . MET A 1 106 ? -72.507 32.977 -27.022 1.00 86.61  ? 119  MET A CE    1 
ATOM   675  N N     . CYS A 1 107 ? -70.005 27.131 -28.331 1.00 82.13  ? 120  CYS A N     1 
ATOM   676  C CA    . CYS A 1 107 ? -70.723 25.953 -28.821 1.00 88.76  ? 120  CYS A CA    1 
ATOM   677  C C     . CYS A 1 107 ? -70.512 24.753 -27.909 1.00 80.86  ? 120  CYS A C     1 
ATOM   678  O O     . CYS A 1 107 ? -71.447 24.005 -27.635 1.00 83.86  ? 120  CYS A O     1 
ATOM   679  C CB    . CYS A 1 107 ? -70.269 25.594 -30.240 1.00 97.40  ? 120  CYS A CB    1 
ATOM   680  S SG    . CYS A 1 107 ? -70.669 26.834 -31.491 1.00 98.38  ? 120  CYS A SG    1 
ATOM   681  N N     . SER A 1 108 ? -69.279 24.567 -27.450 1.00 80.78  ? 121  SER A N     1 
ATOM   682  C CA    . SER A 1 108 ? -68.952 23.445 -26.570 1.00 79.58  ? 121  SER A CA    1 
ATOM   683  C C     . SER A 1 108 ? -69.732 23.537 -25.256 1.00 82.39  ? 121  SER A C     1 
ATOM   684  O O     . SER A 1 108 ? -70.130 22.517 -24.687 1.00 82.06  ? 121  SER A O     1 
ATOM   685  C CB    . SER A 1 108 ? -67.448 23.396 -26.300 1.00 59.32  ? 121  SER A CB    1 
ATOM   686  N N     . ALA A 1 109 ? -69.952 24.765 -24.790 1.00 76.40  ? 122  ALA A N     1 
ATOM   687  C CA    . ALA A 1 109 ? -70.716 25.009 -23.572 1.00 73.95  ? 122  ALA A CA    1 
ATOM   688  C C     . ALA A 1 109 ? -72.218 24.857 -23.797 1.00 75.37  ? 122  ALA A C     1 
ATOM   689  O O     . ALA A 1 109 ? -72.946 24.492 -22.880 1.00 77.45  ? 122  ALA A O     1 
ATOM   690  C CB    . ALA A 1 109 ? -70.402 26.393 -23.026 1.00 75.34  ? 122  ALA A CB    1 
ATOM   691  N N     . GLY A 1 110 ? -72.679 25.144 -25.009 1.00 84.63  ? 123  GLY A N     1 
ATOM   692  C CA    . GLY A 1 110 ? -74.094 25.009 -25.348 1.00 90.97  ? 123  GLY A CA    1 
ATOM   693  C C     . GLY A 1 110 ? -74.533 23.560 -25.456 1.00 97.88  ? 123  GLY A C     1 
ATOM   694  O O     . GLY A 1 110 ? -75.560 23.167 -24.894 1.00 95.30  ? 123  GLY A O     1 
ATOM   695  N N     . VAL A 1 111 ? -73.747 22.767 -26.183 1.00 102.87 ? 124  VAL A N     1 
ATOM   696  C CA    . VAL A 1 111 ? -74.039 21.346 -26.393 1.00 104.32 ? 124  VAL A CA    1 
ATOM   697  C C     . VAL A 1 111 ? -74.007 20.591 -25.059 1.00 110.91 ? 124  VAL A C     1 
ATOM   698  O O     . VAL A 1 111 ? -74.788 19.660 -24.848 1.00 118.43 ? 124  VAL A O     1 
ATOM   699  C CB    . VAL A 1 111 ? -73.053 20.707 -27.407 1.00 97.21  ? 124  VAL A CB    1 
ATOM   700  C CG1   . VAL A 1 111 ? -73.232 19.194 -27.482 1.00 97.09  ? 124  VAL A CG1   1 
ATOM   701  C CG2   . VAL A 1 111 ? -73.232 21.324 -28.789 1.00 93.81  ? 124  VAL A CG2   1 
ATOM   702  N N     . ALA A 1 112 ? -73.110 21.001 -24.164 1.00 98.83  ? 125  ALA A N     1 
ATOM   703  C CA    . ALA A 1 112 ? -73.037 20.424 -22.822 1.00 93.95  ? 125  ALA A CA    1 
ATOM   704  C C     . ALA A 1 112 ? -74.205 20.882 -21.940 1.00 97.84  ? 125  ALA A C     1 
ATOM   705  O O     . ALA A 1 112 ? -74.711 20.106 -21.130 1.00 109.15 ? 125  ALA A O     1 
ATOM   706  C CB    . ALA A 1 112 ? -71.711 20.775 -22.165 1.00 83.73  ? 125  ALA A CB    1 
ATOM   707  N N     . ARG A 1 113 ? -74.623 22.138 -22.098 1.00 97.92  ? 126  ARG A N     1 
ATOM   708  C CA    . ARG A 1 113 ? -75.723 22.700 -21.304 1.00 94.32  ? 126  ARG A CA    1 
ATOM   709  C C     . ARG A 1 113 ? -77.077 22.118 -21.704 1.00 96.26  ? 126  ARG A C     1 
ATOM   710  O O     . ARG A 1 113 ? -77.976 22.014 -20.872 1.00 95.54  ? 126  ARG A O     1 
ATOM   711  C CB    . ARG A 1 113 ? -75.762 24.227 -21.427 1.00 81.59  ? 126  ARG A CB    1 
ATOM   712  N N     . LYS A 1 114 ? -77.218 21.750 -22.976 1.00 104.28 ? 127  LYS A N     1 
ATOM   713  C CA    . LYS A 1 114 ? -78.444 21.125 -23.477 1.00 109.17 ? 127  LYS A CA    1 
ATOM   714  C C     . LYS A 1 114 ? -78.615 19.719 -22.910 1.00 108.12 ? 127  LYS A C     1 
ATOM   715  O O     . LYS A 1 114 ? -79.734 19.294 -22.615 1.00 113.00 ? 127  LYS A O     1 
ATOM   716  C CB    . LYS A 1 114 ? -78.433 21.068 -25.008 1.00 108.40 ? 127  LYS A CB    1 
ATOM   717  N N     . ALA A 1 115 ? -77.499 19.004 -22.768 1.00 100.67 ? 128  ALA A N     1 
ATOM   718  C CA    . ALA A 1 115 ? -77.500 17.656 -22.205 1.00 101.67 ? 128  ALA A CA    1 
ATOM   719  C C     . ALA A 1 115 ? -77.777 17.693 -20.708 1.00 97.97  ? 128  ALA A C     1 
ATOM   720  O O     . ALA A 1 115 ? -78.581 16.910 -20.202 1.00 113.30 ? 128  ALA A O     1 
ATOM   721  C CB    . ALA A 1 115 ? -76.171 16.967 -22.474 1.00 101.49 ? 128  ALA A CB    1 
ATOM   722  N N     . ALA A 1 116 ? -77.106 18.606 -20.009 1.00 89.47  ? 129  ALA A N     1 
ATOM   723  C CA    . ALA A 1 116 ? -77.267 18.770 -18.563 1.00 91.85  ? 129  ALA A CA    1 
ATOM   724  C C     . ALA A 1 116 ? -78.730 18.911 -18.158 1.00 98.13  ? 129  ALA A C     1 
ATOM   725  O O     . ALA A 1 116 ? -79.178 18.299 -17.188 1.00 100.59 ? 129  ALA A O     1 
ATOM   726  C CB    . ALA A 1 116 ? -76.485 19.982 -18.085 1.00 87.79  ? 129  ALA A CB    1 
ATOM   727  N N     . GLU A 1 117 ? -79.463 19.716 -18.920 1.00 99.97  ? 130  GLU A N     1 
ATOM   728  C CA    . GLU A 1 117 ? -80.846 20.052 -18.603 1.00 99.84  ? 130  GLU A CA    1 
ATOM   729  C C     . GLU A 1 117 ? -81.834 18.926 -18.918 1.00 101.17 ? 130  GLU A C     1 
ATOM   730  O O     . GLU A 1 117 ? -82.865 18.809 -18.254 1.00 111.09 ? 130  GLU A O     1 
ATOM   731  C CB    . GLU A 1 117 ? -81.243 21.341 -19.327 1.00 98.42  ? 130  GLU A CB    1 
ATOM   732  C CG    . GLU A 1 117 ? -80.480 22.560 -18.823 1.00 93.32  ? 130  GLU A CG    1 
ATOM   733  C CD    . GLU A 1 117 ? -80.641 23.781 -19.708 1.00 91.61  ? 130  GLU A CD    1 
ATOM   734  O OE1   . GLU A 1 117 ? -81.633 23.850 -20.469 1.00 91.94  ? 130  GLU A OE1   1 
ATOM   735  O OE2   . GLU A 1 117 ? -79.772 24.678 -19.633 1.00 81.27  ? 130  GLU A OE2   1 
ATOM   736  N N     . GLU A 1 118 ? -81.525 18.103 -19.921 1.00 98.45  ? 131  GLU A N     1 
ATOM   737  C CA    . GLU A 1 118 ? -82.358 16.938 -20.239 1.00 99.45  ? 131  GLU A CA    1 
ATOM   738  C C     . GLU A 1 118 ? -82.276 15.896 -19.121 1.00 100.60 ? 131  GLU A C     1 
ATOM   739  O O     . GLU A 1 118 ? -83.298 15.363 -18.689 1.00 99.85  ? 131  GLU A O     1 
ATOM   740  C CB    . GLU A 1 118 ? -81.948 16.311 -21.574 1.00 96.44  ? 131  GLU A CB    1 
ATOM   741  N N     . VAL A 1 119 ? -81.059 15.619 -18.653 1.00 100.71 ? 132  VAL A N     1 
ATOM   742  C CA    . VAL A 1 119 ? -80.856 14.712 -17.521 1.00 98.92  ? 132  VAL A CA    1 
ATOM   743  C C     . VAL A 1 119 ? -81.438 15.298 -16.235 1.00 103.05 ? 132  VAL A C     1 
ATOM   744  O O     . VAL A 1 119 ? -81.926 14.560 -15.382 1.00 112.23 ? 132  VAL A O     1 
ATOM   745  C CB    . VAL A 1 119 ? -79.367 14.396 -17.297 1.00 92.78  ? 132  VAL A CB    1 
ATOM   746  N N     . THR A 1 120 ? -81.388 16.622 -16.103 1.00 104.09 ? 133  THR A N     1 
ATOM   747  C CA    . THR A 1 120 ? -82.006 17.304 -14.967 1.00 104.15 ? 133  THR A CA    1 
ATOM   748  C C     . THR A 1 120 ? -83.526 17.131 -14.994 1.00 113.17 ? 133  THR A C     1 
ATOM   749  O O     . THR A 1 120 ? -84.144 16.914 -13.952 1.00 126.20 ? 133  THR A O     1 
ATOM   750  C CB    . THR A 1 120 ? -81.641 18.805 -14.937 1.00 99.90  ? 133  THR A CB    1 
ATOM   751  O OG1   . THR A 1 120 ? -80.218 18.951 -14.836 1.00 99.27  ? 133  THR A OG1   1 
ATOM   752  C CG2   . THR A 1 120 ? -82.296 19.509 -13.755 1.00 98.33  ? 133  THR A CG2   1 
ATOM   753  N N     . LEU A 1 121 ? -84.118 17.213 -16.185 1.00 114.34 ? 134  LEU A N     1 
ATOM   754  C CA    . LEU A 1 121 ? -85.563 17.027 -16.345 1.00 121.30 ? 134  LEU A CA    1 
ATOM   755  C C     . LEU A 1 121 ? -85.978 15.574 -16.108 1.00 124.40 ? 134  LEU A C     1 
ATOM   756  O O     . LEU A 1 121 ? -86.902 15.305 -15.339 1.00 134.38 ? 134  LEU A O     1 
ATOM   757  C CB    . LEU A 1 121 ? -86.016 17.473 -17.739 1.00 119.22 ? 134  LEU A CB    1 
ATOM   758  N N     . GLN A 1 122 ? -85.289 14.645 -16.768 1.00 119.82 ? 135  GLN A N     1 
ATOM   759  C CA    . GLN A 1 122 ? -85.620 13.219 -16.684 1.00 116.69 ? 135  GLN A CA    1 
ATOM   760  C C     . GLN A 1 122 ? -85.268 12.610 -15.325 1.00 119.93 ? 135  GLN A C     1 
ATOM   761  O O     . GLN A 1 122 ? -86.082 11.901 -14.732 1.00 123.58 ? 135  GLN A O     1 
ATOM   762  C CB    . GLN A 1 122 ? -84.911 12.441 -17.797 1.00 111.58 ? 135  GLN A CB    1 
ATOM   763  N N     . THR A 1 123 ? -84.059 12.886 -14.838 1.00 119.70 ? 136  THR A N     1 
ATOM   764  C CA    . THR A 1 123 ? -83.586 12.314 -13.575 1.00 119.13 ? 136  THR A CA    1 
ATOM   765  C C     . THR A 1 123 ? -84.204 13.001 -12.360 1.00 120.28 ? 136  THR A C     1 
ATOM   766  O O     . THR A 1 123 ? -84.602 12.335 -11.406 1.00 122.89 ? 136  THR A O     1 
ATOM   767  C CB    . THR A 1 123 ? -82.053 12.397 -13.452 1.00 112.67 ? 136  THR A CB    1 
ATOM   768  N N     . GLY A 1 124 ? -84.273 14.330 -12.397 1.00 120.74 ? 137  GLY A N     1 
ATOM   769  C CA    . GLY A 1 124 ? -84.806 15.113 -11.282 1.00 118.83 ? 137  GLY A CA    1 
ATOM   770  C C     . GLY A 1 124 ? -83.728 15.887 -10.543 1.00 120.73 ? 137  GLY A C     1 
ATOM   771  O O     . GLY A 1 124 ? -83.962 17.015 -10.108 1.00 122.21 ? 137  GLY A O     1 
ATOM   772  N N     . ILE A 1 125 ? -82.550 15.280 -10.395 1.00 116.57 ? 138  ILE A N     1 
ATOM   773  C CA    . ILE A 1 125 ? -81.411 15.929 -9.742  1.00 114.10 ? 138  ILE A CA    1 
ATOM   774  C C     . ILE A 1 125 ? -80.664 16.828 -10.732 1.00 108.54 ? 138  ILE A C     1 
ATOM   775  O O     . ILE A 1 125 ? -80.477 16.460 -11.894 1.00 102.84 ? 138  ILE A O     1 
ATOM   776  C CB    . ILE A 1 125 ? -80.432 14.890 -9.161  1.00 114.35 ? 138  ILE A CB    1 
ATOM   777  N N     . LYS A 1 126 ? -80.232 17.998 -10.267 1.00 105.09 ? 139  LYS A N     1 
ATOM   778  C CA    . LYS A 1 126 ? -79.596 18.993 -11.137 1.00 106.83 ? 139  LYS A CA    1 
ATOM   779  C C     . LYS A 1 126 ? -78.195 18.575 -11.589 1.00 101.48 ? 139  LYS A C     1 
ATOM   780  O O     . LYS A 1 126 ? -77.445 17.953 -10.836 1.00 97.26  ? 139  LYS A O     1 
ATOM   781  C CB    . LYS A 1 126 ? -79.523 20.358 -10.437 1.00 112.30 ? 139  LYS A CB    1 
ATOM   782  C CG    . LYS A 1 126 ? -78.892 21.458 -11.282 1.00 113.63 ? 139  LYS A CG    1 
ATOM   783  C CD    . LYS A 1 126 ? -79.018 22.825 -10.634 1.00 119.31 ? 139  LYS A CD    1 
ATOM   784  C CE    . LYS A 1 126 ? -78.372 23.897 -11.498 1.00 122.68 ? 139  LYS A CE    1 
ATOM   785  N NZ    . LYS A 1 126 ? -78.439 25.244 -10.869 1.00 129.36 ? 139  LYS A NZ    1 
ATOM   786  N N     . ARG A 1 127 ? -77.858 18.940 -12.824 1.00 102.81 ? 140  ARG A N     1 
ATOM   787  C CA    . ARG A 1 127 ? -76.535 18.692 -13.398 1.00 104.46 ? 140  ARG A CA    1 
ATOM   788  C C     . ARG A 1 127 ? -75.784 20.008 -13.625 1.00 100.45 ? 140  ARG A C     1 
ATOM   789  O O     . ARG A 1 127 ? -76.399 21.067 -13.781 1.00 100.86 ? 140  ARG A O     1 
ATOM   790  C CB    . ARG A 1 127 ? -76.664 17.918 -14.713 1.00 103.62 ? 140  ARG A CB    1 
ATOM   791  C CG    . ARG A 1 127 ? -76.476 16.414 -14.585 1.00 103.46 ? 140  ARG A CG    1 
ATOM   792  C CD    . ARG A 1 127 ? -77.389 15.773 -13.555 1.00 104.45 ? 140  ARG A CD    1 
ATOM   793  N NE    . ARG A 1 127 ? -77.269 14.316 -13.595 1.00 107.43 ? 140  ARG A NE    1 
ATOM   794  C CZ    . ARG A 1 127 ? -78.075 13.465 -12.963 1.00 112.37 ? 140  ARG A CZ    1 
ATOM   795  N NH1   . ARG A 1 127 ? -79.087 13.905 -12.220 1.00 115.29 ? 140  ARG A NH1   1 
ATOM   796  N NH2   . ARG A 1 127 ? -77.868 12.157 -13.078 1.00 112.62 ? 140  ARG A NH2   1 
ATOM   797  N N     . PHE A 1 128 ? -74.455 19.926 -13.648 1.00 88.43  ? 141  PHE A N     1 
ATOM   798  C CA    . PHE A 1 128 ? -73.604 21.110 -13.740 1.00 90.58  ? 141  PHE A CA    1 
ATOM   799  C C     . PHE A 1 128 ? -72.643 21.041 -14.926 1.00 87.95  ? 141  PHE A C     1 
ATOM   800  O O     . PHE A 1 128 ? -72.123 19.973 -15.256 1.00 89.73  ? 141  PHE A O     1 
ATOM   801  C CB    . PHE A 1 128 ? -72.812 21.276 -12.443 1.00 84.01  ? 141  PHE A CB    1 
ATOM   802  C CG    . PHE A 1 128 ? -73.674 21.513 -11.237 1.00 87.77  ? 141  PHE A CG    1 
ATOM   803  C CD1   . PHE A 1 128 ? -74.088 22.796 -10.905 1.00 87.47  ? 141  PHE A CD1   1 
ATOM   804  C CD2   . PHE A 1 128 ? -74.077 20.454 -10.434 1.00 86.90  ? 141  PHE A CD2   1 
ATOM   805  C CE1   . PHE A 1 128 ? -74.880 23.020 -9.792  1.00 83.62  ? 141  PHE A CE1   1 
ATOM   806  C CE2   . PHE A 1 128 ? -74.870 20.672 -9.321  1.00 87.43  ? 141  PHE A CE2   1 
ATOM   807  C CZ    . PHE A 1 128 ? -75.270 21.957 -8.998  1.00 87.05  ? 141  PHE A CZ    1 
ATOM   808  N N     . VAL A 1 129 ? -72.409 22.189 -15.557 1.00 77.95  ? 142  VAL A N     1 
ATOM   809  C CA    . VAL A 1 129 ? -71.488 22.276 -16.686 1.00 85.99  ? 142  VAL A CA    1 
ATOM   810  C C     . VAL A 1 129 ? -70.164 22.876 -16.228 1.00 79.77  ? 142  VAL A C     1 
ATOM   811  O O     . VAL A 1 129 ? -70.127 24.000 -15.721 1.00 70.66  ? 142  VAL A O     1 
ATOM   812  C CB    . VAL A 1 129 ? -72.063 23.139 -17.827 1.00 84.30  ? 142  VAL A CB    1 
ATOM   813  N N     . ALA A 1 130 ? -69.084 22.116 -16.403 1.00 73.75  ? 143  ALA A N     1 
ATOM   814  C CA    . ALA A 1 130 ? -67.743 22.579 -16.071 1.00 68.58  ? 143  ALA A CA    1 
ATOM   815  C C     . ALA A 1 130 ? -67.041 23.088 -17.326 1.00 67.95  ? 143  ALA A C     1 
ATOM   816  O O     . ALA A 1 130 ? -66.935 22.367 -18.319 1.00 67.01  ? 143  ALA A O     1 
ATOM   817  C CB    . ALA A 1 130 ? -66.940 21.457 -15.435 1.00 73.00  ? 143  ALA A CB    1 
ATOM   818  N N     . GLY A 1 131 ? -66.575 24.334 -17.281 1.00 60.60  ? 144  GLY A N     1 
ATOM   819  C CA    . GLY A 1 131 ? -65.811 24.913 -18.378 1.00 59.69  ? 144  GLY A CA    1 
ATOM   820  C C     . GLY A 1 131 ? -64.361 24.470 -18.320 1.00 60.29  ? 144  GLY A C     1 
ATOM   821  O O     . GLY A 1 131 ? -63.593 24.942 -17.482 1.00 60.79  ? 144  GLY A O     1 
ATOM   822  N N     . ALA A 1 132 ? -63.980 23.560 -19.209 1.00 60.97  ? 145  ALA A N     1 
ATOM   823  C CA    . ALA A 1 132 ? -62.627 23.014 -19.197 1.00 60.31  ? 145  ALA A CA    1 
ATOM   824  C C     . ALA A 1 132 ? -61.636 23.955 -19.875 1.00 64.19  ? 145  ALA A C     1 
ATOM   825  O O     . ALA A 1 132 ? -61.759 24.247 -21.064 1.00 68.11  ? 145  ALA A O     1 
ATOM   826  C CB    . ALA A 1 132 ? -62.598 21.646 -19.866 1.00 62.75  ? 145  ALA A CB    1 
ATOM   827  N N     . LEU A 1 133 ? -60.669 24.441 -19.103 1.00 62.44  ? 146  LEU A N     1 
ATOM   828  C CA    . LEU A 1 133 ? -59.505 25.119 -19.650 1.00 55.59  ? 146  LEU A CA    1 
ATOM   829  C C     . LEU A 1 133 ? -58.315 24.172 -19.559 1.00 58.71  ? 146  LEU A C     1 
ATOM   830  O O     . LEU A 1 133 ? -58.044 23.611 -18.500 1.00 69.06  ? 146  LEU A O     1 
ATOM   831  C CB    . LEU A 1 133 ? -59.219 26.409 -18.890 1.00 58.14  ? 146  LEU A CB    1 
ATOM   832  C CG    . LEU A 1 133 ? -60.271 27.504 -19.083 1.00 62.70  ? 146  LEU A CG    1 
ATOM   833  C CD1   . LEU A 1 133 ? -61.338 27.426 -18.002 1.00 64.16  ? 146  LEU A CD1   1 
ATOM   834  C CD2   . LEU A 1 133 ? -59.621 28.877 -19.085 1.00 65.13  ? 146  LEU A CD2   1 
ATOM   835  N N     . GLY A 1 134 ? -57.620 23.989 -20.677 1.00 63.49  ? 147  GLY A N     1 
ATOM   836  C CA    . GLY A 1 134 ? -56.509 23.049 -20.764 1.00 59.65  ? 147  GLY A CA    1 
ATOM   837  C C     . GLY A 1 134 ? -55.168 23.748 -20.713 1.00 61.08  ? 147  GLY A C     1 
ATOM   838  O O     . GLY A 1 134 ? -55.108 24.973 -20.657 1.00 62.66  ? 147  GLY A O     1 
ATOM   839  N N     . PRO A 1 135 ? -54.075 22.970 -20.742 1.00 70.93  ? 148  PRO A N     1 
ATOM   840  C CA    . PRO A 1 135 ? -52.748 23.514 -20.474 1.00 71.65  ? 148  PRO A CA    1 
ATOM   841  C C     . PRO A 1 135 ? -52.044 24.128 -21.692 1.00 70.10  ? 148  PRO A C     1 
ATOM   842  O O     . PRO A 1 135 ? -51.129 24.939 -21.522 1.00 62.64  ? 148  PRO A O     1 
ATOM   843  C CB    . PRO A 1 135 ? -51.982 22.278 -19.996 1.00 68.04  ? 148  PRO A CB    1 
ATOM   844  C CG    . PRO A 1 135 ? -52.579 21.160 -20.789 1.00 65.30  ? 148  PRO A CG    1 
ATOM   845  C CD    . PRO A 1 135 ? -54.018 21.527 -21.049 1.00 69.42  ? 148  PRO A CD    1 
ATOM   846  N N     . THR A 1 136 ? -52.479 23.752 -22.896 1.00 74.90  ? 149  THR A N     1 
ATOM   847  C CA    . THR A 1 136 ? -51.727 23.987 -24.138 1.00 70.17  ? 149  THR A CA    1 
ATOM   848  C C     . THR A 1 136 ? -50.415 23.192 -24.107 1.00 81.22  ? 149  THR A C     1 
ATOM   849  O O     . THR A 1 136 ? -50.054 22.613 -23.079 1.00 86.86  ? 149  THR A O     1 
ATOM   850  C CB    . THR A 1 136 ? -51.438 25.490 -24.415 1.00 63.24  ? 149  THR A CB    1 
ATOM   851  O OG1   . THR A 1 136 ? -50.261 25.917 -23.715 1.00 58.56  ? 149  THR A OG1   1 
ATOM   852  C CG2   . THR A 1 136 ? -52.615 26.364 -24.020 1.00 58.03  ? 149  THR A CG2   1 
ATOM   853  N N     . ASN A 1 137 ? -49.714 23.160 -25.238 1.00 79.15  ? 150  ASN A N     1 
ATOM   854  C CA    . ASN A 1 137 ? -48.400 22.511 -25.312 1.00 75.32  ? 150  ASN A CA    1 
ATOM   855  C C     . ASN A 1 137 ? -47.247 23.433 -24.883 1.00 81.57  ? 150  ASN A C     1 
ATOM   856  O O     . ASN A 1 137 ? -46.110 22.979 -24.718 1.00 72.84  ? 150  ASN A O     1 
ATOM   857  C CB    . ASN A 1 137 ? -48.144 21.950 -26.714 1.00 77.99  ? 150  ASN A CB    1 
ATOM   858  C CG    . ASN A 1 137 ? -48.246 23.004 -27.802 1.00 90.74  ? 150  ASN A CG    1 
ATOM   859  O OD1   . ASN A 1 137 ? -49.147 23.843 -27.787 1.00 102.08 ? 150  ASN A OD1   1 
ATOM   860  N ND2   . ASN A 1 137 ? -47.334 22.951 -28.768 1.00 97.83  ? 150  ASN A ND2   1 
ATOM   861  N N     . LYS A 1 138 ? -47.545 24.719 -24.695 1.00 75.15  ? 151  LYS A N     1 
ATOM   862  C CA    . LYS A 1 138 ? -46.544 25.686 -24.250 1.00 69.25  ? 151  LYS A CA    1 
ATOM   863  C C     . LYS A 1 138 ? -46.288 25.572 -22.743 1.00 71.25  ? 151  LYS A C     1 
ATOM   864  O O     . LYS A 1 138 ? -47.226 25.438 -21.954 1.00 68.80  ? 151  LYS A O     1 
ATOM   865  C CB    . LYS A 1 138 ? -46.982 27.108 -24.604 1.00 55.84  ? 151  LYS A CB    1 
ATOM   866  N N     . THR A 1 139 ? -45.011 25.620 -22.362 1.00 71.04  ? 152  THR A N     1 
ATOM   867  C CA    . THR A 1 139 ? -44.587 25.549 -20.963 1.00 73.35  ? 152  THR A CA    1 
ATOM   868  C C     . THR A 1 139 ? -43.833 26.828 -20.588 1.00 78.99  ? 152  THR A C     1 
ATOM   869  O O     . THR A 1 139 ? -42.710 27.047 -21.047 1.00 96.84  ? 152  THR A O     1 
ATOM   870  C CB    . THR A 1 139 ? -43.668 24.337 -20.718 1.00 67.10  ? 152  THR A CB    1 
ATOM   871  N N     . LEU A 1 140 ? -44.453 27.664 -19.757 1.00 75.00  ? 153  LEU A N     1 
ATOM   872  C CA    . LEU A 1 140 ? -43.868 28.954 -19.366 1.00 88.15  ? 153  LEU A CA    1 
ATOM   873  C C     . LEU A 1 140 ? -42.753 28.829 -18.315 1.00 83.61  ? 153  LEU A C     1 
ATOM   874  O O     . LEU A 1 140 ? -41.981 29.770 -18.121 1.00 68.81  ? 153  LEU A O     1 
ATOM   875  C CB    . LEU A 1 140 ? -44.961 29.904 -18.853 1.00 84.73  ? 153  LEU A CB    1 
ATOM   876  N N     . SER A 1 141 ? -42.677 27.681 -17.642 1.00 86.42  ? 154  SER A N     1 
ATOM   877  C CA    . SER A 1 141 ? -41.657 27.436 -16.616 1.00 86.87  ? 154  SER A CA    1 
ATOM   878  C C     . SER A 1 141 ? -40.507 26.545 -17.113 1.00 91.65  ? 154  SER A C     1 
ATOM   879  O O     . SER A 1 141 ? -39.491 26.403 -16.424 1.00 84.59  ? 154  SER A O     1 
ATOM   880  C CB    . SER A 1 141 ? -42.302 26.820 -15.365 1.00 64.62  ? 154  SER A CB    1 
ATOM   881  N N     . VAL A 1 142 ? -40.661 25.954 -18.300 1.00 88.60  ? 155  VAL A N     1 
ATOM   882  C CA    . VAL A 1 142 ? -39.647 25.056 -18.863 1.00 91.71  ? 155  VAL A CA    1 
ATOM   883  C C     . VAL A 1 142 ? -39.303 25.440 -20.302 1.00 95.74  ? 155  VAL A C     1 
ATOM   884  O O     . VAL A 1 142 ? -40.195 25.634 -21.131 1.00 105.66 ? 155  VAL A O     1 
ATOM   885  C CB    . VAL A 1 142 ? -40.119 23.586 -18.838 1.00 75.25  ? 155  VAL A CB    1 
ATOM   886  N N     . SER A 1 143 ? -38.006 25.549 -20.588 1.00 101.01 ? 156  SER A N     1 
ATOM   887  C CA    . SER A 1 143 ? -37.516 25.841 -21.937 1.00 111.83 ? 156  SER A CA    1 
ATOM   888  C C     . SER A 1 143 ? -37.787 24.653 -22.872 1.00 114.80 ? 156  SER A C     1 
ATOM   889  O O     . SER A 1 143 ? -37.871 23.513 -22.409 1.00 114.07 ? 156  SER A O     1 
ATOM   890  C CB    . SER A 1 143 ? -36.010 26.136 -21.902 1.00 109.44 ? 156  SER A CB    1 
ATOM   891  O OG    . SER A 1 143 ? -35.517 26.516 -23.176 1.00 89.91  ? 156  SER A OG    1 
ATOM   892  N N     . PRO A 1 144 ? -37.934 24.915 -24.188 1.00 111.91 ? 157  PRO A N     1 
ATOM   893  C CA    . PRO A 1 144 ? -38.055 23.811 -25.151 1.00 112.72 ? 157  PRO A CA    1 
ATOM   894  C C     . PRO A 1 144 ? -36.799 22.933 -25.283 1.00 113.41 ? 157  PRO A C     1 
ATOM   895  O O     . PRO A 1 144 ? -36.896 21.800 -25.754 1.00 129.50 ? 157  PRO A O     1 
ATOM   896  C CB    . PRO A 1 144 ? -38.346 24.530 -26.475 1.00 115.28 ? 157  PRO A CB    1 
ATOM   897  C CG    . PRO A 1 144 ? -38.932 25.838 -26.078 1.00 119.03 ? 157  PRO A CG    1 
ATOM   898  C CD    . PRO A 1 144 ? -38.213 26.218 -24.819 1.00 112.68 ? 157  PRO A CD    1 
ATOM   899  N N     . SER A 1 145 ? -35.642 23.456 -24.881 1.00 112.85 ? 158  SER A N     1 
ATOM   900  C CA    . SER A 1 145 ? -34.389 22.701 -24.920 1.00 120.37 ? 158  SER A CA    1 
ATOM   901  C C     . SER A 1 145 ? -33.485 23.044 -23.735 1.00 116.45 ? 158  SER A C     1 
ATOM   902  O O     . SER A 1 145 ? -33.579 24.130 -23.158 1.00 102.22 ? 158  SER A O     1 
ATOM   903  C CB    . SER A 1 145 ? -33.648 22.976 -26.231 1.00 128.29 ? 158  SER A CB    1 
ATOM   904  N N     . VAL A 1 146 ? -32.607 22.108 -23.383 1.00 128.19 ? 159  VAL A N     1 
ATOM   905  C CA    . VAL A 1 146 ? -31.597 22.337 -22.349 1.00 127.49 ? 159  VAL A CA    1 
ATOM   906  C C     . VAL A 1 146 ? -30.414 23.163 -22.875 1.00 129.16 ? 159  VAL A C     1 
ATOM   907  O O     . VAL A 1 146 ? -29.594 23.638 -22.088 1.00 137.71 ? 159  VAL A O     1 
ATOM   908  C CB    . VAL A 1 146 ? -31.067 21.006 -21.782 1.00 126.20 ? 159  VAL A CB    1 
ATOM   909  N N     . GLU A 1 147 ? -30.327 23.324 -24.198 1.00 124.38 ? 160  GLU A N     1 
ATOM   910  C CA    . GLU A 1 147 ? -29.285 24.144 -24.826 1.00 119.55 ? 160  GLU A CA    1 
ATOM   911  C C     . GLU A 1 147 ? -29.441 25.628 -24.479 1.00 110.65 ? 160  GLU A C     1 
ATOM   912  O O     . GLU A 1 147 ? -28.475 26.283 -24.082 1.00 100.50 ? 160  GLU A O     1 
ATOM   913  C CB    . GLU A 1 147 ? -29.308 23.960 -26.348 1.00 111.68 ? 160  GLU A CB    1 
ATOM   914  N N     . ARG A 1 148 ? -30.659 26.144 -24.632 1.00 109.31 ? 161  ARG A N     1 
ATOM   915  C CA    . ARG A 1 148 ? -30.979 27.531 -24.298 1.00 96.86  ? 161  ARG A CA    1 
ATOM   916  C C     . ARG A 1 148 ? -31.976 27.573 -23.130 1.00 93.91  ? 161  ARG A C     1 
ATOM   917  O O     . ARG A 1 148 ? -33.179 27.729 -23.342 1.00 111.09 ? 161  ARG A O     1 
ATOM   918  C CB    . ARG A 1 148 ? -31.553 28.246 -25.526 1.00 87.00  ? 161  ARG A CB    1 
ATOM   919  N N     . PRO A 1 149 ? -31.475 27.433 -21.887 1.00 92.85  ? 162  PRO A N     1 
ATOM   920  C CA    . PRO A 1 149 ? -32.352 27.380 -20.712 1.00 88.68  ? 162  PRO A CA    1 
ATOM   921  C C     . PRO A 1 149 ? -32.966 28.720 -20.291 1.00 90.83  ? 162  PRO A C     1 
ATOM   922  O O     . PRO A 1 149 ? -33.863 28.737 -19.448 1.00 80.97  ? 162  PRO A O     1 
ATOM   923  C CB    . PRO A 1 149 ? -31.429 26.844 -19.612 1.00 84.42  ? 162  PRO A CB    1 
ATOM   924  C CG    . PRO A 1 149 ? -30.064 27.260 -20.028 1.00 87.85  ? 162  PRO A CG    1 
ATOM   925  C CD    . PRO A 1 149 ? -30.060 27.226 -21.524 1.00 99.62  ? 162  PRO A CD    1 
ATOM   926  N N     . ASP A 1 150 ? -32.482 29.825 -20.856 1.00 103.61 ? 163  ASP A N     1 
ATOM   927  C CA    . ASP A 1 150 ? -33.051 31.151 -20.597 1.00 96.76  ? 163  ASP A CA    1 
ATOM   928  C C     . ASP A 1 150 ? -34.318 31.399 -21.423 1.00 97.10  ? 163  ASP A C     1 
ATOM   929  O O     . ASP A 1 150 ? -35.180 32.192 -21.035 1.00 81.20  ? 163  ASP A O     1 
ATOM   930  C CB    . ASP A 1 150 ? -32.018 32.237 -20.917 1.00 94.59  ? 163  ASP A CB    1 
ATOM   931  N N     . TYR A 1 151 ? -34.423 30.698 -22.550 1.00 89.05  ? 164  TYR A N     1 
ATOM   932  C CA    . TYR A 1 151 ? -35.431 30.971 -23.576 1.00 86.04  ? 164  TYR A CA    1 
ATOM   933  C C     . TYR A 1 151 ? -36.800 30.352 -23.249 1.00 88.69  ? 164  TYR A C     1 
ATOM   934  O O     . TYR A 1 151 ? -36.882 29.340 -22.547 1.00 78.29  ? 164  TYR A O     1 
ATOM   935  C CB    . TYR A 1 151 ? -34.883 30.484 -24.927 1.00 95.66  ? 164  TYR A CB    1 
ATOM   936  C CG    . TYR A 1 151 ? -35.887 30.228 -26.027 1.00 102.83 ? 164  TYR A CG    1 
ATOM   937  C CD1   . TYR A 1 151 ? -36.583 31.275 -26.630 1.00 103.25 ? 164  TYR A CD1   1 
ATOM   938  C CD2   . TYR A 1 151 ? -36.105 28.935 -26.501 1.00 111.07 ? 164  TYR A CD2   1 
ATOM   939  C CE1   . TYR A 1 151 ? -37.488 31.036 -27.653 1.00 109.61 ? 164  TYR A CE1   1 
ATOM   940  C CE2   . TYR A 1 151 ? -37.005 28.686 -27.522 1.00 121.53 ? 164  TYR A CE2   1 
ATOM   941  C CZ    . TYR A 1 151 ? -37.695 29.737 -28.096 1.00 120.50 ? 164  TYR A CZ    1 
ATOM   942  O OH    . TYR A 1 151 ? -38.589 29.484 -29.113 1.00 104.07 ? 164  TYR A OH    1 
ATOM   943  N N     . ARG A 1 152 ? -37.865 30.995 -23.736 1.00 84.24  ? 165  ARG A N     1 
ATOM   944  C CA    . ARG A 1 152 ? -39.240 30.504 -23.581 1.00 80.39  ? 165  ARG A CA    1 
ATOM   945  C C     . ARG A 1 152 ? -40.051 30.686 -24.870 1.00 95.70  ? 165  ARG A C     1 
ATOM   946  O O     . ARG A 1 152 ? -39.806 31.614 -25.646 1.00 85.99  ? 165  ARG A O     1 
ATOM   947  C CB    . ARG A 1 152 ? -39.948 31.233 -22.439 1.00 67.58  ? 165  ARG A CB    1 
ATOM   948  C CG    . ARG A 1 152 ? -39.360 30.983 -21.061 1.00 63.63  ? 165  ARG A CG    1 
ATOM   949  C CD    . ARG A 1 152 ? -39.662 29.585 -20.545 1.00 62.56  ? 165  ARG A CD    1 
ATOM   950  N NE    . ARG A 1 152 ? -39.116 29.386 -19.200 1.00 64.67  ? 165  ARG A NE    1 
ATOM   951  C CZ    . ARG A 1 152 ? -37.868 28.998 -18.924 1.00 66.48  ? 165  ARG A CZ    1 
ATOM   952  N NH1   . ARG A 1 152 ? -36.990 28.747 -19.895 1.00 69.73  ? 165  ARG A NH1   1 
ATOM   953  N NH2   . ARG A 1 152 ? -37.492 28.861 -17.657 1.00 58.46  ? 165  ARG A NH2   1 
ATOM   954  N N     . ASN A 1 153 ? -41.023 29.800 -25.079 1.00 108.20 ? 166  ASN A N     1 
ATOM   955  C CA    . ASN A 1 153 ? -41.862 29.824 -26.280 1.00 109.31 ? 166  ASN A CA    1 
ATOM   956  C C     . ASN A 1 153 ? -42.973 30.869 -26.182 1.00 94.78  ? 166  ASN A C     1 
ATOM   957  O O     . ASN A 1 153 ? -43.098 31.728 -27.057 1.00 110.95 ? 166  ASN A O     1 
ATOM   958  C CB    . ASN A 1 153 ? -42.466 28.439 -26.539 1.00 103.36 ? 166  ASN A CB    1 
ATOM   959  N N     . ILE A 1 154 ? -43.772 30.784 -25.117 1.00 72.40  ? 167  ILE A N     1 
ATOM   960  C CA    . ILE A 1 154 ? -44.866 31.725 -24.863 1.00 72.79  ? 167  ILE A CA    1 
ATOM   961  C C     . ILE A 1 154 ? -44.563 32.608 -23.658 1.00 71.48  ? 167  ILE A C     1 
ATOM   962  O O     . ILE A 1 154 ? -43.683 32.295 -22.854 1.00 89.98  ? 167  ILE A O     1 
ATOM   963  C CB    . ILE A 1 154 ? -46.197 30.989 -24.593 1.00 59.89  ? 167  ILE A CB    1 
ATOM   964  N N     . THR A 1 155 ? -45.308 33.706 -23.539 1.00 66.19  ? 168  THR A N     1 
ATOM   965  C CA    . THR A 1 155 ? -45.214 34.605 -22.387 1.00 56.27  ? 168  THR A CA    1 
ATOM   966  C C     . THR A 1 155 ? -46.498 34.580 -21.556 1.00 51.72  ? 168  THR A C     1 
ATOM   967  O O     . THR A 1 155 ? -47.556 34.140 -22.020 1.00 59.05  ? 168  THR A O     1 
ATOM   968  C CB    . THR A 1 155 ? -44.926 36.057 -22.826 1.00 68.40  ? 168  THR A CB    1 
ATOM   969  O OG1   . THR A 1 155 ? -45.863 36.461 -23.835 1.00 73.40  ? 168  THR A OG1   1 
ATOM   970  C CG2   . THR A 1 155 ? -43.516 36.181 -23.381 1.00 66.06  ? 168  THR A CG2   1 
ATOM   971  N N     . PHE A 1 156 ? -46.386 35.053 -20.319 1.00 48.46  ? 169  PHE A N     1 
ATOM   972  C CA    . PHE A 1 156 ? -47.517 35.163 -19.400 1.00 47.79  ? 169  PHE A CA    1 
ATOM   973  C C     . PHE A 1 156 ? -48.695 35.897 -20.055 1.00 56.28  ? 169  PHE A C     1 
ATOM   974  O O     . PHE A 1 156 ? -49.820 35.396 -20.076 1.00 60.05  ? 169  PHE A O     1 
ATOM   975  C CB    . PHE A 1 156 ? -47.073 35.912 -18.140 1.00 49.11  ? 169  PHE A CB    1 
ATOM   976  C CG    . PHE A 1 156 ? -48.032 35.805 -16.983 1.00 50.82  ? 169  PHE A CG    1 
ATOM   977  C CD1   . PHE A 1 156 ? -47.947 34.742 -16.088 1.00 50.76  ? 169  PHE A CD1   1 
ATOM   978  C CD2   . PHE A 1 156 ? -48.991 36.787 -16.762 1.00 47.22  ? 169  PHE A CD2   1 
ATOM   979  C CE1   . PHE A 1 156 ? -48.818 34.643 -15.013 1.00 53.34  ? 169  PHE A CE1   1 
ATOM   980  C CE2   . PHE A 1 156 ? -49.862 36.699 -15.684 1.00 54.66  ? 169  PHE A CE2   1 
ATOM   981  C CZ    . PHE A 1 156 ? -49.774 35.627 -14.805 1.00 50.92  ? 169  PHE A CZ    1 
ATOM   982  N N     . ASP A 1 157 ? -48.419 37.073 -20.609 1.00 53.90  ? 170  ASP A N     1 
ATOM   983  C CA    . ASP A 1 157 ? -49.462 37.932 -21.161 1.00 60.22  ? 170  ASP A CA    1 
ATOM   984  C C     . ASP A 1 157 ? -50.101 37.304 -22.404 1.00 64.54  ? 170  ASP A C     1 
ATOM   985  O O     . ASP A 1 157 ? -51.308 37.448 -22.627 1.00 55.98  ? 170  ASP A O     1 
ATOM   986  C CB    . ASP A 1 157 ? -48.909 39.332 -21.469 1.00 69.83  ? 170  ASP A CB    1 
ATOM   987  C CG    . ASP A 1 157 ? -48.260 39.992 -20.249 1.00 81.39  ? 170  ASP A CG    1 
ATOM   988  O OD1   . ASP A 1 157 ? -47.044 39.789 -20.036 1.00 88.31  ? 170  ASP A OD1   1 
ATOM   989  O OD2   . ASP A 1 157 ? -48.961 40.712 -19.505 1.00 72.34  ? 170  ASP A OD2   1 
ATOM   990  N N     . GLU A 1 158 ? -49.298 36.594 -23.196 1.00 64.56  ? 171  GLU A N     1 
ATOM   991  C CA    . GLU A 1 158 ? -49.821 35.845 -24.343 1.00 65.40  ? 171  GLU A CA    1 
ATOM   992  C C     . GLU A 1 158 ? -50.776 34.737 -23.898 1.00 61.26  ? 171  GLU A C     1 
ATOM   993  O O     . GLU A 1 158 ? -51.803 34.513 -24.543 1.00 64.83  ? 171  GLU A O     1 
ATOM   994  C CB    . GLU A 1 158 ? -48.683 35.264 -25.189 1.00 70.94  ? 171  GLU A CB    1 
ATOM   995  C CG    . GLU A 1 158 ? -48.021 36.290 -26.098 1.00 75.94  ? 171  GLU A CG    1 
ATOM   996  C CD    . GLU A 1 158 ? -46.721 35.810 -26.722 1.00 71.76  ? 171  GLU A CD    1 
ATOM   997  O OE1   . GLU A 1 158 ? -45.986 35.020 -26.089 1.00 67.82  ? 171  GLU A OE1   1 
ATOM   998  O OE2   . GLU A 1 158 ? -46.420 36.249 -27.849 1.00 81.57  ? 171  GLU A OE2   1 
ATOM   999  N N     . LEU A 1 159 ? -50.442 34.060 -22.797 1.00 56.35  ? 172  LEU A N     1 
ATOM   1000 C CA    . LEU A 1 159 ? -51.306 33.011 -22.236 1.00 58.81  ? 172  LEU A CA    1 
ATOM   1001 C C     . LEU A 1 159 ? -52.563 33.582 -21.603 1.00 50.93  ? 172  LEU A C     1 
ATOM   1002 O O     . LEU A 1 159 ? -53.644 33.026 -21.751 1.00 56.22  ? 172  LEU A O     1 
ATOM   1003 C CB    . LEU A 1 159 ? -50.561 32.181 -21.190 1.00 71.93  ? 172  LEU A CB    1 
ATOM   1004 C CG    . LEU A 1 159 ? -49.647 31.088 -21.739 1.00 83.69  ? 172  LEU A CG    1 
ATOM   1005 C CD1   . LEU A 1 159 ? -48.774 30.534 -20.623 1.00 83.26  ? 172  LEU A CD1   1 
ATOM   1006 C CD2   . LEU A 1 159 ? -50.464 29.984 -22.399 1.00 76.61  ? 172  LEU A CD2   1 
ATOM   1007 N N     . VAL A 1 160 ? -52.412 34.686 -20.883 1.00 47.43  ? 173  VAL A N     1 
ATOM   1008 C CA    . VAL A 1 160 ? -53.552 35.372 -20.292 1.00 51.03  ? 173  VAL A CA    1 
ATOM   1009 C C     . VAL A 1 160 ? -54.563 35.752 -21.380 1.00 50.37  ? 173  VAL A C     1 
ATOM   1010 O O     . VAL A 1 160 ? -55.745 35.444 -21.260 1.00 52.36  ? 173  VAL A O     1 
ATOM   1011 C CB    . VAL A 1 160 ? -53.093 36.604 -19.480 1.00 52.07  ? 173  VAL A CB    1 
ATOM   1012 C CG1   . VAL A 1 160 ? -54.256 37.530 -19.147 1.00 54.02  ? 173  VAL A CG1   1 
ATOM   1013 C CG2   . VAL A 1 160 ? -52.406 36.151 -18.202 1.00 52.44  ? 173  VAL A CG2   1 
ATOM   1014 N N     . GLU A 1 161 ? -54.097 36.395 -22.445 1.00 51.27  ? 174  GLU A N     1 
ATOM   1015 C CA    . GLU A 1 161 ? -54.982 36.777 -23.551 1.00 58.45  ? 174  GLU A CA    1 
ATOM   1016 C C     . GLU A 1 161 ? -55.807 35.585 -24.046 1.00 56.10  ? 174  GLU A C     1 
ATOM   1017 O O     . GLU A 1 161 ? -57.031 35.666 -24.150 1.00 59.56  ? 174  GLU A O     1 
ATOM   1018 C CB    . GLU A 1 161 ? -54.182 37.383 -24.713 1.00 49.33  ? 174  GLU A CB    1 
ATOM   1019 N N     . ALA A 1 162 ? -55.130 34.477 -24.328 1.00 57.90  ? 175  ALA A N     1 
ATOM   1020 C CA    . ALA A 1 162 ? -55.779 33.288 -24.884 1.00 63.29  ? 175  ALA A CA    1 
ATOM   1021 C C     . ALA A 1 162 ? -56.798 32.687 -23.919 1.00 60.74  ? 175  ALA A C     1 
ATOM   1022 O O     . ALA A 1 162 ? -57.938 32.410 -24.302 1.00 61.97  ? 175  ALA A O     1 
ATOM   1023 C CB    . ALA A 1 162 ? -54.732 32.247 -25.254 1.00 61.11  ? 175  ALA A CB    1 
ATOM   1024 N N     . TYR A 1 163 ? -56.372 32.485 -22.673 1.00 53.45  ? 176  TYR A N     1 
ATOM   1025 C CA    . TYR A 1 163 ? -57.244 31.967 -21.623 1.00 52.94  ? 176  TYR A CA    1 
ATOM   1026 C C     . TYR A 1 163 ? -58.436 32.882 -21.372 1.00 60.42  ? 176  TYR A C     1 
ATOM   1027 O O     . TYR A 1 163 ? -59.540 32.406 -21.096 1.00 63.50  ? 176  TYR A O     1 
ATOM   1028 C CB    . TYR A 1 163 ? -56.473 31.791 -20.311 1.00 53.26  ? 176  TYR A CB    1 
ATOM   1029 C CG    . TYR A 1 163 ? -55.654 30.517 -20.208 1.00 56.15  ? 176  TYR A CG    1 
ATOM   1030 C CD1   . TYR A 1 163 ? -56.198 29.285 -20.550 1.00 52.86  ? 176  TYR A CD1   1 
ATOM   1031 C CD2   . TYR A 1 163 ? -54.346 30.542 -19.725 1.00 54.93  ? 176  TYR A CD2   1 
ATOM   1032 C CE1   . TYR A 1 163 ? -55.463 28.124 -20.443 1.00 59.05  ? 176  TYR A CE1   1 
ATOM   1033 C CE2   . TYR A 1 163 ? -53.603 29.381 -19.611 1.00 53.72  ? 176  TYR A CE2   1 
ATOM   1034 C CZ    . TYR A 1 163 ? -54.168 28.173 -19.966 1.00 59.21  ? 176  TYR A CZ    1 
ATOM   1035 O OH    . TYR A 1 163 ? -53.441 27.009 -19.853 1.00 56.90  ? 176  TYR A OH    1 
ATOM   1036 N N     . GLN A 1 164 ? -58.206 34.190 -21.470 1.00 52.51  ? 177  GLN A N     1 
ATOM   1037 C CA    . GLN A 1 164 ? -59.263 35.176 -21.260 1.00 54.94  ? 177  GLN A CA    1 
ATOM   1038 C C     . GLN A 1 164 ? -60.363 35.011 -22.299 1.00 53.38  ? 177  GLN A C     1 
ATOM   1039 O O     . GLN A 1 164 ? -61.551 35.103 -21.982 1.00 54.34  ? 177  GLN A O     1 
ATOM   1040 C CB    . GLN A 1 164 ? -58.693 36.601 -21.294 1.00 54.60  ? 177  GLN A CB    1 
ATOM   1041 C CG    . GLN A 1 164 ? -59.503 37.616 -20.499 1.00 59.86  ? 177  GLN A CG    1 
ATOM   1042 C CD    . GLN A 1 164 ? -58.739 38.899 -20.203 1.00 62.16  ? 177  GLN A CD    1 
ATOM   1043 O OE1   . GLN A 1 164 ? -57.537 38.876 -19.921 1.00 65.89  ? 177  GLN A OE1   1 
ATOM   1044 N NE2   . GLN A 1 164 ? -59.442 40.028 -20.252 1.00 49.54  ? 177  GLN A NE2   1 
ATOM   1045 N N     . GLU A 1 165 ? -59.953 34.740 -23.533 1.00 59.90  ? 178  GLU A N     1 
ATOM   1046 C CA    . GLU A 1 165 ? -60.881 34.574 -24.646 1.00 64.90  ? 178  GLU A CA    1 
ATOM   1047 C C     . GLU A 1 165 ? -61.682 33.288 -24.507 1.00 62.93  ? 178  GLU A C     1 
ATOM   1048 O O     . GLU A 1 165 ? -62.901 33.295 -24.670 1.00 66.02  ? 178  GLU A O     1 
ATOM   1049 C CB    . GLU A 1 165 ? -60.111 34.566 -25.960 1.00 75.27  ? 178  GLU A CB    1 
ATOM   1050 C CG    . GLU A 1 165 ? -60.987 34.620 -27.193 1.00 82.45  ? 178  GLU A CG    1 
ATOM   1051 C CD    . GLU A 1 165 ? -60.196 34.945 -28.437 1.00 93.76  ? 178  GLU A CD    1 
ATOM   1052 O OE1   . GLU A 1 165 ? -58.989 34.612 -28.477 1.00 84.77  ? 178  GLU A OE1   1 
ATOM   1053 O OE2   . GLU A 1 165 ? -60.784 35.535 -29.368 1.00 117.42 ? 178  GLU A OE2   1 
ATOM   1054 N N     . GLN A 1 166 ? -60.994 32.188 -24.211 1.00 60.96  ? 179  GLN A N     1 
ATOM   1055 C CA    . GLN A 1 166 ? -61.668 30.924 -23.895 1.00 58.88  ? 179  GLN A CA    1 
ATOM   1056 C C     . GLN A 1 166 ? -62.661 31.105 -22.745 1.00 58.86  ? 179  GLN A C     1 
ATOM   1057 O O     . GLN A 1 166 ? -63.799 30.653 -22.832 1.00 64.72  ? 179  GLN A O     1 
ATOM   1058 C CB    . GLN A 1 166 ? -60.646 29.833 -23.553 1.00 59.39  ? 179  GLN A CB    1 
ATOM   1059 C CG    . GLN A 1 166 ? -61.186 28.689 -22.704 1.00 61.47  ? 179  GLN A CG    1 
ATOM   1060 C CD    . GLN A 1 166 ? -60.408 27.400 -22.887 1.00 62.45  ? 179  GLN A CD    1 
ATOM   1061 O OE1   . GLN A 1 166 ? -59.196 27.343 -22.651 1.00 53.01  ? 179  GLN A OE1   1 
ATOM   1062 N NE2   . GLN A 1 166 ? -61.103 26.352 -23.309 1.00 62.17  ? 179  GLN A NE2   1 
ATOM   1063 N N     . ALA A 1 167 ? -62.227 31.772 -21.678 1.00 60.16  ? 180  ALA A N     1 
ATOM   1064 C CA    . ALA A 1 167 ? -63.082 32.017 -20.513 1.00 64.44  ? 180  ALA A CA    1 
ATOM   1065 C C     . ALA A 1 167 ? -64.367 32.752 -20.887 1.00 66.45  ? 180  ALA A C     1 
ATOM   1066 O O     . ALA A 1 167 ? -65.454 32.316 -20.511 1.00 70.68  ? 180  ALA A O     1 
ATOM   1067 C CB    . ALA A 1 167 ? -62.324 32.795 -19.448 1.00 69.61  ? 180  ALA A CB    1 
ATOM   1068 N N     . LYS A 1 168 ? -64.240 33.856 -21.627 1.00 61.77  ? 181  LYS A N     1 
ATOM   1069 C CA    . LYS A 1 168 ? -65.407 34.614 -22.087 1.00 61.20  ? 181  LYS A CA    1 
ATOM   1070 C C     . LYS A 1 168 ? -66.442 33.672 -22.680 1.00 66.69  ? 181  LYS A C     1 
ATOM   1071 O O     . LYS A 1 168 ? -67.593 33.633 -22.235 1.00 71.33  ? 181  LYS A O     1 
ATOM   1072 C CB    . LYS A 1 168 ? -65.019 35.648 -23.149 1.00 69.20  ? 181  LYS A CB    1 
ATOM   1073 C CG    . LYS A 1 168 ? -64.449 36.945 -22.607 1.00 71.49  ? 181  LYS A CG    1 
ATOM   1074 C CD    . LYS A 1 168 ? -64.130 37.910 -23.740 1.00 68.92  ? 181  LYS A CD    1 
ATOM   1075 C CE    . LYS A 1 168 ? -63.767 39.298 -23.227 1.00 91.70  ? 181  LYS A CE    1 
ATOM   1076 N NZ    . LYS A 1 168 ? -62.446 39.373 -22.534 1.00 100.18 ? 181  LYS A NZ    1 
ATOM   1077 N N     . GLY A 1 169 ? -66.012 32.904 -23.675 1.00 64.38  ? 182  GLY A N     1 
ATOM   1078 C CA    . GLY A 1 169 ? -66.890 31.985 -24.390 1.00 66.80  ? 182  GLY A CA    1 
ATOM   1079 C C     . GLY A 1 169 ? -67.617 31.015 -23.483 1.00 70.75  ? 182  GLY A C     1 
ATOM   1080 O O     . GLY A 1 169 ? -68.823 30.806 -23.634 1.00 77.52  ? 182  GLY A O     1 
ATOM   1081 N N     . LEU A 1 170 ? -66.888 30.424 -22.537 1.00 72.04  ? 183  LEU A N     1 
ATOM   1082 C CA    . LEU A 1 170 ? -67.478 29.449 -21.621 1.00 71.77  ? 183  LEU A CA    1 
ATOM   1083 C C     . LEU A 1 170 ? -68.539 30.115 -20.753 1.00 68.86  ? 183  LEU A C     1 
ATOM   1084 O O     . LEU A 1 170 ? -69.675 29.643 -20.684 1.00 67.49  ? 183  LEU A O     1 
ATOM   1085 C CB    . LEU A 1 170 ? -66.407 28.799 -20.739 1.00 71.55  ? 183  LEU A CB    1 
ATOM   1086 C CG    . LEU A 1 170 ? -65.365 27.935 -21.456 1.00 72.61  ? 183  LEU A CG    1 
ATOM   1087 C CD1   . LEU A 1 170 ? -64.215 27.583 -20.519 1.00 71.24  ? 183  LEU A CD1   1 
ATOM   1088 C CD2   . LEU A 1 170 ? -65.997 26.679 -22.034 1.00 67.78  ? 183  LEU A CD2   1 
ATOM   1089 N N     . LEU A 1 171 ? -68.166 31.223 -20.117 1.00 61.99  ? 184  LEU A N     1 
ATOM   1090 C CA    . LEU A 1 171 ? -69.069 31.940 -19.216 1.00 67.45  ? 184  LEU A CA    1 
ATOM   1091 C C     . LEU A 1 171 ? -70.315 32.421 -19.950 1.00 66.88  ? 184  LEU A C     1 
ATOM   1092 O O     . LEU A 1 171 ? -71.434 32.227 -19.470 1.00 65.02  ? 184  LEU A O     1 
ATOM   1093 C CB    . LEU A 1 171 ? -68.348 33.117 -18.545 1.00 64.14  ? 184  LEU A CB    1 
ATOM   1094 C CG    . LEU A 1 171 ? -67.245 32.701 -17.563 1.00 62.28  ? 184  LEU A CG    1 
ATOM   1095 C CD1   . LEU A 1 171 ? -66.449 33.905 -17.080 1.00 62.98  ? 184  LEU A CD1   1 
ATOM   1096 C CD2   . LEU A 1 171 ? -67.828 31.933 -16.385 1.00 60.99  ? 184  LEU A CD2   1 
ATOM   1097 N N     . ASP A 1 172 ? -70.115 33.021 -21.121 1.00 65.35  ? 185  ASP A N     1 
ATOM   1098 C CA    . ASP A 1 172 ? -71.221 33.405 -21.996 1.00 63.38  ? 185  ASP A CA    1 
ATOM   1099 C C     . ASP A 1 172 ? -72.043 32.180 -22.369 1.00 65.19  ? 185  ASP A C     1 
ATOM   1100 O O     . ASP A 1 172 ? -73.270 32.245 -22.419 1.00 77.43  ? 185  ASP A O     1 
ATOM   1101 C CB    . ASP A 1 172 ? -70.697 34.078 -23.271 1.00 66.30  ? 185  ASP A CB    1 
ATOM   1102 C CG    . ASP A 1 172 ? -70.020 35.412 -23.001 1.00 66.40  ? 185  ASP A CG    1 
ATOM   1103 O OD1   . ASP A 1 172 ? -70.085 35.905 -21.855 1.00 74.46  ? 185  ASP A OD1   1 
ATOM   1104 O OD2   . ASP A 1 172 ? -69.415 35.968 -23.939 1.00 63.55  ? 185  ASP A OD2   1 
ATOM   1105 N N     . GLY A 1 173 ? -71.359 31.066 -22.624 1.00 66.57  ? 186  GLY A N     1 
ATOM   1106 C CA    . GLY A 1 173 ? -72.012 29.781 -22.874 1.00 66.98  ? 186  GLY A CA    1 
ATOM   1107 C C     . GLY A 1 173 ? -72.717 29.193 -21.659 1.00 71.31  ? 186  GLY A C     1 
ATOM   1108 O O     . GLY A 1 173 ? -73.393 28.171 -21.769 1.00 74.69  ? 186  GLY A O     1 
ATOM   1109 N N     . GLY A 1 174 ? -72.533 29.818 -20.496 1.00 71.90  ? 187  GLY A N     1 
ATOM   1110 C CA    . GLY A 1 174 ? -73.323 29.520 -19.306 1.00 72.20  ? 187  GLY A CA    1 
ATOM   1111 C C     . GLY A 1 174 ? -72.834 28.331 -18.504 1.00 71.96  ? 187  GLY A C     1 
ATOM   1112 O O     . GLY A 1 174 ? -73.625 27.476 -18.104 1.00 77.08  ? 187  GLY A O     1 
ATOM   1113 N N     . VAL A 1 175 ? -71.530 28.274 -18.262 1.00 75.80  ? 188  VAL A N     1 
ATOM   1114 C CA    . VAL A 1 175 ? -70.962 27.215 -17.439 1.00 71.62  ? 188  VAL A CA    1 
ATOM   1115 C C     . VAL A 1 175 ? -71.106 27.599 -15.976 1.00 78.39  ? 188  VAL A C     1 
ATOM   1116 O O     . VAL A 1 175 ? -71.179 28.785 -15.643 1.00 87.32  ? 188  VAL A O     1 
ATOM   1117 C CB    . VAL A 1 175 ? -69.484 26.929 -17.775 1.00 73.71  ? 188  VAL A CB    1 
ATOM   1118 C CG1   . VAL A 1 175 ? -69.337 26.567 -19.249 1.00 71.35  ? 188  VAL A CG1   1 
ATOM   1119 C CG2   . VAL A 1 175 ? -68.586 28.102 -17.391 1.00 74.28  ? 188  VAL A CG2   1 
ATOM   1120 N N     . ASP A 1 176 ? -71.158 26.584 -15.116 1.00 80.88  ? 189  ASP A N     1 
ATOM   1121 C CA    . ASP A 1 176 ? -71.366 26.765 -13.679 1.00 75.77  ? 189  ASP A CA    1 
ATOM   1122 C C     . ASP A 1 176 ? -70.071 26.691 -12.887 1.00 76.47  ? 189  ASP A C     1 
ATOM   1123 O O     . ASP A 1 176 ? -70.027 27.128 -11.738 1.00 81.06  ? 189  ASP A O     1 
ATOM   1124 C CB    . ASP A 1 176 ? -72.327 25.697 -13.159 1.00 77.46  ? 189  ASP A CB    1 
ATOM   1125 C CG    . ASP A 1 176 ? -73.668 25.751 -13.844 1.00 76.35  ? 189  ASP A CG    1 
ATOM   1126 O OD1   . ASP A 1 176 ? -74.333 26.805 -13.747 1.00 74.31  ? 189  ASP A OD1   1 
ATOM   1127 O OD2   . ASP A 1 176 ? -74.050 24.744 -14.481 1.00 77.52  ? 189  ASP A OD2   1 
ATOM   1128 N N     . ILE A 1 177 ? -69.030 26.124 -13.494 1.00 79.49  ? 190  ILE A N     1 
ATOM   1129 C CA    . ILE A 1 177 ? -67.725 25.998 -12.854 1.00 79.26  ? 190  ILE A CA    1 
ATOM   1130 C C     . ILE A 1 177 ? -66.624 26.078 -13.903 1.00 74.32  ? 190  ILE A C     1 
ATOM   1131 O O     . ILE A 1 177 ? -66.708 25.432 -14.945 1.00 68.79  ? 190  ILE A O     1 
ATOM   1132 C CB    . ILE A 1 177 ? -67.599 24.660 -12.097 1.00 72.34  ? 190  ILE A CB    1 
ATOM   1133 N N     . LEU A 1 178 ? -65.598 26.879 -13.630 1.00 80.32  ? 191  LEU A N     1 
ATOM   1134 C CA    . LEU A 1 178 ? -64.429 26.955 -14.502 1.00 72.75  ? 191  LEU A CA    1 
ATOM   1135 C C     . LEU A 1 178 ? -63.375 25.976 -13.996 1.00 70.76  ? 191  LEU A C     1 
ATOM   1136 O O     . LEU A 1 178 ? -62.978 26.032 -12.834 1.00 72.32  ? 191  LEU A O     1 
ATOM   1137 C CB    . LEU A 1 178 ? -63.883 28.382 -14.544 1.00 76.82  ? 191  LEU A CB    1 
ATOM   1138 C CG    . LEU A 1 178 ? -64.823 29.383 -15.228 1.00 83.12  ? 191  LEU A CG    1 
ATOM   1139 C CD1   . LEU A 1 178 ? -64.488 30.809 -14.823 1.00 89.91  ? 191  LEU A CD1   1 
ATOM   1140 C CD2   . LEU A 1 178 ? -64.778 29.224 -16.740 1.00 83.33  ? 191  LEU A CD2   1 
ATOM   1141 N N     . LEU A 1 179 ? -62.935 25.078 -14.874 1.00 67.68  ? 192  LEU A N     1 
ATOM   1142 C CA    . LEU A 1 179 ? -62.075 23.963 -14.494 1.00 65.45  ? 192  LEU A CA    1 
ATOM   1143 C C     . LEU A 1 179 ? -60.729 24.032 -15.217 1.00 66.92  ? 192  LEU A C     1 
ATOM   1144 O O     . LEU A 1 179 ? -60.609 23.615 -16.372 1.00 65.95  ? 192  LEU A O     1 
ATOM   1145 C CB    . LEU A 1 179 ? -62.787 22.639 -14.800 1.00 68.82  ? 192  LEU A CB    1 
ATOM   1146 C CG    . LEU A 1 179 ? -61.995 21.328 -14.697 1.00 76.60  ? 192  LEU A CG    1 
ATOM   1147 C CD1   . LEU A 1 179 ? -61.365 21.144 -13.322 1.00 79.05  ? 192  LEU A CD1   1 
ATOM   1148 C CD2   . LEU A 1 179 ? -62.895 20.151 -15.039 1.00 77.39  ? 192  LEU A CD2   1 
ATOM   1149 N N     . ILE A 1 180 ? -59.718 24.554 -14.527 1.00 64.85  ? 193  ILE A N     1 
ATOM   1150 C CA    . ILE A 1 180 ? -58.353 24.594 -15.053 1.00 61.31  ? 193  ILE A CA    1 
ATOM   1151 C C     . ILE A 1 180 ? -57.722 23.235 -14.755 1.00 68.73  ? 193  ILE A C     1 
ATOM   1152 O O     . ILE A 1 180 ? -57.327 22.963 -13.619 1.00 69.16  ? 193  ILE A O     1 
ATOM   1153 C CB    . ILE A 1 180 ? -57.526 25.738 -14.423 1.00 58.64  ? 193  ILE A CB    1 
ATOM   1154 C CG1   . ILE A 1 180 ? -58.265 27.076 -14.556 1.00 59.71  ? 193  ILE A CG1   1 
ATOM   1155 C CG2   . ILE A 1 180 ? -56.156 25.848 -15.085 1.00 55.17  ? 193  ILE A CG2   1 
ATOM   1156 C CD1   . ILE A 1 180 ? -57.708 28.173 -13.681 1.00 60.82  ? 193  ILE A CD1   1 
ATOM   1157 N N     . GLU A 1 181 ? -57.640 22.386 -15.779 1.00 71.61  ? 194  GLU A N     1 
ATOM   1158 C CA    . GLU A 1 181 ? -57.310 20.975 -15.591 1.00 73.23  ? 194  GLU A CA    1 
ATOM   1159 C C     . GLU A 1 181 ? -56.039 20.542 -16.302 1.00 75.70  ? 194  GLU A C     1 
ATOM   1160 O O     . GLU A 1 181 ? -55.575 21.197 -17.236 1.00 72.00  ? 194  GLU A O     1 
ATOM   1161 C CB    . GLU A 1 181 ? -58.461 20.094 -16.083 1.00 83.47  ? 194  GLU A CB    1 
ATOM   1162 C CG    . GLU A 1 181 ? -58.678 20.116 -17.594 1.00 77.34  ? 194  GLU A CG    1 
ATOM   1163 C CD    . GLU A 1 181 ? -59.749 19.144 -18.045 1.00 77.26  ? 194  GLU A CD    1 
ATOM   1164 O OE1   . GLU A 1 181 ? -60.115 18.248 -17.254 1.00 89.89  ? 194  GLU A OE1   1 
ATOM   1165 O OE2   . GLU A 1 181 ? -60.225 19.271 -19.192 1.00 72.00  ? 194  GLU A OE2   1 
ATOM   1166 N N     . THR A 1 182 ? -55.505 19.408 -15.852 1.00 85.27  ? 195  THR A N     1 
ATOM   1167 C CA    . THR A 1 182 ? -54.341 18.778 -16.467 1.00 90.06  ? 195  THR A CA    1 
ATOM   1168 C C     . THR A 1 182 ? -53.151 19.748 -16.495 1.00 77.10  ? 195  THR A C     1 
ATOM   1169 O O     . THR A 1 182 ? -52.468 19.904 -17.507 1.00 78.47  ? 195  THR A O     1 
ATOM   1170 C CB    . THR A 1 182 ? -54.684 18.250 -17.878 1.00 89.50  ? 195  THR A CB    1 
ATOM   1171 O OG1   . THR A 1 182 ? -55.954 17.585 -17.837 1.00 85.69  ? 195  THR A OG1   1 
ATOM   1172 C CG2   . THR A 1 182 ? -53.619 17.270 -18.376 1.00 88.67  ? 195  THR A CG2   1 
ATOM   1173 N N     . ILE A 1 183 ? -52.915 20.394 -15.359 1.00 66.17  ? 196  ILE A N     1 
ATOM   1174 C CA    . ILE A 1 183 ? -51.908 21.439 -15.266 1.00 68.98  ? 196  ILE A CA    1 
ATOM   1175 C C     . ILE A 1 183 ? -50.518 20.806 -15.189 1.00 74.22  ? 196  ILE A C     1 
ATOM   1176 O O     . ILE A 1 183 ? -50.068 20.394 -14.118 1.00 71.68  ? 196  ILE A O     1 
ATOM   1177 C CB    . ILE A 1 183 ? -52.178 22.364 -14.057 1.00 62.61  ? 196  ILE A CB    1 
ATOM   1178 C CG1   . ILE A 1 183 ? -53.519 23.076 -14.238 1.00 57.16  ? 196  ILE A CG1   1 
ATOM   1179 C CG2   . ILE A 1 183 ? -51.077 23.403 -13.892 1.00 61.27  ? 196  ILE A CG2   1 
ATOM   1180 C CD1   . ILE A 1 183 ? -54.058 23.682 -12.965 1.00 66.16  ? 196  ILE A CD1   1 
ATOM   1181 N N     . PHE A 1 184 ? -49.861 20.715 -16.344 1.00 83.62  ? 197  PHE A N     1 
ATOM   1182 C CA    . PHE A 1 184 ? -48.477 20.250 -16.428 1.00 76.70  ? 197  PHE A CA    1 
ATOM   1183 C C     . PHE A 1 184 ? -47.528 21.319 -15.878 1.00 68.50  ? 197  PHE A C     1 
ATOM   1184 O O     . PHE A 1 184 ? -46.587 21.013 -15.141 1.00 68.37  ? 197  PHE A O     1 
ATOM   1185 C CB    . PHE A 1 184 ? -48.119 19.916 -17.880 1.00 67.69  ? 197  PHE A CB    1 
ATOM   1186 N N     . ASP A 1 185 ? -47.798 22.572 -16.237 1.00 73.52  ? 198  ASP A N     1 
ATOM   1187 C CA    . ASP A 1 185 ? -47.005 23.715 -15.797 1.00 66.65  ? 198  ASP A CA    1 
ATOM   1188 C C     . ASP A 1 185 ? -47.887 24.690 -15.021 1.00 66.69  ? 198  ASP A C     1 
ATOM   1189 O O     . ASP A 1 185 ? -48.920 25.137 -15.517 1.00 79.49  ? 198  ASP A O     1 
ATOM   1190 C CB    . ASP A 1 185 ? -46.391 24.410 -17.009 1.00 68.16  ? 198  ASP A CB    1 
ATOM   1191 C CG    . ASP A 1 185 ? -45.330 25.419 -16.632 1.00 70.25  ? 198  ASP A CG    1 
ATOM   1192 O OD1   . ASP A 1 185 ? -45.438 26.042 -15.555 1.00 60.98  ? 198  ASP A OD1   1 
ATOM   1193 O OD2   . ASP A 1 185 ? -44.386 25.594 -17.430 1.00 91.18  ? 198  ASP A OD2   1 
ATOM   1194 N N     . THR A 1 186 ? -47.451 25.033 -13.814 1.00 57.55  ? 199  THR A N     1 
ATOM   1195 C CA    . THR A 1 186 ? -48.248 25.825 -12.893 1.00 63.97  ? 199  THR A CA    1 
ATOM   1196 C C     . THR A 1 186 ? -48.314 27.301 -13.288 1.00 65.15  ? 199  THR A C     1 
ATOM   1197 O O     . THR A 1 186 ? -49.302 27.978 -12.999 1.00 62.93  ? 199  THR A O     1 
ATOM   1198 C CB    . THR A 1 186 ? -47.698 25.689 -11.459 1.00 66.42  ? 199  THR A CB    1 
ATOM   1199 O OG1   . THR A 1 186 ? -47.598 24.301 -11.128 1.00 68.13  ? 199  THR A OG1   1 
ATOM   1200 C CG2   . THR A 1 186 ? -48.605 26.382 -10.447 1.00 72.95  ? 199  THR A CG2   1 
ATOM   1201 N N     . ALA A 1 187 ? -47.271 27.801 -13.944 1.00 61.74  ? 200  ALA A N     1 
ATOM   1202 C CA    . ALA A 1 187 ? -47.271 29.186 -14.412 1.00 68.92  ? 200  ALA A CA    1 
ATOM   1203 C C     . ALA A 1 187 ? -48.390 29.420 -15.437 1.00 72.04  ? 200  ALA A C     1 
ATOM   1204 O O     . ALA A 1 187 ? -49.000 30.493 -15.462 1.00 62.49  ? 200  ALA A O     1 
ATOM   1205 C CB    . ALA A 1 187 ? -45.919 29.557 -14.994 1.00 72.42  ? 200  ALA A CB    1 
ATOM   1206 N N     . ASN A 1 188 ? -48.664 28.411 -16.265 1.00 57.46  ? 201  ASN A N     1 
ATOM   1207 C CA    . ASN A 1 188 ? -49.827 28.449 -17.154 1.00 57.22  ? 201  ASN A CA    1 
ATOM   1208 C C     . ASN A 1 188 ? -51.130 28.612 -16.368 1.00 56.46  ? 201  ASN A C     1 
ATOM   1209 O O     . ASN A 1 188 ? -51.977 29.426 -16.719 1.00 62.33  ? 201  ASN A O     1 
ATOM   1210 C CB    . ASN A 1 188 ? -49.909 27.176 -17.998 1.00 59.64  ? 201  ASN A CB    1 
ATOM   1211 C CG    . ASN A 1 188 ? -48.700 26.983 -18.893 1.00 61.74  ? 201  ASN A CG    1 
ATOM   1212 O OD1   . ASN A 1 188 ? -47.565 27.280 -18.505 1.00 58.17  ? 201  ASN A OD1   1 
ATOM   1213 N ND2   . ASN A 1 188 ? -48.937 26.476 -20.100 1.00 54.35  ? 201  ASN A ND2   1 
ATOM   1214 N N     . ALA A 1 189 ? -51.273 27.836 -15.297 1.00 58.52  ? 202  ALA A N     1 
ATOM   1215 C CA    . ALA A 1 189 ? -52.474 27.861 -14.467 1.00 53.30  ? 202  ALA A CA    1 
ATOM   1216 C C     . ALA A 1 189 ? -52.630 29.192 -13.758 1.00 56.37  ? 202  ALA A C     1 
ATOM   1217 O O     . ALA A 1 189 ? -53.751 29.658 -13.527 1.00 57.99  ? 202  ALA A O     1 
ATOM   1218 C CB    . ALA A 1 189 ? -52.429 26.738 -13.448 1.00 54.10  ? 202  ALA A CB    1 
ATOM   1219 N N     . LYS A 1 190 ? -51.499 29.793 -13.401 1.00 53.31  ? 203  LYS A N     1 
ATOM   1220 C CA    . LYS A 1 190 ? -51.496 31.106 -12.778 1.00 49.28  ? 203  LYS A CA    1 
ATOM   1221 C C     . LYS A 1 190 ? -51.904 32.167 -13.794 1.00 54.01  ? 203  LYS A C     1 
ATOM   1222 O O     . LYS A 1 190 ? -52.558 33.148 -13.440 1.00 62.72  ? 203  LYS A O     1 
ATOM   1223 C CB    . LYS A 1 190 ? -50.119 31.412 -12.186 1.00 52.43  ? 203  LYS A CB    1 
ATOM   1224 C CG    . LYS A 1 190 ? -49.783 30.553 -10.975 1.00 51.86  ? 203  LYS A CG    1 
ATOM   1225 C CD    . LYS A 1 190 ? -48.355 30.761 -10.505 1.00 49.68  ? 203  LYS A CD    1 
ATOM   1226 C CE    . LYS A 1 190 ? -48.226 32.000 -9.636  1.00 56.89  ? 203  LYS A CE    1 
ATOM   1227 N NZ    . LYS A 1 190 ? -46.797 32.351 -9.401  1.00 61.43  ? 203  LYS A NZ    1 
ATOM   1228 N N     . ALA A 1 191 ? -51.519 31.959 -15.053 1.00 53.59  ? 204  ALA A N     1 
ATOM   1229 C CA    . ALA A 1 191 ? -51.942 32.825 -16.155 1.00 54.16  ? 204  ALA A CA    1 
ATOM   1230 C C     . ALA A 1 191 ? -53.442 32.686 -16.402 1.00 54.94  ? 204  ALA A C     1 
ATOM   1231 O O     . ALA A 1 191 ? -54.133 33.676 -16.632 1.00 49.74  ? 204  ALA A O     1 
ATOM   1232 C CB    . ALA A 1 191 ? -51.164 32.496 -17.424 1.00 50.67  ? 204  ALA A CB    1 
ATOM   1233 N N     . ALA A 1 192 ? -53.934 31.451 -16.358 1.00 55.71  ? 205  ALA A N     1 
ATOM   1234 C CA    . ALA A 1 192 ? -55.365 31.194 -16.436 1.00 62.12  ? 205  ALA A CA    1 
ATOM   1235 C C     . ALA A 1 192 ? -56.105 31.881 -15.284 1.00 68.61  ? 205  ALA A C     1 
ATOM   1236 O O     . ALA A 1 192 ? -57.117 32.546 -15.501 1.00 70.52  ? 205  ALA A O     1 
ATOM   1237 C CB    . ALA A 1 192 ? -55.636 29.698 -16.431 1.00 60.57  ? 205  ALA A CB    1 
ATOM   1238 N N     . LEU A 1 193 ? -55.591 31.740 -14.064 1.00 62.20  ? 206  LEU A N     1 
ATOM   1239 C CA    . LEU A 1 193 ? -56.210 32.384 -12.902 1.00 62.06  ? 206  LEU A CA    1 
ATOM   1240 C C     . LEU A 1 193 ? -56.222 33.909 -13.055 1.00 58.53  ? 206  LEU A C     1 
ATOM   1241 O O     . LEU A 1 193 ? -57.184 34.579 -12.661 1.00 66.75  ? 206  LEU A O     1 
ATOM   1242 C CB    . LEU A 1 193 ? -55.500 31.976 -11.605 1.00 59.84  ? 206  LEU A CB    1 
ATOM   1243 N N     . PHE A 1 194 ? -55.161 34.449 -13.644 1.00 53.91  ? 207  PHE A N     1 
ATOM   1244 C CA    . PHE A 1 194 ? -55.050 35.890 -13.881 1.00 55.67  ? 207  PHE A CA    1 
ATOM   1245 C C     . PHE A 1 194 ? -56.070 36.343 -14.925 1.00 65.45  ? 207  PHE A C     1 
ATOM   1246 O O     . PHE A 1 194 ? -56.646 37.428 -14.812 1.00 75.54  ? 207  PHE A O     1 
ATOM   1247 C CB    . PHE A 1 194 ? -53.636 36.228 -14.345 1.00 52.21  ? 207  PHE A CB    1 
ATOM   1248 C CG    . PHE A 1 194 ? -53.258 37.671 -14.169 1.00 60.46  ? 207  PHE A CG    1 
ATOM   1249 C CD1   . PHE A 1 194 ? -53.681 38.632 -15.077 1.00 57.73  ? 207  PHE A CD1   1 
ATOM   1250 C CD2   . PHE A 1 194 ? -52.437 38.063 -13.115 1.00 59.59  ? 207  PHE A CD2   1 
ATOM   1251 C CE1   . PHE A 1 194 ? -53.305 39.958 -14.931 1.00 54.41  ? 207  PHE A CE1   1 
ATOM   1252 C CE2   . PHE A 1 194 ? -52.064 39.388 -12.962 1.00 57.37  ? 207  PHE A CE2   1 
ATOM   1253 C CZ    . PHE A 1 194 ? -52.496 40.336 -13.872 1.00 52.62  ? 207  PHE A CZ    1 
ATOM   1254 N N     . ALA A 1 195 ? -56.287 35.508 -15.940 1.00 59.95  ? 208  ALA A N     1 
ATOM   1255 C CA    . ALA A 1 195 ? -57.318 35.765 -16.940 1.00 66.62  ? 208  ALA A CA    1 
ATOM   1256 C C     . ALA A 1 195 ? -58.693 35.827 -16.284 1.00 66.34  ? 208  ALA A C     1 
ATOM   1257 O O     . ALA A 1 195 ? -59.482 36.725 -16.568 1.00 79.54  ? 208  ALA A O     1 
ATOM   1258 C CB    . ALA A 1 195 ? -57.296 34.691 -18.020 1.00 67.77  ? 208  ALA A CB    1 
ATOM   1259 N N     . LEU A 1 196 ? -58.968 34.877 -15.396 1.00 64.15  ? 209  LEU A N     1 
ATOM   1260 C CA    . LEU A 1 196 ? -60.259 34.813 -14.717 1.00 62.56  ? 209  LEU A CA    1 
ATOM   1261 C C     . LEU A 1 196 ? -60.499 36.007 -13.795 1.00 65.02  ? 209  LEU A C     1 
ATOM   1262 O O     . LEU A 1 196 ? -61.601 36.559 -13.764 1.00 76.48  ? 209  LEU A O     1 
ATOM   1263 C CB    . LEU A 1 196 ? -60.388 33.502 -13.939 1.00 62.69  ? 209  LEU A CB    1 
ATOM   1264 C CG    . LEU A 1 196 ? -60.422 32.238 -14.804 1.00 63.47  ? 209  LEU A CG    1 
ATOM   1265 C CD1   . LEU A 1 196 ? -60.745 31.013 -13.958 1.00 66.77  ? 209  LEU A CD1   1 
ATOM   1266 C CD2   . LEU A 1 196 ? -61.421 32.385 -15.942 1.00 62.01  ? 209  LEU A CD2   1 
ATOM   1267 N N     . GLN A 1 197 ? -59.468 36.410 -13.060 1.00 67.80  ? 210  GLN A N     1 
ATOM   1268 C CA    . GLN A 1 197 ? -59.548 37.611 -12.230 1.00 68.07  ? 210  GLN A CA    1 
ATOM   1269 C C     . GLN A 1 197 ? -59.793 38.866 -13.077 1.00 64.50  ? 210  GLN A C     1 
ATOM   1270 O O     . GLN A 1 197 ? -60.531 39.755 -12.659 1.00 83.62  ? 210  GLN A O     1 
ATOM   1271 C CB    . GLN A 1 197 ? -58.280 37.778 -11.385 1.00 64.82  ? 210  GLN A CB    1 
ATOM   1272 N N     . ASN A 1 198 ? -59.186 38.937 -14.262 1.00 70.33  ? 211  ASN A N     1 
ATOM   1273 C CA    . ASN A 1 198 ? -59.434 40.056 -15.175 1.00 68.71  ? 211  ASN A CA    1 
ATOM   1274 C C     . ASN A 1 198 ? -60.921 40.223 -15.463 1.00 70.33  ? 211  ASN A C     1 
ATOM   1275 O O     . ASN A 1 198 ? -61.458 41.324 -15.353 1.00 76.48  ? 211  ASN A O     1 
ATOM   1276 C CB    . ASN A 1 198 ? -58.695 39.875 -16.504 1.00 73.68  ? 211  ASN A CB    1 
ATOM   1277 C CG    . ASN A 1 198 ? -57.219 40.212 -16.417 1.00 74.79  ? 211  ASN A CG    1 
ATOM   1278 O OD1   . ASN A 1 198 ? -56.795 41.006 -15.578 1.00 65.60  ? 211  ASN A OD1   1 
ATOM   1279 N ND2   . ASN A 1 198 ? -56.428 39.620 -17.307 1.00 72.93  ? 211  ASN A ND2   1 
ATOM   1280 N N     . LEU A 1 199 ? -61.580 39.125 -15.820 1.00 68.05  ? 212  LEU A N     1 
ATOM   1281 C CA    . LEU A 1 199 ? -62.993 39.168 -16.204 1.00 71.39  ? 212  LEU A CA    1 
ATOM   1282 C C     . LEU A 1 199 ? -63.896 39.480 -15.012 1.00 77.37  ? 212  LEU A C     1 
ATOM   1283 O O     . LEU A 1 199 ? -64.851 40.250 -15.136 1.00 70.05  ? 212  LEU A O     1 
ATOM   1284 C CB    . LEU A 1 199 ? -63.417 37.844 -16.837 1.00 68.21  ? 212  LEU A CB    1 
ATOM   1285 C CG    . LEU A 1 199 ? -62.657 37.431 -18.099 1.00 71.22  ? 212  LEU A CG    1 
ATOM   1286 C CD1   . LEU A 1 199 ? -62.945 35.977 -18.439 1.00 73.84  ? 212  LEU A CD1   1 
ATOM   1287 C CD2   . LEU A 1 199 ? -63.006 38.343 -19.265 1.00 75.18  ? 212  LEU A CD2   1 
ATOM   1288 N N     . PHE A 1 200 ? -63.583 38.888 -13.861 1.00 66.05  ? 213  PHE A N     1 
ATOM   1289 C CA    . PHE A 1 200 ? -64.407 39.049 -12.666 1.00 67.59  ? 213  PHE A CA    1 
ATOM   1290 C C     . PHE A 1 200 ? -64.330 40.456 -12.076 1.00 74.62  ? 213  PHE A C     1 
ATOM   1291 O O     . PHE A 1 200 ? -65.299 40.933 -11.479 1.00 84.76  ? 213  PHE A O     1 
ATOM   1292 C CB    . PHE A 1 200 ? -64.020 38.019 -11.591 1.00 61.86  ? 213  PHE A CB    1 
ATOM   1293 C CG    . PHE A 1 200 ? -64.254 36.581 -11.989 1.00 66.66  ? 213  PHE A CG    1 
ATOM   1294 C CD1   . PHE A 1 200 ? -65.149 36.234 -13.000 1.00 69.19  ? 213  PHE A CD1   1 
ATOM   1295 C CD2   . PHE A 1 200 ? -63.595 35.562 -11.317 1.00 64.73  ? 213  PHE A CD2   1 
ATOM   1296 C CE1   . PHE A 1 200 ? -65.352 34.909 -13.345 1.00 68.28  ? 213  PHE A CE1   1 
ATOM   1297 C CE2   . PHE A 1 200 ? -63.799 34.236 -11.659 1.00 63.38  ? 213  PHE A CE2   1 
ATOM   1298 C CZ    . PHE A 1 200 ? -64.677 33.909 -12.674 1.00 64.08  ? 213  PHE A CZ    1 
ATOM   1299 N N     . GLU A 1 201 ? -63.188 41.118 -12.252 1.00 75.95  ? 214  GLU A N     1 
ATOM   1300 C CA    . GLU A 1 201 ? -62.940 42.430 -11.649 1.00 79.52  ? 214  GLU A CA    1 
ATOM   1301 C C     . GLU A 1 201 ? -63.957 43.504 -12.053 1.00 87.54  ? 214  GLU A C     1 
ATOM   1302 O O     . GLU A 1 201 ? -64.126 44.488 -11.333 1.00 115.07 ? 214  GLU A O     1 
ATOM   1303 C CB    . GLU A 1 201 ? -61.520 42.913 -11.975 1.00 69.76  ? 214  GLU A CB    1 
ATOM   1304 N N     . GLU A 1 202 ? -64.623 43.323 -13.195 1.00 96.11  ? 215  GLU A N     1 
ATOM   1305 C CA    . GLU A 1 202 ? -65.648 44.271 -13.645 1.00 101.71 ? 215  GLU A CA    1 
ATOM   1306 C C     . GLU A 1 202 ? -66.764 43.631 -14.475 1.00 97.08  ? 215  GLU A C     1 
ATOM   1307 O O     . GLU A 1 202 ? -67.941 43.817 -14.171 1.00 112.08 ? 215  GLU A O     1 
ATOM   1308 C CB    . GLU A 1 202 ? -65.003 45.404 -14.446 1.00 108.01 ? 215  GLU A CB    1 
ATOM   1309 N N     . LYS A 1 203 ? -66.396 42.885 -15.514 1.00 93.93  ? 216  LYS A N     1 
ATOM   1310 C CA    . LYS A 1 203 ? -67.365 42.393 -16.504 1.00 96.13  ? 216  LYS A CA    1 
ATOM   1311 C C     . LYS A 1 203 ? -68.304 41.294 -15.995 1.00 91.33  ? 216  LYS A C     1 
ATOM   1312 O O     . LYS A 1 203 ? -69.519 41.376 -16.188 1.00 104.36 ? 216  LYS A O     1 
ATOM   1313 C CB    . LYS A 1 203 ? -66.638 41.896 -17.758 1.00 89.00  ? 216  LYS A CB    1 
ATOM   1314 N N     . TYR A 1 204 ? -67.742 40.273 -15.353 1.00 87.53  ? 217  TYR A N     1 
ATOM   1315 C CA    . TYR A 1 204 ? -68.500 39.074 -14.989 1.00 81.68  ? 217  TYR A CA    1 
ATOM   1316 C C     . TYR A 1 204 ? -68.684 38.892 -13.484 1.00 89.87  ? 217  TYR A C     1 
ATOM   1317 O O     . TYR A 1 204 ? -67.897 39.394 -12.678 1.00 87.73  ? 217  TYR A O     1 
ATOM   1318 C CB    . TYR A 1 204 ? -67.801 37.837 -15.548 1.00 78.66  ? 217  TYR A CB    1 
ATOM   1319 C CG    . TYR A 1 204 ? -67.870 37.727 -17.050 1.00 78.66  ? 217  TYR A CG    1 
ATOM   1320 C CD1   . TYR A 1 204 ? -67.038 38.489 -17.864 1.00 73.52  ? 217  TYR A CD1   1 
ATOM   1321 C CD2   . TYR A 1 204 ? -68.768 36.856 -17.659 1.00 81.37  ? 217  TYR A CD2   1 
ATOM   1322 C CE1   . TYR A 1 204 ? -67.098 38.387 -19.243 1.00 75.03  ? 217  TYR A CE1   1 
ATOM   1323 C CE2   . TYR A 1 204 ? -68.836 36.746 -19.036 1.00 81.92  ? 217  TYR A CE2   1 
ATOM   1324 C CZ    . TYR A 1 204 ? -68.001 37.512 -19.824 1.00 77.12  ? 217  TYR A CZ    1 
ATOM   1325 O OH    . TYR A 1 204 ? -68.066 37.404 -21.192 1.00 81.42  ? 217  TYR A OH    1 
ATOM   1326 N N     . ALA A 1 205 ? -69.741 38.165 -13.125 1.00 88.82  ? 218  ALA A N     1 
ATOM   1327 C CA    . ALA A 1 205 ? -69.943 37.706 -11.759 1.00 86.90  ? 218  ALA A CA    1 
ATOM   1328 C C     . ALA A 1 205 ? -69.193 36.384 -11.606 1.00 87.93  ? 218  ALA A C     1 
ATOM   1329 O O     . ALA A 1 205 ? -69.362 35.481 -12.429 1.00 88.30  ? 218  ALA A O     1 
ATOM   1330 C CB    . ALA A 1 205 ? -71.423 37.514 -11.474 1.00 85.98  ? 218  ALA A CB    1 
ATOM   1331 N N     . PRO A 1 206 ? -68.367 36.261 -10.553 1.00 74.24  ? 219  PRO A N     1 
ATOM   1332 C CA    . PRO A 1 206 ? -67.460 35.121 -10.458 1.00 81.77  ? 219  PRO A CA    1 
ATOM   1333 C C     . PRO A 1 206 ? -68.174 33.789 -10.277 1.00 80.66  ? 219  PRO A C     1 
ATOM   1334 O O     . PRO A 1 206 ? -69.112 33.693 -9.484  1.00 86.93  ? 219  PRO A O     1 
ATOM   1335 C CB    . PRO A 1 206 ? -66.601 35.448 -9.229  1.00 76.22  ? 219  PRO A CB    1 
ATOM   1336 C CG    . PRO A 1 206 ? -67.447 36.349 -8.407  1.00 77.62  ? 219  PRO A CG    1 
ATOM   1337 C CD    . PRO A 1 206 ? -68.274 37.141 -9.376  1.00 77.60  ? 219  PRO A CD    1 
ATOM   1338 N N     . ARG A 1 207 ? -67.733 32.784 -11.031 1.00 75.64  ? 220  ARG A N     1 
ATOM   1339 C CA    . ARG A 1 207 ? -68.181 31.410 -10.845 1.00 69.95  ? 220  ARG A CA    1 
ATOM   1340 C C     . ARG A 1 207 ? -67.065 30.654 -10.132 1.00 64.01  ? 220  ARG A C     1 
ATOM   1341 O O     . ARG A 1 207 ? -65.915 31.084 -10.153 1.00 68.54  ? 220  ARG A O     1 
ATOM   1342 C CB    . ARG A 1 207 ? -68.513 30.761 -12.192 1.00 70.41  ? 220  ARG A CB    1 
ATOM   1343 N N     . PRO A 1 208 ? -67.399 29.537 -9.472  1.00 68.05  ? 221  PRO A N     1 
ATOM   1344 C CA    . PRO A 1 208 ? -66.366 28.793 -8.752  1.00 63.96  ? 221  PRO A CA    1 
ATOM   1345 C C     . PRO A 1 208 ? -65.314 28.185 -9.673  1.00 64.56  ? 221  PRO A C     1 
ATOM   1346 O O     . PRO A 1 208 ? -65.625 27.777 -10.795 1.00 67.68  ? 221  PRO A O     1 
ATOM   1347 C CB    . PRO A 1 208 ? -67.153 27.690 -8.034  1.00 68.41  ? 221  PRO A CB    1 
ATOM   1348 C CG    . PRO A 1 208 ? -68.447 27.592 -8.765  1.00 72.57  ? 221  PRO A CG    1 
ATOM   1349 C CD    . PRO A 1 208 ? -68.740 28.979 -9.242  1.00 67.98  ? 221  PRO A CD    1 
ATOM   1350 N N     . ILE A 1 209 ? -64.081 28.129 -9.179  1.00 64.19  ? 222  ILE A N     1 
ATOM   1351 C CA    . ILE A 1 209 ? -62.952 27.612 -9.928  1.00 54.28  ? 222  ILE A CA    1 
ATOM   1352 C C     . ILE A 1 209 ? -62.526 26.265 -9.358  1.00 58.12  ? 222  ILE A C     1 
ATOM   1353 O O     . ILE A 1 209 ? -62.260 26.149 -8.162  1.00 61.66  ? 222  ILE A O     1 
ATOM   1354 C CB    . ILE A 1 209 ? -61.755 28.580 -9.849  1.00 57.19  ? 222  ILE A CB    1 
ATOM   1355 C CG1   . ILE A 1 209 ? -62.120 29.924 -10.485 1.00 60.03  ? 222  ILE A CG1   1 
ATOM   1356 C CG2   . ILE A 1 209 ? -60.528 27.977 -10.526 1.00 56.44  ? 222  ILE A CG2   1 
ATOM   1357 C CD1   . ILE A 1 209 ? -61.146 31.037 -10.171 1.00 60.88  ? 222  ILE A CD1   1 
ATOM   1358 N N     . PHE A 1 210 ? -62.472 25.254 -10.221 1.00 63.63  ? 223  PHE A N     1 
ATOM   1359 C CA    . PHE A 1 210 ? -61.862 23.964 -9.898  1.00 63.65  ? 223  PHE A CA    1 
ATOM   1360 C C     . PHE A 1 210 ? -60.473 23.952 -10.537 1.00 63.80  ? 223  PHE A C     1 
ATOM   1361 O O     . PHE A 1 210 ? -60.321 24.396 -11.675 1.00 56.18  ? 223  PHE A O     1 
ATOM   1362 C CB    . PHE A 1 210 ? -62.693 22.812 -10.471 1.00 67.94  ? 223  PHE A CB    1 
ATOM   1363 C CG    . PHE A 1 210 ? -63.982 22.532 -9.734  1.00 73.40  ? 223  PHE A CG    1 
ATOM   1364 C CD1   . PHE A 1 210 ? -64.587 23.480 -8.908  1.00 71.82  ? 223  PHE A CD1   1 
ATOM   1365 C CD2   . PHE A 1 210 ? -64.618 21.308 -9.907  1.00 77.80  ? 223  PHE A CD2   1 
ATOM   1366 C CE1   . PHE A 1 210 ? -65.777 23.198 -8.255  1.00 76.35  ? 223  PHE A CE1   1 
ATOM   1367 C CE2   . PHE A 1 210 ? -65.810 21.024 -9.259  1.00 83.22  ? 223  PHE A CE2   1 
ATOM   1368 C CZ    . PHE A 1 210 ? -66.390 21.970 -8.431  1.00 80.71  ? 223  PHE A CZ    1 
ATOM   1369 N N     . ILE A 1 211 ? -59.469 23.459 -9.808  1.00 66.32  ? 224  ILE A N     1 
ATOM   1370 C CA    . ILE A 1 211 ? -58.083 23.412 -10.303 1.00 61.89  ? 224  ILE A CA    1 
ATOM   1371 C C     . ILE A 1 211 ? -57.501 22.024 -10.076 1.00 62.78  ? 224  ILE A C     1 
ATOM   1372 O O     . ILE A 1 211 ? -57.368 21.591 -8.937  1.00 67.90  ? 224  ILE A O     1 
ATOM   1373 C CB    . ILE A 1 211 ? -57.164 24.432 -9.592  1.00 59.33  ? 224  ILE A CB    1 
ATOM   1374 C CG1   . ILE A 1 211 ? -57.808 25.818 -9.545  1.00 64.93  ? 224  ILE A CG1   1 
ATOM   1375 C CG2   . ILE A 1 211 ? -55.820 24.519 -10.303 1.00 65.54  ? 224  ILE A CG2   1 
ATOM   1376 C CD1   . ILE A 1 211 ? -56.936 26.888 -8.913  1.00 63.44  ? 224  ILE A CD1   1 
ATOM   1377 N N     . SER A 1 212 ? -57.136 21.335 -11.152 1.00 58.32  ? 225  SER A N     1 
ATOM   1378 C CA    . SER A 1 212 ? -56.586 19.990 -11.034 1.00 61.01  ? 225  SER A CA    1 
ATOM   1379 C C     . SER A 1 212 ? -55.173 19.943 -11.589 1.00 61.27  ? 225  SER A C     1 
ATOM   1380 O O     . SER A 1 212 ? -54.942 20.286 -12.752 1.00 55.06  ? 225  SER A O     1 
ATOM   1381 C CB    . SER A 1 212 ? -57.470 18.977 -11.762 1.00 60.36  ? 225  SER A CB    1 
ATOM   1382 N N     . GLY A 1 213 ? -54.230 19.523 -10.748 1.00 65.75  ? 226  GLY A N     1 
ATOM   1383 C CA    . GLY A 1 213 ? -52.841 19.343 -11.166 1.00 68.24  ? 226  GLY A CA    1 
ATOM   1384 C C     . GLY A 1 213 ? -52.638 18.009 -11.856 1.00 70.02  ? 226  GLY A C     1 
ATOM   1385 O O     . GLY A 1 213 ? -53.585 17.247 -12.041 1.00 79.59  ? 226  GLY A O     1 
ATOM   1386 N N     . THR A 1 214 ? -51.400 17.731 -12.250 1.00 74.44  ? 227  THR A N     1 
ATOM   1387 C CA    . THR A 1 214 ? -51.055 16.448 -12.861 1.00 76.20  ? 227  THR A CA    1 
ATOM   1388 C C     . THR A 1 214 ? -49.649 16.034 -12.439 1.00 76.08  ? 227  THR A C     1 
ATOM   1389 O O     . THR A 1 214 ? -48.661 16.615 -12.888 1.00 76.63  ? 227  THR A O     1 
ATOM   1390 C CB    . THR A 1 214 ? -51.163 16.498 -14.403 1.00 72.42  ? 227  THR A CB    1 
ATOM   1391 O OG1   . THR A 1 214 ? -52.478 16.915 -14.774 1.00 69.80  ? 227  THR A OG1   1 
ATOM   1392 C CG2   . THR A 1 214 ? -50.905 15.126 -15.023 1.00 71.92  ? 227  THR A CG2   1 
ATOM   1393 N N     . ILE A 1 215 ? -49.582 15.040 -11.554 1.00 88.10  ? 228  ILE A N     1 
ATOM   1394 C CA    . ILE A 1 215 ? -48.322 14.437 -11.124 1.00 82.01  ? 228  ILE A CA    1 
ATOM   1395 C C     . ILE A 1 215 ? -47.919 13.389 -12.150 1.00 79.63  ? 228  ILE A C     1 
ATOM   1396 O O     . ILE A 1 215 ? -48.762 12.630 -12.625 1.00 81.49  ? 228  ILE A O     1 
ATOM   1397 C CB    . ILE A 1 215 ? -48.459 13.748 -9.751  1.00 78.92  ? 228  ILE A CB    1 
ATOM   1398 C CG1   . ILE A 1 215 ? -48.944 14.734 -8.677  1.00 84.41  ? 228  ILE A CG1   1 
ATOM   1399 C CG2   . ILE A 1 215 ? -47.145 13.102 -9.339  1.00 81.85  ? 228  ILE A CG2   1 
ATOM   1400 C CD1   . ILE A 1 215 ? -48.047 15.933 -8.444  1.00 85.86  ? 228  ILE A CD1   1 
ATOM   1401 N N     . VAL A 1 216 ? -46.630 13.334 -12.471 1.00 84.76  ? 229  VAL A N     1 
ATOM   1402 C CA    . VAL A 1 216 ? -46.141 12.449 -13.530 1.00 91.65  ? 229  VAL A CA    1 
ATOM   1403 C C     . VAL A 1 216 ? -45.552 11.134 -13.009 1.00 90.08  ? 229  VAL A C     1 
ATOM   1404 O O     . VAL A 1 216 ? -45.739 10.089 -13.627 1.00 98.26  ? 229  VAL A O     1 
ATOM   1405 C CB    . VAL A 1 216 ? -45.120 13.168 -14.451 1.00 88.46  ? 229  VAL A CB    1 
ATOM   1406 C CG1   . VAL A 1 216 ? -45.811 14.275 -15.234 1.00 90.08  ? 229  VAL A CG1   1 
ATOM   1407 C CG2   . VAL A 1 216 ? -43.941 13.734 -13.668 1.00 82.93  ? 229  VAL A CG2   1 
ATOM   1408 N N     . ASP A 1 217 ? -44.860 11.186 -11.872 1.00 95.82  ? 230  ASP A N     1 
ATOM   1409 C CA    . ASP A 1 217 ? -44.087 10.045 -11.375 1.00 96.99  ? 230  ASP A CA    1 
ATOM   1410 C C     . ASP A 1 217 ? -44.436 9.701  -9.930  1.00 97.81  ? 230  ASP A C     1 
ATOM   1411 O O     . ASP A 1 217 ? -45.257 10.368 -9.299  1.00 98.87  ? 230  ASP A O     1 
ATOM   1412 C CB    . ASP A 1 217 ? -42.585 10.353 -11.477 1.00 98.42  ? 230  ASP A CB    1 
ATOM   1413 C CG    . ASP A 1 217 ? -42.109 10.520 -12.913 1.00 107.13 ? 230  ASP A CG    1 
ATOM   1414 O OD1   . ASP A 1 217 ? -42.725 9.939  -13.832 1.00 105.78 ? 230  ASP A OD1   1 
ATOM   1415 O OD2   . ASP A 1 217 ? -41.103 11.233 -13.122 1.00 123.56 ? 230  ASP A OD2   1 
ATOM   1416 N N     . LYS A 1 218 ? -43.803 8.647  -9.418  1.00 97.72  ? 231  LYS A N     1 
ATOM   1417 C CA    . LYS A 1 218 ? -43.917 8.272  -8.010  1.00 101.58 ? 231  LYS A CA    1 
ATOM   1418 C C     . LYS A 1 218 ? -43.128 9.229  -7.115  1.00 105.14 ? 231  LYS A C     1 
ATOM   1419 O O     . LYS A 1 218 ? -43.181 9.122  -5.889  1.00 105.03 ? 231  LYS A O     1 
ATOM   1420 C CB    . LYS A 1 218 ? -43.426 6.839  -7.795  1.00 100.98 ? 231  LYS A CB    1 
ATOM   1421 N N     . SER A 1 219 ? -42.381 10.144 -7.736  1.00 108.03 ? 232  SER A N     1 
ATOM   1422 C CA    . SER A 1 219 ? -41.690 11.216 -7.025  1.00 116.46 ? 232  SER A CA    1 
ATOM   1423 C C     . SER A 1 219 ? -42.678 12.209 -6.413  1.00 110.18 ? 232  SER A C     1 
ATOM   1424 O O     . SER A 1 219 ? -42.378 12.844 -5.398  1.00 108.84 ? 232  SER A O     1 
ATOM   1425 C CB    . SER A 1 219 ? -40.746 11.957 -7.977  1.00 127.43 ? 232  SER A CB    1 
ATOM   1426 O OG    . SER A 1 219 ? -41.457 12.525 -9.068  1.00 119.84 ? 232  SER A OG    1 
ATOM   1427 N N     . GLY A 1 220 ? -43.846 12.343 -7.042  1.00 93.65  ? 233  GLY A N     1 
ATOM   1428 C CA    . GLY A 1 220 ? -44.898 13.229 -6.556  1.00 80.43  ? 233  GLY A CA    1 
ATOM   1429 C C     . GLY A 1 220 ? -44.766 14.639 -7.094  1.00 77.01  ? 233  GLY A C     1 
ATOM   1430 O O     . GLY A 1 220 ? -45.172 15.597 -6.436  1.00 81.52  ? 233  GLY A O     1 
ATOM   1431 N N     . ARG A 1 221 ? -44.218 14.769 -8.300  1.00 74.88  ? 234  ARG A N     1 
ATOM   1432 C CA    . ARG A 1 221 ? -43.919 16.079 -8.872  1.00 74.77  ? 234  ARG A CA    1 
ATOM   1433 C C     . ARG A 1 221 ? -44.611 16.306 -10.211 1.00 70.04  ? 234  ARG A C     1 
ATOM   1434 O O     . ARG A 1 221 ? -44.820 15.369 -10.978 1.00 80.62  ? 234  ARG A O     1 
ATOM   1435 C CB    . ARG A 1 221 ? -42.408 16.237 -9.039  1.00 86.34  ? 234  ARG A CB    1 
ATOM   1436 C CG    . ARG A 1 221 ? -41.651 16.313 -7.722  1.00 95.76  ? 234  ARG A CG    1 
ATOM   1437 C CD    . ARG A 1 221 ? -40.148 16.307 -7.943  1.00 106.23 ? 234  ARG A CD    1 
ATOM   1438 N NE    . ARG A 1 221 ? -39.404 16.539 -6.703  1.00 113.28 ? 234  ARG A NE    1 
ATOM   1439 C CZ    . ARG A 1 221 ? -39.182 17.732 -6.149  1.00 87.70  ? 234  ARG A CZ    1 
ATOM   1440 N NH1   . ARG A 1 221 ? -39.646 18.848 -6.706  1.00 80.42  ? 234  ARG A NH1   1 
ATOM   1441 N NH2   . ARG A 1 221 ? -38.489 17.810 -5.020  1.00 83.84  ? 234  ARG A NH2   1 
ATOM   1442 N N     . THR A 1 222 ? -44.958 17.563 -10.479 1.00 69.49  ? 235  THR A N     1 
ATOM   1443 C CA    . THR A 1 222 ? -45.526 17.969 -11.763 1.00 69.55  ? 235  THR A CA    1 
ATOM   1444 C C     . THR A 1 222 ? -44.453 17.940 -12.852 1.00 72.82  ? 235  THR A C     1 
ATOM   1445 O O     . THR A 1 222 ? -43.283 17.671 -12.574 1.00 76.17  ? 235  THR A O     1 
ATOM   1446 C CB    . THR A 1 222 ? -46.115 19.397 -11.694 1.00 71.36  ? 235  THR A CB    1 
ATOM   1447 O OG1   . THR A 1 222 ? -45.093 20.329 -11.313 1.00 76.27  ? 235  THR A OG1   1 
ATOM   1448 C CG2   . THR A 1 222 ? -47.255 19.466 -10.694 1.00 76.71  ? 235  THR A CG2   1 
ATOM   1449 N N     . LEU A 1 223 ? -44.852 18.213 -14.091 1.00 74.93  ? 236  LEU A N     1 
ATOM   1450 C CA    . LEU A 1 223 ? -43.906 18.265 -15.207 1.00 75.42  ? 236  LEU A CA    1 
ATOM   1451 C C     . LEU A 1 223 ? -42.927 19.412 -14.996 1.00 75.50  ? 236  LEU A C     1 
ATOM   1452 O O     . LEU A 1 223 ? -41.743 19.317 -15.330 1.00 74.65  ? 236  LEU A O     1 
ATOM   1453 C CB    . LEU A 1 223 ? -44.645 18.457 -16.528 1.00 72.13  ? 236  LEU A CB    1 
ATOM   1454 C CG    . LEU A 1 223 ? -43.805 18.278 -17.792 1.00 73.35  ? 236  LEU A CG    1 
ATOM   1455 C CD1   . LEU A 1 223 ? -43.568 16.801 -18.073 1.00 78.24  ? 236  LEU A CD1   1 
ATOM   1456 C CD2   . LEU A 1 223 ? -44.496 18.946 -18.968 1.00 77.46  ? 236  LEU A CD2   1 
ATOM   1457 N N     . SER A 1 224 ? -43.439 20.492 -14.422 1.00 74.38  ? 237  SER A N     1 
ATOM   1458 C CA    . SER A 1 224 ? -42.635 21.658 -14.101 1.00 78.54  ? 237  SER A CA    1 
ATOM   1459 C C     . SER A 1 224 ? -41.840 21.480 -12.805 1.00 67.68  ? 237  SER A C     1 
ATOM   1460 O O     . SER A 1 224 ? -41.314 22.453 -12.275 1.00 80.32  ? 237  SER A O     1 
ATOM   1461 C CB    . SER A 1 224 ? -43.544 22.883 -13.995 1.00 88.16  ? 237  SER A CB    1 
ATOM   1462 O OG    . SER A 1 224 ? -42.790 24.060 -13.783 1.00 108.20 ? 237  SER A OG    1 
ATOM   1463 N N     . GLY A 1 225 ? -41.764 20.250 -12.294 1.00 69.63  ? 238  GLY A N     1 
ATOM   1464 C CA    . GLY A 1 225 ? -40.922 19.921 -11.139 1.00 64.68  ? 238  GLY A CA    1 
ATOM   1465 C C     . GLY A 1 225 ? -41.500 20.224 -9.763  1.00 63.87  ? 238  GLY A C     1 
ATOM   1466 O O     . GLY A 1 225 ? -40.822 20.027 -8.758  1.00 66.21  ? 238  GLY A O     1 
ATOM   1467 N N     . GLN A 1 226 ? -42.752 20.678 -9.708  1.00 63.82  ? 239  GLN A N     1 
ATOM   1468 C CA    . GLN A 1 226 ? -43.363 21.162 -8.461  1.00 65.24  ? 239  GLN A CA    1 
ATOM   1469 C C     . GLN A 1 226 ? -44.097 20.048 -7.709  1.00 65.58  ? 239  GLN A C     1 
ATOM   1470 O O     . GLN A 1 226 ? -44.725 19.198 -8.330  1.00 85.16  ? 239  GLN A O     1 
ATOM   1471 C CB    . GLN A 1 226 ? -44.347 22.287 -8.786  1.00 65.87  ? 239  GLN A CB    1 
ATOM   1472 C CG    . GLN A 1 226 ? -44.600 23.255 -7.648  1.00 69.86  ? 239  GLN A CG    1 
ATOM   1473 C CD    . GLN A 1 226 ? -45.491 24.407 -8.065  1.00 68.91  ? 239  GLN A CD    1 
ATOM   1474 O OE1   . GLN A 1 226 ? -46.435 24.224 -8.831  1.00 62.14  ? 239  GLN A OE1   1 
ATOM   1475 N NE2   . GLN A 1 226 ? -45.201 25.601 -7.559  1.00 69.83  ? 239  GLN A NE2   1 
ATOM   1476 N N     . THR A 1 227 ? -44.025 20.061 -6.376  1.00 67.81  ? 240  THR A N     1 
ATOM   1477 C CA    . THR A 1 227 ? -44.748 19.077 -5.552  1.00 63.84  ? 240  THR A CA    1 
ATOM   1478 C C     . THR A 1 227 ? -46.171 19.544 -5.280  1.00 57.08  ? 240  THR A C     1 
ATOM   1479 O O     . THR A 1 227 ? -46.462 20.737 -5.353  1.00 61.45  ? 240  THR A O     1 
ATOM   1480 C CB    . THR A 1 227 ? -44.067 18.814 -4.194  1.00 61.71  ? 240  THR A CB    1 
ATOM   1481 O OG1   . THR A 1 227 ? -44.150 19.982 -3.371  1.00 63.08  ? 240  THR A OG1   1 
ATOM   1482 C CG2   . THR A 1 227 ? -42.614 18.422 -4.384  1.00 65.77  ? 240  THR A CG2   1 
ATOM   1483 N N     . GLY A 1 228 ? -47.047 18.597 -4.956  1.00 57.25  ? 241  GLY A N     1 
ATOM   1484 C CA    . GLY A 1 228 ? -48.454 18.889 -4.689  1.00 61.41  ? 241  GLY A CA    1 
ATOM   1485 C C     . GLY A 1 228 ? -48.648 20.016 -3.691  1.00 68.95  ? 241  GLY A C     1 
ATOM   1486 O O     . GLY A 1 228 ? -49.403 20.962 -3.938  1.00 71.42  ? 241  GLY A O     1 
ATOM   1487 N N     . GLU A 1 229 ? -47.949 19.921 -2.566  1.00 68.84  ? 242  GLU A N     1 
ATOM   1488 C CA    . GLU A 1 229 ? -48.008 20.955 -1.538  1.00 70.13  ? 242  GLU A CA    1 
ATOM   1489 C C     . GLU A 1 229 ? -47.591 22.309 -2.102  1.00 67.65  ? 242  GLU A C     1 
ATOM   1490 O O     . GLU A 1 229 ? -48.258 23.318 -1.875  1.00 63.15  ? 242  GLU A O     1 
ATOM   1491 C CB    . GLU A 1 229 ? -47.105 20.594 -0.367  1.00 71.73  ? 242  GLU A CB    1 
ATOM   1492 C CG    . GLU A 1 229 ? -47.501 19.321 0.356   1.00 75.62  ? 242  GLU A CG    1 
ATOM   1493 C CD    . GLU A 1 229 ? -46.609 19.044 1.544   1.00 81.91  ? 242  GLU A CD    1 
ATOM   1494 O OE1   . GLU A 1 229 ? -46.515 19.922 2.429   1.00 82.77  ? 242  GLU A OE1   1 
ATOM   1495 O OE2   . GLU A 1 229 ? -46.007 17.951 1.590   1.00 80.59  ? 242  GLU A OE2   1 
ATOM   1496 N N     . GLY A 1 230 ? -46.485 22.324 -2.839  1.00 60.54  ? 243  GLY A N     1 
ATOM   1497 C CA    . GLY A 1 230 ? -46.021 23.545 -3.495  1.00 63.36  ? 243  GLY A CA    1 
ATOM   1498 C C     . GLY A 1 230 ? -47.022 24.057 -4.512  1.00 61.47  ? 243  GLY A C     1 
ATOM   1499 O O     . GLY A 1 230 ? -47.238 25.262 -4.631  1.00 58.93  ? 243  GLY A O     1 
ATOM   1500 N N     . PHE A 1 231 ? -47.635 23.125 -5.239  1.00 64.57  ? 244  PHE A N     1 
ATOM   1501 C CA    . PHE A 1 231 ? -48.665 23.436 -6.233  1.00 59.17  ? 244  PHE A CA    1 
ATOM   1502 C C     . PHE A 1 231 ? -49.879 24.166 -5.634  1.00 63.05  ? 244  PHE A C     1 
ATOM   1503 O O     . PHE A 1 231 ? -50.316 25.171 -6.192  1.00 69.36  ? 244  PHE A O     1 
ATOM   1504 C CB    . PHE A 1 231 ? -49.081 22.140 -6.944  1.00 62.75  ? 244  PHE A CB    1 
ATOM   1505 C CG    . PHE A 1 231 ? -50.357 22.238 -7.731  1.00 61.81  ? 244  PHE A CG    1 
ATOM   1506 C CD1   . PHE A 1 231 ? -50.374 22.831 -8.979  1.00 56.89  ? 244  PHE A CD1   1 
ATOM   1507 C CD2   . PHE A 1 231 ? -51.534 21.684 -7.238  1.00 68.45  ? 244  PHE A CD2   1 
ATOM   1508 C CE1   . PHE A 1 231 ? -51.544 22.901 -9.714  1.00 64.80  ? 244  PHE A CE1   1 
ATOM   1509 C CE2   . PHE A 1 231 ? -52.708 21.749 -7.968  1.00 68.42  ? 244  PHE A CE2   1 
ATOM   1510 C CZ    . PHE A 1 231 ? -52.714 22.360 -9.208  1.00 62.92  ? 244  PHE A CZ    1 
ATOM   1511 N N     . VAL A 1 232 ? -50.410 23.683 -4.506  1.00 63.16  ? 245  VAL A N     1 
ATOM   1512 C CA    . VAL A 1 232 ? -51.613 24.299 -3.910  1.00 71.44  ? 245  VAL A CA    1 
ATOM   1513 C C     . VAL A 1 232 ? -51.323 25.717 -3.414  1.00 71.35  ? 245  VAL A C     1 
ATOM   1514 O O     . VAL A 1 232 ? -52.167 26.609 -3.540  1.00 74.68  ? 245  VAL A O     1 
ATOM   1515 C CB    . VAL A 1 232 ? -52.264 23.461 -2.764  1.00 71.66  ? 245  VAL A CB    1 
ATOM   1516 C CG1   . VAL A 1 232 ? -52.415 21.995 -3.161  1.00 71.94  ? 245  VAL A CG1   1 
ATOM   1517 C CG2   . VAL A 1 232 ? -51.495 23.583 -1.458  1.00 69.23  ? 245  VAL A CG2   1 
ATOM   1518 N N     . ILE A 1 233 ? -50.128 25.915 -2.861  1.00 64.30  ? 246  ILE A N     1 
ATOM   1519 C CA    . ILE A 1 233 ? -49.693 27.233 -2.409  1.00 62.53  ? 246  ILE A CA    1 
ATOM   1520 C C     . ILE A 1 233 ? -49.598 28.191 -3.591  1.00 59.63  ? 246  ILE A C     1 
ATOM   1521 O O     . ILE A 1 233 ? -49.986 29.351 -3.486  1.00 69.16  ? 246  ILE A O     1 
ATOM   1522 C CB    . ILE A 1 233 ? -48.322 27.170 -1.707  1.00 60.67  ? 246  ILE A CB    1 
ATOM   1523 C CG1   . ILE A 1 233 ? -48.444 26.411 -0.383  1.00 64.37  ? 246  ILE A CG1   1 
ATOM   1524 C CG2   . ILE A 1 233 ? -47.771 28.572 -1.464  1.00 59.25  ? 246  ILE A CG2   1 
ATOM   1525 C CD1   . ILE A 1 233 ? -47.117 26.094 0.269   1.00 65.17  ? 246  ILE A CD1   1 
ATOM   1526 N N     . SER A 1 234 ? -49.087 27.691 -4.712  1.00 57.59  ? 247  SER A N     1 
ATOM   1527 C CA    . SER A 1 234 ? -48.901 28.505 -5.910  1.00 56.24  ? 247  SER A CA    1 
ATOM   1528 C C     . SER A 1 234 ? -50.210 28.947 -6.562  1.00 56.20  ? 247  SER A C     1 
ATOM   1529 O O     . SER A 1 234 ? -50.196 29.872 -7.366  1.00 61.37  ? 247  SER A O     1 
ATOM   1530 C CB    . SER A 1 234 ? -48.054 27.753 -6.943  1.00 62.82  ? 247  SER A CB    1 
ATOM   1531 O OG    . SER A 1 234 ? -46.794 27.382 -6.406  1.00 60.06  ? 247  SER A OG    1 
ATOM   1532 N N     . VAL A 1 235 ? -51.325 28.287 -6.233  1.00 57.45  ? 248  VAL A N     1 
ATOM   1533 C CA    . VAL A 1 235 ? -52.637 28.630 -6.814  1.00 57.03  ? 248  VAL A CA    1 
ATOM   1534 C C     . VAL A 1 235 ? -53.741 28.933 -5.790  1.00 56.15  ? 248  VAL A C     1 
ATOM   1535 O O     . VAL A 1 235 ? -54.893 29.124 -6.173  1.00 66.15  ? 248  VAL A O     1 
ATOM   1536 C CB    . VAL A 1 235 ? -53.145 27.521 -7.775  1.00 56.24  ? 248  VAL A CB    1 
ATOM   1537 C CG1   . VAL A 1 235 ? -52.107 27.226 -8.851  1.00 60.18  ? 248  VAL A CG1   1 
ATOM   1538 C CG2   . VAL A 1 235 ? -53.513 26.251 -7.018  1.00 52.69  ? 248  VAL A CG2   1 
ATOM   1539 N N     . SER A 1 236 ? -53.402 28.981 -4.503  1.00 63.02  ? 249  SER A N     1 
ATOM   1540 C CA    . SER A 1 236 ? -54.393 29.260 -3.459  1.00 67.95  ? 249  SER A CA    1 
ATOM   1541 C C     . SER A 1 236 ? -55.044 30.637 -3.608  1.00 63.92  ? 249  SER A C     1 
ATOM   1542 O O     . SER A 1 236 ? -56.233 30.798 -3.313  1.00 60.73  ? 249  SER A O     1 
ATOM   1543 C CB    . SER A 1 236 ? -53.774 29.126 -2.065  1.00 83.37  ? 249  SER A CB    1 
ATOM   1544 O OG    . SER A 1 236 ? -53.827 27.781 -1.622  1.00 107.55 ? 249  SER A OG    1 
ATOM   1545 N N     . HIS A 1 237 ? -54.269 31.614 -4.078  1.00 54.44  ? 250  HIS A N     1 
ATOM   1546 C CA    . HIS A 1 237 ? -54.770 32.979 -4.293  1.00 53.27  ? 250  HIS A CA    1 
ATOM   1547 C C     . HIS A 1 237 ? -55.986 33.065 -5.224  1.00 62.50  ? 250  HIS A C     1 
ATOM   1548 O O     . HIS A 1 237 ? -56.758 34.026 -5.149  1.00 64.94  ? 250  HIS A O     1 
ATOM   1549 C CB    . HIS A 1 237 ? -53.652 33.893 -4.806  1.00 51.46  ? 250  HIS A CB    1 
ATOM   1550 C CG    . HIS A 1 237 ? -53.167 33.563 -6.186  1.00 51.61  ? 250  HIS A CG    1 
ATOM   1551 N ND1   . HIS A 1 237 ? -52.259 32.557 -6.439  1.00 53.96  ? 250  HIS A ND1   1 
ATOM   1552 C CD2   . HIS A 1 237 ? -53.442 34.128 -7.384  1.00 51.24  ? 250  HIS A CD2   1 
ATOM   1553 C CE1   . HIS A 1 237 ? -52.005 32.512 -7.735  1.00 46.69  ? 250  HIS A CE1   1 
ATOM   1554 N NE2   . HIS A 1 237 ? -52.706 33.458 -8.330  1.00 44.77  ? 250  HIS A NE2   1 
ATOM   1555 N N     . GLY A 1 238 ? -56.150 32.069 -6.096  1.00 67.91  ? 251  GLY A N     1 
ATOM   1556 C CA    . GLY A 1 238 ? -57.340 31.956 -6.937  1.00 57.13  ? 251  GLY A CA    1 
ATOM   1557 C C     . GLY A 1 238 ? -58.595 31.565 -6.171  1.00 71.99  ? 251  GLY A C     1 
ATOM   1558 O O     . GLY A 1 238 ? -59.677 31.474 -6.758  1.00 68.49  ? 251  GLY A O     1 
ATOM   1559 N N     . GLU A 1 239 ? -58.448 31.313 -4.868  1.00 70.21  ? 252  GLU A N     1 
ATOM   1560 C CA    . GLU A 1 239 ? -59.568 30.976 -3.995  1.00 76.53  ? 252  GLU A CA    1 
ATOM   1561 C C     . GLU A 1 239 ? -60.430 29.854 -4.576  1.00 71.61  ? 252  GLU A C     1 
ATOM   1562 O O     . GLU A 1 239 ? -61.657 29.938 -4.532  1.00 71.64  ? 252  GLU A O     1 
ATOM   1563 C CB    . GLU A 1 239 ? -60.435 32.219 -3.735  1.00 93.32  ? 252  GLU A CB    1 
ATOM   1564 C CG    . GLU A 1 239 ? -59.697 33.408 -3.132  1.00 97.87  ? 252  GLU A CG    1 
ATOM   1565 C CD    . GLU A 1 239 ? -59.160 33.134 -1.739  1.00 114.02 ? 252  GLU A CD    1 
ATOM   1566 O OE1   . GLU A 1 239 ? -59.835 32.427 -0.960  1.00 122.79 ? 252  GLU A OE1   1 
ATOM   1567 O OE2   . GLU A 1 239 ? -58.059 33.632 -1.421  1.00 132.52 ? 252  GLU A OE2   1 
ATOM   1568 N N     . PRO A 1 240 ? -59.793 28.795 -5.117  1.00 63.98  ? 253  PRO A N     1 
ATOM   1569 C CA    . PRO A 1 240 ? -60.562 27.743 -5.781  1.00 67.19  ? 253  PRO A CA    1 
ATOM   1570 C C     . PRO A 1 240 ? -61.450 26.977 -4.809  1.00 74.87  ? 253  PRO A C     1 
ATOM   1571 O O     . PRO A 1 240 ? -60.997 26.612 -3.723  1.00 79.33  ? 253  PRO A O     1 
ATOM   1572 C CB    . PRO A 1 240 ? -59.477 26.820 -6.340  1.00 70.29  ? 253  PRO A CB    1 
ATOM   1573 C CG    . PRO A 1 240 ? -58.332 26.988 -5.410  1.00 64.62  ? 253  PRO A CG    1 
ATOM   1574 C CD    . PRO A 1 240 ? -58.368 28.432 -4.992  1.00 65.60  ? 253  PRO A CD    1 
ATOM   1575 N N     . LEU A 1 241 ? -62.702 26.746 -5.196  1.00 75.27  ? 254  LEU A N     1 
ATOM   1576 C CA    . LEU A 1 241 ? -63.636 25.998 -4.360  1.00 76.44  ? 254  LEU A CA    1 
ATOM   1577 C C     . LEU A 1 241 ? -63.144 24.570 -4.184  1.00 80.43  ? 254  LEU A C     1 
ATOM   1578 O O     . LEU A 1 241 ? -63.237 24.002 -3.094  1.00 98.58  ? 254  LEU A O     1 
ATOM   1579 C CB    . LEU A 1 241 ? -65.040 25.995 -4.973  1.00 75.07  ? 254  LEU A CB    1 
ATOM   1580 C CG    . LEU A 1 241 ? -66.171 25.396 -4.126  1.00 79.76  ? 254  LEU A CG    1 
ATOM   1581 C CD1   . LEU A 1 241 ? -66.293 26.105 -2.783  1.00 80.01  ? 254  LEU A CD1   1 
ATOM   1582 C CD2   . LEU A 1 241 ? -67.493 25.454 -4.879  1.00 78.07  ? 254  LEU A CD2   1 
ATOM   1583 N N     . CYS A 1 242 ? -62.616 24.001 -5.264  1.00 70.05  ? 255  CYS A N     1 
ATOM   1584 C CA    . CYS A 1 242 ? -62.080 22.649 -5.247  1.00 71.38  ? 255  CYS A CA    1 
ATOM   1585 C C     . CYS A 1 242 ? -60.682 22.615 -5.860  1.00 71.45  ? 255  CYS A C     1 
ATOM   1586 O O     . CYS A 1 242 ? -60.346 23.434 -6.728  1.00 63.66  ? 255  CYS A O     1 
ATOM   1587 C CB    . CYS A 1 242 ? -63.014 21.714 -6.012  1.00 81.81  ? 255  CYS A CB    1 
ATOM   1588 S SG    . CYS A 1 242 ? -62.613 19.965 -5.828  1.00 98.30  ? 255  CYS A SG    1 
ATOM   1589 N N     . ILE A 1 243 ? -59.867 21.671 -5.393  1.00 66.15  ? 256  ILE A N     1 
ATOM   1590 C CA    . ILE A 1 243 ? -58.515 21.471 -5.918  1.00 65.51  ? 256  ILE A CA    1 
ATOM   1591 C C     . ILE A 1 243 ? -58.199 19.980 -5.938  1.00 67.20  ? 256  ILE A C     1 
ATOM   1592 O O     . ILE A 1 243 ? -58.697 19.234 -5.104  1.00 73.64  ? 256  ILE A O     1 
ATOM   1593 C CB    . ILE A 1 243 ? -57.456 22.240 -5.096  1.00 61.97  ? 256  ILE A CB    1 
ATOM   1594 C CG1   . ILE A 1 243 ? -56.110 22.240 -5.821  1.00 65.59  ? 256  ILE A CG1   1 
ATOM   1595 C CG2   . ILE A 1 243 ? -57.309 21.656 -3.696  1.00 69.48  ? 256  ILE A CG2   1 
ATOM   1596 C CD1   . ILE A 1 243 ? -55.131 23.246 -5.265  1.00 73.63  ? 256  ILE A CD1   1 
ATOM   1597 N N     . GLY A 1 244 ? -57.390 19.538 -6.893  1.00 65.29  ? 257  GLY A N     1 
ATOM   1598 C CA    . GLY A 1 244 ? -57.120 18.111 -7.019  1.00 69.76  ? 257  GLY A CA    1 
ATOM   1599 C C     . GLY A 1 244 ? -56.038 17.731 -8.001  1.00 69.01  ? 257  GLY A C     1 
ATOM   1600 O O     . GLY A 1 244 ? -55.153 18.529 -8.309  1.00 64.73  ? 257  GLY A O     1 
ATOM   1601 N N     . LEU A 1 245 ? -56.110 16.488 -8.469  1.00 74.89  ? 258  LEU A N     1 
ATOM   1602 C CA    . LEU A 1 245 ? -55.200 15.970 -9.485  1.00 79.26  ? 258  LEU A CA    1 
ATOM   1603 C C     . LEU A 1 245 ? -55.978 15.138 -10.508 1.00 82.74  ? 258  LEU A C     1 
ATOM   1604 O O     . LEU A 1 245 ? -57.092 14.685 -10.229 1.00 79.55  ? 258  LEU A O     1 
ATOM   1605 C CB    . LEU A 1 245 ? -54.110 15.123 -8.832  1.00 76.87  ? 258  LEU A CB    1 
ATOM   1606 C CG    . LEU A 1 245 ? -53.253 15.837 -7.782  1.00 91.03  ? 258  LEU A CG    1 
ATOM   1607 C CD1   . LEU A 1 245 ? -52.442 14.831 -6.980  1.00 98.64  ? 258  LEU A CD1   1 
ATOM   1608 C CD2   . LEU A 1 245 ? -52.339 16.871 -8.427  1.00 90.85  ? 258  LEU A CD2   1 
ATOM   1609 N N     . ASN A 1 246 ? -55.394 14.948 -11.690 1.00 81.48  ? 259  ASN A N     1 
ATOM   1610 C CA    . ASN A 1 246 ? -56.048 14.183 -12.756 1.00 87.98  ? 259  ASN A CA    1 
ATOM   1611 C C     . ASN A 1 246 ? -55.082 13.608 -13.796 1.00 84.07  ? 259  ASN A C     1 
ATOM   1612 O O     . ASN A 1 246 ? -54.030 14.189 -14.071 1.00 86.50  ? 259  ASN A O     1 
ATOM   1613 C CB    . ASN A 1 246 ? -57.120 15.037 -13.457 1.00 88.49  ? 259  ASN A CB    1 
ATOM   1614 C CG    . ASN A 1 246 ? -56.534 16.218 -14.222 1.00 89.39  ? 259  ASN A CG    1 
ATOM   1615 O OD1   . ASN A 1 246 ? -55.976 17.144 -13.632 1.00 81.83  ? 259  ASN A OD1   1 
ATOM   1616 N ND2   . ASN A 1 246 ? -56.673 16.193 -15.545 1.00 82.14  ? 259  ASN A ND2   1 
ATOM   1617 N N     . CYS A 1 247 ? -55.460 12.459 -14.357 1.00 86.88  ? 260  CYS A N     1 
ATOM   1618 C CA    . CYS A 1 247 ? -54.733 11.807 -15.456 1.00 95.73  ? 260  CYS A CA    1 
ATOM   1619 C C     . CYS A 1 247 ? -53.329 11.340 -15.054 1.00 87.64  ? 260  CYS A C     1 
ATOM   1620 O O     . CYS A 1 247 ? -52.976 11.386 -13.877 1.00 79.36  ? 260  CYS A O     1 
ATOM   1621 C CB    . CYS A 1 247 ? -54.678 12.723 -16.688 1.00 96.94  ? 260  CYS A CB    1 
ATOM   1622 S SG    . CYS A 1 247 ? -56.271 13.468 -17.110 1.00 124.46 ? 260  CYS A SG    1 
ATOM   1623 N N     . ALA A 1 248 ? -52.561 10.845 -16.028 1.00 88.65  ? 261  ALA A N     1 
ATOM   1624 C CA    . ALA A 1 248 ? -51.153 10.460 -15.840 1.00 88.51  ? 261  ALA A CA    1 
ATOM   1625 C C     . ALA A 1 248 ? -50.950 9.276  -14.889 1.00 104.52 ? 261  ALA A C     1 
ATOM   1626 O O     . ALA A 1 248 ? -50.207 8.344  -15.208 1.00 103.20 ? 261  ALA A O     1 
ATOM   1627 C CB    . ALA A 1 248 ? -50.326 11.653 -15.380 1.00 75.58  ? 261  ALA A CB    1 
ATOM   1628 N N     . LEU A 1 249 ? -51.601 9.331  -13.727 1.00 111.21 ? 262  LEU A N     1 
ATOM   1629 C CA    . LEU A 1 249 ? -51.489 8.301  -12.699 1.00 112.18 ? 262  LEU A CA    1 
ATOM   1630 C C     . LEU A 1 249 ? -52.814 7.580  -12.460 1.00 106.12 ? 262  LEU A C     1 
ATOM   1631 O O     . LEU A 1 249 ? -53.890 8.161  -12.623 1.00 88.61  ? 262  LEU A O     1 
ATOM   1632 C CB    . LEU A 1 249 ? -51.024 8.936  -11.389 1.00 105.31 ? 262  LEU A CB    1 
ATOM   1633 C CG    . LEU A 1 249 ? -49.600 9.487  -11.382 1.00 103.98 ? 262  LEU A CG    1 
ATOM   1634 C CD1   . LEU A 1 249 ? -49.353 10.261 -10.097 1.00 107.69 ? 262  LEU A CD1   1 
ATOM   1635 C CD2   . LEU A 1 249 ? -48.579 8.369  -11.543 1.00 100.92 ? 262  LEU A CD2   1 
ATOM   1636 N N     . GLY A 1 250 ? -52.720 6.311  -12.070 1.00 114.03 ? 263  GLY A N     1 
ATOM   1637 C CA    . GLY A 1 250 ? -53.884 5.542  -11.643 1.00 112.28 ? 263  GLY A CA    1 
ATOM   1638 C C     . GLY A 1 250 ? -54.249 5.890  -10.213 1.00 108.01 ? 263  GLY A C     1 
ATOM   1639 O O     . GLY A 1 250 ? -53.521 6.622  -9.539  1.00 115.86 ? 263  GLY A O     1 
ATOM   1640 N N     . ALA A 1 251 ? -55.378 5.365  -9.747  1.00 99.12  ? 264  ALA A N     1 
ATOM   1641 C CA    . ALA A 1 251 ? -55.849 5.635  -8.389  1.00 98.33  ? 264  ALA A CA    1 
ATOM   1642 C C     . ALA A 1 251 ? -54.827 5.223  -7.329  1.00 95.86  ? 264  ALA A C     1 
ATOM   1643 O O     . ALA A 1 251 ? -54.660 5.916  -6.326  1.00 88.28  ? 264  ALA A O     1 
ATOM   1644 C CB    . ALA A 1 251 ? -57.174 4.928  -8.141  1.00 103.82 ? 264  ALA A CB    1 
ATOM   1645 N N     . ALA A 1 252 ? -54.150 4.098  -7.566  1.00 109.56 ? 265  ALA A N     1 
ATOM   1646 C CA    . ALA A 1 252 ? -53.196 3.528  -6.608  1.00 109.10 ? 265  ALA A CA    1 
ATOM   1647 C C     . ALA A 1 252 ? -51.929 4.371  -6.475  1.00 108.57 ? 265  ALA A C     1 
ATOM   1648 O O     . ALA A 1 252 ? -51.507 4.692  -5.364  1.00 103.95 ? 265  ALA A O     1 
ATOM   1649 C CB    . ALA A 1 252 ? -52.837 2.106  -7.012  1.00 109.42 ? 265  ALA A CB    1 
ATOM   1650 N N     . GLU A 1 253 ? -51.328 4.718  -7.611  1.00 115.52 ? 266  GLU A N     1 
ATOM   1651 C CA    . GLU A 1 253 ? -50.134 5.566  -7.633  1.00 112.89 ? 266  GLU A CA    1 
ATOM   1652 C C     . GLU A 1 253 ? -50.433 6.992  -7.163  1.00 110.88 ? 266  GLU A C     1 
ATOM   1653 O O     . GLU A 1 253 ? -49.612 7.605  -6.475  1.00 111.63 ? 266  GLU A O     1 
ATOM   1654 C CB    . GLU A 1 253 ? -49.531 5.602  -9.040  1.00 111.08 ? 266  GLU A CB    1 
ATOM   1655 N N     . MET A 1 254 ? -51.612 7.503  -7.524  1.00 112.20 ? 267  MET A N     1 
ATOM   1656 C CA    . MET A 1 254 ? -52.012 8.883  -7.207  1.00 112.74 ? 267  MET A CA    1 
ATOM   1657 C C     . MET A 1 254 ? -52.653 9.057  -5.825  1.00 107.50 ? 267  MET A C     1 
ATOM   1658 O O     . MET A 1 254 ? -53.101 10.153 -5.490  1.00 116.08 ? 267  MET A O     1 
ATOM   1659 C CB    . MET A 1 254 ? -52.985 9.404  -8.271  1.00 105.61 ? 267  MET A CB    1 
ATOM   1660 N N     . ARG A 1 255 ? -52.694 7.992  -5.026  1.00 109.99 ? 268  ARG A N     1 
ATOM   1661 C CA    . ARG A 1 255 ? -53.323 8.039  -3.704  1.00 105.34 ? 268  ARG A CA    1 
ATOM   1662 C C     . ARG A 1 255 ? -52.583 8.928  -2.694  1.00 97.02  ? 268  ARG A C     1 
ATOM   1663 O O     . ARG A 1 255 ? -53.126 9.946  -2.266  1.00 88.52  ? 268  ARG A O     1 
ATOM   1664 C CB    . ARG A 1 255 ? -53.486 6.624  -3.136  1.00 106.14 ? 268  ARG A CB    1 
ATOM   1665 N N     . PRO A 1 256 ? -51.339 8.564  -2.325  1.00 99.58  ? 269  PRO A N     1 
ATOM   1666 C CA    . PRO A 1 256 ? -50.657 9.244  -1.210  1.00 101.50 ? 269  PRO A CA    1 
ATOM   1667 C C     . PRO A 1 256 ? -50.419 10.746 -1.406  1.00 97.44  ? 269  PRO A C     1 
ATOM   1668 O O     . PRO A 1 256 ? -50.202 11.462 -0.428  1.00 100.16 ? 269  PRO A O     1 
ATOM   1669 C CB    . PRO A 1 256 ? -49.319 8.504  -1.113  1.00 101.65 ? 269  PRO A CB    1 
ATOM   1670 C CG    . PRO A 1 256 ? -49.087 7.967  -2.480  1.00 101.99 ? 269  PRO A CG    1 
ATOM   1671 C CD    . PRO A 1 256 ? -50.445 7.610  -3.008  1.00 100.57 ? 269  PRO A CD    1 
ATOM   1672 N N     . PHE A 1 257 ? -50.457 11.214 -2.650  1.00 94.33  ? 270  PHE A N     1 
ATOM   1673 C CA    . PHE A 1 257 ? -50.302 12.637 -2.944  1.00 94.21  ? 270  PHE A CA    1 
ATOM   1674 C C     . PHE A 1 257 ? -51.591 13.401 -2.654  1.00 101.59 ? 270  PHE A C     1 
ATOM   1675 O O     . PHE A 1 257 ? -51.547 14.552 -2.218  1.00 108.30 ? 270  PHE A O     1 
ATOM   1676 C CB    . PHE A 1 257 ? -49.879 12.844 -4.401  1.00 87.22  ? 270  PHE A CB    1 
ATOM   1677 C CG    . PHE A 1 257 ? -48.713 11.990 -4.816  1.00 91.52  ? 270  PHE A CG    1 
ATOM   1678 C CD1   . PHE A 1 257 ? -47.531 12.005 -4.084  1.00 90.23  ? 270  PHE A CD1   1 
ATOM   1679 C CD2   . PHE A 1 257 ? -48.798 11.161 -5.928  1.00 95.52  ? 270  PHE A CD2   1 
ATOM   1680 C CE1   . PHE A 1 257 ? -46.457 11.213 -4.454  1.00 90.50  ? 270  PHE A CE1   1 
ATOM   1681 C CE2   . PHE A 1 257 ? -47.725 10.368 -6.305  1.00 98.15  ? 270  PHE A CE2   1 
ATOM   1682 C CZ    . PHE A 1 257 ? -46.552 10.396 -5.567  1.00 98.65  ? 270  PHE A CZ    1 
ATOM   1683 N N     . ILE A 1 258 ? -52.733 12.757 -2.897  1.00 103.40 ? 271  ILE A N     1 
ATOM   1684 C CA    . ILE A 1 258 ? -54.041 13.364 -2.621  1.00 105.01 ? 271  ILE A CA    1 
ATOM   1685 C C     . ILE A 1 258 ? -54.231 13.644 -1.130  1.00 97.88  ? 271  ILE A C     1 
ATOM   1686 O O     . ILE A 1 258 ? -54.723 14.712 -0.762  1.00 99.77  ? 271  ILE A O     1 
ATOM   1687 C CB    . ILE A 1 258 ? -55.206 12.498 -3.177  1.00 102.51 ? 271  ILE A CB    1 
ATOM   1688 C CG1   . ILE A 1 258 ? -55.479 12.848 -4.648  1.00 102.09 ? 271  ILE A CG1   1 
ATOM   1689 C CG2   . ILE A 1 258 ? -56.488 12.666 -2.363  1.00 106.15 ? 271  ILE A CG2   1 
ATOM   1690 C CD1   . ILE A 1 258 ? -56.170 14.182 -4.875  1.00 90.74  ? 271  ILE A CD1   1 
ATOM   1691 N N     . GLU A 1 259 ? -53.846 12.696 -0.280  1.00 91.24  ? 272  GLU A N     1 
ATOM   1692 C CA    . GLU A 1 259 ? -53.971 12.880 1.168   1.00 95.58  ? 272  GLU A CA    1 
ATOM   1693 C C     . GLU A 1 259 ? -52.980 13.912 1.707   1.00 98.22  ? 272  GLU A C     1 
ATOM   1694 O O     . GLU A 1 259 ? -53.214 14.502 2.763   1.00 112.65 ? 272  GLU A O     1 
ATOM   1695 C CB    . GLU A 1 259 ? -53.837 11.548 1.922   1.00 103.26 ? 272  GLU A CB    1 
ATOM   1696 C CG    . GLU A 1 259 ? -52.480 10.865 1.829   1.00 104.55 ? 272  GLU A CG    1 
ATOM   1697 C CD    . GLU A 1 259 ? -52.415 9.585  2.647   1.00 116.09 ? 272  GLU A CD    1 
ATOM   1698 O OE1   . GLU A 1 259 ? -53.025 9.533  3.737   1.00 100.73 ? 272  GLU A OE1   1 
ATOM   1699 O OE2   . GLU A 1 259 ? -51.748 8.626  2.201   1.00 130.54 ? 272  GLU A OE2   1 
ATOM   1700 N N     . ILE A 1 260 ? -51.880 14.129 0.986   1.00 98.04  ? 273  ILE A N     1 
ATOM   1701 C CA    . ILE A 1 260 ? -50.978 15.241 1.282   1.00 87.21  ? 273  ILE A CA    1 
ATOM   1702 C C     . ILE A 1 260 ? -51.677 16.552 0.940   1.00 78.93  ? 273  ILE A C     1 
ATOM   1703 O O     . ILE A 1 260 ? -51.799 17.430 1.789   1.00 85.99  ? 273  ILE A O     1 
ATOM   1704 C CB    . ILE A 1 260 ? -49.661 15.146 0.490   1.00 87.60  ? 273  ILE A CB    1 
ATOM   1705 N N     . ILE A 1 261 ? -52.154 16.663 -0.300  1.00 75.20  ? 274  ILE A N     1 
ATOM   1706 C CA    . ILE A 1 261 ? -52.891 17.849 -0.762  1.00 75.96  ? 274  ILE A CA    1 
ATOM   1707 C C     . ILE A 1 261 ? -54.088 18.184 0.127   1.00 71.00  ? 274  ILE A C     1 
ATOM   1708 O O     . ILE A 1 261 ? -54.362 19.356 0.376   1.00 74.41  ? 274  ILE A O     1 
ATOM   1709 C CB    . ILE A 1 261 ? -53.372 17.689 -2.229  1.00 78.68  ? 274  ILE A CB    1 
ATOM   1710 C CG1   . ILE A 1 261 ? -52.199 17.899 -3.192  1.00 83.78  ? 274  ILE A CG1   1 
ATOM   1711 C CG2   . ILE A 1 261 ? -54.479 18.685 -2.570  1.00 70.00  ? 274  ILE A CG2   1 
ATOM   1712 C CD1   . ILE A 1 261 ? -52.516 17.580 -4.640  1.00 87.19  ? 274  ILE A CD1   1 
ATOM   1713 N N     . GLY A 1 262 ? -54.794 17.160 0.596   1.00 73.97  ? 275  GLY A N     1 
ATOM   1714 C CA    . GLY A 1 262 ? -56.011 17.352 1.386   1.00 78.89  ? 275  GLY A CA    1 
ATOM   1715 C C     . GLY A 1 262 ? -55.776 17.911 2.777   1.00 81.01  ? 275  GLY A C     1 
ATOM   1716 O O     . GLY A 1 262 ? -56.633 18.605 3.327   1.00 79.52  ? 275  GLY A O     1 
ATOM   1717 N N     . LYS A 1 263 ? -54.617 17.603 3.353   1.00 83.68  ? 276  LYS A N     1 
ATOM   1718 C CA    . LYS A 1 263 ? -54.257 18.110 4.673   1.00 81.80  ? 276  LYS A CA    1 
ATOM   1719 C C     . LYS A 1 263 ? -53.635 19.506 4.597   1.00 82.36  ? 276  LYS A C     1 
ATOM   1720 O O     . LYS A 1 263 ? -53.315 20.096 5.629   1.00 90.78  ? 276  LYS A O     1 
ATOM   1721 C CB    . LYS A 1 263 ? -53.289 17.145 5.363   1.00 80.84  ? 276  LYS A CB    1 
ATOM   1722 N N     . CYS A 1 264 ? -53.468 20.029 3.380   1.00 82.63  ? 277  CYS A N     1 
ATOM   1723 C CA    . CYS A 1 264 ? -52.836 21.334 3.158   1.00 71.48  ? 277  CYS A CA    1 
ATOM   1724 C C     . CYS A 1 264 ? -53.793 22.406 2.614   1.00 69.40  ? 277  CYS A C     1 
ATOM   1725 O O     . CYS A 1 264 ? -53.350 23.505 2.281   1.00 62.49  ? 277  CYS A O     1 
ATOM   1726 C CB    . CYS A 1 264 ? -51.649 21.174 2.202   1.00 65.68  ? 277  CYS A CB    1 
ATOM   1727 S SG    . CYS A 1 264 ? -50.218 20.330 2.923   1.00 75.45  ? 277  CYS A SG    1 
ATOM   1728 N N     . THR A 1 265 ? -55.091 22.108 2.535   1.00 70.41  ? 278  THR A N     1 
ATOM   1729 C CA    . THR A 1 265 ? -56.045 23.057 1.953   1.00 63.99  ? 278  THR A CA    1 
ATOM   1730 C C     . THR A 1 265 ? -57.427 23.019 2.592   1.00 69.16  ? 278  THR A C     1 
ATOM   1731 O O     . THR A 1 265 ? -57.901 21.965 3.016   1.00 76.35  ? 278  THR A O     1 
ATOM   1732 C CB    . THR A 1 265 ? -56.207 22.846 0.433   1.00 63.45  ? 278  THR A CB    1 
ATOM   1733 O OG1   . THR A 1 265 ? -57.121 23.819 -0.085  1.00 68.17  ? 278  THR A OG1   1 
ATOM   1734 C CG2   . THR A 1 265 ? -56.738 21.456 0.114   1.00 75.24  ? 278  THR A CG2   1 
ATOM   1735 N N     . THR A 1 266 ? -58.064 24.190 2.639   1.00 75.20  ? 279  THR A N     1 
ATOM   1736 C CA    . THR A 1 266 ? -59.435 24.340 3.130   1.00 77.43  ? 279  THR A CA    1 
ATOM   1737 C C     . THR A 1 266 ? -60.447 24.001 2.034   1.00 73.63  ? 279  THR A C     1 
ATOM   1738 O O     . THR A 1 266 ? -61.610 23.719 2.317   1.00 79.90  ? 279  THR A O     1 
ATOM   1739 C CB    . THR A 1 266 ? -59.677 25.776 3.642   1.00 83.85  ? 279  THR A CB    1 
ATOM   1740 O OG1   . THR A 1 266 ? -58.792 26.042 4.737   1.00 103.91 ? 279  THR A OG1   1 
ATOM   1741 C CG2   . THR A 1 266 ? -61.114 25.973 4.115   1.00 97.74  ? 279  THR A CG2   1 
ATOM   1742 N N     . ALA A 1 267 ? -59.997 24.019 0.783   1.00 74.92  ? 280  ALA A N     1 
ATOM   1743 C CA    . ALA A 1 267 ? -60.855 23.691 -0.351  1.00 76.53  ? 280  ALA A CA    1 
ATOM   1744 C C     . ALA A 1 267 ? -61.309 22.231 -0.328  1.00 78.76  ? 280  ALA A C     1 
ATOM   1745 O O     . ALA A 1 267 ? -60.737 21.398 0.378   1.00 75.35  ? 280  ALA A O     1 
ATOM   1746 C CB    . ALA A 1 267 ? -60.123 23.979 -1.654  1.00 73.11  ? 280  ALA A CB    1 
ATOM   1747 N N     . TYR A 1 268 ? -62.341 21.929 -1.112  1.00 80.92  ? 281  TYR A N     1 
ATOM   1748 C CA    . TYR A 1 268 ? -62.710 20.544 -1.383  1.00 80.71  ? 281  TYR A CA    1 
ATOM   1749 C C     . TYR A 1 268 ? -61.633 19.936 -2.277  1.00 73.12  ? 281  TYR A C     1 
ATOM   1750 O O     . TYR A 1 268 ? -60.843 20.657 -2.882  1.00 68.53  ? 281  TYR A O     1 
ATOM   1751 C CB    . TYR A 1 268 ? -64.074 20.458 -2.065  1.00 84.44  ? 281  TYR A CB    1 
ATOM   1752 C CG    . TYR A 1 268 ? -65.224 20.976 -1.228  1.00 89.60  ? 281  TYR A CG    1 
ATOM   1753 C CD1   . TYR A 1 268 ? -65.877 20.151 -0.318  1.00 92.78  ? 281  TYR A CD1   1 
ATOM   1754 C CD2   . TYR A 1 268 ? -65.667 22.290 -1.356  1.00 96.27  ? 281  TYR A CD2   1 
ATOM   1755 C CE1   . TYR A 1 268 ? -66.936 20.621 0.442   1.00 91.47  ? 281  TYR A CE1   1 
ATOM   1756 C CE2   . TYR A 1 268 ? -66.723 22.769 -0.598  1.00 94.68  ? 281  TYR A CE2   1 
ATOM   1757 C CZ    . TYR A 1 268 ? -67.354 21.931 0.297   1.00 94.12  ? 281  TYR A CZ    1 
ATOM   1758 O OH    . TYR A 1 268 ? -68.401 22.408 1.046   1.00 119.72 ? 281  TYR A OH    1 
ATOM   1759 N N     . VAL A 1 269 ? -61.597 18.612 -2.356  1.00 77.99  ? 282  VAL A N     1 
ATOM   1760 C CA    . VAL A 1 269 ? -60.561 17.928 -3.118  1.00 77.10  ? 282  VAL A CA    1 
ATOM   1761 C C     . VAL A 1 269 ? -61.148 17.161 -4.301  1.00 86.94  ? 282  VAL A C     1 
ATOM   1762 O O     . VAL A 1 269 ? -61.849 16.166 -4.114  1.00 89.96  ? 282  VAL A O     1 
ATOM   1763 C CB    . VAL A 1 269 ? -59.741 16.979 -2.223  1.00 73.35  ? 282  VAL A CB    1 
ATOM   1764 C CG1   . VAL A 1 269 ? -58.767 16.153 -3.053  1.00 77.69  ? 282  VAL A CG1   1 
ATOM   1765 C CG2   . VAL A 1 269 ? -58.983 17.782 -1.178  1.00 73.55  ? 282  VAL A CG2   1 
ATOM   1766 N N     . LEU A 1 270 ? -60.861 17.637 -5.514  1.00 87.49  ? 283  LEU A N     1 
ATOM   1767 C CA    . LEU A 1 270 ? -61.179 16.896 -6.736  1.00 94.52  ? 283  LEU A CA    1 
ATOM   1768 C C     . LEU A 1 270 ? -60.170 15.767 -6.899  1.00 92.80  ? 283  LEU A C     1 
ATOM   1769 O O     . LEU A 1 270 ? -59.077 15.824 -6.336  1.00 87.65  ? 283  LEU A O     1 
ATOM   1770 C CB    . LEU A 1 270 ? -61.135 17.816 -7.963  1.00 81.62  ? 283  LEU A CB    1 
ATOM   1771 N N     . CYS A 1 271 ? -60.546 14.735 -7.649  1.00 91.30  ? 284  CYS A N     1 
ATOM   1772 C CA    . CYS A 1 271 ? -59.619 13.654 -7.981  1.00 91.29  ? 284  CYS A CA    1 
ATOM   1773 C C     . CYS A 1 271 ? -60.189 12.719 -9.042  1.00 91.46  ? 284  CYS A C     1 
ATOM   1774 O O     . CYS A 1 271 ? -61.102 11.950 -8.758  1.00 99.29  ? 284  CYS A O     1 
ATOM   1775 C CB    . CYS A 1 271 ? -59.267 12.838 -6.740  1.00 88.47  ? 284  CYS A CB    1 
ATOM   1776 S SG    . CYS A 1 271 ? -58.132 11.478 -7.085  1.00 94.93  ? 284  CYS A SG    1 
ATOM   1777 N N     . TYR A 1 272 ? -59.644 12.780 -10.257 1.00 96.95  ? 285  TYR A N     1 
ATOM   1778 C CA    . TYR A 1 272 ? -60.037 11.847 -11.319 1.00 96.88  ? 285  TYR A CA    1 
ATOM   1779 C C     . TYR A 1 272 ? -58.835 11.171 -12.001 1.00 90.09  ? 285  TYR A C     1 
ATOM   1780 O O     . TYR A 1 272 ? -58.319 11.675 -12.999 1.00 88.75  ? 285  TYR A O     1 
ATOM   1781 C CB    . TYR A 1 272 ? -61.002 12.485 -12.342 1.00 96.86  ? 285  TYR A CB    1 
ATOM   1782 C CG    . TYR A 1 272 ? -60.704 13.884 -12.855 1.00 93.23  ? 285  TYR A CG    1 
ATOM   1783 C CD1   . TYR A 1 272 ? -60.748 14.992 -12.010 1.00 94.97  ? 285  TYR A CD1   1 
ATOM   1784 C CD2   . TYR A 1 272 ? -60.465 14.107 -14.210 1.00 92.01  ? 285  TYR A CD2   1 
ATOM   1785 C CE1   . TYR A 1 272 ? -60.509 16.269 -12.491 1.00 87.62  ? 285  TYR A CE1   1 
ATOM   1786 C CE2   . TYR A 1 272 ? -60.229 15.381 -14.698 1.00 89.44  ? 285  TYR A CE2   1 
ATOM   1787 C CZ    . TYR A 1 272 ? -60.252 16.457 -13.834 1.00 83.48  ? 285  TYR A CZ    1 
ATOM   1788 O OH    . TYR A 1 272 ? -60.019 17.724 -14.314 1.00 86.13  ? 285  TYR A OH    1 
ATOM   1789 N N     . PRO A 1 273 ? -58.390 10.019 -11.452 1.00 89.23  ? 286  PRO A N     1 
ATOM   1790 C CA    . PRO A 1 273 ? -57.295 9.212  -12.006 1.00 91.00  ? 286  PRO A CA    1 
ATOM   1791 C C     . PRO A 1 273 ? -57.642 8.472  -13.304 1.00 91.14  ? 286  PRO A C     1 
ATOM   1792 O O     . PRO A 1 273 ? -58.635 8.793  -13.959 1.00 90.20  ? 286  PRO A O     1 
ATOM   1793 C CB    . PRO A 1 273 ? -57.001 8.193  -10.889 1.00 99.58  ? 286  PRO A CB    1 
ATOM   1794 C CG    . PRO A 1 273 ? -57.664 8.721  -9.669  1.00 100.31 ? 286  PRO A CG    1 
ATOM   1795 C CD    . PRO A 1 273 ? -58.854 9.476  -10.163 1.00 95.58  ? 286  PRO A CD    1 
ATOM   1796 N N     . ASN A 1 274 ? -56.817 7.485  -13.651 1.00 98.70  ? 287  ASN A N     1 
ATOM   1797 C CA    . ASN A 1 274 ? -56.962 6.718  -14.887 1.00 111.21 ? 287  ASN A CA    1 
ATOM   1798 C C     . ASN A 1 274 ? -56.784 5.217  -14.700 1.00 118.30 ? 287  ASN A C     1 
ATOM   1799 O O     . ASN A 1 274 ? -56.374 4.751  -13.637 1.00 119.54 ? 287  ASN A O     1 
ATOM   1800 C CB    . ASN A 1 274 ? -55.929 7.200  -15.912 1.00 117.78 ? 287  ASN A CB    1 
ATOM   1801 C CG    . ASN A 1 274 ? -56.353 8.466  -16.613 1.00 125.49 ? 287  ASN A CG    1 
ATOM   1802 O OD1   . ASN A 1 274 ? -57.511 8.855  -16.545 1.00 131.70 ? 287  ASN A OD1   1 
ATOM   1803 N ND2   . ASN A 1 274 ? -55.420 9.102  -17.315 1.00 118.90 ? 287  ASN A ND2   1 
ATOM   1804 N N     . ALA A 1 275 ? -57.103 4.472  -15.756 1.00 118.83 ? 288  ALA A N     1 
ATOM   1805 C CA    . ALA A 1 275 ? -56.748 3.061  -15.864 1.00 109.14 ? 288  ALA A CA    1 
ATOM   1806 C C     . ALA A 1 275 ? -55.315 2.937  -16.406 1.00 108.09 ? 288  ALA A C     1 
ATOM   1807 O O     . ALA A 1 275 ? -54.651 3.942  -16.663 1.00 107.83 ? 288  ALA A O     1 
ATOM   1808 C CB    . ALA A 1 275 ? -57.733 2.346  -16.775 1.00 106.93 ? 288  ALA A CB    1 
ATOM   1809 N N     . GLY A 1 276 ? -54.840 1.707  -16.577 1.00 117.77 ? 289  GLY A N     1 
ATOM   1810 C CA    . GLY A 1 276 ? -53.501 1.464  -17.121 1.00 112.85 ? 289  GLY A CA    1 
ATOM   1811 C C     . GLY A 1 276 ? -53.423 1.687  -18.622 1.00 107.25 ? 289  GLY A C     1 
ATOM   1812 O O     . GLY A 1 276 ? -53.860 0.848  -19.413 1.00 92.38  ? 289  GLY A O     1 
ATOM   1813 N N     . PHE A 1 298 ? -63.028 2.429  -6.480  1.00 151.40 ? 311  PHE A N     1 
ATOM   1814 C CA    . PHE A 1 298 ? -62.012 2.828  -5.509  1.00 152.93 ? 311  PHE A CA    1 
ATOM   1815 C C     . PHE A 1 298 ? -62.568 3.810  -4.472  1.00 146.18 ? 311  PHE A C     1 
ATOM   1816 O O     . PHE A 1 298 ? -62.502 5.032  -4.653  1.00 110.09 ? 311  PHE A O     1 
ATOM   1817 C CB    . PHE A 1 298 ? -60.792 3.428  -6.225  1.00 145.53 ? 311  PHE A CB    1 
ATOM   1818 C CG    . PHE A 1 298 ? -59.739 2.414  -6.582  1.00 149.74 ? 311  PHE A CG    1 
ATOM   1819 C CD1   . PHE A 1 298 ? -59.783 1.737  -7.796  1.00 145.12 ? 311  PHE A CD1   1 
ATOM   1820 C CD2   . PHE A 1 298 ? -58.702 2.135  -5.700  1.00 143.01 ? 311  PHE A CD2   1 
ATOM   1821 C CE1   . PHE A 1 298 ? -58.810 0.804  -8.122  1.00 140.64 ? 311  PHE A CE1   1 
ATOM   1822 C CE2   . PHE A 1 298 ? -57.728 1.203  -6.021  1.00 142.24 ? 311  PHE A CE2   1 
ATOM   1823 C CZ    . PHE A 1 298 ? -57.782 0.536  -7.233  1.00 140.05 ? 311  PHE A CZ    1 
ATOM   1824 N N     . ALA A 1 299 ? -63.112 3.258  -3.387  1.00 141.48 ? 312  ALA A N     1 
ATOM   1825 C CA    . ALA A 1 299 ? -63.643 4.053  -2.279  1.00 129.72 ? 312  ALA A CA    1 
ATOM   1826 C C     . ALA A 1 299 ? -62.512 4.514  -1.358  1.00 127.97 ? 312  ALA A C     1 
ATOM   1827 O O     . ALA A 1 299 ? -61.726 3.699  -0.870  1.00 115.77 ? 312  ALA A O     1 
ATOM   1828 C CB    . ALA A 1 299 ? -64.669 3.248  -1.497  1.00 133.97 ? 312  ALA A CB    1 
ATOM   1829 N N     . MET A 1 300 ? -62.447 5.823  -1.119  1.00 123.20 ? 313  MET A N     1 
ATOM   1830 C CA    . MET A 1 300 ? -61.363 6.430  -0.348  1.00 106.92 ? 313  MET A CA    1 
ATOM   1831 C C     . MET A 1 300 ? -61.597 6.346  1.164   1.00 115.73 ? 313  MET A C     1 
ATOM   1832 O O     . MET A 1 300 ? -62.651 5.895  1.623   1.00 109.91 ? 313  MET A O     1 
ATOM   1833 C CB    . MET A 1 300 ? -61.200 7.894  -0.758  1.00 91.75  ? 313  MET A CB    1 
ATOM   1834 N N     . ASP A 1 301 ? -60.594 6.787  1.925   1.00 120.83 ? 314  ASP A N     1 
ATOM   1835 C CA    . ASP A 1 301 ? -60.665 6.868  3.384   1.00 120.51 ? 314  ASP A CA    1 
ATOM   1836 C C     . ASP A 1 301 ? -60.741 8.334  3.829   1.00 123.76 ? 314  ASP A C     1 
ATOM   1837 O O     . ASP A 1 301 ? -59.831 8.842  4.489   1.00 110.35 ? 314  ASP A O     1 
ATOM   1838 C CB    . ASP A 1 301 ? -59.441 6.191  4.006   1.00 119.92 ? 314  ASP A CB    1 
ATOM   1839 N N     . GLY A 1 302 ? -61.833 9.003  3.460   1.00 132.52 ? 315  GLY A N     1 
ATOM   1840 C CA    . GLY A 1 302 ? -62.033 10.422 3.771   1.00 118.91 ? 315  GLY A CA    1 
ATOM   1841 C C     . GLY A 1 302 ? -61.107 11.344 2.998   1.00 112.40 ? 315  GLY A C     1 
ATOM   1842 O O     . GLY A 1 302 ? -60.762 12.426 3.475   1.00 100.23 ? 315  GLY A O     1 
ATOM   1843 N N     . LEU A 1 303 ? -60.724 10.922 1.793   1.00 114.02 ? 316  LEU A N     1 
ATOM   1844 C CA    . LEU A 1 303 ? -59.693 11.607 1.009   1.00 112.37 ? 316  LEU A CA    1 
ATOM   1845 C C     . LEU A 1 303 ? -60.246 12.490 -0.119  1.00 103.53 ? 316  LEU A C     1 
ATOM   1846 O O     . LEU A 1 303 ? -59.705 13.567 -0.378  1.00 106.09 ? 316  LEU A O     1 
ATOM   1847 C CB    . LEU A 1 303 ? -58.716 10.578 0.429   1.00 109.78 ? 316  LEU A CB    1 
ATOM   1848 N N     . VAL A 1 304 ? -61.311 12.039 -0.783  1.00 100.55 ? 317  VAL A N     1 
ATOM   1849 C CA    . VAL A 1 304 ? -61.857 12.733 -1.957  1.00 94.53  ? 317  VAL A CA    1 
ATOM   1850 C C     . VAL A 1 304 ? -63.247 13.329 -1.711  1.00 89.16  ? 317  VAL A C     1 
ATOM   1851 O O     . VAL A 1 304 ? -64.064 12.742 -1.005  1.00 91.62  ? 317  VAL A O     1 
ATOM   1852 C CB    . VAL A 1 304 ? -61.946 11.776 -3.159  1.00 94.02  ? 317  VAL A CB    1 
ATOM   1853 N N     . ASN A 1 305 ? -63.499 14.500 -2.298  1.00 86.25  ? 318  ASN A N     1 
ATOM   1854 C CA    . ASN A 1 305 ? -64.816 15.153 -2.257  1.00 82.25  ? 318  ASN A CA    1 
ATOM   1855 C C     . ASN A 1 305 ? -65.545 15.079 -3.606  1.00 80.67  ? 318  ASN A C     1 
ATOM   1856 O O     . ASN A 1 305 ? -66.773 14.999 -3.653  1.00 79.74  ? 318  ASN A O     1 
ATOM   1857 C CB    . ASN A 1 305 ? -64.673 16.612 -1.818  1.00 74.18  ? 318  ASN A CB    1 
ATOM   1858 N N     . ILE A 1 306 ? -64.785 15.130 -4.698  1.00 84.11  ? 319  ILE A N     1 
ATOM   1859 C CA    . ILE A 1 306 ? -65.317 14.867 -6.036  1.00 84.52  ? 319  ILE A CA    1 
ATOM   1860 C C     . ILE A 1 306 ? -64.481 13.768 -6.687  1.00 83.62  ? 319  ILE A C     1 
ATOM   1861 O O     . ILE A 1 306 ? -63.268 13.702 -6.488  1.00 88.51  ? 319  ILE A O     1 
ATOM   1862 C CB    . ILE A 1 306 ? -65.317 16.134 -6.919  1.00 81.72  ? 319  ILE A CB    1 
ATOM   1863 C CG1   . ILE A 1 306 ? -66.147 17.240 -6.255  1.00 81.08  ? 319  ILE A CG1   1 
ATOM   1864 C CG2   . ILE A 1 306 ? -65.867 15.818 -8.307  1.00 79.48  ? 319  ILE A CG2   1 
ATOM   1865 C CD1   . ILE A 1 306 ? -66.139 18.559 -6.995  1.00 80.03  ? 319  ILE A CD1   1 
ATOM   1866 N N     . VAL A 1 307 ? -65.139 12.905 -7.454  1.00 88.76  ? 320  VAL A N     1 
ATOM   1867 C CA    . VAL A 1 307 ? -64.483 11.765 -8.089  1.00 92.48  ? 320  VAL A CA    1 
ATOM   1868 C C     . VAL A 1 307 ? -64.891 11.654 -9.558  1.00 95.83  ? 320  VAL A C     1 
ATOM   1869 O O     . VAL A 1 307 ? -66.052 11.872 -9.905  1.00 91.37  ? 320  VAL A O     1 
ATOM   1870 C CB    . VAL A 1 307 ? -64.844 10.448 -7.373  1.00 84.26  ? 320  VAL A CB    1 
ATOM   1871 N N     . GLY A 1 308 ? -63.934 11.316 -10.417 1.00 89.44  ? 321  GLY A N     1 
ATOM   1872 C CA    . GLY A 1 308 ? -64.225 11.069 -11.827 1.00 88.12  ? 321  GLY A CA    1 
ATOM   1873 C C     . GLY A 1 308 ? -63.180 10.187 -12.479 1.00 88.96  ? 321  GLY A C     1 
ATOM   1874 O O     . GLY A 1 308 ? -62.458 9.457  -11.799 1.00 83.74  ? 321  GLY A O     1 
ATOM   1875 N N     . GLY A 1 309 ? -63.098 10.268 -13.803 1.00 93.83  ? 322  GLY A N     1 
ATOM   1876 C CA    . GLY A 1 309 ? -62.080 9.554  -14.568 1.00 93.77  ? 322  GLY A CA    1 
ATOM   1877 C C     . GLY A 1 309 ? -61.483 10.435 -15.649 1.00 97.45  ? 322  GLY A C     1 
ATOM   1878 O O     . GLY A 1 309 ? -62.005 11.515 -15.940 1.00 90.15  ? 322  GLY A O     1 
ATOM   1879 N N     . CYS A 1 310 ? -60.376 9.978  -16.228 1.00 94.17  ? 323  CYS A N     1 
ATOM   1880 C CA    . CYS A 1 310 ? -59.735 10.669 -17.346 1.00 100.13 ? 323  CYS A CA    1 
ATOM   1881 C C     . CYS A 1 310 ? -59.425 9.620  -18.433 1.00 96.81  ? 323  CYS A C     1 
ATOM   1882 O O     . CYS A 1 310 ? -60.319 8.848  -18.792 1.00 98.52  ? 323  CYS A O     1 
ATOM   1883 C CB    . CYS A 1 310 ? -58.519 11.470 -16.838 1.00 111.68 ? 323  CYS A CB    1 
ATOM   1884 S SG    . CYS A 1 310 ? -57.291 11.989 -18.061 1.00 125.92 ? 323  CYS A SG    1 
ATOM   1885 N N     . CYS A 1 311 ? -58.199 9.576  -18.954 1.00 94.61  ? 324  CYS A N     1 
ATOM   1886 C CA    . CYS A 1 311 ? -57.833 8.606  -20.000 1.00 94.50  ? 324  CYS A CA    1 
ATOM   1887 C C     . CYS A 1 311 ? -58.168 7.165  -19.601 1.00 89.88  ? 324  CYS A C     1 
ATOM   1888 O O     . CYS A 1 311 ? -57.641 6.645  -18.618 1.00 93.90  ? 324  CYS A O     1 
ATOM   1889 C CB    . CYS A 1 311 ? -56.343 8.715  -20.340 1.00 95.55  ? 324  CYS A CB    1 
ATOM   1890 N N     . GLY A 1 312 ? -59.053 6.533  -20.369 1.00 90.74  ? 325  GLY A N     1 
ATOM   1891 C CA    . GLY A 1 312 ? -59.497 5.167  -20.093 1.00 94.88  ? 325  GLY A CA    1 
ATOM   1892 C C     . GLY A 1 312 ? -60.906 5.092  -19.528 1.00 99.37  ? 325  GLY A C     1 
ATOM   1893 O O     . GLY A 1 312 ? -61.583 4.072  -19.675 1.00 108.55 ? 325  GLY A O     1 
ATOM   1894 N N     . SER A 1 313 ? -61.350 6.170  -18.883 1.00 96.19  ? 326  SER A N     1 
ATOM   1895 C CA    . SER A 1 313 ? -62.675 6.219  -18.267 1.00 93.24  ? 326  SER A CA    1 
ATOM   1896 C C     . SER A 1 313 ? -63.784 6.292  -19.313 1.00 94.54  ? 326  SER A C     1 
ATOM   1897 O O     . SER A 1 313 ? -63.752 7.141  -20.202 1.00 96.02  ? 326  SER A O     1 
ATOM   1898 C CB    . SER A 1 313 ? -62.781 7.423  -17.332 1.00 91.12  ? 326  SER A CB    1 
ATOM   1899 N N     . THR A 1 314 ? -64.758 5.393  -19.190 1.00 100.06 ? 327  THR A N     1 
ATOM   1900 C CA    . THR A 1 314 ? -65.942 5.372  -20.047 1.00 98.91  ? 327  THR A CA    1 
ATOM   1901 C C     . THR A 1 314 ? -67.170 5.655  -19.179 1.00 99.62  ? 327  THR A C     1 
ATOM   1902 O O     . THR A 1 314 ? -67.056 5.715  -17.955 1.00 99.83  ? 327  THR A O     1 
ATOM   1903 C CB    . THR A 1 314 ? -66.103 4.002  -20.739 1.00 102.23 ? 327  THR A CB    1 
ATOM   1904 O OG1   . THR A 1 314 ? -66.251 2.974  -19.752 1.00 104.60 ? 327  THR A OG1   1 
ATOM   1905 C CG2   . THR A 1 314 ? -64.895 3.690  -21.612 1.00 99.81  ? 327  THR A CG2   1 
ATOM   1906 N N     . PRO A 1 315 ? -68.348 5.851  -19.801 1.00 101.94 ? 328  PRO A N     1 
ATOM   1907 C CA    . PRO A 1 315 ? -69.558 5.986  -18.982 1.00 105.68 ? 328  PRO A CA    1 
ATOM   1908 C C     . PRO A 1 315 ? -69.860 4.745  -18.131 1.00 111.49 ? 328  PRO A C     1 
ATOM   1909 O O     . PRO A 1 315 ? -70.463 4.864  -17.062 1.00 112.49 ? 328  PRO A O     1 
ATOM   1910 C CB    . PRO A 1 315 ? -70.659 6.222  -20.021 1.00 106.08 ? 328  PRO A CB    1 
ATOM   1911 C CG    . PRO A 1 315 ? -69.952 6.836  -21.180 1.00 100.29 ? 328  PRO A CG    1 
ATOM   1912 C CD    . PRO A 1 315 ? -68.613 6.159  -21.218 1.00 101.35 ? 328  PRO A CD    1 
ATOM   1913 N N     . ASP A 1 316 ? -69.434 3.574  -18.602 1.00 114.93 ? 329  ASP A N     1 
ATOM   1914 C CA    . ASP A 1 316 ? -69.602 2.325  -17.858 1.00 117.52 ? 329  ASP A CA    1 
ATOM   1915 C C     . ASP A 1 316 ? -68.746 2.310  -16.579 1.00 118.56 ? 329  ASP A C     1 
ATOM   1916 O O     . ASP A 1 316 ? -69.113 1.671  -15.591 1.00 118.97 ? 329  ASP A O     1 
ATOM   1917 C CB    . ASP A 1 316 ? -69.255 1.128  -18.755 1.00 119.85 ? 329  ASP A CB    1 
ATOM   1918 C CG    . ASP A 1 316 ? -69.895 -0.171 -18.288 1.00 128.02 ? 329  ASP A CG    1 
ATOM   1919 O OD1   . ASP A 1 316 ? -70.667 -0.160 -17.305 1.00 137.93 ? 329  ASP A OD1   1 
ATOM   1920 O OD2   . ASP A 1 316 ? -69.628 -1.215 -18.918 1.00 137.41 ? 329  ASP A OD2   1 
ATOM   1921 N N     . HIS A 1 317 ? -67.612 3.011  -16.602 1.00 113.54 ? 330  HIS A N     1 
ATOM   1922 C CA    . HIS A 1 317 ? -66.790 3.195  -15.400 1.00 112.45 ? 330  HIS A CA    1 
ATOM   1923 C C     . HIS A 1 317 ? -67.515 4.097  -14.406 1.00 112.37 ? 330  HIS A C     1 
ATOM   1924 O O     . HIS A 1 317 ? -67.759 3.703  -13.267 1.00 113.18 ? 330  HIS A O     1 
ATOM   1925 C CB    . HIS A 1 317 ? -65.430 3.823  -15.739 1.00 105.84 ? 330  HIS A CB    1 
ATOM   1926 C CG    . HIS A 1 317 ? -64.459 2.881  -16.379 1.00 99.48  ? 330  HIS A CG    1 
ATOM   1927 N ND1   . HIS A 1 317 ? -64.625 2.389  -17.656 1.00 100.78 ? 330  HIS A ND1   1 
ATOM   1928 C CD2   . HIS A 1 317 ? -63.294 2.362  -15.925 1.00 95.45  ? 330  HIS A CD2   1 
ATOM   1929 C CE1   . HIS A 1 317 ? -63.611 1.598  -17.956 1.00 99.12  ? 330  HIS A CE1   1 
ATOM   1930 N NE2   . HIS A 1 317 ? -62.789 1.565  -16.923 1.00 99.31  ? 330  HIS A NE2   1 
ATOM   1931 N N     . ILE A 1 318 ? -67.860 5.303  -14.857 1.00 114.28 ? 331  ILE A N     1 
ATOM   1932 C CA    . ILE A 1 318 ? -68.521 6.313  -14.020 1.00 115.87 ? 331  ILE A CA    1 
ATOM   1933 C C     . ILE A 1 318 ? -69.711 5.767  -13.228 1.00 121.57 ? 331  ILE A C     1 
ATOM   1934 O O     . ILE A 1 318 ? -69.945 6.189  -12.095 1.00 132.37 ? 331  ILE A O     1 
ATOM   1935 C CB    . ILE A 1 318 ? -69.010 7.506  -14.865 1.00 111.45 ? 331  ILE A CB    1 
ATOM   1936 N N     . ARG A 1 319 ? -70.460 4.841  -13.826 1.00 120.70 ? 332  ARG A N     1 
ATOM   1937 C CA    . ARG A 1 319 ? -71.554 4.162  -13.132 1.00 120.72 ? 332  ARG A CA    1 
ATOM   1938 C C     . ARG A 1 319 ? -71.034 3.396  -11.918 1.00 123.58 ? 332  ARG A C     1 
ATOM   1939 O O     . ARG A 1 319 ? -71.596 3.502  -10.828 1.00 135.04 ? 332  ARG A O     1 
ATOM   1940 C CB    . ARG A 1 319 ? -72.280 3.203  -14.078 1.00 129.55 ? 332  ARG A CB    1 
ATOM   1941 N N     . GLU A 1 320 ? -69.959 2.633  -12.115 1.00 123.94 ? 333  GLU A N     1 
ATOM   1942 C CA    . GLU A 1 320 ? -69.298 1.909  -11.025 1.00 117.06 ? 333  GLU A CA    1 
ATOM   1943 C C     . GLU A 1 320 ? -68.778 2.868  -9.951  1.00 112.57 ? 333  GLU A C     1 
ATOM   1944 O O     . GLU A 1 320 ? -68.888 2.589  -8.757  1.00 113.60 ? 333  GLU A O     1 
ATOM   1945 C CB    . GLU A 1 320 ? -68.144 1.061  -11.567 1.00 114.68 ? 333  GLU A CB    1 
ATOM   1946 N N     . ILE A 1 321 ? -68.211 3.992  -10.384 1.00 110.38 ? 334  ILE A N     1 
ATOM   1947 C CA    . ILE A 1 321 ? -67.774 5.046  -9.464  1.00 109.73 ? 334  ILE A CA    1 
ATOM   1948 C C     . ILE A 1 321 ? -68.972 5.626  -8.706  1.00 112.98 ? 334  ILE A C     1 
ATOM   1949 O O     . ILE A 1 321 ? -68.898 5.844  -7.495  1.00 116.34 ? 334  ILE A O     1 
ATOM   1950 C CB    . ILE A 1 321 ? -67.017 6.183  -10.205 1.00 107.70 ? 334  ILE A CB    1 
ATOM   1951 C CG1   . ILE A 1 321 ? -65.566 5.773  -10.508 1.00 107.23 ? 334  ILE A CG1   1 
ATOM   1952 C CG2   . ILE A 1 321 ? -67.010 7.473  -9.387  1.00 109.19 ? 334  ILE A CG2   1 
ATOM   1953 C CD1   . ILE A 1 321 ? -65.387 4.950  -11.764 1.00 105.13 ? 334  ILE A CD1   1 
ATOM   1954 N N     . ALA A 1 322 ? -70.066 5.868  -9.425  1.00 112.65 ? 335  ALA A N     1 
ATOM   1955 C CA    . ALA A 1 322 ? -71.261 6.489  -8.850  1.00 112.92 ? 335  ALA A CA    1 
ATOM   1956 C C     . ALA A 1 322 ? -71.904 5.622  -7.770  1.00 116.74 ? 335  ALA A C     1 
ATOM   1957 O O     . ALA A 1 322 ? -72.231 6.112  -6.688  1.00 111.86 ? 335  ALA A O     1 
ATOM   1958 C CB    . ALA A 1 322 ? -72.272 6.792  -9.944  1.00 115.78 ? 335  ALA A CB    1 
ATOM   1959 N N     . GLU A 1 323 ? -72.082 4.338  -8.072  1.00 121.97 ? 336  GLU A N     1 
ATOM   1960 C CA    . GLU A 1 323 ? -72.704 3.396  -7.141  1.00 125.30 ? 336  GLU A CA    1 
ATOM   1961 C C     . GLU A 1 323 ? -71.832 3.125  -5.912  1.00 133.15 ? 336  GLU A C     1 
ATOM   1962 O O     . GLU A 1 323 ? -72.351 2.805  -4.841  1.00 144.19 ? 336  GLU A O     1 
ATOM   1963 C CB    . GLU A 1 323 ? -73.022 2.080  -7.854  1.00 127.21 ? 336  GLU A CB    1 
ATOM   1964 N N     . ALA A 1 324 ? -70.514 3.254  -6.070  1.00 128.26 ? 337  ALA A N     1 
ATOM   1965 C CA    . ALA A 1 324 ? -69.569 3.059  -4.967  1.00 124.53 ? 337  ALA A CA    1 
ATOM   1966 C C     . ALA A 1 324 ? -69.600 4.236  -3.993  1.00 124.06 ? 337  ALA A C     1 
ATOM   1967 O O     . ALA A 1 324 ? -69.738 4.046  -2.783  1.00 130.11 ? 337  ALA A O     1 
ATOM   1968 C CB    . ALA A 1 324 ? -68.160 2.863  -5.507  1.00 119.11 ? 337  ALA A CB    1 
ATOM   1969 N N     . VAL A 1 325 ? -69.480 5.448  -4.531  1.00 120.28 ? 338  VAL A N     1 
ATOM   1970 C CA    . VAL A 1 325 ? -69.458 6.671  -3.723  1.00 114.82 ? 338  VAL A CA    1 
ATOM   1971 C C     . VAL A 1 325 ? -70.835 7.081  -3.180  1.00 115.59 ? 338  VAL A C     1 
ATOM   1972 O O     . VAL A 1 325 ? -70.921 7.981  -2.343  1.00 109.63 ? 338  VAL A O     1 
ATOM   1973 C CB    . VAL A 1 325 ? -68.889 7.856  -4.532  1.00 103.13 ? 338  VAL A CB    1 
ATOM   1974 N N     . LYS A 1 326 ? -71.894 6.422  -3.656  1.00 121.51 ? 339  LYS A N     1 
ATOM   1975 C CA    . LYS A 1 326 ? -73.285 6.767  -3.319  1.00 126.98 ? 339  LYS A CA    1 
ATOM   1976 C C     . LYS A 1 326 ? -73.534 7.064  -1.839  1.00 131.12 ? 339  LYS A C     1 
ATOM   1977 O O     . LYS A 1 326 ? -74.102 8.105  -1.501  1.00 133.56 ? 339  LYS A O     1 
ATOM   1978 C CB    . LYS A 1 326 ? -74.228 5.643  -3.764  1.00 124.34 ? 339  LYS A CB    1 
ATOM   1979 N N     . ASN A 1 327 ? -73.111 6.150  -0.968  1.00 129.49 ? 340  ASN A N     1 
ATOM   1980 C CA    . ASN A 1 327 ? -73.383 6.258  0.468   1.00 132.64 ? 340  ASN A CA    1 
ATOM   1981 C C     . ASN A 1 327 ? -72.182 6.692  1.315   1.00 134.86 ? 340  ASN A C     1 
ATOM   1982 O O     . ASN A 1 327 ? -72.282 6.744  2.542   1.00 140.53 ? 340  ASN A O     1 
ATOM   1983 C CB    . ASN A 1 327 ? -73.920 4.925  0.994   1.00 141.07 ? 340  ASN A CB    1 
ATOM   1984 N N     . CYS A 1 328 ? -71.061 7.012  0.670   1.00 133.19 ? 341  CYS A N     1 
ATOM   1985 C CA    . CYS A 1 328 ? -69.832 7.377  1.384   1.00 127.21 ? 341  CYS A CA    1 
ATOM   1986 C C     . CYS A 1 328 ? -69.911 8.789  1.971   1.00 123.36 ? 341  CYS A C     1 
ATOM   1987 O O     . CYS A 1 328 ? -70.495 9.687  1.365   1.00 117.20 ? 341  CYS A O     1 
ATOM   1988 C CB    . CYS A 1 328 ? -68.622 7.272  0.450   1.00 121.08 ? 341  CYS A CB    1 
ATOM   1989 S SG    . CYS A 1 328 ? -68.353 5.620  -0.238  1.00 117.57 ? 341  CYS A SG    1 
ATOM   1990 N N     . LYS A 1 329 ? -69.318 8.973  3.151   1.00 124.27 ? 342  LYS A N     1 
ATOM   1991 C CA    . LYS A 1 329 ? -69.306 10.271 3.828   1.00 117.28 ? 342  LYS A CA    1 
ATOM   1992 C C     . LYS A 1 329 ? -68.201 11.166 3.254   1.00 109.68 ? 342  LYS A C     1 
ATOM   1993 O O     . LYS A 1 329 ? -67.036 10.760 3.222   1.00 96.10  ? 342  LYS A O     1 
ATOM   1994 C CB    . LYS A 1 329 ? -69.098 10.090 5.333   1.00 113.76 ? 342  LYS A CB    1 
ATOM   1995 N N     . PRO A 1 330 ? -68.558 12.384 2.794   1.00 111.80 ? 343  PRO A N     1 
ATOM   1996 C CA    . PRO A 1 330 ? -67.561 13.301 2.220   1.00 104.84 ? 343  PRO A CA    1 
ATOM   1997 C C     . PRO A 1 330 ? -66.449 13.723 3.185   1.00 98.46  ? 343  PRO A C     1 
ATOM   1998 O O     . PRO A 1 330 ? -66.618 13.657 4.405   1.00 96.94  ? 343  PRO A O     1 
ATOM   1999 C CB    . PRO A 1 330 ? -68.392 14.527 1.816   1.00 103.47 ? 343  PRO A CB    1 
ATOM   2000 C CG    . PRO A 1 330 ? -69.782 14.024 1.661   1.00 111.68 ? 343  PRO A CG    1 
ATOM   2001 C CD    . PRO A 1 330 ? -69.930 12.912 2.657   1.00 114.64 ? 343  PRO A CD    1 
ATOM   2002 N N     . ARG A 1 331 ? -65.325 14.156 2.614   1.00 90.68  ? 344  ARG A N     1 
ATOM   2003 C CA    . ARG A 1 331 ? -64.178 14.653 3.376   1.00 86.15  ? 344  ARG A CA    1 
ATOM   2004 C C     . ARG A 1 331 ? -64.571 15.869 4.214   1.00 88.45  ? 344  ARG A C     1 
ATOM   2005 O O     . ARG A 1 331 ? -65.416 16.664 3.804   1.00 87.24  ? 344  ARG A O     1 
ATOM   2006 C CB    . ARG A 1 331 ? -63.025 14.996 2.415   1.00 78.40  ? 344  ARG A CB    1 
ATOM   2007 C CG    . ARG A 1 331 ? -61.963 15.959 2.937   1.00 73.39  ? 344  ARG A CG    1 
ATOM   2008 C CD    . ARG A 1 331 ? -60.828 16.099 1.927   1.00 72.66  ? 344  ARG A CD    1 
ATOM   2009 N NE    . ARG A 1 331 ? -59.906 17.192 2.240   1.00 68.83  ? 344  ARG A NE    1 
ATOM   2010 C CZ    . ARG A 1 331 ? -60.104 18.476 1.936   1.00 70.68  ? 344  ARG A CZ    1 
ATOM   2011 N NH1   . ARG A 1 331 ? -61.202 18.869 1.299   1.00 73.92  ? 344  ARG A NH1   1 
ATOM   2012 N NH2   . ARG A 1 331 ? -59.193 19.384 2.271   1.00 69.57  ? 344  ARG A NH2   1 
ATOM   2013 N N     . VAL A 1 332 ? -63.970 15.986 5.396   1.00 96.77  ? 345  VAL A N     1 
ATOM   2014 C CA    . VAL A 1 332 ? -64.151 17.150 6.261   1.00 97.79  ? 345  VAL A CA    1 
ATOM   2015 C C     . VAL A 1 332 ? -62.979 18.109 6.044   1.00 89.57  ? 345  VAL A C     1 
ATOM   2016 O O     . VAL A 1 332 ? -61.877 17.857 6.532   1.00 98.27  ? 345  VAL A O     1 
ATOM   2017 C CB    . VAL A 1 332 ? -64.200 16.743 7.746   1.00 94.35  ? 345  VAL A CB    1 
ATOM   2018 N N     . PRO A 1 333 ? -63.199 19.206 5.301   1.00 84.74  ? 346  PRO A N     1 
ATOM   2019 C CA    . PRO A 1 333 ? -62.060 20.092 5.058   1.00 88.86  ? 346  PRO A CA    1 
ATOM   2020 C C     . PRO A 1 333 ? -61.601 20.801 6.330   1.00 86.31  ? 346  PRO A C     1 
ATOM   2021 O O     . PRO A 1 333 ? -62.439 21.272 7.094   1.00 96.76  ? 346  PRO A O     1 
ATOM   2022 C CB    . PRO A 1 333 ? -62.603 21.116 4.048   1.00 78.53  ? 346  PRO A CB    1 
ATOM   2023 C CG    . PRO A 1 333 ? -63.875 20.538 3.528   1.00 81.77  ? 346  PRO A CG    1 
ATOM   2024 C CD    . PRO A 1 333 ? -64.418 19.690 4.636   1.00 83.47  ? 346  PRO A CD    1 
ATOM   2025 N N     . PRO A 1 334 ? -60.278 20.872 6.563   1.00 93.99  ? 347  PRO A N     1 
ATOM   2026 C CA    . PRO A 1 334 ? -59.792 21.662 7.688   1.00 92.69  ? 347  PRO A CA    1 
ATOM   2027 C C     . PRO A 1 334 ? -59.921 23.154 7.391   1.00 91.91  ? 347  PRO A C     1 
ATOM   2028 O O     . PRO A 1 334 ? -59.272 23.655 6.473   1.00 98.98  ? 347  PRO A O     1 
ATOM   2029 C CB    . PRO A 1 334 ? -58.322 21.247 7.800   1.00 88.89  ? 347  PRO A CB    1 
ATOM   2030 C CG    . PRO A 1 334 ? -57.937 20.840 6.419   1.00 85.32  ? 347  PRO A CG    1 
ATOM   2031 C CD    . PRO A 1 334 ? -59.175 20.260 5.796   1.00 94.60  ? 347  PRO A CD    1 
ATOM   2032 N N     . ALA A 1 335 ? -60.760 23.849 8.155   1.00 110.44 ? 348  ALA A N     1 
ATOM   2033 C CA    . ALA A 1 335 ? -60.968 25.288 7.963   1.00 115.08 ? 348  ALA A CA    1 
ATOM   2034 C C     . ALA A 1 335 ? -59.865 26.142 8.604   1.00 113.00 ? 348  ALA A C     1 
ATOM   2035 O O     . ALA A 1 335 ? -59.838 27.357 8.406   1.00 116.79 ? 348  ALA A O     1 
ATOM   2036 C CB    . ALA A 1 335 ? -62.333 25.698 8.499   1.00 108.66 ? 348  ALA A CB    1 
ATOM   2037 N N     . THR A 1 336 ? -58.967 25.510 9.363   1.00 99.56  ? 349  THR A N     1 
ATOM   2038 C CA    . THR A 1 336 ? -57.869 26.208 10.036  1.00 106.62 ? 349  THR A CA    1 
ATOM   2039 C C     . THR A 1 336 ? -56.487 25.709 9.586   1.00 100.50 ? 349  THR A C     1 
ATOM   2040 O O     . THR A 1 336 ? -55.529 25.738 10.365  1.00 110.80 ? 349  THR A O     1 
ATOM   2041 C CB    . THR A 1 336 ? -57.978 26.041 11.566  1.00 104.50 ? 349  THR A CB    1 
ATOM   2042 N N     . ALA A 1 337 ? -56.384 25.269 8.332   1.00 85.22  ? 350  ALA A N     1 
ATOM   2043 C CA    . ALA A 1 337 ? -55.140 24.686 7.810   1.00 91.03  ? 350  ALA A CA    1 
ATOM   2044 C C     . ALA A 1 337 ? -54.097 25.757 7.487   1.00 78.06  ? 350  ALA A C     1 
ATOM   2045 O O     . ALA A 1 337 ? -54.281 26.543 6.557   1.00 82.57  ? 350  ALA A O     1 
ATOM   2046 C CB    . ALA A 1 337 ? -55.426 23.846 6.574   1.00 97.17  ? 350  ALA A CB    1 
ATOM   2047 N N     . PHE A 1 338 ? -53.005 25.761 8.254   1.00 74.61  ? 351  PHE A N     1 
ATOM   2048 C CA    . PHE A 1 338 ? -51.948 26.783 8.177   1.00 73.83  ? 351  PHE A CA    1 
ATOM   2049 C C     . PHE A 1 338 ? -52.508 28.197 8.337   1.00 79.77  ? 351  PHE A C     1 
ATOM   2050 O O     . PHE A 1 338 ? -52.358 29.044 7.451   1.00 71.12  ? 351  PHE A O     1 
ATOM   2051 C CB    . PHE A 1 338 ? -51.155 26.651 6.875   1.00 74.40  ? 351  PHE A CB    1 
ATOM   2052 C CG    . PHE A 1 338 ? -50.464 25.328 6.725   1.00 79.30  ? 351  PHE A CG    1 
ATOM   2053 C CD1   . PHE A 1 338 ? -49.370 25.011 7.521   1.00 75.23  ? 351  PHE A CD1   1 
ATOM   2054 C CD2   . PHE A 1 338 ? -50.903 24.398 5.791   1.00 74.61  ? 351  PHE A CD2   1 
ATOM   2055 C CE1   . PHE A 1 338 ? -48.726 23.794 7.387   1.00 69.98  ? 351  PHE A CE1   1 
ATOM   2056 C CE2   . PHE A 1 338 ? -50.263 23.178 5.654   1.00 81.88  ? 351  PHE A CE2   1 
ATOM   2057 C CZ    . PHE A 1 338 ? -49.170 22.877 6.451   1.00 77.95  ? 351  PHE A CZ    1 
ATOM   2058 N N     . GLU A 1 339 ? -53.138 28.440 9.485   1.00 82.00  ? 352  GLU A N     1 
ATOM   2059 C CA    . GLU A 1 339 ? -53.920 29.656 9.710   1.00 83.54  ? 352  GLU A CA    1 
ATOM   2060 C C     . GLU A 1 339 ? -53.039 30.894 9.771   1.00 83.24  ? 352  GLU A C     1 
ATOM   2061 O O     . GLU A 1 339 ? -53.251 31.854 9.022   1.00 80.28  ? 352  GLU A O     1 
ATOM   2062 C CB    . GLU A 1 339 ? -54.742 29.540 10.999  1.00 85.97  ? 352  GLU A CB    1 
ATOM   2063 N N     . GLY A 1 340 ? -52.052 30.863 10.663  1.00 77.29  ? 353  GLY A N     1 
ATOM   2064 C CA    . GLY A 1 340 ? -51.146 31.996 10.857  1.00 74.72  ? 353  GLY A CA    1 
ATOM   2065 C C     . GLY A 1 340 ? -49.784 31.765 10.237  1.00 68.49  ? 353  GLY A C     1 
ATOM   2066 O O     . GLY A 1 340 ? -48.762 32.073 10.847  1.00 71.57  ? 353  GLY A O     1 
ATOM   2067 N N     . HIS A 1 341 ? -49.770 31.223 9.022   1.00 66.28  ? 354  HIS A N     1 
ATOM   2068 C CA    . HIS A 1 341 ? -48.531 30.947 8.310   1.00 62.57  ? 354  HIS A CA    1 
ATOM   2069 C C     . HIS A 1 341 ? -48.393 31.829 7.079   1.00 64.75  ? 354  HIS A C     1 
ATOM   2070 O O     . HIS A 1 341 ? -49.373 32.089 6.372   1.00 55.90  ? 354  HIS A O     1 
ATOM   2071 C CB    . HIS A 1 341 ? -48.494 29.487 7.869   1.00 66.86  ? 354  HIS A CB    1 
ATOM   2072 C CG    . HIS A 1 341 ? -48.248 28.526 8.983   1.00 68.66  ? 354  HIS A CG    1 
ATOM   2073 N ND1   . HIS A 1 341 ? -49.175 28.283 9.973   1.00 78.01  ? 354  HIS A ND1   1 
ATOM   2074 C CD2   . HIS A 1 341 ? -47.180 27.744 9.265   1.00 68.17  ? 354  HIS A CD2   1 
ATOM   2075 C CE1   . HIS A 1 341 ? -48.686 27.396 10.821  1.00 75.90  ? 354  HIS A CE1   1 
ATOM   2076 N NE2   . HIS A 1 341 ? -47.476 27.054 10.415  1.00 69.61  ? 354  HIS A NE2   1 
ATOM   2077 N N     . MET A 1 342 ? -47.172 32.289 6.825   1.00 65.02  ? 355  MET A N     1 
ATOM   2078 C CA    . MET A 1 342 ? -46.838 32.842 5.523   1.00 62.11  ? 355  MET A CA    1 
ATOM   2079 C C     . MET A 1 342 ? -46.493 31.683 4.602   1.00 61.24  ? 355  MET A C     1 
ATOM   2080 O O     . MET A 1 342 ? -45.534 30.946 4.847   1.00 60.19  ? 355  MET A O     1 
ATOM   2081 C CB    . MET A 1 342 ? -45.656 33.797 5.603   1.00 57.71  ? 355  MET A CB    1 
ATOM   2082 C CG    . MET A 1 342 ? -45.463 34.586 4.326   1.00 52.61  ? 355  MET A CG    1 
ATOM   2083 S SD    . MET A 1 342 ? -44.225 35.863 4.532   1.00 58.72  ? 355  MET A SD    1 
ATOM   2084 C CE    . MET A 1 342 ? -42.819 34.984 3.881   1.00 71.91  ? 355  MET A CE    1 
ATOM   2085 N N     . LEU A 1 343 ? -47.289 31.520 3.552   1.00 63.62  ? 356  LEU A N     1 
ATOM   2086 C CA    . LEU A 1 343 ? -47.083 30.452 2.594   1.00 64.03  ? 356  LEU A CA    1 
ATOM   2087 C C     . LEU A 1 343 ? -46.295 30.983 1.405   1.00 63.39  ? 356  LEU A C     1 
ATOM   2088 O O     . LEU A 1 343 ? -46.738 31.894 0.706   1.00 57.27  ? 356  LEU A O     1 
ATOM   2089 C CB    . LEU A 1 343 ? -48.423 29.875 2.135   1.00 73.56  ? 356  LEU A CB    1 
ATOM   2090 N N     . LEU A 1 344 ? -45.109 30.421 1.207   1.00 65.39  ? 357  LEU A N     1 
ATOM   2091 C CA    . LEU A 1 344 ? -44.331 30.649 0.006   1.00 59.66  ? 357  LEU A CA    1 
ATOM   2092 C C     . LEU A 1 344 ? -44.154 29.327 -0.696  1.00 55.05  ? 357  LEU A C     1 
ATOM   2093 O O     . LEU A 1 344 ? -44.446 28.279 -0.126  1.00 57.02  ? 357  LEU A O     1 
ATOM   2094 C CB    . LEU A 1 344 ? -42.959 31.208 0.357   1.00 60.01  ? 357  LEU A CB    1 
ATOM   2095 C CG    . LEU A 1 344 ? -42.927 32.514 1.141   1.00 61.15  ? 357  LEU A CG    1 
ATOM   2096 C CD1   . LEU A 1 344 ? -41.473 32.912 1.374   1.00 68.23  ? 357  LEU A CD1   1 
ATOM   2097 C CD2   . LEU A 1 344 ? -43.692 33.608 0.411   1.00 57.53  ? 357  LEU A CD2   1 
ATOM   2098 N N     . SER A 1 345 ? -43.662 29.385 -1.929  1.00 49.56  ? 358  SER A N     1 
ATOM   2099 C CA    . SER A 1 345 ? -43.319 28.179 -2.664  1.00 58.25  ? 358  SER A CA    1 
ATOM   2100 C C     . SER A 1 345 ? -42.313 28.468 -3.768  1.00 62.04  ? 358  SER A C     1 
ATOM   2101 O O     . SER A 1 345 ? -42.388 29.502 -4.428  1.00 77.25  ? 358  SER A O     1 
ATOM   2102 C CB    . SER A 1 345 ? -44.574 27.552 -3.275  1.00 51.52  ? 358  SER A CB    1 
ATOM   2103 N N     . GLY A 1 346 ? -41.354 27.560 -3.927  1.00 56.38  ? 359  GLY A N     1 
ATOM   2104 C CA    . GLY A 1 346 ? -40.601 27.416 -5.168  1.00 59.13  ? 359  GLY A CA    1 
ATOM   2105 C C     . GLY A 1 346 ? -41.191 26.202 -5.866  1.00 63.28  ? 359  GLY A C     1 
ATOM   2106 O O     . GLY A 1 346 ? -42.376 26.197 -6.206  1.00 59.19  ? 359  GLY A O     1 
ATOM   2107 N N     . LEU A 1 347 ? -40.377 25.167 -6.063  1.00 58.05  ? 360  LEU A N     1 
ATOM   2108 C CA    . LEU A 1 347 ? -40.882 23.859 -6.481  1.00 59.63  ? 360  LEU A CA    1 
ATOM   2109 C C     . LEU A 1 347 ? -41.472 23.135 -5.278  1.00 62.51  ? 360  LEU A C     1 
ATOM   2110 O O     . LEU A 1 347 ? -42.431 22.371 -5.402  1.00 59.79  ? 360  LEU A O     1 
ATOM   2111 C CB    . LEU A 1 347 ? -39.769 23.001 -7.088  1.00 63.10  ? 360  LEU A CB    1 
ATOM   2112 C CG    . LEU A 1 347 ? -39.134 23.500 -8.387  1.00 60.61  ? 360  LEU A CG    1 
ATOM   2113 C CD1   . LEU A 1 347 ? -38.085 22.507 -8.853  1.00 62.60  ? 360  LEU A CD1   1 
ATOM   2114 C CD2   . LEU A 1 347 ? -40.188 23.720 -9.461  1.00 55.67  ? 360  LEU A CD2   1 
ATOM   2115 N N     . GLU A 1 348 ? -40.881 23.375 -4.113  1.00 66.16  ? 361  GLU A N     1 
ATOM   2116 C CA    . GLU A 1 348 ? -41.378 22.815 -2.865  1.00 70.19  ? 361  GLU A CA    1 
ATOM   2117 C C     . GLU A 1 348 ? -41.931 23.932 -1.998  1.00 65.54  ? 361  GLU A C     1 
ATOM   2118 O O     . GLU A 1 348 ? -41.535 25.084 -2.155  1.00 67.20  ? 361  GLU A O     1 
ATOM   2119 C CB    . GLU A 1 348 ? -40.254 22.087 -2.143  1.00 71.75  ? 361  GLU A CB    1 
ATOM   2120 C CG    . GLU A 1 348 ? -39.729 20.894 -2.921  1.00 74.75  ? 361  GLU A CG    1 
ATOM   2121 C CD    . GLU A 1 348 ? -38.666 20.130 -2.167  1.00 79.82  ? 361  GLU A CD    1 
ATOM   2122 O OE1   . GLU A 1 348 ? -38.836 19.938 -0.944  1.00 88.35  ? 361  GLU A OE1   1 
ATOM   2123 O OE2   . GLU A 1 348 ? -37.669 19.720 -2.801  1.00 81.41  ? 361  GLU A OE2   1 
ATOM   2124 N N     . PRO A 1 349 ? -42.858 23.598 -1.084  1.00 66.01  ? 362  PRO A N     1 
ATOM   2125 C CA    . PRO A 1 349 ? -43.454 24.616 -0.227  1.00 60.61  ? 362  PRO A CA    1 
ATOM   2126 C C     . PRO A 1 349 ? -42.476 25.092 0.840   1.00 57.91  ? 362  PRO A C     1 
ATOM   2127 O O     . PRO A 1 349 ? -41.576 24.343 1.229   1.00 59.65  ? 362  PRO A O     1 
ATOM   2128 C CB    . PRO A 1 349 ? -44.616 23.870 0.423   1.00 55.61  ? 362  PRO A CB    1 
ATOM   2129 C CG    . PRO A 1 349 ? -44.107 22.480 0.540   1.00 58.72  ? 362  PRO A CG    1 
ATOM   2130 C CD    . PRO A 1 349 ? -43.338 22.249 -0.729  1.00 63.11  ? 362  PRO A CD    1 
ATOM   2131 N N     . PHE A 1 350 ? -42.651 26.327 1.296   1.00 55.59  ? 363  PHE A N     1 
ATOM   2132 C CA    . PHE A 1 350 ? -41.857 26.864 2.400   1.00 64.37  ? 363  PHE A CA    1 
ATOM   2133 C C     . PHE A 1 350 ? -42.729 27.749 3.294   1.00 64.56  ? 363  PHE A C     1 
ATOM   2134 O O     . PHE A 1 350 ? -43.075 28.869 2.924   1.00 59.88  ? 363  PHE A O     1 
ATOM   2135 C CB    . PHE A 1 350 ? -40.655 27.645 1.874   1.00 65.28  ? 363  PHE A CB    1 
ATOM   2136 C CG    . PHE A 1 350 ? -39.839 28.286 2.953   1.00 63.12  ? 363  PHE A CG    1 
ATOM   2137 C CD1   . PHE A 1 350 ? -38.948 27.533 3.700   1.00 62.16  ? 363  PHE A CD1   1 
ATOM   2138 C CD2   . PHE A 1 350 ? -39.977 29.639 3.234   1.00 63.72  ? 363  PHE A CD2   1 
ATOM   2139 C CE1   . PHE A 1 350 ? -38.197 28.118 4.705   1.00 66.65  ? 363  PHE A CE1   1 
ATOM   2140 C CE2   . PHE A 1 350 ? -39.228 30.230 4.236   1.00 67.78  ? 363  PHE A CE2   1 
ATOM   2141 C CZ    . PHE A 1 350 ? -38.336 29.468 4.973   1.00 70.70  ? 363  PHE A CZ    1 
ATOM   2142 N N     . ARG A 1 351 ? -43.070 27.229 4.471   1.00 63.46  ? 364  ARG A N     1 
ATOM   2143 C CA    . ARG A 1 351 ? -44.036 27.862 5.357   1.00 65.44  ? 364  ARG A CA    1 
ATOM   2144 C C     . ARG A 1 351 ? -43.343 28.534 6.542   1.00 63.25  ? 364  ARG A C     1 
ATOM   2145 O O     . ARG A 1 351 ? -42.434 27.964 7.143   1.00 72.32  ? 364  ARG A O     1 
ATOM   2146 C CB    . ARG A 1 351 ? -45.039 26.817 5.850   1.00 68.91  ? 364  ARG A CB    1 
ATOM   2147 C CG    . ARG A 1 351 ? -45.942 26.259 4.754   1.00 66.39  ? 364  ARG A CG    1 
ATOM   2148 C CD    . ARG A 1 351 ? -46.121 24.750 4.874   1.00 72.94  ? 364  ARG A CD    1 
ATOM   2149 N NE    . ARG A 1 351 ? -47.073 24.224 3.888   1.00 72.69  ? 364  ARG A NE    1 
ATOM   2150 C CZ    . ARG A 1 351 ? -47.096 22.969 3.428   1.00 71.49  ? 364  ARG A CZ    1 
ATOM   2151 N NH1   . ARG A 1 351 ? -46.209 22.065 3.842   1.00 64.33  ? 364  ARG A NH1   1 
ATOM   2152 N NH2   . ARG A 1 351 ? -48.008 22.614 2.529   1.00 74.14  ? 364  ARG A NH2   1 
ATOM   2153 N N     . ILE A 1 352 ? -43.776 29.753 6.858   1.00 64.98  ? 365  ILE A N     1 
ATOM   2154 C CA    . ILE A 1 352 ? -43.272 30.499 8.006   1.00 65.12  ? 365  ILE A CA    1 
ATOM   2155 C C     . ILE A 1 352 ? -44.412 30.651 9.006   1.00 69.65  ? 365  ILE A C     1 
ATOM   2156 O O     . ILE A 1 352 ? -45.252 31.546 8.867   1.00 74.57  ? 365  ILE A O     1 
ATOM   2157 C CB    . ILE A 1 352 ? -42.751 31.896 7.590   1.00 73.24  ? 365  ILE A CB    1 
ATOM   2158 C CG1   . ILE A 1 352 ? -41.665 31.767 6.517   1.00 73.01  ? 365  ILE A CG1   1 
ATOM   2159 C CG2   . ILE A 1 352 ? -42.205 32.660 8.791   1.00 71.73  ? 365  ILE A CG2   1 
ATOM   2160 C CD1   . ILE A 1 352 ? -41.017 33.083 6.144   1.00 67.10  ? 365  ILE A CD1   1 
ATOM   2161 N N     . GLY A 1 353 ? -44.443 29.764 9.999   1.00 64.67  ? 366  GLY A N     1 
ATOM   2162 C CA    . GLY A 1 353 ? -45.411 29.840 11.093  1.00 64.98  ? 366  GLY A CA    1 
ATOM   2163 C C     . GLY A 1 353 ? -44.802 30.542 12.293  1.00 65.95  ? 366  GLY A C     1 
ATOM   2164 O O     . GLY A 1 353 ? -43.590 30.737 12.343  1.00 61.75  ? 366  GLY A O     1 
ATOM   2165 N N     . PRO A 1 354 ? -45.632 30.905 13.285  1.00 72.13  ? 367  PRO A N     1 
ATOM   2166 C CA    . PRO A 1 354 ? -45.148 31.682 14.432  1.00 72.31  ? 367  PRO A CA    1 
ATOM   2167 C C     . PRO A 1 354 ? -43.906 31.084 15.089  1.00 79.39  ? 367  PRO A C     1 
ATOM   2168 O O     . PRO A 1 354 ? -42.997 31.822 15.475  1.00 79.90  ? 367  PRO A O     1 
ATOM   2169 C CB    . PRO A 1 354 ? -46.335 31.656 15.406  1.00 76.19  ? 367  PRO A CB    1 
ATOM   2170 C CG    . PRO A 1 354 ? -47.184 30.509 14.967  1.00 76.68  ? 367  PRO A CG    1 
ATOM   2171 C CD    . PRO A 1 354 ? -47.018 30.447 13.482  1.00 78.01  ? 367  PRO A CD    1 
ATOM   2172 N N     . TYR A 1 355 ? -43.870 29.755 15.186  1.00 94.85  ? 368  TYR A N     1 
ATOM   2173 C CA    . TYR A 1 355 ? -42.775 29.044 15.845  1.00 86.05  ? 368  TYR A CA    1 
ATOM   2174 C C     . TYR A 1 355 ? -41.605 28.714 14.910  1.00 78.12  ? 368  TYR A C     1 
ATOM   2175 O O     . TYR A 1 355 ? -40.585 28.187 15.359  1.00 63.22  ? 368  TYR A O     1 
ATOM   2176 C CB    . TYR A 1 355 ? -43.300 27.759 16.488  1.00 108.34 ? 368  TYR A CB    1 
ATOM   2177 C CG    . TYR A 1 355 ? -44.541 27.949 17.345  1.00 131.23 ? 368  TYR A CG    1 
ATOM   2178 C CD1   . TYR A 1 355 ? -44.694 29.073 18.161  1.00 124.40 ? 368  TYR A CD1   1 
ATOM   2179 C CD2   . TYR A 1 355 ? -45.554 26.991 17.354  1.00 136.09 ? 368  TYR A CD2   1 
ATOM   2180 C CE1   . TYR A 1 355 ? -45.825 29.242 18.944  1.00 140.33 ? 368  TYR A CE1   1 
ATOM   2181 C CE2   . TYR A 1 355 ? -46.686 27.152 18.136  1.00 151.98 ? 368  TYR A CE2   1 
ATOM   2182 C CZ    . TYR A 1 355 ? -46.817 28.277 18.929  1.00 154.87 ? 368  TYR A CZ    1 
ATOM   2183 O OH    . TYR A 1 355 ? -47.940 28.439 19.708  1.00 161.53 ? 368  TYR A OH    1 
ATOM   2184 N N     . THR A 1 356 ? -41.746 29.015 13.620  1.00 71.71  ? 369  THR A N     1 
ATOM   2185 C CA    . THR A 1 356 ? -40.633 28.881 12.684  1.00 70.07  ? 369  THR A CA    1 
ATOM   2186 C C     . THR A 1 356 ? -39.535 29.863 13.071  1.00 72.03  ? 369  THR A C     1 
ATOM   2187 O O     . THR A 1 356 ? -39.817 31.005 13.434  1.00 88.45  ? 369  THR A O     1 
ATOM   2188 C CB    . THR A 1 356 ? -41.064 29.147 11.231  1.00 74.25  ? 369  THR A CB    1 
ATOM   2189 O OG1   . THR A 1 356 ? -42.099 28.227 10.863  1.00 78.37  ? 369  THR A OG1   1 
ATOM   2190 C CG2   . THR A 1 356 ? -39.881 28.993 10.270  1.00 71.75  ? 369  THR A CG2   1 
ATOM   2191 N N     . ASN A 1 357 ? -38.288 29.410 13.002  1.00 68.36  ? 370  ASN A N     1 
ATOM   2192 C CA    . ASN A 1 357 ? -37.150 30.235 13.395  1.00 74.34  ? 370  ASN A CA    1 
ATOM   2193 C C     . ASN A 1 357 ? -36.788 31.235 12.300  1.00 70.35  ? 370  ASN A C     1 
ATOM   2194 O O     . ASN A 1 357 ? -37.469 31.313 11.279  1.00 72.82  ? 370  ASN A O     1 
ATOM   2195 C CB    . ASN A 1 357 ? -35.949 29.355 13.788  1.00 82.34  ? 370  ASN A CB    1 
ATOM   2196 C CG    . ASN A 1 357 ? -35.405 28.540 12.633  1.00 82.68  ? 370  ASN A CG    1 
ATOM   2197 O OD1   . ASN A 1 357 ? -35.847 28.675 11.490  1.00 103.87 ? 370  ASN A OD1   1 
ATOM   2198 N ND2   . ASN A 1 357 ? -34.437 27.677 12.929  1.00 84.64  ? 370  ASN A ND2   1 
ATOM   2199 N N     . PHE A 1 358 ? -35.720 31.998 12.516  1.00 73.72  ? 371  PHE A N     1 
ATOM   2200 C CA    . PHE A 1 358 ? -35.313 33.050 11.583  1.00 70.71  ? 371  PHE A CA    1 
ATOM   2201 C C     . PHE A 1 358 ? -35.094 32.522 10.168  1.00 65.04  ? 371  PHE A C     1 
ATOM   2202 O O     . PHE A 1 358 ? -34.271 31.632 9.949   1.00 73.42  ? 371  PHE A O     1 
ATOM   2203 C CB    . PHE A 1 358 ? -34.033 33.716 12.075  1.00 63.35  ? 371  PHE A CB    1 
ATOM   2204 C CG    . PHE A 1 358 ? -33.604 34.896 11.252  1.00 64.05  ? 371  PHE A CG    1 
ATOM   2205 C CD1   . PHE A 1 358 ? -34.252 36.115 11.370  1.00 62.41  ? 371  PHE A CD1   1 
ATOM   2206 C CD2   . PHE A 1 358 ? -32.546 34.789 10.360  1.00 69.61  ? 371  PHE A CD2   1 
ATOM   2207 C CE1   . PHE A 1 358 ? -33.850 37.206 10.627  1.00 59.75  ? 371  PHE A CE1   1 
ATOM   2208 C CE2   . PHE A 1 358 ? -32.140 35.877 9.611   1.00 66.90  ? 371  PHE A CE2   1 
ATOM   2209 C CZ    . PHE A 1 358 ? -32.796 37.087 9.741   1.00 64.07  ? 371  PHE A CZ    1 
ATOM   2210 N N     . VAL A 1 359 ? -35.835 33.079 9.218   1.00 57.21  ? 372  VAL A N     1 
ATOM   2211 C CA    . VAL A 1 359 ? -35.694 32.708 7.819   1.00 63.32  ? 372  VAL A CA    1 
ATOM   2212 C C     . VAL A 1 359 ? -34.598 33.540 7.173   1.00 66.58  ? 372  VAL A C     1 
ATOM   2213 O O     . VAL A 1 359 ? -34.665 34.769 7.172   1.00 52.81  ? 372  VAL A O     1 
ATOM   2214 C CB    . VAL A 1 359 ? -37.004 32.916 7.044   1.00 65.80  ? 372  VAL A CB    1 
ATOM   2215 C CG1   . VAL A 1 359 ? -36.803 32.613 5.563   1.00 65.62  ? 372  VAL A CG1   1 
ATOM   2216 C CG2   . VAL A 1 359 ? -38.104 32.053 7.648   1.00 70.68  ? 372  VAL A CG2   1 
ATOM   2217 N N     . ASN A 1 360 ? -33.594 32.855 6.629   1.00 65.31  ? 373  ASN A N     1 
ATOM   2218 C CA    . ASN A 1 360 ? -32.514 33.505 5.906   1.00 60.29  ? 373  ASN A CA    1 
ATOM   2219 C C     . ASN A 1 360 ? -32.880 33.666 4.438   1.00 58.66  ? 373  ASN A C     1 
ATOM   2220 O O     . ASN A 1 360 ? -33.085 32.677 3.731   1.00 58.03  ? 373  ASN A O     1 
ATOM   2221 C CB    . ASN A 1 360 ? -31.226 32.689 6.025   1.00 69.45  ? 373  ASN A CB    1 
ATOM   2222 C CG    . ASN A 1 360 ? -30.762 32.536 7.461   1.00 74.14  ? 373  ASN A CG    1 
ATOM   2223 O OD1   . ASN A 1 360 ? -30.336 33.501 8.096   1.00 76.13  ? 373  ASN A OD1   1 
ATOM   2224 N ND2   . ASN A 1 360 ? -30.834 31.316 7.980   1.00 73.40  ? 373  ASN A ND2   1 
ATOM   2225 N N     . ILE A 1 361 ? -32.977 34.917 3.996   1.00 58.31  ? 374  ILE A N     1 
ATOM   2226 C CA    . ILE A 1 361 ? -33.142 35.244 2.586   1.00 55.10  ? 374  ILE A CA    1 
ATOM   2227 C C     . ILE A 1 361 ? -31.767 35.641 2.045   1.00 59.50  ? 374  ILE A C     1 
ATOM   2228 O O     . ILE A 1 361 ? -31.184 36.630 2.492   1.00 69.10  ? 374  ILE A O     1 
ATOM   2229 C CB    . ILE A 1 361 ? -34.129 36.406 2.384   1.00 57.10  ? 374  ILE A CB    1 
ATOM   2230 C CG1   . ILE A 1 361 ? -35.407 36.173 3.194   1.00 57.34  ? 374  ILE A CG1   1 
ATOM   2231 C CG2   . ILE A 1 361 ? -34.460 36.566 0.909   1.00 64.93  ? 374  ILE A CG2   1 
ATOM   2232 C CD1   . ILE A 1 361 ? -36.425 37.287 3.076   1.00 58.21  ? 374  ILE A CD1   1 
ATOM   2233 N N     . GLY A 1 362 ? -31.246 34.858 1.101   1.00 54.92  ? 375  GLY A N     1 
ATOM   2234 C CA    . GLY A 1 362 ? -29.888 35.056 0.583   1.00 61.46  ? 375  GLY A CA    1 
ATOM   2235 C C     . GLY A 1 362 ? -29.691 36.384 -0.129  1.00 62.78  ? 375  GLY A C     1 
ATOM   2236 O O     . GLY A 1 362 ? -30.483 36.747 -0.998  1.00 71.52  ? 375  GLY A O     1 
ATOM   2237 N N     . GLU A 1 363 ? -28.617 37.091 0.223   1.00 71.01  ? 376  GLU A N     1 
ATOM   2238 C CA    . GLU A 1 363 ? -28.373 38.462 -0.255  1.00 67.04  ? 376  GLU A CA    1 
ATOM   2239 C C     . GLU A 1 363 ? -27.475 38.565 -1.493  1.00 64.57  ? 376  GLU A C     1 
ATOM   2240 O O     . GLU A 1 363 ? -27.431 39.619 -2.128  1.00 61.06  ? 376  GLU A O     1 
ATOM   2241 C CB    . GLU A 1 363 ? -27.764 39.320 0.870   1.00 64.90  ? 376  GLU A CB    1 
ATOM   2242 C CG    . GLU A 1 363 ? -26.320 38.979 1.241   1.00 65.63  ? 376  GLU A CG    1 
ATOM   2243 C CD    . GLU A 1 363 ? -25.698 39.973 2.212   1.00 79.50  ? 376  GLU A CD    1 
ATOM   2244 O OE1   . GLU A 1 363 ? -26.438 40.559 3.035   1.00 78.79  ? 376  GLU A OE1   1 
ATOM   2245 O OE2   . GLU A 1 363 ? -24.462 40.170 2.156   1.00 71.64  ? 376  GLU A OE2   1 
ATOM   2246 N N     . ARG A 1 364 ? -26.762 37.491 -1.832  1.00 62.95  ? 377  ARG A N     1 
ATOM   2247 C CA    . ARG A 1 364 ? -25.654 37.589 -2.796  1.00 69.55  ? 377  ARG A CA    1 
ATOM   2248 C C     . ARG A 1 364 ? -26.055 37.837 -4.260  1.00 67.39  ? 377  ARG A C     1 
ATOM   2249 O O     . ARG A 1 364 ? -25.282 38.442 -5.000  1.00 75.52  ? 377  ARG A O     1 
ATOM   2250 C CB    . ARG A 1 364 ? -24.739 36.362 -2.720  1.00 76.31  ? 377  ARG A CB    1 
ATOM   2251 C CG    . ARG A 1 364 ? -24.123 36.101 -1.348  1.00 73.94  ? 377  ARG A CG    1 
ATOM   2252 C CD    . ARG A 1 364 ? -22.724 35.513 -1.493  1.00 80.81  ? 377  ARG A CD    1 
ATOM   2253 N NE    . ARG A 1 364 ? -21.786 36.518 -2.002  1.00 94.13  ? 377  ARG A NE    1 
ATOM   2254 C CZ    . ARG A 1 364 ? -20.791 36.294 -2.864  1.00 102.70 ? 377  ARG A CZ    1 
ATOM   2255 N NH1   . ARG A 1 364 ? -20.563 35.079 -3.359  1.00 97.21  ? 377  ARG A NH1   1 
ATOM   2256 N NH2   . ARG A 1 364 ? -20.016 37.308 -3.247  1.00 100.05 ? 377  ARG A NH2   1 
ATOM   2257 N N     . CYS A 1 365 ? -27.237 37.382 -4.681  1.00 63.03  ? 378  CYS A N     1 
ATOM   2258 C CA    . CYS A 1 365 ? -27.693 37.592 -6.070  1.00 65.18  ? 378  CYS A CA    1 
ATOM   2259 C C     . CYS A 1 365 ? -28.222 39.017 -6.272  1.00 60.77  ? 378  CYS A C     1 
ATOM   2260 O O     . CYS A 1 365 ? -29.373 39.218 -6.666  1.00 54.28  ? 378  CYS A O     1 
ATOM   2261 C CB    . CYS A 1 365 ? -28.763 36.562 -6.472  1.00 64.47  ? 378  CYS A CB    1 
ATOM   2262 S SG    . CYS A 1 365 ? -28.164 34.867 -6.663  1.00 69.43  ? 378  CYS A SG    1 
ATOM   2263 N N     . ASN A 1 366 ? -27.355 39.993 -6.017  1.00 63.83  ? 379  ASN A N     1 
ATOM   2264 C CA    . ASN A 1 366 ? -27.699 41.409 -6.062  1.00 64.72  ? 379  ASN A CA    1 
ATOM   2265 C C     . ASN A 1 366 ? -26.562 42.177 -6.743  1.00 72.60  ? 379  ASN A C     1 
ATOM   2266 O O     . ASN A 1 366 ? -25.437 42.207 -6.239  1.00 62.19  ? 379  ASN A O     1 
ATOM   2267 C CB    . ASN A 1 366 ? -27.934 41.923 -4.635  1.00 65.44  ? 379  ASN A CB    1 
ATOM   2268 C CG    . ASN A 1 366 ? -28.244 43.413 -4.571  1.00 65.89  ? 379  ASN A CG    1 
ATOM   2269 O OD1   . ASN A 1 366 ? -27.867 44.189 -5.450  1.00 78.29  ? 379  ASN A OD1   1 
ATOM   2270 N ND2   . ASN A 1 366 ? -28.918 43.822 -3.507  1.00 63.59  ? 379  ASN A ND2   1 
ATOM   2271 N N     . VAL A 1 367 ? -26.874 42.803 -7.877  1.00 69.01  ? 380  VAL A N     1 
ATOM   2272 C CA    . VAL A 1 367 ? -25.878 43.472 -8.720  1.00 72.57  ? 380  VAL A CA    1 
ATOM   2273 C C     . VAL A 1 367 ? -25.158 44.616 -7.997  1.00 73.81  ? 380  VAL A C     1 
ATOM   2274 O O     . VAL A 1 367 ? -23.968 44.837 -8.211  1.00 80.66  ? 380  VAL A O     1 
ATOM   2275 C CB    . VAL A 1 367 ? -26.521 43.989 -10.034 1.00 74.98  ? 380  VAL A CB    1 
ATOM   2276 C CG1   . VAL A 1 367 ? -25.557 44.869 -10.820 1.00 82.67  ? 380  VAL A CG1   1 
ATOM   2277 C CG2   . VAL A 1 367 ? -26.979 42.821 -10.896 1.00 75.60  ? 380  VAL A CG2   1 
ATOM   2278 N N     . ALA A 1 368 ? -25.872 45.338 -7.140  1.00 77.59  ? 381  ALA A N     1 
ATOM   2279 C CA    . ALA A 1 368 ? -25.273 46.455 -6.409  1.00 80.67  ? 381  ALA A CA    1 
ATOM   2280 C C     . ALA A 1 368 ? -24.492 45.993 -5.174  1.00 83.35  ? 381  ALA A C     1 
ATOM   2281 O O     . ALA A 1 368 ? -23.441 46.555 -4.857  1.00 90.02  ? 381  ALA A O     1 
ATOM   2282 C CB    . ALA A 1 368 ? -26.343 47.460 -6.013  1.00 77.28  ? 381  ALA A CB    1 
ATOM   2283 N N     . GLY A 1 369 ? -25.002 44.972 -4.488  1.00 72.39  ? 382  GLY A N     1 
ATOM   2284 C CA    . GLY A 1 369 ? -24.433 44.526 -3.216  1.00 79.97  ? 382  GLY A CA    1 
ATOM   2285 C C     . GLY A 1 369 ? -23.442 43.375 -3.285  1.00 84.88  ? 382  GLY A C     1 
ATOM   2286 O O     . GLY A 1 369 ? -22.977 42.900 -2.246  1.00 76.70  ? 382  GLY A O     1 
ATOM   2287 N N     . SER A 1 370 ? -23.116 42.917 -4.493  1.00 89.14  ? 383  SER A N     1 
ATOM   2288 C CA    . SER A 1 370 ? -22.148 41.833 -4.669  1.00 85.00  ? 383  SER A CA    1 
ATOM   2289 C C     . SER A 1 370 ? -21.185 42.138 -5.810  1.00 93.11  ? 383  SER A C     1 
ATOM   2290 O O     . SER A 1 370 ? -21.606 42.547 -6.892  1.00 90.10  ? 383  SER A O     1 
ATOM   2291 C CB    . SER A 1 370 ? -22.867 40.515 -4.938  1.00 81.62  ? 383  SER A CB    1 
ATOM   2292 O OG    . SER A 1 370 ? -21.947 39.441 -4.979  1.00 83.29  ? 383  SER A OG    1 
ATOM   2293 N N     . ARG A 1 371 ? -19.894 41.928 -5.555  1.00 99.72  ? 384  ARG A N     1 
ATOM   2294 C CA    . ARG A 1 371 ? -18.845 42.224 -6.529  1.00 95.39  ? 384  ARG A CA    1 
ATOM   2295 C C     . ARG A 1 371 ? -18.820 41.188 -7.640  1.00 91.11  ? 384  ARG A C     1 
ATOM   2296 O O     . ARG A 1 371 ? -18.853 41.542 -8.818  1.00 100.39 ? 384  ARG A O     1 
ATOM   2297 C CB    . ARG A 1 371 ? -17.473 42.279 -5.848  1.00 95.00  ? 384  ARG A CB    1 
ATOM   2298 N N     . LYS A 1 372 ? -18.759 39.913 -7.262  1.00 90.17  ? 385  LYS A N     1 
ATOM   2299 C CA    . LYS A 1 372 ? -18.714 38.819 -8.237  1.00 91.28  ? 385  LYS A CA    1 
ATOM   2300 C C     . LYS A 1 372 ? -19.962 38.813 -9.104  1.00 94.96  ? 385  LYS A C     1 
ATOM   2301 O O     . LYS A 1 372 ? -19.876 38.892 -10.329 1.00 111.78 ? 385  LYS A O     1 
ATOM   2302 C CB    . LYS A 1 372 ? -18.582 37.466 -7.535  1.00 87.89  ? 385  LYS A CB    1 
ATOM   2303 N N     . PHE A 1 373 ? -21.121 38.744 -8.453  1.00 95.09  ? 386  PHE A N     1 
ATOM   2304 C CA    . PHE A 1 373 ? -22.407 38.649 -9.146  1.00 89.35  ? 386  PHE A CA    1 
ATOM   2305 C C     . PHE A 1 373 ? -22.544 39.715 -10.226 1.00 84.90  ? 386  PHE A C     1 
ATOM   2306 O O     . PHE A 1 373 ? -22.923 39.415 -11.358 1.00 85.46  ? 386  PHE A O     1 
ATOM   2307 C CB    . PHE A 1 373 ? -23.565 38.763 -8.150  1.00 87.73  ? 386  PHE A CB    1 
ATOM   2308 C CG    . PHE A 1 373 ? -24.872 38.254 -8.684  1.00 82.76  ? 386  PHE A CG    1 
ATOM   2309 C CD1   . PHE A 1 373 ? -25.117 36.891 -8.759  1.00 82.49  ? 386  PHE A CD1   1 
ATOM   2310 C CD2   . PHE A 1 373 ? -25.857 39.134 -9.110  1.00 87.38  ? 386  PHE A CD2   1 
ATOM   2311 C CE1   . PHE A 1 373 ? -26.319 36.414 -9.252  1.00 81.04  ? 386  PHE A CE1   1 
ATOM   2312 C CE2   . PHE A 1 373 ? -27.060 38.663 -9.605  1.00 83.82  ? 386  PHE A CE2   1 
ATOM   2313 C CZ    . PHE A 1 373 ? -27.291 37.301 -9.677  1.00 81.27  ? 386  PHE A CZ    1 
ATOM   2314 N N     . ALA A 1 374 ? -22.216 40.955 -9.875  1.00 84.02  ? 387  ALA A N     1 
ATOM   2315 C CA    . ALA A 1 374 ? -22.284 42.064 -10.826 1.00 82.28  ? 387  ALA A CA    1 
ATOM   2316 C C     . ALA A 1 374 ? -21.355 41.840 -12.017 1.00 82.73  ? 387  ALA A C     1 
ATOM   2317 O O     . ALA A 1 374 ? -21.726 42.117 -13.156 1.00 84.47  ? 387  ALA A O     1 
ATOM   2318 C CB    . ALA A 1 374 ? -21.949 43.376 -10.138 1.00 78.62  ? 387  ALA A CB    1 
ATOM   2319 N N     . LYS A 1 375 ? -20.154 41.336 -11.744 1.00 85.21  ? 388  LYS A N     1 
ATOM   2320 C CA    . LYS A 1 375 ? -19.167 41.064 -12.788 1.00 88.75  ? 388  LYS A CA    1 
ATOM   2321 C C     . LYS A 1 375 ? -19.644 39.976 -13.750 1.00 88.65  ? 388  LYS A C     1 
ATOM   2322 O O     . LYS A 1 375 ? -19.385 40.050 -14.953 1.00 93.83  ? 388  LYS A O     1 
ATOM   2323 C CB    . LYS A 1 375 ? -17.825 40.655 -12.168 1.00 85.07  ? 388  LYS A CB    1 
ATOM   2324 N N     . LEU A 1 376 ? -20.343 38.976 -13.221 1.00 81.82  ? 389  LEU A N     1 
ATOM   2325 C CA    . LEU A 1 376 ? -20.830 37.864 -14.040 1.00 94.50  ? 389  LEU A CA    1 
ATOM   2326 C C     . LEU A 1 376 ? -22.112 38.199 -14.816 1.00 90.38  ? 389  LEU A C     1 
ATOM   2327 O O     . LEU A 1 376 ? -22.330 37.662 -15.901 1.00 105.83 ? 389  LEU A O     1 
ATOM   2328 C CB    . LEU A 1 376 ? -21.032 36.605 -13.188 1.00 100.26 ? 389  LEU A CB    1 
ATOM   2329 C CG    . LEU A 1 376 ? -19.766 35.787 -12.903 1.00 103.11 ? 389  LEU A CG    1 
ATOM   2330 C CD1   . LEU A 1 376 ? -18.907 36.431 -11.829 1.00 108.08 ? 389  LEU A CD1   1 
ATOM   2331 C CD2   . LEU A 1 376 ? -20.131 34.371 -12.489 1.00 112.37 ? 389  LEU A CD2   1 
ATOM   2332 N N     . ILE A 1 377 ? -22.958 39.070 -14.269 1.00 81.27  ? 390  ILE A N     1 
ATOM   2333 C CA    . ILE A 1 377 ? -24.165 39.506 -14.977 1.00 77.09  ? 390  ILE A CA    1 
ATOM   2334 C C     . ILE A 1 377 ? -23.808 40.504 -16.080 1.00 83.16  ? 390  ILE A C     1 
ATOM   2335 O O     . ILE A 1 377 ? -24.265 40.368 -17.216 1.00 81.67  ? 390  ILE A O     1 
ATOM   2336 C CB    . ILE A 1 377 ? -25.203 40.139 -14.022 1.00 76.53  ? 390  ILE A CB    1 
ATOM   2337 C CG1   . ILE A 1 377 ? -25.725 39.101 -13.015 1.00 76.23  ? 390  ILE A CG1   1 
ATOM   2338 C CG2   . ILE A 1 377 ? -26.367 40.746 -14.802 1.00 77.52  ? 390  ILE A CG2   1 
ATOM   2339 C CD1   . ILE A 1 377 ? -26.691 38.085 -13.585 1.00 75.51  ? 390  ILE A CD1   1 
ATOM   2340 N N     . MET A 1 378 ? -22.991 41.501 -15.745 1.00 90.54  ? 391  MET A N     1 
ATOM   2341 C CA    . MET A 1 378 ? -22.579 42.522 -16.713 1.00 90.64  ? 391  MET A CA    1 
ATOM   2342 C C     . MET A 1 378 ? -21.774 41.917 -17.864 1.00 93.47  ? 391  MET A C     1 
ATOM   2343 O O     . MET A 1 378 ? -21.844 42.400 -18.996 1.00 88.50  ? 391  MET A O     1 
ATOM   2344 C CB    . MET A 1 378 ? -21.773 43.632 -16.026 1.00 95.88  ? 391  MET A CB    1 
ATOM   2345 C CG    . MET A 1 378 ? -22.588 44.496 -15.072 1.00 90.41  ? 391  MET A CG    1 
ATOM   2346 N N     . ALA A 1 379 ? -21.026 40.853 -17.572 1.00 94.06  ? 392  ALA A N     1 
ATOM   2347 C CA    . ALA A 1 379 ? -20.280 40.118 -18.594 1.00 90.26  ? 392  ALA A CA    1 
ATOM   2348 C C     . ALA A 1 379 ? -21.126 39.015 -19.242 1.00 91.25  ? 392  ALA A C     1 
ATOM   2349 O O     . ALA A 1 379 ? -20.610 38.205 -20.013 1.00 107.95 ? 392  ALA A O     1 
ATOM   2350 C CB    . ALA A 1 379 ? -19.011 39.527 -17.996 1.00 91.87  ? 392  ALA A CB    1 
ATOM   2351 N N     . GLY A 1 380 ? -22.418 38.980 -18.920 1.00 87.94  ? 393  GLY A N     1 
ATOM   2352 C CA    . GLY A 1 380 ? -23.357 38.058 -19.552 1.00 84.51  ? 393  GLY A CA    1 
ATOM   2353 C C     . GLY A 1 380 ? -23.236 36.598 -19.150 1.00 85.67  ? 393  GLY A C     1 
ATOM   2354 O O     . GLY A 1 380 ? -23.933 35.752 -19.706 1.00 96.37  ? 393  GLY A O     1 
ATOM   2355 N N     . ASN A 1 381 ? -22.365 36.290 -18.192 1.00 90.13  ? 394  ASN A N     1 
ATOM   2356 C CA    . ASN A 1 381 ? -22.167 34.911 -17.759 1.00 94.90  ? 394  ASN A CA    1 
ATOM   2357 C C     . ASN A 1 381 ? -23.220 34.524 -16.721 1.00 93.00  ? 394  ASN A C     1 
ATOM   2358 O O     . ASN A 1 381 ? -22.971 34.540 -15.514 1.00 85.52  ? 394  ASN A O     1 
ATOM   2359 C CB    . ASN A 1 381 ? -20.745 34.708 -17.217 1.00 105.19 ? 394  ASN A CB    1 
ATOM   2360 C CG    . ASN A 1 381 ? -20.356 33.239 -17.121 1.00 117.47 ? 394  ASN A CG    1 
ATOM   2361 O OD1   . ASN A 1 381 ? -21.165 32.343 -17.379 1.00 112.86 ? 394  ASN A OD1   1 
ATOM   2362 N ND2   . ASN A 1 381 ? -19.105 32.985 -16.752 1.00 112.85 ? 394  ASN A ND2   1 
ATOM   2363 N N     . TYR A 1 382 ? -24.403 34.174 -17.216 1.00 100.79 ? 395  TYR A N     1 
ATOM   2364 C CA    . TYR A 1 382 ? -25.522 33.783 -16.368 1.00 90.60  ? 395  TYR A CA    1 
ATOM   2365 C C     . TYR A 1 382 ? -25.396 32.348 -15.848 1.00 85.96  ? 395  TYR A C     1 
ATOM   2366 O O     . TYR A 1 382 ? -25.873 32.041 -14.759 1.00 106.81 ? 395  TYR A O     1 
ATOM   2367 C CB    . TYR A 1 382 ? -26.843 33.941 -17.124 1.00 89.28  ? 395  TYR A CB    1 
ATOM   2368 C CG    . TYR A 1 382 ? -27.367 35.362 -17.204 1.00 90.26  ? 395  TYR A CG    1 
ATOM   2369 C CD1   . TYR A 1 382 ? -26.691 36.340 -17.926 1.00 94.59  ? 395  TYR A CD1   1 
ATOM   2370 C CD2   . TYR A 1 382 ? -28.555 35.722 -16.574 1.00 90.22  ? 395  TYR A CD2   1 
ATOM   2371 C CE1   . TYR A 1 382 ? -27.174 37.639 -18.007 1.00 90.64  ? 395  TYR A CE1   1 
ATOM   2372 C CE2   . TYR A 1 382 ? -29.047 37.017 -16.648 1.00 85.98  ? 395  TYR A CE2   1 
ATOM   2373 C CZ    . TYR A 1 382 ? -28.356 37.972 -17.366 1.00 83.60  ? 395  TYR A CZ    1 
ATOM   2374 O OH    . TYR A 1 382 ? -28.848 39.258 -17.440 1.00 74.29  ? 395  TYR A OH    1 
ATOM   2375 N N     . GLU A 1 383 ? -24.775 31.470 -16.627 1.00 89.48  ? 396  GLU A N     1 
ATOM   2376 C CA    . GLU A 1 383 ? -24.599 30.074 -16.225 1.00 109.05 ? 396  GLU A CA    1 
ATOM   2377 C C     . GLU A 1 383 ? -23.805 29.944 -14.924 1.00 117.49 ? 396  GLU A C     1 
ATOM   2378 O O     . GLU A 1 383 ? -24.180 29.172 -14.042 1.00 139.28 ? 396  GLU A O     1 
ATOM   2379 C CB    . GLU A 1 383 ? -23.904 29.277 -17.333 1.00 121.73 ? 396  GLU A CB    1 
ATOM   2380 N N     . GLU A 1 384 ? -22.712 30.697 -14.810 1.00 112.42 ? 397  GLU A N     1 
ATOM   2381 C CA    . GLU A 1 384 ? -21.885 30.686 -13.596 1.00 118.61 ? 397  GLU A CA    1 
ATOM   2382 C C     . GLU A 1 384 ? -22.488 31.525 -12.468 1.00 112.36 ? 397  GLU A C     1 
ATOM   2383 O O     . GLU A 1 384 ? -22.166 31.313 -11.297 1.00 102.56 ? 397  GLU A O     1 
ATOM   2384 C CB    . GLU A 1 384 ? -20.452 31.155 -13.893 1.00 126.17 ? 397  GLU A CB    1 
ATOM   2385 C CG    . GLU A 1 384 ? -19.459 30.024 -14.107 1.00 129.85 ? 397  GLU A CG    1 
ATOM   2386 C CD    . GLU A 1 384 ? -19.033 29.367 -12.805 1.00 135.21 ? 397  GLU A CD    1 
ATOM   2387 O OE1   . GLU A 1 384 ? -18.498 30.074 -11.924 1.00 121.65 ? 397  GLU A OE1   1 
ATOM   2388 O OE2   . GLU A 1 384 ? -19.228 28.141 -12.664 1.00 145.59 ? 397  GLU A OE2   1 
ATOM   2389 N N     . ALA A 1 385 ? -23.350 32.479 -12.818 1.00 99.10  ? 398  ALA A N     1 
ATOM   2390 C CA    . ALA A 1 385 ? -24.053 33.279 -11.813 1.00 88.04  ? 398  ALA A CA    1 
ATOM   2391 C C     . ALA A 1 385 ? -25.015 32.422 -10.985 1.00 90.95  ? 398  ALA A C     1 
ATOM   2392 O O     . ALA A 1 385 ? -25.290 32.741 -9.829  1.00 98.27  ? 398  ALA A O     1 
ATOM   2393 C CB    . ALA A 1 385 ? -24.797 34.431 -12.471 1.00 77.15  ? 398  ALA A CB    1 
ATOM   2394 N N     . LEU A 1 386 ? -25.513 31.336 -11.577 1.00 92.90  ? 399  LEU A N     1 
ATOM   2395 C CA    . LEU A 1 386 ? -26.371 30.376 -10.872 1.00 88.45  ? 399  LEU A CA    1 
ATOM   2396 C C     . LEU A 1 386 ? -25.643 29.651 -9.739  1.00 89.50  ? 399  LEU A C     1 
ATOM   2397 O O     . LEU A 1 386 ? -26.280 29.171 -8.799  1.00 90.00  ? 399  LEU A O     1 
ATOM   2398 C CB    . LEU A 1 386 ? -26.935 29.335 -11.847 1.00 90.81  ? 399  LEU A CB    1 
ATOM   2399 C CG    . LEU A 1 386 ? -27.928 29.840 -12.896 1.00 94.22  ? 399  LEU A CG    1 
ATOM   2400 C CD1   . LEU A 1 386 ? -28.172 28.777 -13.957 1.00 88.91  ? 399  LEU A CD1   1 
ATOM   2401 C CD2   . LEU A 1 386 ? -29.235 30.260 -12.241 1.00 99.97  ? 399  LEU A CD2   1 
ATOM   2402 N N     . CYS A 1 387 ? -24.319 29.556 -9.834  1.00 81.56  ? 400  CYS A N     1 
ATOM   2403 C CA    . CYS A 1 387 ? -23.527 28.966 -8.759  1.00 90.96  ? 400  CYS A CA    1 
ATOM   2404 C C     . CYS A 1 387 ? -23.611 29.809 -7.485  1.00 83.59  ? 400  CYS A C     1 
ATOM   2405 O O     . CYS A 1 387 ? -23.530 29.269 -6.381  1.00 88.56  ? 400  CYS A O     1 
ATOM   2406 C CB    . CYS A 1 387 ? -22.065 28.786 -9.184  1.00 99.96  ? 400  CYS A CB    1 
ATOM   2407 S SG    . CYS A 1 387 ? -21.829 27.627 -10.555 1.00 103.06 ? 400  CYS A SG    1 
ATOM   2408 N N     . VAL A 1 388 ? -23.776 31.123 -7.642  1.00 76.09  ? 401  VAL A N     1 
ATOM   2409 C CA    . VAL A 1 388 ? -23.942 32.022 -6.498  1.00 78.98  ? 401  VAL A CA    1 
ATOM   2410 C C     . VAL A 1 388 ? -25.277 31.745 -5.799  1.00 80.80  ? 401  VAL A C     1 
ATOM   2411 O O     . VAL A 1 388 ? -25.362 31.798 -4.572  1.00 85.14  ? 401  VAL A O     1 
ATOM   2412 C CB    . VAL A 1 388 ? -23.842 33.508 -6.914  1.00 82.86  ? 401  VAL A CB    1 
ATOM   2413 C CG1   . VAL A 1 388 ? -24.163 34.433 -5.744  1.00 80.72  ? 401  VAL A CG1   1 
ATOM   2414 C CG2   . VAL A 1 388 ? -22.454 33.810 -7.463  1.00 83.14  ? 401  VAL A CG2   1 
ATOM   2415 N N     . ALA A 1 389 ? -26.311 31.446 -6.582  1.00 73.58  ? 402  ALA A N     1 
ATOM   2416 C CA    . ALA A 1 389 ? -27.593 31.011 -6.032  1.00 70.94  ? 402  ALA A CA    1 
ATOM   2417 C C     . ALA A 1 389 ? -27.482 29.616 -5.410  1.00 74.73  ? 402  ALA A C     1 
ATOM   2418 O O     . ALA A 1 389 ? -27.956 29.392 -4.296  1.00 67.41  ? 402  ALA A O     1 
ATOM   2419 C CB    . ALA A 1 389 ? -28.665 31.026 -7.109  1.00 69.92  ? 402  ALA A CB    1 
ATOM   2420 N N     . LYS A 1 390 ? -26.847 28.690 -6.129  1.00 84.40  ? 403  LYS A N     1 
ATOM   2421 C CA    . LYS A 1 390 ? -26.689 27.304 -5.666  1.00 82.11  ? 403  LYS A CA    1 
ATOM   2422 C C     . LYS A 1 390 ? -25.945 27.215 -4.332  1.00 81.83  ? 403  LYS A C     1 
ATOM   2423 O O     . LYS A 1 390 ? -26.408 26.546 -3.406  1.00 85.24  ? 403  LYS A O     1 
ATOM   2424 C CB    . LYS A 1 390 ? -25.957 26.465 -6.720  1.00 81.32  ? 403  LYS A CB    1 
ATOM   2425 N N     . VAL A 1 391 ? -24.803 27.894 -4.237  1.00 76.74  ? 404  VAL A N     1 
ATOM   2426 C CA    . VAL A 1 391 ? -23.993 27.870 -3.017  1.00 78.28  ? 404  VAL A CA    1 
ATOM   2427 C C     . VAL A 1 391 ? -24.713 28.485 -1.815  1.00 74.73  ? 404  VAL A C     1 
ATOM   2428 O O     . VAL A 1 391 ? -24.591 27.977 -0.704  1.00 70.65  ? 404  VAL A O     1 
ATOM   2429 C CB    . VAL A 1 391 ? -22.613 28.554 -3.209  1.00 88.55  ? 404  VAL A CB    1 
ATOM   2430 C CG1   . VAL A 1 391 ? -22.750 30.056 -3.428  1.00 89.16  ? 404  VAL A CG1   1 
ATOM   2431 C CG2   . VAL A 1 391 ? -21.711 28.277 -2.011  1.00 90.86  ? 404  VAL A CG2   1 
ATOM   2432 N N     . GLN A 1 392 ? -25.454 29.570 -2.038  1.00 71.83  ? 405  GLN A N     1 
ATOM   2433 C CA    . GLN A 1 392 ? -26.225 30.212 -0.964  1.00 69.06  ? 405  GLN A CA    1 
ATOM   2434 C C     . GLN A 1 392 ? -27.238 29.260 -0.342  1.00 70.90  ? 405  GLN A C     1 
ATOM   2435 O O     . GLN A 1 392 ? -27.383 29.222 0.881   1.00 76.53  ? 405  GLN A O     1 
ATOM   2436 C CB    . GLN A 1 392 ? -26.965 31.443 -1.476  1.00 69.55  ? 405  GLN A CB    1 
ATOM   2437 C CG    . GLN A 1 392 ? -26.131 32.706 -1.526  1.00 68.83  ? 405  GLN A CG    1 
ATOM   2438 C CD    . GLN A 1 392 ? -26.923 33.868 -2.079  1.00 75.38  ? 405  GLN A CD    1 
ATOM   2439 O OE1   . GLN A 1 392 ? -27.334 34.764 -1.336  1.00 77.06  ? 405  GLN A OE1   1 
ATOM   2440 N NE2   . GLN A 1 392 ? -27.164 33.853 -3.389  1.00 77.48  ? 405  GLN A NE2   1 
ATOM   2441 N N     . VAL A 1 393 ? -27.934 28.499 -1.185  1.00 65.62  ? 406  VAL A N     1 
ATOM   2442 C CA    . VAL A 1 393 ? -28.907 27.513 -0.711  1.00 65.76  ? 406  VAL A CA    1 
ATOM   2443 C C     . VAL A 1 393 ? -28.193 26.413 0.073   1.00 69.99  ? 406  VAL A C     1 
ATOM   2444 O O     . VAL A 1 393 ? -28.679 25.965 1.111   1.00 81.90  ? 406  VAL A O     1 
ATOM   2445 C CB    . VAL A 1 393 ? -29.717 26.903 -1.877  1.00 66.83  ? 406  VAL A CB    1 
ATOM   2446 C CG1   . VAL A 1 393 ? -30.562 25.725 -1.407  1.00 64.52  ? 406  VAL A CG1   1 
ATOM   2447 C CG2   . VAL A 1 393 ? -30.600 27.966 -2.518  1.00 64.06  ? 406  VAL A CG2   1 
ATOM   2448 N N     . GLU A 1 394 ? -27.031 25.999 -0.419  1.00 71.27  ? 407  GLU A N     1 
ATOM   2449 C CA    . GLU A 1 394 ? -26.211 24.990 0.259   1.00 82.30  ? 407  GLU A CA    1 
ATOM   2450 C C     . GLU A 1 394 ? -25.685 25.534 1.591   1.00 82.05  ? 407  GLU A C     1 
ATOM   2451 O O     . GLU A 1 394 ? -25.482 24.786 2.549   1.00 82.25  ? 407  GLU A O     1 
ATOM   2452 C CB    . GLU A 1 394 ? -25.036 24.580 -0.642  1.00 89.32  ? 407  GLU A CB    1 
ATOM   2453 C CG    . GLU A 1 394 ? -24.905 23.085 -0.879  1.00 98.30  ? 407  GLU A CG    1 
ATOM   2454 C CD    . GLU A 1 394 ? -24.157 22.766 -2.163  1.00 112.65 ? 407  GLU A CD    1 
ATOM   2455 O OE1   . GLU A 1 394 ? -23.175 23.476 -2.474  1.00 103.00 ? 407  GLU A OE1   1 
ATOM   2456 O OE2   . GLU A 1 394 ? -24.553 21.808 -2.864  1.00 115.99 ? 407  GLU A OE2   1 
ATOM   2457 N N     . MET A 1 395 ? -25.479 26.847 1.634   1.00 82.98  ? 408  MET A N     1 
ATOM   2458 C CA    . MET A 1 395 ? -24.930 27.530 2.796   1.00 76.37  ? 408  MET A CA    1 
ATOM   2459 C C     . MET A 1 395 ? -26.015 28.024 3.769   1.00 76.39  ? 408  MET A C     1 
ATOM   2460 O O     . MET A 1 395 ? -25.718 28.785 4.687   1.00 76.31  ? 408  MET A O     1 
ATOM   2461 C CB    . MET A 1 395 ? -24.090 28.713 2.314   1.00 83.71  ? 408  MET A CB    1 
ATOM   2462 C CG    . MET A 1 395 ? -22.927 29.064 3.216   1.00 96.02  ? 408  MET A CG    1 
ATOM   2463 S SD    . MET A 1 395 ? -21.362 28.346 2.707   1.00 108.81 ? 408  MET A SD    1 
ATOM   2464 C CE    . MET A 1 395 ? -20.846 29.548 1.483   1.00 102.63 ? 408  MET A CE    1 
ATOM   2465 N N     . GLY A 1 396 ? -27.266 27.613 3.560   1.00 78.36  ? 409  GLY A N     1 
ATOM   2466 C CA    . GLY A 1 396 ? -28.346 27.868 4.516   1.00 70.05  ? 409  GLY A CA    1 
ATOM   2467 C C     . GLY A 1 396 ? -29.442 28.827 4.072   1.00 77.52  ? 409  GLY A C     1 
ATOM   2468 O O     . GLY A 1 396 ? -30.343 29.139 4.858   1.00 71.27  ? 409  GLY A O     1 
ATOM   2469 N N     . ALA A 1 397 ? -29.386 29.295 2.826   1.00 67.78  ? 410  ALA A N     1 
ATOM   2470 C CA    . ALA A 1 397 ? -30.397 30.229 2.318   1.00 64.41  ? 410  ALA A CA    1 
ATOM   2471 C C     . ALA A 1 397 ? -31.710 29.506 2.032   1.00 60.55  ? 410  ALA A C     1 
ATOM   2472 O O     . ALA A 1 397 ? -31.745 28.556 1.252   1.00 69.10  ? 410  ALA A O     1 
ATOM   2473 C CB    . ALA A 1 397 ? -29.899 30.926 1.062   1.00 68.33  ? 410  ALA A CB    1 
ATOM   2474 N N     . GLN A 1 398 ? -32.787 29.959 2.663   1.00 56.39  ? 411  GLN A N     1 
ATOM   2475 C CA    . GLN A 1 398 ? -34.098 29.324 2.508   1.00 57.83  ? 411  GLN A CA    1 
ATOM   2476 C C     . GLN A 1 398 ? -34.965 30.036 1.468   1.00 53.12  ? 411  GLN A C     1 
ATOM   2477 O O     . GLN A 1 398 ? -35.880 29.441 0.898   1.00 52.07  ? 411  GLN A O     1 
ATOM   2478 C CB    . GLN A 1 398 ? -34.808 29.271 3.858   1.00 62.43  ? 411  GLN A CB    1 
ATOM   2479 C CG    . GLN A 1 398 ? -34.064 28.431 4.884   1.00 69.53  ? 411  GLN A CG    1 
ATOM   2480 C CD    . GLN A 1 398 ? -34.694 28.494 6.258   1.00 73.80  ? 411  GLN A CD    1 
ATOM   2481 O OE1   . GLN A 1 398 ? -34.827 29.568 6.833   1.00 87.12  ? 411  GLN A OE1   1 
ATOM   2482 N NE2   . GLN A 1 398 ? -35.079 27.340 6.794   1.00 82.11  ? 411  GLN A NE2   1 
ATOM   2483 N N     . VAL A 1 399 ? -34.680 31.315 1.244   1.00 53.83  ? 412  VAL A N     1 
ATOM   2484 C CA    . VAL A 1 399 ? -35.249 32.074 0.138   1.00 53.73  ? 412  VAL A CA    1 
ATOM   2485 C C     . VAL A 1 399 ? -34.089 32.787 -0.555  1.00 58.34  ? 412  VAL A C     1 
ATOM   2486 O O     . VAL A 1 399 ? -33.080 33.085 0.081   1.00 69.18  ? 412  VAL A O     1 
ATOM   2487 C CB    . VAL A 1 399 ? -36.284 33.097 0.647   1.00 54.06  ? 412  VAL A CB    1 
ATOM   2488 C CG1   . VAL A 1 399 ? -36.942 33.840 -0.509  1.00 64.21  ? 412  VAL A CG1   1 
ATOM   2489 C CG2   . VAL A 1 399 ? -37.341 32.403 1.491   1.00 56.58  ? 412  VAL A CG2   1 
ATOM   2490 N N     . LEU A 1 400 ? -34.214 33.032 -1.857  1.00 61.09  ? 413  LEU A N     1 
ATOM   2491 C CA    . LEU A 1 400 ? -33.181 33.753 -2.602  1.00 57.91  ? 413  LEU A CA    1 
ATOM   2492 C C     . LEU A 1 400 ? -33.669 35.127 -3.026  1.00 55.17  ? 413  LEU A C     1 
ATOM   2493 O O     . LEU A 1 400 ? -34.714 35.244 -3.655  1.00 65.52  ? 413  LEU A O     1 
ATOM   2494 C CB    . LEU A 1 400 ? -32.767 32.965 -3.840  1.00 57.70  ? 413  LEU A CB    1 
ATOM   2495 C CG    . LEU A 1 400 ? -31.887 31.741 -3.603  1.00 66.69  ? 413  LEU A CG    1 
ATOM   2496 C CD1   . LEU A 1 400 ? -31.623 31.056 -4.933  1.00 72.00  ? 413  LEU A CD1   1 
ATOM   2497 C CD2   . LEU A 1 400 ? -30.580 32.112 -2.919  1.00 66.12  ? 413  LEU A CD2   1 
ATOM   2498 N N     . ASP A 1 401 ? -32.906 36.162 -2.676  1.00 61.63  ? 414  ASP A N     1 
ATOM   2499 C CA    . ASP A 1 401 ? -33.175 37.523 -3.146  1.00 60.55  ? 414  ASP A CA    1 
ATOM   2500 C C     . ASP A 1 401 ? -32.518 37.703 -4.507  1.00 61.28  ? 414  ASP A C     1 
ATOM   2501 O O     . ASP A 1 401 ? -31.335 37.415 -4.659  1.00 62.43  ? 414  ASP A O     1 
ATOM   2502 C CB    . ASP A 1 401 ? -32.622 38.561 -2.165  1.00 58.54  ? 414  ASP A CB    1 
ATOM   2503 C CG    . ASP A 1 401 ? -33.235 39.934 -2.358  1.00 63.40  ? 414  ASP A CG    1 
ATOM   2504 O OD1   . ASP A 1 401 ? -34.437 40.088 -2.063  1.00 69.69  ? 414  ASP A OD1   1 
ATOM   2505 O OD2   . ASP A 1 401 ? -32.518 40.862 -2.789  1.00 60.43  ? 414  ASP A OD2   1 
ATOM   2506 N N     . VAL A 1 402 ? -33.285 38.163 -5.493  1.00 62.97  ? 415  VAL A N     1 
ATOM   2507 C CA    . VAL A 1 402 ? -32.751 38.443 -6.828  1.00 56.91  ? 415  VAL A CA    1 
ATOM   2508 C C     . VAL A 1 402 ? -32.909 39.925 -7.121  1.00 50.28  ? 415  VAL A C     1 
ATOM   2509 O O     . VAL A 1 402 ? -34.018 40.446 -7.076  1.00 48.48  ? 415  VAL A O     1 
ATOM   2510 C CB    . VAL A 1 402 ? -33.476 37.635 -7.920  1.00 53.98  ? 415  VAL A CB    1 
ATOM   2511 C CG1   . VAL A 1 402 ? -32.904 37.965 -9.294  1.00 53.79  ? 415  VAL A CG1   1 
ATOM   2512 C CG2   . VAL A 1 402 ? -33.369 36.141 -7.637  1.00 55.99  ? 415  VAL A CG2   1 
ATOM   2513 N N     . ASN A 1 403 ? -31.799 40.595 -7.417  1.00 52.77  ? 416  ASN A N     1 
ATOM   2514 C CA    . ASN A 1 403 ? -31.803 42.031 -7.695  1.00 56.75  ? 416  ASN A CA    1 
ATOM   2515 C C     . ASN A 1 403 ? -30.934 42.372 -8.904  1.00 56.79  ? 416  ASN A C     1 
ATOM   2516 O O     . ASN A 1 403 ? -29.717 42.199 -8.864  1.00 59.11  ? 416  ASN A O     1 
ATOM   2517 C CB    . ASN A 1 403 ? -31.322 42.803 -6.466  1.00 59.86  ? 416  ASN A CB    1 
ATOM   2518 C CG    . ASN A 1 403 ? -31.510 44.300 -6.604  1.00 59.61  ? 416  ASN A CG    1 
ATOM   2519 O OD1   . ASN A 1 403 ? -31.261 44.873 -7.662  1.00 57.77  ? 416  ASN A OD1   1 
ATOM   2520 N ND2   . ASN A 1 403 ? -31.935 44.944 -5.524  1.00 64.35  ? 416  ASN A ND2   1 
ATOM   2521 N N     . MET A 1 404 ? -31.574 42.872 -9.963  1.00 63.11  ? 417  MET A N     1 
ATOM   2522 C CA    . MET A 1 404 ? -30.911 43.161 -11.239 1.00 63.11  ? 417  MET A CA    1 
ATOM   2523 C C     . MET A 1 404 ? -30.897 44.656 -11.563 1.00 59.06  ? 417  MET A C     1 
ATOM   2524 O O     . MET A 1 404 ? -30.905 45.044 -12.735 1.00 62.16  ? 417  MET A O     1 
ATOM   2525 C CB    . MET A 1 404 ? -31.621 42.407 -12.361 1.00 64.38  ? 417  MET A CB    1 
ATOM   2526 C CG    . MET A 1 404 ? -31.608 40.901 -12.187 1.00 74.48  ? 417  MET A CG    1 
ATOM   2527 S SD    . MET A 1 404 ? -29.967 40.222 -12.464 1.00 74.20  ? 417  MET A SD    1 
ATOM   2528 C CE    . MET A 1 404 ? -30.126 38.634 -11.654 1.00 70.62  ? 417  MET A CE    1 
ATOM   2529 N N     . ASP A 1 405 ? -30.856 45.491 -10.527 1.00 54.81  ? 418  ASP A N     1 
ATOM   2530 C CA    . ASP A 1 405 ? -30.913 46.939 -10.700 1.00 60.28  ? 418  ASP A CA    1 
ATOM   2531 C C     . ASP A 1 405 ? -29.529 47.555 -10.927 1.00 74.21  ? 418  ASP A C     1 
ATOM   2532 O O     . ASP A 1 405 ? -28.682 47.568 -10.029 1.00 77.33  ? 418  ASP A O     1 
ATOM   2533 C CB    . ASP A 1 405 ? -31.588 47.595 -9.493  1.00 56.32  ? 418  ASP A CB    1 
ATOM   2534 C CG    . ASP A 1 405 ? -33.064 47.239 -9.378  1.00 59.77  ? 418  ASP A CG    1 
ATOM   2535 O OD1   . ASP A 1 405 ? -33.569 46.433 -10.196 1.00 57.24  ? 418  ASP A OD1   1 
ATOM   2536 O OD2   . ASP A 1 405 ? -33.721 47.780 -8.462  1.00 58.22  ? 418  ASP A OD2   1 
ATOM   2537 N N     . ASP A 1 406 ? -29.313 48.052 -12.142 1.00 83.40  ? 419  ASP A N     1 
ATOM   2538 C CA    . ASP A 1 406 ? -28.135 48.846 -12.477 1.00 85.58  ? 419  ASP A CA    1 
ATOM   2539 C C     . ASP A 1 406 ? -28.408 49.618 -13.764 1.00 86.34  ? 419  ASP A C     1 
ATOM   2540 O O     . ASP A 1 406 ? -29.071 49.107 -14.673 1.00 87.85  ? 419  ASP A O     1 
ATOM   2541 C CB    . ASP A 1 406 ? -26.900 47.950 -12.640 1.00 103.01 ? 419  ASP A CB    1 
ATOM   2542 C CG    . ASP A 1 406 ? -25.620 48.745 -12.875 1.00 99.61  ? 419  ASP A CG    1 
ATOM   2543 O OD1   . ASP A 1 406 ? -25.380 49.164 -14.025 1.00 94.36  ? 419  ASP A OD1   1 
ATOM   2544 O OD2   . ASP A 1 406 ? -24.846 48.937 -11.914 1.00 98.05  ? 419  ASP A OD2   1 
ATOM   2545 N N     . GLY A 1 407 ? -27.892 50.844 -13.835 1.00 88.81  ? 420  GLY A N     1 
ATOM   2546 C CA    . GLY A 1 407 ? -28.039 51.694 -15.021 1.00 92.55  ? 420  GLY A CA    1 
ATOM   2547 C C     . GLY A 1 407 ? -27.538 51.063 -16.312 1.00 94.95  ? 420  GLY A C     1 
ATOM   2548 O O     . GLY A 1 407 ? -28.035 51.379 -17.397 1.00 96.28  ? 420  GLY A O     1 
ATOM   2549 N N     . MET A 1 408 ? -26.564 50.161 -16.192 1.00 91.16  ? 421  MET A N     1 
ATOM   2550 C CA    . MET A 1 408 ? -26.021 49.428 -17.338 1.00 94.38  ? 421  MET A CA    1 
ATOM   2551 C C     . MET A 1 408 ? -26.758 48.107 -17.613 1.00 91.74  ? 421  MET A C     1 
ATOM   2552 O O     . MET A 1 408 ? -26.191 47.207 -18.234 1.00 96.28  ? 421  MET A O     1 
ATOM   2553 C CB    . MET A 1 408 ? -24.531 49.129 -17.109 1.00 93.04  ? 421  MET A CB    1 
ATOM   2554 C CG    . MET A 1 408 ? -23.692 50.310 -16.633 1.00 100.45 ? 421  MET A CG    1 
ATOM   2555 S SD    . MET A 1 408 ? -23.866 51.801 -17.631 1.00 115.78 ? 421  MET A SD    1 
ATOM   2556 C CE    . MET A 1 408 ? -23.611 51.163 -19.288 1.00 100.21 ? 421  MET A CE    1 
ATOM   2557 N N     . LEU A 1 409 ? -28.007 47.986 -17.159 1.00 90.43  ? 422  LEU A N     1 
ATOM   2558 C CA    . LEU A 1 409 ? -28.789 46.757 -17.348 1.00 88.66  ? 422  LEU A CA    1 
ATOM   2559 C C     . LEU A 1 409 ? -30.239 47.025 -17.736 1.00 83.39  ? 422  LEU A C     1 
ATOM   2560 O O     . LEU A 1 409 ? -30.850 47.992 -17.278 1.00 81.09  ? 422  LEU A O     1 
ATOM   2561 C CB    . LEU A 1 409 ? -28.786 45.910 -16.070 1.00 92.79  ? 422  LEU A CB    1 
ATOM   2562 C CG    . LEU A 1 409 ? -27.579 45.020 -15.771 1.00 94.81  ? 422  LEU A CG    1 
ATOM   2563 C CD1   . LEU A 1 409 ? -27.882 44.179 -14.540 1.00 82.99  ? 422  LEU A CD1   1 
ATOM   2564 C CD2   . LEU A 1 409 ? -27.222 44.129 -16.954 1.00 97.13  ? 422  LEU A CD2   1 
ATOM   2565 N N     . ASP A 1 410 ? -30.777 46.145 -18.577 1.00 81.53  ? 423  ASP A N     1 
ATOM   2566 C CA    . ASP A 1 410 ? -32.199 46.125 -18.886 1.00 82.35  ? 423  ASP A CA    1 
ATOM   2567 C C     . ASP A 1 410 ? -32.890 45.328 -17.785 1.00 82.16  ? 423  ASP A C     1 
ATOM   2568 O O     . ASP A 1 410 ? -32.965 44.099 -17.851 1.00 80.59  ? 423  ASP A O     1 
ATOM   2569 C CB    . ASP A 1 410 ? -32.436 45.482 -20.256 1.00 91.89  ? 423  ASP A CB    1 
ATOM   2570 C CG    . ASP A 1 410 ? -33.903 45.470 -20.659 1.00 102.03 ? 423  ASP A CG    1 
ATOM   2571 O OD1   . ASP A 1 410 ? -34.718 46.178 -20.031 1.00 105.96 ? 423  ASP A OD1   1 
ATOM   2572 O OD2   . ASP A 1 410 ? -34.239 44.753 -21.623 1.00 107.77 ? 423  ASP A OD2   1 
ATOM   2573 N N     . GLY A 1 411 ? -33.380 46.037 -16.769 1.00 70.63  ? 424  GLY A N     1 
ATOM   2574 C CA    . GLY A 1 411 ? -33.942 45.410 -15.579 1.00 69.86  ? 424  GLY A CA    1 
ATOM   2575 C C     . GLY A 1 411 ? -34.888 44.258 -15.877 1.00 76.88  ? 424  GLY A C     1 
ATOM   2576 O O     . GLY A 1 411 ? -34.601 43.115 -15.514 1.00 67.38  ? 424  GLY A O     1 
ATOM   2577 N N     . PRO A 1 412 ? -36.017 44.551 -16.551 1.00 70.30  ? 425  PRO A N     1 
ATOM   2578 C CA    . PRO A 1 412 ? -37.048 43.549 -16.820 1.00 63.89  ? 425  PRO A CA    1 
ATOM   2579 C C     . PRO A 1 412 ? -36.546 42.291 -17.515 1.00 66.40  ? 425  PRO A C     1 
ATOM   2580 O O     . PRO A 1 412 ? -36.968 41.195 -17.159 1.00 82.36  ? 425  PRO A O     1 
ATOM   2581 C CB    . PRO A 1 412 ? -38.030 44.297 -17.718 1.00 70.15  ? 425  PRO A CB    1 
ATOM   2582 C CG    . PRO A 1 412 ? -37.898 45.720 -17.300 1.00 70.24  ? 425  PRO A CG    1 
ATOM   2583 C CD    . PRO A 1 412 ? -36.447 45.900 -16.967 1.00 70.82  ? 425  PRO A CD    1 
ATOM   2584 N N     . SER A 1 413 ? -35.651 42.449 -18.486 1.00 72.40  ? 426  SER A N     1 
ATOM   2585 C CA    . SER A 1 413 ? -35.143 41.316 -19.261 1.00 72.26  ? 426  SER A CA    1 
ATOM   2586 C C     . SER A 1 413 ? -34.191 40.455 -18.447 1.00 75.86  ? 426  SER A C     1 
ATOM   2587 O O     . SER A 1 413 ? -34.305 39.230 -18.443 1.00 80.23  ? 426  SER A O     1 
ATOM   2588 C CB    . SER A 1 413 ? -34.432 41.807 -20.521 1.00 81.25  ? 426  SER A CB    1 
ATOM   2589 O OG    . SER A 1 413 ? -35.314 42.569 -21.320 1.00 83.76  ? 426  SER A OG    1 
ATOM   2590 N N     . ALA A 1 414 ? -33.248 41.104 -17.768 1.00 74.76  ? 427  ALA A N     1 
ATOM   2591 C CA    . ALA A 1 414 ? -32.272 40.402 -16.934 1.00 72.90  ? 427  ALA A CA    1 
ATOM   2592 C C     . ALA A 1 414 ? -32.960 39.600 -15.827 1.00 75.45  ? 427  ALA A C     1 
ATOM   2593 O O     . ALA A 1 414 ? -32.593 38.450 -15.564 1.00 77.71  ? 427  ALA A O     1 
ATOM   2594 C CB    . ALA A 1 414 ? -31.280 41.388 -16.337 1.00 70.95  ? 427  ALA A CB    1 
ATOM   2595 N N     . MET A 1 415 ? -33.954 40.214 -15.187 1.00 65.21  ? 428  MET A N     1 
ATOM   2596 C CA    . MET A 1 415 ? -34.756 39.535 -14.172 1.00 64.11  ? 428  MET A CA    1 
ATOM   2597 C C     . MET A 1 415 ? -35.444 38.339 -14.813 1.00 62.83  ? 428  MET A C     1 
ATOM   2598 O O     . MET A 1 415 ? -35.315 37.208 -14.343 1.00 62.73  ? 428  MET A O     1 
ATOM   2599 C CB    . MET A 1 415 ? -35.802 40.489 -13.585 1.00 66.04  ? 428  MET A CB    1 
ATOM   2600 C CG    . MET A 1 415 ? -36.673 39.891 -12.487 1.00 61.72  ? 428  MET A CG    1 
ATOM   2601 S SD    . MET A 1 415 ? -35.766 39.522 -10.972 1.00 64.88  ? 428  MET A SD    1 
ATOM   2602 C CE    . MET A 1 415 ? -35.500 41.169 -10.309 1.00 66.47  ? 428  MET A CE    1 
ATOM   2603 N N     . THR A 1 416 ? -36.167 38.613 -15.897 1.00 61.49  ? 429  THR A N     1 
ATOM   2604 C CA    . THR A 1 416 ? -36.838 37.592 -16.690 1.00 59.17  ? 429  THR A CA    1 
ATOM   2605 C C     . THR A 1 416 ? -35.889 36.462 -17.070 1.00 61.44  ? 429  THR A C     1 
ATOM   2606 O O     . THR A 1 416 ? -36.254 35.288 -16.989 1.00 60.82  ? 429  THR A O     1 
ATOM   2607 C CB    . THR A 1 416 ? -37.410 38.214 -17.979 1.00 68.18  ? 429  THR A CB    1 
ATOM   2608 O OG1   . THR A 1 416 ? -38.472 39.116 -17.639 1.00 68.24  ? 429  THR A OG1   1 
ATOM   2609 C CG2   . THR A 1 416 ? -37.917 37.140 -18.955 1.00 61.87  ? 429  THR A CG2   1 
ATOM   2610 N N     . ARG A 1 417 ? -34.678 36.824 -17.485 1.00 59.15  ? 430  ARG A N     1 
ATOM   2611 C CA    . ARG A 1 417 ? -33.693 35.837 -17.913 1.00 67.86  ? 430  ARG A CA    1 
ATOM   2612 C C     . ARG A 1 417 ? -33.195 35.004 -16.743 1.00 64.65  ? 430  ARG A C     1 
ATOM   2613 O O     . ARG A 1 417 ? -33.184 33.776 -16.820 1.00 74.86  ? 430  ARG A O     1 
ATOM   2614 C CB    . ARG A 1 417 ? -32.508 36.507 -18.617 1.00 72.62  ? 430  ARG A CB    1 
ATOM   2615 C CG    . ARG A 1 417 ? -31.415 35.529 -19.030 1.00 79.54  ? 430  ARG A CG    1 
ATOM   2616 C CD    . ARG A 1 417 ? -30.363 36.187 -19.903 1.00 92.19  ? 430  ARG A CD    1 
ATOM   2617 N NE    . ARG A 1 417 ? -30.793 36.298 -21.293 1.00 105.24 ? 430  ARG A NE    1 
ATOM   2618 C CZ    . ARG A 1 417 ? -30.049 36.809 -22.270 1.00 133.01 ? 430  ARG A CZ    1 
ATOM   2619 N NH1   . ARG A 1 417 ? -28.825 37.266 -22.018 1.00 128.27 ? 430  ARG A NH1   1 
ATOM   2620 N NH2   . ARG A 1 417 ? -30.531 36.863 -23.509 1.00 137.17 ? 430  ARG A NH2   1 
ATOM   2621 N N     . PHE A 1 418 ? -32.782 35.669 -15.666 1.00 68.19  ? 431  PHE A N     1 
ATOM   2622 C CA    . PHE A 1 418 ? -32.220 34.969 -14.508 1.00 65.38  ? 431  PHE A CA    1 
ATOM   2623 C C     . PHE A 1 418 ? -33.267 34.097 -13.817 1.00 59.68  ? 431  PHE A C     1 
ATOM   2624 O O     . PHE A 1 418 ? -32.961 32.984 -13.385 1.00 63.54  ? 431  PHE A O     1 
ATOM   2625 C CB    . PHE A 1 418 ? -31.607 35.955 -13.510 1.00 57.36  ? 431  PHE A CB    1 
ATOM   2626 C CG    . PHE A 1 418 ? -30.663 35.315 -12.526 1.00 58.04  ? 431  PHE A CG    1 
ATOM   2627 C CD1   . PHE A 1 418 ? -29.511 34.681 -12.962 1.00 61.70  ? 431  PHE A CD1   1 
ATOM   2628 C CD2   . PHE A 1 418 ? -30.913 35.364 -11.162 1.00 62.31  ? 431  PHE A CD2   1 
ATOM   2629 C CE1   . PHE A 1 418 ? -28.634 34.095 -12.062 1.00 63.44  ? 431  PHE A CE1   1 
ATOM   2630 C CE2   . PHE A 1 418 ? -30.038 34.781 -10.257 1.00 58.61  ? 431  PHE A CE2   1 
ATOM   2631 C CZ    . PHE A 1 418 ? -28.898 34.145 -10.708 1.00 59.04  ? 431  PHE A CZ    1 
ATOM   2632 N N     . CYS A 1 419 ? -34.497 34.597 -13.724 1.00 59.23  ? 432  CYS A N     1 
ATOM   2633 C CA    . CYS A 1 419 ? -35.587 33.830 -13.117 1.00 63.04  ? 432  CYS A CA    1 
ATOM   2634 C C     . CYS A 1 419 ? -35.856 32.549 -13.900 1.00 63.52  ? 432  CYS A C     1 
ATOM   2635 O O     . CYS A 1 419 ? -36.007 31.480 -13.313 1.00 63.97  ? 432  CYS A O     1 
ATOM   2636 C CB    . CYS A 1 419 ? -36.859 34.673 -13.006 1.00 63.52  ? 432  CYS A CB    1 
ATOM   2637 S SG    . CYS A 1 419 ? -36.761 35.996 -11.770 1.00 70.00  ? 432  CYS A SG    1 
ATOM   2638 N N     . ASN A 1 420 ? -35.890 32.659 -15.226 1.00 72.56  ? 433  ASN A N     1 
ATOM   2639 C CA    . ASN A 1 420 ? -36.077 31.495 -16.095 1.00 63.61  ? 433  ASN A CA    1 
ATOM   2640 C C     . ASN A 1 420 ? -34.920 30.501 -16.023 1.00 63.79  ? 433  ASN A C     1 
ATOM   2641 O O     . ASN A 1 420 ? -35.128 29.301 -16.181 1.00 66.58  ? 433  ASN A O     1 
ATOM   2642 C CB    . ASN A 1 420 ? -36.301 31.935 -17.545 1.00 66.05  ? 433  ASN A CB    1 
ATOM   2643 C CG    . ASN A 1 420 ? -37.697 32.499 -17.781 1.00 63.77  ? 433  ASN A CG    1 
ATOM   2644 O OD1   . ASN A 1 420 ? -38.639 32.221 -17.032 1.00 58.71  ? 433  ASN A OD1   1 
ATOM   2645 N ND2   . ASN A 1 420 ? -37.835 33.292 -18.833 1.00 55.63  ? 433  ASN A ND2   1 
ATOM   2646 N N     . LEU A 1 421 ? -33.710 30.998 -15.777 1.00 67.24  ? 434  LEU A N     1 
ATOM   2647 C CA    . LEU A 1 421 ? -32.538 30.131 -15.603 1.00 74.15  ? 434  LEU A CA    1 
ATOM   2648 C C     . LEU A 1 421 ? -32.580 29.375 -14.290 1.00 71.38  ? 434  LEU A C     1 
ATOM   2649 O O     . LEU A 1 421 ? -32.349 28.170 -14.258 1.00 88.23  ? 434  LEU A O     1 
ATOM   2650 C CB    . LEU A 1 421 ? -31.244 30.939 -15.667 1.00 81.65  ? 434  LEU A CB    1 
ATOM   2651 C CG    . LEU A 1 421 ? -30.697 31.152 -17.073 1.00 87.32  ? 434  LEU A CG    1 
ATOM   2652 C CD1   . LEU A 1 421 ? -29.637 32.233 -17.039 1.00 87.04  ? 434  LEU A CD1   1 
ATOM   2653 C CD2   . LEU A 1 421 ? -30.129 29.857 -17.631 1.00 86.79  ? 434  LEU A CD2   1 
ATOM   2654 N N     . ILE A 1 422 ? -32.856 30.095 -13.206 1.00 75.41  ? 435  ILE A N     1 
ATOM   2655 C CA    . ILE A 1 422 ? -33.039 29.484 -11.891 1.00 72.11  ? 435  ILE A CA    1 
ATOM   2656 C C     . ILE A 1 422 ? -34.008 28.310 -11.986 1.00 70.46  ? 435  ILE A C     1 
ATOM   2657 O O     . ILE A 1 422 ? -33.734 27.225 -11.472 1.00 70.55  ? 435  ILE A O     1 
ATOM   2658 C CB    . ILE A 1 422 ? -33.559 30.516 -10.864 1.00 70.54  ? 435  ILE A CB    1 
ATOM   2659 C CG1   . ILE A 1 422 ? -32.399 31.386 -10.376 1.00 76.46  ? 435  ILE A CG1   1 
ATOM   2660 C CG2   . ILE A 1 422 ? -34.242 29.828 -9.685  1.00 76.96  ? 435  ILE A CG2   1 
ATOM   2661 C CD1   . ILE A 1 422 ? -32.819 32.571 -9.534  1.00 84.37  ? 435  ILE A CD1   1 
ATOM   2662 N N     . ALA A 1 423 ? -35.135 28.538 -12.657 1.00 67.97  ? 436  ALA A N     1 
ATOM   2663 C CA    . ALA A 1 423 ? -36.165 27.514 -12.822 1.00 77.03  ? 436  ALA A CA    1 
ATOM   2664 C C     . ALA A 1 423 ? -35.616 26.226 -13.436 1.00 73.19  ? 436  ALA A C     1 
ATOM   2665 O O     . ALA A 1 423 ? -36.121 25.140 -13.148 1.00 69.92  ? 436  ALA A O     1 
ATOM   2666 C CB    . ALA A 1 423 ? -37.315 28.051 -13.664 1.00 72.34  ? 436  ALA A CB    1 
ATOM   2667 N N     . SER A 1 424 ? -34.589 26.353 -14.276 1.00 72.43  ? 437  SER A N     1 
ATOM   2668 C CA    . SER A 1 424 ? -33.960 25.192 -14.906 1.00 84.20  ? 437  SER A CA    1 
ATOM   2669 C C     . SER A 1 424 ? -33.270 24.296 -13.881 1.00 86.02  ? 437  SER A C     1 
ATOM   2670 O O     . SER A 1 424 ? -33.405 23.075 -13.939 1.00 105.85 ? 437  SER A O     1 
ATOM   2671 C CB    . SER A 1 424 ? -32.948 25.624 -15.974 1.00 85.90  ? 437  SER A CB    1 
ATOM   2672 O OG    . SER A 1 424 ? -31.717 26.021 -15.391 1.00 80.81  ? 437  SER A OG    1 
ATOM   2673 N N     . GLU A 1 425 ? -32.541 24.905 -12.946 1.00 78.84  ? 438  GLU A N     1 
ATOM   2674 C CA    . GLU A 1 425 ? -31.757 24.151 -11.967 1.00 75.10  ? 438  GLU A CA    1 
ATOM   2675 C C     . GLU A 1 425 ? -32.610 23.737 -10.761 1.00 72.92  ? 438  GLU A C     1 
ATOM   2676 O O     . GLU A 1 425 ? -33.010 24.590 -9.964  1.00 73.34  ? 438  GLU A O     1 
ATOM   2677 C CB    . GLU A 1 425 ? -30.557 24.977 -11.502 1.00 80.21  ? 438  GLU A CB    1 
ATOM   2678 C CG    . GLU A 1 425 ? -29.419 24.137 -10.941 1.00 100.99 ? 438  GLU A CG    1 
ATOM   2679 C CD    . GLU A 1 425 ? -28.811 23.202 -11.972 1.00 113.87 ? 438  GLU A CD    1 
ATOM   2680 O OE1   . GLU A 1 425 ? -28.802 23.551 -13.174 1.00 94.42  ? 438  GLU A OE1   1 
ATOM   2681 O OE2   . GLU A 1 425 ? -28.342 22.113 -11.578 1.00 156.70 ? 438  GLU A OE2   1 
ATOM   2682 N N     . PRO A 1 426 ? -32.879 22.424 -10.612 1.00 74.24  ? 439  PRO A N     1 
ATOM   2683 C CA    . PRO A 1 426 ? -33.804 21.965 -9.563  1.00 77.27  ? 439  PRO A CA    1 
ATOM   2684 C C     . PRO A 1 426 ? -33.359 22.272 -8.130  1.00 76.24  ? 439  PRO A C     1 
ATOM   2685 O O     . PRO A 1 426 ? -34.209 22.534 -7.276  1.00 92.34  ? 439  PRO A O     1 
ATOM   2686 C CB    . PRO A 1 426 ? -33.888 20.448 -9.792  1.00 75.71  ? 439  PRO A CB    1 
ATOM   2687 C CG    . PRO A 1 426 ? -32.665 20.096 -10.560 1.00 78.57  ? 439  PRO A CG    1 
ATOM   2688 C CD    . PRO A 1 426 ? -32.324 21.298 -11.388 1.00 76.70  ? 439  PRO A CD    1 
ATOM   2689 N N     . ASP A 1 427 ? -32.052 22.245 -7.872  1.00 71.34  ? 440  ASP A N     1 
ATOM   2690 C CA    . ASP A 1 427 ? -31.517 22.591 -6.548  1.00 75.98  ? 440  ASP A CA    1 
ATOM   2691 C C     . ASP A 1 427 ? -31.876 24.022 -6.151  1.00 77.36  ? 440  ASP A C     1 
ATOM   2692 O O     . ASP A 1 427 ? -32.272 24.277 -5.015  1.00 84.85  ? 440  ASP A O     1 
ATOM   2693 C CB    . ASP A 1 427 ? -29.996 22.424 -6.518  1.00 82.32  ? 440  ASP A CB    1 
ATOM   2694 N N     . ILE A 1 428 ? -31.752 24.945 -7.101  1.00 76.80  ? 441  ILE A N     1 
ATOM   2695 C CA    . ILE A 1 428 ? -32.034 26.356 -6.850  1.00 73.71  ? 441  ILE A CA    1 
ATOM   2696 C C     . ILE A 1 428 ? -33.544 26.613 -6.860  1.00 76.08  ? 441  ILE A C     1 
ATOM   2697 O O     . ILE A 1 428 ? -34.050 27.360 -6.025  1.00 71.47  ? 441  ILE A O     1 
ATOM   2698 C CB    . ILE A 1 428 ? -31.366 27.278 -7.898  1.00 73.64  ? 441  ILE A CB    1 
ATOM   2699 C CG1   . ILE A 1 428 ? -29.883 26.946 -8.072  1.00 84.55  ? 441  ILE A CG1   1 
ATOM   2700 C CG2   . ILE A 1 428 ? -31.492 28.736 -7.480  1.00 71.79  ? 441  ILE A CG2   1 
ATOM   2701 C CD1   . ILE A 1 428 ? -29.235 27.664 -9.236  1.00 90.05  ? 441  ILE A CD1   1 
ATOM   2702 N N     . ALA A 1 429 ? -34.254 25.992 -7.803  1.00 71.23  ? 442  ALA A N     1 
ATOM   2703 C CA    . ALA A 1 429 ? -35.689 26.246 -7.999  1.00 65.58  ? 442  ALA A CA    1 
ATOM   2704 C C     . ALA A 1 429 ? -36.579 25.809 -6.823  1.00 62.81  ? 442  ALA A C     1 
ATOM   2705 O O     . ALA A 1 429 ? -37.694 26.306 -6.677  1.00 65.30  ? 442  ALA A O     1 
ATOM   2706 C CB    . ALA A 1 429 ? -36.166 25.594 -9.292  1.00 59.57  ? 442  ALA A CB    1 
ATOM   2707 N N     . LYS A 1 430 ? -36.086 24.884 -6.000  1.00 62.05  ? 443  LYS A N     1 
ATOM   2708 C CA    . LYS A 1 430 ? -36.796 24.425 -4.802  1.00 59.75  ? 443  LYS A CA    1 
ATOM   2709 C C     . LYS A 1 430 ? -37.275 25.569 -3.910  1.00 56.11  ? 443  LYS A C     1 
ATOM   2710 O O     . LYS A 1 430 ? -38.403 25.553 -3.418  1.00 55.73  ? 443  LYS A O     1 
ATOM   2711 C CB    . LYS A 1 430 ? -35.897 23.492 -3.974  1.00 60.51  ? 443  LYS A CB    1 
ATOM   2712 N N     . VAL A 1 431 ? -36.414 26.558 -3.700  1.00 55.22  ? 444  VAL A N     1 
ATOM   2713 C CA    . VAL A 1 431 ? -36.706 27.618 -2.740  1.00 57.92  ? 444  VAL A CA    1 
ATOM   2714 C C     . VAL A 1 431 ? -37.587 28.706 -3.346  1.00 55.79  ? 444  VAL A C     1 
ATOM   2715 O O     . VAL A 1 431 ? -37.641 28.849 -4.565  1.00 60.99  ? 444  VAL A O     1 
ATOM   2716 C CB    . VAL A 1 431 ? -35.414 28.244 -2.166  1.00 59.05  ? 444  VAL A CB    1 
ATOM   2717 C CG1   . VAL A 1 431 ? -34.625 27.193 -1.398  1.00 62.76  ? 444  VAL A CG1   1 
ATOM   2718 C CG2   . VAL A 1 431 ? -34.550 28.873 -3.255  1.00 59.09  ? 444  VAL A CG2   1 
ATOM   2719 N N     . PRO A 1 432 ? -38.290 29.476 -2.494  1.00 55.12  ? 445  PRO A N     1 
ATOM   2720 C CA    . PRO A 1 432 ? -38.993 30.643 -3.017  1.00 51.23  ? 445  PRO A CA    1 
ATOM   2721 C C     . PRO A 1 432 ? -38.013 31.709 -3.477  1.00 52.18  ? 445  PRO A C     1 
ATOM   2722 O O     . PRO A 1 432 ? -36.833 31.657 -3.133  1.00 58.37  ? 445  PRO A O     1 
ATOM   2723 C CB    . PRO A 1 432 ? -39.805 31.153 -1.812  1.00 48.81  ? 445  PRO A CB    1 
ATOM   2724 C CG    . PRO A 1 432 ? -39.830 30.024 -0.842  1.00 52.29  ? 445  PRO A CG    1 
ATOM   2725 C CD    . PRO A 1 432 ? -38.542 29.288 -1.055  1.00 53.73  ? 445  PRO A CD    1 
ATOM   2726 N N     . LEU A 1 433 ? -38.505 32.662 -4.254  1.00 58.15  ? 446  LEU A N     1 
ATOM   2727 C CA    . LEU A 1 433 ? -37.694 33.772 -4.705  1.00 53.14  ? 446  LEU A CA    1 
ATOM   2728 C C     . LEU A 1 433 ? -38.227 35.077 -4.135  1.00 57.81  ? 446  LEU A C     1 
ATOM   2729 O O     . LEU A 1 433 ? -39.433 35.242 -3.924  1.00 62.38  ? 446  LEU A O     1 
ATOM   2730 C CB    . LEU A 1 433 ? -37.672 33.827 -6.230  1.00 58.73  ? 446  LEU A CB    1 
ATOM   2731 C CG    . LEU A 1 433 ? -36.997 32.639 -6.921  1.00 77.33  ? 446  LEU A CG    1 
ATOM   2732 C CD1   . LEU A 1 433 ? -37.078 32.806 -8.430  1.00 83.59  ? 446  LEU A CD1   1 
ATOM   2733 C CD2   . LEU A 1 433 ? -35.547 32.480 -6.479  1.00 76.81  ? 446  LEU A CD2   1 
ATOM   2734 N N     . CYS A 1 434 ? -37.304 35.996 -3.877  1.00 57.28  ? 447  CYS A N     1 
ATOM   2735 C CA    . CYS A 1 434 ? -37.627 37.322 -3.398  1.00 54.94  ? 447  CYS A CA    1 
ATOM   2736 C C     . CYS A 1 434 ? -37.221 38.277 -4.506  1.00 54.23  ? 447  CYS A C     1 
ATOM   2737 O O     . CYS A 1 434 ? -36.034 38.484 -4.744  1.00 64.40  ? 447  CYS A O     1 
ATOM   2738 C CB    . CYS A 1 434 ? -36.857 37.596 -2.106  1.00 59.85  ? 447  CYS A CB    1 
ATOM   2739 S SG    . CYS A 1 434 ? -37.258 39.139 -1.269  1.00 58.07  ? 447  CYS A SG    1 
ATOM   2740 N N     . ILE A 1 435 ? -38.210 38.820 -5.213  1.00 57.75  ? 448  ILE A N     1 
ATOM   2741 C CA    . ILE A 1 435 ? -37.957 39.696 -6.359  1.00 50.35  ? 448  ILE A CA    1 
ATOM   2742 C C     . ILE A 1 435 ? -37.668 41.107 -5.850  1.00 51.52  ? 448  ILE A C     1 
ATOM   2743 O O     . ILE A 1 435 ? -38.559 41.780 -5.321  1.00 45.48  ? 448  ILE A O     1 
ATOM   2744 C CB    . ILE A 1 435 ? -39.154 39.750 -7.335  1.00 52.32  ? 448  ILE A CB    1 
ATOM   2745 C CG1   . ILE A 1 435 ? -39.656 38.345 -7.695  1.00 59.96  ? 448  ILE A CG1   1 
ATOM   2746 C CG2   . ILE A 1 435 ? -38.771 40.514 -8.594  1.00 56.01  ? 448  ILE A CG2   1 
ATOM   2747 C CD1   . ILE A 1 435 ? -38.611 37.426 -8.291  1.00 61.24  ? 448  ILE A CD1   1 
ATOM   2748 N N     . ASP A 1 436 ? -36.425 41.548 -6.025  1.00 53.07  ? 449  ASP A N     1 
ATOM   2749 C CA    . ASP A 1 436 ? -35.942 42.789 -5.430  1.00 58.95  ? 449  ASP A CA    1 
ATOM   2750 C C     . ASP A 1 436 ? -35.714 43.857 -6.497  1.00 57.82  ? 449  ASP A C     1 
ATOM   2751 O O     . ASP A 1 436 ? -34.834 43.715 -7.348  1.00 71.97  ? 449  ASP A O     1 
ATOM   2752 C CB    . ASP A 1 436 ? -34.644 42.520 -4.659  1.00 68.00  ? 449  ASP A CB    1 
ATOM   2753 C CG    . ASP A 1 436 ? -34.313 43.612 -3.653  1.00 68.64  ? 449  ASP A CG    1 
ATOM   2754 O OD1   . ASP A 1 436 ? -34.328 44.805 -4.023  1.00 64.28  ? 449  ASP A OD1   1 
ATOM   2755 O OD2   . ASP A 1 436 ? -34.027 43.270 -2.485  1.00 71.08  ? 449  ASP A OD2   1 
ATOM   2756 N N     . SER A 1 437 ? -36.510 44.923 -6.455  1.00 53.65  ? 450  SER A N     1 
ATOM   2757 C CA    . SER A 1 437 ? -36.302 46.057 -7.351  1.00 58.58  ? 450  SER A CA    1 
ATOM   2758 C C     . SER A 1 437 ? -36.956 47.346 -6.869  1.00 59.26  ? 450  SER A C     1 
ATOM   2759 O O     . SER A 1 437 ? -37.988 47.325 -6.193  1.00 60.67  ? 450  SER A O     1 
ATOM   2760 C CB    . SER A 1 437 ? -36.818 45.743 -8.753  1.00 59.72  ? 450  SER A CB    1 
ATOM   2761 O OG    . SER A 1 437 ? -36.585 46.842 -9.617  1.00 59.57  ? 450  SER A OG    1 
ATOM   2762 N N     . SER A 1 438 ? -36.341 48.465 -7.244  1.00 57.18  ? 451  SER A N     1 
ATOM   2763 C CA    . SER A 1 438 ? -36.915 49.794 -7.030  1.00 57.97  ? 451  SER A CA    1 
ATOM   2764 C C     . SER A 1 438 ? -37.890 50.150 -8.151  1.00 54.95  ? 451  SER A C     1 
ATOM   2765 O O     . SER A 1 438 ? -38.529 51.196 -8.105  1.00 58.29  ? 451  SER A O     1 
ATOM   2766 C CB    . SER A 1 438 ? -35.808 50.848 -6.981  1.00 58.82  ? 451  SER A CB    1 
ATOM   2767 O OG    . SER A 1 438 ? -35.269 51.078 -8.275  1.00 59.13  ? 451  SER A OG    1 
ATOM   2768 N N     . ASN A 1 439 ? -37.985 49.277 -9.152  1.00 52.87  ? 452  ASN A N     1 
ATOM   2769 C CA    . ASN A 1 439 ? -38.794 49.498 -10.337 1.00 53.58  ? 452  ASN A CA    1 
ATOM   2770 C C     . ASN A 1 439 ? -39.889 48.441 -10.399 1.00 62.56  ? 452  ASN A C     1 
ATOM   2771 O O     . ASN A 1 439 ? -39.604 47.247 -10.512 1.00 66.26  ? 452  ASN A O     1 
ATOM   2772 C CB    . ASN A 1 439 ? -37.893 49.410 -11.571 1.00 58.48  ? 452  ASN A CB    1 
ATOM   2773 C CG    . ASN A 1 439 ? -38.611 49.765 -12.862 1.00 62.94  ? 452  ASN A CG    1 
ATOM   2774 O OD1   . ASN A 1 439 ? -39.784 49.443 -13.059 1.00 68.99  ? 452  ASN A OD1   1 
ATOM   2775 N ND2   . ASN A 1 439 ? -37.890 50.407 -13.765 1.00 74.55  ? 452  ASN A ND2   1 
ATOM   2776 N N     . PHE A 1 440 ? -41.144 48.879 -10.340 1.00 69.68  ? 453  PHE A N     1 
ATOM   2777 C CA    . PHE A 1 440 ? -42.260 47.939 -10.268 1.00 69.15  ? 453  PHE A CA    1 
ATOM   2778 C C     . PHE A 1 440 ? -42.383 47.065 -11.516 1.00 62.00  ? 453  PHE A C     1 
ATOM   2779 O O     . PHE A 1 440 ? -42.827 45.923 -11.424 1.00 57.68  ? 453  PHE A O     1 
ATOM   2780 C CB    . PHE A 1 440 ? -43.578 48.665 -10.001 1.00 66.01  ? 453  PHE A CB    1 
ATOM   2781 C CG    . PHE A 1 440 ? -44.697 47.740 -9.630  1.00 63.65  ? 453  PHE A CG    1 
ATOM   2782 C CD1   . PHE A 1 440 ? -44.769 47.200 -8.353  1.00 70.41  ? 453  PHE A CD1   1 
ATOM   2783 C CD2   . PHE A 1 440 ? -45.660 47.384 -10.561 1.00 57.78  ? 453  PHE A CD2   1 
ATOM   2784 C CE1   . PHE A 1 440 ? -45.792 46.332 -8.007  1.00 77.21  ? 453  PHE A CE1   1 
ATOM   2785 C CE2   . PHE A 1 440 ? -46.687 46.520 -10.220 1.00 67.12  ? 453  PHE A CE2   1 
ATOM   2786 C CZ    . PHE A 1 440 ? -46.756 45.994 -8.941  1.00 67.10  ? 453  PHE A CZ    1 
ATOM   2787 N N     . ALA A 1 441 ? -41.980 47.593 -12.670 1.00 56.53  ? 454  ALA A N     1 
ATOM   2788 C CA    . ALA A 1 441 ? -41.980 46.820 -13.916 1.00 53.84  ? 454  ALA A CA    1 
ATOM   2789 C C     . ALA A 1 441 ? -40.998 45.647 -13.870 1.00 55.82  ? 454  ALA A C     1 
ATOM   2790 O O     . ALA A 1 441 ? -41.223 44.625 -14.515 1.00 56.15  ? 454  ALA A O     1 
ATOM   2791 C CB    . ALA A 1 441 ? -41.666 47.720 -15.102 1.00 56.38  ? 454  ALA A CB    1 
ATOM   2792 N N     . VAL A 1 442 ? -39.908 45.795 -13.120 1.00 55.51  ? 455  VAL A N     1 
ATOM   2793 C CA    . VAL A 1 442 ? -38.991 44.679 -12.893 1.00 55.79  ? 455  VAL A CA    1 
ATOM   2794 C C     . VAL A 1 442 ? -39.676 43.663 -11.985 1.00 56.79  ? 455  VAL A C     1 
ATOM   2795 O O     . VAL A 1 442 ? -39.703 42.468 -12.292 1.00 55.96  ? 455  VAL A O     1 
ATOM   2796 C CB    . VAL A 1 442 ? -37.650 45.138 -12.278 1.00 59.89  ? 455  VAL A CB    1 
ATOM   2797 C CG1   . VAL A 1 442 ? -36.776 43.941 -11.923 1.00 62.04  ? 455  VAL A CG1   1 
ATOM   2798 C CG2   . VAL A 1 442 ? -36.914 46.062 -13.241 1.00 59.48  ? 455  VAL A CG2   1 
ATOM   2799 N N     . ILE A 1 443 ? -40.242 44.143 -10.877 1.00 56.48  ? 456  ILE A N     1 
ATOM   2800 C CA    . ILE A 1 443 ? -41.031 43.287 -9.989  1.00 53.54  ? 456  ILE A CA    1 
ATOM   2801 C C     . ILE A 1 443 ? -42.013 42.482 -10.834 1.00 56.57  ? 456  ILE A C     1 
ATOM   2802 O O     . ILE A 1 443 ? -41.990 41.249 -10.840 1.00 53.08  ? 456  ILE A O     1 
ATOM   2803 C CB    . ILE A 1 443 ? -41.830 44.101 -8.943  1.00 55.31  ? 456  ILE A CB    1 
ATOM   2804 C CG1   . ILE A 1 443 ? -40.903 44.855 -7.976  1.00 58.99  ? 456  ILE A CG1   1 
ATOM   2805 C CG2   . ILE A 1 443 ? -42.782 43.201 -8.169  1.00 61.04  ? 456  ILE A CG2   1 
ATOM   2806 C CD1   . ILE A 1 443 ? -39.959 43.982 -7.182  1.00 64.25  ? 456  ILE A CD1   1 
ATOM   2807 N N     . GLU A 1 444 ? -42.847 43.209 -11.571 1.00 50.64  ? 457  GLU A N     1 
ATOM   2808 C CA    . GLU A 1 444 ? -43.908 42.624 -12.389 1.00 59.12  ? 457  GLU A CA    1 
ATOM   2809 C C     . GLU A 1 444 ? -43.375 41.585 -13.385 1.00 61.10  ? 457  GLU A C     1 
ATOM   2810 O O     . GLU A 1 444 ? -44.030 40.576 -13.645 1.00 62.64  ? 457  GLU A O     1 
ATOM   2811 C CB    . GLU A 1 444 ? -44.661 43.740 -13.129 1.00 66.51  ? 457  GLU A CB    1 
ATOM   2812 C CG    . GLU A 1 444 ? -46.081 43.394 -13.546 1.00 78.21  ? 457  GLU A CG    1 
ATOM   2813 C CD    . GLU A 1 444 ? -46.942 44.622 -13.801 1.00 87.07  ? 457  GLU A CD    1 
ATOM   2814 O OE1   . GLU A 1 444 ? -46.388 45.722 -14.029 1.00 85.44  ? 457  GLU A OE1   1 
ATOM   2815 O OE2   . GLU A 1 444 ? -48.183 44.488 -13.774 1.00 78.42  ? 457  GLU A OE2   1 
ATOM   2816 N N     . ALA A 1 445 ? -42.184 41.828 -13.927 1.00 57.83  ? 458  ALA A N     1 
ATOM   2817 C CA    . ALA A 1 445 ? -41.567 40.891 -14.864 1.00 55.01  ? 458  ALA A CA    1 
ATOM   2818 C C     . ALA A 1 445 ? -41.178 39.587 -14.169 1.00 63.03  ? 458  ALA A C     1 
ATOM   2819 O O     . ALA A 1 445 ? -41.411 38.505 -14.706 1.00 60.06  ? 458  ALA A O     1 
ATOM   2820 C CB    . ALA A 1 445 ? -40.353 41.521 -15.529 1.00 52.92  ? 458  ALA A CB    1 
ATOM   2821 N N     . GLY A 1 446 ? -40.595 39.698 -12.975 1.00 60.24  ? 459  GLY A N     1 
ATOM   2822 C CA    . GLY A 1 446 ? -40.203 38.526 -12.192 1.00 53.32  ? 459  GLY A CA    1 
ATOM   2823 C C     . GLY A 1 446 ? -41.378 37.656 -11.779 1.00 54.01  ? 459  GLY A C     1 
ATOM   2824 O O     . GLY A 1 446 ? -41.293 36.428 -11.822 1.00 56.34  ? 459  GLY A O     1 
ATOM   2825 N N     . LEU A 1 447 ? -42.479 38.290 -11.380 1.00 54.74  ? 460  LEU A N     1 
ATOM   2826 C CA    . LEU A 1 447 ? -43.683 37.563 -10.981 1.00 55.07  ? 460  LEU A CA    1 
ATOM   2827 C C     . LEU A 1 447 ? -44.214 36.709 -12.133 1.00 60.07  ? 460  LEU A C     1 
ATOM   2828 O O     . LEU A 1 447 ? -44.592 35.557 -11.930 1.00 65.77  ? 460  LEU A O     1 
ATOM   2829 C CB    . LEU A 1 447 ? -44.765 38.534 -10.498 1.00 57.09  ? 460  LEU A CB    1 
ATOM   2830 C CG    . LEU A 1 447 ? -44.500 39.247 -9.167  1.00 54.10  ? 460  LEU A CG    1 
ATOM   2831 C CD1   . LEU A 1 447 ? -45.486 40.378 -8.945  1.00 50.36  ? 460  LEU A CD1   1 
ATOM   2832 C CD2   . LEU A 1 447 ? -44.568 38.265 -8.011  1.00 63.76  ? 460  LEU A CD2   1 
ATOM   2833 N N     . LYS A 1 448 ? -44.226 37.272 -13.338 1.00 54.54  ? 461  LYS A N     1 
ATOM   2834 C CA    . LYS A 1 448 ? -44.639 36.530 -14.531 1.00 61.95  ? 461  LYS A CA    1 
ATOM   2835 C C     . LYS A 1 448 ? -43.761 35.305 -14.785 1.00 59.40  ? 461  LYS A C     1 
ATOM   2836 O O     . LYS A 1 448 ? -44.247 34.277 -15.255 1.00 70.67  ? 461  LYS A O     1 
ATOM   2837 C CB    . LYS A 1 448 ? -44.620 37.435 -15.767 1.00 58.05  ? 461  LYS A CB    1 
ATOM   2838 C CG    . LYS A 1 448 ? -45.691 38.512 -15.759 1.00 61.83  ? 461  LYS A CG    1 
ATOM   2839 C CD    . LYS A 1 448 ? -45.408 39.580 -16.804 1.00 63.68  ? 461  LYS A CD    1 
ATOM   2840 C CE    . LYS A 1 448 ? -46.386 40.733 -16.680 1.00 65.72  ? 461  LYS A CE    1 
ATOM   2841 N NZ    . LYS A 1 448 ? -46.134 41.788 -17.697 1.00 73.92  ? 461  LYS A NZ    1 
ATOM   2842 N N     . CYS A 1 449 ? -42.476 35.416 -14.461 1.00 57.02  ? 462  CYS A N     1 
ATOM   2843 C CA    . CYS A 1 449 ? -41.514 34.343 -14.720 1.00 71.83  ? 462  CYS A CA    1 
ATOM   2844 C C     . CYS A 1 449 ? -41.387 33.309 -13.588 1.00 73.10  ? 462  CYS A C     1 
ATOM   2845 O O     . CYS A 1 449 ? -40.761 32.262 -13.775 1.00 60.37  ? 462  CYS A O     1 
ATOM   2846 C CB    . CYS A 1 449 ? -40.150 34.954 -15.037 1.00 64.81  ? 462  CYS A CB    1 
ATOM   2847 S SG    . CYS A 1 449 ? -40.209 36.025 -16.495 1.00 87.89  ? 462  CYS A SG    1 
ATOM   2848 N N     . CYS A 1 450 ? -41.989 33.590 -12.433 1.00 69.04  ? 463  CYS A N     1 
ATOM   2849 C CA    . CYS A 1 450 ? -41.869 32.711 -11.270 1.00 74.15  ? 463  CYS A CA    1 
ATOM   2850 C C     . CYS A 1 450 ? -43.092 31.816 -11.115 1.00 55.21  ? 463  CYS A C     1 
ATOM   2851 O O     . CYS A 1 450 ? -44.224 32.282 -11.111 1.00 66.88  ? 463  CYS A O     1 
ATOM   2852 C CB    . CYS A 1 450 ? -41.656 33.529 -9.995  1.00 84.62  ? 463  CYS A CB    1 
ATOM   2853 N N     . GLN A 1 451 ? -42.843 30.524 -10.971 1.00 59.03  ? 464  GLN A N     1 
ATOM   2854 C CA    . GLN A 1 451 ? -43.895 29.519 -10.857 1.00 59.27  ? 464  GLN A CA    1 
ATOM   2855 C C     . GLN A 1 451 ? -44.472 29.487 -9.446  1.00 66.19  ? 464  GLN A C     1 
ATOM   2856 O O     . GLN A 1 451 ? -45.684 29.412 -9.258  1.00 73.17  ? 464  GLN A O     1 
ATOM   2857 C CB    . GLN A 1 451 ? -43.303 28.154 -11.191 1.00 57.13  ? 464  GLN A CB    1 
ATOM   2858 C CG    . GLN A 1 451 ? -44.305 27.024 -11.254 1.00 62.62  ? 464  GLN A CG    1 
ATOM   2859 C CD    . GLN A 1 451 ? -43.665 25.672 -11.503 1.00 64.53  ? 464  GLN A CD    1 
ATOM   2860 O OE1   . GLN A 1 451 ? -44.362 24.672 -11.644 1.00 77.20  ? 464  GLN A OE1   1 
ATOM   2861 N NE2   . GLN A 1 451 ? -42.338 25.632 -11.568 1.00 64.33  ? 464  GLN A NE2   1 
ATOM   2862 N N     . GLY A 1 452 ? -43.591 29.524 -8.453  1.00 64.14  ? 465  GLY A N     1 
ATOM   2863 C CA    . GLY A 1 452 ? -44.010 29.461 -7.066  1.00 66.03  ? 465  GLY A CA    1 
ATOM   2864 C C     . GLY A 1 452 ? -44.440 30.817 -6.557  1.00 65.78  ? 465  GLY A C     1 
ATOM   2865 O O     . GLY A 1 452 ? -44.313 31.824 -7.259  1.00 68.10  ? 465  GLY A O     1 
ATOM   2866 N N     . LYS A 1 453 ? -44.949 30.844 -5.330  1.00 60.43  ? 466  LYS A N     1 
ATOM   2867 C CA    . LYS A 1 453 ? -45.325 32.096 -4.687  1.00 50.81  ? 466  LYS A CA    1 
ATOM   2868 C C     . LYS A 1 453 ? -44.082 32.802 -4.150  1.00 49.50  ? 466  LYS A C     1 
ATOM   2869 O O     . LYS A 1 453 ? -43.346 32.242 -3.345  1.00 56.39  ? 466  LYS A O     1 
ATOM   2870 C CB    . LYS A 1 453 ? -46.322 31.849 -3.559  1.00 49.25  ? 466  LYS A CB    1 
ATOM   2871 C CG    . LYS A 1 453 ? -46.801 33.127 -2.896  1.00 49.55  ? 466  LYS A CG    1 
ATOM   2872 C CD    . LYS A 1 453 ? -48.036 32.880 -2.051  1.00 54.43  ? 466  LYS A CD    1 
ATOM   2873 C CE    . LYS A 1 453 ? -48.251 34.001 -1.049  1.00 51.68  ? 466  LYS A CE    1 
ATOM   2874 N NZ    . LYS A 1 453 ? -49.294 33.638 -0.055  1.00 55.64  ? 466  LYS A NZ    1 
ATOM   2875 N N     . CYS A 1 454 ? -43.869 34.037 -4.596  1.00 56.10  ? 467  CYS A N     1 
ATOM   2876 C CA    . CYS A 1 454 ? -42.660 34.793 -4.294  1.00 55.16  ? 467  CYS A CA    1 
ATOM   2877 C C     . CYS A 1 454 ? -42.916 35.850 -3.240  1.00 55.20  ? 467  CYS A C     1 
ATOM   2878 O O     . CYS A 1 454 ? -44.063 36.175 -2.939  1.00 52.54  ? 467  CYS A O     1 
ATOM   2879 C CB    . CYS A 1 454 ? -42.168 35.499 -5.558  1.00 58.39  ? 467  CYS A CB    1 
ATOM   2880 S SG    . CYS A 1 454 ? -41.873 34.397 -6.953  1.00 75.64  ? 467  CYS A SG    1 
ATOM   2881 N N     . ILE A 1 455 ? -41.829 36.384 -2.688  1.00 56.14  ? 468  ILE A N     1 
ATOM   2882 C CA    . ILE A 1 455 ? -41.879 37.639 -1.955  1.00 50.51  ? 468  ILE A CA    1 
ATOM   2883 C C     . ILE A 1 455 ? -41.649 38.745 -2.980  1.00 49.29  ? 468  ILE A C     1 
ATOM   2884 O O     . ILE A 1 455 ? -40.807 38.603 -3.868  1.00 47.66  ? 468  ILE A O     1 
ATOM   2885 C CB    . ILE A 1 455 ? -40.749 37.779 -0.913  1.00 56.26  ? 468  ILE A CB    1 
ATOM   2886 C CG1   . ILE A 1 455 ? -40.617 36.536 -0.029  1.00 53.82  ? 468  ILE A CG1   1 
ATOM   2887 C CG2   . ILE A 1 455 ? -40.963 39.033 -0.073  1.00 50.53  ? 468  ILE A CG2   1 
ATOM   2888 C CD1   . ILE A 1 455 ? -41.782 36.314 0.891   1.00 61.45  ? 468  ILE A CD1   1 
ATOM   2889 N N     . VAL A 1 456 ? -42.390 39.838 -2.853  1.00 51.01  ? 469  VAL A N     1 
ATOM   2890 C CA    . VAL A 1 456 ? -42.137 41.035 -3.637  1.00 49.01  ? 469  VAL A CA    1 
ATOM   2891 C C     . VAL A 1 456 ? -41.435 42.043 -2.749  1.00 50.36  ? 469  VAL A C     1 
ATOM   2892 O O     . VAL A 1 456 ? -41.847 42.287 -1.619  1.00 68.12  ? 469  VAL A O     1 
ATOM   2893 C CB    . VAL A 1 456 ? -43.434 41.631 -4.206  1.00 51.00  ? 469  VAL A CB    1 
ATOM   2894 C CG1   . VAL A 1 456 ? -43.219 43.058 -4.696  1.00 53.78  ? 469  VAL A CG1   1 
ATOM   2895 C CG2   . VAL A 1 456 ? -43.943 40.760 -5.339  1.00 49.48  ? 469  VAL A CG2   1 
ATOM   2896 N N     . ASN A 1 457 ? -40.378 42.635 -3.281  1.00 55.78  ? 470  ASN A N     1 
ATOM   2897 C CA    . ASN A 1 457 ? -39.518 43.520 -2.522  1.00 54.99  ? 470  ASN A CA    1 
ATOM   2898 C C     . ASN A 1 457 ? -39.074 44.669 -3.432  1.00 58.67  ? 470  ASN A C     1 
ATOM   2899 O O     . ASN A 1 457 ? -38.154 44.492 -4.222  1.00 61.95  ? 470  ASN A O     1 
ATOM   2900 C CB    . ASN A 1 457 ? -38.317 42.716 -2.029  1.00 56.91  ? 470  ASN A CB    1 
ATOM   2901 C CG    . ASN A 1 457 ? -37.424 43.497 -1.093  1.00 61.79  ? 470  ASN A CG    1 
ATOM   2902 O OD1   . ASN A 1 457 ? -37.753 44.598 -0.664  1.00 70.09  ? 470  ASN A OD1   1 
ATOM   2903 N ND2   . ASN A 1 457 ? -36.286 42.914 -0.755  1.00 63.04  ? 470  ASN A ND2   1 
ATOM   2904 N N     . SER A 1 458 ? -39.698 45.845 -3.347  1.00 57.54  ? 471  SER A N     1 
ATOM   2905 C CA    . SER A 1 458 ? -40.692 46.195 -2.340  1.00 55.08  ? 471  SER A CA    1 
ATOM   2906 C C     . SER A 1 458 ? -41.643 47.237 -2.904  1.00 51.95  ? 471  SER A C     1 
ATOM   2907 O O     . SER A 1 458 ? -41.511 47.647 -4.056  1.00 59.10  ? 471  SER A O     1 
ATOM   2908 C CB    . SER A 1 458 ? -39.986 46.780 -1.114  1.00 49.24  ? 471  SER A CB    1 
ATOM   2909 N N     . ILE A 1 459 ? -42.609 47.655 -2.093  1.00 51.18  ? 472  ILE A N     1 
ATOM   2910 C CA    . ILE A 1 459 ? -43.352 48.880 -2.371  1.00 50.22  ? 472  ILE A CA    1 
ATOM   2911 C C     . ILE A 1 459 ? -43.288 49.792 -1.149  1.00 49.51  ? 472  ILE A C     1 
ATOM   2912 O O     . ILE A 1 459 ? -42.801 49.392 -0.092  1.00 48.08  ? 472  ILE A O     1 
ATOM   2913 C CB    . ILE A 1 459 ? -44.815 48.614 -2.795  1.00 51.47  ? 472  ILE A CB    1 
ATOM   2914 C CG1   . ILE A 1 459 ? -45.595 47.881 -1.709  1.00 54.05  ? 472  ILE A CG1   1 
ATOM   2915 C CG2   . ILE A 1 459 ? -44.857 47.804 -4.080  1.00 55.02  ? 472  ILE A CG2   1 
ATOM   2916 C CD1   . ILE A 1 459 ? -47.081 47.821 -1.987  1.00 61.22  ? 472  ILE A CD1   1 
ATOM   2917 N N     . SER A 1 460 ? -43.751 51.027 -1.316  1.00 54.36  ? 473  SER A N     1 
ATOM   2918 C CA    . SER A 1 460 ? -43.800 51.996 -0.229  1.00 53.31  ? 473  SER A CA    1 
ATOM   2919 C C     . SER A 1 460 ? -44.795 53.105 -0.551  1.00 54.16  ? 473  SER A C     1 
ATOM   2920 O O     . SER A 1 460 ? -45.421 53.098 -1.610  1.00 63.39  ? 473  SER A O     1 
ATOM   2921 C CB    . SER A 1 460 ? -42.413 52.593 0.028   1.00 52.16  ? 473  SER A CB    1 
ATOM   2922 O OG    . SER A 1 460 ? -42.108 53.607 -0.912  1.00 56.23  ? 473  SER A OG    1 
ATOM   2923 N N     . LEU A 1 461 ? -44.931 54.054 0.370   1.00 58.69  ? 474  LEU A N     1 
ATOM   2924 C CA    . LEU A 1 461 ? -45.804 55.207 0.182   1.00 62.55  ? 474  LEU A CA    1 
ATOM   2925 C C     . LEU A 1 461 ? -45.031 56.435 -0.302  1.00 66.71  ? 474  LEU A C     1 
ATOM   2926 O O     . LEU A 1 461 ? -45.546 57.551 -0.249  1.00 72.64  ? 474  LEU A O     1 
ATOM   2927 C CB    . LEU A 1 461 ? -46.543 55.521 1.486   1.00 70.47  ? 474  LEU A CB    1 
ATOM   2928 C CG    . LEU A 1 461 ? -47.587 54.486 1.918   1.00 72.53  ? 474  LEU A CG    1 
ATOM   2929 C CD1   . LEU A 1 461 ? -47.906 54.636 3.396   1.00 74.86  ? 474  LEU A CD1   1 
ATOM   2930 C CD2   . LEU A 1 461 ? -48.858 54.611 1.091   1.00 74.81  ? 474  LEU A CD2   1 
ATOM   2931 N N     . LYS A 1 462 ? -43.808 56.227 -0.790  1.00 71.86  ? 475  LYS A N     1 
ATOM   2932 C CA    . LYS A 1 462 ? -42.985 57.313 -1.333  1.00 81.69  ? 475  LYS A CA    1 
ATOM   2933 C C     . LYS A 1 462 ? -43.766 58.220 -2.282  1.00 78.07  ? 475  LYS A C     1 
ATOM   2934 O O     . LYS A 1 462 ? -43.695 59.442 -2.168  1.00 79.45  ? 475  LYS A O     1 
ATOM   2935 C CB    . LYS A 1 462 ? -41.771 56.741 -2.072  1.00 81.81  ? 475  LYS A CB    1 
ATOM   2936 N N     . GLU A 1 463 ? -44.514 57.610 -3.203  1.00 80.67  ? 476  GLU A N     1 
ATOM   2937 C CA    . GLU A 1 463 ? -45.280 58.345 -4.217  1.00 79.87  ? 476  GLU A CA    1 
ATOM   2938 C C     . GLU A 1 463 ? -46.779 58.473 -3.885  1.00 79.06  ? 476  GLU A C     1 
ATOM   2939 O O     . GLU A 1 463 ? -47.606 58.644 -4.783  1.00 77.29  ? 476  GLU A O     1 
ATOM   2940 C CB    . GLU A 1 463 ? -45.104 57.676 -5.584  1.00 78.74  ? 476  GLU A CB    1 
ATOM   2941 C CG    . GLU A 1 463 ? -43.666 57.657 -6.080  1.00 95.13  ? 476  GLU A CG    1 
ATOM   2942 C CD    . GLU A 1 463 ? -43.529 57.115 -7.495  1.00 127.19 ? 476  GLU A CD    1 
ATOM   2943 O OE1   . GLU A 1 463 ? -44.526 56.601 -8.052  1.00 134.12 ? 476  GLU A OE1   1 
ATOM   2944 O OE2   . GLU A 1 463 ? -42.415 57.201 -8.057  1.00 144.25 ? 476  GLU A OE2   1 
ATOM   2945 N N     . GLY A 1 464 ? -47.126 58.396 -2.602  1.00 75.06  ? 477  GLY A N     1 
ATOM   2946 C CA    . GLY A 1 464 ? -48.505 58.597 -2.161  1.00 66.95  ? 477  GLY A CA    1 
ATOM   2947 C C     . GLY A 1 464 ? -49.335 57.330 -2.064  1.00 64.59  ? 477  GLY A C     1 
ATOM   2948 O O     . GLY A 1 464 ? -48.915 56.252 -2.490  1.00 61.51  ? 477  GLY A O     1 
ATOM   2949 N N     . GLU A 1 465 ? -50.534 57.488 -1.511  1.00 63.30  ? 478  GLU A N     1 
ATOM   2950 C CA    . GLU A 1 465 ? -51.453 56.390 -1.226  1.00 61.30  ? 478  GLU A CA    1 
ATOM   2951 C C     . GLU A 1 465 ? -51.928 55.651 -2.478  1.00 60.89  ? 478  GLU A C     1 
ATOM   2952 O O     . GLU A 1 465 ? -51.813 54.432 -2.561  1.00 63.77  ? 478  GLU A O     1 
ATOM   2953 C CB    . GLU A 1 465 ? -52.660 56.935 -0.450  1.00 67.19  ? 478  GLU A CB    1 
ATOM   2954 C CG    . GLU A 1 465 ? -53.678 55.898 0.000   1.00 74.07  ? 478  GLU A CG    1 
ATOM   2955 C CD    . GLU A 1 465 ? -54.779 56.491 0.866   1.00 82.06  ? 478  GLU A CD    1 
ATOM   2956 O OE1   . GLU A 1 465 ? -54.465 57.241 1.821   1.00 79.27  ? 478  GLU A OE1   1 
ATOM   2957 O OE2   . GLU A 1 465 ? -55.964 56.196 0.599   1.00 81.61  ? 478  GLU A OE2   1 
ATOM   2958 N N     . ASP A 1 466 ? -52.462 56.388 -3.446  1.00 68.84  ? 479  ASP A N     1 
ATOM   2959 C CA    . ASP A 1 466 ? -53.053 55.775 -4.647  1.00 70.10  ? 479  ASP A CA    1 
ATOM   2960 C C     . ASP A 1 466 ? -52.080 54.874 -5.399  1.00 66.61  ? 479  ASP A C     1 
ATOM   2961 O O     . ASP A 1 466 ? -52.457 53.805 -5.870  1.00 71.94  ? 479  ASP A O     1 
ATOM   2962 C CB    . ASP A 1 466 ? -53.580 56.851 -5.597  1.00 69.05  ? 479  ASP A CB    1 
ATOM   2963 C CG    . ASP A 1 466 ? -54.720 57.644 -5.000  1.00 73.48  ? 479  ASP A CG    1 
ATOM   2964 O OD1   . ASP A 1 466 ? -55.414 57.104 -4.113  1.00 79.08  ? 479  ASP A OD1   1 
ATOM   2965 O OD2   . ASP A 1 466 ? -54.919 58.806 -5.415  1.00 78.89  ? 479  ASP A OD2   1 
ATOM   2966 N N     . ASP A 1 467 ? -50.832 55.316 -5.503  1.00 71.51  ? 480  ASP A N     1 
ATOM   2967 C CA    . ASP A 1 467 ? -49.796 54.566 -6.205  1.00 67.31  ? 480  ASP A CA    1 
ATOM   2968 C C     . ASP A 1 467 ? -49.464 53.285 -5.441  1.00 65.64  ? 480  ASP A C     1 
ATOM   2969 O O     . ASP A 1 467 ? -49.314 52.217 -6.040  1.00 60.23  ? 480  ASP A O     1 
ATOM   2970 C CB    . ASP A 1 467 ? -48.541 55.430 -6.366  1.00 76.85  ? 480  ASP A CB    1 
ATOM   2971 C CG    . ASP A 1 467 ? -47.715 55.041 -7.572  1.00 92.35  ? 480  ASP A CG    1 
ATOM   2972 O OD1   . ASP A 1 467 ? -47.968 55.585 -8.671  1.00 100.20 ? 480  ASP A OD1   1 
ATOM   2973 O OD2   . ASP A 1 467 ? -46.799 54.209 -7.413  1.00 90.37  ? 480  ASP A OD2   1 
ATOM   2974 N N     . PHE A 1 468 ? -49.351 53.411 -4.118  1.00 58.24  ? 481  PHE A N     1 
ATOM   2975 C CA    . PHE A 1 468 ? -49.126 52.279 -3.219  1.00 50.67  ? 481  PHE A CA    1 
ATOM   2976 C C     . PHE A 1 468 ? -50.230 51.243 -3.391  1.00 54.81  ? 481  PHE A C     1 
ATOM   2977 O O     . PHE A 1 468 ? -49.962 50.040 -3.511  1.00 52.49  ? 481  PHE A O     1 
ATOM   2978 C CB    . PHE A 1 468 ? -49.084 52.785 -1.771  1.00 55.61  ? 481  PHE A CB    1 
ATOM   2979 C CG    . PHE A 1 468 ? -48.950 51.705 -0.728  1.00 59.42  ? 481  PHE A CG    1 
ATOM   2980 C CD1   . PHE A 1 468 ? -47.733 51.071 -0.510  1.00 61.60  ? 481  PHE A CD1   1 
ATOM   2981 C CD2   . PHE A 1 468 ? -50.031 51.352 0.067   1.00 59.17  ? 481  PHE A CD2   1 
ATOM   2982 C CE1   . PHE A 1 468 ? -47.606 50.093 0.464   1.00 64.95  ? 481  PHE A CE1   1 
ATOM   2983 C CE2   . PHE A 1 468 ? -49.909 50.378 1.044   1.00 60.26  ? 481  PHE A CE2   1 
ATOM   2984 C CZ    . PHE A 1 468 ? -48.695 49.744 1.242   1.00 62.04  ? 481  PHE A CZ    1 
ATOM   2985 N N     . LEU A 1 469 ? -51.469 51.723 -3.425  1.00 56.73  ? 482  LEU A N     1 
ATOM   2986 C CA    . LEU A 1 469 ? -52.631 50.850 -3.538  1.00 60.01  ? 482  LEU A CA    1 
ATOM   2987 C C     . LEU A 1 469 ? -52.690 50.151 -4.886  1.00 64.45  ? 482  LEU A C     1 
ATOM   2988 O O     . LEU A 1 469 ? -53.034 48.971 -4.952  1.00 75.32  ? 482  LEU A O     1 
ATOM   2989 C CB    . LEU A 1 469 ? -53.926 51.634 -3.309  1.00 62.44  ? 482  LEU A CB    1 
ATOM   2990 C CG    . LEU A 1 469 ? -54.170 52.074 -1.869  1.00 63.20  ? 482  LEU A CG    1 
ATOM   2991 C CD1   . LEU A 1 469 ? -55.418 52.935 -1.798  1.00 71.79  ? 482  LEU A CD1   1 
ATOM   2992 C CD2   . LEU A 1 469 ? -54.287 50.869 -0.948  1.00 65.70  ? 482  LEU A CD2   1 
ATOM   2993 N N     . GLU A 1 470 ? -52.353 50.868 -5.955  1.00 59.86  ? 483  GLU A N     1 
ATOM   2994 C CA    . GLU A 1 470 ? -52.397 50.281 -7.291  1.00 62.82  ? 483  GLU A CA    1 
ATOM   2995 C C     . GLU A 1 470 ? -51.398 49.136 -7.389  1.00 64.30  ? 483  GLU A C     1 
ATOM   2996 O O     . GLU A 1 470 ? -51.718 48.070 -7.916  1.00 76.08  ? 483  GLU A O     1 
ATOM   2997 C CB    . GLU A 1 470 ? -52.116 51.329 -8.370  1.00 62.66  ? 483  GLU A CB    1 
ATOM   2998 C CG    . GLU A 1 470 ? -52.500 50.880 -9.773  1.00 62.70  ? 483  GLU A CG    1 
ATOM   2999 N N     . LYS A 1 471 ? -50.199 49.357 -6.855  1.00 62.92  ? 484  LYS A N     1 
ATOM   3000 C CA    . LYS A 1 471 ? -49.144 48.342 -6.861  1.00 60.14  ? 484  LYS A CA    1 
ATOM   3001 C C     . LYS A 1 471 ? -49.474 47.175 -5.940  1.00 55.65  ? 484  LYS A C     1 
ATOM   3002 O O     . LYS A 1 471 ? -49.226 46.023 -6.291  1.00 65.48  ? 484  LYS A O     1 
ATOM   3003 C CB    . LYS A 1 471 ? -47.805 48.956 -6.459  1.00 62.64  ? 484  LYS A CB    1 
ATOM   3004 C CG    . LYS A 1 471 ? -47.217 49.874 -7.512  1.00 63.82  ? 484  LYS A CG    1 
ATOM   3005 C CD    . LYS A 1 471 ? -46.149 50.781 -6.926  1.00 69.60  ? 484  LYS A CD    1 
ATOM   3006 C CE    . LYS A 1 471 ? -45.422 51.545 -8.020  1.00 79.30  ? 484  LYS A CE    1 
ATOM   3007 N NZ    . LYS A 1 471 ? -44.555 52.615 -7.459  1.00 99.19  ? 484  LYS A NZ    1 
ATOM   3008 N N     . ALA A 1 472 ? -50.030 47.469 -4.769  1.00 52.24  ? 485  ALA A N     1 
ATOM   3009 C CA    . ALA A 1 472 ? -50.435 46.418 -3.835  1.00 53.13  ? 485  ALA A CA    1 
ATOM   3010 C C     . ALA A 1 472 ? -51.621 45.627 -4.386  1.00 56.00  ? 485  ALA A C     1 
ATOM   3011 O O     . ALA A 1 472 ? -51.767 44.436 -4.104  1.00 52.79  ? 485  ALA A O     1 
ATOM   3012 C CB    . ALA A 1 472 ? -50.778 47.012 -2.479  1.00 60.78  ? 485  ALA A CB    1 
ATOM   3013 N N     . ARG A 1 473 ? -52.459 46.296 -5.174  1.00 65.61  ? 486  ARG A N     1 
ATOM   3014 C CA    . ARG A 1 473 ? -53.597 45.649 -5.832  1.00 70.74  ? 486  ARG A CA    1 
ATOM   3015 C C     . ARG A 1 473 ? -53.127 44.679 -6.917  1.00 67.25  ? 486  ARG A C     1 
ATOM   3016 O O     . ARG A 1 473 ? -53.702 43.604 -7.082  1.00 66.01  ? 486  ARG A O     1 
ATOM   3017 C CB    . ARG A 1 473 ? -54.529 46.704 -6.429  1.00 70.44  ? 486  ARG A CB    1 
ATOM   3018 C CG    . ARG A 1 473 ? -55.890 46.183 -6.842  1.00 82.93  ? 486  ARG A CG    1 
ATOM   3019 C CD    . ARG A 1 473 ? -56.840 47.322 -7.200  1.00 94.47  ? 486  ARG A CD    1 
ATOM   3020 N NE    . ARG A 1 473 ? -57.218 48.139 -6.036  1.00 90.83  ? 486  ARG A NE    1 
ATOM   3021 C CZ    . ARG A 1 473 ? -57.010 49.454 -5.897  1.00 88.12  ? 486  ARG A CZ    1 
ATOM   3022 N NH1   . ARG A 1 473 ? -56.423 50.180 -6.848  1.00 87.55  ? 486  ARG A NH1   1 
ATOM   3023 N NH2   . ARG A 1 473 ? -57.411 50.060 -4.785  1.00 85.80  ? 486  ARG A NH2   1 
ATOM   3024 N N     . LYS A 1 474 ? -52.079 45.061 -7.645  1.00 66.76  ? 487  LYS A N     1 
ATOM   3025 C CA    . LYS A 1 474 ? -51.500 44.199 -8.676  1.00 66.48  ? 487  LYS A CA    1 
ATOM   3026 C C     . LYS A 1 474 ? -50.792 42.984 -8.080  1.00 63.07  ? 487  LYS A C     1 
ATOM   3027 O O     . LYS A 1 474 ? -50.904 41.879 -8.607  1.00 67.28  ? 487  LYS A O     1 
ATOM   3028 C CB    . LYS A 1 474 ? -50.524 44.986 -9.555  1.00 72.19  ? 487  LYS A CB    1 
ATOM   3029 C CG    . LYS A 1 474 ? -51.199 45.956 -10.509 1.00 82.77  ? 487  LYS A CG    1 
ATOM   3030 C CD    . LYS A 1 474 ? -50.201 46.571 -11.477 1.00 88.88  ? 487  LYS A CD    1 
ATOM   3031 C CE    . LYS A 1 474 ? -50.872 47.575 -12.400 1.00 105.77 ? 487  LYS A CE    1 
ATOM   3032 N NZ    . LYS A 1 474 ? -50.021 47.917 -13.573 1.00 116.82 ? 487  LYS A NZ    1 
ATOM   3033 N N     . ILE A 1 475 ? -50.056 43.188 -6.990  1.00 57.42  ? 488  ILE A N     1 
ATOM   3034 C CA    . ILE A 1 475 ? -49.332 42.094 -6.344  1.00 59.04  ? 488  ILE A CA    1 
ATOM   3035 C C     . ILE A 1 475 ? -50.311 41.047 -5.816  1.00 56.61  ? 488  ILE A C     1 
ATOM   3036 O O     . ILE A 1 475 ? -50.139 39.860 -6.067  1.00 51.37  ? 488  ILE A O     1 
ATOM   3037 C CB    . ILE A 1 475 ? -48.429 42.603 -5.202  1.00 68.27  ? 488  ILE A CB    1 
ATOM   3038 C CG1   . ILE A 1 475 ? -47.279 43.437 -5.776  1.00 64.05  ? 488  ILE A CG1   1 
ATOM   3039 C CG2   . ILE A 1 475 ? -47.871 41.433 -4.398  1.00 66.12  ? 488  ILE A CG2   1 
ATOM   3040 C CD1   . ILE A 1 475 ? -46.617 44.346 -4.766  1.00 70.14  ? 488  ILE A CD1   1 
ATOM   3041 N N     . LYS A 1 476 ? -51.339 41.498 -5.098  1.00 50.46  ? 489  LYS A N     1 
ATOM   3042 C CA    . LYS A 1 476 ? -52.426 40.622 -4.652  1.00 51.87  ? 489  LYS A CA    1 
ATOM   3043 C C     . LYS A 1 476 ? -53.015 39.786 -5.796  1.00 53.31  ? 489  LYS A C     1 
ATOM   3044 O O     . LYS A 1 476 ? -53.394 38.636 -5.593  1.00 57.87  ? 489  LYS A O     1 
ATOM   3045 C CB    . LYS A 1 476 ? -53.540 41.449 -3.996  1.00 63.79  ? 489  LYS A CB    1 
ATOM   3046 C CG    . LYS A 1 476 ? -54.576 40.631 -3.237  1.00 64.11  ? 489  LYS A CG    1 
ATOM   3047 N N     . LYS A 1 477 ? -53.078 40.368 -6.993  1.00 55.93  ? 490  LYS A N     1 
ATOM   3048 C CA    . LYS A 1 477 ? -53.601 39.688 -8.187  1.00 54.01  ? 490  LYS A CA    1 
ATOM   3049 C C     . LYS A 1 477 ? -52.679 38.557 -8.645  1.00 52.74  ? 490  LYS A C     1 
ATOM   3050 O O     . LYS A 1 477 ? -53.147 37.453 -8.935  1.00 58.62  ? 490  LYS A O     1 
ATOM   3051 C CB    . LYS A 1 477 ? -53.791 40.703 -9.311  1.00 62.92  ? 490  LYS A CB    1 
ATOM   3052 C CG    . LYS A 1 477 ? -54.737 40.292 -10.423 1.00 67.17  ? 490  LYS A CG    1 
ATOM   3053 C CD    . LYS A 1 477 ? -55.235 41.537 -11.144 1.00 79.33  ? 490  LYS A CD    1 
ATOM   3054 C CE    . LYS A 1 477 ? -55.694 41.252 -12.560 1.00 86.85  ? 490  LYS A CE    1 
ATOM   3055 N NZ    . LYS A 1 477 ? -56.658 40.125 -12.630 1.00 106.18 ? 490  LYS A NZ    1 
ATOM   3056 N N     . TYR A 1 478 ? -51.377 38.832 -8.707  1.00 62.06  ? 491  TYR A N     1 
ATOM   3057 C CA    . TYR A 1 478 ? -50.374 37.785 -8.946  1.00 66.89  ? 491  TYR A CA    1 
ATOM   3058 C C     . TYR A 1 478 ? -50.300 36.803 -7.772  1.00 69.50  ? 491  TYR A C     1 
ATOM   3059 O O     . TYR A 1 478 ? -49.903 35.651 -7.949  1.00 76.29  ? 491  TYR A O     1 
ATOM   3060 C CB    . TYR A 1 478 ? -48.982 38.385 -9.170  1.00 66.49  ? 491  TYR A CB    1 
ATOM   3061 C CG    . TYR A 1 478 ? -48.816 39.157 -10.456 1.00 63.34  ? 491  TYR A CG    1 
ATOM   3062 C CD1   . TYR A 1 478 ? -48.794 38.505 -11.687 1.00 70.80  ? 491  TYR A CD1   1 
ATOM   3063 C CD2   . TYR A 1 478 ? -48.662 40.540 -10.443 1.00 65.25  ? 491  TYR A CD2   1 
ATOM   3064 C CE1   . TYR A 1 478 ? -48.641 39.211 -12.871 1.00 71.22  ? 491  TYR A CE1   1 
ATOM   3065 C CE2   . TYR A 1 478 ? -48.502 41.255 -11.619 1.00 73.34  ? 491  TYR A CE2   1 
ATOM   3066 C CZ    . TYR A 1 478 ? -48.492 40.588 -12.830 1.00 73.47  ? 491  TYR A CZ    1 
ATOM   3067 O OH    . TYR A 1 478 ? -48.330 41.298 -13.995 1.00 74.20  ? 491  TYR A OH    1 
ATOM   3068 N N     . GLY A 1 479 ? -50.652 37.276 -6.576  1.00 69.28  ? 492  GLY A N     1 
ATOM   3069 C CA    . GLY A 1 479 ? -50.773 36.423 -5.391  1.00 66.45  ? 492  GLY A CA    1 
ATOM   3070 C C     . GLY A 1 479 ? -49.475 36.221 -4.629  1.00 60.31  ? 492  GLY A C     1 
ATOM   3071 O O     . GLY A 1 479 ? -49.255 35.162 -4.051  1.00 63.20  ? 492  GLY A O     1 
ATOM   3072 N N     . ALA A 1 480 ? -48.623 37.241 -4.610  1.00 54.63  ? 493  ALA A N     1 
ATOM   3073 C CA    . ALA A 1 480 ? -47.329 37.151 -3.933  1.00 54.23  ? 493  ALA A CA    1 
ATOM   3074 C C     . ALA A 1 480 ? -47.382 37.696 -2.514  1.00 53.08  ? 493  ALA A C     1 
ATOM   3075 O O     . ALA A 1 480 ? -48.240 38.512 -2.171  1.00 51.49  ? 493  ALA A O     1 
ATOM   3076 C CB    . ALA A 1 480 ? -46.266 37.895 -4.726  1.00 52.38  ? 493  ALA A CB    1 
ATOM   3077 N N     . ALA A 1 481 ? -46.458 37.224 -1.687  1.00 53.36  ? 494  ALA A N     1 
ATOM   3078 C CA    . ALA A 1 481 ? -46.152 37.904 -0.444  1.00 57.73  ? 494  ALA A CA    1 
ATOM   3079 C C     . ALA A 1 481 ? -45.473 39.212 -0.851  1.00 58.31  ? 494  ALA A C     1 
ATOM   3080 O O     . ALA A 1 481 ? -45.116 39.383 -2.015  1.00 57.06  ? 494  ALA A O     1 
ATOM   3081 C CB    . ALA A 1 481 ? -45.248 37.057 0.433   1.00 55.08  ? 494  ALA A CB    1 
ATOM   3082 N N     . MET A 1 482 ? -45.294 40.126 0.095   1.00 64.62  ? 495  MET A N     1 
ATOM   3083 C CA    . MET A 1 482 ? -44.946 41.502 -0.240  1.00 60.17  ? 495  MET A CA    1 
ATOM   3084 C C     . MET A 1 482 ? -44.235 42.214 0.902   1.00 59.27  ? 495  MET A C     1 
ATOM   3085 O O     . MET A 1 482 ? -44.687 42.163 2.045   1.00 53.21  ? 495  MET A O     1 
ATOM   3086 C CB    . MET A 1 482 ? -46.228 42.256 -0.572  1.00 66.04  ? 495  MET A CB    1 
ATOM   3087 C CG    . MET A 1 482 ? -46.038 43.717 -0.942  1.00 75.69  ? 495  MET A CG    1 
ATOM   3088 S SD    . MET A 1 482 ? -47.604 44.473 -1.415  1.00 75.11  ? 495  MET A SD    1 
ATOM   3089 C CE    . MET A 1 482 ? -48.492 44.417 0.139   1.00 66.45  ? 495  MET A CE    1 
ATOM   3090 N N     . VAL A 1 483 ? -43.131 42.884 0.580   1.00 58.84  ? 496  VAL A N     1 
ATOM   3091 C CA    . VAL A 1 483 ? -42.410 43.699 1.554   1.00 59.88  ? 496  VAL A CA    1 
ATOM   3092 C C     . VAL A 1 483 ? -42.861 45.151 1.436   1.00 60.10  ? 496  VAL A C     1 
ATOM   3093 O O     . VAL A 1 483 ? -42.848 45.730 0.347   1.00 62.06  ? 496  VAL A O     1 
ATOM   3094 C CB    . VAL A 1 483 ? -40.886 43.625 1.352   1.00 54.81  ? 496  VAL A CB    1 
ATOM   3095 C CG1   . VAL A 1 483 ? -40.170 44.538 2.338   1.00 55.52  ? 496  VAL A CG1   1 
ATOM   3096 C CG2   . VAL A 1 483 ? -40.399 42.196 1.513   1.00 55.47  ? 496  VAL A CG2   1 
ATOM   3097 N N     . VAL A 1 484 ? -43.260 45.727 2.565   1.00 54.92  ? 497  VAL A N     1 
ATOM   3098 C CA    . VAL A 1 484 ? -43.634 47.132 2.634   1.00 58.74  ? 497  VAL A CA    1 
ATOM   3099 C C     . VAL A 1 484 ? -42.536 47.911 3.356   1.00 58.41  ? 497  VAL A C     1 
ATOM   3100 O O     . VAL A 1 484 ? -42.319 47.746 4.555   1.00 61.13  ? 497  VAL A O     1 
ATOM   3101 C CB    . VAL A 1 484 ? -44.989 47.314 3.341   1.00 62.00  ? 497  VAL A CB    1 
ATOM   3102 C CG1   . VAL A 1 484 ? -45.220 48.767 3.737   1.00 66.45  ? 497  VAL A CG1   1 
ATOM   3103 C CG2   . VAL A 1 484 ? -46.108 46.822 2.436   1.00 68.47  ? 497  VAL A CG2   1 
ATOM   3104 N N     . MET A 1 485 ? -41.859 48.768 2.602   1.00 61.24  ? 498  MET A N     1 
ATOM   3105 C CA    . MET A 1 485 ? -40.765 49.580 3.116   1.00 63.45  ? 498  MET A CA    1 
ATOM   3106 C C     . MET A 1 485 ? -41.295 50.685 4.032   1.00 62.56  ? 498  MET A C     1 
ATOM   3107 O O     . MET A 1 485 ? -42.394 51.193 3.823   1.00 67.74  ? 498  MET A O     1 
ATOM   3108 C CB    . MET A 1 485 ? -40.008 50.203 1.938   1.00 69.42  ? 498  MET A CB    1 
ATOM   3109 C CG    . MET A 1 485 ? -38.506 50.172 2.078   1.00 73.47  ? 498  MET A CG    1 
ATOM   3110 S SD    . MET A 1 485 ? -37.892 48.483 2.036   1.00 81.74  ? 498  MET A SD    1 
ATOM   3111 C CE    . MET A 1 485 ? -36.522 48.669 3.176   1.00 77.08  ? 498  MET A CE    1 
ATOM   3112 N N     . ALA A 1 486 ? -40.519 51.052 5.047   1.00 65.82  ? 499  ALA A N     1 
ATOM   3113 C CA    . ALA A 1 486 ? -40.865 52.184 5.914   1.00 69.42  ? 499  ALA A CA    1 
ATOM   3114 C C     . ALA A 1 486 ? -40.429 53.504 5.272   1.00 71.57  ? 499  ALA A C     1 
ATOM   3115 O O     . ALA A 1 486 ? -39.530 54.190 5.762   1.00 71.51  ? 499  ALA A O     1 
ATOM   3116 C CB    . ALA A 1 486 ? -40.235 52.019 7.287   1.00 68.38  ? 499  ALA A CB    1 
ATOM   3117 N N     . PHE A 1 487 ? -41.082 53.836 4.166   1.00 67.56  ? 500  PHE A N     1 
ATOM   3118 C CA    . PHE A 1 487 ? -40.809 55.040 3.394   1.00 69.27  ? 500  PHE A CA    1 
ATOM   3119 C C     . PHE A 1 487 ? -42.168 55.651 3.090   1.00 71.27  ? 500  PHE A C     1 
ATOM   3120 O O     . PHE A 1 487 ? -43.089 54.931 2.694   1.00 72.44  ? 500  PHE A O     1 
ATOM   3121 C CB    . PHE A 1 487 ? -40.110 54.661 2.081   1.00 61.91  ? 500  PHE A CB    1 
ATOM   3122 C CG    . PHE A 1 487 ? -39.155 55.700 1.563   1.00 65.23  ? 500  PHE A CG    1 
ATOM   3123 C CD1   . PHE A 1 487 ? -39.625 56.868 0.970   1.00 72.69  ? 500  PHE A CD1   1 
ATOM   3124 C CD2   . PHE A 1 487 ? -37.777 55.499 1.643   1.00 68.51  ? 500  PHE A CD2   1 
ATOM   3125 C CE1   . PHE A 1 487 ? -38.741 57.825 0.481   1.00 74.30  ? 500  PHE A CE1   1 
ATOM   3126 C CE2   . PHE A 1 487 ? -36.890 56.449 1.157   1.00 69.92  ? 500  PHE A CE2   1 
ATOM   3127 C CZ    . PHE A 1 487 ? -37.372 57.615 0.575   1.00 76.34  ? 500  PHE A CZ    1 
ATOM   3128 N N     . ASP A 1 488 ? -42.311 56.960 3.290   1.00 68.16  ? 501  ASP A N     1 
ATOM   3129 C CA    . ASP A 1 488 ? -43.529 57.658 2.869   1.00 68.50  ? 501  ASP A CA    1 
ATOM   3130 C C     . ASP A 1 488 ? -43.208 58.999 2.201   1.00 68.44  ? 501  ASP A C     1 
ATOM   3131 O O     . ASP A 1 488 ? -42.070 59.229 1.790   1.00 66.99  ? 501  ASP A O     1 
ATOM   3132 C CB    . ASP A 1 488 ? -44.506 57.799 4.046   1.00 69.18  ? 501  ASP A CB    1 
ATOM   3133 C CG    . ASP A 1 488 ? -44.034 58.781 5.102   1.00 73.27  ? 501  ASP A CG    1 
ATOM   3134 O OD1   . ASP A 1 488 ? -42.864 59.222 5.056   1.00 70.76  ? 501  ASP A OD1   1 
ATOM   3135 O OD2   . ASP A 1 488 ? -44.852 59.102 5.992   1.00 66.79  ? 501  ASP A OD2   1 
ATOM   3136 N N     . GLU A 1 489 ? -44.211 59.868 2.080   1.00 74.93  ? 502  GLU A N     1 
ATOM   3137 C CA    . GLU A 1 489 ? -44.047 61.173 1.430   1.00 78.41  ? 502  GLU A CA    1 
ATOM   3138 C C     . GLU A 1 489 ? -42.973 62.038 2.099   1.00 81.14  ? 502  GLU A C     1 
ATOM   3139 O O     . GLU A 1 489 ? -42.295 62.815 1.426   1.00 82.11  ? 502  GLU A O     1 
ATOM   3140 C CB    . GLU A 1 489 ? -45.380 61.931 1.393   1.00 80.77  ? 502  GLU A CB    1 
ATOM   3141 C CG    . GLU A 1 489 ? -46.458 61.278 0.529   1.00 83.76  ? 502  GLU A CG    1 
ATOM   3142 C CD    . GLU A 1 489 ? -47.385 60.348 1.303   1.00 87.74  ? 502  GLU A CD    1 
ATOM   3143 O OE1   . GLU A 1 489 ? -46.925 59.666 2.248   1.00 72.93  ? 502  GLU A OE1   1 
ATOM   3144 O OE2   . GLU A 1 489 ? -48.585 60.294 0.958   1.00 95.56  ? 502  GLU A OE2   1 
ATOM   3145 N N     . GLU A 1 490 ? -42.822 61.894 3.416   1.00 87.17  ? 503  GLU A N     1 
ATOM   3146 C CA    . GLU A 1 490 ? -41.788 62.608 4.177   1.00 89.27  ? 503  GLU A CA    1 
ATOM   3147 C C     . GLU A 1 490 ? -40.362 62.119 3.890   1.00 85.62  ? 503  GLU A C     1 
ATOM   3148 O O     . GLU A 1 490 ? -39.399 62.839 4.158   1.00 108.33 ? 503  GLU A O     1 
ATOM   3149 C CB    . GLU A 1 490 ? -42.061 62.494 5.681   1.00 95.90  ? 503  GLU A CB    1 
ATOM   3150 C CG    . GLU A 1 490 ? -43.229 63.336 6.169   1.00 107.54 ? 503  GLU A CG    1 
ATOM   3151 C CD    . GLU A 1 490 ? -42.847 64.786 6.410   1.00 124.42 ? 503  GLU A CD    1 
ATOM   3152 O OE1   . GLU A 1 490 ? -41.875 65.034 7.157   1.00 134.06 ? 503  GLU A OE1   1 
ATOM   3153 O OE2   . GLU A 1 490 ? -43.524 65.679 5.860   1.00 134.47 ? 503  GLU A OE2   1 
ATOM   3154 N N     . GLY A 1 491 ? -40.229 60.900 3.369   1.00 77.66  ? 504  GLY A N     1 
ATOM   3155 C CA    . GLY A 1 491 ? -38.920 60.303 3.093   1.00 76.25  ? 504  GLY A CA    1 
ATOM   3156 C C     . GLY A 1 491 ? -38.722 58.996 3.840   1.00 74.09  ? 504  GLY A C     1 
ATOM   3157 O O     . GLY A 1 491 ? -39.692 58.325 4.199   1.00 71.90  ? 504  GLY A O     1 
ATOM   3158 N N     . GLN A 1 492 ? -37.462 58.636 4.078   1.00 69.04  ? 505  GLN A N     1 
ATOM   3159 C CA    . GLN A 1 492 ? -37.129 57.377 4.745   1.00 63.37  ? 505  GLN A CA    1 
ATOM   3160 C C     . GLN A 1 492 ? -37.315 57.482 6.259   1.00 66.80  ? 505  GLN A C     1 
ATOM   3161 O O     . GLN A 1 492 ? -36.809 58.416 6.889   1.00 67.58  ? 505  GLN A O     1 
ATOM   3162 C CB    . GLN A 1 492 ? -35.684 56.977 4.442   1.00 64.83  ? 505  GLN A CB    1 
ATOM   3163 C CG    . GLN A 1 492 ? -35.330 55.566 4.885   1.00 63.58  ? 505  GLN A CG    1 
ATOM   3164 C CD    . GLN A 1 492 ? -33.884 55.215 4.603   1.00 66.88  ? 505  GLN A CD    1 
ATOM   3165 O OE1   . GLN A 1 492 ? -32.970 55.894 5.070   1.00 73.78  ? 505  GLN A OE1   1 
ATOM   3166 N NE2   . GLN A 1 492 ? -33.667 54.143 3.844   1.00 67.39  ? 505  GLN A NE2   1 
ATOM   3167 N N     . ALA A 1 493 ? -38.011 56.503 6.837   1.00 66.22  ? 506  ALA A N     1 
ATOM   3168 C CA    . ALA A 1 493 ? -38.294 56.486 8.272   1.00 66.67  ? 506  ALA A CA    1 
ATOM   3169 C C     . ALA A 1 493 ? -37.080 56.006 9.065   1.00 63.90  ? 506  ALA A C     1 
ATOM   3170 O O     . ALA A 1 493 ? -36.745 54.824 9.036   1.00 60.47  ? 506  ALA A O     1 
ATOM   3171 C CB    . ALA A 1 493 ? -39.499 55.607 8.563   1.00 67.54  ? 506  ALA A CB    1 
ATOM   3172 N N     . THR A 1 494 ? -36.435 56.931 9.774   1.00 65.63  ? 507  THR A N     1 
ATOM   3173 C CA    . THR A 1 494 ? -35.216 56.637 10.528  1.00 72.14  ? 507  THR A CA    1 
ATOM   3174 C C     . THR A 1 494 ? -35.424 56.662 12.046  1.00 76.25  ? 507  THR A C     1 
ATOM   3175 O O     . THR A 1 494 ? -34.516 56.320 12.802  1.00 83.83  ? 507  THR A O     1 
ATOM   3176 C CB    . THR A 1 494 ? -34.100 57.636 10.167  1.00 72.37  ? 507  THR A CB    1 
ATOM   3177 O OG1   . THR A 1 494 ? -34.459 58.947 10.624  1.00 68.19  ? 507  THR A OG1   1 
ATOM   3178 C CG2   . THR A 1 494 ? -33.875 57.665 8.655   1.00 69.21  ? 507  THR A CG2   1 
ATOM   3179 N N     . GLU A 1 495 ? -36.616 57.060 12.481  1.00 71.48  ? 508  GLU A N     1 
ATOM   3180 C CA    . GLU A 1 495 ? -36.953 57.144 13.901  1.00 70.65  ? 508  GLU A CA    1 
ATOM   3181 C C     . GLU A 1 495 ? -38.012 56.097 14.246  1.00 73.27  ? 508  GLU A C     1 
ATOM   3182 O O     . GLU A 1 495 ? -38.841 55.738 13.407  1.00 78.16  ? 508  GLU A O     1 
ATOM   3183 C CB    . GLU A 1 495 ? -37.470 58.543 14.232  1.00 71.67  ? 508  GLU A CB    1 
ATOM   3184 C CG    . GLU A 1 495 ? -36.444 59.648 14.005  1.00 89.18  ? 508  GLU A CG    1 
ATOM   3185 C CD    . GLU A 1 495 ? -37.075 60.989 13.665  1.00 109.80 ? 508  GLU A CD    1 
ATOM   3186 O OE1   . GLU A 1 495 ? -38.166 61.299 14.196  1.00 102.46 ? 508  GLU A OE1   1 
ATOM   3187 O OE2   . GLU A 1 495 ? -36.475 61.738 12.862  1.00 129.01 ? 508  GLU A OE2   1 
ATOM   3188 N N     . THR A 1 496 ? -37.982 55.620 15.487  1.00 69.68  ? 509  THR A N     1 
ATOM   3189 C CA    . THR A 1 496 ? -38.895 54.573 15.943  1.00 63.26  ? 509  THR A CA    1 
ATOM   3190 C C     . THR A 1 496 ? -40.355 54.908 15.646  1.00 59.17  ? 509  THR A C     1 
ATOM   3191 O O     . THR A 1 496 ? -41.096 54.054 15.166  1.00 63.60  ? 509  THR A O     1 
ATOM   3192 C CB    . THR A 1 496 ? -38.743 54.320 17.456  1.00 60.89  ? 509  THR A CB    1 
ATOM   3193 O OG1   . THR A 1 496 ? -37.358 54.210 17.780  1.00 68.07  ? 509  THR A OG1   1 
ATOM   3194 C CG2   . THR A 1 496 ? -39.452 53.046 17.876  1.00 62.88  ? 509  THR A CG2   1 
ATOM   3195 N N     . ASP A 1 497 ? -40.759 56.144 15.930  1.00 61.44  ? 510  ASP A N     1 
ATOM   3196 C CA    . ASP A 1 497 ? -42.148 56.572 15.720  1.00 68.31  ? 510  ASP A CA    1 
ATOM   3197 C C     . ASP A 1 497 ? -42.500 56.652 14.236  1.00 67.89  ? 510  ASP A C     1 
ATOM   3198 O O     . ASP A 1 497 ? -43.564 56.187 13.825  1.00 69.98  ? 510  ASP A O     1 
ATOM   3199 C CB    . ASP A 1 497 ? -42.403 57.927 16.385  1.00 76.98  ? 510  ASP A CB    1 
ATOM   3200 C CG    . ASP A 1 497 ? -42.205 57.886 17.892  1.00 101.55 ? 510  ASP A CG    1 
ATOM   3201 O OD1   . ASP A 1 497 ? -42.916 57.114 18.578  1.00 91.12  ? 510  ASP A OD1   1 
ATOM   3202 O OD2   . ASP A 1 497 ? -41.338 58.633 18.392  1.00 109.49 ? 510  ASP A OD2   1 
ATOM   3203 N N     . THR A 1 498 ? -41.602 57.233 13.441  1.00 63.09  ? 511  THR A N     1 
ATOM   3204 C CA    . THR A 1 498 ? -41.814 57.361 11.999  1.00 71.77  ? 511  THR A CA    1 
ATOM   3205 C C     . THR A 1 498 ? -41.909 55.990 11.344  1.00 68.57  ? 511  THR A C     1 
ATOM   3206 O O     . THR A 1 498 ? -42.729 55.780 10.451  1.00 81.32  ? 511  THR A O     1 
ATOM   3207 C CB    . THR A 1 498 ? -40.688 58.163 11.310  1.00 76.01  ? 511  THR A CB    1 
ATOM   3208 O OG1   . THR A 1 498 ? -39.425 57.533 11.550  1.00 88.40  ? 511  THR A OG1   1 
ATOM   3209 C CG2   . THR A 1 498 ? -40.642 59.583 11.831  1.00 73.92  ? 511  THR A CG2   1 
ATOM   3210 N N     . LYS A 1 499 ? -41.066 55.064 11.788  1.00 60.32  ? 512  LYS A N     1 
ATOM   3211 C CA    . LYS A 1 499 ? -41.125 53.681 11.313  1.00 60.51  ? 512  LYS A CA    1 
ATOM   3212 C C     . LYS A 1 499 ? -42.500 53.064 11.578  1.00 59.29  ? 512  LYS A C     1 
ATOM   3213 O O     . LYS A 1 499 ? -43.100 52.467 10.682  1.00 67.26  ? 512  LYS A O     1 
ATOM   3214 C CB    . LYS A 1 499 ? -40.034 52.840 11.984  1.00 62.44  ? 512  LYS A CB    1 
ATOM   3215 C CG    . LYS A 1 499 ? -38.628 53.167 11.505  1.00 65.28  ? 512  LYS A CG    1 
ATOM   3216 C CD    . LYS A 1 499 ? -37.574 52.497 12.369  1.00 64.41  ? 512  LYS A CD    1 
ATOM   3217 C CE    . LYS A 1 499 ? -36.174 52.956 11.994  1.00 65.98  ? 512  LYS A CE    1 
ATOM   3218 N NZ    . LYS A 1 499 ? -35.789 52.568 10.611  1.00 69.10  ? 512  LYS A NZ    1 
ATOM   3219 N N     . ILE A 1 500 ? -42.993 53.234 12.805  1.00 60.52  ? 513  ILE A N     1 
ATOM   3220 C CA    . ILE A 1 500 ? -44.297 52.700 13.218  1.00 60.54  ? 513  ILE A CA    1 
ATOM   3221 C C     . ILE A 1 500 ? -45.442 53.360 12.446  1.00 57.71  ? 513  ILE A C     1 
ATOM   3222 O O     . ILE A 1 500 ? -46.364 52.680 11.999  1.00 66.83  ? 513  ILE A O     1 
ATOM   3223 C CB    . ILE A 1 500 ? -44.547 52.900 14.733  1.00 61.82  ? 513  ILE A CB    1 
ATOM   3224 C CG1   . ILE A 1 500 ? -43.515 52.133 15.564  1.00 64.85  ? 513  ILE A CG1   1 
ATOM   3225 C CG2   . ILE A 1 500 ? -45.949 52.433 15.120  1.00 64.71  ? 513  ILE A CG2   1 
ATOM   3226 C CD1   . ILE A 1 500 ? -43.360 52.669 16.972  1.00 65.11  ? 513  ILE A CD1   1 
ATOM   3227 N N     . ARG A 1 501 ? -45.383 54.681 12.310  1.00 51.74  ? 514  ARG A N     1 
ATOM   3228 C CA    . ARG A 1 501 ? -46.413 55.438 11.591  1.00 61.54  ? 514  ARG A CA    1 
ATOM   3229 C C     . ARG A 1 501 ? -46.701 54.832 10.217  1.00 59.47  ? 514  ARG A C     1 
ATOM   3230 O O     . ARG A 1 501 ? -47.840 54.478 9.911   1.00 59.26  ? 514  ARG A O     1 
ATOM   3231 C CB    . ARG A 1 501 ? -45.972 56.894 11.422  1.00 57.90  ? 514  ARG A CB    1 
ATOM   3232 C CG    . ARG A 1 501 ? -46.998 57.804 10.766  1.00 59.45  ? 514  ARG A CG    1 
ATOM   3233 C CD    . ARG A 1 501 ? -46.356 58.703 9.718   1.00 72.41  ? 514  ARG A CD    1 
ATOM   3234 N NE    . ARG A 1 501 ? -45.281 59.531 10.270  1.00 68.06  ? 514  ARG A NE    1 
ATOM   3235 C CZ    . ARG A 1 501 ? -44.286 60.071 9.565   1.00 72.37  ? 514  ARG A CZ    1 
ATOM   3236 N NH1   . ARG A 1 501 ? -44.190 59.883 8.252   1.00 77.75  ? 514  ARG A NH1   1 
ATOM   3237 N NH2   . ARG A 1 501 ? -43.367 60.808 10.179  1.00 83.95  ? 514  ARG A NH2   1 
ATOM   3238 N N     . VAL A 1 502 ? -45.652 54.700 9.411   1.00 58.51  ? 515  VAL A N     1 
ATOM   3239 C CA    . VAL A 1 502 ? -45.779 54.238 8.031   1.00 61.61  ? 515  VAL A CA    1 
ATOM   3240 C C     . VAL A 1 502 ? -46.358 52.832 7.962   1.00 58.41  ? 515  VAL A C     1 
ATOM   3241 O O     . VAL A 1 502 ? -47.292 52.575 7.200   1.00 62.11  ? 515  VAL A O     1 
ATOM   3242 C CB    . VAL A 1 502 ? -44.416 54.275 7.307   1.00 57.85  ? 515  VAL A CB    1 
ATOM   3243 C CG1   . VAL A 1 502 ? -44.484 53.552 5.971   1.00 60.81  ? 515  VAL A CG1   1 
ATOM   3244 C CG2   . VAL A 1 502 ? -43.966 55.717 7.119   1.00 55.06  ? 515  VAL A CG2   1 
ATOM   3245 N N     . CYS A 1 503 ? -45.799 51.930 8.759   1.00 54.25  ? 516  CYS A N     1 
ATOM   3246 C CA    . CYS A 1 503 ? -46.237 50.538 8.767   1.00 57.53  ? 516  CYS A CA    1 
ATOM   3247 C C     . CYS A 1 503 ? -47.673 50.410 9.264   1.00 56.14  ? 516  CYS A C     1 
ATOM   3248 O O     . CYS A 1 503 ? -48.435 49.590 8.762   1.00 61.39  ? 516  CYS A O     1 
ATOM   3249 C CB    . CYS A 1 503 ? -45.291 49.686 9.616   1.00 63.97  ? 516  CYS A CB    1 
ATOM   3250 S SG    . CYS A 1 503 ? -43.599 49.618 8.967   1.00 62.35  ? 516  CYS A SG    1 
ATOM   3251 N N     . THR A 1 504 ? -48.049 51.240 10.231  1.00 66.08  ? 517  THR A N     1 
ATOM   3252 C CA    . THR A 1 504 ? -49.407 51.217 10.776  1.00 69.14  ? 517  THR A CA    1 
ATOM   3253 C C     . THR A 1 504 ? -50.428 51.708 9.749   1.00 65.49  ? 517  THR A C     1 
ATOM   3254 O O     . THR A 1 504 ? -51.493 51.109 9.580   1.00 64.24  ? 517  THR A O     1 
ATOM   3255 C CB    . THR A 1 504 ? -49.507 52.075 12.049  1.00 64.16  ? 517  THR A CB    1 
ATOM   3256 O OG1   . THR A 1 504 ? -48.496 51.667 12.977  1.00 69.21  ? 517  THR A OG1   1 
ATOM   3257 C CG2   . THR A 1 504 ? -50.877 51.923 12.698  1.00 68.82  ? 517  THR A CG2   1 
ATOM   3258 N N     . ARG A 1 505 ? -50.089 52.802 9.074   1.00 66.32  ? 518  ARG A N     1 
ATOM   3259 C CA    . ARG A 1 505 ? -50.910 53.347 7.994   1.00 61.76  ? 518  ARG A CA    1 
ATOM   3260 C C     . ARG A 1 505 ? -51.031 52.336 6.870   1.00 64.37  ? 518  ARG A C     1 
ATOM   3261 O O     . ARG A 1 505 ? -52.128 52.083 6.372   1.00 79.34  ? 518  ARG A O     1 
ATOM   3262 C CB    . ARG A 1 505 ? -50.271 54.628 7.458   1.00 58.66  ? 518  ARG A CB    1 
ATOM   3263 C CG    . ARG A 1 505 ? -51.091 55.386 6.434   1.00 65.36  ? 518  ARG A CG    1 
ATOM   3264 C CD    . ARG A 1 505 ? -50.247 56.480 5.792   1.00 75.19  ? 518  ARG A CD    1 
ATOM   3265 N NE    . ARG A 1 505 ? -50.879 57.037 4.597   1.00 72.86  ? 518  ARG A NE    1 
ATOM   3266 C CZ    . ARG A 1 505 ? -50.274 57.831 3.715   1.00 75.10  ? 518  ARG A CZ    1 
ATOM   3267 N NH1   . ARG A 1 505 ? -48.999 58.184 3.868   1.00 72.15  ? 518  ARG A NH1   1 
ATOM   3268 N NH2   . ARG A 1 505 ? -50.951 58.276 2.663   1.00 74.96  ? 518  ARG A NH2   1 
ATOM   3269 N N     . ALA A 1 506 ? -49.892 51.767 6.481   1.00 66.16  ? 519  ALA A N     1 
ATOM   3270 C CA    . ALA A 1 506 ? -49.830 50.795 5.392   1.00 66.17  ? 519  ALA A CA    1 
ATOM   3271 C C     . ALA A 1 506 ? -50.687 49.573 5.704   1.00 61.84  ? 519  ALA A C     1 
ATOM   3272 O O     . ALA A 1 506 ? -51.515 49.165 4.889   1.00 60.70  ? 519  ALA A O     1 
ATOM   3273 C CB    . ALA A 1 506 ? -48.387 50.381 5.131   1.00 62.72  ? 519  ALA A CB    1 
ATOM   3274 N N     . TYR A 1 507 ? -50.491 49.007 6.891   1.00 54.34  ? 520  TYR A N     1 
ATOM   3275 C CA    . TYR A 1 507 ? -51.290 47.874 7.359   1.00 57.28  ? 520  TYR A CA    1 
ATOM   3276 C C     . TYR A 1 507 ? -52.788 48.156 7.243   1.00 61.77  ? 520  TYR A C     1 
ATOM   3277 O O     . TYR A 1 507 ? -53.554 47.280 6.849   1.00 73.71  ? 520  TYR A O     1 
ATOM   3278 C CB    . TYR A 1 507 ? -50.939 47.544 8.813   1.00 62.72  ? 520  TYR A CB    1 
ATOM   3279 C CG    . TYR A 1 507 ? -51.625 46.315 9.361   1.00 60.71  ? 520  TYR A CG    1 
ATOM   3280 C CD1   . TYR A 1 507 ? -51.074 45.050 9.192   1.00 58.93  ? 520  TYR A CD1   1 
ATOM   3281 C CD2   . TYR A 1 507 ? -52.819 46.420 10.061  1.00 64.02  ? 520  TYR A CD2   1 
ATOM   3282 C CE1   . TYR A 1 507 ? -51.697 43.924 9.704   1.00 58.08  ? 520  TYR A CE1   1 
ATOM   3283 C CE2   . TYR A 1 507 ? -53.452 45.302 10.570  1.00 66.41  ? 520  TYR A CE2   1 
ATOM   3284 C CZ    . TYR A 1 507 ? -52.888 44.057 10.392  1.00 61.63  ? 520  TYR A CZ    1 
ATOM   3285 O OH    . TYR A 1 507 ? -53.528 42.951 10.905  1.00 59.68  ? 520  TYR A OH    1 
ATOM   3286 N N     . HIS A 1 508 ? -53.194 49.379 7.582   1.00 59.70  ? 521  HIS A N     1 
ATOM   3287 C CA    . HIS A 1 508 ? -54.598 49.786 7.490   1.00 61.36  ? 521  HIS A CA    1 
ATOM   3288 C C     . HIS A 1 508 ? -55.112 49.811 6.047   1.00 65.03  ? 521  HIS A C     1 
ATOM   3289 O O     . HIS A 1 508 ? -56.235 49.383 5.776   1.00 69.13  ? 521  HIS A O     1 
ATOM   3290 C CB    . HIS A 1 508 ? -54.799 51.161 8.131   1.00 63.19  ? 521  HIS A CB    1 
ATOM   3291 N N     . LEU A 1 509 ? -54.294 50.308 5.124   1.00 64.10  ? 522  LEU A N     1 
ATOM   3292 C CA    . LEU A 1 509 ? -54.682 50.361 3.715   1.00 62.42  ? 522  LEU A CA    1 
ATOM   3293 C C     . LEU A 1 509 ? -54.753 48.959 3.113   1.00 65.11  ? 522  LEU A C     1 
ATOM   3294 O O     . LEU A 1 509 ? -55.701 48.633 2.397   1.00 64.04  ? 522  LEU A O     1 
ATOM   3295 C CB    . LEU A 1 509 ? -53.711 51.238 2.917   1.00 65.62  ? 522  LEU A CB    1 
ATOM   3296 C CG    . LEU A 1 509 ? -53.764 52.734 3.252   1.00 73.35  ? 522  LEU A CG    1 
ATOM   3297 C CD1   . LEU A 1 509 ? -52.542 53.460 2.709   1.00 74.12  ? 522  LEU A CD1   1 
ATOM   3298 C CD2   . LEU A 1 509 ? -55.045 53.367 2.723   1.00 68.63  ? 522  LEU A CD2   1 
ATOM   3299 N N     . LEU A 1 510 ? -53.762 48.127 3.421   1.00 59.45  ? 523  LEU A N     1 
ATOM   3300 C CA    . LEU A 1 510 ? -53.707 46.773 2.874   1.00 63.57  ? 523  LEU A CA    1 
ATOM   3301 C C     . LEU A 1 510 ? -54.830 45.885 3.410   1.00 64.97  ? 523  LEU A C     1 
ATOM   3302 O O     . LEU A 1 510 ? -55.570 45.275 2.639   1.00 56.49  ? 523  LEU A O     1 
ATOM   3303 C CB    . LEU A 1 510 ? -52.347 46.126 3.162   1.00 58.04  ? 523  LEU A CB    1 
ATOM   3304 C CG    . LEU A 1 510 ? -51.135 46.749 2.461   1.00 56.82  ? 523  LEU A CG    1 
ATOM   3305 C CD1   . LEU A 1 510 ? -49.887 45.961 2.807   1.00 53.14  ? 523  LEU A CD1   1 
ATOM   3306 C CD2   . LEU A 1 510 ? -51.319 46.808 0.952   1.00 55.09  ? 523  LEU A CD2   1 
ATOM   3307 N N     . VAL A 1 511 ? -54.961 45.827 4.729   1.00 70.15  ? 524  VAL A N     1 
ATOM   3308 C CA    . VAL A 1 511 ? -55.896 44.901 5.356   1.00 72.60  ? 524  VAL A CA    1 
ATOM   3309 C C     . VAL A 1 511 ? -57.338 45.384 5.209   1.00 76.16  ? 524  VAL A C     1 
ATOM   3310 O O     . VAL A 1 511 ? -58.206 44.622 4.779   1.00 70.47  ? 524  VAL A O     1 
ATOM   3311 C CB    . VAL A 1 511 ? -55.547 44.669 6.839   1.00 80.34  ? 524  VAL A CB    1 
ATOM   3312 C CG1   . VAL A 1 511 ? -56.593 43.787 7.511   1.00 96.14  ? 524  VAL A CG1   1 
ATOM   3313 C CG2   . VAL A 1 511 ? -54.163 44.044 6.955   1.00 71.62  ? 524  VAL A CG2   1 
ATOM   3314 N N     . LYS A 1 512 ? -57.591 46.646 5.553   1.00 77.27  ? 525  LYS A N     1 
ATOM   3315 C CA    . LYS A 1 512 ? -58.946 47.202 5.455   1.00 84.94  ? 525  LYS A CA    1 
ATOM   3316 C C     . LYS A 1 512 ? -59.361 47.469 4.005   1.00 75.38  ? 525  LYS A C     1 
ATOM   3317 O O     . LYS A 1 512 ? -60.266 46.817 3.487   1.00 73.44  ? 525  LYS A O     1 
ATOM   3318 C CB    . LYS A 1 512 ? -59.077 48.486 6.282   1.00 84.62  ? 525  LYS A CB    1 
ATOM   3319 N N     . LYS A 1 513 ? -58.682 48.409 3.351   1.00 74.71  ? 526  LYS A N     1 
ATOM   3320 C CA    . LYS A 1 513 ? -59.107 48.900 2.034   1.00 78.16  ? 526  LYS A CA    1 
ATOM   3321 C C     . LYS A 1 513 ? -59.010 47.846 0.926   1.00 77.19  ? 526  LYS A C     1 
ATOM   3322 O O     . LYS A 1 513 ? -59.789 47.880 -0.026  1.00 87.09  ? 526  LYS A O     1 
ATOM   3323 C CB    . LYS A 1 513 ? -58.300 50.147 1.635   1.00 83.01  ? 526  LYS A CB    1 
ATOM   3324 C CG    . LYS A 1 513 ? -59.004 51.078 0.657   1.00 93.79  ? 526  LYS A CG    1 
ATOM   3325 C CD    . LYS A 1 513 ? -60.031 51.962 1.351   1.00 100.72 ? 526  LYS A CD    1 
ATOM   3326 N N     . LEU A 1 514 ? -58.063 46.917 1.052   1.00 70.44  ? 527  LEU A N     1 
ATOM   3327 C CA    . LEU A 1 514 ? -57.801 45.927 0.001   1.00 65.54  ? 527  LEU A CA    1 
ATOM   3328 C C     . LEU A 1 514 ? -58.124 44.479 0.372   1.00 69.20  ? 527  LEU A C     1 
ATOM   3329 O O     . LEU A 1 514 ? -58.222 43.633 -0.519  1.00 68.47  ? 527  LEU A O     1 
ATOM   3330 C CB    . LEU A 1 514 ? -56.340 46.020 -0.446  1.00 63.35  ? 527  LEU A CB    1 
ATOM   3331 C CG    . LEU A 1 514 ? -56.049 46.882 -1.675  1.00 69.49  ? 527  LEU A CG    1 
ATOM   3332 C CD1   . LEU A 1 514 ? -56.722 48.243 -1.594  1.00 78.22  ? 527  LEU A CD1   1 
ATOM   3333 C CD2   . LEU A 1 514 ? -54.546 47.035 -1.843  1.00 73.20  ? 527  LEU A CD2   1 
ATOM   3334 N N     . GLY A 1 515 ? -58.282 44.184 1.663   1.00 68.20  ? 528  GLY A N     1 
ATOM   3335 C CA    . GLY A 1 515 ? -58.501 42.805 2.114   1.00 64.12  ? 528  GLY A CA    1 
ATOM   3336 C C     . GLY A 1 515 ? -57.283 41.913 1.917   1.00 60.83  ? 528  GLY A C     1 
ATOM   3337 O O     . GLY A 1 515 ? -57.406 40.700 1.751   1.00 62.15  ? 528  GLY A O     1 
ATOM   3338 N N     . PHE A 1 516 ? -56.104 42.524 1.935   1.00 62.64  ? 529  PHE A N     1 
ATOM   3339 C CA    . PHE A 1 516 ? -54.841 41.810 1.798   1.00 64.70  ? 529  PHE A CA    1 
ATOM   3340 C C     . PHE A 1 516 ? -54.680 40.903 3.016   1.00 61.43  ? 529  PHE A C     1 
ATOM   3341 O O     . PHE A 1 516 ? -54.924 41.333 4.140   1.00 80.99  ? 529  PHE A O     1 
ATOM   3342 C CB    . PHE A 1 516 ? -53.693 42.828 1.731   1.00 72.49  ? 529  PHE A CB    1 
ATOM   3343 C CG    . PHE A 1 516 ? -52.487 42.355 0.976   1.00 75.67  ? 529  PHE A CG    1 
ATOM   3344 C CD1   . PHE A 1 516 ? -52.372 42.590 -0.389  1.00 86.28  ? 529  PHE A CD1   1 
ATOM   3345 C CD2   . PHE A 1 516 ? -51.450 41.705 1.631   1.00 78.96  ? 529  PHE A CD2   1 
ATOM   3346 C CE1   . PHE A 1 516 ? -51.255 42.164 -1.090  1.00 85.37  ? 529  PHE A CE1   1 
ATOM   3347 C CE2   . PHE A 1 516 ? -50.330 41.275 0.936   1.00 79.94  ? 529  PHE A CE2   1 
ATOM   3348 C CZ    . PHE A 1 516 ? -50.233 41.504 -0.428  1.00 78.42  ? 529  PHE A CZ    1 
ATOM   3349 N N     . ASN A 1 517 ? -54.303 39.647 2.796   1.00 67.88  ? 530  ASN A N     1 
ATOM   3350 C CA    . ASN A 1 517 ? -54.041 38.732 3.903   1.00 70.92  ? 530  ASN A CA    1 
ATOM   3351 C C     . ASN A 1 517 ? -52.891 39.295 4.731   1.00 70.63  ? 530  ASN A C     1 
ATOM   3352 O O     . ASN A 1 517 ? -51.799 39.495 4.199   1.00 69.69  ? 530  ASN A O     1 
ATOM   3353 C CB    . ASN A 1 517 ? -53.686 37.331 3.389   1.00 75.84  ? 530  ASN A CB    1 
ATOM   3354 C CG    . ASN A 1 517 ? -53.628 36.288 4.500   1.00 88.06  ? 530  ASN A CG    1 
ATOM   3355 O OD1   . ASN A 1 517 ? -53.305 36.593 5.649   1.00 85.64  ? 530  ASN A OD1   1 
ATOM   3356 N ND2   . ASN A 1 517 ? -53.933 35.045 4.154   1.00 89.50  ? 530  ASN A ND2   1 
ATOM   3357 N N     . PRO A 1 518 ? -53.126 39.554 6.032   1.00 67.62  ? 531  PRO A N     1 
ATOM   3358 C CA    . PRO A 1 518 ? -52.052 40.139 6.845   1.00 64.70  ? 531  PRO A CA    1 
ATOM   3359 C C     . PRO A 1 518 ? -50.829 39.230 7.003   1.00 59.34  ? 531  PRO A C     1 
ATOM   3360 O O     . PRO A 1 518 ? -49.757 39.712 7.360   1.00 59.65  ? 531  PRO A O     1 
ATOM   3361 C CB    . PRO A 1 518 ? -52.729 40.400 8.198   1.00 67.00  ? 531  PRO A CB    1 
ATOM   3362 C CG    . PRO A 1 518 ? -53.888 39.465 8.239   1.00 70.16  ? 531  PRO A CG    1 
ATOM   3363 C CD    . PRO A 1 518 ? -54.354 39.333 6.818   1.00 66.62  ? 531  PRO A CD    1 
ATOM   3364 N N     . ASN A 1 519 ? -50.986 37.937 6.725   1.00 62.71  ? 532  ASN A N     1 
ATOM   3365 C CA    . ASN A 1 519 ? -49.860 37.003 6.730   1.00 64.88  ? 532  ASN A CA    1 
ATOM   3366 C C     . ASN A 1 519 ? -48.998 37.058 5.477   1.00 64.20  ? 532  ASN A C     1 
ATOM   3367 O O     . ASN A 1 519 ? -47.922 36.466 5.445   1.00 73.45  ? 532  ASN A O     1 
ATOM   3368 C CB    . ASN A 1 519 ? -50.355 35.580 6.958   1.00 66.88  ? 532  ASN A CB    1 
ATOM   3369 C CG    . ASN A 1 519 ? -50.850 35.373 8.370   1.00 71.02  ? 532  ASN A CG    1 
ATOM   3370 O OD1   . ASN A 1 519 ? -50.142 35.681 9.330   1.00 66.17  ? 532  ASN A OD1   1 
ATOM   3371 N ND2   . ASN A 1 519 ? -52.069 34.866 8.508   1.00 76.86  ? 532  ASN A ND2   1 
ATOM   3372 N N     . ASP A 1 520 ? -49.464 37.768 4.454   1.00 61.47  ? 533  ASP A N     1 
ATOM   3373 C CA    . ASP A 1 520 ? -48.651 38.033 3.269   1.00 61.84  ? 533  ASP A CA    1 
ATOM   3374 C C     . ASP A 1 520 ? -47.886 39.361 3.372   1.00 58.12  ? 533  ASP A C     1 
ATOM   3375 O O     . ASP A 1 520 ? -47.128 39.706 2.460   1.00 49.84  ? 533  ASP A O     1 
ATOM   3376 C CB    . ASP A 1 520 ? -49.525 38.021 2.007   1.00 62.47  ? 533  ASP A CB    1 
ATOM   3377 C CG    . ASP A 1 520 ? -49.975 36.621 1.617   1.00 67.49  ? 533  ASP A CG    1 
ATOM   3378 O OD1   . ASP A 1 520 ? -49.149 35.686 1.670   1.00 68.18  ? 533  ASP A OD1   1 
ATOM   3379 O OD2   . ASP A 1 520 ? -51.155 36.452 1.244   1.00 102.04 ? 533  ASP A OD2   1 
ATOM   3380 N N     . ILE A 1 521 ? -48.072 40.094 4.473   1.00 50.29  ? 534  ILE A N     1 
ATOM   3381 C CA    . ILE A 1 521 ? -47.433 41.402 4.642   1.00 52.16  ? 534  ILE A CA    1 
ATOM   3382 C C     . ILE A 1 521 ? -46.169 41.293 5.486   1.00 51.89  ? 534  ILE A C     1 
ATOM   3383 O O     . ILE A 1 521 ? -46.206 40.887 6.646   1.00 60.00  ? 534  ILE A O     1 
ATOM   3384 C CB    . ILE A 1 521 ? -48.375 42.453 5.280   1.00 53.26  ? 534  ILE A CB    1 
ATOM   3385 C CG1   . ILE A 1 521 ? -49.598 42.681 4.399   1.00 57.88  ? 534  ILE A CG1   1 
ATOM   3386 C CG2   . ILE A 1 521 ? -47.659 43.785 5.462   1.00 56.79  ? 534  ILE A CG2   1 
ATOM   3387 C CD1   . ILE A 1 521 ? -50.704 43.464 5.080   1.00 59.55  ? 534  ILE A CD1   1 
ATOM   3388 N N     . ILE A 1 522 ? -45.054 41.660 4.871   1.00 55.30  ? 535  ILE A N     1 
ATOM   3389 C CA    . ILE A 1 522 ? -43.792 41.841 5.552   1.00 46.84  ? 535  ILE A CA    1 
ATOM   3390 C C     . ILE A 1 522 ? -43.564 43.350 5.625   1.00 50.03  ? 535  ILE A C     1 
ATOM   3391 O O     . ILE A 1 522 ? -43.790 44.063 4.646   1.00 50.72  ? 535  ILE A O     1 
ATOM   3392 C CB    . ILE A 1 522 ? -42.653 41.176 4.758   1.00 49.49  ? 535  ILE A CB    1 
ATOM   3393 C CG1   . ILE A 1 522 ? -42.908 39.673 4.626   1.00 54.08  ? 535  ILE A CG1   1 
ATOM   3394 C CG2   . ILE A 1 522 ? -41.309 41.427 5.424   1.00 60.91  ? 535  ILE A CG2   1 
ATOM   3395 C CD1   . ILE A 1 522 ? -42.120 39.018 3.515   1.00 60.69  ? 535  ILE A CD1   1 
ATOM   3396 N N     . PHE A 1 523 ? -43.143 43.834 6.786   1.00 54.68  ? 536  PHE A N     1 
ATOM   3397 C CA    . PHE A 1 523 ? -42.778 45.236 6.951   1.00 52.87  ? 536  PHE A CA    1 
ATOM   3398 C C     . PHE A 1 523 ? -41.277 45.318 7.139   1.00 54.90  ? 536  PHE A C     1 
ATOM   3399 O O     . PHE A 1 523 ? -40.684 44.508 7.851   1.00 50.23  ? 536  PHE A O     1 
ATOM   3400 C CB    . PHE A 1 523 ? -43.488 45.863 8.158   1.00 53.78  ? 536  PHE A CB    1 
ATOM   3401 C CG    . PHE A 1 523 ? -44.923 46.213 7.900   1.00 57.52  ? 536  PHE A CG    1 
ATOM   3402 C CD1   . PHE A 1 523 ? -45.251 47.175 6.957   1.00 55.13  ? 536  PHE A CD1   1 
ATOM   3403 C CD2   . PHE A 1 523 ? -45.949 45.586 8.597   1.00 62.98  ? 536  PHE A CD2   1 
ATOM   3404 C CE1   . PHE A 1 523 ? -46.572 47.498 6.707   1.00 59.11  ? 536  PHE A CE1   1 
ATOM   3405 C CE2   . PHE A 1 523 ? -47.277 45.912 8.355   1.00 56.21  ? 536  PHE A CE2   1 
ATOM   3406 C CZ    . PHE A 1 523 ? -47.588 46.867 7.408   1.00 54.88  ? 536  PHE A CZ    1 
ATOM   3407 N N     . ASP A 1 524 ? -40.665 46.291 6.481   1.00 57.24  ? 537  ASP A N     1 
ATOM   3408 C CA    . ASP A 1 524 ? -39.252 46.541 6.643   1.00 55.76  ? 537  ASP A CA    1 
ATOM   3409 C C     . ASP A 1 524 ? -39.055 47.943 7.206   1.00 66.66  ? 537  ASP A C     1 
ATOM   3410 O O     . ASP A 1 524 ? -38.961 48.913 6.449   1.00 56.93  ? 537  ASP A O     1 
ATOM   3411 C CB    . ASP A 1 524 ? -38.521 46.378 5.309   1.00 49.33  ? 537  ASP A CB    1 
ATOM   3412 C CG    . ASP A 1 524 ? -37.007 46.362 5.468   1.00 59.89  ? 537  ASP A CG    1 
ATOM   3413 O OD1   . ASP A 1 524 ? -36.483 46.973 6.422   1.00 62.28  ? 537  ASP A OD1   1 
ATOM   3414 O OD2   . ASP A 1 524 ? -36.331 45.740 4.626   1.00 69.04  ? 537  ASP A OD2   1 
ATOM   3415 N N     . PRO A 1 525 ? -39.013 48.059 8.546   1.00 77.86  ? 538  PRO A N     1 
ATOM   3416 C CA    . PRO A 1 525 ? -38.438 49.275 9.093   1.00 71.73  ? 538  PRO A CA    1 
ATOM   3417 C C     . PRO A 1 525 ? -36.987 49.232 8.659   1.00 78.67  ? 538  PRO A C     1 
ATOM   3418 O O     . PRO A 1 525 ? -36.384 48.167 8.673   1.00 110.91 ? 538  PRO A O     1 
ATOM   3419 C CB    . PRO A 1 525 ? -38.589 49.107 10.612  1.00 73.58  ? 538  PRO A CB    1 
ATOM   3420 C CG    . PRO A 1 525 ? -39.392 47.866 10.823  1.00 66.24  ? 538  PRO A CG    1 
ATOM   3421 C CD    . PRO A 1 525 ? -39.242 47.044 9.585   1.00 67.97  ? 538  PRO A CD    1 
ATOM   3422 N N     . ASN A 1 526 ? -36.434 50.353 8.239   1.00 66.85  ? 539  ASN A N     1 
ATOM   3423 C CA    . ASN A 1 526 ? -35.180 50.311 7.497   1.00 65.18  ? 539  ASN A CA    1 
ATOM   3424 C C     . ASN A 1 526 ? -33.978 50.095 8.406   1.00 65.49  ? 539  ASN A C     1 
ATOM   3425 O O     . ASN A 1 526 ? -33.757 50.864 9.338   1.00 76.67  ? 539  ASN A O     1 
ATOM   3426 C CB    . ASN A 1 526 ? -35.027 51.590 6.686   1.00 59.65  ? 539  ASN A CB    1 
ATOM   3427 C CG    . ASN A 1 526 ? -36.277 51.917 5.898   1.00 65.49  ? 539  ASN A CG    1 
ATOM   3428 O OD1   . ASN A 1 526 ? -36.569 51.279 4.889   1.00 75.68  ? 539  ASN A OD1   1 
ATOM   3429 N ND2   . ASN A 1 526 ? -37.031 52.909 6.363   1.00 70.73  ? 539  ASN A ND2   1 
ATOM   3430 N N     . ILE A 1 527 ? -33.225 49.028 8.147   1.00 64.30  ? 540  ILE A N     1 
ATOM   3431 C CA    . ILE A 1 527 ? -31.951 48.791 8.826   1.00 58.32  ? 540  ILE A CA    1 
ATOM   3432 C C     . ILE A 1 527 ? -30.886 49.651 8.153   1.00 56.20  ? 540  ILE A C     1 
ATOM   3433 O O     . ILE A 1 527 ? -30.450 49.358 7.040   1.00 58.23  ? 540  ILE A O     1 
ATOM   3434 C CB    . ILE A 1 527 ? -31.530 47.307 8.769   1.00 60.42  ? 540  ILE A CB    1 
ATOM   3435 C CG1   . ILE A 1 527 ? -32.508 46.456 9.586   1.00 61.96  ? 540  ILE A CG1   1 
ATOM   3436 C CG2   . ILE A 1 527 ? -30.104 47.136 9.278   1.00 64.56  ? 540  ILE A CG2   1 
ATOM   3437 C CD1   . ILE A 1 527 ? -32.157 44.983 9.647   1.00 60.84  ? 540  ILE A CD1   1 
ATOM   3438 N N     . LEU A 1 528 ? -30.473 50.710 8.836   1.00 57.99  ? 541  LEU A N     1 
ATOM   3439 C CA    . LEU A 1 528 ? -29.523 51.666 8.289   1.00 61.57  ? 541  LEU A CA    1 
ATOM   3440 C C     . LEU A 1 528 ? -28.165 51.553 8.968   1.00 65.71  ? 541  LEU A C     1 
ATOM   3441 O O     . LEU A 1 528 ? -28.045 51.014 10.075  1.00 66.35  ? 541  LEU A O     1 
ATOM   3442 C CB    . LEU A 1 528 ? -30.064 53.081 8.457   1.00 66.89  ? 541  LEU A CB    1 
ATOM   3443 C CG    . LEU A 1 528 ? -31.484 53.330 7.948   1.00 64.84  ? 541  LEU A CG    1 
ATOM   3444 C CD1   . LEU A 1 528 ? -31.872 54.767 8.249   1.00 77.24  ? 541  LEU A CD1   1 
ATOM   3445 C CD2   . LEU A 1 528 ? -31.608 53.041 6.462   1.00 62.82  ? 541  LEU A CD2   1 
ATOM   3446 N N     . THR A 1 529 ? -27.148 52.077 8.290   1.00 68.80  ? 542  THR A N     1 
ATOM   3447 C CA    . THR A 1 529 ? -25.770 52.006 8.760   1.00 72.27  ? 542  THR A CA    1 
ATOM   3448 C C     . THR A 1 529 ? -25.610 52.747 10.083  1.00 75.99  ? 542  THR A C     1 
ATOM   3449 O O     . THR A 1 529 ? -26.160 53.836 10.258  1.00 89.66  ? 542  THR A O     1 
ATOM   3450 C CB    . THR A 1 529 ? -24.805 52.636 7.729   1.00 76.48  ? 542  THR A CB    1 
ATOM   3451 O OG1   . THR A 1 529 ? -25.011 52.043 6.440   1.00 75.08  ? 542  THR A OG1   1 
ATOM   3452 C CG2   . THR A 1 529 ? -23.357 52.442 8.144   1.00 73.94  ? 542  THR A CG2   1 
ATOM   3453 N N     . ILE A 1 530 ? -24.872 52.141 11.011  1.00 74.98  ? 543  ILE A N     1 
ATOM   3454 C CA    . ILE A 1 530 ? -24.430 52.820 12.236  1.00 79.36  ? 543  ILE A CA    1 
ATOM   3455 C C     . ILE A 1 530 ? -22.902 52.820 12.269  1.00 76.38  ? 543  ILE A C     1 
ATOM   3456 O O     . ILE A 1 530 ? -22.263 52.267 11.372  1.00 77.01  ? 543  ILE A O     1 
ATOM   3457 C CB    . ILE A 1 530 ? -24.998 52.157 13.514  1.00 77.92  ? 543  ILE A CB    1 
ATOM   3458 C CG1   . ILE A 1 530 ? -24.433 50.741 13.703  1.00 79.52  ? 543  ILE A CG1   1 
ATOM   3459 C CG2   . ILE A 1 530 ? -26.521 52.134 13.464  1.00 74.77  ? 543  ILE A CG2   1 
ATOM   3460 C CD1   . ILE A 1 530 ? -24.907 50.061 14.968  1.00 80.22  ? 543  ILE A CD1   1 
ATOM   3461 N N     . GLY A 1 531 ? -22.325 53.438 13.296  1.00 72.38  ? 544  GLY A N     1 
ATOM   3462 C CA    . GLY A 1 531 ? -20.870 53.496 13.452  1.00 74.85  ? 544  GLY A CA    1 
ATOM   3463 C C     . GLY A 1 531 ? -20.185 54.413 12.452  1.00 80.59  ? 544  GLY A C     1 
ATOM   3464 O O     . GLY A 1 531 ? -18.994 54.258 12.175  1.00 80.30  ? 544  GLY A O     1 
ATOM   3465 N N     . THR A 1 532 ? -20.933 55.379 11.922  1.00 80.84  ? 545  THR A N     1 
ATOM   3466 C CA    . THR A 1 532 ? -20.437 56.255 10.862  1.00 88.07  ? 545  THR A CA    1 
ATOM   3467 C C     . THR A 1 532 ? -19.535 57.376 11.379  1.00 98.58  ? 545  THR A C     1 
ATOM   3468 O O     . THR A 1 532 ? -18.718 57.913 10.628  1.00 107.62 ? 545  THR A O     1 
ATOM   3469 C CB    . THR A 1 532 ? -21.607 56.897 10.091  1.00 93.14  ? 545  THR A CB    1 
ATOM   3470 O OG1   . THR A 1 532 ? -22.468 57.591 11.007  1.00 98.99  ? 545  THR A OG1   1 
ATOM   3471 C CG2   . THR A 1 532 ? -22.405 55.836 9.357   1.00 89.98  ? 545  THR A CG2   1 
ATOM   3472 N N     . GLY A 1 533 ? -19.681 57.718 12.657  1.00 103.74 ? 546  GLY A N     1 
ATOM   3473 C CA    . GLY A 1 533 ? -19.040 58.898 13.229  1.00 99.20  ? 546  GLY A CA    1 
ATOM   3474 C C     . GLY A 1 533 ? -19.929 60.127 13.117  1.00 106.04 ? 546  GLY A C     1 
ATOM   3475 O O     . GLY A 1 533 ? -19.436 61.256 13.062  1.00 101.15 ? 546  GLY A O     1 
ATOM   3476 N N     . MET A 1 534 ? -21.243 59.902 13.077  1.00 103.50 ? 547  MET A N     1 
ATOM   3477 C CA    . MET A 1 534 ? -22.229 60.980 13.051  1.00 107.71 ? 547  MET A CA    1 
ATOM   3478 C C     . MET A 1 534 ? -23.340 60.662 14.049  1.00 97.42  ? 547  MET A C     1 
ATOM   3479 O O     . MET A 1 534 ? -24.102 59.712 13.860  1.00 100.77 ? 547  MET A O     1 
ATOM   3480 C CB    . MET A 1 534 ? -22.805 61.150 11.643  1.00 110.19 ? 547  MET A CB    1 
ATOM   3481 C CG    . MET A 1 534 ? -21.760 61.478 10.585  1.00 112.62 ? 547  MET A CG    1 
ATOM   3482 S SD    . MET A 1 534 ? -22.469 61.903 8.981   1.00 132.29 ? 547  MET A SD    1 
ATOM   3483 C CE    . MET A 1 534 ? -20.990 62.029 7.978   1.00 131.95 ? 547  MET A CE    1 
ATOM   3484 N N     . GLU A 1 535 ? -23.429 61.472 15.102  1.00 97.43  ? 548  GLU A N     1 
ATOM   3485 C CA    . GLU A 1 535 ? -24.344 61.232 16.227  1.00 105.71 ? 548  GLU A CA    1 
ATOM   3486 C C     . GLU A 1 535 ? -25.810 60.990 15.835  1.00 105.78 ? 548  GLU A C     1 
ATOM   3487 O O     . GLU A 1 535 ? -26.552 60.336 16.572  1.00 103.46 ? 548  GLU A O     1 
ATOM   3488 C CB    . GLU A 1 535 ? -24.269 62.400 17.220  1.00 94.44  ? 548  GLU A CB    1 
ATOM   3489 N N     . GLU A 1 536 ? -26.222 61.515 14.683  1.00 98.66  ? 549  GLU A N     1 
ATOM   3490 C CA    . GLU A 1 536 ? -27.590 61.339 14.194  1.00 96.04  ? 549  GLU A CA    1 
ATOM   3491 C C     . GLU A 1 536 ? -27.926 59.858 13.984  1.00 92.12  ? 549  GLU A C     1 
ATOM   3492 O O     . GLU A 1 536 ? -29.039 59.418 14.280  1.00 94.65  ? 549  GLU A O     1 
ATOM   3493 C CB    . GLU A 1 536 ? -27.808 62.118 12.887  1.00 87.26  ? 549  GLU A CB    1 
ATOM   3494 C CG    . GLU A 1 536 ? -27.820 63.638 13.039  1.00 96.12  ? 549  GLU A CG    1 
ATOM   3495 C CD    . GLU A 1 536 ? -26.435 64.259 13.193  1.00 115.42 ? 549  GLU A CD    1 
ATOM   3496 O OE1   . GLU A 1 536 ? -25.423 63.552 12.988  1.00 112.52 ? 549  GLU A OE1   1 
ATOM   3497 O OE2   . GLU A 1 536 ? -26.353 65.463 13.525  1.00 108.44 ? 549  GLU A OE2   1 
ATOM   3498 N N     . HIS A 1 537 ? -26.951 59.089 13.505  1.00 87.23  ? 550  HIS A N     1 
ATOM   3499 C CA    . HIS A 1 537 ? -27.168 57.682 13.158  1.00 86.66  ? 550  HIS A CA    1 
ATOM   3500 C C     . HIS A 1 537 ? -27.088 56.715 14.346  1.00 85.94  ? 550  HIS A C     1 
ATOM   3501 O O     . HIS A 1 537 ? -27.232 55.508 14.162  1.00 79.66  ? 550  HIS A O     1 
ATOM   3502 C CB    . HIS A 1 537 ? -26.150 57.238 12.101  1.00 81.21  ? 550  HIS A CB    1 
ATOM   3503 C CG    . HIS A 1 537 ? -26.123 58.102 10.878  1.00 72.42  ? 550  HIS A CG    1 
ATOM   3504 N ND1   . HIS A 1 537 ? -25.021 58.190 10.056  1.00 78.87  ? 550  HIS A ND1   1 
ATOM   3505 C CD2   . HIS A 1 537 ? -27.059 58.918 10.341  1.00 73.07  ? 550  HIS A CD2   1 
ATOM   3506 C CE1   . HIS A 1 537 ? -25.281 59.018 9.060   1.00 84.60  ? 550  HIS A CE1   1 
ATOM   3507 N NE2   . HIS A 1 537 ? -26.511 59.476 9.211   1.00 78.36  ? 550  HIS A NE2   1 
ATOM   3508 N N     . ASN A 1 538 ? -26.866 57.235 15.552  1.00 93.39  ? 551  ASN A N     1 
ATOM   3509 C CA    . ASN A 1 538 ? -26.568 56.395 16.718  1.00 93.49  ? 551  ASN A CA    1 
ATOM   3510 C C     . ASN A 1 538 ? -27.727 55.514 17.198  1.00 87.48  ? 551  ASN A C     1 
ATOM   3511 O O     . ASN A 1 538 ? -27.506 54.380 17.624  1.00 91.86  ? 551  ASN A O     1 
ATOM   3512 C CB    . ASN A 1 538 ? -26.073 57.263 17.882  1.00 107.15 ? 551  ASN A CB    1 
ATOM   3513 C CG    . ASN A 1 538 ? -24.706 57.883 17.622  1.00 109.14 ? 551  ASN A CG    1 
ATOM   3514 O OD1   . ASN A 1 538 ? -24.089 57.663 16.578  1.00 111.10 ? 551  ASN A OD1   1 
ATOM   3515 N ND2   . ASN A 1 538 ? -24.227 58.666 18.583  1.00 113.23 ? 551  ASN A ND2   1 
ATOM   3516 N N     . LEU A 1 539 ? -28.951 56.033 17.126  1.00 82.03  ? 552  LEU A N     1 
ATOM   3517 C CA    . LEU A 1 539 ? -30.140 55.306 17.596  1.00 79.30  ? 552  LEU A CA    1 
ATOM   3518 C C     . LEU A 1 539 ? -30.761 54.382 16.539  1.00 82.40  ? 552  LEU A C     1 
ATOM   3519 O O     . LEU A 1 539 ? -31.685 53.620 16.841  1.00 78.51  ? 552  LEU A O     1 
ATOM   3520 C CB    . LEU A 1 539 ? -31.198 56.301 18.079  1.00 77.93  ? 552  LEU A CB    1 
ATOM   3521 C CG    . LEU A 1 539 ? -30.844 57.068 19.355  1.00 74.99  ? 552  LEU A CG    1 
ATOM   3522 C CD1   . LEU A 1 539 ? -31.627 58.369 19.432  1.00 72.50  ? 552  LEU A CD1   1 
ATOM   3523 C CD2   . LEU A 1 539 ? -31.094 56.208 20.586  1.00 73.89  ? 552  LEU A CD2   1 
ATOM   3524 N N     . TYR A 1 540 ? -30.246 54.447 15.313  1.00 72.31  ? 553  TYR A N     1 
ATOM   3525 C CA    . TYR A 1 540 ? -30.826 53.742 14.170  1.00 71.81  ? 553  TYR A CA    1 
ATOM   3526 C C     . TYR A 1 540 ? -31.116 52.261 14.432  1.00 77.13  ? 553  TYR A C     1 
ATOM   3527 O O     . TYR A 1 540 ? -32.239 51.803 14.205  1.00 75.08  ? 553  TYR A O     1 
ATOM   3528 C CB    . TYR A 1 540 ? -29.921 53.922 12.941  1.00 72.57  ? 553  TYR A CB    1 
ATOM   3529 C CG    . TYR A 1 540 ? -30.063 55.272 12.244  1.00 76.19  ? 553  TYR A CG    1 
ATOM   3530 C CD1   . TYR A 1 540 ? -30.765 56.335 12.833  1.00 79.00  ? 553  TYR A CD1   1 
ATOM   3531 C CD2   . TYR A 1 540 ? -29.481 55.492 10.999  1.00 78.29  ? 553  TYR A CD2   1 
ATOM   3532 C CE1   . TYR A 1 540 ? -30.892 57.555 12.192  1.00 79.80  ? 553  TYR A CE1   1 
ATOM   3533 C CE2   . TYR A 1 540 ? -29.605 56.715 10.352  1.00 88.14  ? 553  TYR A CE2   1 
ATOM   3534 C CZ    . TYR A 1 540 ? -30.311 57.741 10.953  1.00 84.62  ? 553  TYR A CZ    1 
ATOM   3535 O OH    . TYR A 1 540 ? -30.437 58.956 10.319  1.00 86.07  ? 553  TYR A OH    1 
ATOM   3536 N N     . ALA A 1 541 ? -30.122 51.521 14.917  1.00 80.95  ? 554  ALA A N     1 
ATOM   3537 C CA    . ALA A 1 541 ? -30.318 50.107 15.252  1.00 76.43  ? 554  ALA A CA    1 
ATOM   3538 C C     . ALA A 1 541 ? -31.426 49.948 16.291  1.00 80.48  ? 554  ALA A C     1 
ATOM   3539 O O     . ALA A 1 541 ? -32.373 49.185 16.082  1.00 73.52  ? 554  ALA A O     1 
ATOM   3540 C CB    . ALA A 1 541 ? -29.023 49.482 15.758  1.00 76.34  ? 554  ALA A CB    1 
ATOM   3541 N N     . ILE A 1 542 ? -31.312 50.681 17.400  1.00 70.39  ? 555  ILE A N     1 
ATOM   3542 C CA    . ILE A 1 542 ? -32.305 50.604 18.470  1.00 72.16  ? 555  ILE A CA    1 
ATOM   3543 C C     . ILE A 1 542 ? -33.710 50.882 17.930  1.00 77.38  ? 555  ILE A C     1 
ATOM   3544 O O     . ILE A 1 542 ? -34.647 50.123 18.204  1.00 70.82  ? 555  ILE A O     1 
ATOM   3545 C CB    . ILE A 1 542 ? -31.991 51.580 19.625  1.00 73.04  ? 555  ILE A CB    1 
ATOM   3546 N N     . ASN A 1 543 ? -33.849 51.947 17.141  1.00 69.38  ? 556  ASN A N     1 
ATOM   3547 C CA    . ASN A 1 543 ? -35.153 52.307 16.576  1.00 75.69  ? 556  ASN A CA    1 
ATOM   3548 C C     . ASN A 1 543 ? -35.777 51.154 15.791  1.00 81.37  ? 556  ASN A C     1 
ATOM   3549 O O     . ASN A 1 543 ? -36.984 50.920 15.877  1.00 84.01  ? 556  ASN A O     1 
ATOM   3550 C CB    . ASN A 1 543 ? -35.058 53.547 15.680  1.00 69.63  ? 556  ASN A CB    1 
ATOM   3551 C CG    . ASN A 1 543 ? -34.609 54.791 16.431  1.00 78.74  ? 556  ASN A CG    1 
ATOM   3552 O OD1   . ASN A 1 543 ? -34.619 54.837 17.664  1.00 79.27  ? 556  ASN A OD1   1 
ATOM   3553 N ND2   . ASN A 1 543 ? -34.207 55.812 15.682  1.00 74.71  ? 556  ASN A ND2   1 
ATOM   3554 N N     . PHE A 1 544 ? -34.952 50.430 15.038  1.00 73.48  ? 557  PHE A N     1 
ATOM   3555 C CA    . PHE A 1 544 ? -35.434 49.287 14.269  1.00 69.99  ? 557  PHE A CA    1 
ATOM   3556 C C     . PHE A 1 544 ? -35.939 48.179 15.190  1.00 67.94  ? 557  PHE A C     1 
ATOM   3557 O O     . PHE A 1 544 ? -36.979 47.573 14.923  1.00 62.01  ? 557  PHE A O     1 
ATOM   3558 C CB    . PHE A 1 544 ? -34.342 48.748 13.337  1.00 68.14  ? 557  PHE A CB    1 
ATOM   3559 C CG    . PHE A 1 544 ? -34.724 47.475 12.633  1.00 73.29  ? 557  PHE A CG    1 
ATOM   3560 C CD1   . PHE A 1 544 ? -34.491 46.242 13.228  1.00 70.91  ? 557  PHE A CD1   1 
ATOM   3561 C CD2   . PHE A 1 544 ? -35.325 47.504 11.387  1.00 65.76  ? 557  PHE A CD2   1 
ATOM   3562 C CE1   . PHE A 1 544 ? -34.844 45.067 12.593  1.00 62.47  ? 557  PHE A CE1   1 
ATOM   3563 C CE2   . PHE A 1 544 ? -35.683 46.326 10.748  1.00 66.82  ? 557  PHE A CE2   1 
ATOM   3564 C CZ    . PHE A 1 544 ? -35.442 45.108 11.354  1.00 62.08  ? 557  PHE A CZ    1 
ATOM   3565 N N     . ILE A 1 545 ? -35.206 47.924 16.272  1.00 71.83  ? 558  ILE A N     1 
ATOM   3566 C CA    . ILE A 1 545 ? -35.582 46.878 17.226  1.00 65.96  ? 558  ILE A CA    1 
ATOM   3567 C C     . ILE A 1 545 ? -36.817 47.291 18.024  1.00 68.69  ? 558  ILE A C     1 
ATOM   3568 O O     . ILE A 1 545 ? -37.716 46.481 18.241  1.00 74.30  ? 558  ILE A O     1 
ATOM   3569 C CB    . ILE A 1 545 ? -34.435 46.543 18.199  1.00 65.70  ? 558  ILE A CB    1 
ATOM   3570 C CG1   . ILE A 1 545 ? -33.197 46.061 17.434  1.00 72.86  ? 558  ILE A CG1   1 
ATOM   3571 C CG2   . ILE A 1 545 ? -34.869 45.456 19.168  1.00 67.98  ? 558  ILE A CG2   1 
ATOM   3572 C CD1   . ILE A 1 545 ? -31.915 46.128 18.236  1.00 75.51  ? 558  ILE A CD1   1 
ATOM   3573 N N     . HIS A 1 546 ? -36.854 48.547 18.464  1.00 73.52  ? 559  HIS A N     1 
ATOM   3574 C CA    . HIS A 1 546 ? -38.022 49.079 19.167  1.00 77.52  ? 559  HIS A CA    1 
ATOM   3575 C C     . HIS A 1 546 ? -39.260 49.065 18.276  1.00 68.53  ? 559  HIS A C     1 
ATOM   3576 O O     . HIS A 1 546 ? -40.347 48.703 18.720  1.00 88.31  ? 559  HIS A O     1 
ATOM   3577 C CB    . HIS A 1 546 ? -37.775 50.511 19.645  1.00 84.98  ? 559  HIS A CB    1 
ATOM   3578 C CG    . HIS A 1 546 ? -36.780 50.620 20.757  1.00 92.13  ? 559  HIS A CG    1 
ATOM   3579 N ND1   . HIS A 1 546 ? -36.897 49.912 21.933  1.00 91.71  ? 559  HIS A ND1   1 
ATOM   3580 C CD2   . HIS A 1 546 ? -35.664 51.377 20.884  1.00 97.32  ? 559  HIS A CD2   1 
ATOM   3581 C CE1   . HIS A 1 546 ? -35.889 50.216 22.730  1.00 94.55  ? 559  HIS A CE1   1 
ATOM   3582 N NE2   . HIS A 1 546 ? -35.127 51.104 22.117  1.00 86.38  ? 559  HIS A NE2   1 
ATOM   3583 N N     . ALA A 1 547 ? -39.090 49.467 17.020  1.00 71.99  ? 560  ALA A N     1 
ATOM   3584 C CA    . ALA A 1 547 ? -40.203 49.528 16.076  1.00 68.59  ? 560  ALA A CA    1 
ATOM   3585 C C     . ALA A 1 547 ? -40.724 48.130 15.763  1.00 72.13  ? 560  ALA A C     1 
ATOM   3586 O O     . ALA A 1 547 ? -41.923 47.929 15.571  1.00 76.81  ? 560  ALA A O     1 
ATOM   3587 C CB    . ALA A 1 547 ? -39.773 50.234 14.802  1.00 69.78  ? 560  ALA A CB    1 
ATOM   3588 N N     . THR A 1 548 ? -39.807 47.169 15.724  1.00 72.91  ? 561  THR A N     1 
ATOM   3589 C CA    . THR A 1 548 ? -40.147 45.770 15.503  1.00 66.06  ? 561  THR A CA    1 
ATOM   3590 C C     . THR A 1 548 ? -41.072 45.234 16.597  1.00 65.52  ? 561  THR A C     1 
ATOM   3591 O O     . THR A 1 548 ? -42.024 44.509 16.303  1.00 66.84  ? 561  THR A O     1 
ATOM   3592 C CB    . THR A 1 548 ? -38.862 44.922 15.402  1.00 73.60  ? 561  THR A CB    1 
ATOM   3593 O OG1   . THR A 1 548 ? -38.098 45.364 14.270  1.00 72.48  ? 561  THR A OG1   1 
ATOM   3594 C CG2   . THR A 1 548 ? -39.173 43.433 15.256  1.00 77.45  ? 561  THR A CG2   1 
ATOM   3595 N N     . LYS A 1 549 ? -40.801 45.606 17.847  1.00 69.35  ? 562  LYS A N     1 
ATOM   3596 C CA    . LYS A 1 549 ? -41.637 45.206 18.982  1.00 72.15  ? 562  LYS A CA    1 
ATOM   3597 C C     . LYS A 1 549 ? -43.063 45.743 18.845  1.00 70.69  ? 562  LYS A C     1 
ATOM   3598 O O     . LYS A 1 549 ? -44.032 44.983 18.938  1.00 63.58  ? 562  LYS A O     1 
ATOM   3599 C CB    . LYS A 1 549 ? -41.020 45.697 20.298  1.00 80.23  ? 562  LYS A CB    1 
ATOM   3600 C CG    . LYS A 1 549 ? -41.809 45.354 21.560  1.00 88.83  ? 562  LYS A CG    1 
ATOM   3601 C CD    . LYS A 1 549 ? -41.556 43.931 22.038  1.00 98.05  ? 562  LYS A CD    1 
ATOM   3602 C CE    . LYS A 1 549 ? -40.284 43.817 22.870  1.00 106.18 ? 562  LYS A CE    1 
ATOM   3603 N NZ    . LYS A 1 549 ? -40.396 44.465 24.210  1.00 112.06 ? 562  LYS A NZ    1 
ATOM   3604 N N     . VAL A 1 550 ? -43.184 47.050 18.628  1.00 64.72  ? 563  VAL A N     1 
ATOM   3605 C CA    . VAL A 1 550 ? -44.497 47.701 18.591  1.00 69.42  ? 563  VAL A CA    1 
ATOM   3606 C C     . VAL A 1 550 ? -45.325 47.218 17.398  1.00 65.72  ? 563  VAL A C     1 
ATOM   3607 O O     . VAL A 1 550 ? -46.542 47.085 17.500  1.00 77.76  ? 563  VAL A O     1 
ATOM   3608 C CB    . VAL A 1 550 ? -44.384 49.250 18.580  1.00 53.14  ? 563  VAL A CB    1 
ATOM   3609 N N     . ILE A 1 551 ? -44.658 46.953 16.278  1.00 64.73  ? 564  ILE A N     1 
ATOM   3610 C CA    . ILE A 1 551 ? -45.320 46.455 15.069  1.00 63.32  ? 564  ILE A CA    1 
ATOM   3611 C C     . ILE A 1 551 ? -45.798 45.011 15.244  1.00 65.60  ? 564  ILE A C     1 
ATOM   3612 O O     . ILE A 1 551 ? -46.885 44.652 14.783  1.00 74.04  ? 564  ILE A O     1 
ATOM   3613 C CB    . ILE A 1 551 ? -44.385 46.556 13.841  1.00 61.89  ? 564  ILE A CB    1 
ATOM   3614 C CG1   . ILE A 1 551 ? -44.234 48.022 13.429  1.00 64.05  ? 564  ILE A CG1   1 
ATOM   3615 C CG2   . ILE A 1 551 ? -44.916 45.736 12.667  1.00 62.46  ? 564  ILE A CG2   1 
ATOM   3616 C CD1   . ILE A 1 551 ? -43.052 48.294 12.522  1.00 69.50  ? 564  ILE A CD1   1 
ATOM   3617 N N     . LYS A 1 552 ? -44.982 44.188 15.896  1.00 63.79  ? 565  LYS A N     1 
ATOM   3618 C CA    . LYS A 1 552 ? -45.347 42.800 16.168  1.00 66.32  ? 565  LYS A CA    1 
ATOM   3619 C C     . LYS A 1 552 ? -46.522 42.709 17.144  1.00 68.69  ? 565  LYS A C     1 
ATOM   3620 O O     . LYS A 1 552 ? -47.259 41.724 17.132  1.00 76.64  ? 565  LYS A O     1 
ATOM   3621 C CB    . LYS A 1 552 ? -44.146 42.027 16.714  1.00 71.05  ? 565  LYS A CB    1 
ATOM   3622 N N     . GLU A 1 553 ? -46.685 43.737 17.979  1.00 72.50  ? 566  GLU A N     1 
ATOM   3623 C CA    . GLU A 1 553 ? -47.781 43.813 18.948  1.00 71.11  ? 566  GLU A CA    1 
ATOM   3624 C C     . GLU A 1 553 ? -48.987 44.578 18.413  1.00 74.17  ? 566  GLU A C     1 
ATOM   3625 O O     . GLU A 1 553 ? -50.123 44.283 18.784  1.00 93.20  ? 566  GLU A O     1 
ATOM   3626 C CB    . GLU A 1 553 ? -47.299 44.486 20.234  1.00 72.51  ? 566  GLU A CB    1 
ATOM   3627 N N     . THR A 1 554 ? -48.735 45.562 17.554  1.00 80.65  ? 567  THR A N     1 
ATOM   3628 C CA    . THR A 1 554 ? -49.778 46.453 17.043  1.00 71.02  ? 567  THR A CA    1 
ATOM   3629 C C     . THR A 1 554 ? -50.557 45.850 15.876  1.00 72.62  ? 567  THR A C     1 
ATOM   3630 O O     . THR A 1 554 ? -51.782 45.963 15.813  1.00 80.69  ? 567  THR A O     1 
ATOM   3631 C CB    . THR A 1 554 ? -49.173 47.781 16.550  1.00 58.86  ? 567  THR A CB    1 
ATOM   3632 N N     . LEU A 1 555 ? -49.837 45.210 14.959  1.00 72.02  ? 568  LEU A N     1 
ATOM   3633 C CA    . LEU A 1 555 ? -50.376 44.833 13.657  1.00 65.47  ? 568  LEU A CA    1 
ATOM   3634 C C     . LEU A 1 555 ? -50.405 43.309 13.498  1.00 67.09  ? 568  LEU A C     1 
ATOM   3635 O O     . LEU A 1 555 ? -49.407 42.702 13.100  1.00 68.21  ? 568  LEU A O     1 
ATOM   3636 C CB    . LEU A 1 555 ? -49.525 45.481 12.561  1.00 57.32  ? 568  LEU A CB    1 
ATOM   3637 C CG    . LEU A 1 555 ? -49.256 46.974 12.779  1.00 60.86  ? 568  LEU A CG    1 
ATOM   3638 C CD1   . LEU A 1 555 ? -48.285 47.535 11.751  1.00 60.18  ? 568  LEU A CD1   1 
ATOM   3639 C CD2   . LEU A 1 555 ? -50.560 47.761 12.768  1.00 65.17  ? 568  LEU A CD2   1 
ATOM   3640 N N     . PRO A 1 556 ? -51.552 42.680 13.810  1.00 70.38  ? 569  PRO A N     1 
ATOM   3641 C CA    . PRO A 1 556 ? -51.585 41.214 13.802  1.00 70.23  ? 569  PRO A CA    1 
ATOM   3642 C C     . PRO A 1 556 ? -51.423 40.611 12.405  1.00 64.84  ? 569  PRO A C     1 
ATOM   3643 O O     . PRO A 1 556 ? -52.010 41.103 11.447  1.00 72.21  ? 569  PRO A O     1 
ATOM   3644 C CB    . PRO A 1 556 ? -52.965 40.884 14.389  1.00 65.17  ? 569  PRO A CB    1 
ATOM   3645 C CG    . PRO A 1 556 ? -53.797 42.088 14.125  1.00 72.43  ? 569  PRO A CG    1 
ATOM   3646 C CD    . PRO A 1 556 ? -52.861 43.264 14.160  1.00 73.67  ? 569  PRO A CD    1 
ATOM   3647 N N     . GLY A 1 557 ? -50.618 39.557 12.307  1.00 67.52  ? 570  GLY A N     1 
ATOM   3648 C CA    . GLY A 1 557 ? -50.418 38.837 11.053  1.00 60.05  ? 570  GLY A CA    1 
ATOM   3649 C C     . GLY A 1 557 ? -49.126 39.214 10.358  1.00 55.78  ? 570  GLY A C     1 
ATOM   3650 O O     . GLY A 1 557 ? -48.382 38.347 9.912   1.00 65.46  ? 570  GLY A O     1 
ATOM   3651 N N     . ALA A 1 558 ? -48.858 40.511 10.262  1.00 57.09  ? 571  ALA A N     1 
ATOM   3652 C CA    . ALA A 1 558 ? -47.674 41.006 9.558   1.00 59.05  ? 571  ALA A CA    1 
ATOM   3653 C C     . ALA A 1 558 ? -46.398 40.468 10.172  1.00 52.76  ? 571  ALA A C     1 
ATOM   3654 O O     . ALA A 1 558 ? -46.374 40.101 11.336  1.00 59.95  ? 571  ALA A O     1 
ATOM   3655 C CB    . ALA A 1 558 ? -47.650 42.527 9.565   1.00 64.52  ? 571  ALA A CB    1 
ATOM   3656 N N     . ARG A 1 559 ? -45.340 40.419 9.375   1.00 62.99  ? 572  ARG A N     1 
ATOM   3657 C CA    . ARG A 1 559 ? -44.038 39.961 9.845   1.00 63.70  ? 572  ARG A CA    1 
ATOM   3658 C C     . ARG A 1 559 ? -42.997 41.031 9.587   1.00 61.69  ? 572  ARG A C     1 
ATOM   3659 O O     . ARG A 1 559 ? -43.280 42.032 8.933   1.00 55.30  ? 572  ARG A O     1 
ATOM   3660 C CB    . ARG A 1 559 ? -43.667 38.641 9.167   1.00 65.97  ? 572  ARG A CB    1 
ATOM   3661 C CG    . ARG A 1 559 ? -44.401 37.458 9.784   1.00 70.56  ? 572  ARG A CG    1 
ATOM   3662 C CD    . ARG A 1 559 ? -44.388 36.228 8.898   1.00 65.12  ? 572  ARG A CD    1 
ATOM   3663 N NE    . ARG A 1 559 ? -45.085 35.106 9.523   1.00 62.07  ? 572  ARG A NE    1 
ATOM   3664 C CZ    . ARG A 1 559 ? -46.409 34.973 9.603   1.00 64.59  ? 572  ARG A CZ    1 
ATOM   3665 N NH1   . ARG A 1 559 ? -47.229 35.893 9.103   1.00 72.19  ? 572  ARG A NH1   1 
ATOM   3666 N NH2   . ARG A 1 559 ? -46.923 33.901 10.187  1.00 68.22  ? 572  ARG A NH2   1 
ATOM   3667 N N     . ILE A 1 560 ? -41.798 40.825 10.121  1.00 71.40  ? 573  ILE A N     1 
ATOM   3668 C CA    . ILE A 1 560 ? -40.741 41.825 10.034  1.00 65.89  ? 573  ILE A CA    1 
ATOM   3669 C C     . ILE A 1 560 ? -39.501 41.272 9.361   1.00 60.57  ? 573  ILE A C     1 
ATOM   3670 O O     . ILE A 1 560 ? -39.021 40.186 9.708   1.00 45.34  ? 573  ILE A O     1 
ATOM   3671 C CB    . ILE A 1 560 ? -40.347 42.344 11.425  1.00 71.83  ? 573  ILE A CB    1 
ATOM   3672 C CG1   . ILE A 1 560 ? -41.546 43.024 12.095  1.00 74.39  ? 573  ILE A CG1   1 
ATOM   3673 C CG2   . ILE A 1 560 ? -39.160 43.298 11.324  1.00 71.05  ? 573  ILE A CG2   1 
ATOM   3674 C CD1   . ILE A 1 560 ? -42.045 44.261 11.375  1.00 69.08  ? 573  ILE A CD1   1 
ATOM   3675 N N     . SER A 1 561 ? -38.985 42.051 8.411   1.00 59.40  ? 574  SER A N     1 
ATOM   3676 C CA    . SER A 1 561 ? -37.749 41.735 7.706   1.00 62.10  ? 574  SER A CA    1 
ATOM   3677 C C     . SER A 1 561 ? -36.810 42.940 7.683   1.00 63.15  ? 574  SER A C     1 
ATOM   3678 O O     . SER A 1 561 ? -37.189 44.050 8.054   1.00 56.88  ? 574  SER A O     1 
ATOM   3679 C CB    . SER A 1 561 ? -38.060 41.308 6.271   1.00 58.95  ? 574  SER A CB    1 
ATOM   3680 O OG    . SER A 1 561 ? -36.896 40.828 5.621   1.00 61.54  ? 574  SER A OG    1 
ATOM   3681 N N     . GLY A 1 562 ? -35.584 42.712 7.227   1.00 66.48  ? 575  GLY A N     1 
ATOM   3682 C CA    . GLY A 1 562 ? -34.606 43.780 7.092   1.00 58.51  ? 575  GLY A CA    1 
ATOM   3683 C C     . GLY A 1 562 ? -33.343 43.315 6.395   1.00 58.59  ? 575  GLY A C     1 
ATOM   3684 O O     . GLY A 1 562 ? -32.937 42.161 6.535   1.00 71.05  ? 575  GLY A O     1 
ATOM   3685 N N     . GLY A 1 563 ? -32.729 44.215 5.634   1.00 61.97  ? 576  GLY A N     1 
ATOM   3686 C CA    . GLY A 1 563 ? -31.443 43.948 4.999   1.00 61.49  ? 576  GLY A CA    1 
ATOM   3687 C C     . GLY A 1 563 ? -30.349 44.136 6.024   1.00 62.00  ? 576  GLY A C     1 
ATOM   3688 O O     . GLY A 1 563 ? -29.974 45.268 6.338   1.00 70.75  ? 576  GLY A O     1 
ATOM   3689 N N     . LEU A 1 564 ? -29.838 43.025 6.547   1.00 60.45  ? 577  LEU A N     1 
ATOM   3690 C CA    . LEU A 1 564 ? -28.969 43.059 7.725   1.00 63.96  ? 577  LEU A CA    1 
ATOM   3691 C C     . LEU A 1 564 ? -27.605 43.682 7.462   1.00 63.11  ? 577  LEU A C     1 
ATOM   3692 O O     . LEU A 1 564 ? -27.128 44.485 8.263   1.00 69.94  ? 577  LEU A O     1 
ATOM   3693 C CB    . LEU A 1 564 ? -28.786 41.652 8.290   1.00 59.28  ? 577  LEU A CB    1 
ATOM   3694 C CG    . LEU A 1 564 ? -28.035 41.531 9.615   1.00 62.58  ? 577  LEU A CG    1 
ATOM   3695 C CD1   . LEU A 1 564 ? -28.615 42.453 10.678  1.00 66.80  ? 577  LEU A CD1   1 
ATOM   3696 C CD2   . LEU A 1 564 ? -28.073 40.083 10.078  1.00 71.08  ? 577  LEU A CD2   1 
ATOM   3697 N N     . SER A 1 565 ? -26.986 43.327 6.339   1.00 63.80  ? 578  SER A N     1 
ATOM   3698 C CA    . SER A 1 565 ? -25.635 43.803 6.024   1.00 63.37  ? 578  SER A CA    1 
ATOM   3699 C C     . SER A 1 565 ? -25.523 45.325 5.833   1.00 68.53  ? 578  SER A C     1 
ATOM   3700 O O     . SER A 1 565 ? -24.417 45.857 5.795   1.00 84.23  ? 578  SER A O     1 
ATOM   3701 C CB    . SER A 1 565 ? -25.089 43.080 4.795   1.00 65.52  ? 578  SER A CB    1 
ATOM   3702 O OG    . SER A 1 565 ? -24.989 41.687 5.032   1.00 71.52  ? 578  SER A OG    1 
ATOM   3703 N N     . ASN A 1 566 ? -26.656 46.018 5.716   1.00 70.05  ? 579  ASN A N     1 
ATOM   3704 C CA    . ASN A 1 566 ? -26.670 47.483 5.684   1.00 70.63  ? 579  ASN A CA    1 
ATOM   3705 C C     . ASN A 1 566 ? -26.134 48.089 6.982   1.00 77.80  ? 579  ASN A C     1 
ATOM   3706 O O     . ASN A 1 566 ? -25.547 49.173 6.976   1.00 81.72  ? 579  ASN A O     1 
ATOM   3707 C CB    . ASN A 1 566 ? -28.090 48.007 5.451   1.00 69.26  ? 579  ASN A CB    1 
ATOM   3708 C CG    . ASN A 1 566 ? -28.645 47.623 4.094   1.00 64.75  ? 579  ASN A CG    1 
ATOM   3709 O OD1   . ASN A 1 566 ? -29.668 46.947 4.001   1.00 65.72  ? 579  ASN A OD1   1 
ATOM   3710 N ND2   . ASN A 1 566 ? -27.980 48.058 3.036   1.00 64.01  ? 579  ASN A ND2   1 
ATOM   3711 N N     . LEU A 1 567 ? -26.354 47.385 8.090   1.00 74.00  ? 580  LEU A N     1 
ATOM   3712 C CA    . LEU A 1 567 ? -25.936 47.845 9.414   1.00 73.05  ? 580  LEU A CA    1 
ATOM   3713 C C     . LEU A 1 567 ? -24.436 48.126 9.478   1.00 69.22  ? 580  LEU A C     1 
ATOM   3714 O O     . LEU A 1 567 ? -24.009 49.074 10.129  1.00 61.18  ? 580  LEU A O     1 
ATOM   3715 C CB    . LEU A 1 567 ? -26.309 46.796 10.473  1.00 70.45  ? 580  LEU A CB    1 
ATOM   3716 C CG    . LEU A 1 567 ? -26.079 47.130 11.957  1.00 70.95  ? 580  LEU A CG    1 
ATOM   3717 C CD1   . LEU A 1 567 ? -27.170 48.046 12.489  1.00 64.72  ? 580  LEU A CD1   1 
ATOM   3718 C CD2   . LEU A 1 567 ? -26.019 45.857 12.791  1.00 67.50  ? 580  LEU A CD2   1 
ATOM   3719 N N     . SER A 1 568 ? -23.647 47.311 8.784   1.00 75.08  ? 581  SER A N     1 
ATOM   3720 C CA    . SER A 1 568 ? -22.203 47.258 9.001   1.00 74.46  ? 581  SER A CA    1 
ATOM   3721 C C     . SER A 1 568 ? -21.356 47.746 7.819   1.00 75.24  ? 581  SER A C     1 
ATOM   3722 O O     . SER A 1 568 ? -20.220 47.304 7.649   1.00 82.91  ? 581  SER A O     1 
ATOM   3723 C CB    . SER A 1 568 ? -21.820 45.823 9.367   1.00 73.14  ? 581  SER A CB    1 
ATOM   3724 O OG    . SER A 1 568 ? -22.274 44.915 8.375   1.00 72.47  ? 581  SER A OG    1 
ATOM   3725 N N     . PHE A 1 569 ? -21.893 48.665 7.016   1.00 76.56  ? 582  PHE A N     1 
ATOM   3726 C CA    . PHE A 1 569 ? -21.098 49.331 5.974   1.00 74.45  ? 582  PHE A CA    1 
ATOM   3727 C C     . PHE A 1 569 ? -19.963 50.165 6.573   1.00 80.81  ? 582  PHE A C     1 
ATOM   3728 O O     . PHE A 1 569 ? -18.972 50.437 5.898   1.00 75.45  ? 582  PHE A O     1 
ATOM   3729 C CB    . PHE A 1 569 ? -21.958 50.274 5.120   1.00 75.26  ? 582  PHE A CB    1 
ATOM   3730 C CG    . PHE A 1 569 ? -22.866 49.586 4.135   1.00 77.98  ? 582  PHE A CG    1 
ATOM   3731 C CD1   . PHE A 1 569 ? -22.468 48.447 3.442   1.00 81.75  ? 582  PHE A CD1   1 
ATOM   3732 C CD2   . PHE A 1 569 ? -24.114 50.129 3.853   1.00 84.05  ? 582  PHE A CD2   1 
ATOM   3733 C CE1   . PHE A 1 569 ? -23.313 47.846 2.523   1.00 83.37  ? 582  PHE A CE1   1 
ATOM   3734 C CE2   . PHE A 1 569 ? -24.958 49.535 2.933   1.00 80.65  ? 582  PHE A CE2   1 
ATOM   3735 C CZ    . PHE A 1 569 ? -24.558 48.392 2.267   1.00 81.87  ? 582  PHE A CZ    1 
ATOM   3736 N N     . SER A 1 570 ? -20.119 50.596 7.824   1.00 75.38  ? 583  SER A N     1 
ATOM   3737 C CA    . SER A 1 570 ? -19.110 51.421 8.478   1.00 78.70  ? 583  SER A CA    1 
ATOM   3738 C C     . SER A 1 570 ? -17.800 50.678 8.732   1.00 79.97  ? 583  SER A C     1 
ATOM   3739 O O     . SER A 1 570 ? -16.751 51.307 8.841   1.00 80.76  ? 583  SER A O     1 
ATOM   3740 C CB    . SER A 1 570 ? -19.646 51.981 9.795   1.00 86.88  ? 583  SER A CB    1 
ATOM   3741 O OG    . SER A 1 570 ? -20.631 52.969 9.560   1.00 86.08  ? 583  SER A OG    1 
ATOM   3742 N N     . PHE A 1 571 ? -17.862 49.351 8.831   1.00 83.13  ? 584  PHE A N     1 
ATOM   3743 C CA    . PHE A 1 571 ? -16.670 48.540 9.064   1.00 82.88  ? 584  PHE A CA    1 
ATOM   3744 C C     . PHE A 1 571 ? -16.459 47.530 7.942   1.00 79.85  ? 584  PHE A C     1 
ATOM   3745 O O     . PHE A 1 571 ? -16.324 46.335 8.200   1.00 82.36  ? 584  PHE A O     1 
ATOM   3746 C CB    . PHE A 1 571 ? -16.765 47.822 10.416  1.00 80.20  ? 584  PHE A CB    1 
ATOM   3747 N N     . ARG A 1 572 ? -16.418 48.014 6.699   1.00 81.08  ? 585  ARG A N     1 
ATOM   3748 C CA    . ARG A 1 572 ? -16.068 47.156 5.559   1.00 82.96  ? 585  ARG A CA    1 
ATOM   3749 C C     . ARG A 1 572 ? -14.597 46.786 5.679   1.00 85.23  ? 585  ARG A C     1 
ATOM   3750 O O     . ARG A 1 572 ? -13.803 47.567 6.197   1.00 83.26  ? 585  ARG A O     1 
ATOM   3751 C CB    . ARG A 1 572 ? -16.307 47.846 4.212   1.00 81.03  ? 585  ARG A CB    1 
ATOM   3752 C CG    . ARG A 1 572 ? -17.623 48.585 4.097   1.00 83.80  ? 585  ARG A CG    1 
ATOM   3753 C CD    . ARG A 1 572 ? -18.110 48.683 2.661   1.00 89.40  ? 585  ARG A CD    1 
ATOM   3754 N NE    . ARG A 1 572 ? -19.289 49.542 2.549   1.00 91.75  ? 585  ARG A NE    1 
ATOM   3755 C CZ    . ARG A 1 572 ? -20.003 49.718 1.440   1.00 91.42  ? 585  ARG A CZ    1 
ATOM   3756 N NH1   . ARG A 1 572 ? -19.682 49.087 0.314   1.00 108.43 ? 585  ARG A NH1   1 
ATOM   3757 N NH2   . ARG A 1 572 ? -21.053 50.529 1.457   1.00 101.11 ? 585  ARG A NH2   1 
ATOM   3758 N N     . GLY A 1 573 ? -14.243 45.601 5.191   1.00 89.52  ? 586  GLY A N     1 
ATOM   3759 C CA    . GLY A 1 573 ? -12.892 45.069 5.340   1.00 94.14  ? 586  GLY A CA    1 
ATOM   3760 C C     . GLY A 1 573 ? -12.834 44.146 6.538   1.00 96.72  ? 586  GLY A C     1 
ATOM   3761 O O     . GLY A 1 573 ? -12.548 42.955 6.404   1.00 105.39 ? 586  GLY A O     1 
ATOM   3762 N N     . MET A 1 574 ? -13.119 44.700 7.713   1.00 96.89  ? 587  MET A N     1 
ATOM   3763 C CA    . MET A 1 574 ? -13.194 43.918 8.944   1.00 101.62 ? 587  MET A CA    1 
ATOM   3764 C C     . MET A 1 574 ? -14.452 43.046 8.938   1.00 94.85  ? 587  MET A C     1 
ATOM   3765 O O     . MET A 1 574 ? -15.453 43.379 9.571   1.00 97.30  ? 587  MET A O     1 
ATOM   3766 C CB    . MET A 1 574 ? -13.193 44.846 10.165  1.00 92.61  ? 587  MET A CB    1 
ATOM   3767 N N     . GLU A 1 575 ? -14.387 41.929 8.218   1.00 95.18  ? 588  GLU A N     1 
ATOM   3768 C CA    . GLU A 1 575 ? -15.530 41.019 8.092   1.00 93.27  ? 588  GLU A CA    1 
ATOM   3769 C C     . GLU A 1 575 ? -15.920 40.368 9.420   1.00 97.37  ? 588  GLU A C     1 
ATOM   3770 O O     . GLU A 1 575 ? -17.110 40.236 9.715   1.00 103.22 ? 588  GLU A O     1 
ATOM   3771 C CB    . GLU A 1 575 ? -15.254 39.935 7.041   1.00 85.85  ? 588  GLU A CB    1 
ATOM   3772 C CG    . GLU A 1 575 ? -15.537 40.371 5.609   1.00 97.29  ? 588  GLU A CG    1 
ATOM   3773 C CD    . GLU A 1 575 ? -17.020 40.573 5.325   1.00 105.06 ? 588  GLU A CD    1 
ATOM   3774 O OE1   . GLU A 1 575 ? -17.838 39.701 5.697   1.00 95.21  ? 588  GLU A OE1   1 
ATOM   3775 O OE2   . GLU A 1 575 ? -17.372 41.609 4.720   1.00 115.22 ? 588  GLU A OE2   1 
ATOM   3776 N N     . ALA A 1 576 ? -14.927 39.970 10.214  1.00 86.55  ? 589  ALA A N     1 
ATOM   3777 C CA    . ALA A 1 576 ? -15.181 39.343 11.512  1.00 84.10  ? 589  ALA A CA    1 
ATOM   3778 C C     . ALA A 1 576 ? -16.033 40.238 12.413  1.00 92.25  ? 589  ALA A C     1 
ATOM   3779 O O     . ALA A 1 576 ? -16.863 39.744 13.179  1.00 103.11 ? 589  ALA A O     1 
ATOM   3780 C CB    . ALA A 1 576 ? -13.873 38.990 12.199  1.00 88.05  ? 589  ALA A CB    1 
ATOM   3781 N N     . ILE A 1 577 ? -15.833 41.550 12.312  1.00 90.30  ? 590  ILE A N     1 
ATOM   3782 C CA    . ILE A 1 577 ? -16.648 42.509 13.050  1.00 85.98  ? 590  ILE A CA    1 
ATOM   3783 C C     . ILE A 1 577 ? -18.048 42.589 12.449  1.00 86.63  ? 590  ILE A C     1 
ATOM   3784 O O     . ILE A 1 577 ? -19.039 42.575 13.178  1.00 92.00  ? 590  ILE A O     1 
ATOM   3785 C CB    . ILE A 1 577 ? -16.013 43.911 13.062  1.00 93.47  ? 590  ILE A CB    1 
ATOM   3786 C CG1   . ILE A 1 577 ? -14.653 43.868 13.769  1.00 108.11 ? 590  ILE A CG1   1 
ATOM   3787 C CG2   . ILE A 1 577 ? -16.934 44.902 13.763  1.00 95.78  ? 590  ILE A CG2   1 
ATOM   3788 C CD1   . ILE A 1 577 ? -13.871 45.162 13.697  1.00 113.70 ? 590  ILE A CD1   1 
ATOM   3789 N N     . ARG A 1 578 ? -18.125 42.674 11.123  1.00 87.60  ? 591  ARG A N     1 
ATOM   3790 C CA    . ARG A 1 578 ? -19.414 42.738 10.430  1.00 86.66  ? 591  ARG A CA    1 
ATOM   3791 C C     . ARG A 1 578 ? -20.286 41.547 10.797  1.00 83.41  ? 591  ARG A C     1 
ATOM   3792 O O     . ARG A 1 578 ? -21.444 41.709 11.177  1.00 86.82  ? 591  ARG A O     1 
ATOM   3793 C CB    . ARG A 1 578 ? -19.223 42.786 8.913   1.00 83.14  ? 591  ARG A CB    1 
ATOM   3794 C CG    . ARG A 1 578 ? -18.577 44.071 8.419   1.00 86.95  ? 591  ARG A CG    1 
ATOM   3795 C CD    . ARG A 1 578 ? -18.737 44.267 6.920   1.00 82.98  ? 591  ARG A CD    1 
ATOM   3796 N NE    . ARG A 1 578 ? -20.123 44.531 6.538   1.00 79.76  ? 591  ARG A NE    1 
ATOM   3797 C CZ    . ARG A 1 578 ? -20.517 44.917 5.327   1.00 82.37  ? 591  ARG A CZ    1 
ATOM   3798 N NH1   . ARG A 1 578 ? -19.635 45.102 4.347   1.00 87.92  ? 591  ARG A NH1   1 
ATOM   3799 N NH2   . ARG A 1 578 ? -21.807 45.121 5.094   1.00 84.67  ? 591  ARG A NH2   1 
ATOM   3800 N N     . GLU A 1 579 ? -19.716 40.353 10.693  1.00 81.99  ? 592  GLU A N     1 
ATOM   3801 C CA    . GLU A 1 579 ? -20.427 39.134 11.058  1.00 80.69  ? 592  GLU A CA    1 
ATOM   3802 C C     . GLU A 1 579 ? -20.817 39.137 12.536  1.00 82.20  ? 592  GLU A C     1 
ATOM   3803 O O     . GLU A 1 579 ? -21.929 38.742 12.885  1.00 91.08  ? 592  GLU A O     1 
ATOM   3804 C CB    . GLU A 1 579 ? -19.583 37.901 10.726  1.00 84.98  ? 592  GLU A CB    1 
ATOM   3805 C CG    . GLU A 1 579 ? -19.380 37.693 9.230   1.00 91.59  ? 592  GLU A CG    1 
ATOM   3806 C CD    . GLU A 1 579 ? -18.517 36.491 8.899   1.00 94.73  ? 592  GLU A CD    1 
ATOM   3807 O OE1   . GLU A 1 579 ? -18.431 35.555 9.725   1.00 98.42  ? 592  GLU A OE1   1 
ATOM   3808 O OE2   . GLU A 1 579 ? -17.933 36.478 7.794   1.00 99.29  ? 592  GLU A OE2   1 
ATOM   3809 N N     . ALA A 1 580 ? -19.910 39.593 13.397  1.00 83.14  ? 593  ALA A N     1 
ATOM   3810 C CA    . ALA A 1 580 ? -20.191 39.688 14.830  1.00 87.04  ? 593  ALA A CA    1 
ATOM   3811 C C     . ALA A 1 580 ? -21.318 40.687 15.118  1.00 95.95  ? 593  ALA A C     1 
ATOM   3812 O O     . ALA A 1 580 ? -22.226 40.393 15.898  1.00 98.96  ? 593  ALA A O     1 
ATOM   3813 C CB    . ALA A 1 580 ? -18.934 40.067 15.594  1.00 87.69  ? 593  ALA A CB    1 
ATOM   3814 N N     . MET A 1 581 ? -21.257 41.860 14.486  1.00 91.43  ? 594  MET A N     1 
ATOM   3815 C CA    . MET A 1 581 ? -22.343 42.843 14.570  1.00 95.93  ? 594  MET A CA    1 
ATOM   3816 C C     . MET A 1 581 ? -23.684 42.211 14.204  1.00 94.88  ? 594  MET A C     1 
ATOM   3817 O O     . MET A 1 581 ? -24.669 42.363 14.929  1.00 99.03  ? 594  MET A O     1 
ATOM   3818 C CB    . MET A 1 581 ? -22.097 44.022 13.624  1.00 96.07  ? 594  MET A CB    1 
ATOM   3819 C CG    . MET A 1 581 ? -21.086 45.049 14.102  1.00 96.53  ? 594  MET A CG    1 
ATOM   3820 S SD    . MET A 1 581 ? -21.291 46.592 13.189  1.00 101.25 ? 594  MET A SD    1 
ATOM   3821 C CE    . MET A 1 581 ? -19.622 47.238 13.222  1.00 122.46 ? 594  MET A CE    1 
ATOM   3822 N N     . HIS A 1 582 ? -23.707 41.510 13.072  1.00 87.81  ? 595  HIS A N     1 
ATOM   3823 C CA    . HIS A 1 582 ? -24.924 40.876 12.565  1.00 80.75  ? 595  HIS A CA    1 
ATOM   3824 C C     . HIS A 1 582 ? -25.521 39.911 13.588  1.00 81.10  ? 595  HIS A C     1 
ATOM   3825 O O     . HIS A 1 582 ? -26.725 39.931 13.839  1.00 72.17  ? 595  HIS A O     1 
ATOM   3826 C CB    . HIS A 1 582 ? -24.645 40.133 11.253  1.00 81.87  ? 595  HIS A CB    1 
ATOM   3827 C CG    . HIS A 1 582 ? -24.110 41.007 10.160  1.00 80.75  ? 595  HIS A CG    1 
ATOM   3828 N ND1   . HIS A 1 582 ? -23.318 40.524 9.139   1.00 80.35  ? 595  HIS A ND1   1 
ATOM   3829 C CD2   . HIS A 1 582 ? -24.230 42.339 9.943   1.00 77.08  ? 595  HIS A CD2   1 
ATOM   3830 C CE1   . HIS A 1 582 ? -22.987 41.517 8.333   1.00 71.81  ? 595  HIS A CE1   1 
ATOM   3831 N NE2   . HIS A 1 582 ? -23.525 42.629 8.801   1.00 69.54  ? 595  HIS A NE2   1 
ATOM   3832 N N     . GLY A 1 583 ? -24.670 39.077 14.181  1.00 83.03  ? 596  GLY A N     1 
ATOM   3833 C CA    . GLY A 1 583 ? -25.105 38.112 15.188  1.00 82.04  ? 596  GLY A CA    1 
ATOM   3834 C C     . GLY A 1 583 ? -25.606 38.771 16.460  1.00 85.15  ? 596  GLY A C     1 
ATOM   3835 O O     . GLY A 1 583 ? -26.592 38.325 17.050  1.00 93.01  ? 596  GLY A O     1 
ATOM   3836 N N     . VAL A 1 584 ? -24.922 39.832 16.883  1.00 81.46  ? 597  VAL A N     1 
ATOM   3837 C CA    . VAL A 1 584 ? -25.317 40.581 18.077  1.00 87.28  ? 597  VAL A CA    1 
ATOM   3838 C C     . VAL A 1 584 ? -26.629 41.317 17.819  1.00 83.97  ? 597  VAL A C     1 
ATOM   3839 O O     . VAL A 1 584 ? -27.515 41.344 18.675  1.00 86.98  ? 597  VAL A O     1 
ATOM   3840 C CB    . VAL A 1 584 ? -24.211 41.568 18.526  1.00 80.51  ? 597  VAL A CB    1 
ATOM   3841 C CG1   . VAL A 1 584 ? -24.735 42.557 19.558  1.00 81.18  ? 597  VAL A CG1   1 
ATOM   3842 C CG2   . VAL A 1 584 ? -23.026 40.801 19.092  1.00 78.34  ? 597  VAL A CG2   1 
ATOM   3843 N N     . PHE A 1 585 ? -26.749 41.904 16.634  1.00 85.26  ? 598  PHE A N     1 
ATOM   3844 C CA    . PHE A 1 585 ? -27.976 42.575 16.243  1.00 77.86  ? 598  PHE A CA    1 
ATOM   3845 C C     . PHE A 1 585 ? -29.150 41.603 16.198  1.00 78.58  ? 598  PHE A C     1 
ATOM   3846 O O     . PHE A 1 585 ? -30.195 41.858 16.799  1.00 85.38  ? 598  PHE A O     1 
ATOM   3847 C CB    . PHE A 1 585 ? -27.816 43.237 14.880  1.00 79.52  ? 598  PHE A CB    1 
ATOM   3848 C CG    . PHE A 1 585 ? -28.998 44.067 14.480  1.00 77.60  ? 598  PHE A CG    1 
ATOM   3849 C CD1   . PHE A 1 585 ? -29.168 45.341 15.000  1.00 68.66  ? 598  PHE A CD1   1 
ATOM   3850 C CD2   . PHE A 1 585 ? -29.950 43.568 13.604  1.00 68.92  ? 598  PHE A CD2   1 
ATOM   3851 C CE1   . PHE A 1 585 ? -30.260 46.108 14.644  1.00 68.42  ? 598  PHE A CE1   1 
ATOM   3852 C CE2   . PHE A 1 585 ? -31.045 44.329 13.248  1.00 69.86  ? 598  PHE A CE2   1 
ATOM   3853 C CZ    . PHE A 1 585 ? -31.199 45.602 13.768  1.00 68.29  ? 598  PHE A CZ    1 
ATOM   3854 N N     . LEU A 1 586 ? -28.971 40.490 15.492  1.00 81.30  ? 599  LEU A N     1 
ATOM   3855 C CA    . LEU A 1 586 ? -30.045 39.508 15.318  1.00 79.66  ? 599  LEU A CA    1 
ATOM   3856 C C     . LEU A 1 586 ? -30.603 39.021 16.651  1.00 87.19  ? 599  LEU A C     1 
ATOM   3857 O O     . LEU A 1 586 ? -31.805 39.109 16.884  1.00 91.29  ? 599  LEU A O     1 
ATOM   3858 C CB    . LEU A 1 586 ? -29.578 38.319 14.467  1.00 66.86  ? 599  LEU A CB    1 
ATOM   3859 C CG    . LEU A 1 586 ? -29.445 38.604 12.967  1.00 66.35  ? 599  LEU A CG    1 
ATOM   3860 C CD1   . LEU A 1 586 ? -28.862 37.399 12.246  1.00 63.34  ? 599  LEU A CD1   1 
ATOM   3861 C CD2   . LEU A 1 586 ? -30.779 39.013 12.352  1.00 65.15  ? 599  LEU A CD2   1 
ATOM   3862 N N     . TYR A 1 587 ? -29.725 38.541 17.528  1.00 91.65  ? 600  TYR A N     1 
ATOM   3863 C CA    . TYR A 1 587 ? -30.135 38.019 18.837  1.00 90.74  ? 600  TYR A CA    1 
ATOM   3864 C C     . TYR A 1 587 ? -31.253 38.847 19.476  1.00 87.52  ? 600  TYR A C     1 
ATOM   3865 O O     . TYR A 1 587 ? -32.272 38.302 19.906  1.00 85.09  ? 600  TYR A O     1 
ATOM   3866 C CB    . TYR A 1 587 ? -28.933 37.960 19.780  1.00 90.59  ? 600  TYR A CB    1 
ATOM   3867 C CG    . TYR A 1 587 ? -29.294 37.638 21.209  1.00 97.79  ? 600  TYR A CG    1 
ATOM   3868 C CD1   . TYR A 1 587 ? -29.594 36.335 21.595  1.00 107.37 ? 600  TYR A CD1   1 
ATOM   3869 C CD2   . TYR A 1 587 ? -29.341 38.637 22.176  1.00 103.36 ? 600  TYR A CD2   1 
ATOM   3870 C CE1   . TYR A 1 587 ? -29.923 36.033 22.906  1.00 102.58 ? 600  TYR A CE1   1 
ATOM   3871 C CE2   . TYR A 1 587 ? -29.669 38.345 23.490  1.00 117.77 ? 600  TYR A CE2   1 
ATOM   3872 C CZ    . TYR A 1 587 ? -29.959 37.042 23.850  1.00 108.08 ? 600  TYR A CZ    1 
ATOM   3873 O OH    . TYR A 1 587 ? -30.286 36.752 25.155  1.00 109.93 ? 600  TYR A OH    1 
ATOM   3874 N N     . HIS A 1 588 ? -31.057 40.160 19.526  1.00 80.59  ? 601  HIS A N     1 
ATOM   3875 C CA    . HIS A 1 588 ? -32.044 41.060 20.117  1.00 81.63  ? 601  HIS A CA    1 
ATOM   3876 C C     . HIS A 1 588 ? -33.245 41.230 19.187  1.00 80.10  ? 601  HIS A C     1 
ATOM   3877 O O     . HIS A 1 588 ? -34.389 41.020 19.598  1.00 69.38  ? 601  HIS A O     1 
ATOM   3878 C CB    . HIS A 1 588 ? -31.403 42.411 20.446  1.00 84.20  ? 601  HIS A CB    1 
ATOM   3879 C CG    . HIS A 1 588 ? -30.290 42.317 21.447  1.00 94.99  ? 601  HIS A CG    1 
ATOM   3880 N ND1   . HIS A 1 588 ? -28.967 42.518 21.113  1.00 96.72  ? 601  HIS A ND1   1 
ATOM   3881 C CD2   . HIS A 1 588 ? -30.303 42.021 22.769  1.00 86.34  ? 601  HIS A CD2   1 
ATOM   3882 C CE1   . HIS A 1 588 ? -28.215 42.360 22.188  1.00 98.22  ? 601  HIS A CE1   1 
ATOM   3883 N NE2   . HIS A 1 588 ? -29.000 42.058 23.206  1.00 90.82  ? 601  HIS A NE2   1 
ATOM   3884 N N     . ALA A 1 589 ? -32.971 41.587 17.933  1.00 74.61  ? 602  ALA A N     1 
ATOM   3885 C CA    . ALA A 1 589 ? -34.005 41.728 16.909  1.00 66.34  ? 602  ALA A CA    1 
ATOM   3886 C C     . ALA A 1 589 ? -34.968 40.544 16.906  1.00 69.87  ? 602  ALA A C     1 
ATOM   3887 O O     . ALA A 1 589 ? -36.186 40.719 16.954  1.00 73.97  ? 602  ALA A O     1 
ATOM   3888 C CB    . ALA A 1 589 ? -33.365 41.875 15.536  1.00 70.66  ? 602  ALA A CB    1 
ATOM   3889 N N     . ILE A 1 590 ? -34.406 39.341 16.870  1.00 80.20  ? 603  ILE A N     1 
ATOM   3890 C CA    . ILE A 1 590 ? -35.197 38.108 16.860  1.00 81.44  ? 603  ILE A CA    1 
ATOM   3891 C C     . ILE A 1 590 ? -36.085 38.051 18.102  1.00 80.55  ? 603  ILE A C     1 
ATOM   3892 O O     . ILE A 1 590 ? -37.237 37.624 18.026  1.00 97.53  ? 603  ILE A O     1 
ATOM   3893 C CB    . ILE A 1 590 ? -34.306 36.841 16.840  1.00 83.22  ? 603  ILE A CB    1 
ATOM   3894 C CG1   . ILE A 1 590 ? -33.267 36.898 15.702  1.00 74.81  ? 603  ILE A CG1   1 
ATOM   3895 C CG2   . ILE A 1 590 ? -35.173 35.583 16.767  1.00 76.88  ? 603  ILE A CG2   1 
ATOM   3896 C CD1   . ILE A 1 590 ? -33.648 36.184 14.432  1.00 72.29  ? 603  ILE A CD1   1 
ATOM   3897 N N     . LYS A 1 591 ? -35.538 38.475 19.241  1.00 73.72  ? 604  LYS A N     1 
ATOM   3898 C CA    . LYS A 1 591 ? -36.288 38.514 20.496  1.00 83.29  ? 604  LYS A CA    1 
ATOM   3899 C C     . LYS A 1 591 ? -37.459 39.494 20.416  1.00 82.66  ? 604  LYS A C     1 
ATOM   3900 O O     . LYS A 1 591 ? -38.534 39.224 20.949  1.00 91.25  ? 604  LYS A O     1 
ATOM   3901 C CB    . LYS A 1 591 ? -35.370 38.882 21.671  1.00 75.31  ? 604  LYS A CB    1 
ATOM   3902 N N     . SER A 1 592 ? -37.248 40.623 19.744  1.00 88.71  ? 605  SER A N     1 
ATOM   3903 C CA    . SER A 1 592 ? -38.297 41.634 19.581  1.00 90.84  ? 605  SER A CA    1 
ATOM   3904 C C     . SER A 1 592 ? -39.379 41.217 18.581  1.00 80.84  ? 605  SER A C     1 
ATOM   3905 O O     . SER A 1 592 ? -40.516 41.682 18.665  1.00 76.83  ? 605  SER A O     1 
ATOM   3906 C CB    . SER A 1 592 ? -37.688 42.977 19.175  1.00 89.65  ? 605  SER A CB    1 
ATOM   3907 O OG    . SER A 1 592 ? -37.003 43.553 20.273  1.00 100.21 ? 605  SER A OG    1 
ATOM   3908 N N     . GLY A 1 593 ? -39.024 40.344 17.643  1.00 72.61  ? 606  GLY A N     1 
ATOM   3909 C CA    . GLY A 1 593 ? -40.001 39.769 16.714  1.00 74.25  ? 606  GLY A CA    1 
ATOM   3910 C C     . GLY A 1 593 ? -39.609 39.742 15.246  1.00 65.67  ? 606  GLY A C     1 
ATOM   3911 O O     . GLY A 1 593 ? -40.476 39.632 14.379  1.00 59.51  ? 606  GLY A O     1 
ATOM   3912 N N     . MET A 1 594 ? -38.313 39.832 14.959  1.00 68.32  ? 607  MET A N     1 
ATOM   3913 C CA    . MET A 1 594 ? -37.835 39.799 13.585  1.00 69.76  ? 607  MET A CA    1 
ATOM   3914 C C     . MET A 1 594 ? -37.935 38.377 13.060  1.00 63.79  ? 607  MET A C     1 
ATOM   3915 O O     . MET A 1 594 ? -37.284 37.469 13.571  1.00 86.95  ? 607  MET A O     1 
ATOM   3916 C CB    . MET A 1 594 ? -36.394 40.289 13.499  1.00 70.25  ? 607  MET A CB    1 
ATOM   3917 C CG    . MET A 1 594 ? -35.900 40.476 12.078  1.00 64.39  ? 607  MET A CG    1 
ATOM   3918 S SD    . MET A 1 594 ? -34.302 41.296 12.058  1.00 63.23  ? 607  MET A SD    1 
ATOM   3919 C CE    . MET A 1 594 ? -33.986 41.374 10.296  1.00 72.62  ? 607  MET A CE    1 
ATOM   3920 N N     . ASP A 1 595 ? -38.751 38.205 12.030  1.00 65.14  ? 608  ASP A N     1 
ATOM   3921 C CA    . ASP A 1 595 ? -39.100 36.887 11.510  1.00 74.23  ? 608  ASP A CA    1 
ATOM   3922 C C     . ASP A 1 595 ? -38.116 36.382 10.452  1.00 65.35  ? 608  ASP A C     1 
ATOM   3923 O O     . ASP A 1 595 ? -37.955 35.177 10.267  1.00 74.30  ? 608  ASP A O     1 
ATOM   3924 C CB    . ASP A 1 595 ? -40.511 36.947 10.921  1.00 71.13  ? 608  ASP A CB    1 
ATOM   3925 C CG    . ASP A 1 595 ? -41.521 37.509 11.904  1.00 78.72  ? 608  ASP A CG    1 
ATOM   3926 O OD1   . ASP A 1 595 ? -42.072 36.726 12.704  1.00 110.71 ? 608  ASP A OD1   1 
ATOM   3927 O OD2   . ASP A 1 595 ? -41.758 38.735 11.877  1.00 70.66  ? 608  ASP A OD2   1 
ATOM   3928 N N     . MET A 1 596 ? -37.457 37.311 9.772   1.00 62.34  ? 609  MET A N     1 
ATOM   3929 C CA    . MET A 1 596 ? -36.657 36.996 8.602   1.00 57.67  ? 609  MET A CA    1 
ATOM   3930 C C     . MET A 1 596 ? -35.766 38.180 8.266   1.00 58.66  ? 609  MET A C     1 
ATOM   3931 O O     . MET A 1 596 ? -35.922 39.265 8.828   1.00 71.34  ? 609  MET A O     1 
ATOM   3932 C CB    . MET A 1 596 ? -37.576 36.724 7.420   1.00 63.32  ? 609  MET A CB    1 
ATOM   3933 C CG    . MET A 1 596 ? -38.458 37.913 7.084   1.00 62.06  ? 609  MET A CG    1 
ATOM   3934 S SD    . MET A 1 596 ? -39.431 37.706 5.589   1.00 63.74  ? 609  MET A SD    1 
ATOM   3935 C CE    . MET A 1 596 ? -40.844 36.796 6.201   1.00 61.50  ? 609  MET A CE    1 
ATOM   3936 N N     . GLY A 1 597 ? -34.837 37.976 7.344   1.00 51.91  ? 610  GLY A N     1 
ATOM   3937 C CA    . GLY A 1 597 ? -33.968 39.058 6.912   1.00 55.98  ? 610  GLY A CA    1 
ATOM   3938 C C     . GLY A 1 597 ? -33.216 38.707 5.654   1.00 60.77  ? 610  GLY A C     1 
ATOM   3939 O O     . GLY A 1 597 ? -33.127 37.536 5.279   1.00 62.10  ? 610  GLY A O     1 
ATOM   3940 N N     . ILE A 1 598 ? -32.691 39.728 4.989   1.00 56.05  ? 611  ILE A N     1 
ATOM   3941 C CA    . ILE A 1 598 ? -31.848 39.510 3.826   1.00 60.15  ? 611  ILE A CA    1 
ATOM   3942 C C     . ILE A 1 598 ? -30.420 39.516 4.335   1.00 59.51  ? 611  ILE A C     1 
ATOM   3943 O O     . ILE A 1 598 ? -29.880 40.557 4.692   1.00 58.63  ? 611  ILE A O     1 
ATOM   3944 C CB    . ILE A 1 598 ? -32.071 40.572 2.739   1.00 58.34  ? 611  ILE A CB    1 
ATOM   3945 C CG1   . ILE A 1 598 ? -33.544 40.566 2.324   1.00 54.01  ? 611  ILE A CG1   1 
ATOM   3946 C CG2   . ILE A 1 598 ? -31.167 40.299 1.538   1.00 58.75  ? 611  ILE A CG2   1 
ATOM   3947 C CD1   . ILE A 1 598 ? -33.933 41.696 1.405   1.00 57.48  ? 611  ILE A CD1   1 
ATOM   3948 N N     . VAL A 1 599 ? -29.823 38.333 4.381   1.00 65.38  ? 612  VAL A N     1 
ATOM   3949 C CA    . VAL A 1 599 ? -28.573 38.135 5.094   1.00 65.45  ? 612  VAL A CA    1 
ATOM   3950 C C     . VAL A 1 599 ? -27.588 37.323 4.272   1.00 62.65  ? 612  VAL A C     1 
ATOM   3951 O O     . VAL A 1 599 ? -27.945 36.764 3.236   1.00 65.36  ? 612  VAL A O     1 
ATOM   3952 C CB    . VAL A 1 599 ? -28.821 37.419 6.438   1.00 65.24  ? 612  VAL A CB    1 
ATOM   3953 C CG1   . VAL A 1 599 ? -29.766 38.236 7.308   1.00 61.77  ? 612  VAL A CG1   1 
ATOM   3954 C CG2   . VAL A 1 599 ? -29.378 36.017 6.219   1.00 60.18  ? 612  VAL A CG2   1 
ATOM   3955 N N     . ASN A 1 600 ? -26.344 37.277 4.740   1.00 68.04  ? 613  ASN A N     1 
ATOM   3956 C CA    . ASN A 1 600 ? -25.323 36.434 4.138   1.00 66.59  ? 613  ASN A CA    1 
ATOM   3957 C C     . ASN A 1 600 ? -25.355 35.085 4.853   1.00 63.83  ? 613  ASN A C     1 
ATOM   3958 O O     . ASN A 1 600 ? -24.724 34.907 5.897   1.00 61.77  ? 613  ASN A O     1 
ATOM   3959 C CB    . ASN A 1 600 ? -23.951 37.104 4.229   1.00 66.61  ? 613  ASN A CB    1 
ATOM   3960 C CG    . ASN A 1 600 ? -22.924 36.465 3.314   1.00 76.22  ? 613  ASN A CG    1 
ATOM   3961 O OD1   . ASN A 1 600 ? -23.183 35.434 2.682   1.00 74.09  ? 613  ASN A OD1   1 
ATOM   3962 N ND2   . ASN A 1 600 ? -21.743 37.072 3.242   1.00 77.29  ? 613  ASN A ND2   1 
ATOM   3963 N N     . ALA A 1 601 ? -26.098 34.145 4.266   1.00 65.57  ? 614  ALA A N     1 
ATOM   3964 C CA    . ALA A 1 601 ? -26.596 32.953 4.966   1.00 64.22  ? 614  ALA A CA    1 
ATOM   3965 C C     . ALA A 1 601 ? -25.521 32.069 5.594   1.00 75.28  ? 614  ALA A C     1 
ATOM   3966 O O     . ALA A 1 601 ? -25.738 31.483 6.660   1.00 82.67  ? 614  ALA A O     1 
ATOM   3967 C CB    . ALA A 1 601 ? -27.474 32.127 4.037   1.00 64.63  ? 614  ALA A CB    1 
ATOM   3968 N N     . GLY A 1 602 ? -24.371 31.960 4.943   1.00 70.77  ? 615  GLY A N     1 
ATOM   3969 C CA    . GLY A 1 602 ? -23.273 31.177 5.509   1.00 79.14  ? 615  GLY A CA    1 
ATOM   3970 C C     . GLY A 1 602 ? -22.615 31.808 6.714   1.00 75.48  ? 615  GLY A C     1 
ATOM   3971 O O     . GLY A 1 602 ? -22.128 31.113 7.600   1.00 77.46  ? 615  GLY A O     1 
ATOM   3972 N N     . ASN A 1 603 ? -22.627 33.135 6.751   1.00 78.54  ? 616  ASN A N     1 
ATOM   3973 C CA    . ASN A 1 603 ? -21.741 33.893 7.611   1.00 85.85  ? 616  ASN A CA    1 
ATOM   3974 C C     . ASN A 1 603 ? -22.491 34.633 8.714   1.00 90.45  ? 616  ASN A C     1 
ATOM   3975 O O     . ASN A 1 603 ? -22.385 35.857 8.845   1.00 89.59  ? 616  ASN A O     1 
ATOM   3976 C CB    . ASN A 1 603 ? -20.939 34.859 6.739   1.00 93.64  ? 616  ASN A CB    1 
ATOM   3977 C CG    . ASN A 1 603 ? -20.415 34.198 5.475   1.00 85.01  ? 616  ASN A CG    1 
ATOM   3978 O OD1   . ASN A 1 603 ? -20.733 34.620 4.366   1.00 78.99  ? 616  ASN A OD1   1 
ATOM   3979 N ND2   . ASN A 1 603 ? -19.631 33.141 5.639   1.00 85.57  ? 616  ASN A ND2   1 
ATOM   3980 N N     . LEU A 1 604 ? -23.253 33.877 9.503   1.00 84.46  ? 617  LEU A N     1 
ATOM   3981 C CA    . LEU A 1 604 ? -23.962 34.423 10.658  1.00 81.80  ? 617  LEU A CA    1 
ATOM   3982 C C     . LEU A 1 604 ? -23.651 33.598 11.900  1.00 89.84  ? 617  LEU A C     1 
ATOM   3983 O O     . LEU A 1 604 ? -24.324 32.601 12.167  1.00 92.40  ? 617  LEU A O     1 
ATOM   3984 C CB    . LEU A 1 604 ? -25.470 34.454 10.414  1.00 76.49  ? 617  LEU A CB    1 
ATOM   3985 C CG    . LEU A 1 604 ? -25.986 35.567 9.503   1.00 75.94  ? 617  LEU A CG    1 
ATOM   3986 C CD1   . LEU A 1 604 ? -27.500 35.458 9.384   1.00 79.07  ? 617  LEU A CD1   1 
ATOM   3987 C CD2   . LEU A 1 604 ? -25.576 36.945 10.010  1.00 78.68  ? 617  LEU A CD2   1 
ATOM   3988 N N     . PRO A 1 605 ? -22.624 34.017 12.663  1.00 91.28  ? 618  PRO A N     1 
ATOM   3989 C CA    . PRO A 1 605 ? -22.213 33.338 13.890  1.00 92.02  ? 618  PRO A CA    1 
ATOM   3990 C C     . PRO A 1 605 ? -23.350 33.120 14.889  1.00 90.67  ? 618  PRO A C     1 
ATOM   3991 O O     . PRO A 1 605 ? -24.330 33.869 14.890  1.00 93.60  ? 618  PRO A O     1 
ATOM   3992 C CB    . PRO A 1 605 ? -21.178 34.297 14.488  1.00 100.46 ? 618  PRO A CB    1 
ATOM   3993 C CG    . PRO A 1 605 ? -20.624 35.037 13.324  1.00 93.62  ? 618  PRO A CG    1 
ATOM   3994 C CD    . PRO A 1 605 ? -21.754 35.168 12.352  1.00 95.74  ? 618  PRO A CD    1 
ATOM   3995 N N     . VAL A 1 606 ? -23.206 32.097 15.729  1.00 94.86  ? 619  VAL A N     1 
ATOM   3996 C CA    . VAL A 1 606 ? -24.144 31.852 16.819  1.00 97.06  ? 619  VAL A CA    1 
ATOM   3997 C C     . VAL A 1 606 ? -23.828 32.814 17.967  1.00 103.82 ? 619  VAL A C     1 
ATOM   3998 O O     . VAL A 1 606 ? -22.666 32.982 18.346  1.00 92.57  ? 619  VAL A O     1 
ATOM   3999 C CB    . VAL A 1 606 ? -24.066 30.395 17.318  1.00 98.56  ? 619  VAL A CB    1 
ATOM   4000 C CG1   . VAL A 1 606 ? -24.978 30.185 18.523  1.00 108.70 ? 619  VAL A CG1   1 
ATOM   4001 C CG2   . VAL A 1 606 ? -24.426 29.431 16.197  1.00 92.17  ? 619  VAL A CG2   1 
ATOM   4002 N N     . TYR A 1 607 ? -24.871 33.433 18.514  1.00 102.79 ? 620  TYR A N     1 
ATOM   4003 C CA    . TYR A 1 607 ? -24.733 34.449 19.561  1.00 103.12 ? 620  TYR A CA    1 
ATOM   4004 C C     . TYR A 1 607 ? -23.907 33.972 20.771  1.00 103.57 ? 620  TYR A C     1 
ATOM   4005 O O     . TYR A 1 607 ? -23.092 34.726 21.302  1.00 100.18 ? 620  TYR A O     1 
ATOM   4006 C CB    . TYR A 1 607 ? -26.128 34.920 20.004  1.00 99.59  ? 620  TYR A CB    1 
ATOM   4007 C CG    . TYR A 1 607 ? -26.128 36.053 21.007  1.00 99.88  ? 620  TYR A CG    1 
ATOM   4008 C CD1   . TYR A 1 607 ? -25.707 37.331 20.646  1.00 100.75 ? 620  TYR A CD1   1 
ATOM   4009 C CD2   . TYR A 1 607 ? -26.561 35.850 22.316  1.00 98.81  ? 620  TYR A CD2   1 
ATOM   4010 C CE1   . TYR A 1 607 ? -25.709 38.370 21.563  1.00 102.71 ? 620  TYR A CE1   1 
ATOM   4011 C CE2   . TYR A 1 607 ? -26.568 36.882 23.238  1.00 93.56  ? 620  TYR A CE2   1 
ATOM   4012 C CZ    . TYR A 1 607 ? -26.139 38.137 22.860  1.00 97.75  ? 620  TYR A CZ    1 
ATOM   4013 O OH    . TYR A 1 607 ? -26.146 39.160 23.778  1.00 94.71  ? 620  TYR A OH    1 
ATOM   4014 N N     . ASP A 1 608 ? -24.108 32.723 21.187  1.00 111.23 ? 621  ASP A N     1 
ATOM   4015 C CA    . ASP A 1 608 ? -23.393 32.157 22.344  1.00 127.65 ? 621  ASP A CA    1 
ATOM   4016 C C     . ASP A 1 608 ? -21.908 31.849 22.087  1.00 120.62 ? 621  ASP A C     1 
ATOM   4017 O O     . ASP A 1 608 ? -21.116 31.815 23.031  1.00 112.11 ? 621  ASP A O     1 
ATOM   4018 C CB    . ASP A 1 608 ? -24.092 30.883 22.833  1.00 123.85 ? 621  ASP A CB    1 
ATOM   4019 N N     . ASP A 1 609 ? -21.540 31.621 20.825  1.00 118.09 ? 622  ASP A N     1 
ATOM   4020 C CA    . ASP A 1 609 ? -20.156 31.278 20.456  1.00 115.44 ? 622  ASP A CA    1 
ATOM   4021 C C     . ASP A 1 609 ? -19.333 32.475 19.951  1.00 112.23 ? 622  ASP A C     1 
ATOM   4022 O O     . ASP A 1 609 ? -18.225 32.290 19.441  1.00 98.54  ? 622  ASP A O     1 
ATOM   4023 C CB    . ASP A 1 609 ? -20.148 30.166 19.393  1.00 127.72 ? 622  ASP A CB    1 
ATOM   4024 C CG    . ASP A 1 609 ? -20.615 28.821 19.935  1.00 142.74 ? 622  ASP A CG    1 
ATOM   4025 O OD1   . ASP A 1 609 ? -20.773 28.676 21.167  1.00 167.72 ? 622  ASP A OD1   1 
ATOM   4026 O OD2   . ASP A 1 609 ? -20.818 27.899 19.116  1.00 142.06 ? 622  ASP A OD2   1 
ATOM   4027 N N     . ILE A 1 610 ? -19.867 33.689 20.089  1.00 117.24 ? 623  ILE A N     1 
ATOM   4028 C CA    . ILE A 1 610 ? -19.134 34.909 19.734  1.00 118.53 ? 623  ILE A CA    1 
ATOM   4029 C C     . ILE A 1 610 ? -18.324 35.392 20.938  1.00 110.46 ? 623  ILE A C     1 
ATOM   4030 O O     . ILE A 1 610 ? -18.865 35.493 22.041  1.00 114.29 ? 623  ILE A O     1 
ATOM   4031 C CB    . ILE A 1 610 ? -20.090 36.034 19.281  1.00 104.72 ? 623  ILE A CB    1 
ATOM   4032 N N     . HIS A 1 611 ? -17.039 35.689 20.724  1.00 111.12 ? 624  HIS A N     1 
ATOM   4033 C CA    . HIS A 1 611 ? -16.126 36.111 21.806  1.00 110.37 ? 624  HIS A CA    1 
ATOM   4034 C C     . HIS A 1 611 ? -16.745 37.197 22.694  1.00 108.65 ? 624  HIS A C     1 
ATOM   4035 O O     . HIS A 1 611 ? -17.281 38.186 22.190  1.00 107.22 ? 624  HIS A O     1 
ATOM   4036 C CB    . HIS A 1 611 ? -14.792 36.608 21.232  1.00 97.40  ? 624  HIS A CB    1 
ATOM   4037 N N     . LYS A 1 612 ? -16.658 37.002 24.011  1.00 106.59 ? 625  LYS A N     1 
ATOM   4038 C CA    . LYS A 1 612 ? -17.379 37.836 24.982  1.00 109.42 ? 625  LYS A CA    1 
ATOM   4039 C C     . LYS A 1 612 ? -16.966 39.314 24.991  1.00 114.01 ? 625  LYS A C     1 
ATOM   4040 O O     . LYS A 1 612 ? -17.764 40.174 25.366  1.00 121.27 ? 625  LYS A O     1 
ATOM   4041 C CB    . LYS A 1 612 ? -17.241 37.255 26.392  1.00 104.76 ? 625  LYS A CB    1 
ATOM   4042 N N     . GLU A 1 613 ? -15.732 39.607 24.585  1.00 119.57 ? 626  GLU A N     1 
ATOM   4043 C CA    . GLU A 1 613 ? -15.260 40.993 24.503  1.00 119.03 ? 626  GLU A CA    1 
ATOM   4044 C C     . GLU A 1 613 ? -15.886 41.702 23.306  1.00 112.47 ? 626  GLU A C     1 
ATOM   4045 O O     . GLU A 1 613 ? -16.436 42.800 23.437  1.00 107.58 ? 626  GLU A O     1 
ATOM   4046 C CB    . GLU A 1 613 ? -13.734 41.041 24.395  1.00 127.10 ? 626  GLU A CB    1 
ATOM   4047 N N     . LEU A 1 614 ? -15.799 41.059 22.143  1.00 108.93 ? 627  LEU A N     1 
ATOM   4048 C CA    . LEU A 1 614 ? -16.341 41.604 20.899  1.00 96.43  ? 627  LEU A CA    1 
ATOM   4049 C C     . LEU A 1 614 ? -17.861 41.715 20.962  1.00 98.49  ? 627  LEU A C     1 
ATOM   4050 O O     . LEU A 1 614 ? -18.435 42.711 20.516  1.00 95.92  ? 627  LEU A O     1 
ATOM   4051 C CB    . LEU A 1 614 ? -15.929 40.728 19.711  1.00 89.76  ? 627  LEU A CB    1 
ATOM   4052 C CG    . LEU A 1 614 ? -16.439 41.136 18.325  1.00 88.38  ? 627  LEU A CG    1 
ATOM   4053 C CD1   . LEU A 1 614 ? -16.066 42.577 18.019  1.00 90.53  ? 627  LEU A CD1   1 
ATOM   4054 C CD2   . LEU A 1 614 ? -15.894 40.200 17.257  1.00 86.00  ? 627  LEU A CD2   1 
ATOM   4055 N N     . LEU A 1 615 ? -18.499 40.685 21.513  1.00 96.70  ? 628  LEU A N     1 
ATOM   4056 C CA    . LEU A 1 615 ? -19.948 40.667 21.696  1.00 95.53  ? 628  LEU A CA    1 
ATOM   4057 C C     . LEU A 1 615 ? -20.396 41.877 22.512  1.00 105.17 ? 628  LEU A C     1 
ATOM   4058 O O     . LEU A 1 615 ? -21.279 42.630 22.091  1.00 108.54 ? 628  LEU A O     1 
ATOM   4059 C CB    . LEU A 1 615 ? -20.378 39.369 22.393  1.00 100.98 ? 628  LEU A CB    1 
ATOM   4060 C CG    . LEU A 1 615 ? -21.871 39.008 22.384  1.00 104.31 ? 628  LEU A CG    1 
ATOM   4061 C CD1   . LEU A 1 615 ? -22.054 37.513 22.623  1.00 108.49 ? 628  LEU A CD1   1 
ATOM   4062 C CD2   . LEU A 1 615 ? -22.675 39.823 23.393  1.00 94.71  ? 628  LEU A CD2   1 
ATOM   4063 N N     . GLN A 1 616 ? -19.769 42.060 23.673  1.00 104.30 ? 629  GLN A N     1 
ATOM   4064 C CA    . GLN A 1 616 ? -20.099 43.164 24.569  1.00 101.96 ? 629  GLN A CA    1 
ATOM   4065 C C     . GLN A 1 616 ? -19.829 44.528 23.927  1.00 104.11 ? 629  GLN A C     1 
ATOM   4066 O O     . GLN A 1 616 ? -20.536 45.498 24.207  1.00 105.94 ? 629  GLN A O     1 
ATOM   4067 C CB    . GLN A 1 616 ? -19.320 43.037 25.881  1.00 92.39  ? 629  GLN A CB    1 
ATOM   4068 N N     . LEU A 1 617 ? -18.810 44.595 23.069  1.00 101.75 ? 630  LEU A N     1 
ATOM   4069 C CA    . LEU A 1 617 ? -18.466 45.835 22.373  1.00 97.18  ? 630  LEU A CA    1 
ATOM   4070 C C     . LEU A 1 617 ? -19.558 46.212 21.380  1.00 99.05  ? 630  LEU A C     1 
ATOM   4071 O O     . LEU A 1 617 ? -20.046 47.345 21.382  1.00 97.49  ? 630  LEU A O     1 
ATOM   4072 C CB    . LEU A 1 617 ? -17.127 45.691 21.646  1.00 101.72 ? 630  LEU A CB    1 
ATOM   4073 N N     . CYS A 1 618 ? -19.939 45.253 20.539  1.00 97.46  ? 631  CYS A N     1 
ATOM   4074 C CA    . CYS A 1 618 ? -21.021 45.449 19.576  1.00 89.82  ? 631  CYS A CA    1 
ATOM   4075 C C     . CYS A 1 618 ? -22.343 45.735 20.283  1.00 92.30  ? 631  CYS A C     1 
ATOM   4076 O O     . CYS A 1 618 ? -23.094 46.614 19.865  1.00 89.28  ? 631  CYS A O     1 
ATOM   4077 C CB    . CYS A 1 618 ? -21.170 44.222 18.675  1.00 94.94  ? 631  CYS A CB    1 
ATOM   4078 S SG    . CYS A 1 618 ? -19.818 43.986 17.499  1.00 92.52  ? 631  CYS A SG    1 
ATOM   4079 N N     . GLU A 1 619 ? -22.621 44.998 21.356  1.00 103.70 ? 632  GLU A N     1 
ATOM   4080 C CA    . GLU A 1 619 ? -23.810 45.247 22.174  1.00 103.97 ? 632  GLU A CA    1 
ATOM   4081 C C     . GLU A 1 619 ? -23.906 46.722 22.576  1.00 104.29 ? 632  GLU A C     1 
ATOM   4082 O O     . GLU A 1 619 ? -24.994 47.291 22.592  1.00 110.24 ? 632  GLU A O     1 
ATOM   4083 C CB    . GLU A 1 619 ? -23.803 44.361 23.423  1.00 98.95  ? 632  GLU A CB    1 
ATOM   4084 N N     . ASP A 1 620 ? -22.762 47.334 22.882  1.00 105.02 ? 633  ASP A N     1 
ATOM   4085 C CA    . ASP A 1 620 ? -22.709 48.750 23.255  1.00 116.00 ? 633  ASP A CA    1 
ATOM   4086 C C     . ASP A 1 620 ? -22.955 49.687 22.064  1.00 109.48 ? 633  ASP A C     1 
ATOM   4087 O O     . ASP A 1 620 ? -23.562 50.748 22.223  1.00 103.47 ? 633  ASP A O     1 
ATOM   4088 C CB    . ASP A 1 620 ? -21.362 49.077 23.908  1.00 133.95 ? 633  ASP A CB    1 
ATOM   4089 N N     . LEU A 1 621 ? -22.483 49.293 20.882  1.00 100.92 ? 634  LEU A N     1 
ATOM   4090 C CA    . LEU A 1 621 ? -22.665 50.090 19.660  1.00 94.11  ? 634  LEU A CA    1 
ATOM   4091 C C     . LEU A 1 621 ? -24.120 50.095 19.183  1.00 92.07  ? 634  LEU A C     1 
ATOM   4092 O O     . LEU A 1 621 ? -24.671 51.150 18.859  1.00 91.16  ? 634  LEU A O     1 
ATOM   4093 C CB    . LEU A 1 621 ? -21.749 49.573 18.542  1.00 88.19  ? 634  LEU A CB    1 
ATOM   4094 C CG    . LEU A 1 621 ? -21.881 50.207 17.152  1.00 90.10  ? 634  LEU A CG    1 
ATOM   4095 C CD1   . LEU A 1 621 ? -21.756 51.723 17.200  1.00 92.70  ? 634  LEU A CD1   1 
ATOM   4096 C CD2   . LEU A 1 621 ? -20.839 49.618 16.216  1.00 92.82  ? 634  LEU A CD2   1 
ATOM   4097 N N     . ILE A 1 622 ? -24.728 48.913 19.135  1.00 80.28  ? 635  ILE A N     1 
ATOM   4098 C CA    . ILE A 1 622 ? -26.122 48.771 18.713  1.00 82.50  ? 635  ILE A CA    1 
ATOM   4099 C C     . ILE A 1 622 ? -27.065 49.523 19.662  1.00 93.41  ? 635  ILE A C     1 
ATOM   4100 O O     . ILE A 1 622 ? -28.027 50.152 19.215  1.00 97.82  ? 635  ILE A O     1 
ATOM   4101 C CB    . ILE A 1 622 ? -26.529 47.273 18.603  1.00 88.32  ? 635  ILE A CB    1 
ATOM   4102 C CG1   . ILE A 1 622 ? -26.088 46.684 17.253  1.00 84.64  ? 635  ILE A CG1   1 
ATOM   4103 C CG2   . ILE A 1 622 ? -28.035 47.080 18.760  1.00 102.65 ? 635  ILE A CG2   1 
ATOM   4104 C CD1   . ILE A 1 622 ? -24.647 46.227 17.200  1.00 82.69  ? 635  ILE A CD1   1 
ATOM   4105 N N     . TRP A 1 623 ? -26.781 49.462 20.963  1.00 93.54  ? 636  TRP A N     1 
ATOM   4106 C CA    . TRP A 1 623 ? -27.628 50.096 21.976  1.00 88.97  ? 636  TRP A CA    1 
ATOM   4107 C C     . TRP A 1 623 ? -27.113 51.466 22.438  1.00 93.17  ? 636  TRP A C     1 
ATOM   4108 O O     . TRP A 1 623 ? -27.598 52.009 23.437  1.00 91.24  ? 636  TRP A O     1 
ATOM   4109 C CB    . TRP A 1 623 ? -27.783 49.165 23.182  1.00 82.41  ? 636  TRP A CB    1 
ATOM   4110 C CG    . TRP A 1 623 ? -28.593 47.953 22.890  1.00 82.44  ? 636  TRP A CG    1 
ATOM   4111 C CD1   . TRP A 1 623 ? -28.131 46.695 22.642  1.00 90.38  ? 636  TRP A CD1   1 
ATOM   4112 C CD2   . TRP A 1 623 ? -30.019 47.880 22.813  1.00 86.36  ? 636  TRP A CD2   1 
ATOM   4113 N NE1   . TRP A 1 623 ? -29.181 45.840 22.416  1.00 93.14  ? 636  TRP A NE1   1 
ATOM   4114 C CE2   . TRP A 1 623 ? -30.352 46.541 22.514  1.00 89.35  ? 636  TRP A CE2   1 
ATOM   4115 C CE3   . TRP A 1 623 ? -31.048 48.814 22.970  1.00 87.07  ? 636  TRP A CE3   1 
ATOM   4116 C CZ2   . TRP A 1 623 ? -31.672 46.113 22.370  1.00 90.97  ? 636  TRP A CZ2   1 
ATOM   4117 C CZ3   . TRP A 1 623 ? -32.360 48.389 22.825  1.00 95.72  ? 636  TRP A CZ3   1 
ATOM   4118 C CH2   . TRP A 1 623 ? -32.660 47.049 22.528  1.00 100.70 ? 636  TRP A CH2   1 
ATOM   4119 N N     . ASN A 1 624 ? -26.130 52.017 21.725  1.00 85.45  ? 637  ASN A N     1 
ATOM   4120 C CA    . ASN A 1 624 ? -25.594 53.351 22.018  1.00 90.18  ? 637  ASN A CA    1 
ATOM   4121 C C     . ASN A 1 624 ? -25.450 53.647 23.518  1.00 94.92  ? 637  ASN A C     1 
ATOM   4122 O O     . ASN A 1 624 ? -25.719 54.761 23.973  1.00 94.23  ? 637  ASN A O     1 
ATOM   4123 C CB    . ASN A 1 624 ? -26.471 54.420 21.352  1.00 87.63  ? 637  ASN A CB    1 
ATOM   4124 C CG    . ASN A 1 624 ? -25.790 55.777 21.280  1.00 86.16  ? 637  ASN A CG    1 
ATOM   4125 O OD1   . ASN A 1 624 ? -24.625 55.882 20.894  1.00 81.26  ? 637  ASN A OD1   1 
ATOM   4126 N ND2   . ASN A 1 624 ? -26.519 56.824 21.648  1.00 82.78  ? 637  ASN A ND2   1 
ATOM   4127 N N     . LYS A 1 625 ? -25.023 52.642 24.277  1.00 108.50 ? 638  LYS A N     1 
ATOM   4128 C CA    . LYS A 1 625 ? -24.866 52.775 25.723  1.00 117.64 ? 638  LYS A CA    1 
ATOM   4129 C C     . LYS A 1 625 ? -23.557 53.485 26.044  1.00 119.64 ? 638  LYS A C     1 
ATOM   4130 O O     . LYS A 1 625 ? -23.501 54.308 26.957  1.00 134.58 ? 638  LYS A O     1 
ATOM   4131 C CB    . LYS A 1 625 ? -24.911 51.403 26.397  1.00 120.80 ? 638  LYS A CB    1 
ATOM   4132 C CG    . LYS A 1 625 ? -26.203 50.640 26.137  1.00 118.05 ? 638  LYS A CG    1 
ATOM   4133 C CD    . LYS A 1 625 ? -26.270 49.339 26.920  1.00 111.92 ? 638  LYS A CD    1 
ATOM   4134 C CE    . LYS A 1 625 ? -25.286 48.309 26.392  1.00 106.38 ? 638  LYS A CE    1 
ATOM   4135 N NZ    . LYS A 1 625 ? -25.436 47.005 27.089  1.00 114.93 ? 638  LYS A NZ    1 
ATOM   4136 N N     . ASP A 1 626 ? -22.509 53.156 25.290  1.00 127.35 ? 639  ASP A N     1 
ATOM   4137 C CA    . ASP A 1 626 ? -21.230 53.854 25.384  1.00 133.60 ? 639  ASP A CA    1 
ATOM   4138 C C     . ASP A 1 626 ? -21.223 55.012 24.389  1.00 135.05 ? 639  ASP A C     1 
ATOM   4139 O O     . ASP A 1 626 ? -21.543 54.816 23.216  1.00 115.62 ? 639  ASP A O     1 
ATOM   4140 C CB    . ASP A 1 626 ? -20.071 52.902 25.082  1.00 134.24 ? 639  ASP A CB    1 
ATOM   4141 N N     . PRO A 1 627 ? -20.863 56.226 24.851  1.00 109.08 ? 640  PRO A N     1 
ATOM   4142 C CA    . PRO A 1 627 ? -20.850 57.384 23.951  1.00 112.11 ? 640  PRO A CA    1 
ATOM   4143 C C     . PRO A 1 627 ? -19.747 57.290 22.898  1.00 111.36 ? 640  PRO A C     1 
ATOM   4144 O O     . PRO A 1 627 ? -19.955 57.693 21.754  1.00 115.68 ? 640  PRO A O     1 
ATOM   4145 C CB    . PRO A 1 627 ? -20.611 58.567 24.895  1.00 115.83 ? 640  PRO A CB    1 
ATOM   4146 C CG    . PRO A 1 627 ? -19.914 57.983 26.074  1.00 126.14 ? 640  PRO A CG    1 
ATOM   4147 C CD    . PRO A 1 627 ? -20.408 56.573 26.211  1.00 101.99 ? 640  PRO A CD    1 
ATOM   4148 N N     . GLU A 1 628 ? -18.588 56.764 23.289  1.00 103.21 ? 641  GLU A N     1 
ATOM   4149 C CA    . GLU A 1 628 ? -17.517 56.467 22.348  1.00 116.61 ? 641  GLU A CA    1 
ATOM   4150 C C     . GLU A 1 628 ? -17.536 54.965 22.050  1.00 133.69 ? 641  GLU A C     1 
ATOM   4151 O O     . GLU A 1 628 ? -16.600 54.234 22.377  1.00 152.97 ? 641  GLU A O     1 
ATOM   4152 C CB    . GLU A 1 628 ? -16.164 56.921 22.915  1.00 123.86 ? 641  GLU A CB    1 
ATOM   4153 C CG    . GLU A 1 628 ? -14.964 56.772 21.980  1.00 130.18 ? 641  GLU A CG    1 
ATOM   4154 C CD    . GLU A 1 628 ? -15.163 57.430 20.626  1.00 137.58 ? 641  GLU A CD    1 
ATOM   4155 O OE1   . GLU A 1 628 ? -15.883 56.857 19.780  1.00 140.54 ? 641  GLU A OE1   1 
ATOM   4156 O OE2   . GLU A 1 628 ? -14.579 58.510 20.398  1.00 138.36 ? 641  GLU A OE2   1 
ATOM   4157 N N     . ALA A 1 629 ? -18.630 54.515 21.440  1.00 120.52 ? 642  ALA A N     1 
ATOM   4158 C CA    . ALA A 1 629 ? -18.781 53.115 21.044  1.00 117.32 ? 642  ALA A CA    1 
ATOM   4159 C C     . ALA A 1 629 ? -18.142 52.853 19.682  1.00 96.31  ? 642  ALA A C     1 
ATOM   4160 O O     . ALA A 1 629 ? -17.690 51.742 19.410  1.00 92.27  ? 642  ALA A O     1 
ATOM   4161 C CB    . ALA A 1 629 ? -20.251 52.725 21.018  1.00 130.26 ? 642  ALA A CB    1 
ATOM   4162 N N     . THR A 1 630 ? -18.115 53.875 18.829  1.00 112.92 ? 643  THR A N     1 
ATOM   4163 C CA    . THR A 1 630 ? -17.540 53.755 17.492  1.00 106.84 ? 643  THR A CA    1 
ATOM   4164 C C     . THR A 1 630 ? -16.061 53.395 17.566  1.00 98.20  ? 643  THR A C     1 
ATOM   4165 O O     . THR A 1 630 ? -15.663 52.305 17.142  1.00 77.78  ? 643  THR A O     1 
ATOM   4166 C CB    . THR A 1 630 ? -17.710 55.062 16.686  1.00 121.05 ? 643  THR A CB    1 
ATOM   4167 O OG1   . THR A 1 630 ? -19.103 55.385 16.586  1.00 141.66 ? 643  THR A OG1   1 
ATOM   4168 C CG2   . THR A 1 630 ? -17.120 54.925 15.282  1.00 123.08 ? 643  THR A CG2   1 
ATOM   4169 N N     . GLU A 1 631 ? -15.265 54.305 18.130  1.00 100.23 ? 644  GLU A N     1 
ATOM   4170 C CA    . GLU A 1 631 ? -13.808 54.163 18.179  1.00 95.48  ? 644  GLU A CA    1 
ATOM   4171 C C     . GLU A 1 631 ? -13.381 52.871 18.866  1.00 106.53 ? 644  GLU A C     1 
ATOM   4172 O O     . GLU A 1 631 ? -12.468 52.189 18.400  1.00 99.56  ? 644  GLU A O     1 
ATOM   4173 C CB    . GLU A 1 631 ? -13.181 55.357 18.897  1.00 85.99  ? 644  GLU A CB    1 
ATOM   4174 N N     . LYS A 1 632 ? -14.058 52.541 19.965  1.00 96.40  ? 645  LYS A N     1 
ATOM   4175 C CA    . LYS A 1 632 ? -13.788 51.322 20.729  1.00 89.23  ? 645  LYS A CA    1 
ATOM   4176 C C     . LYS A 1 632 ? -13.997 50.042 19.909  1.00 100.44 ? 645  LYS A C     1 
ATOM   4177 O O     . LYS A 1 632 ? -13.342 49.029 20.160  1.00 94.91  ? 645  LYS A O     1 
ATOM   4178 C CB    . LYS A 1 632 ? -14.668 51.284 21.986  1.00 74.46  ? 645  LYS A CB    1 
ATOM   4179 N N     . LEU A 1 633 ? -14.912 50.087 18.942  1.00 105.60 ? 646  LEU A N     1 
ATOM   4180 C CA    . LEU A 1 633 ? -15.144 48.953 18.046  1.00 115.24 ? 646  LEU A CA    1 
ATOM   4181 C C     . LEU A 1 633 ? -14.039 48.855 16.995  1.00 95.59  ? 646  LEU A C     1 
ATOM   4182 O O     . LEU A 1 633 ? -13.508 47.769 16.747  1.00 81.78  ? 646  LEU A O     1 
ATOM   4183 C CB    . LEU A 1 633 ? -16.510 49.066 17.363  1.00 111.45 ? 646  LEU A CB    1 
ATOM   4184 N N     . LEU A 1 634 ? -13.697 49.987 16.381  1.00 69.27  ? 647  LEU A N     1 
ATOM   4185 C CA    . LEU A 1 634 ? -12.623 50.030 15.383  1.00 87.65  ? 647  LEU A CA    1 
ATOM   4186 C C     . LEU A 1 634 ? -11.268 49.796 16.045  1.00 109.40 ? 647  LEU A C     1 
ATOM   4187 O O     . LEU A 1 634 ? -10.333 49.315 15.404  1.00 108.93 ? 647  LEU A O     1 
ATOM   4188 C CB    . LEU A 1 634 ? -12.620 51.367 14.634  1.00 75.66  ? 647  LEU A CB    1 
ATOM   4189 N N     . ARG A 1 635 ? -11.176 50.144 17.329  1.00 110.71 ? 648  ARG A N     1 
ATOM   4190 C CA    . ARG A 1 635 ? -9.994  49.856 18.140  1.00 106.42 ? 648  ARG A CA    1 
ATOM   4191 C C     . ARG A 1 635 ? -9.781  48.348 18.275  1.00 113.95 ? 648  ARG A C     1 
ATOM   4192 O O     . ARG A 1 635 ? -8.643  47.885 18.273  1.00 126.66 ? 648  ARG A O     1 
ATOM   4193 C CB    . ARG A 1 635 ? -10.136 50.482 19.535  1.00 113.78 ? 648  ARG A CB    1 
ATOM   4194 C CG    . ARG A 1 635 ? -8.846  50.558 20.341  1.00 109.55 ? 648  ARG A CG    1 
ATOM   4195 C CD    . ARG A 1 635 ? -9.113  50.759 21.828  1.00 123.27 ? 648  ARG A CD    1 
ATOM   4196 N NE    . ARG A 1 635 ? -10.097 51.804 22.112  1.00 137.81 ? 648  ARG A NE    1 
ATOM   4197 C CZ    . ARG A 1 635 ? -9.860  53.116 22.067  1.00 140.67 ? 648  ARG A CZ    1 
ATOM   4198 N NH1   . ARG A 1 635 ? -8.659  53.588 21.734  1.00 123.13 ? 648  ARG A NH1   1 
ATOM   4199 N NH2   . ARG A 1 635 ? -10.840 53.970 22.349  1.00 131.85 ? 648  ARG A NH2   1 
ATOM   4200 N N     . TYR A 1 636 ? -10.878 47.592 18.368  1.00 126.06 ? 649  TYR A N     1 
ATOM   4201 C CA    . TYR A 1 636 ? -10.834 46.133 18.572  1.00 101.03 ? 649  TYR A CA    1 
ATOM   4202 C C     . TYR A 1 636 ? -10.065 45.352 17.493  1.00 96.59  ? 649  TYR A C     1 
ATOM   4203 O O     . TYR A 1 636 ? -9.963  44.127 17.576  1.00 73.21  ? 649  TYR A O     1 
ATOM   4204 C CB    . TYR A 1 636 ? -12.255 45.571 18.706  1.00 93.48  ? 649  TYR A CB    1 
ATOM   4205 N N     . ALA A 1 637 ? -9.567  46.062 16.478  1.00 123.09 ? 650  ALA A N     1 
ATOM   4206 C CA    . ALA A 1 637 ? -8.500  45.577 15.601  1.00 114.91 ? 650  ALA A CA    1 
ATOM   4207 C C     . ALA A 1 637 ? -7.422  46.672 15.518  1.00 108.49 ? 650  ALA A C     1 
ATOM   4208 O O     . ALA A 1 637 ? -7.780  47.825 15.271  1.00 84.06  ? 650  ALA A O     1 
ATOM   4209 C CB    . ALA A 1 637 ? -9.056  45.279 14.218  1.00 96.29  ? 650  ALA A CB    1 
ATOM   4210 N N     . GLN A 1 638 ? -6.123  46.382 15.695  1.00 99.68  ? 651  GLN A N     1 
ATOM   4211 C CA    . GLN A 1 638 ? -5.494  45.045 15.820  1.00 122.89 ? 651  GLN A CA    1 
ATOM   4212 C C     . GLN A 1 638 ? -6.244  43.849 15.225  1.00 120.86 ? 651  GLN A C     1 
ATOM   4213 O O     . GLN A 1 638 ? -5.625  42.896 14.745  1.00 80.15  ? 651  GLN A O     1 
ATOM   4214 C CB    . GLN A 1 638 ? -5.087  44.748 17.279  1.00 121.33 ? 651  GLN A CB    1 
ATOM   4215 C CG    . GLN A 1 638 ? -6.171  44.943 18.331  1.00 113.62 ? 651  GLN A CG    1 
ATOM   4216 C CD    . GLN A 1 638 ? -6.179  46.337 18.943  1.00 110.80 ? 651  GLN A CD    1 
ATOM   4217 O OE1   . GLN A 1 638 ? -5.623  47.283 18.383  1.00 84.23  ? 651  GLN A OE1   1 
ATOM   4218 N NE2   . GLN A 1 638 ? -6.827  46.470 20.100  1.00 76.42  ? 651  GLN A NE2   1 
HETATM 4219 N N3    . THG B 2 .   ? -34.234 46.322 2.807   1.00 76.46  ? 1652 THG A N3    1 
HETATM 4220 C C2    . THG B 2 .   ? -34.865 45.641 1.813   1.00 82.31  ? 1652 THG A C2    1 
HETATM 4221 N N1    . THG B 2 .   ? -34.223 45.215 0.711   1.00 73.72  ? 1652 THG A N1    1 
HETATM 4222 C C8A   . THG B 2 .   ? -32.919 45.434 0.530   1.00 66.62  ? 1652 THG A C8A   1 
HETATM 4223 C C4A   . THG B 2 .   ? -32.163 46.187 1.558   1.00 69.80  ? 1652 THG A C4A   1 
HETATM 4224 C C4    . THG B 2 .   ? -32.918 46.619 2.755   1.00 69.25  ? 1652 THG A C4    1 
HETATM 4225 N N8    . THG B 2 .   ? -32.298 45.020 -0.596  1.00 67.70  ? 1652 THG A N8    1 
HETATM 4226 C C7    . THG B 2 .   ? -30.921 45.408 -0.861  1.00 79.25  ? 1652 THG A C7    1 
HETATM 4227 C C6    . THG B 2 .   ? -30.131 45.569 0.436   1.00 72.57  ? 1652 THG A C6    1 
HETATM 4228 N N5    . THG B 2 .   ? -30.836 46.371 1.417   1.00 61.32  ? 1652 THG A N5    1 
HETATM 4229 C C9    . THG B 2 .   ? -29.916 44.183 1.046   1.00 70.61  ? 1652 THG A C9    1 
HETATM 4230 N N10   . THG B 2 .   ? -28.841 43.460 0.393   1.00 68.92  ? 1652 THG A N10   1 
HETATM 4231 C "C4'" . THG B 2 .   ? -27.526 43.673 0.656   1.00 83.86  ? 1652 THG A "C4'" 1 
HETATM 4232 C "C3'" . THG B 2 .   ? -27.087 44.655 1.548   1.00 77.54  ? 1652 THG A "C3'" 1 
HETATM 4233 C "C2'" . THG B 2 .   ? -25.728 44.828 1.789   1.00 88.48  ? 1652 THG A "C2'" 1 
HETATM 4234 C "C1'" . THG B 2 .   ? -24.792 44.020 1.148   1.00 86.41  ? 1652 THG A "C1'" 1 
HETATM 4235 C "C6'" . THG B 2 .   ? -25.227 43.038 0.260   1.00 93.05  ? 1652 THG A "C6'" 1 
HETATM 4236 C "C5'" . THG B 2 .   ? -26.586 42.866 0.017   1.00 83.22  ? 1652 THG A "C5'" 1 
HETATM 4237 C C11   . THG B 2 .   ? -23.329 44.225 1.421   1.00 99.35  ? 1652 THG A C11   1 
HETATM 4238 N N     . THG B 2 .   ? -22.451 44.090 0.422   1.00 96.24  ? 1652 THG A N     1 
HETATM 4239 C CA    . THG B 2 .   ? -21.035 44.357 0.595   1.00 91.87  ? 1652 THG A CA    1 
HETATM 4240 C C     . THG B 2 .   ? -20.815 45.819 0.862   1.00 97.91  ? 1652 THG A C     1 
HETATM 4241 O OX2   . THG B 2 .   ? -20.279 46.149 1.941   1.00 94.44  ? 1652 THG A OX2   1 
HETATM 4242 O OX1   . THG B 2 .   ? -21.191 46.652 0.008   1.00 81.87  ? 1652 THG A OX1   1 
HETATM 4243 C CB    . THG B 2 .   ? -20.244 43.926 -0.639  1.00 101.89 ? 1652 THG A CB    1 
HETATM 4244 C CG    . THG B 2 .   ? -20.067 42.408 -0.685  1.00 109.69 ? 1652 THG A CG    1 
HETATM 4245 C CD    . THG B 2 .   ? -19.301 41.962 -1.917  1.00 110.57 ? 1652 THG A CD    1 
HETATM 4246 O OE1   . THG B 2 .   ? -19.087 40.738 -2.066  1.00 95.09  ? 1652 THG A OE1   1 
HETATM 4247 O OE2   . THG B 2 .   ? -18.904 42.813 -2.745  1.00 116.51 ? 1652 THG A OE2   1 
HETATM 4248 O O11   . THG B 2 .   ? -22.987 44.538 2.552   1.00 95.75  ? 1652 THG A O11   1 
HETATM 4249 O O4    . THG B 2 .   ? -32.372 47.246 3.687   1.00 74.64  ? 1652 THG A O4    1 
HETATM 4250 N N2    . THG B 2 .   ? -36.192 45.385 1.939   1.00 85.72  ? 1652 THG A N2    1 
HETATM 4251 O O     . HOH C 3 .   ? -60.859 19.094 -44.430 1.00 60.13  ? 2001 HOH A O     1 
HETATM 4252 O O     . HOH C 3 .   ? -38.157 57.348 17.938  1.00 78.30  ? 2002 HOH A O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . THR A 4   ? 1.6158 1.5719 1.5585 0.4497  0.0196  0.0695  17  THR A N   
2    C CA  . THR A 4   ? 1.5906 1.4699 1.6251 0.3830  0.0723  0.1429  17  THR A CA  
3    C C   . THR A 4   ? 1.4577 1.4671 1.4999 0.3143  0.1054  0.1514  17  THR A C   
4    O O   . THR A 4   ? 1.3887 1.5148 1.4001 0.2944  0.0852  0.1044  17  THR A O   
5    C CB  . THR A 4   ? 1.6320 1.3502 1.8083 0.3328  0.0444  0.1495  17  THR A CB  
6    N N   . LEU A 5   ? 1.4382 1.4195 1.5176 0.2850  0.1597  0.2163  18  LEU A N   
7    C CA  . LEU A 5   ? 1.3256 1.4002 1.4098 0.2266  0.1854  0.2240  18  LEU A CA  
8    C C   . LEU A 5   ? 1.2601 1.3169 1.4237 0.1507  0.1598  0.2017  18  LEU A C   
9    O O   . LEU A 5   ? 1.1743 1.3119 1.3185 0.1071  0.1638  0.1865  18  LEU A O   
10   C CB  . LEU A 5   ? 1.3494 1.3883 1.4401 0.2375  0.2470  0.2989  18  LEU A CB  
11   N N   . ARG A 6   ? 1.3195 1.2638 1.5741 0.1403  0.1286  0.1957  19  ARG A N   
12   C CA  . ARG A 6   ? 1.2790 1.2047 1.6064 0.0894  0.0891  0.1604  19  ARG A CA  
13   C C   . ARG A 6   ? 1.2589 1.2702 1.4967 0.1033  0.0492  0.0956  19  ARG A C   
14   O O   . ARG A 6   ? 1.2084 1.2564 1.4408 0.0656  0.0455  0.0826  19  ARG A O   
15   C CB  . ARG A 6   ? 1.3551 1.1485 1.8130 0.0869  0.0455  0.1477  19  ARG A CB  
16   N N   . ASP A 7   ? 1.3103 1.3524 1.4718 0.1666  0.0255  0.0615  20  ASP A N   
17   C CA  . ASP A 7   ? 1.2972 1.4421 1.3692 0.1943  0.0048  0.0142  20  ASP A CA  
18   C C   . ASP A 7   ? 1.2130 1.4852 1.2452 0.1465  0.0567  0.0374  20  ASP A C   
19   O O   . ASP A 7   ? 1.1886 1.4931 1.2036 0.1157  0.0599  0.0303  20  ASP A O   
20   C CB  . ASP A 7   ? 1.3598 1.5390 1.3565 0.2809  -0.0182 -0.0178 20  ASP A CB  
21   N N   . GLU A 8   ? 1.1891 1.5224 1.2067 0.1466  0.0933  0.0627  21  GLU A N   
22   C CA  . GLU A 8   ? 1.1178 1.5650 1.1206 0.0997  0.1299  0.0729  21  GLU A CA  
23   C C   . GLU A 8   ? 1.0725 1.4650 1.1120 0.0292  0.1461  0.0991  21  GLU A C   
24   O O   . GLU A 8   ? 1.0335 1.4839 1.0607 -0.0183 0.1625  0.0978  21  GLU A O   
25   C CB  . GLU A 8   ? 1.1136 1.6219 1.0977 0.1315  0.1480  0.0810  21  GLU A CB  
26   N N   . ILE A 9   ? 1.0809 1.3619 1.1722 0.0242  0.1446  0.1260  22  ILE A N   
27   C CA  . ILE A 9   ? 1.0380 1.2717 1.1652 -0.0279 0.1577  0.1496  22  ILE A CA  
28   C C   . ILE A 9   ? 1.0281 1.2406 1.1509 -0.0501 0.1316  0.1238  22  ILE A C   
29   O O   . ILE A 9   ? 0.9950 1.2315 1.0820 -0.0874 0.1459  0.1268  22  ILE A O   
30   C CB  . ILE A 9   ? 1.0358 1.1764 1.2433 -0.0230 0.1700  0.1906  22  ILE A CB  
31   N N   . ASN A 10  ? 1.0682 1.2261 1.2206 -0.0178 0.0890  0.0951  23  ASN A N   
32   C CA  . ASN A 10  ? 1.0925 1.2287 1.2223 -0.0093 0.0526  0.0600  23  ASN A CA  
33   C C   . ASN A 10  ? 1.1028 1.3227 1.1272 -0.0012 0.0731  0.0541  23  ASN A C   
34   O O   . ASN A 10  ? 1.1079 1.3167 1.0867 -0.0112 0.0772  0.0553  23  ASN A O   
35   C CB  . ASN A 10  ? 1.1532 1.2247 1.3263 0.0434  -0.0129 0.0115  23  ASN A CB  
36   N N   . ALA A 11  ? 1.1021 1.4087 1.0925 0.0206  0.0913  0.0529  24  ALA A N   
37   C CA  . ALA A 11  ? 1.1305 1.5444 1.0538 0.0218  0.1255  0.0583  24  ALA A CA  
38   C C   . ALA A 11  ? 1.1048 1.5348 1.0287 -0.0545 0.1710  0.0936  24  ALA A C   
39   O O   . ALA A 11  ? 1.1636 1.5871 1.0370 -0.0620 0.1906  0.1079  24  ALA A O   
40   C CB  . ALA A 11  ? 1.1255 1.6522 1.0450 0.0513  0.1385  0.0502  24  ALA A CB  
41   N N   . ILE A 12  ? 1.0534 1.4931 1.0238 -0.1003 0.1855  0.1069  25  ILE A N   
42   C CA  . ILE A 12  ? 1.0441 1.4836 1.0194 -0.1692 0.2145  0.1283  25  ILE A CA  
43   C C   . ILE A 12  ? 1.0763 1.4000 1.0244 -0.1856 0.2080  0.1421  25  ILE A C   
44   O O   . ILE A 12  ? 1.0962 1.3998 1.0106 -0.2241 0.2331  0.1614  25  ILE A O   
45   C CB  . ILE A 12  ? 0.9748 1.4348 0.9899 -0.1890 0.2139  0.1257  25  ILE A CB  
46   N N   . LEU A 13  ? 1.0900 1.3382 1.0614 -0.1549 0.1751  0.1329  26  LEU A N   
47   C CA  . LEU A 13  ? 1.1102 1.2668 1.0703 -0.1590 0.1602  0.1364  26  LEU A CA  
48   C C   . LEU A 13  ? 1.1670 1.3004 1.0503 -0.1264 0.1522  0.1270  26  LEU A C   
49   O O   . LEU A 13  ? 1.2291 1.3025 1.0602 -0.1359 0.1595  0.1402  26  LEU A O   
50   C CB  . LEU A 13  ? 1.0858 1.1929 1.1286 -0.1370 0.1276  0.1267  26  LEU A CB  
51   C CG  . LEU A 13  ? 1.0448 1.1518 1.1469 -0.1548 0.1491  0.1552  26  LEU A CG  
52   C CD1 . LEU A 13  ? 1.0319 1.0993 1.2415 -0.1353 0.1310  0.1587  26  LEU A CD1 
53   C CD2 . LEU A 13  ? 1.0474 1.1285 1.1165 -0.1838 0.1680  0.1749  26  LEU A CD2 
54   N N   . GLN A 14  ? 1.1782 1.3541 1.0372 -0.0730 0.1366  0.1045  27  GLN A N   
55   C CA  . GLN A 14  ? 1.2603 1.4247 1.0206 -0.0143 0.1317  0.0966  27  GLN A CA  
56   C C   . GLN A 14  ? 1.3065 1.4991 0.9929 -0.0472 0.2020  0.1488  27  GLN A C   
57   O O   . GLN A 14  ? 1.4035 1.5537 0.9909 -0.0060 0.2156  0.1645  27  GLN A O   
58   C CB  . GLN A 14  ? 1.2831 1.4954 1.0222 0.0654  0.0985  0.0581  27  GLN A CB  
59   N N   . LYS A 15  ? 1.2633 1.5240 1.0040 -0.1177 0.2453  0.1749  28  LYS A N   
60   C CA  . LYS A 15  ? 1.3118 1.6048 1.0318 -0.1707 0.3134  0.2247  28  LYS A CA  
61   C C   . LYS A 15  ? 1.3078 1.5106 1.0428 -0.2458 0.3239  0.2448  28  LYS A C   
62   O O   . LYS A 15  ? 1.4114 1.5439 1.0830 -0.2623 0.3614  0.2851  28  LYS A O   
63   C CB  . LYS A 15  ? 1.2645 1.7061 1.0593 -0.2016 0.3447  0.2276  28  LYS A CB  
64   N N   . ARG A 16  ? 1.2172 1.4140 1.0223 -0.2792 0.2924  0.2194  29  ARG A N   
65   C CA  . ARG A 16  ? 1.2294 1.3504 1.0449 -0.3377 0.2929  0.2273  29  ARG A CA  
66   C C   . ARG A 16  ? 1.1834 1.2443 1.0105 -0.3134 0.2488  0.2045  29  ARG A C   
67   O O   . ARG A 16  ? 1.1136 1.2173 0.9864 -0.2785 0.2254  0.1852  29  ARG A O   
68   C CB  . ARG A 16  ? 1.1941 1.3990 1.0921 -0.4028 0.3072  0.2199  29  ARG A CB  
69   N N   . ILE A 17  ? 1.2322 1.1924 1.0202 -0.3290 0.2428  0.2123  30  ILE A N   
70   C CA  . ILE A 17  ? 1.1995 1.1179 1.0009 -0.3013 0.2121  0.1995  30  ILE A CA  
71   C C   . ILE A 17  ? 1.1668 1.1284 1.0145 -0.3172 0.2062  0.1872  30  ILE A C   
72   O O   . ILE A 17  ? 1.2299 1.1619 1.0611 -0.3536 0.2049  0.1804  30  ILE A O   
73   C CB  . ILE A 17  ? 1.2812 1.0808 1.0058 -0.2935 0.2049  0.2086  30  ILE A CB  
74   N N   . MET A 18  ? 1.1174 1.1396 1.0194 -0.2823 0.1996  0.1827  31  MET A N   
75   C CA  . MET A 18  ? 1.0922 1.1594 1.0150 -0.2690 0.1961  0.1739  31  MET A CA  
76   C C   . MET A 18  ? 1.1279 1.1322 1.0117 -0.2469 0.1861  0.1764  31  MET A C   
77   O O   . MET A 18  ? 1.1423 1.0781 1.0006 -0.2363 0.1838  0.1890  31  MET A O   
78   C CB  . MET A 18  ? 1.0291 1.1527 1.0028 -0.2237 0.2027  0.1843  31  MET A CB  
79   C CG  . MET A 18  ? 1.0086 1.2032 1.0073 -0.2260 0.2047  0.1722  31  MET A CG  
80   S SD  . MET A 18  ? 0.9949 1.2259 1.0354 -0.1653 0.2110  0.1857  31  MET A SD  
81   C CE  . MET A 18  ? 1.0013 1.2785 1.0551 -0.1577 0.2004  0.1654  31  MET A CE  
82   N N   . VAL A 19  ? 1.1719 1.2073 1.0437 -0.2255 0.1750  0.1582  32  VAL A N   
83   C CA  . VAL A 19  ? 1.2507 1.2362 1.0673 -0.1815 0.1611  0.1544  32  VAL A CA  
84   C C   . VAL A 19  ? 1.2534 1.2964 1.0724 -0.1009 0.1782  0.1753  32  VAL A C   
85   O O   . VAL A 19  ? 1.2522 1.3660 1.0894 -0.0824 0.1807  0.1667  32  VAL A O   
86   C CB  . VAL A 19  ? 1.3183 1.2694 1.0972 -0.2093 0.1216  0.1046  32  VAL A CB  
87   C CG1 . VAL A 19  ? 1.4104 1.2901 1.1091 -0.1496 0.0966  0.0924  32  VAL A CG1 
88   C CG2 . VAL A 19  ? 1.3478 1.2403 1.1369 -0.2951 0.1229  0.1018  32  VAL A CG2 
89   N N   . LEU A 20  ? 1.3011 1.3170 1.0990 -0.0455 0.1962  0.2088  33  LEU A N   
90   C CA  . LEU A 20  ? 1.3292 1.3913 1.1151 0.0443  0.2285  0.2464  33  LEU A CA  
91   C C   . LEU A 20  ? 1.4202 1.4585 1.0986 0.1142  0.2004  0.2177  33  LEU A C   
92   O O   . LEU A 20  ? 1.4414 1.4097 1.0741 0.0963  0.1683  0.1895  33  LEU A O   
93   C CB  . LEU A 20  ? 1.3166 1.3844 1.1790 0.0617  0.2786  0.3130  33  LEU A CB  
94   C CG  . LEU A 20  ? 1.3997 1.5129 1.2715 0.1516  0.3380  0.3807  33  LEU A CG  
95   C CD1 . LEU A 20  ? 1.4313 1.5801 1.3163 0.1723  0.3591  0.3977  33  LEU A CD1 
96   C CD2 . LEU A 20  ? 1.3931 1.5182 1.3841 0.1451  0.3855  0.4427  33  LEU A CD2 
97   N N   . ASP A 21  ? 0.9840 1.5461 1.1707 -0.1947 -0.0019 0.2654  34  ASP A N   
98   C CA  . ASP A 21  ? 1.0568 1.5357 1.2392 -0.2070 0.0013  0.2634  34  ASP A CA  
99   C C   . ASP A 21  ? 1.0859 1.4951 1.2573 -0.1835 0.0051  0.2752  34  ASP A C   
100  O O   . ASP A 21  ? 1.0655 1.4945 1.2329 -0.1567 0.0025  0.2760  34  ASP A O   
101  C CB  . ASP A 21  ? 1.0323 1.5090 1.2177 -0.2135 -0.0076 0.2242  34  ASP A CB  
102  C CG  . ASP A 21  ? 0.9970 1.4657 1.1757 -0.1830 -0.0165 0.1981  34  ASP A CG  
103  O OD1 . ASP A 21  ? 0.9576 1.4459 1.1321 -0.1610 -0.0169 0.2033  34  ASP A OD1 
104  O OD2 . ASP A 21  ? 0.9358 1.3814 1.1124 -0.1831 -0.0223 0.1718  34  ASP A OD2 
105  N N   . GLY A 22  ? 1.1659 1.4969 1.3321 -0.1948 0.0121  0.2825  35  GLY A N   
106  C CA  . GLY A 22  ? 1.2704 1.5315 1.4256 -0.1709 0.0160  0.2904  35  GLY A CA  
107  C C   . GLY A 22  ? 1.3740 1.6212 1.5267 -0.1532 0.0061  0.2550  35  GLY A C   
108  O O   . GLY A 22  ? 1.4382 1.7211 1.5961 -0.1593 -0.0030 0.2258  35  GLY A O   
109  N N   . GLY A 23  ? 1.4026 1.6000 1.5462 -0.1293 0.0085  0.2589  36  GLY A N   
110  C CA  . GLY A 23  ? 1.3302 1.5114 1.4693 -0.1133 0.0006  0.2283  36  GLY A CA  
111  C C   . GLY A 23  ? 1.3284 1.4672 1.4685 -0.1325 -0.0017 0.2014  36  GLY A C   
112  O O   . GLY A 23  ? 1.3366 1.4189 1.4752 -0.1482 0.0063  0.2082  36  GLY A O   
113  N N   . MET A 24  ? 1.2540 1.4200 1.3950 -0.1314 -0.0119 0.1708  37  MET A N   
114  C CA  . MET A 24  ? 1.2682 1.4120 1.4102 -0.1479 -0.0158 0.1430  37  MET A CA  
115  C C   . MET A 24  ? 1.2378 1.3150 1.3716 -0.1380 -0.0134 0.1325  37  MET A C   
116  O O   . MET A 24  ? 1.2375 1.2794 1.3723 -0.1570 -0.0112 0.1169  37  MET A O   
117  C CB  . MET A 24  ? 1.2456 1.4398 1.3875 -0.1424 -0.0269 0.1173  37  MET A CB  
118  N N   . GLY A 25  ? 1.2120 1.2783 1.3380 -0.1095 -0.0133 0.1387  38  GLY A N   
119  C CA  . GLY A 25  ? 1.1885 1.2007 1.3062 -0.0950 -0.0113 0.1283  38  GLY A CA  
120  C C   . GLY A 25  ? 1.2306 1.1740 1.3473 -0.1068 -0.0008 0.1350  38  GLY A C   
121  O O   . GLY A 25  ? 1.2519 1.1534 1.3651 -0.1109 -0.0003 0.1122  38  GLY A O   
122  N N   . THR A 26  ? 1.2251 1.1553 1.3431 -0.1129 0.0086  0.1660  39  THR A N   
123  C CA  . THR A 26  ? 1.2769 1.1310 1.3903 -0.1262 0.0220  0.1770  39  THR A CA  
124  C C   . THR A 26  ? 1.3106 1.1469 1.4290 -0.1663 0.0230  0.1501  39  THR A C   
125  O O   . THR A 26  ? 1.3919 1.1593 1.5043 -0.1760 0.0311  0.1367  39  THR A O   
126  C CB  . THR A 26  ? 1.2950 1.1456 1.4070 -0.1284 0.0326  0.2194  39  THR A CB  
127  N N   . MET A 27  ? 1.2717 1.1744 1.4005 -0.1887 0.0151  0.1401  40  MET A N   
128  C CA  . MET A 27  ? 1.2835 1.1921 1.4184 -0.2274 0.0147  0.1130  40  MET A CA  
129  C C   . MET A 27  ? 1.2891 1.1981 1.4224 -0.2220 0.0059  0.0742  40  MET A C   
130  O O   . MET A 27  ? 1.4063 1.2786 1.5387 -0.2460 0.0109  0.0509  40  MET A O   
131  C CB  . MET A 27  ? 1.2380 1.2301 1.3841 -0.2465 0.0081  0.1142  40  MET A CB  
132  N N   . ILE A 28  ? 1.2072 1.1577 1.3388 -0.1925 -0.0059 0.0669  41  ILE A N   
133  C CA  . ILE A 28  ? 1.1720 1.1268 1.2993 -0.1833 -0.0142 0.0346  41  ILE A CA  
134  C C   . ILE A 28  ? 1.2296 1.1111 1.3488 -0.1750 -0.0068 0.0254  41  ILE A C   
135  O O   . ILE A 28  ? 1.2875 1.1562 1.4056 -0.1873 -0.0079 -0.0048 41  ILE A O   
136  C CB  . ILE A 28  ? 1.0878 1.0887 1.2102 -0.1525 -0.0253 0.0341  41  ILE A CB  
137  C CG1 . ILE A 28  ? 1.0369 1.1085 1.1654 -0.1595 -0.0331 0.0330  41  ILE A CG1 
138  C CG2 . ILE A 28  ? 1.0566 1.0501 1.1707 -0.1395 -0.0314 0.0073  41  ILE A CG2 
139  C CD1 . ILE A 28  ? 0.9953 1.1014 1.1173 -0.1321 -0.0393 0.0406  41  ILE A CD1 
140  N N   . GLN A 29  ? 1.2519 1.0908 1.3652 -0.1522 0.0007  0.0507  42  GLN A N   
141  C CA  . GLN A 29  ? 1.3030 1.0674 1.4073 -0.1401 0.0098  0.0450  42  GLN A CA  
142  C C   . GLN A 29  ? 1.3619 1.0684 1.4664 -0.1760 0.0215  0.0315  42  GLN A C   
143  O O   . GLN A 29  ? 1.3786 1.0433 1.4784 -0.1800 0.0249  0.0034  42  GLN A O   
144  C CB  . GLN A 29  ? 1.2894 1.0245 1.3869 -0.1082 0.0174  0.0799  42  GLN A CB  
145  N N   . ARG A 30  ? 1.3798 1.0870 1.4892 -0.2046 0.0283  0.0500  43  ARG A N   
146  C CA  . ARG A 30  ? 1.4491 1.1064 1.5580 -0.2479 0.0411  0.0373  43  ARG A CA  
147  C C   . ARG A 30  ? 1.4428 1.1441 1.5593 -0.2789 0.0333  -0.0065 43  ARG A C   
148  O O   . ARG A 30  ? 1.5517 1.2065 1.6654 -0.3095 0.0431  -0.0323 43  ARG A O   
149  C CB  . ARG A 30  ? 1.4664 1.1293 1.5785 -0.2741 0.0497  0.0689  43  ARG A CB  
150  N N   . GLU A 31  ? 1.3484 1.1392 1.4729 -0.2702 0.0168  -0.0154 44  GLU A N   
151  C CA  . GLU A 31  ? 1.3144 1.1617 1.4450 -0.2916 0.0077  -0.0539 44  GLU A CA  
152  C C   . GLU A 31  ? 1.3437 1.1603 1.4676 -0.2833 0.0069  -0.0875 44  GLU A C   
153  O O   . GLU A 31  ? 1.3380 1.1812 1.4652 -0.3102 0.0050  -0.1226 44  GLU A O   
154  C CB  . GLU A 31  ? 1.2248 1.1652 1.3607 -0.2728 -0.0088 -0.0516 44  GLU A CB  
155  N N   . LYS A 32  ? 1.3852 1.1550 1.4998 -0.2462 0.0082  -0.0779 45  LYS A N   
156  C CA  . LYS A 32  ? 1.4183 1.1590 1.5257 -0.2338 0.0080  -0.1081 45  LYS A CA  
157  C C   . LYS A 32  ? 1.4008 1.2204 1.5108 -0.2335 -0.0069 -0.1368 45  LYS A C   
158  O O   . LYS A 32  ? 1.4289 1.2626 1.5412 -0.2605 -0.0065 -0.1717 45  LYS A O   
159  C CB  . LYS A 32  ? 1.4805 1.1449 1.5845 -0.2649 0.0242  -0.1303 45  LYS A CB  
160  N N   . LEU A 33  ? 1.3685 1.2391 1.4763 -0.2029 -0.0190 -0.1216 46  LEU A N   
161  C CA  . LEU A 33  ? 1.3621 1.3080 1.4688 -0.1971 -0.0328 -0.1393 46  LEU A CA  
162  C C   . LEU A 33  ? 1.4371 1.3862 1.5396 -0.2031 -0.0344 -0.1776 46  LEU A C   
163  O O   . LEU A 33  ? 1.5041 1.4911 1.6119 -0.2312 -0.0361 -0.2042 46  LEU A O   
164  C CB  . LEU A 33  ? 1.2665 1.2368 1.3650 -0.1595 -0.0412 -0.1182 46  LEU A CB  
165  N N   . GLU A 35  ? 1.1250 1.0366 1.2075 -0.1393 -0.0373 -0.1690 48  GLU A N   
166  C CA  . GLU A 35  ? 1.1362 1.0831 1.2107 -0.1309 -0.0445 -0.1954 48  GLU A CA  
167  C C   . GLU A 35  ? 1.0968 1.1023 1.1623 -0.1105 -0.0559 -0.1810 48  GLU A C   
168  O O   . GLU A 35  ? 1.1150 1.1587 1.1834 -0.1160 -0.0610 -0.1689 48  GLU A O   
169  C CB  . GLU A 35  ? 1.1575 1.1300 1.2378 -0.1624 -0.0450 -0.2308 48  GLU A CB  
170  N N   . GLU A 36  ? 1.0872 1.0973 1.1400 -0.0870 -0.0585 -0.1828 49  GLU A N   
171  C CA  . GLU A 36  ? 1.0272 1.0821 1.0659 -0.0686 -0.0668 -0.1711 49  GLU A CA  
172  C C   . GLU A 36  ? 1.0002 1.1128 1.0369 -0.0767 -0.0751 -0.1802 49  GLU A C   
173  O O   . GLU A 36  ? 0.9429 1.0824 0.9723 -0.0662 -0.0797 -0.1615 49  GLU A O   
174  C CB  . GLU A 36  ? 1.0322 1.0887 1.0571 -0.0510 -0.0672 -0.1815 49  GLU A CB  
175  C CG  . GLU A 36  ? 1.0296 1.1275 1.0353 -0.0358 -0.0738 -0.1723 49  GLU A CG  
176  C CD  . GLU A 36  ? 1.0375 1.1271 1.0351 -0.0237 -0.0722 -0.1418 49  GLU A CD  
177  O OE1 . GLU A 36  ? 1.0518 1.1098 1.0575 -0.0221 -0.0665 -0.1289 49  GLU A OE1 
178  O OE2 . GLU A 36  ? 1.0788 1.1933 1.0599 -0.0153 -0.0759 -0.1311 49  GLU A OE2 
179  N N   . HIS A 37  ? 1.0506 1.1838 1.0929 -0.0943 -0.0762 -0.2103 50  HIS A N   
180  C CA  . HIS A 37  ? 1.0439 1.2455 1.0843 -0.1005 -0.0844 -0.2227 50  HIS A CA  
181  C C   . HIS A 37  ? 1.0333 1.2605 1.0808 -0.1058 -0.0871 -0.2050 50  HIS A C   
182  O O   . HIS A 37  ? 0.9797 1.2607 1.0181 -0.0923 -0.0947 -0.1985 50  HIS A O   
183  C CB  . HIS A 37  ? 1.0568 1.2764 1.1068 -0.1272 -0.0829 -0.2614 50  HIS A CB  
184  N N   . PHE A 38  ? 1.0817 1.2705 1.1437 -0.1226 -0.0803 -0.1955 51  PHE A N   
185  C CA  . PHE A 38  ? 1.1289 1.3456 1.2003 -0.1326 -0.0817 -0.1819 51  PHE A CA  
186  C C   . PHE A 38  ? 1.1143 1.3366 1.1766 -0.1065 -0.0849 -0.1508 51  PHE A C   
187  O O   . PHE A 38  ? 1.0932 1.3312 1.1640 -0.1126 -0.0847 -0.1377 51  PHE A O   
188  C CB  . PHE A 38  ? 1.1771 1.3506 1.2652 -0.1625 -0.0719 -0.1816 51  PHE A CB  
189  C CG  . PHE A 38  ? 1.2493 1.4305 1.3470 -0.1978 -0.0678 -0.2149 51  PHE A CG  
190  C CD1 . PHE A 38  ? 1.3109 1.4569 1.4053 -0.2028 -0.0631 -0.2399 51  PHE A CD1 
191  C CD2 . PHE A 38  ? 1.2361 1.4632 1.3458 -0.2280 -0.0677 -0.2239 51  PHE A CD2 
192  C CE1 . PHE A 38  ? 1.3064 1.4568 1.4084 -0.2387 -0.0577 -0.2748 51  PHE A CE1 
193  C CE2 . PHE A 38  ? 1.2626 1.4990 1.3803 -0.2664 -0.0623 -0.2577 51  PHE A CE2 
194  C CZ  . PHE A 38  ? 1.3112 1.5062 1.4246 -0.2726 -0.0569 -0.2841 51  PHE A CZ  
195  N N   . ARG A 39  ? 1.1304 1.3401 1.1749 -0.0800 -0.0866 -0.1408 52  ARG A N   
196  C CA  . ARG A 39  ? 1.0556 1.2759 1.0858 -0.0562 -0.0893 -0.1180 52  ARG A CA  
197  C C   . ARG A 39  ? 1.0628 1.3024 1.0692 -0.0336 -0.0939 -0.1199 52  ARG A C   
198  O O   . ARG A 39  ? 1.0710 1.2800 1.0644 -0.0235 -0.0908 -0.1151 52  ARG A O   
199  C CB  . ARG A 39  ? 1.0210 1.1937 1.0502 -0.0499 -0.0827 -0.0966 52  ARG A CB  
200  C CG  . ARG A 39  ? 1.0588 1.2019 1.1079 -0.0688 -0.0763 -0.0914 52  ARG A CG  
201  C CD  . ARG A 39  ? 1.0882 1.1863 1.1399 -0.0723 -0.0706 -0.0994 52  ARG A CD  
202  N NE  . ARG A 39  ? 1.0888 1.1507 1.1555 -0.0868 -0.0629 -0.0910 52  ARG A NE  
203  C CZ  . ARG A 39  ? 0.9999 1.0439 1.0694 -0.0803 -0.0582 -0.0668 52  ARG A CZ  
204  N NH1 . ARG A 39  ? 0.9554 1.0144 1.0150 -0.0631 -0.0600 -0.0518 52  ARG A NH1 
205  N NH2 . ARG A 39  ? 0.9901 1.0007 1.0710 -0.0923 -0.0505 -0.0576 52  ARG A NH2 
206  N N   . GLY A 40  ? 1.0263 1.3209 1.0261 -0.0254 -0.1007 -0.1266 53  GLY A N   
207  C CA  . GLY A 40  ? 1.0075 1.3534 1.0241 -0.0409 -0.1047 -0.1387 53  GLY A CA  
208  C C   . GLY A 40  ? 1.0373 1.4511 1.0439 -0.0303 -0.1124 -0.1532 53  GLY A C   
209  O O   . GLY A 40  ? 1.0468 1.4692 1.0489 -0.0339 -0.1137 -0.1705 53  GLY A O   
210  N N   . GLN A 41  ? 1.0781 1.5458 1.0809 -0.0151 -0.1176 -0.1465 54  GLN A N   
211  C CA  . GLN A 41  ? 1.0936 1.6310 1.0808 0.0068  -0.1252 -0.1524 54  GLN A CA  
212  C C   . GLN A 41  ? 1.0954 1.6081 1.0502 0.0478  -0.1248 -0.1256 54  GLN A C   
213  O O   . GLN A 41  ? 1.0839 1.6025 1.0173 0.0650  -0.1263 -0.1238 54  GLN A O   
214  C CB  . GLN A 41  ? 1.0784 1.6978 1.0784 0.0032  -0.1308 -0.1614 54  GLN A CB  
215  N N   . GLU A 42  ? 1.0931 1.5758 1.0435 0.0613  -0.1214 -0.1053 55  GLU A N   
216  C CA  . GLU A 42  ? 1.1485 1.5985 1.0664 0.0978  -0.1183 -0.0805 55  GLU A CA  
217  C C   . GLU A 42  ? 1.1817 1.5750 1.0771 0.1023  -0.1129 -0.0719 55  GLU A C   
218  O O   . GLU A 42  ? 1.2884 1.6802 1.1525 0.1304  -0.1123 -0.0584 55  GLU A O   
219  C CB  . GLU A 42  ? 1.1349 1.5475 1.0560 0.1009  -0.1128 -0.0662 55  GLU A CB  
220  C CG  . GLU A 42  ? 1.1279 1.4915 1.0143 0.1331  -0.1064 -0.0437 55  GLU A CG  
221  C CD  . GLU A 42  ? 1.1419 1.4886 1.0306 0.1406  -0.1021 -0.0348 55  GLU A CD  
222  O OE1 . GLU A 42  ? 1.0989 1.4976 1.0099 0.1354  -0.1070 -0.0427 55  GLU A OE1 
223  O OE2 . GLU A 42  ? 1.1846 1.4691 1.0523 0.1499  -0.0932 -0.0214 55  GLU A OE2 
224  N N   . PHE A 43  ? 1.1483 1.4970 1.0581 0.0758  -0.1083 -0.0782 56  PHE A N   
225  C CA  . PHE A 43  ? 1.1191 1.4185 1.0098 0.0773  -0.1024 -0.0707 56  PHE A CA  
226  C C   . PHE A 43  ? 1.2417 1.5720 1.1277 0.0748  -0.1064 -0.0857 56  PHE A C   
227  O O   . PHE A 43  ? 1.2513 1.5900 1.1084 0.0961  -0.1065 -0.0753 56  PHE A O   
228  C CB  . PHE A 43  ? 1.0552 1.3027 0.9618 0.0556  -0.0957 -0.0699 56  PHE A CB  
229  C CG  . PHE A 43  ? 0.9878 1.2084 0.8941 0.0597  -0.0908 -0.0545 56  PHE A CG  
230  C CD1 . PHE A 43  ? 0.9679 1.1489 0.8460 0.0747  -0.0835 -0.0373 56  PHE A CD1 
231  C CD2 . PHE A 43  ? 0.9533 1.1905 0.8858 0.0472  -0.0926 -0.0583 56  PHE A CD2 
232  C CE1 . PHE A 43  ? 0.9466 1.1053 0.8236 0.0777  -0.0783 -0.0272 56  PHE A CE1 
233  C CE2 . PHE A 43  ? 0.9206 1.1408 0.8527 0.0518  -0.0883 -0.0457 56  PHE A CE2 
234  C CZ  . PHE A 43  ? 0.9264 1.1080 0.8312 0.0675  -0.0813 -0.0317 56  PHE A CZ  
235  N N   . LYS A 44  ? 1.2467 1.5924 1.1592 0.0493  -0.1088 -0.1100 57  LYS A N   
236  C CA  . LYS A 44  ? 1.2013 1.5872 1.1136 0.0439  -0.1130 -0.1317 57  LYS A CA  
237  C C   . LYS A 44  ? 1.1732 1.5323 1.0657 0.0496  -0.1090 -0.1279 57  LYS A C   
238  O O   . LYS A 44  ? 1.1664 1.5222 1.0705 0.0336  -0.1081 -0.1486 57  LYS A O   
239  C CB  . LYS A 44  ? 1.2277 1.6893 1.1293 0.0619  -0.1210 -0.1345 57  LYS A CB  
240  N N   . ASP A 45  ? 1.1518 1.4918 1.0128 0.0720  -0.1057 -0.1023 58  ASP A N   
241  C CA  . ASP A 45  ? 1.1494 1.4692 0.9871 0.0763  -0.1008 -0.0954 58  ASP A CA  
242  C C   . ASP A 45  ? 1.1492 1.4030 0.9754 0.0738  -0.0909 -0.0755 58  ASP A C   
243  O O   . ASP A 45  ? 1.1800 1.4122 0.9751 0.0833  -0.0847 -0.0576 58  ASP A O   
244  C CB  . ASP A 45  ? 1.1908 1.5467 0.9954 0.1018  -0.1032 -0.0814 58  ASP A CB  
245  C CG  . ASP A 45  ? 1.2272 1.6627 1.0424 0.1068  -0.1134 -0.1000 58  ASP A CG  
246  O OD1 . ASP A 45  ? 1.2513 1.7165 1.0917 0.0853  -0.1172 -0.1307 58  ASP A OD1 
247  O OD2 . ASP A 45  ? 1.1694 1.6391 0.9669 0.1326  -0.1169 -0.0852 58  ASP A OD2 
248  N N   . HIS A 46  ? 1.1219 1.3468 0.9725 0.0590  -0.0885 -0.0789 59  HIS A N   
249  C CA  . HIS A 46  ? 1.1042 1.2781 0.9478 0.0539  -0.0793 -0.0639 59  HIS A CA  
250  C C   . HIS A 46  ? 1.0942 1.2576 0.9383 0.0426  -0.0749 -0.0720 59  HIS A C   
251  O O   . HIS A 46  ? 1.0787 1.2576 0.9441 0.0339  -0.0784 -0.0925 59  HIS A O   
252  C CB  . HIS A 46  ? 1.0762 1.2343 0.9457 0.0443  -0.0789 -0.0637 59  HIS A CB  
253  C CG  . HIS A 46  ? 1.0414 1.1591 0.9004 0.0429  -0.0701 -0.0469 59  HIS A CG  
254  N ND1 . HIS A 46  ? 1.0408 1.1384 0.8714 0.0561  -0.0651 -0.0299 59  HIS A ND1 
255  C CD2 . HIS A 46  ? 1.0239 1.1199 0.8963 0.0299  -0.0646 -0.0457 59  HIS A CD2 
256  C CE1 . HIS A 46  ? 1.0576 1.1223 0.8851 0.0473  -0.0565 -0.0223 59  HIS A CE1 
257  N NE2 . HIS A 46  ? 1.0030 1.0719 0.8562 0.0317  -0.0567 -0.0311 59  HIS A NE2 
258  N N   . ALA A 47  ? 1.1231 1.2602 0.9424 0.0423  -0.0663 -0.0572 60  ALA A N   
259  C CA  . ALA A 47  ? 1.1143 1.2527 0.9287 0.0334  -0.0616 -0.0636 60  ALA A CA  
260  C C   . ALA A 47  ? 1.0701 1.1960 0.9093 0.0220  -0.0585 -0.0712 60  ALA A C   
261  O O   . ALA A 47  ? 1.0234 1.1596 0.8654 0.0180  -0.0562 -0.0811 60  ALA A O   
262  C CB  . ALA A 47  ? 1.1387 1.2575 0.9153 0.0330  -0.0519 -0.0449 60  ALA A CB  
263  N N   . ARG A 48  ? 1.0351 1.1432 0.8909 0.0192  -0.0583 -0.0655 61  ARG A N   
264  C CA  . ARG A 48  ? 1.0307 1.1298 0.9092 0.0120  -0.0554 -0.0685 61  ARG A CA  
265  C C   . ARG A 48  ? 0.9985 1.0994 0.9069 0.0112  -0.0616 -0.0792 61  ARG A C   
266  O O   . ARG A 48  ? 1.0235 1.1312 0.9364 0.0123  -0.0668 -0.0794 61  ARG A O   
267  C CB  . ARG A 48  ? 1.0749 1.1548 0.9476 0.0069  -0.0486 -0.0525 61  ARG A CB  
268  C CG  . ARG A 48  ? 1.1185 1.1912 0.9626 0.0000  -0.0389 -0.0445 61  ARG A CG  
269  C CD  . ARG A 48  ? 1.1539 1.2366 1.0074 -0.0089 -0.0328 -0.0463 61  ARG A CD  
270  N NE  . ARG A 48  ? 1.2801 1.3532 1.1102 -0.0224 -0.0218 -0.0375 61  ARG A NE  
271  C CZ  . ARG A 48  ? 1.3556 1.4432 1.1908 -0.0332 -0.0150 -0.0377 61  ARG A CZ  
272  N NH1 . ARG A 48  ? 1.4350 1.5466 1.2971 -0.0268 -0.0182 -0.0423 61  ARG A NH1 
273  N NH2 . ARG A 48  ? 1.3892 1.4679 1.2008 -0.0504 -0.0037 -0.0333 61  ARG A NH2 
274  N N   . PRO A 49  ? 1.0132 1.1084 0.9407 0.0094  -0.0600 -0.0880 62  PRO A N   
275  C CA  . PRO A 49  ? 0.9997 1.0848 0.9528 0.0051  -0.0628 -0.0958 62  PRO A CA  
276  C C   . PRO A 49  ? 0.9529 1.0274 0.9167 0.0005  -0.0616 -0.0794 62  PRO A C   
277  O O   . PRO A 49  ? 0.8982 0.9679 0.8583 0.0018  -0.0566 -0.0651 62  PRO A O   
278  C CB  . PRO A 49  ? 1.0512 1.1238 1.0152 0.0094  -0.0587 -0.1051 62  PRO A CB  
279  C CG  . PRO A 49  ? 1.0522 1.1359 1.0009 0.0156  -0.0538 -0.0969 62  PRO A CG  
280  C CD  . PRO A 49  ? 1.0269 1.1262 0.9511 0.0128  -0.0551 -0.0925 62  PRO A CD  
281  N N   . LEU A 50  ? 0.9587 1.0368 0.9355 -0.0063 -0.0659 -0.0832 63  LEU A N   
282  C CA  . LEU A 50  ? 0.9406 1.0171 0.9284 -0.0116 -0.0654 -0.0692 63  LEU A CA  
283  C C   . LEU A 50  ? 0.9486 1.0059 0.9593 -0.0207 -0.0623 -0.0681 63  LEU A C   
284  O O   . LEU A 50  ? 0.9060 0.9621 0.9259 -0.0246 -0.0602 -0.0531 63  LEU A O   
285  C CB  . LEU A 50  ? 0.9209 1.0226 0.9064 -0.0129 -0.0716 -0.0721 63  LEU A CB  
286  N N   . LYS A 51  ? 0.9933 1.0336 1.0114 -0.0236 -0.0610 -0.0836 64  LYS A N   
287  C CA  . LYS A 51  ? 0.9757 0.9848 1.0110 -0.0315 -0.0557 -0.0818 64  LYS A CA  
288  C C   . LYS A 51  ? 0.9549 0.9534 0.9931 -0.0226 -0.0502 -0.0573 64  LYS A C   
289  O O   . LYS A 51  ? 0.9628 0.9675 0.9914 -0.0086 -0.0482 -0.0515 64  LYS A O   
290  C CB  . LYS A 51  ? 0.9803 0.9625 1.0170 -0.0292 -0.0523 -0.1020 64  LYS A CB  
291  N N   . GLY A 52  ? 0.9614 0.9515 1.0123 -0.0324 -0.0474 -0.0433 65  GLY A N   
292  C CA  . GLY A 52  ? 0.9593 0.9477 1.0139 -0.0244 -0.0423 -0.0187 65  GLY A CA  
293  C C   . GLY A 52  ? 0.9586 0.9823 1.0106 -0.0265 -0.0449 -0.0059 65  GLY A C   
294  O O   . GLY A 52  ? 0.9910 1.0226 1.0487 -0.0247 -0.0411 0.0133  65  GLY A O   
295  N N   . ASN A 53  ? 0.9184 0.9633 0.9602 -0.0282 -0.0507 -0.0165 66  ASN A N   
296  C CA  . ASN A 53  ? 0.8921 0.9634 0.9285 -0.0281 -0.0521 -0.0078 66  ASN A CA  
297  C C   . ASN A 53  ? 0.8997 0.9866 0.9490 -0.0403 -0.0549 -0.0053 66  ASN A C   
298  O O   . ASN A 53  ? 0.8778 0.9834 0.9232 -0.0420 -0.0604 -0.0155 66  ASN A O   
299  C CB  . ASN A 53  ? 0.8746 0.9544 0.8901 -0.0209 -0.0552 -0.0174 66  ASN A CB  
300  C CG  . ASN A 53  ? 0.8510 0.9457 0.8559 -0.0180 -0.0539 -0.0096 66  ASN A CG  
301  O OD1 . ASN A 53  ? 0.8680 0.9729 0.8810 -0.0211 -0.0506 0.0014  66  ASN A OD1 
302  N ND2 . ASN A 53  ? 0.8533 0.9481 0.8382 -0.0110 -0.0556 -0.0155 66  ASN A ND2 
303  N N   . ASN A 54  ? 0.8877 0.9722 0.9514 -0.0476 -0.0507 0.0094  67  ASN A N   
304  C CA  . ASN A 54  ? 0.8812 0.9840 0.9583 -0.0632 -0.0518 0.0132  67  ASN A CA  
305  C C   . ASN A 54  ? 0.8600 1.0028 0.9325 -0.0600 -0.0566 0.0110  67  ASN A C   
306  O O   . ASN A 54  ? 0.8209 0.9897 0.9010 -0.0702 -0.0602 0.0054  67  ASN A O   
307  C CB  . ASN A 54  ? 0.8957 0.9922 0.9846 -0.0688 -0.0451 0.0353  67  ASN A CB  
308  C CG  . ASN A 54  ? 0.9371 0.9871 1.0300 -0.0707 -0.0388 0.0393  67  ASN A CG  
309  O OD1 . ASN A 54  ? 0.9276 0.9510 1.0169 -0.0713 -0.0396 0.0217  67  ASN A OD1 
310  N ND2 . ASN A 54  ? 0.9617 1.0013 1.0606 -0.0698 -0.0318 0.0628  67  ASN A ND2 
311  N N   . ASP A 55  ? 0.8664 1.0142 0.9253 -0.0461 -0.0555 0.0143  68  ASP A N   
312  C CA  . ASP A 55  ? 0.8523 1.0267 0.9021 -0.0385 -0.0576 0.0122  68  ASP A CA  
313  C C   . ASP A 55  ? 0.8459 1.0329 0.8865 -0.0315 -0.0641 -0.0016 68  ASP A C   
314  O O   . ASP A 55  ? 0.8550 1.0730 0.8962 -0.0272 -0.0669 -0.0030 68  ASP A O   
315  C CB  . ASP A 55  ? 0.8927 1.0569 0.9250 -0.0282 -0.0526 0.0145  68  ASP A CB  
316  C CG  . ASP A 55  ? 0.9005 1.0869 0.9391 -0.0312 -0.0478 0.0252  68  ASP A CG  
317  O OD1 . ASP A 55  ? 1.0845 1.2946 1.1229 -0.0288 -0.0488 0.0233  68  ASP A OD1 
318  O OD2 . ASP A 55  ? 0.8216 1.0073 0.8649 -0.0338 -0.0430 0.0347  68  ASP A OD2 
319  N N   . ILE A 56  ? 0.8497 1.0190 0.8813 -0.0281 -0.0666 -0.0118 69  ILE A N   
320  C CA  . ILE A 56  ? 0.8231 1.0101 0.8431 -0.0179 -0.0727 -0.0232 69  ILE A CA  
321  C C   . ILE A 56  ? 0.8241 1.0466 0.8616 -0.0310 -0.0782 -0.0330 69  ILE A C   
322  O O   . ILE A 56  ? 0.8144 1.0703 0.8453 -0.0217 -0.0840 -0.0418 69  ILE A O   
323  C CB  . ILE A 56  ? 0.8261 0.9893 0.8282 -0.0096 -0.0731 -0.0303 69  ILE A CB  
324  C CG1 . ILE A 56  ? 0.8448 1.0237 0.8253 0.0094  -0.0773 -0.0344 69  ILE A CG1 
325  C CG2 . ILE A 56  ? 0.8254 0.9814 0.8407 -0.0233 -0.0746 -0.0416 69  ILE A CG2 
326  C CD1 . ILE A 56  ? 0.8570 1.0236 0.8165 0.0262  -0.0727 -0.0244 69  ILE A CD1 
327  N N   . LEU A 57  ? 0.8187 1.0356 0.8767 -0.0529 -0.0754 -0.0308 70  LEU A N   
328  C CA  . LEU A 57  ? 0.8286 1.0763 0.9031 -0.0738 -0.0780 -0.0412 70  LEU A CA  
329  C C   . LEU A 57  ? 0.8165 1.1208 0.8959 -0.0717 -0.0817 -0.0399 70  LEU A C   
330  O O   . LEU A 57  ? 0.8314 1.1795 0.9195 -0.0841 -0.0857 -0.0527 70  LEU A O   
331  C CB  . LEU A 57  ? 0.8338 1.0515 0.9253 -0.0986 -0.0710 -0.0352 70  LEU A CB  
332  C CG  . LEU A 57  ? 0.8543 1.0169 0.9422 -0.0984 -0.0664 -0.0378 70  LEU A CG  
333  C CD1 . LEU A 57  ? 0.8750 1.0021 0.9763 -0.1180 -0.0578 -0.0278 70  LEU A CD1 
334  C CD2 . LEU A 57  ? 0.8734 1.0394 0.9558 -0.1003 -0.0706 -0.0620 70  LEU A CD2 
335  N N   . SER A 58  ? 0.7958 1.1039 0.8696 -0.0566 -0.0800 -0.0268 71  SER A N   
336  C CA  . SER A 58  ? 0.7923 1.1540 0.8667 -0.0464 -0.0834 -0.0272 71  SER A CA  
337  C C   . SER A 58  ? 0.8262 1.2208 0.8867 -0.0257 -0.0905 -0.0401 71  SER A C   
338  O O   . SER A 58  ? 0.8477 1.3030 0.9141 -0.0227 -0.0951 -0.0465 71  SER A O   
339  C CB  . SER A 58  ? 0.8012 1.1518 0.8658 -0.0290 -0.0793 -0.0156 71  SER A CB  
340  O OG  . SER A 58  ? 0.8026 1.1405 0.8807 -0.0458 -0.0733 -0.0023 71  SER A OG  
341  N N   . ILE A 59  ? 0.8533 1.2137 0.8946 -0.0103 -0.0912 -0.0429 72  ILE A N   
342  C CA  . ILE A 59  ? 0.8569 1.2456 0.8813 0.0124  -0.0973 -0.0515 72  ILE A CA  
343  C C   . ILE A 59  ? 0.8803 1.2932 0.9141 -0.0054 -0.1019 -0.0683 72  ILE A C   
344  O O   . ILE A 59  ? 0.9065 1.3829 0.9435 -0.0027 -0.1082 -0.0798 72  ILE A O   
345  C CB  . ILE A 59  ? 0.8443 1.1841 0.8385 0.0386  -0.0942 -0.0437 72  ILE A CB  
346  C CG1 . ILE A 59  ? 0.8434 1.1583 0.8258 0.0538  -0.0880 -0.0319 72  ILE A CG1 
347  C CG2 . ILE A 59  ? 0.8589 1.2270 0.8326 0.0648  -0.0999 -0.0483 72  ILE A CG2 
348  C CD1 . ILE A 59  ? 0.8558 1.1141 0.8069 0.0718  -0.0817 -0.0245 72  ILE A CD1 
349  N N   . THR A 60  ? 0.8808 1.2477 0.9188 -0.0232 -0.0984 -0.0715 73  THR A N   
350  C CA  . THR A 60  ? 0.8900 1.2691 0.9324 -0.0378 -0.1013 -0.0906 73  THR A CA  
351  C C   . THR A 60  ? 0.8985 1.2995 0.9662 -0.0752 -0.1000 -0.1048 73  THR A C   
352  O O   . THR A 60  ? 0.8978 1.3235 0.9701 -0.0910 -0.1022 -0.1262 73  THR A O   
353  C CB  . THR A 60  ? 0.9226 1.2418 0.9560 -0.0375 -0.0973 -0.0905 73  THR A CB  
354  O OG1 . THR A 60  ? 0.9757 1.2453 1.0190 -0.0496 -0.0900 -0.0785 73  THR A OG1 
355  C CG2 . THR A 60  ? 0.9230 1.2268 0.9280 -0.0062 -0.0981 -0.0804 73  THR A CG2 
356  N N   . GLN A 61  ? 0.8930 1.2850 0.9754 -0.0916 -0.0951 -0.0936 74  GLN A N   
357  C CA  . GLN A 61  ? 0.9133 1.3188 1.0169 -0.1306 -0.0913 -0.1033 74  GLN A CA  
358  C C   . GLN A 61  ? 0.9060 1.3424 1.0214 -0.1389 -0.0895 -0.0894 74  GLN A C   
359  O O   . GLN A 61  ? 0.8859 1.2893 1.0127 -0.1612 -0.0817 -0.0779 74  GLN A O   
360  C CB  . GLN A 61  ? 0.9365 1.2674 1.0452 -0.1500 -0.0826 -0.1025 74  GLN A CB  
361  N N   . PRO A 62  ? 0.9093 1.4116 1.0207 -0.1186 -0.0962 -0.0897 75  PRO A N   
362  C CA  . PRO A 62  ? 0.9095 1.4462 1.0297 -0.1193 -0.0950 -0.0767 75  PRO A CA  
363  C C   . PRO A 62  ? 0.9388 1.5041 1.0807 -0.1630 -0.0901 -0.0800 75  PRO A C   
364  O O   . PRO A 62  ? 0.9715 1.5226 1.1216 -0.1743 -0.0842 -0.0625 75  PRO A O   
365  C CB  . PRO A 62  ? 0.8848 1.4927 0.9948 -0.0868 -0.1034 -0.0830 75  PRO A CB  
366  C CG  . PRO A 62  ? 0.8835 1.4734 0.9738 -0.0615 -0.1079 -0.0901 75  PRO A CG  
367  C CD  . PRO A 62  ? 0.8907 1.4445 0.9885 -0.0923 -0.1049 -0.1023 75  PRO A CD  
368  N N   . ASP A 63  ? 0.9661 1.5736 1.1158 -0.1892 -0.0916 -0.1023 76  ASP A N   
369  C CA  . ASP A 63  ? 1.0308 1.6658 1.1989 -0.2373 -0.0850 -0.1082 76  ASP A CA  
370  C C   . ASP A 63  ? 1.0472 1.5937 1.2199 -0.2640 -0.0728 -0.0921 76  ASP A C   
371  O O   . ASP A 63  ? 1.0540 1.6065 1.2374 -0.2916 -0.0655 -0.0796 76  ASP A O   
372  C CB  . ASP A 63  ? 1.0380 1.7246 1.2114 -0.2653 -0.0870 -0.1399 76  ASP A CB  
373  N N   . VAL A 64  ? 1.0505 1.5181 1.2138 -0.2533 -0.0702 -0.0911 77  VAL A N   
374  C CA  . VAL A 64  ? 1.0797 1.4599 1.2441 -0.2687 -0.0586 -0.0746 77  VAL A CA  
375  C C   . VAL A 64  ? 1.0416 1.4110 1.2069 -0.2537 -0.0559 -0.0427 77  VAL A C   
376  O O   . VAL A 64  ? 1.0582 1.4068 1.2307 -0.2785 -0.0464 -0.0257 77  VAL A O   
377  C CB  . VAL A 64  ? 1.1048 1.4141 1.2575 -0.2501 -0.0579 -0.0801 77  VAL A CB  
378  C CG1 . VAL A 64  ? 1.1222 1.3458 1.2736 -0.2534 -0.0466 -0.0584 77  VAL A CG1 
379  C CG2 . VAL A 64  ? 1.1113 1.4280 1.2640 -0.2705 -0.0586 -0.1135 77  VAL A CG2 
380  N N   . ILE A 65  ? 0.9809 1.3647 1.1371 -0.2144 -0.0632 -0.0350 78  ILE A N   
381  C CA  . ILE A 65  ? 0.9492 1.3299 1.1050 -0.1984 -0.0610 -0.0093 78  ILE A CA  
382  C C   . ILE A 65  ? 0.9521 1.3992 1.1203 -0.2157 -0.0603 -0.0026 78  ILE A C   
383  O O   . ILE A 65  ? 0.9732 1.4109 1.1472 -0.2263 -0.0533 0.0196  78  ILE A O   
384  C CB  . ILE A 65  ? 0.9080 1.2918 1.0492 -0.1568 -0.0677 -0.0085 78  ILE A CB  
385  C CG1 . ILE A 65  ? 0.9046 1.2252 1.0333 -0.1418 -0.0671 -0.0118 78  ILE A CG1 
386  C CG2 . ILE A 65  ? 0.9094 1.3030 1.0510 -0.1440 -0.0651 0.0119  78  ILE A CG2 
387  C CD1 . ILE A 65  ? 0.9107 1.1690 1.0416 -0.1495 -0.0582 0.0046  78  ILE A CD1 
388  N N   . TYR A 66  ? 0.9263 1.4466 1.0978 -0.2168 -0.0675 -0.0214 79  TYR A N   
389  C CA  . TYR A 66  ? 0.9072 1.5062 1.0909 -0.2336 -0.0677 -0.0199 79  TYR A CA  
390  C C   . TYR A 66  ? 0.9318 1.5177 1.1279 -0.2823 -0.0566 -0.0102 79  TYR A C   
391  O O   . TYR A 66  ? 0.9207 1.5322 1.1240 -0.2937 -0.0519 0.0084  79  TYR A O   
392  C CB  . TYR A 66  ? 0.9087 1.5898 1.0934 -0.2282 -0.0768 -0.0455 79  TYR A CB  
393  C CG  . TYR A 66  ? 0.9086 1.6856 1.1068 -0.2470 -0.0776 -0.0491 79  TYR A CG  
394  C CD1 . TYR A 66  ? 0.8950 1.7268 1.0926 -0.2182 -0.0818 -0.0419 79  TYR A CD1 
395  C CD2 . TYR A 66  ? 0.9483 1.7647 1.1590 -0.2948 -0.0733 -0.0625 79  TYR A CD2 
396  C CE1 . TYR A 66  ? 0.9106 1.8388 1.1208 -0.2337 -0.0827 -0.0466 79  TYR A CE1 
397  C CE2 . TYR A 66  ? 0.9568 1.8705 1.1799 -0.3148 -0.0736 -0.0669 79  TYR A CE2 
398  C CZ  . TYR A 66  ? 0.9473 1.9197 1.1706 -0.2826 -0.0789 -0.0584 79  TYR A CZ  
399  O OH  . TYR A 66  ? 1.0013 2.0783 1.2373 -0.3013 -0.0792 -0.0640 79  TYR A OH  
400  N N   . GLN A 67  ? 0.9691 1.5127 1.1657 -0.3112 -0.0513 -0.0230 80  GLN A N   
401  C CA  . GLN A 67  ? 1.0169 1.5294 1.2205 -0.3602 -0.0379 -0.0150 80  GLN A CA  
402  C C   . GLN A 67  ? 1.0180 1.4521 1.2171 -0.3559 -0.0277 0.0191  80  GLN A C   
403  O O   . GLN A 67  ? 1.0482 1.4746 1.2517 -0.3867 -0.0168 0.0387  80  GLN A O   
404  C CB  . GLN A 67  ? 1.0480 1.5235 1.2501 -0.3899 -0.0333 -0.0411 80  GLN A CB  
405  N N   . ILE A 68  ? 1.0095 1.3902 1.1986 -0.3177 -0.0307 0.0272  81  ILE A N   
406  C CA  . ILE A 68  ? 1.0177 1.3402 1.2021 -0.3055 -0.0228 0.0597  81  ILE A CA  
407  C C   . ILE A 68  ? 0.9764 1.3579 1.1667 -0.3007 -0.0232 0.0819  81  ILE A C   
408  O O   . ILE A 68  ? 0.9997 1.3628 1.1915 -0.3167 -0.0129 0.1096  81  ILE A O   
409  C CB  . ILE A 68  ? 0.9764 1.2526 1.1496 -0.2642 -0.0274 0.0606  81  ILE A CB  
410  N N   . HIS A 69  ? 0.9247 1.3764 1.1168 -0.2777 -0.0343 0.0698  82  HIS A N   
411  C CA  . HIS A 69  ? 0.9010 1.4176 1.0989 -0.2712 -0.0353 0.0845  82  HIS A CA  
412  C C   . HIS A 69  ? 0.9368 1.5025 1.1462 -0.3124 -0.0290 0.0914  82  HIS A C   
413  O O   . HIS A 69  ? 0.9720 1.5502 1.1847 -0.3218 -0.0221 0.1178  82  HIS A O   
414  C CB  . HIS A 69  ? 0.8451 1.4230 1.0404 -0.2385 -0.0471 0.0651  82  HIS A CB  
415  C CG  . HIS A 69  ? 0.8154 1.3553 0.9979 -0.1996 -0.0506 0.0661  82  HIS A CG  
416  N ND1 . HIS A 69  ? 0.7939 1.3353 0.9656 -0.1714 -0.0589 0.0452  82  HIS A ND1 
417  C CD2 . HIS A 69  ? 0.8043 1.3066 0.9816 -0.1861 -0.0459 0.0855  82  HIS A CD2 
418  C CE1 . HIS A 69  ? 0.7819 1.2841 0.9421 -0.1460 -0.0583 0.0509  82  HIS A CE1 
419  N NE2 . HIS A 69  ? 0.7796 1.2622 0.9440 -0.1546 -0.0509 0.0737  82  HIS A NE2 
420  N N   . LYS A 70  ? 0.9553 1.5544 1.1702 -0.3384 -0.0309 0.0674  83  LYS A N   
421  C CA  . LYS A 70  ? 0.9869 1.6418 1.2125 -0.3837 -0.0244 0.0692  83  LYS A CA  
422  C C   . LYS A 70  ? 1.0543 1.6445 1.2778 -0.4175 -0.0081 0.0999  83  LYS A C   
423  O O   . LYS A 70  ? 1.0771 1.7068 1.3055 -0.4350 -0.0020 0.1222  83  LYS A O   
424  C CB  . LYS A 70  ? 1.0033 1.6924 1.2334 -0.4111 -0.0271 0.0359  83  LYS A CB  
425  N N   . GLU A 71  ? 1.1128 1.6033 1.3273 -0.4240 -0.0005 0.1018  84  GLU A N   
426  C CA  . GLU A 71  ? 1.2084 1.6194 1.4160 -0.4504 0.0167  0.1325  84  GLU A CA  
427  C C   . GLU A 71  ? 1.2139 1.6305 1.4193 -0.4303 0.0203  0.1727  84  GLU A C   
428  O O   . GLU A 71  ? 1.2457 1.6580 1.4499 -0.4597 0.0330  0.2008  84  GLU A O   
429  C CB  . GLU A 71  ? 1.2535 1.5529 1.4492 -0.4413 0.0223  0.1285  84  GLU A CB  
430  C CG  . GLU A 71  ? 1.2996 1.5769 1.4955 -0.4758 0.0253  0.0931  84  GLU A CG  
431  C CD  . GLU A 71  ? 1.3588 1.5189 1.5419 -0.4713 0.0346  0.0917  84  GLU A CD  
432  O OE1 . GLU A 71  ? 1.4121 1.4929 1.5852 -0.4821 0.0505  0.1214  84  GLU A OE1 
433  O OE2 . GLU A 71  ? 1.3517 1.4997 1.5332 -0.4546 0.0264  0.0619  84  GLU A OE2 
434  N N   . TYR A 72  ? 1.0265 1.4716 1.1701 -0.4747 0.0195  0.2561  85  TYR A N   
435  C CA  . TYR A 72  ? 1.0282 1.4736 1.1795 -0.4268 0.0337  0.2731  85  TYR A CA  
436  C C   . TYR A 72  ? 1.0140 1.5707 1.2116 -0.4295 0.0364  0.2953  85  TYR A C   
437  O O   . TYR A 72  ? 1.1763 1.7227 1.3685 -0.4279 0.0519  0.3169  85  TYR A O   
438  C CB  . TYR A 72  ? 0.9577 1.4000 1.1161 -0.3636 0.0297  0.2591  85  TYR A CB  
439  C CG  . TYR A 72  ? 0.9815 1.3100 1.0915 -0.3471 0.0336  0.2441  85  TYR A CG  
440  C CD1 . TYR A 72  ? 1.0433 1.2855 1.1133 -0.3341 0.0510  0.2558  85  TYR A CD1 
441  C CD2 . TYR A 72  ? 0.9949 1.3047 1.0972 -0.3401 0.0210  0.2198  85  TYR A CD2 
442  C CE1 . TYR A 72  ? 1.0988 1.2415 1.1227 -0.3134 0.0561  0.2439  85  TYR A CE1 
443  C CE2 . TYR A 72  ? 1.0522 1.2627 1.1099 -0.3220 0.0256  0.2070  85  TYR A CE2 
444  C CZ  . TYR A 72  ? 1.0787 1.2071 1.0974 -0.3077 0.0433  0.2192  85  TYR A CZ  
445  O OH  . TYR A 72  ? 1.1104 1.1444 1.0830 -0.2847 0.0493  0.2081  85  TYR A OH  
446  N N   . LEU A 73  ? 0.9298 1.5926 1.1700 -0.4311 0.0223  0.2911  86  LEU A N   
447  C CA  . LEU A 73  ? 0.9282 1.7062 1.2130 -0.4275 0.0247  0.3117  86  LEU A CA  
448  C C   . LEU A 73  ? 0.9748 1.7656 1.2571 -0.4842 0.0343  0.3332  86  LEU A C   
449  O O   . LEU A 73  ? 0.9870 1.8190 1.2853 -0.4742 0.0467  0.3561  86  LEU A O   
450  C CB  . LEU A 73  ? 0.9005 1.7854 1.2241 -0.4215 0.0085  0.3038  86  LEU A CB  
451  C CG  . LEU A 73  ? 0.9223 1.8058 1.2509 -0.3640 0.0014  0.2857  86  LEU A CG  
452  C CD1 . LEU A 73  ? 0.9409 1.9049 1.2933 -0.3675 -0.0147 0.2760  86  LEU A CD1 
453  C CD2 . LEU A 73  ? 0.8603 1.7725 1.2045 -0.3088 0.0118  0.2956  86  LEU A CD2 
454  N N   . LEU A 74  ? 0.9847 1.7383 1.2444 -0.5452 0.0291  0.3252  87  LEU A N   
455  C CA  . LEU A 74  ? 1.0312 1.7798 1.2797 -0.6088 0.0395  0.3431  87  LEU A CA  
456  C C   . LEU A 74  ? 1.0735 1.7014 1.2743 -0.6042 0.0613  0.3555  87  LEU A C   
457  O O   . LEU A 74  ? 1.0490 1.6880 1.2497 -0.6273 0.0766  0.3802  87  LEU A O   
458  C CB  . LEU A 74  ? 1.0825 1.8170 1.3132 -0.6791 0.0277  0.3272  87  LEU A CB  
459  N N   . ALA A 75  ? 1.1063 1.6224 1.2656 -0.5721 0.0637  0.3400  88  ALA A N   
460  C CA  . ALA A 75  ? 1.1708 1.5708 1.2805 -0.5564 0.0848  0.3520  88  ALA A CA  
461  C C   . ALA A 75  ? 1.0833 1.5228 1.2155 -0.4932 0.0942  0.3690  88  ALA A C   
462  O O   . ALA A 75  ? 1.0747 1.4977 1.1950 -0.4945 0.1122  0.3937  88  ALA A O   
463  C CB  . ALA A 75  ? 1.1973 1.4733 1.2546 -0.5403 0.0843  0.3301  88  ALA A CB  
464  N N   . ASP A 78  ? 0.7402 1.5930 1.0526 -0.2323 0.0837  0.3800  91  ASP A N   
465  C CA  . ASP A 78  ? 0.7534 1.5627 1.0562 -0.2331 0.0700  0.3535  91  ASP A CA  
466  C C   . ASP A 78  ? 0.7152 1.5679 1.0369 -0.1881 0.0614  0.3356  91  ASP A C   
467  O O   . ASP A 78  ? 0.6717 1.6094 1.0220 -0.1739 0.0606  0.3413  91  ASP A O   
468  C CB  . ASP A 78  ? 0.7187 1.5441 1.0285 -0.2867 0.0600  0.3501  91  ASP A CB  
469  N N   . ILE A 79  ? 0.7318 1.5222 1.0337 -0.1652 0.0570  0.3150  92  ILE A N   
470  C CA  . ILE A 79  ? 0.6812 1.4937 0.9935 -0.1315 0.0488  0.2945  92  ILE A CA  
471  C C   . ILE A 79  ? 0.7494 1.5001 1.0438 -0.1435 0.0388  0.2737  92  ILE A C   
472  O O   . ILE A 79  ? 0.9047 1.5782 1.1703 -0.1523 0.0419  0.2713  92  ILE A O   
473  C CB  . ILE A 79  ? 0.6023 1.4065 0.9072 -0.0860 0.0559  0.2897  92  ILE A CB  
474  N N   . ILE A 80  ? 0.7511 1.5347 1.0593 -0.1414 0.0280  0.2599  93  ILE A N   
475  C CA  . ILE A 80  ? 0.8205 1.5542 1.1128 -0.1543 0.0178  0.2407  93  ILE A CA  
476  C C   . ILE A 80  ? 0.7477 1.4605 1.0338 -0.1158 0.0157  0.2205  93  ILE A C   
477  O O   . ILE A 80  ? 0.7116 1.4736 1.0135 -0.0904 0.0154  0.2170  93  ILE A O   
478  C CB  . ILE A 80  ? 0.6933 1.4790 1.0022 -0.1845 0.0063  0.2399  93  ILE A CB  
479  N N   . GLU A 81  ? 0.8343 1.4727 1.0943 -0.1114 0.0160  0.2081  94  GLU A N   
480  C CA  . GLU A 81  ? 0.7152 1.3317 0.9679 -0.0820 0.0139  0.1882  94  GLU A CA  
481  C C   . GLU A 81  ? 0.6774 1.2994 0.9319 -0.0924 0.0028  0.1747  94  GLU A C   
482  O O   . GLU A 81  ? 0.8415 1.4477 1.0888 -0.1245 -0.0039 0.1748  94  GLU A O   
483  C CB  . GLU A 81  ? 0.7205 1.2629 0.9447 -0.0736 0.0182  0.1812  94  GLU A CB  
484  C CG  . GLU A 81  ? 0.7837 1.3179 1.0011 -0.0546 0.0294  0.1929  94  GLU A CG  
485  C CD  . GLU A 81  ? 0.8630 1.3269 1.0493 -0.0446 0.0340  0.1888  94  GLU A CD  
486  O OE1 . GLU A 81  ? 0.7246 1.1650 0.9021 -0.0322 0.0303  0.1713  94  GLU A OE1 
487  O OE2 . GLU A 81  ? 1.0059 1.4379 1.1742 -0.0472 0.0428  0.2043  94  GLU A OE2 
488  N N   . THR A 82  ? 0.6433 1.2849 0.9037 -0.0663 0.0018  0.1629  95  THR A N   
489  C CA  . THR A 82  ? 0.6434 1.2814 0.8999 -0.0695 -0.0071 0.1494  95  THR A CA  
490  C C   . THR A 82  ? 0.6286 1.1941 0.8594 -0.0724 -0.0090 0.1347  95  THR A C   
491  O O   . THR A 82  ? 0.6491 1.1778 0.8681 -0.0571 -0.0018 0.1316  95  THR A O   
492  C CB  . THR A 82  ? 0.6056 1.2734 0.8684 -0.0382 -0.0043 0.1420  95  THR A CB  
493  O OG1 . THR A 82  ? 0.7047 1.3486 0.9599 -0.0139 0.0049  0.1349  95  THR A OG1 
494  C CG2 . THR A 82  ? 0.5457 1.2868 0.8295 -0.0322 -0.0028 0.1564  95  THR A CG2 
495  N N   . ASN A 83  ? 0.6563 1.2068 0.8777 -0.0904 -0.0185 0.1260  96  ASN A N   
496  C CA  . ASN A 83  ? 0.6743 1.1565 0.8680 -0.0932 -0.0204 0.1116  96  ASN A CA  
497  C C   . ASN A 83  ? 0.6435 1.1151 0.8330 -0.0624 -0.0173 0.0974  96  ASN A C   
498  O O   . ASN A 83  ? 0.6513 1.1085 0.8303 -0.0625 -0.0228 0.0854  96  ASN A O   
499  C CB  . ASN A 83  ? 0.6802 1.1555 0.8637 -0.1248 -0.0322 0.1062  96  ASN A CB  
500  C CG  . ASN A 83  ? 0.7658 1.1660 0.9154 -0.1289 -0.0336 0.0913  96  ASN A CG  
501  O OD1 . ASN A 83  ? 0.9035 1.2486 1.0333 -0.1202 -0.0252 0.0911  96  ASN A OD1 
502  N ND2 . ASN A 83  ? 0.7269 1.1267 0.8673 -0.1394 -0.0437 0.0795  96  ASN A ND2 
503  N N   . THR A 84  ? 0.6190 1.0986 0.8151 -0.0383 -0.0079 0.0986  97  THR A N   
504  C CA  . THR A 84  ? 0.6170 1.1009 0.8129 -0.0135 -0.0033 0.0867  97  THR A CA  
505  C C   . THR A 84  ? 0.6282 1.0849 0.8146 0.0029  0.0047  0.0802  97  THR A C   
506  O O   . THR A 84  ? 0.6771 1.1489 0.8672 0.0201  0.0111  0.0737  97  THR A O   
507  C CB  . THR A 84  ? 0.5480 1.0843 0.7613 -0.0003 0.0005  0.0924  97  THR A CB  
508  O OG1 . THR A 84  ? 0.5774 1.1377 0.8023 0.0003  0.0053  0.1053  97  THR A OG1 
509  C CG2 . THR A 84  ? 0.5744 1.1466 0.7961 -0.0092 -0.0069 0.0980  97  THR A CG2 
510  N N   . PHE A 85  ? 0.6299 1.0462 0.8007 -0.0021 0.0051  0.0818  98  PHE A N   
511  C CA  . PHE A 85  ? 0.6783 1.0783 0.8402 0.0163  0.0128  0.0789  98  PHE A CA  
512  C C   . PHE A 85  ? 0.6102 1.0002 0.7648 0.0297  0.0150  0.0625  98  PHE A C   
513  O O   . PHE A 85  ? 0.8193 1.2215 0.9750 0.0454  0.0215  0.0581  98  PHE A O   
514  C CB  . PHE A 85  ? 0.7646 1.1180 0.9050 0.0122  0.0147  0.0867  98  PHE A CB  
515  C CG  . PHE A 85  ? 0.7892 1.1375 0.9212 0.0360  0.0235  0.0891  98  PHE A CG  
516  C CD1 . PHE A 85  ? 0.7413 1.1200 0.8836 0.0448  0.0288  0.1014  98  PHE A CD1 
517  C CD2 . PHE A 85  ? 0.7839 1.1035 0.8973 0.0515  0.0267  0.0799  98  PHE A CD2 
518  C CE1 . PHE A 85  ? 0.7777 1.1610 0.9121 0.0686  0.0361  0.1045  98  PHE A CE1 
519  C CE2 . PHE A 85  ? 0.7679 1.0948 0.8746 0.0760  0.0347  0.0836  98  PHE A CE2 
520  C CZ  . PHE A 85  ? 0.8108 1.1709 0.9280 0.0846  0.0390  0.0959  98  PHE A CZ  
521  N N   . SER A 86  ? 0.6139 0.9858 0.7605 0.0222  0.0096  0.0538  99  SER A N   
522  C CA  . SER A 86  ? 0.5752 0.9358 0.7132 0.0327  0.0125  0.0393  99  SER A CA  
523  C C   . SER A 86  ? 0.5395 0.9162 0.6826 0.0307  0.0106  0.0334  99  SER A C   
524  O O   . SER A 86  ? 0.5134 0.8724 0.6449 0.0341  0.0113  0.0233  99  SER A O   
525  C CB  . SER A 86  ? 0.5935 0.9067 0.7076 0.0312  0.0102  0.0341  99  SER A CB  
526  O OG  . SER A 86  ? 0.7829 1.0699 0.8847 0.0324  0.0123  0.0428  99  SER A OG  
527  N N   . SER A 87  ? 0.6328 1.0428 0.7907 0.0282  0.0096  0.0410  100 SER A N   
528  C CA  . SER A 87  ? 0.5868 1.0120 0.7453 0.0316  0.0092  0.0387  100 SER A CA  
529  C C   . SER A 87  ? 0.5365 0.9681 0.6927 0.0459  0.0206  0.0313  100 SER A C   
530  O O   . SER A 87  ? 0.6639 1.1190 0.8252 0.0529  0.0249  0.0359  100 SER A O   
531  C CB  . SER A 87  ? 0.5451 1.0064 0.7174 0.0243  0.0032  0.0519  100 SER A CB  
532  O OG  . SER A 87  ? 0.7463 1.2015 0.9147 0.0072  -0.0079 0.0540  100 SER A OG  
533  N N   . THR A 88  ? 0.6074 1.0171 0.7533 0.0494  0.0265  0.0196  101 THR A N   
534  C CA  . THR A 88  ? 0.7002 1.1082 0.8383 0.0562  0.0382  0.0094  101 THR A CA  
535  C C   . THR A 88  ? 0.6643 1.0438 0.7858 0.0569  0.0416  -0.0003 101 THR A C   
536  O O   . THR A 88  ? 0.6560 1.0196 0.7732 0.0541  0.0348  -0.0006 101 THR A O   
537  C CB  . THR A 88  ? 0.4845 0.9062 0.6281 0.0561  0.0437  0.0045  101 THR A CB  
538  N N   . SER A 89  ? 0.6150 0.9840 0.7234 0.0602  0.0534  -0.0084 102 SER A N   
539  C CA  . SER A 89  ? 0.6243 0.9667 0.7157 0.0595  0.0600  -0.0177 102 SER A CA  
540  C C   . SER A 89  ? 0.6791 1.0224 0.7745 0.0548  0.0585  -0.0237 102 SER A C   
541  O O   . SER A 89  ? 0.6822 1.0081 0.7694 0.0563  0.0553  -0.0251 102 SER A O   
542  C CB  . SER A 89  ? 0.5338 0.8614 0.6078 0.0587  0.0762  -0.0264 102 SER A CB  
543  N N   . ILE A 90  ? 0.6786 1.0451 0.7847 0.0517  0.0612  -0.0266 103 ILE A N   
544  C CA  . ILE A 90  ? 0.7408 1.1175 0.8500 0.0521  0.0618  -0.0308 103 ILE A CA  
545  C C   . ILE A 90  ? 0.5824 0.9438 0.6902 0.0590  0.0518  -0.0236 103 ILE A C   
546  O O   . ILE A 90  ? 0.6313 0.9754 0.7278 0.0625  0.0528  -0.0275 103 ILE A O   
547  C CB  . ILE A 90  ? 0.5096 0.9244 0.6318 0.0509  0.0641  -0.0322 103 ILE A CB  
548  N N   . ALA A 91  ? 0.5901 0.9544 0.7059 0.0598  0.0434  -0.0133 104 ALA A N   
549  C CA  . ALA A 91  ? 0.6245 0.9664 0.7334 0.0626  0.0355  -0.0069 104 ALA A CA  
550  C C   . ALA A 91  ? 0.5793 0.8896 0.6733 0.0584  0.0294  -0.0089 104 ALA A C   
551  O O   . ALA A 91  ? 0.6703 0.9532 0.7489 0.0615  0.0267  -0.0103 104 ALA A O   
552  C CB  . ALA A 91  ? 0.5200 0.8701 0.6386 0.0597  0.0298  0.0051  104 ALA A CB  
553  N N   . GLN A 92  ? 0.5511 0.8655 0.6466 0.0535  0.0277  -0.0090 105 GLN A N   
554  C CA  . GLN A 92  ? 0.5916 0.8860 0.6735 0.0501  0.0205  -0.0100 105 GLN A CA  
555  C C   . GLN A 92  ? 0.6585 0.9333 0.7231 0.0565  0.0266  -0.0195 105 GLN A C   
556  O O   . GLN A 92  ? 0.7587 1.0145 0.8077 0.0555  0.0206  -0.0217 105 GLN A O   
557  C CB  . GLN A 92  ? 0.5823 0.8966 0.6713 0.0472  0.0164  -0.0036 105 GLN A CB  
558  C CG  . GLN A 92  ? 0.5955 0.9308 0.6999 0.0378  0.0080  0.0071  105 GLN A CG  
559  C CD  . GLN A 92  ? 0.6487 0.9637 0.7446 0.0243  -0.0027 0.0084  105 GLN A CD  
560  O OE1 . GLN A 92  ? 0.7742 1.0696 0.8535 0.0204  -0.0084 0.0027  105 GLN A OE1 
561  N NE2 . GLN A 92  ? 0.5999 0.9156 0.7032 0.0166  -0.0045 0.0158  105 GLN A NE2 
562  N N   . ALA A 93  ? 0.5899 0.8722 0.6561 0.0611  0.0386  -0.0252 106 ALA A N   
563  C CA  . ALA A 93  ? 0.6566 0.9242 0.7073 0.0656  0.0467  -0.0332 106 ALA A CA  
564  C C   . ALA A 93  ? 0.6798 0.9261 0.7163 0.0715  0.0424  -0.0355 106 ALA A C   
565  O O   . ALA A 93  ? 0.7935 1.0212 0.8123 0.0754  0.0444  -0.0403 106 ALA A O   
566  C CB  . ALA A 93  ? 0.5909 0.8777 0.6480 0.0640  0.0601  -0.0389 106 ALA A CB  
567  N N   . ASP A 94  ? 0.8406 1.0852 0.8802 0.0738  0.0377  -0.0317 107 ASP A N   
568  C CA  . ASP A 94  ? 0.9974 1.2110 1.0158 0.0820  0.0351  -0.0335 107 ASP A CA  
569  C C   . ASP A 94  ? 0.9932 1.1738 0.9924 0.0736  0.0238  -0.0351 107 ASP A C   
570  O O   . ASP A 94  ? 0.9159 1.0622 0.8896 0.0791  0.0224  -0.0397 107 ASP A O   
571  C CB  . ASP A 94  ? 0.8318 1.0449 0.8524 0.0890  0.0354  -0.0270 107 ASP A CB  
572  N N   . TYR A 95  ? 0.8685 1.0621 0.8779 0.0611  0.0160  -0.0317 108 TYR A N   
573  C CA  . TYR A 95  ? 0.8626 1.0400 0.8566 0.0506  0.0040  -0.0337 108 TYR A CA  
574  C C   . TYR A 95  ? 0.8151 1.0088 0.8085 0.0529  0.0040  -0.0346 108 TYR A C   
575  O O   . TYR A 95  ? 0.9695 1.1653 0.9543 0.0450  -0.0068 -0.0346 108 TYR A O   
576  C CB  . TYR A 95  ? 0.8472 1.0326 0.8515 0.0332  -0.0068 -0.0264 108 TYR A CB  
577  C CG  . TYR A 95  ? 0.8926 1.0577 0.8945 0.0317  -0.0049 -0.0225 108 TYR A CG  
578  C CD1 . TYR A 95  ? 0.8178 0.9340 0.7893 0.0280  -0.0076 -0.0270 108 TYR A CD1 
579  C CD2 . TYR A 95  ? 0.9124 1.1035 0.9375 0.0358  0.0006  -0.0142 108 TYR A CD2 
580  C CE1 . TYR A 95  ? 0.9010 0.9910 0.8639 0.0305  -0.0032 -0.0214 108 TYR A CE1 
581  C CE2 . TYR A 95  ? 0.8670 1.0401 0.8872 0.0380  0.0035  -0.0084 108 TYR A CE2 
582  C CZ  . TYR A 95  ? 0.8865 1.0074 0.8749 0.0365  0.0022  -0.0111 108 TYR A CZ  
583  O OH  . TYR A 95  ? 0.9309 1.0267 0.9084 0.0424  0.0076  -0.0033 108 TYR A OH  
584  N N   . GLY A 96  ? 0.8307 1.0357 0.8300 0.0631  0.0168  -0.0351 109 GLY A N   
585  C CA  . GLY A 96  ? 0.7857 0.9972 0.7781 0.0689  0.0209  -0.0341 109 GLY A CA  
586  C C   . GLY A 96  ? 0.8118 1.0501 0.8164 0.0666  0.0153  -0.0252 109 GLY A C   
587  O O   . GLY A 96  ? 0.9805 1.2251 0.9741 0.0723  0.0124  -0.0223 109 GLY A O   
588  N N   . LEU A 97  ? 0.7468 1.0045 0.7730 0.0610  0.0144  -0.0198 110 LEU A N   
589  C CA  . LEU A 97  ? 0.7140 1.0028 0.7533 0.0610  0.0105  -0.0100 110 LEU A CA  
590  C C   . LEU A 97  ? 0.6567 0.9563 0.7084 0.0666  0.0228  -0.0072 110 LEU A C   
591  O O   . LEU A 97  ? 0.6815 1.0070 0.7493 0.0646  0.0198  0.0004  110 LEU A O   
592  C CB  . LEU A 97  ? 0.7949 1.1008 0.8465 0.0451  -0.0045 -0.0050 110 LEU A CB  
593  C CG  . LEU A 97  ? 0.7355 1.0308 0.7719 0.0330  -0.0184 -0.0093 110 LEU A CG  
594  C CD1 . LEU A 97  ? 0.7545 1.0620 0.8015 0.0112  -0.0304 -0.0047 110 LEU A CD1 
595  C CD2 . LEU A 97  ? 0.8131 1.1284 0.8389 0.0408  -0.0227 -0.0072 110 LEU A CD2 
596  N N   . GLU A 98  ? 0.8274 1.1081 0.8696 0.0717  0.0372  -0.0141 111 GLU A N   
597  C CA  . GLU A 98  ? 0.8535 1.1387 0.9002 0.0736  0.0502  -0.0149 111 GLU A CA  
598  C C   . GLU A 98  ? 0.7550 1.0511 0.7978 0.0845  0.0530  -0.0060 111 GLU A C   
599  O O   . GLU A 98  ? 0.6342 0.9491 0.6887 0.0854  0.0544  -0.0016 111 GLU A O   
600  C CB  . GLU A 98  ? 0.9380 1.1988 0.9682 0.0734  0.0662  -0.0243 111 GLU A CB  
601  C CG  . GLU A 98  ? 1.0720 1.3299 1.1051 0.0667  0.0665  -0.0323 111 GLU A CG  
602  C CD  . GLU A 98  ? 1.2273 1.4657 1.2440 0.0714  0.0635  -0.0343 111 GLU A CD  
603  O OE1 . GLU A 98  ? 1.1356 1.3710 1.1462 0.0759  0.0529  -0.0293 111 GLU A OE1 
604  O OE2 . GLU A 98  ? 1.5074 1.7381 1.5170 0.0701  0.0716  -0.0410 111 GLU A OE2 
605  N N   . HIS A 99  ? 0.6499 0.9359 0.6738 0.0960  0.0544  -0.0024 112 HIS A N   
606  C CA  . HIS A 99  ? 0.6206 0.9142 0.6329 0.1141  0.0602  0.0076  112 HIS A CA  
607  C C   . HIS A 99  ? 0.5882 0.9287 0.6208 0.1164  0.0468  0.0194  112 HIS A C   
608  O O   . HIS A 99  ? 0.5121 0.8677 0.5373 0.1348  0.0523  0.0295  112 HIS A O   
609  C CB  . HIS A 99  ? 0.6333 0.9085 0.6187 0.1285  0.0642  0.0102  112 HIS A CB  
610  C CG  . HIS A 99  ? 0.6417 0.9382 0.6325 0.1241  0.0457  0.0119  112 HIS A CG  
611  N ND1 . HIS A 99  ? 0.7616 1.0456 0.7561 0.1082  0.0375  0.0020  112 HIS A ND1 
612  C CD2 . HIS A 99  ? 0.6827 1.0135 0.6730 0.1330  0.0340  0.0215  112 HIS A CD2 
613  C CE1 . HIS A 99  ? 0.6734 0.9755 0.6664 0.1052  0.0217  0.0038  112 HIS A CE1 
614  N NE2 . HIS A 99  ? 0.6492 0.9842 0.6415 0.1182  0.0184  0.0153  112 HIS A NE2 
615  N N   . LEU A 100 ? 0.6859 1.0481 0.7410 0.0984  0.0310  0.0190  113 LEU A N   
616  C CA  . LEU A 100 ? 0.6529 1.0621 0.7267 0.0937  0.0169  0.0300  113 LEU A CA  
617  C C   . LEU A 100 ? 0.6802 1.1120 0.7771 0.0856  0.0162  0.0347  113 LEU A C   
618  O O   . LEU A 100 ? 0.7992 1.2716 0.9137 0.0773  0.0053  0.0444  113 LEU A O   
619  C CB  . LEU A 100 ? 0.7256 1.1381 0.8020 0.0748  0.0000  0.0264  113 LEU A CB  
620  C CG  . LEU A 100 ? 0.8303 1.2910 0.9128 0.0708  -0.0146 0.0357  113 LEU A CG  
621  C CD1 . LEU A 100 ? 0.7937 1.2616 0.8554 0.0934  -0.0114 0.0393  113 LEU A CD1 
622  C CD2 . LEU A 100 ? 0.9152 1.3714 0.9992 0.0428  -0.0308 0.0292  113 LEU A CD2 
623  N N   . ALA A 101 ? 0.8016 1.2112 0.8977 0.0867  0.0278  0.0282  114 ALA A N   
624  C CA  . ALA A 101 ? 0.7248 1.1529 0.8405 0.0789  0.0272  0.0314  114 ALA A CA  
625  C C   . ALA A 101 ? 0.6630 1.1343 0.7902 0.0879  0.0267  0.0452  114 ALA A C   
626  O O   . ALA A 101 ? 0.6598 1.1626 0.8076 0.0759  0.0175  0.0537  114 ALA A O   
627  C CB  . ALA A 101 ? 0.7110 1.1150 0.8200 0.0805  0.0406  0.0210  114 ALA A CB  
628  N N   . TYR A 102 ? 0.6490 1.1194 0.7599 0.1101  0.0382  0.0484  115 TYR A N   
629  C CA  . TYR A 102 ? 0.5953 1.1071 0.7127 0.1257  0.0410  0.0622  115 TYR A CA  
630  C C   . TYR A 102 ? 0.6152 1.1830 0.7534 0.1183  0.0251  0.0758  115 TYR A C   
631  O O   . TYR A 102 ? 0.5777 1.1887 0.7375 0.1120  0.0204  0.0862  115 TYR A O   
632  C CB  . TYR A 102 ? 0.5817 1.0738 0.6684 0.1558  0.0576  0.0640  115 TYR A CB  
633  C CG  . TYR A 102 ? 0.6050 1.1426 0.6939 0.1793  0.0616  0.0803  115 TYR A CG  
634  C CD1 . TYR A 102 ? 0.6156 1.1554 0.7030 0.1877  0.0721  0.0813  115 TYR A CD1 
635  C CD2 . TYR A 102 ? 0.5378 1.1220 0.6296 0.1942  0.0549  0.0949  115 TYR A CD2 
636  C CE1 . TYR A 102 ? 0.5805 1.1636 0.6680 0.2125  0.0772  0.0970  115 TYR A CE1 
637  C CE2 . TYR A 102 ? 0.6500 1.2852 0.7448 0.2189  0.0593  0.1116  115 TYR A CE2 
638  C CZ  . TYR A 102 ? 0.6096 1.2422 0.7018 0.2290  0.0711  0.1129  115 TYR A CZ  
639  O OH  . TYR A 102 ? 0.5172 1.2018 0.6104 0.2567  0.0768  0.1302  115 TYR A OH  
640  N N   . ARG A 103 ? 0.5861 1.1553 0.7168 0.1170  0.0170  0.0752  116 ARG A N   
641  C CA  . ARG A 103 ? 0.5427 1.1687 0.6897 0.1062  0.0010  0.0857  116 ARG A CA  
642  C C   . ARG A 103 ? 0.5914 1.2265 0.7603 0.0702  -0.0127 0.0842  116 ARG A C   
643  O O   . ARG A 103 ? 0.6236 1.3138 0.8122 0.0564  -0.0224 0.0955  116 ARG A O   
644  C CB  . ARG A 103 ? 0.6277 1.2477 0.7568 0.1116  -0.0046 0.0824  116 ARG A CB  
645  C CG  . ARG A 103 ? 0.6625 1.3380 0.8058 0.0917  -0.0240 0.0881  116 ARG A CG  
646  C CD  . ARG A 103 ? 0.6773 1.3636 0.8006 0.1083  -0.0273 0.0889  116 ARG A CD  
647  N NE  . ARG A 103 ? 0.6351 1.3794 0.7704 0.0850  -0.0475 0.0918  116 ARG A NE  
648  C CZ  . ARG A 103 ? 0.6232 1.3515 0.7462 0.0663  -0.0597 0.0806  116 ARG A CZ  
649  N NH1 . ARG A 103 ? 0.6344 1.2922 0.7339 0.0710  -0.0535 0.0670  116 ARG A NH1 
650  N NH2 . ARG A 103 ? 0.6289 1.4154 0.7620 0.0415  -0.0781 0.0826  116 ARG A NH2 
651  N N   . MET A 104 ? 0.5646 1.1460 0.7275 0.0555  -0.0123 0.0713  117 MET A N   
652  C CA  . MET A 104 ? 0.5862 1.1611 0.7608 0.0252  -0.0222 0.0702  117 MET A CA  
653  C C   . MET A 104 ? 0.6277 1.2336 0.8230 0.0208  -0.0192 0.0819  117 MET A C   
654  O O   . MET A 104 ? 0.8032 1.4388 1.0128 -0.0022 -0.0281 0.0905  117 MET A O   
655  C CB  . MET A 104 ? 0.6209 1.1329 0.7813 0.0199  -0.0189 0.0560  117 MET A CB  
656  C CG  . MET A 104 ? 0.6663 1.1465 0.8057 0.0199  -0.0228 0.0447  117 MET A CG  
657  S SD  . MET A 104 ? 0.7255 1.1413 0.8487 0.0196  -0.0162 0.0301  117 MET A SD  
658  C CE  . MET A 104 ? 0.7612 1.1611 0.8856 -0.0078 -0.0264 0.0319  117 MET A CE  
659  N N   . ASN A 105 ? 0.6885 1.2870 0.8829 0.0411  -0.0060 0.0817  118 ASN A N   
660  C CA  . ASN A 105 ? 0.6472 1.2769 0.8582 0.0426  -0.0014 0.0927  118 ASN A CA  
661  C C   . ASN A 105 ? 0.6658 1.3632 0.8918 0.0479  -0.0041 0.1092  118 ASN A C   
662  O O   . ASN A 105 ? 0.6034 1.3387 0.8485 0.0341  -0.0071 0.1214  118 ASN A O   
663  C CB  . ASN A 105 ? 0.5937 1.2019 0.7946 0.0646  0.0134  0.0863  118 ASN A CB  
664  C CG  . ASN A 105 ? 0.6031 1.1639 0.7961 0.0574  0.0162  0.0730  118 ASN A CG  
665  O OD1 . ASN A 105 ? 0.6261 1.1873 0.8285 0.0478  0.0153  0.0761  118 ASN A OD1 
666  N ND2 . ASN A 105 ? 0.6474 1.1706 0.8224 0.0637  0.0205  0.0596  118 ASN A ND2 
667  N N   . MET A 106 ? 0.6868 1.4011 0.9025 0.0699  -0.0016 0.1108  119 MET A N   
668  C CA  . MET A 106 ? 0.6523 1.4390 0.8798 0.0817  -0.0035 0.1276  119 MET A CA  
669  C C   . MET A 106 ? 0.6135 1.4478 0.8620 0.0473  -0.0205 0.1350  119 MET A C   
670  O O   . MET A 106 ? 0.5799 1.4728 0.8502 0.0375  -0.0228 0.1496  119 MET A O   
671  C CB  . MET A 106 ? 0.6239 1.4117 0.8301 0.1133  0.0019  0.1276  119 MET A CB  
672  C CG  . MET A 106 ? 0.8551 1.7202 1.0683 0.1378  0.0036  0.1467  119 MET A CG  
673  S SD  . MET A 106 ? 0.8404 1.7087 1.0427 0.1773  0.0250  0.1553  119 MET A SD  
674  C CE  . MET A 106 ? 0.7269 1.6503 0.9136 0.2221  0.0309  0.1721  119 MET A CE  
675  N N   . CYS A 107 ? 0.6913 1.4985 0.9307 0.0270  -0.0315 0.1242  120 CYS A N   
676  C CA  . CYS A 107 ? 0.7603 1.6002 1.0118 -0.0117 -0.0478 0.1269  120 CYS A CA  
677  C C   . CYS A 107 ? 0.6633 1.4835 0.9252 -0.0436 -0.0488 0.1288  120 CYS A C   
678  O O   . CYS A 107 ? 0.6795 1.5483 0.9585 -0.0721 -0.0561 0.1394  120 CYS A O   
679  C CB  . CYS A 107 ? 0.8896 1.6901 1.1210 -0.0248 -0.0577 0.1116  120 CYS A CB  
680  S SG  . CYS A 107 ? 0.8973 1.7268 1.1137 0.0091  -0.0583 0.1119  120 CYS A SG  
681  N N   . SER A 108 ? 0.6895 1.4402 0.9394 -0.0390 -0.0407 0.1193  121 SER A N   
682  C CA  . SER A 108 ? 0.6820 1.4058 0.9356 -0.0625 -0.0392 0.1224  121 SER A CA  
683  C C   . SER A 108 ? 0.6914 1.4710 0.9678 -0.0600 -0.0333 0.1405  121 SER A C   
684  O O   . SER A 108 ? 0.6815 1.4696 0.9665 -0.0885 -0.0353 0.1498  121 SER A O   
685  C CB  . SER A 108 ? 0.4554 1.1066 0.6920 -0.0493 -0.0305 0.1104  121 SER A CB  
686  N N   . ALA A 109 ? 0.6023 1.4158 0.8844 -0.0256 -0.0246 0.1457  122 ALA A N   
687  C CA  . ALA A 109 ? 0.5462 1.4164 0.8471 -0.0165 -0.0176 0.1627  122 ALA A CA  
688  C C   . ALA A 109 ? 0.5283 1.4848 0.8502 -0.0304 -0.0254 0.1786  122 ALA A C   
689  O O   . ALA A 109 ? 0.5318 1.5379 0.8728 -0.0407 -0.0230 0.1947  122 ALA A O   
690  C CB  . ALA A 109 ? 0.5674 1.4356 0.8593 0.0263  -0.0040 0.1609  122 ALA A CB  
691  N N   . GLY A 110 ? 0.6387 1.6192 0.9573 -0.0304 -0.0346 0.1750  123 GLY A N   
692  C CA  . GLY A 110 ? 0.6810 1.7551 1.0200 -0.0444 -0.0439 0.1892  123 GLY A CA  
693  C C   . GLY A 110 ? 0.7613 1.8466 1.1109 -0.1006 -0.0556 0.1913  123 GLY A C   
694  O O   . GLY A 110 ? 0.6965 1.8549 1.0695 -0.1206 -0.0572 0.2079  123 GLY A O   
695  N N   . VAL A 111 ? 1.0537 1.5337 1.3209 -0.1366 -0.1079 0.0136  124 VAL A N   
696  C CA  . VAL A 111 ? 1.0722 1.5405 1.3509 -0.1595 -0.1168 0.0105  124 VAL A CA  
697  C C   . VAL A 111 ? 1.1537 1.6160 1.4442 -0.1730 -0.1058 0.0227  124 VAL A C   
698  O O   . VAL A 111 ? 1.2385 1.7106 1.5504 -0.1948 -0.1108 0.0268  124 VAL A O   
699  C CB  . VAL A 111 ? 1.0050 1.4308 1.2575 -0.1599 -0.1265 -0.0037 124 VAL A CB  
700  C CG1 . VAL A 111 ? 1.0072 1.4126 1.2692 -0.1822 -0.1362 -0.0072 124 VAL A CG1 
701  C CG2 . VAL A 111 ? 0.9632 1.3973 1.2036 -0.1514 -0.1389 -0.0151 124 VAL A CG2 
702  N N   . ALA A 112 ? 1.0113 1.4570 1.2866 -0.1611 -0.0916 0.0290  125 ALA A N   
703  C CA  . ALA A 112 ? 0.9492 1.3889 1.2314 -0.1721 -0.0805 0.0421  125 ALA A CA  
704  C C   . ALA A 112 ? 0.9729 1.4625 1.2820 -0.1768 -0.0710 0.0541  125 ALA A C   
705  O O   . ALA A 112 ? 1.1083 1.6060 1.4326 -0.1968 -0.0670 0.0645  125 ALA A O   
706  C CB  . ALA A 112 ? 0.8386 1.2469 1.0957 -0.1568 -0.0694 0.0442  125 ALA A CB  
707  N N   . ARG A 113 ? 0.9612 1.4840 1.2751 -0.1585 -0.0677 0.0522  126 ARG A N   
708  C CA  . ARG A 113 ? 0.8895 1.4645 1.2297 -0.1583 -0.0585 0.0604  126 ARG A CA  
709  C C   . ARG A 113 ? 0.8899 1.5041 1.2632 -0.1781 -0.0679 0.0598  126 ARG A C   
710  O O   . ARG A 113 ? 0.8587 1.5136 1.2576 -0.1892 -0.0593 0.0683  126 ARG A O   
711  C CB  . ARG A 113 ? 0.7232 1.3185 1.0583 -0.1305 -0.0556 0.0565  126 ARG A CB  
712  N N   . LYS A 114 ? 0.9952 1.5990 1.3677 -0.1830 -0.0853 0.0492  127 LYS A N   
713  C CA  . LYS A 114 ? 1.0361 1.6730 1.4389 -0.2032 -0.0971 0.0473  127 LYS A CA  
714  C C   . LYS A 114 ? 1.0237 1.6479 1.4362 -0.2342 -0.0966 0.0558  127 LYS A C   
715  O O   . LYS A 114 ? 1.0617 1.7262 1.5052 -0.2545 -0.0971 0.0616  127 LYS A O   
716  C CB  . LYS A 114 ? 1.0340 1.6566 1.4280 -0.2002 -0.1170 0.0332  127 LYS A CB  
717  N N   . ALA A 115 ? 0.9568 1.5250 1.3429 -0.2380 -0.0967 0.0565  128 ALA A N   
718  C CA  . ALA A 115 ? 0.9765 1.5207 1.3656 -0.2661 -0.0985 0.0652  128 ALA A CA  
719  C C   . ALA A 115 ? 0.9191 1.4855 1.3178 -0.2750 -0.0802 0.0825  128 ALA A C   
720  O O   . ALA A 115 ? 1.1003 1.6854 1.5190 -0.3027 -0.0800 0.0927  128 ALA A O   
721  C CB  . ALA A 115 ? 1.0071 1.4844 1.3643 -0.2629 -0.1049 0.0592  128 ALA A CB  
722  N N   . ALA A 116 ? 0.8172 1.3817 1.2003 -0.2525 -0.0652 0.0857  129 ALA A N   
723  C CA  . ALA A 116 ? 0.8391 1.4241 1.2265 -0.2572 -0.0467 0.1009  129 ALA A CA  
724  C C   . ALA A 116 ? 0.8838 1.5369 1.3075 -0.2716 -0.0404 0.1071  129 ALA A C   
725  O O   . ALA A 116 ? 0.9068 1.5748 1.3403 -0.2949 -0.0315 0.1210  129 ALA A O   
726  C CB  . ALA A 116 ? 0.7952 1.3769 1.1635 -0.2266 -0.0337 0.0996  129 ALA A CB  
727  N N   . GLU A 117 ? 0.8867 1.5817 1.3299 -0.2580 -0.0455 0.0966  130 GLU A N   
728  C CA  . GLU A 117 ? 0.8483 1.6159 1.3291 -0.2653 -0.0396 0.0990  130 GLU A CA  
729  C C   . GLU A 117 ? 0.8493 1.6375 1.3572 -0.3004 -0.0500 0.1024  130 GLU A C   
730  O O   . GLU A 117 ? 0.9465 1.7904 1.4841 -0.3177 -0.0409 0.1101  130 GLU A O   
731  C CB  . GLU A 117 ? 0.8155 1.6172 1.3066 -0.2357 -0.0443 0.0858  130 GLU A CB  
732  C CG  . GLU A 117 ? 0.7617 1.5533 1.2306 -0.2032 -0.0325 0.0843  130 GLU A CG  
733  C CD  . GLU A 117 ? 0.7350 1.5413 1.2046 -0.1736 -0.0420 0.0713  130 GLU A CD  
734  O OE1 . GLU A 117 ? 0.7178 1.5616 1.2138 -0.1762 -0.0541 0.0642  130 GLU A OE1 
735  O OE2 . GLU A 117 ? 0.6219 1.4011 1.0649 -0.1484 -0.0382 0.0686  130 GLU A OE2 
736  N N   . GLU A 118 ? 0.8324 1.5777 1.3305 -0.3114 -0.0690 0.0960  131 GLU A N   
737  C CA  . GLU A 118 ? 0.8345 1.5893 1.3546 -0.3468 -0.0814 0.0992  131 GLU A CA  
738  C C   . GLU A 118 ? 0.8568 1.5933 1.3721 -0.3776 -0.0731 0.1172  131 GLU A C   
739  O O   . GLU A 118 ? 0.8244 1.6021 1.3671 -0.4070 -0.0705 0.1268  131 GLU A O   
740  C CB  . GLU A 118 ? 0.8171 1.5240 1.3231 -0.3492 -0.1045 0.0865  131 GLU A CB  
741  N N   . VAL A 119 ? 0.8902 1.5659 1.3705 -0.3712 -0.0695 0.1220  132 VAL A N   
742  C CA  . VAL A 119 ? 0.8790 1.5305 1.3487 -0.3972 -0.0623 0.1403  132 VAL A CA  
743  C C   . VAL A 119 ? 0.9079 1.6159 1.3914 -0.4000 -0.0387 0.1535  132 VAL A C   
744  O O   . VAL A 119 ? 1.0180 1.7378 1.5083 -0.4315 -0.0325 0.1698  132 VAL A O   
745  C CB  . VAL A 119 ? 0.8402 1.4155 1.2694 -0.3849 -0.0644 0.1410  132 VAL A CB  
746  N N   . THR A 120 ? 0.9088 1.6510 1.3950 -0.3675 -0.0262 0.1461  133 THR A N   
747  C CA  . THR A 120 ? 0.8845 1.6869 1.3858 -0.3655 -0.0040 0.1544  133 THR A CA  
748  C C   . THR A 120 ? 0.9591 1.8366 1.5041 -0.3889 -0.0024 0.1562  133 THR A C   
749  O O   . THR A 120 ? 1.1062 2.0246 1.6639 -0.4100 0.0130  0.1694  133 THR A O   
750  C CB  . THR A 120 ? 0.8270 1.6468 1.3219 -0.3231 0.0055  0.1433  133 THR A CB  
751  O OG1 . THR A 120 ? 0.8542 1.6078 1.3097 -0.3041 0.0052  0.1427  133 THR A OG1 
752  C CG2 . THR A 120 ? 0.7809 1.6637 1.2913 -0.3192 0.0280  0.1495  133 THR A CG2 
753  N N   . LEU A 121 ? 0.9600 1.8569 1.5274 -0.3861 -0.0186 0.1428  134 LEU A N   
754  C CA  . LEU A 121 ? 1.0091 1.9786 1.6211 -0.4080 -0.0202 0.1425  134 LEU A CA  
755  C C   . LEU A 121 ? 1.0500 2.0079 1.6684 -0.4560 -0.0262 0.1571  134 LEU A C   
756  O O   . LEU A 121 ? 1.1493 2.1636 1.7929 -0.4826 -0.0140 0.1683  134 LEU A O   
757  C CB  . LEU A 121 ? 0.9707 1.9574 1.6017 -0.3917 -0.0390 0.1241  134 LEU A CB  
758  N N   . GLN A 122 ? 1.0241 1.9092 1.6191 -0.4674 -0.0452 0.1567  135 GLN A N   
759  C CA  . GLN A 122 ? 0.9913 1.8534 1.5888 -0.5125 -0.0561 0.1694  135 GLN A CA  
760  C C   . GLN A 122 ? 1.0469 1.8862 1.6236 -0.5355 -0.0421 0.1914  135 GLN A C   
761  O O   . GLN A 122 ? 1.0775 1.9469 1.6710 -0.5745 -0.0379 0.2066  135 GLN A O   
762  C CB  . GLN A 122 ? 0.9592 1.7452 1.5348 -0.5135 -0.0820 0.1599  135 GLN A CB  
763  N N   . THR A 123 ? 1.0738 1.8605 1.6134 -0.5126 -0.0354 0.1935  136 THR A N   
764  C CA  . THR A 123 ? 1.0856 1.8412 1.5994 -0.5315 -0.0245 0.2142  136 THR A CA  
765  C C   . THR A 123 ? 1.0721 1.8982 1.5994 -0.5335 0.0027  0.2247  136 THR A C   
766  O O   . THR A 123 ? 1.1018 1.9395 1.6279 -0.5681 0.0116  0.2444  136 THR A O   
767  C CB  . THR A 123 ? 1.0443 1.7218 1.5147 -0.5049 -0.0274 0.2118  136 THR A CB  
768  N N   . GLY A 124 ? 1.0591 1.9307 1.5975 -0.4965 0.0155  0.2114  137 GLY A N   
769  C CA  . GLY A 124 ? 1.0083 1.9478 1.5586 -0.4914 0.0415  0.2171  137 GLY A CA  
770  C C   . GLY A 124 ? 1.0540 1.9628 1.5702 -0.4595 0.0546  0.2174  137 GLY A C   
771  O O   . GLY A 124 ? 1.0529 2.0120 1.5785 -0.4337 0.0712  0.2102  137 GLY A O   
772  N N   . ILE A 125 ? 1.0419 1.8682 1.5189 -0.4607 0.0462  0.2247  138 ILE A N   
773  C CA  . ILE A 125 ? 1.0342 1.8240 1.4770 -0.4314 0.0558  0.2249  138 ILE A CA  
774  C C   . ILE A 125 ? 0.9744 1.7394 1.4102 -0.3895 0.0466  0.2042  138 ILE A C   
775  O O   . ILE A 125 ? 0.9118 1.6455 1.3500 -0.3881 0.0272  0.1941  138 ILE A O   
776  C CB  . ILE A 125 ? 1.0760 1.7881 1.4805 -0.4495 0.0491  0.2410  138 ILE A CB  
777  N N   . LYS A 126 ? 0.9298 1.7077 1.3551 -0.3566 0.0602  0.1982  139 LYS A N   
778  C CA  . LYS A 126 ? 0.9598 1.7207 1.3784 -0.3177 0.0532  0.1799  139 LYS A CA  
779  C C   . LYS A 126 ? 0.9311 1.6091 1.3156 -0.3086 0.0395  0.1775  139 LYS A C   
780  O O   . LYS A 126 ? 0.9012 1.5346 1.2597 -0.3187 0.0413  0.1895  139 LYS A O   
781  C CB  . LYS A 126 ? 1.0187 1.8139 1.4340 -0.2867 0.0707  0.1748  139 LYS A CB  
782  C CG  . LYS A 126 ? 1.0445 1.8220 1.4509 -0.2481 0.0632  0.1576  139 LYS A CG  
783  C CD  . LYS A 126 ? 1.1033 1.9193 1.5106 -0.2187 0.0782  0.1516  139 LYS A CD  
784  C CE  . LYS A 126 ? 1.1576 1.9504 1.5532 -0.1833 0.0687  0.1363  139 LYS A CE  
785  N NZ  . LYS A 126 ? 1.2329 2.0555 1.6264 -0.1537 0.0808  0.1300  139 LYS A NZ  
786  N N   . ARG A 127 ? 0.9537 1.6138 1.3384 -0.2888 0.0256  0.1613  140 ARG A N   
787  C CA  . ARG A 127 ? 1.0077 1.5981 1.3631 -0.2760 0.0133  0.1549  140 ARG A CA  
788  C C   . ARG A 127 ? 0.9634 1.5489 1.3041 -0.2382 0.0177  0.1432  140 ARG A C   
789  O O   . ARG A 127 ? 0.9478 1.5799 1.3043 -0.2210 0.0234  0.1362  140 ARG A O   
790  C CB  . ARG A 127 ? 1.0018 1.5700 1.3650 -0.2871 -0.0075 0.1454  140 ARG A CB  
791  C CG  . ARG A 127 ? 1.0176 1.5407 1.3725 -0.3177 -0.0188 0.1549  140 ARG A CG  
792  C CD  . ARG A 127 ? 1.0158 1.5684 1.3844 -0.3506 -0.0100 0.1737  140 ARG A CD  
793  N NE  . ARG A 127 ? 1.0723 1.5769 1.4325 -0.3813 -0.0252 0.1823  140 ARG A NE  
794  C CZ  . ARG A 127 ? 1.1264 1.6457 1.4972 -0.4178 -0.0240 0.1989  140 ARG A CZ  
795  N NH1 . ARG A 127 ? 1.1338 1.7205 1.5261 -0.4291 -0.0063 0.2084  140 ARG A NH1 
796  N NH2 . ARG A 127 ? 1.1510 1.6171 1.5106 -0.4438 -0.0410 0.2058  140 ARG A NH2 
797  N N   . PHE A 128 ? 0.8400 1.3688 1.1509 -0.2257 0.0139  0.1410  141 PHE A N   
798  C CA  . PHE A 128 ? 0.8766 1.3952 1.1698 -0.1934 0.0184  0.1322  141 PHE A CA  
799  C C   . PHE A 128 ? 0.8632 1.3379 1.1406 -0.1811 0.0040  0.1188  141 PHE A C   
800  O O   . PHE A 128 ? 0.9023 1.3358 1.1709 -0.1938 -0.0068 0.1182  141 PHE A O   
801  C CB  . PHE A 128 ? 0.8075 1.3062 1.0781 -0.1876 0.0311  0.1425  141 PHE A CB  
802  C CG  . PHE A 128 ? 0.8362 1.3807 1.1179 -0.1962 0.0477  0.1542  141 PHE A CG  
803  C CD1 . PHE A 128 ? 0.8156 1.4032 1.1044 -0.1750 0.0593  0.1494  141 PHE A CD1 
804  C CD2 . PHE A 128 ? 0.8244 1.3691 1.1084 -0.2259 0.0511  0.1697  141 PHE A CD2 
805  C CE1 . PHE A 128 ? 0.7480 1.3817 1.0472 -0.1816 0.0755  0.1581  141 PHE A CE1 
806  C CE2 . PHE A 128 ? 0.8126 1.4036 1.1056 -0.2353 0.0679  0.1803  141 PHE A CE2 
807  C CZ  . PHE A 128 ? 0.7895 1.4272 1.0908 -0.2124 0.0808  0.1736  141 PHE A CZ  
808  N N   . VAL A 129 ? 0.7350 1.2187 1.0079 -0.1563 0.0035  0.1079  142 VAL A N   
809  C CA  . VAL A 129 ? 0.8543 1.3024 1.1102 -0.1441 -0.0079 0.0949  142 VAL A CA  
810  C C   . VAL A 129 ? 0.7950 1.2119 1.0239 -0.1248 -0.0013 0.0942  142 VAL A C   
811  O O   . VAL A 129 ? 0.6754 1.1097 0.8996 -0.1078 0.0082  0.0958  142 VAL A O   
812  C CB  . VAL A 129 ? 0.8208 1.2960 1.0862 -0.1316 -0.0152 0.0837  142 VAL A CB  
813  N N   . ALA A 130 ? 0.7397 1.1108 0.9514 -0.1273 -0.0075 0.0910  143 ALA A N   
814  C CA  . ALA A 130 ? 0.6923 1.0334 0.8799 -0.1103 -0.0031 0.0888  143 ALA A CA  
815  C C   . ALA A 130 ? 0.6925 1.0209 0.8682 -0.0960 -0.0106 0.0738  143 ALA A C   
816  O O   . ALA A 130 ? 0.6853 0.9989 0.8619 -0.1029 -0.0221 0.0641  143 ALA A O   
817  C CB  . ALA A 130 ? 0.7653 1.0660 0.9421 -0.1201 -0.0056 0.0938  143 ALA A CB  
818  N N   . GLY A 131 ? 0.6017 0.9357 0.7649 -0.0771 -0.0044 0.0718  144 GLY A N   
819  C CA  . GLY A 131 ? 0.5994 0.9212 0.7473 -0.0649 -0.0100 0.0596  144 GLY A CA  
820  C C   . GLY A 131 ? 0.6252 0.9102 0.7551 -0.0610 -0.0104 0.0542  144 GLY A C   
821  O O   . GLY A 131 ? 0.6390 0.9136 0.7571 -0.0517 -0.0026 0.0588  144 GLY A O   
822  N N   . ALA A 132 ? 0.6406 0.9068 0.7690 -0.0674 -0.0203 0.0433  145 ALA A N   
823  C CA  . ALA A 132 ? 0.6474 0.8814 0.7624 -0.0629 -0.0220 0.0356  145 ALA A CA  
824  C C   . ALA A 132 ? 0.7030 0.9355 0.8002 -0.0487 -0.0196 0.0259  145 ALA A C   
825  O O   . ALA A 132 ? 0.7512 0.9924 0.8440 -0.0479 -0.0248 0.0162  145 ALA A O   
826  C CB  . ALA A 132 ? 0.6832 0.8973 0.8036 -0.0739 -0.0342 0.0257  145 ALA A CB  
827  N N   . LEU A 133 ? 0.6881 0.9102 0.7740 -0.0388 -0.0121 0.0291  146 LEU A N   
828  C CA  . LEU A 133 ? 0.6088 0.8256 0.6777 -0.0281 -0.0101 0.0196  146 LEU A CA  
829  C C   . LEU A 133 ? 0.6574 0.8498 0.7234 -0.0263 -0.0129 0.0099  146 LEU A C   
830  O O   . LEU A 133 ? 0.7926 0.9693 0.8621 -0.0265 -0.0120 0.0165  146 LEU A O   
831  C CB  . LEU A 133 ? 0.6422 0.8656 0.7009 -0.0181 -0.0009 0.0288  146 LEU A CB  
832  C CG  . LEU A 133 ? 0.6921 0.9385 0.7516 -0.0157 0.0001  0.0356  146 LEU A CG  
833  C CD1 . LEU A 133 ? 0.7015 0.9607 0.7756 -0.0186 0.0043  0.0483  146 LEU A CD1 
834  C CD2 . LEU A 133 ? 0.7290 0.9755 0.7700 -0.0048 0.0042  0.0367  146 LEU A CD2 
835  N N   . GLY A 134 ? 0.7210 0.9111 0.7801 -0.0240 -0.0171 -0.0063 147 GLY A N   
836  C CA  . GLY A 134 ? 0.6792 0.8496 0.7376 -0.0201 -0.0213 -0.0198 147 GLY A CA  
837  C C   . GLY A 134 ? 0.7006 0.8731 0.7471 -0.0094 -0.0146 -0.0258 147 GLY A C   
838  O O   . GLY A 134 ? 0.7193 0.9054 0.7558 -0.0064 -0.0073 -0.0189 147 GLY A O   
839  N N   . PRO A 135 ? 0.8294 0.9882 0.8772 -0.0034 -0.0180 -0.0395 148 PRO A N   
840  C CA  . PRO A 135 ? 0.8399 1.0018 0.8805 0.0063  -0.0119 -0.0446 148 PRO A CA  
841  C C   . PRO A 135 ? 0.8173 0.9994 0.8468 0.0080  -0.0078 -0.0592 148 PRO A C   
842  O O   . PRO A 135 ? 0.7223 0.9138 0.7438 0.0126  -0.0007 -0.0595 148 PRO A O   
843  C CB  . PRO A 135 ? 0.7987 0.9381 0.8483 0.0126  -0.0196 -0.0541 148 PRO A CB  
844  C CG  . PRO A 135 ? 0.7649 0.8946 0.8215 0.0070  -0.0301 -0.0648 148 PRO A CG  
845  C CD  . PRO A 135 ? 0.8136 0.9533 0.8705 -0.0049 -0.0293 -0.0521 148 PRO A CD  
846  N N   . THR A 136 ? 0.8763 1.0653 0.9041 0.0028  -0.0125 -0.0707 149 THR A N   
847  C CA  . THR A 136 ? 0.8141 1.0209 0.8310 0.0036  -0.0099 -0.0885 149 THR A CA  
848  C C   . THR A 136 ? 0.9529 1.1565 0.9766 0.0134  -0.0110 -0.1077 149 THR A C   
849  O O   . THR A 136 ? 1.0266 1.2123 1.0614 0.0202  -0.0143 -0.1051 149 THR A O   
850  C CB  . THR A 136 ? 0.7258 0.9517 0.7251 0.0009  -0.0005 -0.0808 149 THR A CB  
851  O OG1 . THR A 136 ? 0.6660 0.8943 0.6645 0.0073  0.0061  -0.0806 149 THR A OG1 
852  C CG2 . THR A 136 ? 0.6615 0.8864 0.6570 -0.0039 -0.0002 -0.0598 149 THR A CG2 
853  N N   . ASN A 137 ? 0.9229 1.1449 0.9393 0.0145  -0.0088 -0.1275 150 ASN A N   
854  C CA  . ASN A 137 ? 0.8704 1.0971 0.8943 0.0256  -0.0088 -0.1489 150 ASN A CA  
855  C C   . ASN A 137 ? 0.9447 1.1896 0.9650 0.0292  0.0017  -0.1469 150 ASN A C   
856  O O   . ASN A 137 ? 0.8288 1.0799 0.8588 0.0396  0.0019  -0.1627 150 ASN A O   
857  C CB  . ASN A 137 ? 0.9008 1.1425 0.9200 0.0260  -0.0109 -0.1742 150 ASN A CB  
858  C CG  . ASN A 137 ? 1.0601 1.3293 1.0583 0.0152  -0.0021 -0.1735 150 ASN A CG  
859  O OD1 . ASN A 137 ? 1.2077 1.4754 1.1954 0.0055  -0.0007 -0.1538 150 ASN A OD1 
860  N ND2 . ASN A 137 ? 1.1437 1.4384 1.1349 0.0169  0.0032  -0.1953 150 ASN A ND2 
861  N N   . LYS A 138 ? 0.8651 1.1179 0.8722 0.0210  0.0092  -0.1281 151 LYS A N   
862  C CA  . LYS A 138 ? 0.7873 1.0545 0.7893 0.0217  0.0182  -0.1236 151 LYS A CA  
863  C C   . LYS A 138 ? 0.8150 1.0630 0.8288 0.0299  0.0160  -0.1122 151 LYS A C   
864  O O   . LYS A 138 ? 0.7904 1.0164 0.8073 0.0293  0.0115  -0.0961 151 LYS A O   
865  C CB  . LYS A 138 ? 0.6211 0.8982 0.6021 0.0099  0.0245  -0.1076 151 LYS A CB  
866  N N   . THR A 139 ? 0.8066 1.0655 0.8269 0.0371  0.0191  -0.1211 152 THR A N   
867  C CA  . THR A 139 ? 0.8382 1.0808 0.8679 0.0454  0.0164  -0.1120 152 THR A CA  
868  C C   . THR A 139 ? 0.9073 1.1656 0.9280 0.0417  0.0250  -0.1037 152 THR A C   
869  O O   . THR A 139 ? 1.1242 1.4083 1.1468 0.0422  0.0301  -0.1178 152 THR A O   
870  C CB  . THR A 139 ? 0.7543 0.9925 0.8027 0.0595  0.0089  -0.1313 152 THR A CB  
871  N N   . LEU A 140 ? 0.8648 1.1088 0.8761 0.0378  0.0263  -0.0817 153 LEU A N   
872  C CA  . LEU A 140 ? 1.0320 1.2852 1.0319 0.0332  0.0326  -0.0721 153 LEU A CA  
873  C C   . LEU A 140 ? 0.9713 1.2232 0.9822 0.0423  0.0310  -0.0747 153 LEU A C   
874  O O   . LEU A 140 ? 0.7818 1.0464 0.7863 0.0383  0.0356  -0.0720 153 LEU A O   
875  C CB  . LEU A 140 ? 0.9989 1.2360 0.9843 0.0279  0.0332  -0.0496 153 LEU A CB  
876  N N   . SER A 141 ? 1.0073 1.2425 1.0336 0.0536  0.0231  -0.0795 154 SER A N   
877  C CA  . SER A 141 ? 1.0108 1.2419 1.0479 0.0639  0.0189  -0.0824 154 SER A CA  
878  C C   . SER A 141 ? 1.0591 1.3085 1.1146 0.0737  0.0155  -0.1077 154 SER A C   
879  O O   . SER A 141 ? 0.9648 1.2179 1.0313 0.0828  0.0117  -0.1135 154 SER A O   
880  C CB  . SER A 141 ? 0.7398 0.9365 0.7790 0.0702  0.0106  -0.0684 154 SER A CB  
881  N N   . VAL A 142 ? 1.0150 1.2771 1.0742 0.0728  0.0162  -0.1238 155 VAL A N   
882  C CA  . VAL A 142 ? 1.0420 1.3234 1.1190 0.0840  0.0128  -0.1510 155 VAL A CA  
883  C C   . VAL A 142 ? 1.0820 1.4018 1.1540 0.0755  0.0232  -0.1668 155 VAL A C   
884  O O   . VAL A 142 ? 1.2124 1.5314 1.2706 0.0652  0.0268  -0.1627 155 VAL A O   
885  C CB  . VAL A 142 ? 0.8392 1.0928 0.9269 0.0951  -0.0001 -0.1601 155 VAL A CB  
886  N N   . SER A 143 ? 1.1332 1.4883 1.2163 0.0794  0.0279  -0.1850 156 SER A N   
887  C CA  . SER A 143 ? 1.2576 1.6547 1.3366 0.0711  0.0387  -0.2024 156 SER A CA  
888  C C   . SER A 143 ? 1.2926 1.6907 1.3785 0.0797  0.0340  -0.2247 156 SER A C   
889  O O   . SER A 143 ? 1.2867 1.6597 1.3875 0.0958  0.0212  -0.2331 156 SER A O   
890  C CB  . SER A 143 ? 1.2087 1.6472 1.3022 0.0740  0.0446  -0.2180 156 SER A CB  
891  O OG  . SER A 143 ? 0.9485 1.4316 1.0357 0.0629  0.0570  -0.2331 156 SER A OG  
892  N N   . PRO A 144 ? 1.2516 1.6759 1.3243 0.0686  0.0430  -0.2342 157 PRO A N   
893  C CA  . PRO A 144 ? 1.2581 1.6879 1.3365 0.0772  0.0389  -0.2592 157 PRO A CA  
894  C C   . PRO A 144 ? 1.2495 1.7065 1.3528 0.0961  0.0364  -0.2915 157 PRO A C   
895  O O   . PRO A 144 ? 1.4527 1.9024 1.5650 0.1094  0.0278  -0.3129 157 PRO A O   
896  C CB  . PRO A 144 ? 1.2892 1.7465 1.3444 0.0588  0.0509  -0.2601 157 PRO A CB  
897  C CG  . PRO A 144 ? 1.3476 1.7925 1.3824 0.0413  0.0559  -0.2288 157 PRO A CG  
898  C CD  . PRO A 144 ? 1.2641 1.7052 1.3117 0.0467  0.0550  -0.2193 157 PRO A CD  
899  N N   . SER A 145 ? 1.2282 1.7165 1.3430 0.0976  0.0428  -0.2957 158 SER A N   
900  C CA  . SER A 145 ? 1.3042 1.8231 1.4461 0.1169  0.0401  -0.3267 158 SER A CA  
901  C C   . SER A 145 ? 1.2472 1.7710 1.4061 0.1237  0.0374  -0.3204 158 SER A C   
902  O O   . SER A 145 ? 1.0723 1.5921 1.2193 0.1087  0.0432  -0.2954 158 SER A O   
903  C CB  . SER A 145 ? 1.3851 1.9644 1.5249 0.1096  0.0556  -0.3506 158 SER A CB  
904  N N   . VAL A 146 ? 1.3841 1.9156 1.5707 0.1472  0.0271  -0.3441 159 VAL A N   
905  C CA  . VAL A 146 ? 1.3652 1.9078 1.5711 0.1559  0.0232  -0.3432 159 VAL A CA  
906  C C   . VAL A 146 ? 1.3609 1.9712 1.5754 0.1463  0.0397  -0.3566 159 VAL A C   
907  O O   . VAL A 146 ? 1.4596 2.0853 1.6871 0.1473  0.0392  -0.3524 159 VAL A O   
908  C CB  . VAL A 146 ? 1.3455 1.8708 1.5786 0.1862  0.0037  -0.3646 159 VAL A CB  
909  N N   . GLU A 147 ? 1.2893 1.9407 1.4957 0.1358  0.0539  -0.3724 160 GLU A N   
910  C CA  . GLU A 147 ? 1.2043 1.9231 1.4147 0.1216  0.0716  -0.3837 160 GLU A CA  
911  C C   . GLU A 147 ? 1.0995 1.8169 1.2877 0.0936  0.0815  -0.3513 160 GLU A C   
912  O O   . GLU A 147 ? 0.9559 1.7068 1.1557 0.0872  0.0868  -0.3508 160 GLU A O   
913  C CB  . GLU A 147 ? 1.0948 1.8529 1.2954 0.1148  0.0844  -0.4057 160 GLU A CB  
914  N N   . ARG A 148 ? 1.1059 1.7841 1.2629 0.0776  0.0826  -0.3251 161 ARG A N   
915  C CA  . ARG A 148 ? 0.9602 1.6269 1.0928 0.0529  0.0890  -0.2935 161 ARG A CA  
916  C C   . ARG A 148 ? 0.9472 1.5494 1.0712 0.0581  0.0759  -0.2661 161 ARG A C   
917  O O   . ARG A 148 ? 1.1840 1.7514 1.2854 0.0505  0.0745  -0.2490 161 ARG A O   
918  C CB  . ARG A 148 ? 0.8418 1.5211 0.9427 0.0286  0.1016  -0.2860 161 ARG A CB  
919  N N   . PRO A 149 ? 0.9324 1.5208 1.0744 0.0710  0.0663  -0.2622 162 PRO A N   
920  C CA  . PRO A 149 ? 0.9015 1.4317 1.0359 0.0771  0.0541  -0.2381 162 PRO A CA  
921  C C   . PRO A 149 ? 0.9449 1.4538 1.0524 0.0569  0.0585  -0.2068 162 PRO A C   
922  O O   . PRO A 149 ? 0.8386 1.3017 0.9362 0.0602  0.0506  -0.1867 162 PRO A O   
923  C CB  . PRO A 149 ? 0.8388 1.3686 1.0001 0.0965  0.0429  -0.2469 162 PRO A CB  
924  C CG  . PRO A 149 ? 0.8567 1.4468 1.0344 0.0919  0.0522  -0.2654 162 PRO A CG  
925  C CD  . PRO A 149 ? 0.9951 1.6233 1.1666 0.0820  0.0654  -0.2822 162 PRO A CD  
926  N N   . ASP A 150 ? 1.0999 1.6415 1.1951 0.0363  0.0704  -0.2032 163 ASP A N   
927  C CA  . ASP A 150 ? 1.0297 1.5500 1.0968 0.0167  0.0734  -0.1751 163 ASP A CA  
928  C C   . ASP A 150 ? 1.0496 1.5493 1.0902 0.0060  0.0763  -0.1633 163 ASP A C   
929  O O   . ASP A 150 ? 0.8664 1.3330 0.8855 -0.0021 0.0738  -0.1395 163 ASP A O   
930  C CB  . ASP A 150 ? 0.9903 1.5509 1.0528 -0.0032 0.0832  -0.1752 163 ASP A CB  
931  N N   . TYR A 151 ? 0.9402 1.4602 0.9831 0.0075  0.0806  -0.1814 164 TYR A N   
932  C CA  . TYR A 151 ? 0.9134 1.4248 0.9309 -0.0051 0.0843  -0.1741 164 TYR A CA  
933  C C   . TYR A 151 ? 0.9633 1.4289 0.9774 0.0056  0.0744  -0.1640 164 TYR A C   
934  O O   . TYR A 151 ? 0.8312 1.2783 0.8652 0.0242  0.0656  -0.1705 164 TYR A O   
935  C CB  . TYR A 151 ? 1.0192 1.5755 1.0397 -0.0086 0.0933  -0.1996 164 TYR A CB  
936  C CG  . TYR A 151 ? 1.1192 1.6672 1.1206 -0.0140 0.0941  -0.2008 164 TYR A CG  
937  C CD1 . TYR A 151 ? 1.1384 1.6772 1.1072 -0.0349 0.0976  -0.1813 164 TYR A CD1 
938  C CD2 . TYR A 151 ? 1.2185 1.7677 1.2338 0.0017  0.0901  -0.2226 164 TYR A CD2 
939  C CE1 . TYR A 151 ? 1.2270 1.7593 1.1782 -0.0396 0.0970  -0.1828 164 TYR A CE1 
940  C CE2 . TYR A 151 ? 1.3591 1.9016 1.3569 -0.0035 0.0899  -0.2247 164 TYR A CE2 
941  C CZ  . TYR A 151 ? 1.3589 1.8942 1.3251 -0.0242 0.0936  -0.2047 164 TYR A CZ  
942  O OH  . TYR A 151 ? 1.1589 1.6878 1.1076 -0.0291 0.0921  -0.2071 164 TYR A OH  
943  N N   . ARG A 152 ? 0.9216 1.3688 0.9102 -0.0070 0.0750  -0.1471 165 ARG A N   
944  C CA  . ARG A 152 ? 0.8865 1.2967 0.8712 -0.0001 0.0669  -0.1374 165 ARG A CA  
945  C C   . ARG A 152 ? 1.0861 1.5001 1.0497 -0.0121 0.0693  -0.1368 165 ARG A C   
946  O O   . ARG A 152 ? 0.9639 1.3966 0.9066 -0.0291 0.0762  -0.1329 165 ARG A O   
947  C CB  . ARG A 152 ? 0.7388 1.1136 0.7151 -0.0003 0.0616  -0.1116 165 ARG A CB  
948  C CG  . ARG A 152 ? 0.6865 1.0501 0.6808 0.0123  0.0571  -0.1096 165 ARG A CG  
949  C CD  . ARG A 152 ? 0.6724 1.0174 0.6871 0.0300  0.0486  -0.1182 165 ARG A CD  
950  N NE  . ARG A 152 ? 0.6991 1.0308 0.7273 0.0414  0.0429  -0.1145 165 ARG A NE  
951  C CZ  . ARG A 152 ? 0.7093 1.0606 0.7560 0.0500  0.0418  -0.1301 165 ARG A CZ  
952  N NH1 . ARG A 152 ? 0.7347 1.1240 0.7906 0.0492  0.0473  -0.1522 165 ARG A NH1 
953  N NH2 . ARG A 152 ? 0.6102 0.9449 0.6661 0.0601  0.0348  -0.1241 165 ARG A NH2 
954  N N   . ASN A 153 ? 1.2493 1.6443 1.2174 -0.0041 0.0626  -0.1400 166 ASN A N   
955  C CA  . ASN A 153 ? 1.2687 1.6656 1.2187 -0.0134 0.0627  -0.1410 166 ASN A CA  
956  C C   . ASN A 153 ? 1.1000 1.4730 1.0280 -0.0236 0.0594  -0.1152 166 ASN A C   
957  O O   . ASN A 153 ? 1.3098 1.6924 1.2133 -0.0386 0.0627  -0.1093 166 ASN A O   
958  C CB  . ASN A 153 ? 1.1924 1.5777 1.1568 -0.0014 0.0551  -0.1554 166 ASN A CB  
959  N N   . ILE A 154 ? 0.8240 1.1665 0.7603 -0.0151 0.0525  -0.1005 167 ILE A N   
960  C CA  . ILE A 154 ? 0.8417 1.1620 0.7616 -0.0207 0.0485  -0.0777 167 ILE A CA  
961  C C   . ILE A 154 ? 0.8300 1.1373 0.7484 -0.0191 0.0490  -0.0619 167 ILE A C   
962  O O   . ILE A 154 ? 1.0581 1.3688 0.9917 -0.0118 0.0508  -0.0673 167 ILE A O   
963  C CB  . ILE A 154 ? 0.6824 0.9807 0.6123 -0.0131 0.0405  -0.0727 167 ILE A CB  
964  N N   . THR A 155 ? 0.7746 1.0661 0.6743 -0.0250 0.0461  -0.0433 168 THR A N   
965  C CA  . THR A 155 ? 0.6559 0.9306 0.5514 -0.0225 0.0448  -0.0279 168 THR A CA  
966  C C   . THR A 155 ? 0.6048 0.8551 0.5050 -0.0130 0.0389  -0.0147 168 THR A C   
967  O O   . THR A 155 ? 0.6980 0.9450 0.6006 -0.0117 0.0352  -0.0144 168 THR A O   
968  C CB  . THR A 155 ? 0.8188 1.0933 0.6867 -0.0367 0.0452  -0.0172 168 THR A CB  
969  O OG1 . THR A 155 ? 0.8899 1.1598 0.7388 -0.0441 0.0408  -0.0116 168 THR A OG1 
970  C CG2 . THR A 155 ? 0.7812 1.0829 0.6459 -0.0479 0.0526  -0.0284 168 THR A CG2 
971  N N   . PHE A 156 ? 0.5679 0.8037 0.4697 -0.0067 0.0382  -0.0046 169 PHE A N   
972  C CA  . PHE A 156 ? 0.5648 0.7813 0.4698 0.0020  0.0342  0.0079  169 PHE A CA  
973  C C   . PHE A 156 ? 0.6791 0.8898 0.5692 -0.0014 0.0294  0.0169  169 PHE A C   
974  O O   . PHE A 156 ? 0.7246 0.9330 0.6239 0.0030  0.0265  0.0189  169 PHE A O   
975  C CB  . PHE A 156 ? 0.5874 0.7907 0.4879 0.0069  0.0343  0.0171  169 PHE A CB  
976  C CG  . PHE A 156 ? 0.6120 0.7998 0.5191 0.0177  0.0323  0.0270  169 PHE A CG  
977  C CD1 . PHE A 156 ? 0.6062 0.7909 0.5313 0.0253  0.0335  0.0245  169 PHE A CD1 
978  C CD2 . PHE A 156 ? 0.5744 0.7510 0.4688 0.0202  0.0288  0.0386  169 PHE A CD2 
979  C CE1 . PHE A 156 ? 0.6414 0.8145 0.5706 0.0330  0.0329  0.0343  169 PHE A CE1 
980  C CE2 . PHE A 156 ? 0.6693 0.8371 0.5703 0.0302  0.0286  0.0463  169 PHE A CE2 
981  C CZ  . PHE A 156 ? 0.6166 0.7838 0.5344 0.0354  0.0314  0.0446  169 PHE A CZ  
982  N N   . ASP A 157 ? 0.6576 0.8659 0.5245 -0.0101 0.0274  0.0224  170 ASP A N   
983  C CA  . ASP A 157 ? 0.7465 0.9450 0.5963 -0.0122 0.0201  0.0320  170 ASP A CA  
984  C C   . ASP A 157 ? 0.7970 1.0073 0.6479 -0.0172 0.0180  0.0253  170 ASP A C   
985  O O   . ASP A 157 ? 0.6905 0.8957 0.5407 -0.0134 0.0114  0.0308  170 ASP A O   
986  C CB  . ASP A 157 ? 0.8810 1.0694 0.7026 -0.0220 0.0166  0.0401  170 ASP A CB  
987  C CG  . ASP A 157 ? 1.0327 1.2077 0.8519 -0.0177 0.0173  0.0461  170 ASP A CG  
988  O OD1 . ASP A 157 ? 1.1156 1.3006 0.9391 -0.0228 0.0233  0.0400  170 ASP A OD1 
989  O OD2 . ASP A 157 ? 0.9263 1.0823 0.7398 -0.0085 0.0115  0.0558  170 ASP A OD2 
990  N N   . GLU A 158 ? 0.7904 1.0183 0.6439 -0.0248 0.0231  0.0122  171 GLU A N   
991  C CA  . GLU A 158 ? 0.7966 1.0363 0.6519 -0.0289 0.0213  0.0030  171 GLU A CA  
992  C C   . GLU A 158 ? 0.7365 0.9742 0.6167 -0.0189 0.0191  0.0001  171 GLU A C   
993  O O   . GLU A 158 ? 0.7812 1.0202 0.6617 -0.0199 0.0132  0.0004  171 GLU A O   
994  C CB  . GLU A 158 ? 0.8600 1.1210 0.7142 -0.0372 0.0281  -0.0131 171 GLU A CB  
995  C CG  . GLU A 158 ? 0.9306 1.1989 0.7556 -0.0527 0.0295  -0.0103 171 GLU A CG  
996  C CD  . GLU A 158 ? 0.8684 1.1637 0.6944 -0.0608 0.0389  -0.0269 171 GLU A CD  
997  O OE1 . GLU A 158 ? 0.8076 1.1125 0.6566 -0.0526 0.0444  -0.0380 171 GLU A OE1 
998  O OE2 . GLU A 158 ? 0.9961 1.3040 0.7991 -0.0754 0.0404  -0.0288 171 GLU A OE2 
999  N N   . LEU A 159 ? 0.6688 0.9030 0.5689 -0.0105 0.0229  -0.0018 172 LEU A N   
1000 C CA  . LEU A 159 ? 0.6941 0.9239 0.6164 -0.0033 0.0207  -0.0023 172 LEU A CA  
1001 C C   . LEU A 159 ? 0.5968 0.8179 0.5203 0.0016  0.0168  0.0121  172 LEU A C   
1002 O O   . LEU A 159 ? 0.6591 0.8828 0.5941 0.0023  0.0129  0.0129  172 LEU A O   
1003 C CB  . LEU A 159 ? 0.8560 1.0813 0.7955 0.0035  0.0246  -0.0067 172 LEU A CB  
1004 C CG  . LEU A 159 ? 0.9987 1.2332 0.9477 0.0029  0.0260  -0.0249 172 LEU A CG  
1005 C CD1 . LEU A 159 ? 0.9910 1.2186 0.9536 0.0109  0.0279  -0.0276 172 LEU A CD1 
1006 C CD2 . LEU A 159 ? 0.9053 1.1403 0.8652 0.0017  0.0208  -0.0329 172 LEU A CD2 
1007 N N   . VAL A 160 ? 0.5592 0.7713 0.4715 0.0053  0.0175  0.0226  173 VAL A N   
1008 C CA  . VAL A 160 ? 0.6069 0.8129 0.5190 0.0122  0.0137  0.0345  173 VAL A CA  
1009 C C   . VAL A 160 ? 0.5994 0.8104 0.5039 0.0090  0.0058  0.0359  173 VAL A C   
1010 O O   . VAL A 160 ? 0.6181 0.8348 0.5363 0.0129  0.0025  0.0386  173 VAL A O   
1011 C CB  . VAL A 160 ? 0.6295 0.8224 0.5263 0.0169  0.0141  0.0433  173 VAL A CB  
1012 C CG1 . VAL A 160 ? 0.6577 0.8450 0.5496 0.0250  0.0082  0.0530  173 VAL A CG1 
1013 C CG2 . VAL A 160 ? 0.6322 0.8204 0.5397 0.0223  0.0205  0.0433  173 VAL A CG2 
1014 N N   . GLU A 161 ? 0.6184 0.8285 0.5011 0.0009  0.0024  0.0343  174 GLU A N   
1015 C CA  . GLU A 161 ? 0.7121 0.9249 0.5839 -0.0027 -0.0067 0.0359  174 GLU A CA  
1016 C C   . GLU A 161 ? 0.6712 0.8974 0.5627 -0.0039 -0.0086 0.0283  174 GLU A C   
1017 O O   . GLU A 161 ? 0.7111 0.9414 0.6103 0.0000  -0.0157 0.0324  174 GLU A O   
1018 C CB  . GLU A 161 ? 0.6064 0.8177 0.4502 -0.0149 -0.0088 0.0339  174 GLU A CB  
1019 N N   . ALA A 162 ? 0.6887 0.9218 0.5892 -0.0090 -0.0032 0.0165  175 ALA A N   
1020 C CA  . ALA A 162 ? 0.7484 0.9908 0.6652 -0.0118 -0.0063 0.0077  175 ALA A CA  
1021 C C   . ALA A 162 ? 0.7073 0.9507 0.6495 -0.0057 -0.0068 0.0129  175 ALA A C   
1022 O O   . ALA A 162 ? 0.7171 0.9682 0.6690 -0.0070 -0.0135 0.0137  175 ALA A O   
1023 C CB  . ALA A 162 ? 0.7181 0.9646 0.6389 -0.0161 -0.0010 -0.0073 175 ALA A CB  
1024 N N   . TYR A 163 ? 0.6139 0.8507 0.5662 -0.0002 0.0000  0.0167  176 TYR A N   
1025 C CA  . TYR A 163 ? 0.5998 0.8381 0.5733 0.0037  0.0011  0.0234  176 TYR A CA  
1026 C C   . TYR A 163 ? 0.6918 0.9374 0.6663 0.0092  -0.0026 0.0336  176 TYR A C   
1027 O O   . TYR A 163 ? 0.7209 0.9776 0.7140 0.0090  -0.0044 0.0365  176 TYR A O   
1028 C CB  . TYR A 163 ? 0.6058 0.8341 0.5835 0.0088  0.0086  0.0270  176 TYR A CB  
1029 C CG  . TYR A 163 ? 0.6414 0.8630 0.6287 0.0059  0.0105  0.0175  176 TYR A CG  
1030 C CD1 . TYR A 163 ? 0.5944 0.8171 0.5969 0.0004  0.0062  0.0116  176 TYR A CD1 
1031 C CD2 . TYR A 163 ? 0.6307 0.8439 0.6124 0.0093  0.0151  0.0141  176 TYR A CD2 
1032 C CE1 . TYR A 163 ? 0.6735 0.8860 0.6839 -0.0004 0.0054  0.0023  176 TYR A CE1 
1033 C CE2 . TYR A 163 ? 0.6143 0.8209 0.6058 0.0092  0.0148  0.0043  176 TYR A CE2 
1034 C CZ  . TYR A 163 ? 0.6799 0.8845 0.6851 0.0049  0.0096  -0.0016 176 TYR A CZ  
1035 O OH  . TYR A 163 ? 0.6513 0.8452 0.6654 0.0062  0.0070  -0.0120 176 TYR A OH  
1036 N N   . GLN A 164 ? 0.6001 0.8398 0.5549 0.0140  -0.0045 0.0386  177 GLN A N   
1037 C CA  . GLN A 164 ? 0.6297 0.8741 0.5837 0.0223  -0.0101 0.0467  177 GLN A CA  
1038 C C   . GLN A 164 ? 0.6034 0.8612 0.5636 0.0191  -0.0198 0.0441  177 GLN A C   
1039 O O   . GLN A 164 ? 0.6056 0.8774 0.5817 0.0247  -0.0231 0.0477  177 GLN A O   
1040 C CB  . GLN A 164 ? 0.6392 0.8683 0.5669 0.0271  -0.0132 0.0517  177 GLN A CB  
1041 C CG  . GLN A 164 ? 0.7059 0.9342 0.6340 0.0405  -0.0166 0.0594  177 GLN A CG  
1042 C CD  . GLN A 164 ? 0.7507 0.9576 0.6533 0.0453  -0.0189 0.0643  177 GLN A CD  
1043 O OE1 . GLN A 164 ? 0.8049 1.0008 0.6976 0.0403  -0.0126 0.0636  177 GLN A OE1 
1044 N NE2 . GLN A 164 ? 0.5962 0.7969 0.4889 0.0553  -0.0290 0.0689  177 GLN A NE2 
1045 N N   . GLU A 165 ? 0.6906 0.9464 0.6386 0.0099  -0.0242 0.0371  178 GLU A N   
1046 C CA  . GLU A 165 ? 0.7498 1.0163 0.6997 0.0058  -0.0348 0.0337  178 GLU A CA  
1047 C C   . GLU A 165 ? 0.7102 0.9917 0.6889 0.0014  -0.0344 0.0294  178 GLU A C   
1048 O O   . GLU A 165 ? 0.7395 1.0362 0.7325 0.0030  -0.0416 0.0313  178 GLU A O   
1049 C CB  . GLU A 165 ? 0.8910 1.1514 0.8174 -0.0039 -0.0382 0.0265  178 GLU A CB  
1050 C CG  . GLU A 165 ? 0.9812 1.2495 0.9019 -0.0081 -0.0511 0.0239  178 GLU A CG  
1051 C CD  . GLU A 165 ? 1.1372 1.3982 1.0267 -0.0174 -0.0543 0.0193  178 GLU A CD  
1052 O OE1 . GLU A 165 ? 1.0276 1.2847 0.9086 -0.0231 -0.0448 0.0131  178 GLU A OE1 
1053 O OE2 . GLU A 165 ? 1.4424 1.7030 1.3159 -0.0192 -0.0666 0.0219  178 GLU A OE2 
1054 N N   . GLN A 166 ? 0.6840 0.9608 0.6712 -0.0043 -0.0271 0.0234  179 GLN A N   
1055 C CA  . GLN A 166 ? 0.6463 0.9315 0.6595 -0.0099 -0.0270 0.0210  179 GLN A CA  
1056 C C   . GLN A 166 ? 0.6351 0.9331 0.6681 -0.0047 -0.0239 0.0314  179 GLN A C   
1057 O O   . GLN A 166 ? 0.6971 1.0123 0.7497 -0.0088 -0.0285 0.0322  179 GLN A O   
1058 C CB  . GLN A 166 ? 0.6560 0.9278 0.6725 -0.0143 -0.0207 0.0142  179 GLN A CB  
1059 C CG  . GLN A 166 ? 0.6740 0.9468 0.7147 -0.0190 -0.0190 0.0169  179 GLN A CG  
1060 C CD  . GLN A 166 ? 0.6904 0.9481 0.7341 -0.0249 -0.0198 0.0062  179 GLN A CD  
1061 O OE1 . GLN A 166 ? 0.5785 0.8229 0.6124 -0.0208 -0.0149 0.0017  179 GLN A OE1 
1062 N NE2 . GLN A 166 ? 0.6817 0.9410 0.7394 -0.0341 -0.0271 0.0014  179 GLN A NE2 
1063 N N   . ALA A 167 ? 0.6554 0.9471 0.6831 0.0038  -0.0160 0.0385  180 ALA A N   
1064 C CA  . ALA A 167 ? 0.6997 1.0054 0.7434 0.0099  -0.0114 0.0473  180 ALA A CA  
1065 C C   . ALA A 167 ? 0.7153 1.0424 0.7671 0.0159  -0.0192 0.0493  180 ALA A C   
1066 O O   . ALA A 167 ? 0.7532 1.1032 0.8288 0.0135  -0.0188 0.0515  180 ALA A O   
1067 C CB  . ALA A 167 ? 0.7735 1.0668 0.8045 0.0197  -0.0033 0.0530  180 ALA A CB  
1068 N N   . LYS A 168 ? 0.6648 0.9850 0.6969 0.0230  -0.0272 0.0485  181 LYS A N   
1069 C CA  . LYS A 168 ? 0.6500 0.9874 0.6877 0.0307  -0.0379 0.0494  181 LYS A CA  
1070 C C   . LYS A 168 ? 0.7041 1.0642 0.7655 0.0212  -0.0438 0.0454  181 LYS A C   
1071 O O   . LYS A 168 ? 0.7457 1.1328 0.8315 0.0245  -0.0445 0.0474  181 LYS A O   
1072 C CB  . LYS A 168 ? 0.7667 1.0870 0.7755 0.0344  -0.0492 0.0486  181 LYS A CB  
1073 C CG  . LYS A 168 ? 0.8092 1.1107 0.7963 0.0464  -0.0487 0.0540  181 LYS A CG  
1074 C CD  . LYS A 168 ? 0.7930 1.0759 0.7497 0.0465  -0.0617 0.0548  181 LYS A CD  
1075 C CE  . LYS A 168 ? 1.0954 1.3577 1.0308 0.0586  -0.0650 0.0609  181 LYS A CE  
1076 N NZ  . LYS A 168 ? 1.2137 1.4573 1.1352 0.0552  -0.0534 0.0629  181 LYS A NZ  
1077 N N   . GLY A 169 ? 0.6804 1.0310 0.7348 0.0091  -0.0480 0.0389  182 GLY A N   
1078 C CA  . GLY A 169 ? 0.6990 1.0666 0.7721 -0.0013 -0.0557 0.0338  182 GLY A CA  
1079 C C   . GLY A 169 ? 0.7323 1.1190 0.8366 -0.0084 -0.0491 0.0366  182 GLY A C   
1080 O O   . GLY A 169 ? 0.8016 1.2150 0.9286 -0.0114 -0.0552 0.0365  182 GLY A O   
1081 N N   . LEU A 170 ? 0.7528 1.1265 0.8577 -0.0121 -0.0374 0.0394  183 LEU A N   
1082 C CA  . LEU A 170 ? 0.7364 1.1237 0.8664 -0.0217 -0.0310 0.0440  183 LEU A CA  
1083 C C   . LEU A 170 ? 0.6833 1.1016 0.8314 -0.0136 -0.0266 0.0510  183 LEU A C   
1084 O O   . LEU A 170 ? 0.6478 1.0949 0.8215 -0.0214 -0.0287 0.0522  183 LEU A O   
1085 C CB  . LEU A 170 ? 0.7443 1.1074 0.8669 -0.0254 -0.0208 0.0467  183 LEU A CB  
1086 C CG  . LEU A 170 ? 0.7711 1.1066 0.8810 -0.0328 -0.0245 0.0378  183 LEU A CG  
1087 C CD1 . LEU A 170 ? 0.7647 1.0766 0.8654 -0.0312 -0.0155 0.0402  183 LEU A CD1 
1088 C CD2 . LEU A 170 ? 0.7033 1.0424 0.8296 -0.0483 -0.0327 0.0328  183 LEU A CD2 
1089 N N   . LEU A 171 ? 0.6023 1.0159 0.7370 0.0018  -0.0211 0.0546  184 LEU A N   
1090 C CA  . LEU A 171 ? 0.6569 1.0993 0.8064 0.0129  -0.0162 0.0592  184 LEU A CA  
1091 C C   . LEU A 171 ? 0.6340 1.1068 0.8001 0.0183  -0.0278 0.0552  184 LEU A C   
1092 O O   . LEU A 171 ? 0.5889 1.0987 0.7828 0.0167  -0.0252 0.0565  184 LEU A O   
1093 C CB  . LEU A 171 ? 0.6278 1.0536 0.7556 0.0301  -0.0111 0.0617  184 LEU A CB  
1094 C CG  . LEU A 171 ? 0.6162 1.0184 0.7317 0.0264  0.0009  0.0663  184 LEU A CG  
1095 C CD1 . LEU A 171 ? 0.6395 1.0221 0.7312 0.0423  0.0033  0.0676  184 LEU A CD1 
1096 C CD2 . LEU A 171 ? 0.5861 1.0091 0.7219 0.0184  0.0121  0.0725  184 LEU A CD2 
1097 N N   . ASP A 172 ? 0.6251 1.0837 0.7741 0.0239  -0.0410 0.0504  185 ASP A N   
1098 C CA  . ASP A 172 ? 0.5878 1.0705 0.7497 0.0284  -0.0555 0.0462  185 ASP A CA  
1099 C C   . ASP A 172 ? 0.5936 1.1003 0.7829 0.0104  -0.0584 0.0438  185 ASP A C   
1100 O O   . ASP A 172 ? 0.7273 1.2712 0.9433 0.0122  -0.0639 0.0422  185 ASP A O   
1101 C CB  . ASP A 172 ? 0.6433 1.0996 0.7761 0.0329  -0.0697 0.0426  185 ASP A CB  
1102 C CG  . ASP A 172 ? 0.6615 1.0943 0.7670 0.0496  -0.0702 0.0457  185 ASP A CG  
1103 O OD1 . ASP A 172 ? 0.7595 1.1988 0.8705 0.0608  -0.0612 0.0490  185 ASP A OD1 
1104 O OD2 . ASP A 172 ? 0.6435 1.0505 0.7204 0.0505  -0.0799 0.0449  185 ASP A OD2 
1105 N N   . GLY A 173 ? 0.6202 1.1056 0.8033 -0.0064 -0.0556 0.0427  186 GLY A N   
1106 C CA  . GLY A 173 ? 0.6124 1.1132 0.8190 -0.0258 -0.0585 0.0409  186 GLY A CA  
1107 C C   . GLY A 173 ? 0.6485 1.1773 0.8833 -0.0344 -0.0469 0.0478  186 GLY A C   
1108 O O   . GLY A 173 ? 0.6787 1.2237 0.9354 -0.0523 -0.0495 0.0478  186 GLY A O   
1109 N N   . GLY A 174 ? 0.6553 1.1888 0.8877 -0.0232 -0.0343 0.0537  187 GLY A N   
1110 C CA  . GLY A 174 ? 0.6393 1.2070 0.8969 -0.0288 -0.0224 0.0602  187 GLY A CA  
1111 C C   . GLY A 174 ? 0.6420 1.1930 0.8990 -0.0477 -0.0121 0.0676  187 GLY A C   
1112 O O   . GLY A 174 ? 0.6908 1.2664 0.9712 -0.0654 -0.0089 0.0722  187 GLY A O   
1113 N N   . VAL A 175 ? 0.7134 1.2228 0.9436 -0.0445 -0.0078 0.0690  188 VAL A N   
1114 C CA  . VAL A 175 ? 0.6689 1.1572 0.8952 -0.0595 0.0002  0.0761  188 VAL A CA  
1115 C C   . VAL A 175 ? 0.7485 1.2531 0.9768 -0.0546 0.0153  0.0852  188 VAL A C   
1116 O O   . VAL A 175 ? 0.8588 1.3765 1.0822 -0.0353 0.0195  0.0837  188 VAL A O   
1117 C CB  . VAL A 175 ? 0.7208 1.1600 0.9196 -0.0575 -0.0023 0.0725  188 VAL A CB  
1118 C CG1 . VAL A 175 ? 0.6967 1.1225 0.8916 -0.0618 -0.0164 0.0619  188 VAL A CG1 
1119 C CG2 . VAL A 175 ? 0.7406 1.1649 0.9165 -0.0373 0.0035  0.0724  188 VAL A CG2 
1120 N N   . ASP A 176 ? 0.7791 1.2812 1.0128 -0.0726 0.0224  0.0943  189 ASP A N   
1121 C CA  . ASP A 176 ? 0.7081 1.2277 0.9429 -0.0724 0.0375  0.1040  189 ASP A CA  
1122 C C   . ASP A 176 ? 0.7397 1.2183 0.9472 -0.0680 0.0434  0.1090  189 ASP A C   
1123 O O   . ASP A 176 ? 0.7969 1.2848 0.9980 -0.0619 0.0553  0.1152  189 ASP A O   
1124 C CB  . ASP A 176 ? 0.7134 1.2592 0.9703 -0.0980 0.0417  0.1131  189 ASP A CB  
1125 C CG  . ASP A 176 ? 0.6735 1.2661 0.9612 -0.1036 0.0363  0.1083  189 ASP A CG  
1126 O OD1 . ASP A 176 ? 0.6309 1.2620 0.9302 -0.0867 0.0401  0.1035  189 ASP A OD1 
1127 O OD2 . ASP A 176 ? 0.6850 1.2750 0.9854 -0.1241 0.0270  0.1085  189 ASP A OD2 
1128 N N   . ILE A 177 ? 0.7975 1.2330 0.9896 -0.0707 0.0349  0.1054  190 ILE A N   
1129 C CA  . ILE A 177 ? 0.8158 1.2120 0.9838 -0.0660 0.0381  0.1085  190 ILE A CA  
1130 C C   . ILE A 177 ? 0.7694 1.1320 0.9221 -0.0574 0.0283  0.0976  190 ILE A C   
1131 O O   . ILE A 177 ? 0.6999 1.0549 0.8588 -0.0657 0.0180  0.0908  190 ILE A O   
1132 C CB  . ILE A 177 ? 0.7346 1.1118 0.9021 -0.0866 0.0391  0.1189  190 ILE A CB  
1133 N N   . LEU A 178 ? 0.8583 1.2024 0.9908 -0.0413 0.0316  0.0955  191 LEU A N   
1134 C CA  . LEU A 178 ? 0.7775 1.0922 0.8943 -0.0344 0.0245  0.0857  191 LEU A CA  
1135 C C   . LEU A 178 ? 0.7669 1.0473 0.8740 -0.0401 0.0236  0.0874  191 LEU A C   
1136 O O   . LEU A 178 ? 0.7924 1.0643 0.8911 -0.0377 0.0306  0.0955  191 LEU A O   
1137 C CB  . LEU A 178 ? 0.8345 1.1488 0.9352 -0.0156 0.0273  0.0824  191 LEU A CB  
1138 C CG  . LEU A 178 ? 0.9030 1.2445 1.0105 -0.0076 0.0240  0.0790  191 LEU A CG  
1139 C CD1 . LEU A 178 ? 0.9943 1.3353 1.0863 0.0103  0.0276  0.0795  191 LEU A CD1 
1140 C CD2 . LEU A 178 ? 0.9074 1.2444 1.0143 -0.0110 0.0128  0.0694  191 LEU A CD2 
1141 N N   . LEU A 179 ? 0.7342 0.9949 0.8421 -0.0469 0.0140  0.0789  192 LEU A N   
1142 C CA  . LEU A 179 ? 0.7190 0.9466 0.8212 -0.0526 0.0097  0.0789  192 LEU A CA  
1143 C C   . LEU A 179 ? 0.7492 0.9547 0.8385 -0.0420 0.0049  0.0653  192 LEU A C   
1144 O O   . LEU A 179 ? 0.7376 0.9388 0.8293 -0.0442 -0.0031 0.0532  192 LEU A O   
1145 C CB  . LEU A 179 ? 0.7588 0.9809 0.8752 -0.0712 0.0010  0.0798  192 LEU A CB  
1146 C CG  . LEU A 179 ? 0.8720 1.0549 0.9836 -0.0776 -0.0086 0.0769  192 LEU A CG  
1147 C CD1 . LEU A 179 ? 0.9134 1.0763 1.0138 -0.0759 -0.0042 0.0882  192 LEU A CD1 
1148 C CD2 . LEU A 179 ? 0.8786 1.0576 1.0040 -0.0976 -0.0183 0.0787  192 LEU A CD2 
1149 N N   . ILE A 180 ? 0.7314 0.9252 0.8071 -0.0309 0.0100  0.0668  193 ILE A N   
1150 C CA  . ILE A 180 ? 0.6960 0.8723 0.7611 -0.0214 0.0067  0.0543  193 ILE A CA  
1151 C C   . ILE A 180 ? 0.7991 0.9461 0.8660 -0.0258 -0.0012 0.0513  193 ILE A C   
1152 O O   . ILE A 180 ? 0.8115 0.9427 0.8736 -0.0248 0.0001  0.0601  193 ILE A O   
1153 C CB  . ILE A 180 ? 0.6667 0.8435 0.7176 -0.0086 0.0144  0.0570  193 ILE A CB  
1154 C CG1 . ILE A 180 ? 0.6731 0.8744 0.7212 -0.0038 0.0203  0.0615  193 ILE A CG1 
1155 C CG2 . ILE A 180 ? 0.6292 0.7954 0.6714 -0.0007 0.0116  0.0432  193 ILE A CG2 
1156 C CD1 . ILE A 180 ? 0.6922 0.8922 0.7265 0.0071  0.0272  0.0670  193 ILE A CD1 
1157 N N   . GLU A 181 ? 0.8366 0.9748 0.9093 -0.0300 -0.0107 0.0386  194 GLU A N   
1158 C CA  . GLU A 181 ? 0.8659 0.9741 0.9422 -0.0353 -0.0216 0.0353  194 GLU A CA  
1159 C C   . GLU A 181 ? 0.9037 0.9960 0.9764 -0.0248 -0.0287 0.0159  194 GLU A C   
1160 O O   . GLU A 181 ? 0.8529 0.9610 0.9217 -0.0175 -0.0255 0.0033  194 GLU A O   
1161 C CB  . GLU A 181 ? 0.9916 1.0997 1.0799 -0.0513 -0.0295 0.0365  194 GLU A CB  
1162 C CG  . GLU A 181 ? 0.9086 1.0290 1.0007 -0.0516 -0.0345 0.0205  194 GLU A CG  
1163 C CD  . GLU A 181 ? 0.9048 1.0218 1.0088 -0.0681 -0.0445 0.0209  194 GLU A CD  
1164 O OE1 . GLU A 181 ? 1.0695 1.1676 1.1781 -0.0797 -0.0496 0.0315  194 GLU A OE1 
1165 O OE2 . GLU A 181 ? 0.8318 0.9641 0.9396 -0.0705 -0.0480 0.0110  194 GLU A OE2 
1166 N N   . THR A 182 ? 1.0351 1.0961 1.1087 -0.0246 -0.0390 0.0134  195 THR A N   
1167 C CA  . THR A 182 ? 1.1013 1.1459 1.1747 -0.0136 -0.0480 -0.0069 195 THR A CA  
1168 C C   . THR A 182 ? 0.9343 0.9940 1.0009 0.0014  -0.0393 -0.0148 195 THR A C   
1169 O O   . THR A 182 ? 0.9480 1.0193 1.0142 0.0088  -0.0391 -0.0333 195 THR A O   
1170 C CB  . THR A 182 ? 1.0910 1.1395 1.1698 -0.0175 -0.0554 -0.0240 195 THR A CB  
1171 O OG1 . THR A 182 ? 1.0430 1.0841 1.1287 -0.0343 -0.0617 -0.0139 195 THR A OG1 
1172 C CG2 . THR A 182 ? 1.0875 1.1137 1.1677 -0.0068 -0.0676 -0.0460 195 THR A CG2 
1173 N N   . ILE A 183 ? 0.7977 0.8578 0.8583 0.0047  -0.0322 -0.0005 196 ILE A N   
1174 C CA  . ILE A 183 ? 0.8305 0.9058 0.8843 0.0162  -0.0237 -0.0047 196 ILE A CA  
1175 C C   . ILE A 183 ? 0.9013 0.9612 0.9575 0.0287  -0.0315 -0.0197 196 ILE A C   
1176 O O   . ILE A 183 ? 0.8767 0.9153 0.9314 0.0329  -0.0366 -0.0128 196 ILE A O   
1177 C CB  . ILE A 183 ? 0.7510 0.8313 0.7966 0.0157  -0.0143 0.0148  196 ILE A CB  
1178 C CG1 . ILE A 183 ? 0.6751 0.7760 0.7206 0.0065  -0.0067 0.0260  196 ILE A CG1 
1179 C CG2 . ILE A 183 ? 0.7327 0.8245 0.7707 0.0266  -0.0076 0.0106  196 ILE A CG2 
1180 C CD1 . ILE A 183 ? 0.7901 0.8939 0.8297 0.0047  0.0007  0.0450  196 ILE A CD1 
1181 N N   . PHE A 184 ? 1.0150 1.0872 1.0747 0.0346  -0.0328 -0.0409 197 PHE A N   
1182 C CA  . PHE A 184 ? 0.9274 0.9947 0.9919 0.0485  -0.0387 -0.0592 197 PHE A CA  
1183 C C   . PHE A 184 ? 0.8197 0.9034 0.8793 0.0558  -0.0296 -0.0563 197 PHE A C   
1184 O O   . PHE A 184 ? 0.8208 0.8930 0.8838 0.0660  -0.0350 -0.0593 197 PHE A O   
1185 C CB  . PHE A 184 ? 0.8067 0.8891 0.8759 0.0519  -0.0407 -0.0838 197 PHE A CB  
1186 N N   . ASP A 185 ? 0.8777 0.9866 0.9289 0.0504  -0.0172 -0.0502 198 ASP A N   
1187 C CA  . ASP A 185 ? 0.7878 0.9121 0.8324 0.0544  -0.0087 -0.0464 198 ASP A CA  
1188 C C   . ASP A 185 ? 0.7920 0.9159 0.8257 0.0478  -0.0015 -0.0240 198 ASP A C   
1189 O O   . ASP A 185 ? 0.9526 1.0854 0.9821 0.0397  0.0026  -0.0174 198 ASP A O   
1190 C CB  . ASP A 185 ? 0.7979 0.9521 0.8395 0.0538  -0.0015 -0.0612 198 ASP A CB  
1191 C CG  . ASP A 185 ? 0.8210 0.9904 0.8577 0.0573  0.0050  -0.0607 198 ASP A CG  
1192 O OD1 . ASP A 185 ? 0.7088 0.8691 0.7389 0.0575  0.0071  -0.0445 198 ASP A OD1 
1193 O OD2 . ASP A 185 ? 1.0777 1.2698 1.1168 0.0592  0.0083  -0.0772 198 ASP A OD2 
1194 N N   . THR A 186 ? 0.6808 0.7955 0.7101 0.0525  -0.0007 -0.0137 199 THR A N   
1195 C CA  . THR A 186 ? 0.7664 0.8783 0.7855 0.0485  0.0050  0.0061  199 THR A CA  
1196 C C   . THR A 186 ? 0.7783 0.9105 0.7865 0.0464  0.0142  0.0091  199 THR A C   
1197 O O   . THR A 186 ? 0.7516 0.8865 0.7528 0.0425  0.0188  0.0220  199 THR A O   
1198 C CB  . THR A 186 ? 0.8047 0.8987 0.8200 0.0545  0.0018  0.0150  199 THR A CB  
1199 O OG1 . THR A 186 ? 0.8315 0.9023 0.8546 0.0563  -0.0090 0.0126  199 THR A OG1 
1200 C CG2 . THR A 186 ? 0.8921 0.9833 0.8961 0.0507  0.0080  0.0345  199 THR A CG2 
1201 N N   . ALA A 187 ? 0.7308 0.8775 0.7375 0.0487  0.0162  -0.0028 200 ALA A N   
1202 C CA  . ALA A 187 ? 0.8209 0.9831 0.8146 0.0446  0.0230  0.0003  200 ALA A CA  
1203 C C   . ALA A 187 ? 0.8586 1.0296 0.8489 0.0372  0.0246  0.0017  200 ALA A C   
1204 O O   . ALA A 187 ? 0.7402 0.9150 0.7190 0.0345  0.0278  0.0115  200 ALA A O   
1205 C CB  . ALA A 187 ? 0.8601 1.0382 0.8532 0.0453  0.0249  -0.0129 200 ALA A CB  
1206 N N   . ASN A 188 ? 0.6700 0.8429 0.6702 0.0348  0.0208  -0.0085 201 ASN A N   
1207 C CA  . ASN A 188 ? 0.6651 0.8448 0.6641 0.0278  0.0203  -0.0069 201 ASN A CA  
1208 C C   . ASN A 188 ? 0.6575 0.8302 0.6573 0.0262  0.0206  0.0096  201 ASN A C   
1209 O O   . ASN A 188 ? 0.7311 0.9127 0.7244 0.0232  0.0224  0.0163  201 ASN A O   
1210 C CB  . ASN A 188 ? 0.6923 0.8711 0.7025 0.0260  0.0145  -0.0211 201 ASN A CB  
1211 C CG  . ASN A 188 ? 0.7147 0.9059 0.7249 0.0283  0.0150  -0.0405 201 ASN A CG  
1212 O OD1 . ASN A 188 ? 0.6684 0.8638 0.6780 0.0334  0.0177  -0.0446 201 ASN A OD1 
1213 N ND2 . ASN A 188 ? 0.6179 0.8176 0.6294 0.0244  0.0124  -0.0533 201 ASN A ND2 
1214 N N   . ALA A 189 ? 0.6860 0.8439 0.6936 0.0283  0.0185  0.0159  202 ALA A N   
1215 C CA  . ALA A 189 ? 0.6201 0.7752 0.6298 0.0255  0.0201  0.0311  202 ALA A CA  
1216 C C   . ALA A 189 ? 0.6613 0.8215 0.6589 0.0299  0.0262  0.0419  202 ALA A C   
1217 O O   . ALA A 189 ? 0.6791 0.8476 0.6766 0.0286  0.0288  0.0511  202 ALA A O   
1218 C CB  . ALA A 189 ? 0.6343 0.7705 0.6508 0.0250  0.0162  0.0361  202 ALA A CB  
1219 N N   . LYS A 190 ? 0.6270 0.7830 0.6154 0.0356  0.0278  0.0397  203 LYS A N   
1220 C CA  . LYS A 190 ? 0.5801 0.7374 0.5548 0.0402  0.0319  0.0481  203 LYS A CA  
1221 C C   . LYS A 190 ? 0.6391 0.8080 0.6050 0.0382  0.0323  0.0468  203 LYS A C   
1222 O O   . LYS A 190 ? 0.7515 0.9222 0.7091 0.0417  0.0337  0.0549  203 LYS A O   
1223 C CB  . LYS A 190 ? 0.6250 0.7742 0.5927 0.0452  0.0319  0.0453  203 LYS A CB  
1224 C CG  . LYS A 190 ? 0.6212 0.7556 0.5934 0.0488  0.0300  0.0494  203 LYS A CG  
1225 C CD  . LYS A 190 ? 0.5970 0.7255 0.5650 0.0541  0.0280  0.0445  203 LYS A CD  
1226 C CE  . LYS A 190 ? 0.6945 0.8198 0.6469 0.0581  0.0310  0.0530  203 LYS A CE  
1227 N NZ  . LYS A 190 ? 0.7537 0.8774 0.7027 0.0612  0.0286  0.0469  203 LYS A NZ  
1228 N N   . ALA A 191 ? 0.6310 0.8071 0.5978 0.0331  0.0301  0.0362  204 ALA A N   
1229 C CA  . ALA A 191 ? 0.6385 0.8240 0.5951 0.0292  0.0288  0.0353  204 ALA A CA  
1230 C C   . ALA A 191 ? 0.6438 0.8360 0.6077 0.0280  0.0266  0.0404  204 ALA A C   
1231 O O   . ALA A 191 ? 0.5795 0.7755 0.5347 0.0298  0.0249  0.0460  204 ALA A O   
1232 C CB  . ALA A 191 ? 0.5921 0.7858 0.5471 0.0230  0.0277  0.0221  204 ALA A CB  
1233 N N   . ALA A 192 ? 0.6476 0.8410 0.6279 0.0249  0.0255  0.0382  205 ALA A N   
1234 C CA  . ALA A 192 ? 0.7221 0.9247 0.7131 0.0223  0.0237  0.0435  205 ALA A CA  
1235 C C   . ALA A 192 ? 0.8037 1.0090 0.7941 0.0285  0.0276  0.0556  205 ALA A C   
1236 O O   . ALA A 192 ? 0.8237 1.0409 0.8147 0.0307  0.0262  0.0594  205 ALA A O   
1237 C CB  . ALA A 192 ? 0.6980 0.8975 0.7056 0.0160  0.0212  0.0400  205 ALA A CB  
1238 N N   . LEU A 193 ? 0.7264 0.9216 0.7151 0.0323  0.0318  0.0605  206 LEU A N   
1239 C CA  . LEU A 193 ? 0.7244 0.9230 0.7103 0.0388  0.0364  0.0706  206 LEU A CA  
1240 C C   . LEU A 193 ? 0.6845 0.8842 0.6551 0.0471  0.0354  0.0716  206 LEU A C   
1241 O O   . LEU A 193 ? 0.7850 0.9948 0.7561 0.0534  0.0365  0.0765  206 LEU A O   
1242 C CB  . LEU A 193 ? 0.7020 0.8869 0.6846 0.0410  0.0400  0.0752  206 LEU A CB  
1243 N N   . PHE A 194 ? 0.6338 0.8235 0.5909 0.0468  0.0327  0.0665  207 PHE A N   
1244 C CA  . PHE A 194 ? 0.6637 0.8486 0.6028 0.0523  0.0295  0.0681  207 PHE A CA  
1245 C C   . PHE A 194 ? 0.7840 0.9792 0.7235 0.0518  0.0236  0.0675  207 PHE A C   
1246 O O   . PHE A 194 ? 0.9151 1.1092 0.8456 0.0598  0.0199  0.0712  207 PHE A O   
1247 C CB  . PHE A 194 ? 0.6280 0.8021 0.5534 0.0479  0.0281  0.0632  207 PHE A CB  
1248 C CG  . PHE A 194 ? 0.7436 0.9057 0.6479 0.0522  0.0249  0.0669  207 PHE A CG  
1249 C CD1 . PHE A 194 ? 0.7141 0.8741 0.6051 0.0513  0.0181  0.0681  207 PHE A CD1 
1250 C CD2 . PHE A 194 ? 0.7393 0.8894 0.6354 0.0564  0.0269  0.0693  207 PHE A CD2 
1251 C CE1 . PHE A 194 ? 0.6847 0.8285 0.5541 0.0541  0.0129  0.0721  207 PHE A CE1 
1252 C CE2 . PHE A 194 ? 0.7226 0.8587 0.5983 0.0592  0.0224  0.0724  207 PHE A CE2 
1253 C CZ  . PHE A 194 ? 0.6685 0.8002 0.5306 0.0578  0.0152  0.0740  207 PHE A CZ  
1254 N N   . ALA A 195 ? 0.7082 0.9122 0.6575 0.0433  0.0215  0.0620  208 ALA A N   
1255 C CA  . ALA A 195 ? 0.7881 1.0032 0.7396 0.0421  0.0149  0.0612  208 ALA A CA  
1256 C C   . ALA A 195 ? 0.7746 1.0047 0.7409 0.0492  0.0155  0.0664  208 ALA A C   
1257 O O   . ALA A 195 ? 0.9412 1.1769 0.9038 0.0562  0.0095  0.0681  208 ALA A O   
1258 C CB  . ALA A 195 ? 0.7975 1.0194 0.7580 0.0315  0.0128  0.0535  208 ALA A CB  
1259 N N   . LEU A 196 ? 0.7391 0.9763 0.7219 0.0472  0.0222  0.0687  209 LEU A N   
1260 C CA  . LEU A 196 ? 0.7069 0.9641 0.7057 0.0513  0.0250  0.0734  209 LEU A CA  
1261 C C   . LEU A 196 ? 0.7412 0.9986 0.7306 0.0655  0.0270  0.0773  209 LEU A C   
1262 O O   . LEU A 196 ? 0.8777 1.1531 0.8749 0.0736  0.0247  0.0777  209 LEU A O   
1263 C CB  . LEU A 196 ? 0.7018 0.9636 0.7163 0.0428  0.0319  0.0765  209 LEU A CB  
1264 C CG  . LEU A 196 ? 0.7074 0.9696 0.7343 0.0294  0.0281  0.0719  209 LEU A CG  
1265 C CD1 . LEU A 196 ? 0.7435 1.0082 0.7850 0.0203  0.0329  0.0771  209 LEU A CD1 
1266 C CD2 . LEU A 196 ? 0.6801 0.9598 0.7159 0.0271  0.0208  0.0681  209 LEU A CD2 
1267 N N   . GLN A 197 ? 0.7881 1.0264 0.7615 0.0695  0.0302  0.0790  210 GLN A N   
1268 C CA  . GLN A 197 ? 0.7974 1.0307 0.7579 0.0835  0.0305  0.0811  210 GLN A CA  
1269 C C   . GLN A 197 ? 0.7588 0.9856 0.7062 0.0914  0.0196  0.0788  210 GLN A C   
1270 O O   . GLN A 197 ? 0.9996 1.2321 0.9453 0.1050  0.0168  0.0788  210 GLN A O   
1271 C CB  . GLN A 197 ? 0.7689 0.9803 0.7134 0.0845  0.0342  0.0828  210 GLN A CB  
1272 N N   . ASN A 198 ? 0.8399 1.0548 0.7772 0.0831  0.0129  0.0766  211 ASN A N   
1273 C CA  . ASN A 198 ? 0.8274 1.0334 0.7496 0.0878  0.0008  0.0760  211 ASN A CA  
1274 C C   . ASN A 198 ? 0.8357 1.0632 0.7731 0.0961  -0.0048 0.0749  211 ASN A C   
1275 O O   . ASN A 198 ? 0.9177 1.1411 0.8471 0.1099  -0.0129 0.0749  211 ASN A O   
1276 C CB  . ASN A 198 ? 0.8974 1.0938 0.8082 0.0743  -0.0041 0.0739  211 ASN A CB  
1277 C CG  . ASN A 198 ? 0.9252 1.1002 0.8159 0.0680  -0.0022 0.0744  211 ASN A CG  
1278 O OD1 . ASN A 198 ? 0.8179 0.9782 0.6962 0.0752  -0.0022 0.0773  211 ASN A OD1 
1279 N ND2 . ASN A 198 ? 0.9026 1.0777 0.7904 0.0547  -0.0009 0.0705  211 ASN A ND2 
1280 N N   . LEU A 199 ? 0.7918 1.0420 0.7517 0.0881  -0.0015 0.0731  212 LEU A N   
1281 C CA  . LEU A 199 ? 0.8196 1.0950 0.7977 0.0938  -0.0074 0.0713  212 LEU A CA  
1282 C C   . LEU A 199 ? 0.8837 1.1798 0.8760 0.1078  -0.0019 0.0716  212 LEU A C   
1283 O O   . LEU A 199 ? 0.7850 1.0940 0.7825 0.1213  -0.0098 0.0690  212 LEU A O   
1284 C CB  . LEU A 199 ? 0.7661 1.0603 0.7651 0.0793  -0.0053 0.0693  212 LEU A CB  
1285 C CG  . LEU A 199 ? 0.8132 1.0925 0.8002 0.0661  -0.0106 0.0664  212 LEU A CG  
1286 C CD1 . LEU A 199 ? 0.8346 1.1285 0.8423 0.0524  -0.0071 0.0634  212 LEU A CD1 
1287 C CD2 . LEU A 199 ? 0.8700 1.1438 0.8427 0.0698  -0.0252 0.0652  212 LEU A CD2 
1288 N N   . PHE A 200 ? 0.7373 1.0373 0.7351 0.1050  0.0111  0.0743  213 PHE A N   
1289 C CA  . PHE A 200 ? 0.7446 1.0683 0.7552 0.1158  0.0191  0.0744  213 PHE A CA  
1290 C C   . PHE A 200 ? 0.8438 1.1547 0.8367 0.1357  0.0147  0.0721  213 PHE A C   
1291 O O   . PHE A 200 ? 0.9608 1.2952 0.9645 0.1501  0.0160  0.0685  213 PHE A O   
1292 C CB  . PHE A 200 ? 0.6688 0.9963 0.6853 0.1056  0.0334  0.0793  213 PHE A CB  
1293 C CG  . PHE A 200 ? 0.7190 1.0591 0.7545 0.0869  0.0370  0.0816  213 PHE A CG  
1294 C CD1 . PHE A 200 ? 0.7384 1.0985 0.7920 0.0814  0.0304  0.0787  213 PHE A CD1 
1295 C CD2 . PHE A 200 ? 0.6981 1.0283 0.7330 0.0749  0.0455  0.0865  213 PHE A CD2 
1296 C CE1 . PHE A 200 ? 0.7185 1.0872 0.7884 0.0637  0.0324  0.0803  213 PHE A CE1 
1297 C CE2 . PHE A 200 ? 0.6735 1.0104 0.7242 0.0579  0.0467  0.0884  213 PHE A CE2 
1298 C CZ  . PHE A 200 ? 0.6703 1.0260 0.7384 0.0519  0.0403  0.0851  213 PHE A CZ  
1299 N N   . GLU A 201 ? 0.8818 1.1563 0.8477 0.1362  0.0091  0.0733  214 GLU A N   
1300 C CA  . GLU A 201 ? 0.9405 1.1951 0.8857 0.1531  0.0036  0.0715  214 GLU A CA  
1301 C C   . GLU A 201 ? 1.0398 1.3003 0.9858 0.1713  -0.0097 0.0662  214 GLU A C   
1302 O O   . GLU A 201 ? 1.3943 1.6475 1.3302 0.1892  -0.0132 0.0624  214 GLU A O   
1303 C CB  . GLU A 201 ? 0.8397 1.0544 0.7565 0.1462  -0.0018 0.0744  214 GLU A CB  
1304 N N   . GLU A 202 ? 1.1406 1.4132 1.0979 0.1677  -0.0185 0.0652  215 GLU A N   
1305 C CA  . GLU A 202 ? 1.2082 1.4878 1.1686 0.1857  -0.0334 0.0599  215 GLU A CA  
1306 C C   . GLU A 202 ? 1.1289 1.4428 1.1166 0.1818  -0.0369 0.0576  215 GLU A C   
1307 O O   . GLU A 202 ? 1.3007 1.6474 1.3104 0.1962  -0.0381 0.0515  215 GLU A O   
1308 C CB  . GLU A 202 ? 1.3133 1.5493 1.2412 0.1888  -0.0516 0.0620  215 GLU A CB  
1309 N N   . LYS A 203 ? 1.0912 1.3995 1.0781 0.1627  -0.0386 0.0614  216 LYS A N   
1310 C CA  . LYS A 203 ? 1.1036 1.4375 1.1112 0.1582  -0.0460 0.0591  216 LYS A CA  
1311 C C   . LYS A 203 ? 1.0153 1.3954 1.0595 0.1526  -0.0334 0.0571  216 LYS A C   
1312 O O   . LYS A 203 ? 1.1614 1.5745 1.2290 0.1612  -0.0390 0.0522  216 LYS A O   
1313 C CB  . LYS A 203 ? 1.0249 1.3383 1.0181 0.1389  -0.0513 0.0625  216 LYS A CB  
1314 N N   . TYR A 204 ? 0.9647 1.3471 1.0139 0.1376  -0.0173 0.0610  217 TYR A N   
1315 C CA  . TYR A 204 ? 0.8677 1.2878 0.9478 0.1259  -0.0061 0.0616  217 TYR A CA  
1316 C C   . TYR A 204 ? 0.9618 1.4014 1.0513 0.1297  0.0099  0.0631  217 TYR A C   
1317 O O   . TYR A 204 ? 0.9489 1.3660 1.0181 0.1367  0.0151  0.0647  217 TYR A O   
1318 C CB  . TYR A 204 ? 0.8342 1.2410 0.9133 0.1028  -0.0025 0.0653  217 TYR A CB  
1319 C CG  . TYR A 204 ? 0.8378 1.2371 0.9137 0.0958  -0.0164 0.0628  217 TYR A CG  
1320 C CD1 . TYR A 204 ? 0.7937 1.1590 0.8404 0.0985  -0.0268 0.0626  217 TYR A CD1 
1321 C CD2 . TYR A 204 ? 0.8548 1.2814 0.9555 0.0849  -0.0193 0.0607  217 TYR A CD2 
1322 C CE1 . TYR A 204 ? 0.8169 1.1761 0.8576 0.0911  -0.0391 0.0605  217 TYR A CE1 
1323 C CE2 . TYR A 204 ? 0.8657 1.2854 0.9616 0.0785  -0.0326 0.0578  217 TYR A CE2 
1324 C CZ  . TYR A 204 ? 0.8262 1.2124 0.8912 0.0819  -0.0422 0.0576  217 TYR A CZ  
1325 O OH  . TYR A 204 ? 0.8854 1.2654 0.9426 0.0747  -0.0549 0.0549  217 TYR A OH  
1326 N N   . ALA A 205 ? 0.9242 1.4067 1.0437 0.1237  0.0177  0.0627  218 ALA A N   
1327 C CA  . ALA A 205 ? 0.8893 1.3941 1.0182 0.1205  0.0349  0.0660  218 ALA A CA  
1328 C C   . ALA A 205 ? 0.9091 1.3969 1.0347 0.0964  0.0432  0.0745  218 ALA A C   
1329 O O   . ALA A 205 ? 0.9089 1.3994 1.0465 0.0801  0.0390  0.0758  218 ALA A O   
1330 C CB  . ALA A 205 ? 0.8475 1.4089 1.0102 0.1225  0.0396  0.0621  218 ALA A CB  
1331 N N   . PRO A 206 ? 0.7476 1.2166 0.8564 0.0949  0.0536  0.0796  219 PRO A N   
1332 C CA  . PRO A 206 ? 0.8539 1.2977 0.9550 0.0754  0.0579  0.0868  219 PRO A CA  
1333 C C   . PRO A 206 ? 0.8237 1.2929 0.9480 0.0547  0.0645  0.0924  219 PRO A C   
1334 O O   . PRO A 206 ? 0.8855 1.3916 1.0256 0.0536  0.0740  0.0944  219 PRO A O   
1335 C CB  . PRO A 206 ? 0.7975 1.2214 0.8769 0.0819  0.0666  0.0905  219 PRO A CB  
1336 C CG  . PRO A 206 ? 0.8037 1.2574 0.8878 0.0989  0.0722  0.0866  219 PRO A CG  
1337 C CD  . PRO A 206 ? 0.7937 1.2646 0.8901 0.1118  0.0608  0.0781  219 PRO A CD  
1338 N N   . ARG A 207 ? 0.7662 1.2158 0.8918 0.0380  0.0590  0.0943  220 ARG A N   
1339 C CA  . ARG A 207 ? 0.6848 1.1460 0.8270 0.0156  0.0631  0.1008  220 ARG A CA  
1340 C C   . ARG A 207 ? 0.6272 1.0532 0.7515 0.0063  0.0675  0.1081  220 ARG A C   
1341 O O   . ARG A 207 ? 0.7027 1.0961 0.8054 0.0156  0.0650  0.1059  220 ARG A O   
1342 C CB  . ARG A 207 ? 0.6858 1.1476 0.8419 0.0041  0.0516  0.0965  220 ARG A CB  
1343 N N   . PRO A 208 ? 0.6734 1.1060 0.8061 -0.0124 0.0734  0.1171  221 PRO A N   
1344 C CA  . PRO A 208 ? 0.6394 1.0364 0.7543 -0.0205 0.0755  0.1245  221 PRO A CA  
1345 C C   . PRO A 208 ? 0.6629 1.0203 0.7695 -0.0242 0.0640  0.1197  221 PRO A C   
1346 O O   . PRO A 208 ? 0.6976 1.0573 0.8164 -0.0307 0.0554  0.1139  221 PRO A O   
1347 C CB  . PRO A 208 ? 0.6859 1.1000 0.8130 -0.0427 0.0816  0.1359  221 PRO A CB  
1348 C CG  . PRO A 208 ? 0.7164 1.1696 0.8710 -0.0501 0.0796  0.1325  221 PRO A CG  
1349 C CD  . PRO A 208 ? 0.6504 1.1244 0.8081 -0.0271 0.0786  0.1218  221 PRO A CD  
1350 N N   . ILE A 209 ? 0.6763 1.0000 0.7626 -0.0194 0.0639  0.1211  222 ILE A N   
1351 C CA  . ILE A 209 ? 0.5651 0.8538 0.6432 -0.0202 0.0543  0.1148  222 ILE A CA  
1352 C C   . ILE A 209 ? 0.6234 0.8863 0.6986 -0.0347 0.0516  0.1220  222 ILE A C   
1353 O O   . ILE A 209 ? 0.6747 0.9292 0.7388 -0.0357 0.0573  0.1314  222 ILE A O   
1354 C CB  . ILE A 209 ? 0.6152 0.8845 0.6733 -0.0031 0.0543  0.1095  222 ILE A CB  
1355 C CG1 . ILE A 209 ? 0.6453 0.9328 0.7027 0.0105  0.0540  0.1028  222 ILE A CG1 
1356 C CG2 . ILE A 209 ? 0.6184 0.8564 0.6696 -0.0042 0.0457  0.1021  222 ILE A CG2 
1357 C CD1 . ILE A 209 ? 0.6680 0.9401 0.7050 0.0259  0.0550  0.1003  222 ILE A CD1 
1358 N N   . PHE A 210 ? 0.6950 0.9438 0.7787 -0.0455 0.0417  0.1174  223 PHE A N   
1359 C CA  . PHE A 210 ? 0.7081 0.9230 0.7870 -0.0565 0.0345  0.1212  223 PHE A CA  
1360 C C   . PHE A 210 ? 0.7229 0.9092 0.7917 -0.0446 0.0267  0.1087  223 PHE A C   
1361 O O   . PHE A 210 ? 0.6232 0.8163 0.6951 -0.0379 0.0235  0.0966  223 PHE A O   
1362 C CB  . PHE A 210 ? 0.7568 0.9727 0.8517 -0.0759 0.0268  0.1224  223 PHE A CB  
1363 C CG  . PHE A 210 ? 0.8134 1.0560 0.9193 -0.0927 0.0338  0.1362  223 PHE A CG  
1364 C CD1 . PHE A 210 ? 0.7823 1.0580 0.8882 -0.0872 0.0475  0.1430  223 PHE A CD1 
1365 C CD2 . PHE A 210 ? 0.8677 1.1038 0.9845 -0.1148 0.0263  0.1415  223 PHE A CD2 
1366 C CE1 . PHE A 210 ? 0.8256 1.1318 0.9432 -0.1034 0.0552  0.1544  223 PHE A CE1 
1367 C CE2 . PHE A 210 ? 0.9232 1.1875 1.0511 -0.1332 0.0333  0.1546  223 PHE A CE2 
1368 C CZ  . PHE A 210 ? 0.8786 1.1805 1.0075 -0.1275 0.0486  0.1609  223 PHE A CZ  
1369 N N   . ILE A 211 ? 0.7691 0.9252 0.8255 -0.0423 0.0236  0.1115  224 ILE A N   
1370 C CA  . ILE A 211 ? 0.7233 0.8559 0.7722 -0.0305 0.0166  0.0988  224 ILE A CA  
1371 C C   . ILE A 211 ? 0.7469 0.8440 0.7944 -0.0368 0.0049  0.0988  224 ILE A C   
1372 O O   . ILE A 211 ? 0.8202 0.9003 0.8591 -0.0410 0.0043  0.1109  224 ILE A O   
1373 C CB  . ILE A 211 ? 0.6965 0.8271 0.7304 -0.0155 0.0229  0.0995  224 ILE A CB  
1374 C CG1 . ILE A 211 ? 0.7580 0.9186 0.7902 -0.0089 0.0334  0.1019  224 ILE A CG1 
1375 C CG2 . ILE A 211 ? 0.7811 0.8978 0.8112 -0.0043 0.0170  0.0845  224 ILE A CG2 
1376 C CD1 . ILE A 211 ? 0.7455 0.9026 0.7621 0.0050  0.0382  0.1018  224 ILE A CD1 
1377 N N   . SER A 212 ? 0.6923 0.7768 0.7467 -0.0368 -0.0055 0.0847  225 SER A N   
1378 C CA  . SER A 212 ? 0.7387 0.7867 0.7925 -0.0407 -0.0194 0.0821  225 SER A CA  
1379 C C   . SER A 212 ? 0.7476 0.7814 0.7988 -0.0245 -0.0258 0.0640  225 SER A C   
1380 O O   . SER A 212 ? 0.6625 0.7108 0.7187 -0.0185 -0.0254 0.0484  225 SER A O   
1381 C CB  . SER A 212 ? 0.7284 0.7710 0.7939 -0.0562 -0.0285 0.0800  225 SER A CB  
1382 N N   . GLY A 213 ? 0.8159 0.8232 0.8590 -0.0177 -0.0320 0.0660  226 GLY A N   
1383 C CA  . GLY A 213 ? 0.8515 0.8463 0.8948 -0.0018 -0.0394 0.0481  226 GLY A CA  
1384 C C   . GLY A 213 ? 0.8803 0.8490 0.9311 -0.0030 -0.0558 0.0348  226 GLY A C   
1385 O O   . GLY A 213 ? 1.0035 0.9618 1.0584 -0.0174 -0.0618 0.0403  226 GLY A O   
1386 N N   . THR A 214 ? 0.9385 0.8978 0.9919 0.0124  -0.0634 0.0163  227 THR A N   
1387 C CA  . THR A 214 ? 0.9677 0.8997 1.0277 0.0155  -0.0807 0.0004  227 THR A CA  
1388 C C   . THR A 214 ? 0.9731 0.8847 1.0328 0.0334  -0.0913 -0.0108 227 THR A C   
1389 O O   . THR A 214 ? 0.9715 0.9046 1.0353 0.0478  -0.0861 -0.0268 227 THR A O   
1390 C CB  . THR A 214 ? 0.9100 0.8630 0.9786 0.0171  -0.0793 -0.0203 227 THR A CB  
1391 O OG1 . THR A 214 ? 0.8699 0.8426 0.9395 0.0013  -0.0709 -0.0096 227 THR A OG1 
1392 C CG2 . THR A 214 ? 0.9117 0.8346 0.9863 0.0205  -0.0982 -0.0379 227 THR A CG2 
1393 N N   . ILE A 215 ? 1.1408 1.0114 1.1951 0.0314  -0.1066 -0.0014 228 ILE A N   
1394 C CA  . ILE A 215 ? 1.0722 0.9167 1.1269 0.0489  -0.1216 -0.0121 228 ILE A CA  
1395 C C   . ILE A 215 ? 1.0442 0.8717 1.1096 0.0582  -0.1378 -0.0374 228 ILE A C   
1396 O O   . ILE A 215 ? 1.0734 0.8832 1.1396 0.0461  -0.1458 -0.0369 228 ILE A O   
1397 C CB  . ILE A 215 ? 1.0517 0.8539 1.0930 0.0423  -0.1341 0.0093  228 ILE A CB  
1398 C CG1 . ILE A 215 ? 1.1198 0.9387 1.1484 0.0323  -0.1179 0.0343  228 ILE A CG1 
1399 C CG2 . ILE A 215 ? 1.0980 0.8715 1.1402 0.0623  -0.1525 -0.0026 228 ILE A CG2 
1400 C CD1 . ILE A 215 ? 1.1280 0.9774 1.1567 0.0467  -0.1053 0.0292  228 ILE A CD1 
1401 N N   . VAL A 216 ? 1.1041 0.9380 1.1782 0.0799  -0.1430 -0.0602 229 VAL A N   
1402 C CA  . VAL A 216 ? 1.1905 1.0158 1.2759 0.0924  -0.1566 -0.0891 229 VAL A CA  
1403 C C   . VAL A 216 ? 1.1877 0.9615 1.2732 0.1044  -0.1836 -0.0956 229 VAL A C   
1404 O O   . VAL A 216 ? 1.2993 1.0458 1.3881 0.1060  -0.2000 -0.1094 229 VAL A O   
1405 C CB  . VAL A 216 ? 1.1308 1.0022 1.2280 0.1089  -0.1450 -0.1151 229 VAL A CB  
1406 C CG1 . VAL A 216 ? 1.1376 1.0521 1.2326 0.0959  -0.1230 -0.1113 229 VAL A CG1 
1407 C CG2 . VAL A 216 ? 1.0558 0.9396 1.1556 0.1237  -0.1423 -0.1159 229 VAL A CG2 
1408 N N   . ASP A 217 ? 1.2673 1.0256 1.3479 0.1130  -0.1896 -0.0856 230 ASP A N   
1409 C CA  . ASP A 217 ? 1.2975 1.0090 1.3787 0.1290  -0.2167 -0.0941 230 ASP A CA  
1410 C C   . ASP A 217 ? 1.3286 0.9966 1.3910 0.1177  -0.2275 -0.0636 230 ASP A C   
1411 O O   . ASP A 217 ? 1.3428 1.0210 1.3928 0.0981  -0.2122 -0.0370 230 ASP A O   
1412 C CB  . ASP A 217 ? 1.3022 1.0390 1.3982 0.1562  -0.2177 -0.1182 230 ASP A CB  
1413 C CG  . ASP A 217 ? 1.3928 1.1708 1.5066 0.1685  -0.2096 -0.1513 230 ASP A CG  
1414 O OD1 . ASP A 217 ? 1.3781 1.1476 1.4933 0.1630  -0.2138 -0.1619 230 ASP A OD1 
1415 O OD2 . ASP A 217 ? 1.5831 1.4029 1.7087 0.1829  -0.1991 -0.1668 230 ASP A OD2 
1416 N N   . LYS A 218 ? 1.3446 0.9639 1.4042 0.1308  -0.2546 -0.0682 231 LYS A N   
1417 C CA  . LYS A 218 ? 1.4151 0.9900 1.4544 0.1228  -0.2679 -0.0407 231 LYS A CA  
1418 C C   . LYS A 218 ? 1.4528 1.0525 1.4896 0.1325  -0.2576 -0.0333 231 LYS A C   
1419 O O   . LYS A 218 ? 1.4675 1.0376 1.4853 0.1258  -0.2652 -0.0095 231 LYS A O   
1420 C CB  . LYS A 218 ? 1.4299 0.9412 1.4657 0.1355  -0.3033 -0.0493 231 LYS A CB  
1421 N N   . SER A 219 ? 1.4657 1.1185 1.5202 0.1474  -0.2413 -0.0536 232 SER A N   
1422 C CA  . SER A 219 ? 1.5625 1.2461 1.6162 0.1541  -0.2286 -0.0476 232 SER A CA  
1423 C C   . SER A 219 ? 1.4827 1.1842 1.5195 0.1308  -0.2061 -0.0186 232 SER A C   
1424 O O   . SER A 219 ? 1.4679 1.1736 1.4937 0.1311  -0.2014 -0.0038 232 SER A O   
1425 C CB  . SER A 219 ? 1.6754 1.4139 1.7523 0.1715  -0.2156 -0.0765 232 SER A CB  
1426 O OG  . SER A 219 ? 1.5654 1.3402 1.6477 0.1595  -0.1950 -0.0819 232 SER A OG  
1427 N N   . GLY A 220 ? 1.2698 0.9831 1.3052 0.1119  -0.1930 -0.0119 233 GLY A N   
1428 C CA  . GLY A 220 ? 1.1004 0.8330 1.1223 0.0907  -0.1722 0.0132  233 GLY A CA  
1429 C C   . GLY A 220 ? 1.0356 0.8244 1.0660 0.0932  -0.1476 0.0059  233 GLY A C   
1430 O O   . GLY A 220 ? 1.0904 0.8972 1.1098 0.0843  -0.1321 0.0236  233 GLY A O   
1431 N N   . ARG A 221 ? 0.9936 0.8093 1.0421 0.1049  -0.1445 -0.0202 234 ARG A N   
1432 C CA  . ARG A 221 ? 0.9730 0.8396 1.0284 0.1076  -0.1237 -0.0285 234 ARG A CA  
1433 C C   . ARG A 221 ? 0.9017 0.7948 0.9647 0.0995  -0.1123 -0.0389 234 ARG A C   
1434 O O   . ARG A 221 ? 1.0382 0.9166 1.1083 0.1001  -0.1229 -0.0518 234 ARG A O   
1435 C CB  . ARG A 221 ? 1.1093 0.9929 1.1781 0.1291  -0.1283 -0.0508 234 ARG A CB  
1436 C CG  . ARG A 221 ? 1.2368 1.1033 1.2983 0.1377  -0.1372 -0.0407 234 ARG A CG  
1437 C CD  . ARG A 221 ? 1.3576 1.2419 1.4368 0.1598  -0.1445 -0.0652 234 ARG A CD  
1438 N NE  . ARG A 221 ? 1.4528 1.3260 1.5253 0.1677  -0.1521 -0.0557 234 ARG A NE  
1439 C CZ  . ARG A 221 ? 1.1230 1.0206 1.1885 0.1640  -0.1384 -0.0454 234 ARG A CZ  
1440 N NH1 . ARG A 221 ? 1.0195 0.9528 1.0832 0.1526  -0.1166 -0.0426 234 ARG A NH1 
1441 N NH2 . ARG A 221 ? 1.0809 0.9647 1.1399 0.1719  -0.1483 -0.0380 234 ARG A NH2 
1442 N N   . THR A 222 ? 0.8834 0.8134 0.9435 0.0922  -0.0922 -0.0332 235 THR A N   
1443 C CA  . THR A 222 ? 0.8727 0.8315 0.9382 0.0853  -0.0810 -0.0427 235 THR A CA  
1444 C C   . THR A 222 ? 0.9018 0.8841 0.9808 0.0993  -0.0816 -0.0717 235 THR A C   
1445 O O   . THR A 222 ? 0.9424 0.9224 1.0290 0.1148  -0.0898 -0.0845 235 THR A O   
1446 C CB  . THR A 222 ? 0.8884 0.8777 0.9452 0.0753  -0.0613 -0.0284 235 THR A CB  
1447 O OG1 . THR A 222 ? 0.9447 0.9529 1.0001 0.0846  -0.0548 -0.0311 235 THR A OG1 
1448 C CG2 . THR A 222 ? 0.9654 0.9389 1.0102 0.0617  -0.0586 -0.0021 235 THR A CG2 
1449 N N   . LEU A 223 ? 0.9193 0.9263 1.0013 0.0939  -0.0731 -0.0827 236 LEU A N   
1450 C CA  . LEU A 223 ? 0.9125 0.9480 1.0051 0.1047  -0.0708 -0.1102 236 LEU A CA  
1451 C C   . LEU A 223 ? 0.9027 0.9703 0.9954 0.1098  -0.0591 -0.1118 236 LEU A C   
1452 O O   . LEU A 223 ? 0.8820 0.9682 0.9860 0.1229  -0.0609 -0.1327 236 LEU A O   
1453 C CB  . LEU A 223 ? 0.8647 0.9203 0.9554 0.0948  -0.0630 -0.1178 236 LEU A CB  
1454 C CG  . LEU A 223 ? 0.8682 0.9509 0.9677 0.1044  -0.0618 -0.1480 236 LEU A CG  
1455 C CD1 . LEU A 223 ? 0.9356 0.9915 1.0454 0.1160  -0.0803 -0.1678 236 LEU A CD1 
1456 C CD2 . LEU A 223 ? 0.9139 1.0237 1.0055 0.0919  -0.0496 -0.1496 236 LEU A CD2 
1457 N N   . SER A 224 ? 0.8903 0.9649 0.9709 0.0993  -0.0476 -0.0902 237 SER A N   
1458 C CA  . SER A 224 ? 0.9355 1.0353 1.0133 0.1014  -0.0376 -0.0880 237 SER A CA  
1459 C C   . SER A 224 ? 0.8031 0.8857 0.8828 0.1116  -0.0462 -0.0825 237 SER A C   
1460 O O   . SER A 224 ? 0.9599 1.0568 1.0349 0.1117  -0.0393 -0.0760 237 SER A O   
1461 C CB  . SER A 224 ? 1.0590 1.1691 1.1216 0.0875  -0.0241 -0.0679 237 SER A CB  
1462 O OG  . SER A 224 ? 1.3069 1.4392 1.3649 0.0879  -0.0153 -0.0662 237 SER A OG  
1463 N N   . GLY A 225 ? 0.8370 0.8866 0.9220 0.1198  -0.0626 -0.0847 238 GLY A N   
1464 C CA  . GLY A 225 ? 0.7800 0.8105 0.8670 0.1315  -0.0744 -0.0820 238 GLY A CA  
1465 C C   . GLY A 225 ? 0.7837 0.7893 0.8536 0.1242  -0.0747 -0.0544 238 GLY A C   
1466 O O   . GLY A 225 ? 0.8193 0.8085 0.8876 0.1329  -0.0846 -0.0504 238 GLY A O   
1467 N N   . GLN A 226 ? 0.7878 0.7917 0.8450 0.1087  -0.0645 -0.0361 239 GLN A N   
1468 C CA  . GLN A 226 ? 0.8165 0.8058 0.8565 0.1009  -0.0608 -0.0109 239 GLN A CA  
1469 C C   . GLN A 226 ? 0.8367 0.7859 0.8690 0.0953  -0.0728 0.0034  239 GLN A C   
1470 O O   . GLN A 226 ? 1.0871 1.0241 1.1245 0.0898  -0.0783 -0.0001 239 GLN A O   
1471 C CB  . GLN A 226 ? 0.8197 0.8318 0.8510 0.0883  -0.0433 0.0000  239 GLN A CB  
1472 C CG  . GLN A 226 ? 0.8757 0.8878 0.8908 0.0848  -0.0357 0.0190  239 GLN A CG  
1473 C CD  . GLN A 226 ? 0.8582 0.8935 0.8665 0.0756  -0.0204 0.0262  239 GLN A CD  
1474 O OE1 . GLN A 226 ? 0.7693 0.8106 0.7811 0.0675  -0.0167 0.0263  239 GLN A OE1 
1475 N NE2 . GLN A 226 ? 0.8693 0.9163 0.8674 0.0772  -0.0129 0.0319  239 GLN A NE2 
1476 N N   . THR A 227 ? 0.8765 0.8048 0.8950 0.0952  -0.0773 0.0202  240 THR A N   
1477 C CA  . THR A 227 ? 0.8429 0.7328 0.8497 0.0864  -0.0880 0.0376  240 THR A CA  
1478 C C   . THR A 227 ? 0.7586 0.6562 0.7536 0.0683  -0.0740 0.0577  240 THR A C   
1479 O O   . THR A 227 ? 0.8051 0.7324 0.7971 0.0659  -0.0578 0.0610  240 THR A O   
1480 C CB  . THR A 227 ? 0.8295 0.6918 0.8233 0.0932  -0.1002 0.0479  240 THR A CB  
1481 O OG1 . THR A 227 ? 0.8460 0.7248 0.8258 0.0903  -0.0871 0.0612  240 THR A OG1 
1482 C CG2 . THR A 227 ? 0.8774 0.7361 0.8852 0.1131  -0.1148 0.0272  240 THR A CG2 
1483 N N   . GLY A 228 ? 0.7719 0.6428 0.7605 0.0556  -0.0811 0.0709  241 GLY A N   
1484 C CA  . GLY A 228 ? 0.8239 0.7048 0.8042 0.0373  -0.0685 0.0894  241 GLY A CA  
1485 C C   . GLY A 228 ? 0.9189 0.8167 0.8841 0.0360  -0.0546 0.1038  241 GLY A C   
1486 O O   . GLY A 228 ? 0.9398 0.8681 0.9057 0.0309  -0.0386 0.1070  241 GLY A O   
1487 N N   . GLU A 229 ? 0.9293 0.8062 0.8801 0.0418  -0.0622 0.1115  242 GLU A N   
1488 C CA  . GLU A 229 ? 0.9470 0.8365 0.8811 0.0423  -0.0509 0.1237  242 GLU A CA  
1489 C C   . GLU A 229 ? 0.9016 0.8256 0.8430 0.0524  -0.0386 0.1111  242 GLU A C   
1490 O O   . GLU A 229 ? 0.8396 0.7860 0.7738 0.0487  -0.0239 0.1181  242 GLU A O   
1491 C CB  . GLU A 229 ? 0.9824 0.8424 0.9006 0.0494  -0.0642 0.1304  242 GLU A CB  
1492 C CG  . GLU A 229 ? 1.0493 0.8700 0.9539 0.0378  -0.0778 0.1463  242 GLU A CG  
1493 C CD  . GLU A 229 ? 1.1450 0.9358 1.0311 0.0453  -0.0919 0.1539  242 GLU A CD  
1494 O OE1 . GLU A 229 ? 1.1576 0.9596 1.0275 0.0471  -0.0831 0.1622  242 GLU A OE1 
1495 O OE2 . GLU A 229 ? 1.1400 0.8949 1.0269 0.0500  -0.1129 0.1511  242 GLU A OE2 
1496 N N   . GLY A 230 ? 0.8056 0.7338 0.7609 0.0651  -0.0451 0.0923  243 GLY A N   
1497 C CA  . GLY A 230 ? 0.8286 0.7882 0.7906 0.0720  -0.0347 0.0803  243 GLY A CA  
1498 C C   . GLY A 230 ? 0.7939 0.7786 0.7630 0.0639  -0.0221 0.0781  243 GLY A C   
1499 O O   . GLY A 230 ? 0.7558 0.7627 0.7205 0.0642  -0.0105 0.0790  243 GLY A O   
1500 N N   . PHE A 231 ? 0.8317 0.8103 0.8111 0.0570  -0.0261 0.0752  244 PHE A N   
1501 C CA  . PHE A 231 ? 0.7536 0.7540 0.7406 0.0485  -0.0167 0.0734  244 PHE A CA  
1502 C C   . PHE A 231 ? 0.8016 0.8155 0.7785 0.0397  -0.0043 0.0900  244 PHE A C   
1503 O O   . PHE A 231 ? 0.8727 0.9115 0.8510 0.0399  0.0056  0.0874  244 PHE A O   
1504 C CB  . PHE A 231 ? 0.7999 0.7858 0.7983 0.0419  -0.0263 0.0682  244 PHE A CB  
1505 C CG  . PHE A 231 ? 0.7800 0.7835 0.7847 0.0302  -0.0189 0.0705  244 PHE A CG  
1506 C CD1 . PHE A 231 ? 0.7067 0.7347 0.7200 0.0325  -0.0134 0.0571  244 PHE A CD1 
1507 C CD2 . PHE A 231 ? 0.8675 0.8636 0.8697 0.0159  -0.0184 0.0860  244 PHE A CD2 
1508 C CE1 . PHE A 231 ? 0.7997 0.8434 0.8189 0.0224  -0.0085 0.0588  244 PHE A CE1 
1509 C CE2 . PHE A 231 ? 0.8580 0.8730 0.8687 0.0052  -0.0127 0.0873  244 PHE A CE2 
1510 C CZ  . PHE A 231 ? 0.7776 0.8157 0.7970 0.0094  -0.0084 0.0734  244 PHE A CZ  
1511 N N   . VAL A 232 ? 0.8118 0.8100 0.7777 0.0324  -0.0054 0.1064  245 VAL A N   
1512 C CA  . VAL A 232 ? 0.9136 0.9293 0.8715 0.0242  0.0071  0.1207  245 VAL A CA  
1513 C C   . VAL A 232 ? 0.9110 0.9425 0.8575 0.0341  0.0164  0.1210  245 VAL A C   
1514 O O   . VAL A 232 ? 0.9453 1.0006 0.8914 0.0331  0.0273  0.1233  245 VAL A O   
1515 C CB  . VAL A 232 ? 0.9259 0.9244 0.8724 0.0117  0.0052  0.1391  245 VAL A CB  
1516 C CG1 . VAL A 232 ? 0.9348 0.9089 0.8895 0.0014  -0.0075 0.1396  245 VAL A CG1 
1517 C CG2 . VAL A 232 ? 0.9080 0.8878 0.8346 0.0178  0.0019  0.1472  245 VAL A CG2 
1518 N N   . ILE A 233 ? 0.8292 0.8467 0.7670 0.0440  0.0107  0.1179  246 ILE A N   
1519 C CA  . ILE A 233 ? 0.8070 0.8352 0.7334 0.0532  0.0169  0.1168  246 ILE A CA  
1520 C C   . ILE A 233 ? 0.7601 0.8097 0.6956 0.0574  0.0218  0.1045  246 ILE A C   
1521 O O   . ILE A 233 ? 0.8786 0.9427 0.8064 0.0603  0.0298  0.1062  246 ILE A O   
1522 C CB  . ILE A 233 ? 0.7926 0.8019 0.7107 0.0623  0.0075  0.1141  246 ILE A CB  
1523 C CG1 . ILE A 233 ? 0.8522 0.8384 0.7548 0.0583  0.0023  0.1288  246 ILE A CG1 
1524 C CG2 . ILE A 233 ? 0.7740 0.7945 0.6825 0.0709  0.0124  0.1103  246 ILE A CG2 
1525 C CD1 . ILE A 233 ? 0.8720 0.8359 0.7682 0.0671  -0.0106 0.1262  246 ILE A CD1 
1526 N N   . SER A 234 ? 0.7291 0.7794 0.6794 0.0576  0.0162  0.0919  247 SER A N   
1527 C CA  . SER A 234 ? 0.7034 0.7729 0.6602 0.0595  0.0199  0.0804  247 SER A CA  
1528 C C   . SER A 234 ? 0.6960 0.7834 0.6559 0.0536  0.0275  0.0834  247 SER A C   
1529 O O   . SER A 234 ? 0.7569 0.8586 0.7162 0.0552  0.0308  0.0774  247 SER A O   
1530 C CB  . SER A 234 ? 0.7824 0.8507 0.7537 0.0609  0.0125  0.0651  247 SER A CB  
1531 O OG  . SER A 234 ? 0.7517 0.8070 0.7231 0.0684  0.0045  0.0600  247 SER A OG  
1532 N N   . VAL A 235 ? 0.7108 0.7979 0.6739 0.0460  0.0293  0.0929  248 VAL A N   
1533 C CA  . VAL A 235 ? 0.6967 0.8041 0.6660 0.0405  0.0356  0.0954  248 VAL A CA  
1534 C C   . VAL A 235 ? 0.6845 0.8015 0.6475 0.0380  0.0435  0.1087  248 VAL A C   
1535 O O   . VAL A 235 ? 0.8019 0.9386 0.7727 0.0338  0.0483  0.1107  248 VAL A O   
1536 C CB  . VAL A 235 ? 0.6811 0.7891 0.6664 0.0312  0.0308  0.0909  248 VAL A CB  
1537 C CG1 . VAL A 235 ? 0.7307 0.8335 0.7222 0.0346  0.0240  0.0754  248 VAL A CG1 
1538 C CG2 . VAL A 235 ? 0.6411 0.7325 0.6284 0.0222  0.0267  0.1005  248 VAL A CG2 
1539 N N   . SER A 236 ? 0.7798 0.8855 0.7289 0.0409  0.0448  0.1168  249 SER A N   
1540 C CA  . SER A 236 ? 0.8410 0.9584 0.7821 0.0386  0.0535  0.1285  249 SER A CA  
1541 C C   . SER A 236 ? 0.7831 0.9236 0.7218 0.0470  0.0611  0.1256  249 SER A C   
1542 O O   . SER A 236 ? 0.7343 0.8962 0.6766 0.0443  0.0687  0.1309  249 SER A O   
1543 C CB  . SER A 236 ? 1.0485 1.1478 0.9713 0.0410  0.0526  0.1367  249 SER A CB  
1544 O OG  . SER A 236 ? 1.3603 1.4425 1.2834 0.0298  0.0475  0.1454  249 SER A OG  
1545 N N   . HIS A 237 ? 0.6664 0.8028 0.5992 0.0569  0.0583  0.1170  250 HIS A N   
1546 C CA  . HIS A 237 ? 0.6483 0.7995 0.5762 0.0659  0.0620  0.1136  250 HIS A CA  
1547 C C   . HIS A 237 ? 0.7524 0.9267 0.6956 0.0629  0.0641  0.1115  250 HIS A C   
1548 O O   . HIS A 237 ? 0.7787 0.9687 0.7199 0.0707  0.0676  0.1107  250 HIS A O   
1549 C CB  . HIS A 237 ? 0.6325 0.7715 0.5512 0.0731  0.0564  0.1055  250 HIS A CB  
1550 C CG  . HIS A 237 ? 0.6310 0.7692 0.5606 0.0678  0.0510  0.0973  250 HIS A CG  
1551 N ND1 . HIS A 237 ? 0.6624 0.7892 0.5986 0.0628  0.0462  0.0935  250 HIS A ND1 
1552 C CD2 . HIS A 237 ? 0.6221 0.7695 0.5554 0.0674  0.0491  0.0914  250 HIS A CD2 
1553 C CE1 . HIS A 237 ? 0.5660 0.6978 0.5101 0.0595  0.0430  0.0847  250 HIS A CE1 
1554 N NE2 . HIS A 237 ? 0.5387 0.6823 0.4800 0.0613  0.0447  0.0842  250 HIS A NE2 
1555 N N   . GLY A 238 ? 0.8152 0.9909 0.7739 0.0527  0.0607  0.1096  251 GLY A N   
1556 C CA  . GLY A 238 ? 0.6659 0.8638 0.6407 0.0478  0.0616  0.1083  251 GLY A CA  
1557 C C   . GLY A 238 ? 0.8443 1.0633 0.8273 0.0422  0.0691  0.1168  251 GLY A C   
1558 O O   . GLY A 238 ? 0.7872 1.0291 0.7859 0.0379  0.0701  0.1160  251 GLY A O   
1559 N N   . GLU A 239 ? 0.8274 1.0404 0.7998 0.0411  0.0742  0.1251  252 GLU A N   
1560 C CA  . GLU A 239 ? 0.8985 1.1338 0.8755 0.0342  0.0831  0.1341  252 GLU A CA  
1561 C C   . GLU A 239 ? 0.8251 1.0730 0.8225 0.0173  0.0821  0.1375  252 GLU A C   
1562 O O   . GLU A 239 ? 0.8104 1.0904 0.8208 0.0133  0.0885  0.1397  252 GLU A O   
1563 C CB  . GLU A 239 ? 1.1016 1.3655 1.0784 0.0470  0.0902  0.1308  252 GLU A CB  
1564 C CG  . GLU A 239 ? 1.1707 1.4213 1.1263 0.0637  0.0902  0.1269  252 GLU A CG  
1565 C CD  . GLU A 239 ? 1.3861 1.6230 1.3230 0.0625  0.0947  0.1347  252 GLU A CD  
1566 O OE1 . GLU A 239 ? 1.4918 1.7430 1.4306 0.0522  0.1023  0.1436  252 GLU A OE1 
1567 O OE2 . GLU A 239 ? 1.6344 1.8467 1.5540 0.0708  0.0901  0.1322  252 GLU A OE2 
1568 N N   . PRO A 240 ? 0.7356 0.9589 0.7364 0.0077  0.0733  0.1370  253 PRO A N   
1569 C CA  . PRO A 240 ? 0.7676 0.9985 0.7868 -0.0083 0.0699  0.1388  253 PRO A CA  
1570 C C   . PRO A 240 ? 0.8598 1.1031 0.8817 -0.0243 0.0764  0.1525  253 PRO A C   
1571 O O   . PRO A 240 ? 0.9274 1.1533 0.9334 -0.0277 0.0782  0.1618  253 PRO A O   
1572 C CB  . PRO A 240 ? 0.8192 1.0151 0.8364 -0.0119 0.0583  0.1343  253 PRO A CB  
1573 C CG  . PRO A 240 ? 0.7620 0.9334 0.7597 -0.0036 0.0577  0.1369  253 PRO A CG  
1574 C CD  . PRO A 240 ? 0.7722 0.9600 0.7602 0.0109  0.0657  0.1350  253 PRO A CD  
1575 N N   . LEU A 241 ? 0.8482 1.1221 0.8893 -0.0350 0.0796  0.1540  254 LEU A N   
1576 C CA  . LEU A 241 ? 0.8557 1.1469 0.9015 -0.0538 0.0865  0.1674  254 LEU A CA  
1577 C C   . LEU A 241 ? 0.9207 1.1749 0.9602 -0.0715 0.0772  0.1761  254 LEU A C   
1578 O O   . LEU A 241 ? 1.1569 1.4040 1.1844 -0.0840 0.0809  0.1900  254 LEU A O   
1579 C CB  . LEU A 241 ? 0.8156 1.1492 0.8872 -0.0627 0.0900  0.1656  254 LEU A CB  
1580 C CG  . LEU A 241 ? 0.8623 1.2261 0.9420 -0.0832 0.0997  0.1788  254 LEU A CG  
1581 C CD1 . LEU A 241 ? 0.8641 1.2469 0.9287 -0.0758 0.1140  0.1845  254 LEU A CD1 
1582 C CD2 . LEU A 241 ? 0.8162 1.2247 0.9252 -0.0902 0.1015  0.1744  254 LEU A CD2 
1583 N N   . CYS A 242 ? 0.7952 1.0248 0.8414 -0.0722 0.0643  0.1676  255 CYS A N   
1584 C CA  . CYS A 242 ? 0.8269 1.0168 0.8681 -0.0857 0.0521  0.1726  255 CYS A CA  
1585 C C   . CYS A 242 ? 0.8420 0.9969 0.8758 -0.0706 0.0408  0.1600  255 CYS A C   
1586 O O   . CYS A 242 ? 0.7385 0.9031 0.7770 -0.0557 0.0410  0.1465  255 CYS A O   
1587 C CB  . CYS A 242 ? 0.9501 1.1474 1.0107 -0.1054 0.0459  0.1735  255 CYS A CB  
1588 S SG  . CYS A 242 ? 1.1782 1.3253 1.2315 -0.1256 0.0296  0.1822  255 CYS A SG  
1589 N N   . ILE A 243 ? 0.7921 0.9072 0.8139 -0.0749 0.0308  0.1646  256 ILE A N   
1590 C CA  . ILE A 243 ? 0.7961 0.8795 0.8132 -0.0612 0.0192  0.1519  256 ILE A CA  
1591 C C   . ILE A 243 ? 0.8313 0.8749 0.8471 -0.0727 0.0032  0.1545  256 ILE A C   
1592 O O   . ILE A 243 ? 0.9192 0.9506 0.9280 -0.0895 0.0015  0.1705  256 ILE A O   
1593 C CB  . ILE A 243 ? 0.7602 0.8345 0.7599 -0.0446 0.0226  0.1519  256 ILE A CB  
1594 C CG1 . ILE A 243 ? 0.8128 0.8666 0.8128 -0.0293 0.0128  0.1355  256 ILE A CG1 
1595 C CG2 . ILE A 243 ? 0.8688 0.9207 0.8505 -0.0527 0.0210  0.1684  256 ILE A CG2 
1596 C CD1 . ILE A 243 ? 0.9188 0.9727 0.9059 -0.0127 0.0171  0.1327  256 ILE A CD1 
1597 N N   . GLY A 244 ? 0.8120 0.8351 0.8336 -0.0642 -0.0088 0.1386  257 GLY A N   
1598 C CA  . GLY A 244 ? 0.8820 0.8652 0.9033 -0.0731 -0.0262 0.1383  257 GLY A CA  
1599 C C   . GLY A 244 ? 0.8774 0.8402 0.9042 -0.0584 -0.0390 0.1173  257 GLY A C   
1600 O O   . GLY A 244 ? 0.8199 0.7931 0.8461 -0.0403 -0.0349 0.1049  257 GLY A O   
1601 N N   . LEU A 245 ? 0.9601 0.8935 0.9916 -0.0670 -0.0549 0.1131  258 LEU A N   
1602 C CA  . LEU A 245 ? 1.0194 0.9344 1.0576 -0.0538 -0.0681 0.0908  258 LEU A CA  
1603 C C   . LEU A 245 ? 1.0613 0.9712 1.1112 -0.0668 -0.0773 0.0837  258 LEU A C   
1604 O O   . LEU A 245 ? 1.0204 0.9298 1.0720 -0.0880 -0.0777 0.0986  258 LEU A O   
1605 C CB  . LEU A 245 ? 1.0073 0.8778 1.0355 -0.0452 -0.0843 0.0897  258 LEU A CB  
1606 C CG  . LEU A 245 ? 1.1904 1.0619 1.2062 -0.0323 -0.0782 0.0961  258 LEU A CG  
1607 C CD1 . LEU A 245 ? 1.3066 1.1300 1.3111 -0.0282 -0.0971 0.1000  258 LEU A CD1 
1608 C CD2 . LEU A 245 ? 1.1768 1.0760 1.1990 -0.0119 -0.0697 0.0776  258 LEU A CD2 
1609 N N   . ASN A 246 ? 1.0432 0.9514 1.1012 -0.0548 -0.0844 0.0605  259 ASN A N   
1610 C CA  . ASN A 246 ? 1.1239 1.0267 1.1920 -0.0651 -0.0943 0.0506  259 ASN A CA  
1611 C C   . ASN A 246 ? 1.0789 0.9644 1.1509 -0.0493 -0.1075 0.0236  259 ASN A C   
1612 O O   . ASN A 246 ? 1.1057 1.0034 1.1772 -0.0298 -0.1027 0.0091  259 ASN A O   
1613 C CB  . ASN A 246 ? 1.1123 1.0598 1.1899 -0.0734 -0.0805 0.0519  259 ASN A CB  
1614 C CG  . ASN A 246 ? 1.1125 1.0926 1.1913 -0.0558 -0.0689 0.0370  259 ASN A CG  
1615 O OD1 . ASN A 246 ? 1.0146 1.0079 1.0867 -0.0449 -0.0580 0.0414  259 ASN A OD1 
1616 N ND2 . ASN A 246 ? 1.0143 1.0067 1.0999 -0.0542 -0.0719 0.0198  259 ASN A ND2 
1617 N N   . CYS A 247 ? 1.1223 0.9804 1.1982 -0.0585 -0.1242 0.0166  260 CYS A N   
1618 C CA  . CYS A 247 ? 1.2381 1.0807 1.3184 -0.0448 -0.1378 -0.0112 260 CYS A CA  
1619 C C   . CYS A 247 ? 1.1470 0.9599 1.2229 -0.0240 -0.1492 -0.0231 260 CYS A C   
1620 O O   . CYS A 247 ? 1.0499 0.8474 1.1179 -0.0225 -0.1494 -0.0076 260 CYS A O   
1621 C CB  . CYS A 247 ? 1.2368 1.1231 1.3232 -0.0363 -0.1250 -0.0287 260 CYS A CB  
1622 S SG  . CYS A 247 ? 1.5702 1.4960 1.6625 -0.0568 -0.1117 -0.0147 260 CYS A SG  
1623 N N   . ALA A 248 ? 1.1606 0.9658 1.2416 -0.0080 -0.1597 -0.0513 261 ALA A N   
1624 C CA  . ALA A 248 ? 1.1654 0.9510 1.2465 0.0155  -0.1703 -0.0685 261 ALA A CA  
1625 C C   . ALA A 248 ? 1.3898 1.1174 1.4639 0.0144  -0.1930 -0.0595 261 ALA A C   
1626 O O   . ALA A 248 ? 1.3828 1.0788 1.4594 0.0296  -0.2127 -0.0801 261 ALA A O   
1627 C CB  . ALA A 248 ? 0.9906 0.8100 1.0711 0.0287  -0.1527 -0.0663 261 ALA A CB  
1628 N N   . LEU A 249 ? 1.4823 1.1964 1.5467 -0.0030 -0.1906 -0.0293 262 LEU A N   
1629 C CA  . LEU A 249 ? 1.5169 1.1752 1.5699 -0.0080 -0.2113 -0.0153 262 LEU A CA  
1630 C C   . LEU A 249 ? 1.4509 1.0835 1.4976 -0.0382 -0.2191 0.0057  262 LEU A C   
1631 O O   . LEU A 249 ? 1.2166 0.8831 1.2668 -0.0571 -0.2028 0.0185  262 LEU A O   
1632 C CB  . LEU A 249 ? 1.4321 1.0940 1.4750 -0.0042 -0.2027 0.0039  262 LEU A CB  
1633 C CG  . LEU A 249 ? 1.4079 1.0864 1.4562 0.0244  -0.1996 -0.0143 262 LEU A CG  
1634 C CD1 . LEU A 249 ? 1.4557 1.1429 1.4929 0.0241  -0.1887 0.0071  262 LEU A CD1 
1635 C CD2 . LEU A 249 ? 1.3826 1.0182 1.4336 0.0446  -0.2261 -0.0355 262 LEU A CD2 
1636 N N   . GLY A 250 ? 1.5742 1.1468 1.6116 -0.0428 -0.2453 0.0092  263 GLY A N   
1637 C CA  . GLY A 250 ? 1.5653 1.1070 1.5936 -0.0743 -0.2552 0.0328  263 GLY A CA  
1638 C C   . GLY A 250 ? 1.5164 1.0576 1.5297 -0.0908 -0.2456 0.0663  263 GLY A C   
1639 O O   . GLY A 250 ? 1.6120 1.1690 1.6209 -0.0756 -0.2351 0.0697  263 GLY A O   
1640 N N   . ALA A 251 ? 1.4121 0.9367 1.4172 -0.1228 -0.2493 0.0908  264 ALA A N   
1641 C CA  . ALA A 251 ? 1.4068 0.9332 1.3958 -0.1422 -0.2394 0.1234  264 ALA A CA  
1642 C C   . ALA A 251 ? 1.3976 0.8774 1.3669 -0.1298 -0.2551 0.1311  264 ALA A C   
1643 O O   . ALA A 251 ? 1.2997 0.7965 1.2580 -0.1291 -0.2412 0.1475  264 ALA A O   
1644 C CB  . ALA A 251 ? 1.4833 0.9947 1.4667 -0.1804 -0.2445 0.1466  264 ALA A CB  
1645 N N   . ALA A 252 ? 1.5926 1.0132 1.5570 -0.1191 -0.2851 0.1181  265 ALA A N   
1646 C CA  . ALA A 252 ? 1.6108 0.9784 1.5560 -0.1071 -0.3061 0.1246  265 ALA A CA  
1647 C C   . ALA A 252 ? 1.5933 0.9867 1.5449 -0.0727 -0.2973 0.1081  265 ALA A C   
1648 O O   . ALA A 252 ? 1.5418 0.9297 1.4781 -0.0699 -0.2948 0.1243  265 ALA A O   
1649 C CB  . ALA A 252 ? 1.6398 0.9372 1.5803 -0.1024 -0.3425 0.1118  265 ALA A CB  
1650 N N   . GLU A 253 ? 1.6644 1.0869 1.6379 -0.0479 -0.2928 0.0759  266 GLU A N   
1651 C CA  . GLU A 253 ? 1.6173 1.0716 1.6002 -0.0169 -0.2829 0.0579  266 GLU A CA  
1652 C C   . GLU A 253 ? 1.5723 1.0852 1.5553 -0.0223 -0.2507 0.0723  266 GLU A C   
1653 O O   . GLU A 253 ? 1.5797 1.1033 1.5583 -0.0070 -0.2453 0.0740  266 GLU A O   
1654 C CB  . GLU A 253 ? 1.5795 1.0559 1.5850 0.0066  -0.2837 0.0206  266 GLU A CB  
1655 N N   . MET A 254 ? 1.5752 1.1247 1.5633 -0.0437 -0.2311 0.0821  267 MET A N   
1656 C CA  . MET A 254 ? 1.5625 1.1689 1.5522 -0.0480 -0.2011 0.0933  267 MET A CA  
1657 C C   . MET A 254 ? 1.5044 1.1060 1.4739 -0.0691 -0.1936 0.1264  267 MET A C   
1658 O O   . MET A 254 ? 1.5980 1.2448 1.5676 -0.0738 -0.1697 0.1364  267 MET A O   
1659 C CB  . MET A 254 ? 1.4519 1.1030 1.4577 -0.0587 -0.1842 0.0866  267 MET A CB  
1660 N N   . ARG A 255 ? 1.5605 1.1071 1.5112 -0.0816 -0.2145 0.1430  268 ARG A N   
1661 C CA  . ARG A 255 ? 1.5116 1.0512 1.4397 -0.1045 -0.2084 0.1755  268 ARG A CA  
1662 C C   . ARG A 255 ? 1.4052 0.9599 1.3210 -0.0898 -0.1977 0.1823  268 ARG A C   
1663 O O   . ARG A 255 ? 1.2833 0.8827 1.1971 -0.0969 -0.1732 0.1935  268 ARG A O   
1664 C CB  . ARG A 255 ? 1.5512 1.0226 1.4590 -0.1226 -0.2361 0.1921  268 ARG A CB  
1665 N N   . PRO A 256 ? 1.4523 0.9707 1.3605 -0.0682 -0.2167 0.1742  269 PRO A N   
1666 C CA  . PRO A 256 ? 1.4801 1.0040 1.3725 -0.0575 -0.2109 0.1840  269 PRO A CA  
1667 C C   . PRO A 256 ? 1.4037 0.9894 1.3089 -0.0428 -0.1841 0.1735  269 PRO A C   
1668 O O   . PRO A 256 ? 1.4390 1.0372 1.3295 -0.0407 -0.1740 0.1856  269 PRO A O   
1669 C CB  . PRO A 256 ? 1.4986 0.9750 1.3885 -0.0334 -0.2393 0.1701  269 PRO A CB  
1670 C CG  . PRO A 256 ? 1.4963 0.9685 1.4104 -0.0210 -0.2501 0.1422  269 PRO A CG  
1671 C CD  . PRO A 256 ? 1.4758 0.9526 1.3928 -0.0489 -0.2439 0.1516  269 PRO A CD  
1672 N N   . PHE A 257 ? 1.3440 0.9656 1.2742 -0.0334 -0.1737 0.1514  270 PHE A N   
1673 C CA  . PHE A 257 ? 1.3202 0.9977 1.2616 -0.0218 -0.1495 0.1419  270 PHE A CA  
1674 C C   . PHE A 257 ? 1.4025 1.1176 1.3398 -0.0422 -0.1260 0.1597  270 PHE A C   
1675 O O   . PHE A 257 ? 1.4774 1.2264 1.4111 -0.0367 -0.1081 0.1632  270 PHE A O   
1676 C CB  . PHE A 257 ? 1.2154 0.9164 1.1820 -0.0058 -0.1478 0.1127  270 PHE A CB  
1677 C CG  . PHE A 257 ? 1.2784 0.9464 1.2524 0.0143  -0.1710 0.0918  270 PHE A CG  
1678 C CD1 . PHE A 257 ? 1.2697 0.9211 1.2373 0.0326  -0.1816 0.0889  270 PHE A CD1 
1679 C CD2 . PHE A 257 ? 1.3289 0.9834 1.3169 0.0161  -0.1832 0.0739  270 PHE A CD2 
1680 C CE1 . PHE A 257 ? 1.2792 0.9031 1.2560 0.0532  -0.2038 0.0680  270 PHE A CE1 
1681 C CE2 . PHE A 257 ? 1.3692 0.9950 1.3648 0.0369  -0.2050 0.0522  270 PHE A CE2 
1682 C CZ  . PHE A 257 ? 1.3818 0.9934 1.3729 0.0561  -0.2152 0.0490  270 PHE A CZ  
1683 N N   . ILE A 258 ? 1.4267 1.1364 1.3655 -0.0654 -0.1269 0.1701  271 ILE A N   
1684 C CA  . ILE A 258 ? 1.4348 1.1824 1.3725 -0.0859 -0.1058 0.1865  271 ILE A CA  
1685 C C   . ILE A 258 ? 1.3534 1.0991 1.2664 -0.0957 -0.0983 0.2106  271 ILE A C   
1686 O O   . ILE A 258 ? 1.3637 1.1516 1.2754 -0.0968 -0.0769 0.2163  271 ILE A O   
1687 C CB  . ILE A 258 ? 1.4024 1.1440 1.3482 -0.1108 -0.1105 0.1927  271 ILE A CB  
1688 C CG1 . ILE A 258 ? 1.3781 1.1511 1.3497 -0.1039 -0.1046 0.1709  271 ILE A CG1 
1689 C CG2 . ILE A 258 ? 1.4441 1.2083 1.3807 -0.1377 -0.0955 0.2177  271 ILE A CG2 
1690 C CD1 . ILE A 258 ? 1.2110 1.0438 1.1929 -0.1031 -0.0793 0.1704  271 ILE A CD1 
1691 N N   . GLU A 259 ? 1.2930 0.9889 1.1848 -0.1022 -0.1168 0.2242  272 GLU A N   
1692 C CA  . GLU A 259 ? 1.3591 1.0493 1.2230 -0.1123 -0.1115 0.2478  272 GLU A CA  
1693 C C   . GLU A 259 ? 1.3901 1.0946 1.2472 -0.0883 -0.1045 0.2408  272 GLU A C   
1694 O O   . GLU A 259 ? 1.5744 1.2933 1.4122 -0.0937 -0.0921 0.2561  272 GLU A O   
1695 C CB  . GLU A 259 ? 1.4851 1.1136 1.3248 -0.1276 -0.1355 0.2659  272 GLU A CB  
1696 C CG  . GLU A 259 ? 1.5193 1.0970 1.3561 -0.1057 -0.1629 0.2531  272 GLU A CG  
1697 C CD  . GLU A 259 ? 1.6961 1.2091 1.5054 -0.1215 -0.1883 0.2734  272 GLU A CD  
1698 O OE1 . GLU A 259 ? 1.5118 1.0207 1.2947 -0.1440 -0.1823 0.3001  272 GLU A OE1 
1699 O OE2 . GLU A 259 ? 1.8937 1.3593 1.7067 -0.1112 -0.2150 0.2623  272 GLU A OE2 
1700 N N   . ILE A 260 ? 1.3834 1.0855 1.2560 -0.0626 -0.1123 0.2174  273 ILE A N   
1701 C CA  . ILE A 260 ? 1.2392 0.9631 1.1109 -0.0406 -0.1039 0.2079  273 ILE A CA  
1702 C C   . ILE A 260 ? 1.1120 0.8924 0.9943 -0.0408 -0.0774 0.2042  273 ILE A C   
1703 O O   . ILE A 260 ? 1.1994 0.9999 1.0677 -0.0400 -0.0638 0.2133  273 ILE A O   
1704 C CB  . ILE A 260 ? 1.2419 0.9556 1.1309 -0.0150 -0.1177 0.1825  273 ILE A CB  
1705 N N   . ILE A 261 ? 1.0491 0.8530 0.9550 -0.0415 -0.0715 0.1907  274 ILE A N   
1706 C CA  . ILE A 261 ? 1.0378 0.8929 0.9552 -0.0415 -0.0491 0.1864  274 ILE A CA  
1707 C C   . ILE A 261 ? 0.9720 0.8488 0.8767 -0.0597 -0.0334 0.2070  274 ILE A C   
1708 O O   . ILE A 261 ? 1.0038 0.9160 0.9071 -0.0538 -0.0163 0.2066  274 ILE A O   
1709 C CB  . ILE A 261 ? 1.0585 0.9301 1.0007 -0.0435 -0.0484 0.1714  274 ILE A CB  
1710 C CG1 . ILE A 261 ? 1.1189 0.9896 1.0747 -0.0218 -0.0553 0.1473  274 ILE A CG1 
1711 C CG2 . ILE A 261 ? 0.9294 0.8492 0.8808 -0.0496 -0.0278 0.1729  274 ILE A CG2 
1712 C CD1 . ILE A 261 ? 1.1519 1.0324 1.1285 -0.0230 -0.0578 0.1312  274 ILE A CD1 
1713 N N   . GLY A 262 ? 1.0197 0.8757 0.9151 -0.0820 -0.0396 0.2242  275 GLY A N   
1714 C CA  . GLY A 262 ? 1.0769 0.9581 0.9622 -0.1026 -0.0240 0.2435  275 GLY A CA  
1715 C C   . GLY A 262 ? 1.1121 0.9951 0.9707 -0.1002 -0.0163 0.2566  275 GLY A C   
1716 O O   . GLY A 262 ? 1.0826 1.0027 0.9361 -0.1076 0.0024  0.2649  275 GLY A O   
1717 N N   . LYS A 263 ? 1.1647 1.0086 1.0061 -0.0892 -0.0313 0.2574  276 LYS A N   
1718 C CA  . LYS A 263 ? 1.1510 0.9921 0.9647 -0.0854 -0.0267 0.2687  276 LYS A CA  
1719 C C   . LYS A 263 ? 1.1472 1.0163 0.9656 -0.0612 -0.0160 0.2532  276 LYS A C   
1720 O O   . LYS A 263 ? 1.2607 1.1313 1.0572 -0.0555 -0.0112 0.2594  276 LYS A O   
1721 C CB  . LYS A 263 ? 1.1649 0.9498 0.9569 -0.0845 -0.0500 0.2772  276 LYS A CB  
1722 N N   . CYS A 264 ? 1.1350 1.0246 0.9799 -0.0481 -0.0129 0.2334  277 CYS A N   
1723 C CA  . CYS A 264 ? 0.9843 0.8971 0.8344 -0.0268 -0.0048 0.2183  277 CYS A CA  
1724 C C   . CYS A 264 ? 0.9375 0.8977 0.8015 -0.0260 0.0146  0.2122  277 CYS A C   
1725 O O   . CYS A 264 ? 0.8424 0.8204 0.7114 -0.0097 0.0203  0.1995  277 CYS A O   
1726 C CB  . CYS A 264 ? 0.9107 0.8074 0.7773 -0.0102 -0.0187 0.1991  277 CYS A CB  
1727 S SG  . CYS A 264 ? 1.0560 0.9031 0.9077 -0.0009 -0.0423 0.2005  277 CYS A SG  
1728 N N   . THR A 265 ? 0.9415 0.9220 0.8115 -0.0436 0.0238  0.2213  278 THR A N   
1729 C CA  . THR A 265 ? 0.8398 0.8657 0.7258 -0.0417 0.0400  0.2145  278 THR A CA  
1730 C C   . THR A 265 ? 0.8966 0.9519 0.7792 -0.0593 0.0543  0.2287  278 THR A C   
1731 O O   . THR A 265 ? 0.9942 1.0362 0.8704 -0.0799 0.0506  0.2435  278 THR A O   
1732 C CB  . THR A 265 ? 0.8215 0.8544 0.7348 -0.0409 0.0355  0.2007  278 THR A CB  
1733 O OG1 . THR A 265 ? 0.8626 0.9380 0.7895 -0.0379 0.0495  0.1947  278 THR A OG1 
1734 C CG2 . THR A 265 ? 0.9741 0.9894 0.8950 -0.0610 0.0262  0.2084  278 THR A CG2 
1735 N N   . THR A 266 ? 0.9581 1.0539 0.8450 -0.0510 0.0699  0.2234  279 THR A N   
1736 C CA  . THR A 266 ? 0.9725 1.1078 0.8615 -0.0642 0.0857  0.2325  279 THR A CA  
1737 C C   . THR A 266 ? 0.9064 1.0666 0.8245 -0.0751 0.0874  0.2286  279 THR A C   
1738 O O   . THR A 266 ? 0.9738 1.1636 0.8983 -0.0923 0.0972  0.2378  279 THR A O   
1739 C CB  . THR A 266 ? 1.0450 1.2134 0.9273 -0.0472 0.1002  0.2257  279 THR A CB  
1740 O OG1 . THR A 266 ? 1.3163 1.4617 1.1699 -0.0390 0.0982  0.2301  279 THR A OG1 
1741 C CG2 . THR A 266 ? 1.2032 1.4192 1.0909 -0.0583 0.1173  0.2320  279 THR A CG2 
1742 N N   . ALA A 267 ? 0.9205 1.0701 0.8559 -0.0660 0.0778  0.2148  280 ALA A N   
1743 C CA  . ALA A 267 ? 0.9255 1.0949 0.8873 -0.0752 0.0769  0.2096  280 ALA A CA  
1744 C C   . ALA A 267 ? 0.9584 1.1106 0.9234 -0.1010 0.0692  0.2222  280 ALA A C   
1745 O O   . ALA A 267 ? 0.9338 1.0490 0.8802 -0.1096 0.0606  0.2332  280 ALA A O   
1746 C CB  . ALA A 267 ? 0.8821 1.0393 0.8565 -0.0600 0.0672  0.1922  280 ALA A CB  
1747 N N   . TYR A 268 ? 0.9698 1.1471 0.9577 -0.1137 0.0707  0.2205  281 TYR A N   
1748 C CA  . TYR A 268 ? 0.9720 1.1287 0.9658 -0.1379 0.0599  0.2293  281 TYR A CA  
1749 C C   . TYR A 268 ? 0.8904 1.0020 0.8856 -0.1294 0.0411  0.2180  281 TYR A C   
1750 O O   . TYR A 268 ? 0.8324 0.9414 0.8300 -0.1073 0.0393  0.2026  281 TYR A O   
1751 C CB  . TYR A 268 ? 0.9966 1.1948 1.0168 -0.1525 0.0657  0.2283  281 TYR A CB  
1752 C CG  . TYR A 268 ? 1.0439 1.2933 1.0671 -0.1617 0.0846  0.2378  281 TYR A CG  
1753 C CD1 . TYR A 268 ? 1.0855 1.3389 1.1005 -0.1892 0.0888  0.2571  281 TYR A CD1 
1754 C CD2 . TYR A 268 ? 1.1098 1.4042 1.1437 -0.1430 0.0976  0.2269  281 TYR A CD2 
1755 C CE1 . TYR A 268 ? 1.0501 1.3564 1.0689 -0.1979 0.1076  0.2643  281 TYR A CE1 
1756 C CE2 . TYR A 268 ? 1.0713 1.4162 1.1099 -0.1490 0.1149  0.2329  281 TYR A CE2 
1757 C CZ  . TYR A 268 ? 1.0636 1.4169 1.0954 -0.1765 0.1208  0.2511  281 TYR A CZ  
1758 O OH  . TYR A 268 ? 1.3675 1.7764 1.4046 -0.1826 0.1393  0.2556  281 TYR A OH  
1759 N N   . VAL A 269 ? 0.9646 1.0409 0.9577 -0.1473 0.0268  0.2253  282 VAL A N   
1760 C CA  . VAL A 269 ? 0.9679 1.0000 0.9615 -0.1385 0.0078  0.2136  282 VAL A CA  
1761 C C   . VAL A 269 ? 1.0864 1.1166 1.1003 -0.1507 -0.0019 0.2064  282 VAL A C   
1762 O O   . VAL A 269 ? 1.1281 1.1469 1.1427 -0.1753 -0.0081 0.2189  282 VAL A O   
1763 C CB  . VAL A 269 ? 0.9455 0.9254 0.9158 -0.1435 -0.0062 0.2250  282 VAL A CB  
1764 C CG1 . VAL A 269 ? 1.0141 0.9497 0.9880 -0.1343 -0.0274 0.2111  282 VAL A CG1 
1765 C CG2 . VAL A 269 ? 0.9551 0.9343 0.9050 -0.1279 0.0010  0.2288  282 VAL A CG2 
1766 N N   . LEU A 270 ? 1.0846 1.1257 1.1136 -0.1347 -0.0037 0.1865  283 LEU A N   
1767 C CA  . LEU A 270 ? 1.1708 1.2040 1.2163 -0.1424 -0.0157 0.1759  283 LEU A CA  
1768 C C   . LEU A 270 ? 1.1706 1.1480 1.2071 -0.1400 -0.0363 0.1705  283 LEU A C   
1769 O O   . LEU A 270 ? 1.1187 1.0708 1.1405 -0.1257 -0.0404 0.1695  283 LEU A O   
1770 C CB  . LEU A 270 ? 0.9928 1.0551 1.0531 -0.1253 -0.0110 0.1565  283 LEU A CB  
1771 N N   . CYS A 271 ? 1.1549 1.1131 1.2008 -0.1535 -0.0505 0.1664  284 CYS A N   
1772 C CA  . CYS A 271 ? 1.1745 1.0796 1.2142 -0.1485 -0.0722 0.1568  284 CYS A CA  
1773 C C   . CYS A 271 ? 1.1765 1.0690 1.2294 -0.1618 -0.0863 0.1482  284 CYS A C   
1774 O O   . CYS A 271 ? 1.2784 1.1622 1.3320 -0.1878 -0.0916 0.1629  284 CYS A O   
1775 C CB  . CYS A 271 ? 1.1602 1.0219 1.1790 -0.1582 -0.0824 0.1749  284 CYS A CB  
1776 S SG  . CYS A 271 ? 1.2676 1.0604 1.2789 -0.1494 -0.1124 0.1625  284 CYS A SG  
1777 N N   . TYR A 272 ? 1.2431 1.1350 1.3054 -0.1452 -0.0925 0.1243  285 TYR A N   
1778 C CA  . TYR A 272 ? 1.2444 1.1194 1.3170 -0.1550 -0.1082 0.1127  285 TYR A CA  
1779 C C   . TYR A 272 ? 1.1729 1.0079 1.2421 -0.1360 -0.1264 0.0901  285 TYR A C   
1780 O O   . TYR A 272 ? 1.1475 1.0007 1.2238 -0.1177 -0.1234 0.0686  285 TYR A O   
1781 C CB  . TYR A 272 ? 1.2224 1.1448 1.3130 -0.1597 -0.0982 0.1052  285 TYR A CB  
1782 C CG  . TYR A 272 ? 1.1608 1.1257 1.2559 -0.1388 -0.0817 0.0936  285 TYR A CG  
1783 C CD1 . TYR A 272 ? 1.1744 1.1688 1.2651 -0.1327 -0.0636 0.1053  285 TYR A CD1 
1784 C CD2 . TYR A 272 ? 1.1391 1.1150 1.2417 -0.1271 -0.0848 0.0716  285 TYR A CD2 
1785 C CE1 . TYR A 272 ? 1.0689 1.0978 1.1622 -0.1151 -0.0508 0.0956  285 TYR A CE1 
1786 C CE2 . TYR A 272 ? 1.0940 1.1061 1.1981 -0.1109 -0.0710 0.0630  285 TYR A CE2 
1787 C CZ  . TYR A 272 ? 1.0117 1.0486 1.1113 -0.1051 -0.0548 0.0754  285 TYR A CZ  
1788 O OH  . TYR A 272 ? 1.0351 1.1030 1.1343 -0.0898 -0.0433 0.0675  285 TYR A OH  
1789 N N   . PRO A 273 ? 1.1839 0.9646 1.2416 -0.1404 -0.1460 0.0950  286 PRO A N   
1790 C CA  . PRO A 273 ? 1.2212 0.9598 1.2765 -0.1222 -0.1666 0.0731  286 PRO A CA  
1791 C C   . PRO A 273 ? 1.2231 0.9508 1.2888 -0.1263 -0.1807 0.0539  286 PRO A C   
1792 O O   . PRO A 273 ? 1.1964 0.9572 1.2732 -0.1395 -0.1723 0.0542  286 PRO A O   
1793 C CB  . PRO A 273 ? 1.3543 1.0366 1.3927 -0.1306 -0.1846 0.0894  286 PRO A CB  
1794 C CG  . PRO A 273 ? 1.3602 1.0616 1.3894 -0.1481 -0.1688 0.1187  286 PRO A CG  
1795 C CD  . PRO A 273 ? 1.2769 1.0333 1.3211 -0.1620 -0.1496 0.1225  286 PRO A CD  
1796 N N   . ASN A 274 ? 1.3357 1.0168 1.3976 -0.1138 -0.2032 0.0364  287 ASN A N   
1797 C CA  . ASN A 274 ? 1.4969 1.1620 1.5662 -0.1135 -0.2191 0.0141  287 ASN A CA  
1798 C C   . ASN A 274 ? 1.6128 1.2090 1.6730 -0.1194 -0.2495 0.0125  287 ASN A C   
1799 O O   . ASN A 274 ? 1.6457 1.2033 1.6929 -0.1203 -0.2598 0.0271  287 ASN A O   
1800 C CB  . ASN A 274 ? 1.5707 1.2575 1.6467 -0.0836 -0.2149 -0.0175 287 ASN A CB  
1801 C CG  . ASN A 274 ? 1.6446 1.3936 1.7296 -0.0824 -0.1910 -0.0212 287 ASN A CG  
1802 O OD1 . ASN A 274 ? 1.7132 1.4880 1.8028 -0.1029 -0.1808 -0.0044 287 ASN A OD1 
1803 N ND2 . ASN A 274 ? 1.5519 1.3259 1.6398 -0.0587 -0.1830 -0.0435 287 ASN A ND2 
1804 N N   . ALA A 275 ? 1.6232 1.2025 1.6890 -0.1233 -0.2650 -0.0054 288 ALA A N   
1805 C CA  . ALA A 275 ? 1.5257 1.0373 1.5836 -0.1218 -0.2968 -0.0160 288 ALA A CA  
1806 C C   . ALA A 275 ? 1.5156 1.0160 1.5751 -0.0844 -0.3056 -0.0489 288 ALA A C   
1807 O O   . ALA A 275 ? 1.4948 1.0410 1.5610 -0.0637 -0.2860 -0.0607 288 ALA A O   
1808 C CB  . ALA A 275 ? 1.4999 0.9996 1.5630 -0.1422 -0.3099 -0.0224 288 ALA A CB  
1809 N N   . GLY A 276 ? 1.6604 1.1004 1.7138 -0.0761 -0.3355 -0.0640 289 GLY A N   
1810 C CA  . GLY A 276 ? 1.6005 1.0297 1.6575 -0.0396 -0.3462 -0.0983 289 GLY A CA  
1811 C C   . GLY A 276 ? 1.5140 0.9782 1.5825 -0.0267 -0.3403 -0.1313 289 GLY A C   
1812 O O   . GLY A 276 ? 1.3349 0.7720 1.4030 -0.0331 -0.3584 -0.1458 289 GLY A O   
1813 N N   . PHE A 298 ? 2.0950 1.5970 2.0604 -0.3678 -0.2482 0.2603  311 PHE A N   
1814 C CA  . PHE A 298 ? 2.1259 1.6134 2.0711 -0.3466 -0.2446 0.2662  311 PHE A CA  
1815 C C   . PHE A 298 ? 2.0229 1.5673 1.9636 -0.3581 -0.2142 0.2882  311 PHE A C   
1816 O O   . PHE A 298 ? 1.5411 1.1447 1.4969 -0.3375 -0.1896 0.2772  311 PHE A O   
1817 C CB  . PHE A 298 ? 2.0267 1.5198 1.9826 -0.3009 -0.2442 0.2344  311 PHE A CB  
1818 C CG  . PHE A 298 ? 2.1074 1.5283 2.0538 -0.2823 -0.2769 0.2177  311 PHE A CG  
1819 C CD1 . PHE A 298 ? 2.0515 1.4507 2.0115 -0.2785 -0.2950 0.1950  311 PHE A CD1 
1820 C CD2 . PHE A 298 ? 2.0449 1.4198 1.9688 -0.2673 -0.2905 0.2235  311 PHE A CD2 
1821 C CE1 . PHE A 298 ? 2.0193 1.3529 1.9711 -0.2590 -0.3256 0.1772  311 PHE A CE1 
1822 C CE2 . PHE A 298 ? 2.0593 1.3689 1.9762 -0.2476 -0.3219 0.2065  311 PHE A CE2 
1823 C CZ  . PHE A 298 ? 2.0336 1.3228 1.9648 -0.2429 -0.3393 0.1827  311 PHE A CZ  
1824 N N   . ALA A 299 ? 1.9775 1.5021 1.8958 -0.3914 -0.2168 0.3192  312 ALA A N   
1825 C CA  . ALA A 299 ? 1.8150 1.3890 1.7245 -0.4048 -0.1896 0.3414  312 ALA A CA  
1826 C C   . ALA A 299 ? 1.8066 1.3627 1.6928 -0.3793 -0.1876 0.3441  312 ALA A C   
1827 O O   . ALA A 299 ? 1.6833 1.1711 1.5441 -0.3769 -0.2121 0.3509  312 ALA A O   
1828 C CB  . ALA A 299 ? 1.8785 1.4403 1.7715 -0.4529 -0.1928 0.3737  312 ALA A CB  
1829 N N   . MET A 300 ? 1.7232 1.3398 1.6180 -0.3603 -0.1600 0.3384  313 MET A N   
1830 C CA  . MET A 300 ? 1.5259 1.1339 1.4025 -0.3333 -0.1562 0.3373  313 MET A CA  
1831 C C   . MET A 300 ? 1.6507 1.2516 1.4946 -0.3555 -0.1500 0.3684  313 MET A C   
1832 O O   . MET A 300 ? 1.5766 1.1864 1.4130 -0.3930 -0.1453 0.3912  313 MET A O   
1833 C CB  . MET A 300 ? 1.3049 0.9780 1.2030 -0.3043 -0.1306 0.3178  313 MET A CB  
1834 N N   . ASP A 301 ? 1.7268 1.3130 1.5509 -0.3328 -0.1500 0.3687  314 ASP A N   
1835 C CA  . ASP A 301 ? 1.7354 1.3174 1.5257 -0.3484 -0.1428 0.3956  314 ASP A CA  
1836 C C   . ASP A 301 ? 1.7523 1.4021 1.5477 -0.3318 -0.1113 0.3910  314 ASP A C   
1837 O O   . ASP A 301 ? 1.5913 1.2316 1.3696 -0.3099 -0.1107 0.3894  314 ASP A O   
1838 C CB  . ASP A 301 ? 1.7629 1.2705 1.5229 -0.3356 -0.1705 0.4006  314 ASP A CB  
1839 N N   . GLY A 302 ? 1.8329 1.5500 1.6522 -0.3419 -0.0866 0.3882  315 GLY A N   
1840 C CA  . GLY A 302 ? 1.6357 1.4193 1.4629 -0.3256 -0.0573 0.3815  315 GLY A CA  
1841 C C   . GLY A 302 ? 1.5430 1.3384 1.3890 -0.2845 -0.0554 0.3529  315 GLY A C   
1842 O O   . GLY A 302 ? 1.3806 1.2057 1.2218 -0.2648 -0.0396 0.3480  315 GLY A O   
1843 N N   . LEU A 303 ? 1.5642 1.3371 1.4308 -0.2727 -0.0714 0.3339  316 LEU A N   
1844 C CA  . LEU A 303 ? 1.5375 1.3128 1.4191 -0.2356 -0.0736 0.3070  316 LEU A CA  
1845 C C   . LEU A 303 ? 1.3959 1.2273 1.3104 -0.2252 -0.0574 0.2876  316 LEU A C   
1846 O O   . LEU A 303 ? 1.4170 1.2745 1.3392 -0.1988 -0.0468 0.2719  316 LEU A O   
1847 C CB  . LEU A 303 ? 1.5262 1.2382 1.4065 -0.2251 -0.1032 0.2959  316 LEU A CB  
1848 N N   . VAL A 304 ? 1.3466 1.1946 1.2790 -0.2466 -0.0568 0.2892  317 VAL A N   
1849 C CA  . VAL A 304 ? 1.2444 1.1397 1.2075 -0.2378 -0.0458 0.2707  317 VAL A CA  
1850 C C   . VAL A 304 ? 1.1514 1.1091 1.1269 -0.2558 -0.0234 0.2807  317 VAL A C   
1851 O O   . VAL A 304 ? 1.1844 1.1450 1.1517 -0.2855 -0.0209 0.3014  317 VAL A O   
1852 C CB  . VAL A 304 ? 1.2417 1.1097 1.2207 -0.2441 -0.0651 0.2589  317 VAL A CB  
1853 N N   . ASN A 305 ? 1.0913 1.0993 1.0864 -0.2376 -0.0077 0.2655  318 ASN A N   
1854 C CA  . ASN A 305 ? 1.0134 1.0854 1.0260 -0.2491 0.0122  0.2696  318 ASN A CA  
1855 C C   . ASN A 305 ? 0.9753 1.0712 1.0183 -0.2529 0.0089  0.2560  318 ASN A C   
1856 O O   . ASN A 305 ? 0.9448 1.0805 1.0043 -0.2738 0.0171  0.2630  318 ASN A O   
1857 C CB  . ASN A 305 ? 0.8984 1.0110 0.9091 -0.2254 0.0317  0.2634  318 ASN A CB  
1858 N N   . ILE A 306 ? 1.0236 1.0981 1.0739 -0.2327 -0.0028 0.2361  319 ILE A N   
1859 C CA  . ILE A 306 ? 1.0173 1.1024 1.0915 -0.2367 -0.0105 0.2227  319 ILE A CA  
1860 C C   . ILE A 306 ? 1.0279 1.0532 1.0961 -0.2356 -0.0343 0.2140  319 ILE A C   
1861 O O   . ILE A 306 ? 1.1076 1.0953 1.1598 -0.2175 -0.0422 0.2084  319 ILE A O   
1862 C CB  . ILE A 306 ? 0.9631 1.0884 1.0533 -0.2116 -0.0006 0.2037  319 ILE A CB  
1863 C CG1 . ILE A 306 ? 0.9338 1.1165 1.0301 -0.2099 0.0210  0.2105  319 ILE A CG1 
1864 C CG2 . ILE A 306 ? 0.9244 1.0588 1.0366 -0.2167 -0.0101 0.1903  319 ILE A CG2 
1865 C CD1 . ILE A 306 ? 0.9049 1.1227 1.0131 -0.1846 0.0294  0.1937  319 ILE A CD1 
1866 N N   . VAL A 307 ? 1.0910 1.1087 1.1727 -0.2544 -0.0465 0.2119  320 VAL A N   
1867 C CA  . VAL A 307 ? 1.1590 1.1192 1.2355 -0.2551 -0.0707 0.2027  320 VAL A CA  
1868 C C   . VAL A 307 ? 1.1902 1.1630 1.2880 -0.2539 -0.0782 0.1837  320 VAL A C   
1869 O O   . VAL A 307 ? 1.1133 1.1284 1.2298 -0.2690 -0.0707 0.1865  320 VAL A O   
1870 C CB  . VAL A 307 ? 1.0728 0.9920 1.1365 -0.2862 -0.0848 0.2232  320 VAL A CB  
1871 N N   . GLY A 308 ? 1.1216 1.0598 1.2167 -0.2355 -0.0930 0.1636  321 GLY A N   
1872 C CA  . GLY A 308 ? 1.0981 1.0410 1.2091 -0.2346 -0.1028 0.1445  321 GLY A CA  
1873 C C   . GLY A 308 ? 1.1296 1.0182 1.2322 -0.2219 -0.1244 0.1264  321 GLY A C   
1874 O O   . GLY A 308 ? 1.0848 0.9254 1.1712 -0.2211 -0.1366 0.1320  321 GLY A O   
1875 N N   . GLY A 309 ? 1.1849 1.0820 1.2981 -0.2111 -0.1297 0.1038  322 GLY A N   
1876 C CA  . GLY A 309 ? 1.2005 1.0546 1.3076 -0.1949 -0.1484 0.0815  322 GLY A CA  
1877 C C   . GLY A 309 ? 1.2359 1.1184 1.3481 -0.1694 -0.1405 0.0576  322 GLY A C   
1878 O O   . GLY A 309 ? 1.1243 1.0558 1.2451 -0.1670 -0.1238 0.0586  322 GLY A O   
1879 N N   . CYS A 310 ? 1.2067 1.0585 1.3128 -0.1502 -0.1531 0.0359  323 CYS A N   
1880 C CA  . CYS A 310 ? 1.2732 1.1491 1.3819 -0.1280 -0.1473 0.0116  323 CYS A CA  
1881 C C   . CYS A 310 ? 1.2416 1.0858 1.3508 -0.1241 -0.1681 -0.0126 323 CYS A C   
1882 O O   . CYS A 310 ? 1.2660 1.0969 1.3804 -0.1437 -0.1804 -0.0106 323 CYS A O   
1883 C CB  . CYS A 310 ? 1.4199 1.3028 1.5206 -0.1043 -0.1361 0.0084  323 CYS A CB  
1884 S SG  . CYS A 310 ? 1.5954 1.4935 1.6951 -0.0762 -0.1335 -0.0233 323 CYS A SG  
1885 N N   . CYS A 311 ? 1.2189 1.0525 1.3233 -0.0998 -0.1722 -0.0360 324 CYS A N   
1886 C CA  . CYS A 311 ? 1.2269 1.0324 1.3310 -0.0928 -0.1914 -0.0624 324 CYS A CA  
1887 C C   . CYS A 311 ? 1.1882 0.9372 1.2894 -0.1080 -0.2158 -0.0568 324 CYS A C   
1888 O O   . CYS A 311 ? 1.2539 0.9659 1.3478 -0.1054 -0.2246 -0.0472 324 CYS A O   
1889 C CB  . CYS A 311 ? 1.2428 1.0449 1.3426 -0.0633 -0.1918 -0.0870 324 CYS A CB  
1890 N N   . GLY A 312 ? 1.2002 0.9412 1.3061 -0.1246 -0.2278 -0.0620 325 GLY A N   
1891 C CA  . GLY A 312 ? 1.2720 0.9583 1.3745 -0.1430 -0.2525 -0.0561 325 GLY A CA  
1892 C C   . GLY A 312 ? 1.3239 1.0194 1.4320 -0.1773 -0.2497 -0.0271 325 GLY A C   
1893 O O   . GLY A 312 ? 1.4513 1.1135 1.5596 -0.1985 -0.2690 -0.0240 325 GLY A O   
1894 N N   . SER A 313 ? 1.2667 1.0082 1.3796 -0.1829 -0.2261 -0.0066 326 SER A N   
1895 C CA  . SER A 313 ? 1.2206 0.9810 1.3410 -0.2141 -0.2199 0.0206  326 SER A CA  
1896 C C   . SER A 313 ? 1.2218 1.0134 1.3567 -0.2292 -0.2207 0.0142  326 SER A C   
1897 O O   . SER A 313 ? 1.2253 1.0566 1.3662 -0.2149 -0.2098 -0.0007 326 SER A O   
1898 C CB  . SER A 313 ? 1.1786 0.9831 1.3004 -0.2114 -0.1940 0.0402  326 SER A CB  
1899 N N   . THR A 314 ? 1.2965 1.0689 1.4361 -0.2593 -0.2346 0.0262  327 THR A N   
1900 C CA  . THR A 314 ? 1.2670 1.0688 1.4222 -0.2784 -0.2373 0.0235  327 THR A CA  
1901 C C   . THR A 314 ? 1.2598 1.0974 1.4275 -0.3075 -0.2247 0.0529  327 THR A C   
1902 O O   . THR A 314 ? 1.2668 1.0985 1.4277 -0.3137 -0.2164 0.0741  327 THR A O   
1903 C CB  . THR A 314 ? 1.3273 1.0774 1.4793 -0.2915 -0.2666 0.0104  327 THR A CB  
1904 O OG1 . THR A 314 ? 1.3766 1.0773 1.5201 -0.3141 -0.2812 0.0302  327 THR A OG1 
1905 C CG2 . THR A 314 ? 1.3114 1.0292 1.4518 -0.2612 -0.2789 -0.0214 327 THR A CG2 
1906 N N   . PRO A 315 ? 1.2696 1.1477 1.4559 -0.3249 -0.2229 0.0536  328 PRO A N   
1907 C CA  . PRO A 315 ? 1.3002 1.2139 1.5009 -0.3546 -0.2125 0.0802  328 PRO A CA  
1908 C C   . PRO A 315 ? 1.3919 1.2589 1.5851 -0.3861 -0.2277 0.0999  328 PRO A C   
1909 O O   . PRO A 315 ? 1.3965 1.2843 1.5931 -0.4068 -0.2158 0.1252  328 PRO A O   
1910 C CB  . PRO A 315 ? 1.2834 1.2410 1.5060 -0.3658 -0.2142 0.0717  328 PRO A CB  
1911 C CG  . PRO A 315 ? 1.2093 1.1741 1.4271 -0.3342 -0.2138 0.0447  328 PRO A CG  
1912 C CD  . PRO A 315 ? 1.2509 1.1535 1.4463 -0.3160 -0.2268 0.0308  328 PRO A CD  
1913 N N   . ASP A 316 ? 1.4605 1.2642 1.6419 -0.3894 -0.2543 0.0880  329 ASP A N   
1914 C CA  . ASP A 316 ? 1.5160 1.2635 1.6857 -0.4181 -0.2733 0.1057  329 ASP A CA  
1915 C C   . ASP A 316 ? 1.5463 1.2631 1.6953 -0.4100 -0.2680 0.1219  329 ASP A C   
1916 O O   . ASP A 316 ? 1.5627 1.2547 1.7026 -0.4382 -0.2733 0.1471  329 ASP A O   
1917 C CB  . ASP A 316 ? 1.5700 1.2529 1.7306 -0.4183 -0.3053 0.0851  329 ASP A CB  
1918 C CG  . ASP A 316 ? 1.6919 1.3255 1.8464 -0.4578 -0.3281 0.1035  329 ASP A CG  
1919 O OD1 . ASP A 316 ? 1.8096 1.4632 1.9678 -0.4880 -0.3181 0.1330  329 ASP A OD1 
1920 O OD2 . ASP A 316 ? 1.8339 1.4079 1.9789 -0.4593 -0.3566 0.0879  329 ASP A OD2 
1921 N N   . HIS A 317 ? 1.4849 1.2035 1.6254 -0.3729 -0.2582 0.1080  330 HIS A N   
1922 C CA  . HIS A 317 ? 1.4835 1.1825 1.6062 -0.3621 -0.2507 0.1222  330 HIS A CA  
1923 C C   . HIS A 317 ? 1.4612 1.2175 1.5909 -0.3757 -0.2236 0.1476  330 HIS A C   
1924 O O   . HIS A 317 ? 1.4806 1.2207 1.5990 -0.3978 -0.2231 0.1730  330 HIS A O   
1925 C CB  . HIS A 317 ? 1.4033 1.0991 1.5188 -0.3193 -0.2454 0.0996  330 HIS A CB  
1926 C CG  . HIS A 317 ? 1.3473 0.9807 1.4515 -0.3019 -0.2716 0.0760  330 HIS A CG  
1927 N ND1 . HIS A 317 ? 1.3649 0.9880 1.4762 -0.3001 -0.2872 0.0523  330 HIS A ND1 
1928 C CD2 . HIS A 317 ? 1.3200 0.9000 1.4067 -0.2835 -0.2853 0.0708  330 HIS A CD2 
1929 C CE1 . HIS A 317 ? 1.3670 0.9333 1.4657 -0.2811 -0.3089 0.0327  330 HIS A CE1 
1930 N NE2 . HIS A 317 ? 1.3830 0.9227 1.4676 -0.2703 -0.3085 0.0434  330 HIS A NE2 
1931 N N   . ILE A 318 ? 1.4574 1.2800 1.6046 -0.3622 -0.2019 0.1398  331 ILE A N   
1932 C CA  . ILE A 318 ? 1.4544 1.3376 1.6103 -0.3688 -0.1751 0.1587  331 ILE A CA  
1933 C C   . ILE A 318 ? 1.5207 1.4160 1.6821 -0.4103 -0.1738 0.1856  331 ILE A C   
1934 O O   . ILE A 318 ? 1.6510 1.5705 1.8078 -0.4187 -0.1567 0.2062  331 ILE A O   
1935 C CB  . ILE A 318 ? 1.3690 1.3190 1.5465 -0.3538 -0.1584 0.1449  331 ILE A CB  
1936 N N   . ARG A 319 ? 1.5116 1.3917 1.6824 -0.4368 -0.1917 0.1850  332 ARG A N   
1937 C CA  . ARG A 319 ? 1.5084 1.3945 1.6836 -0.4805 -0.1937 0.2105  332 ARG A CA  
1938 C C   . ARG A 319 ? 1.5733 1.4026 1.7196 -0.4945 -0.2018 0.2324  332 ARG A C   
1939 O O   . ARG A 319 ? 1.7115 1.5650 1.8544 -0.5177 -0.1878 0.2578  332 ARG A O   
1940 C CB  . ARG A 319 ? 1.6221 1.4903 1.8096 -0.5053 -0.2162 0.2035  332 ARG A CB  
1941 N N   . GLU A 320 ? 1.6097 1.3645 1.7348 -0.4796 -0.2250 0.2219  333 GLU A N   
1942 C CA  . GLU A 320 ? 1.5534 1.2460 1.6483 -0.4871 -0.2366 0.2401  333 GLU A CA  
1943 C C   . GLU A 320 ? 1.4913 1.2107 1.5750 -0.4694 -0.2128 0.2514  333 GLU A C   
1944 O O   . GLU A 320 ? 1.5153 1.2205 1.5804 -0.4900 -0.2099 0.2776  333 GLU A O   
1945 C CB  . GLU A 320 ? 1.5553 1.1686 1.6332 -0.4654 -0.2660 0.2205  333 GLU A CB  
1946 N N   . ILE A 321 ? 1.4480 1.2047 1.5412 -0.4324 -0.1965 0.2319  334 ILE A N   
1947 C CA  . ILE A 321 ? 1.4317 1.2205 1.5170 -0.4141 -0.1728 0.2399  334 ILE A CA  
1948 C C   . ILE A 321 ? 1.4474 1.3014 1.5437 -0.4393 -0.1485 0.2616  334 ILE A C   
1949 O O   . ILE A 321 ? 1.4939 1.3526 1.5737 -0.4459 -0.1365 0.2816  334 ILE A O   
1950 C CB  . ILE A 321 ? 1.3926 1.2115 1.4879 -0.3718 -0.1607 0.2138  334 ILE A CB  
1951 C CG1 . ILE A 321 ? 1.4121 1.1710 1.4911 -0.3429 -0.1791 0.1958  334 ILE A CG1 
1952 C CG2 . ILE A 321 ? 1.3939 1.2658 1.4890 -0.3589 -0.1324 0.2224  334 ILE A CG2 
1953 C CD1 . ILE A 321 ? 1.3952 1.1185 1.4805 -0.3389 -0.2027 0.1732  334 ILE A CD1 
1954 N N   . ALA A 322 ? 1.4169 1.3223 1.5410 -0.4526 -0.1418 0.2567  335 ALA A N   
1955 C CA  . ALA A 322 ? 1.3906 1.3682 1.5314 -0.4734 -0.1181 0.2726  335 ALA A CA  
1956 C C   . ALA A 322 ? 1.4480 1.4119 1.5757 -0.5162 -0.1203 0.3028  335 ALA A C   
1957 O O   . ALA A 322 ? 1.3760 1.3762 1.4978 -0.5251 -0.0998 0.3207  335 ALA A O   
1958 C CB  . ALA A 322 ? 1.3981 1.4283 1.5727 -0.4787 -0.1154 0.2593  335 ALA A CB  
1959 N N   . GLU A 323 ? 1.5339 1.4448 1.6556 -0.5431 -0.1457 0.3082  336 GLU A N   
1960 C CA  . GLU A 323 ? 1.5878 1.4783 1.6948 -0.5884 -0.1515 0.3381  336 GLU A CA  
1961 C C   . GLU A 323 ? 1.7169 1.5567 1.7856 -0.5868 -0.1542 0.3564  336 GLU A C   
1962 O O   . GLU A 323 ? 1.8598 1.7050 1.9138 -0.6199 -0.1474 0.3843  336 GLU A O   
1963 C CB  . GLU A 323 ? 1.6294 1.4667 1.7373 -0.6158 -0.1819 0.3375  336 GLU A CB  
1964 N N   . ALA A 324 ? 1.6760 1.4688 1.7285 -0.5491 -0.1641 0.3408  337 ALA A N   
1965 C CA  . ALA A 324 ? 1.6569 1.4007 1.6740 -0.5419 -0.1686 0.3552  337 ALA A CA  
1966 C C   . ALA A 324 ? 1.6327 1.4348 1.6462 -0.5308 -0.1372 0.3644  337 ALA A C   
1967 O O   . ALA A 324 ? 1.7192 1.5154 1.7089 -0.5522 -0.1311 0.3901  337 ALA A O   
1968 C CB  . ALA A 324 ? 1.6126 1.2948 1.6182 -0.5033 -0.1890 0.3327  337 ALA A CB  
1969 N N   . VAL A 325 ? 1.5592 1.4161 1.5945 -0.4980 -0.1182 0.3433  338 VAL A N   
1970 C CA  . VAL A 325 ? 1.4724 1.3842 1.5058 -0.4821 -0.0896 0.3473  338 VAL A CA  
1971 C C   . VAL A 325 ? 1.4521 1.4388 1.5009 -0.5107 -0.0653 0.3633  338 VAL A C   
1972 O O   . VAL A 325 ? 1.3634 1.3944 1.4074 -0.5024 -0.0420 0.3695  338 VAL A O   
1973 C CB  . VAL A 325 ? 1.3079 1.2513 1.3592 -0.4380 -0.0792 0.3191  338 VAL A CB  
1974 N N   . LYS A 326 ? 1.5156 1.5175 1.5834 -0.5439 -0.0713 0.3688  339 LYS A N   
1975 C CA  . LYS A 326 ? 1.5513 1.6319 1.6411 -0.5718 -0.0494 0.3806  339 LYS A CA  
1976 C C   . LYS A 326 ? 1.6012 1.7102 1.6705 -0.5874 -0.0282 0.4042  339 LYS A C   
1977 O O   . LYS A 326 ? 1.6017 1.7858 1.6870 -0.5789 -0.0015 0.4014  339 LYS A O   
1978 C CB  . LYS A 326 ? 1.5167 1.5882 1.6191 -0.6148 -0.0650 0.3905  339 LYS A CB  
1979 N N   . ASN A 327 ? 1.6130 1.6612 1.6459 -0.6095 -0.0411 0.4269  340 ASN A N   
1980 C CA  . ASN A 327 ? 1.6539 1.7234 1.6621 -0.6308 -0.0232 0.4524  340 ASN A CA  
1981 C C   . ASN A 327 ? 1.7058 1.7392 1.6791 -0.6020 -0.0212 0.4543  340 ASN A C   
1982 O O   . ASN A 327 ? 1.7832 1.8259 1.7301 -0.6181 -0.0086 0.4755  340 ASN A O   
1983 C CB  . ASN A 327 ? 1.7798 1.8120 1.7680 -0.6837 -0.0375 0.4818  340 ASN A CB  
1984 N N   . CYS A 328 ? 1.6974 1.6927 1.6705 -0.5606 -0.0334 0.4320  341 CYS A N   
1985 C CA  . CYS A 328 ? 1.6445 1.6019 1.5869 -0.5322 -0.0349 0.4318  341 CYS A CA  
1986 C C   . CYS A 328 ? 1.5719 1.5968 1.5183 -0.5091 -0.0044 0.4260  341 CYS A C   
1987 O O   . CYS A 328 ? 1.4614 1.5509 1.4405 -0.4950 0.0124  0.4092  341 CYS A O   
1988 C CB  . CYS A 328 ? 1.5849 1.4861 1.5293 -0.4960 -0.0571 0.4082  341 CYS A CB  
1989 S SG  . CYS A 328 ? 1.5724 1.3855 1.5089 -0.5158 -0.0963 0.4107  341 CYS A SG  
1990 N N   . LYS A 329 ? 1.6008 1.6079 1.5128 -0.5050 0.0007  0.4395  342 LYS A N   
1991 C CA  . LYS A 329 ? 1.4942 1.5574 1.4043 -0.4829 0.0276  0.4344  342 LYS A CA  
1992 C C   . LYS A 329 ? 1.3997 1.4511 1.3164 -0.4343 0.0248  0.4082  342 LYS A C   
1993 O O   . LYS A 329 ? 1.2560 1.2418 1.1533 -0.4185 0.0044  0.4053  342 LYS A O   
1994 C CB  . LYS A 329 ? 1.4691 1.5163 1.3368 -0.4990 0.0333  0.4593  342 LYS A CB  
1995 N N   . PRO A 330 ? 1.3962 1.5112 1.3402 -0.4106 0.0442  0.3891  343 PRO A N   
1996 C CA  . PRO A 330 ? 1.3086 1.4159 1.2588 -0.3671 0.0425  0.3651  343 PRO A CA  
1997 C C   . PRO A 330 ? 1.2486 1.3264 1.1660 -0.3466 0.0429  0.3683  343 PRO A C   
1998 O O   . PRO A 330 ? 1.2366 1.3187 1.1278 -0.3620 0.0520  0.3873  343 PRO A O   
1999 C CB  . PRO A 330 ? 1.2550 1.4407 1.2357 -0.3529 0.0652  0.3501  343 PRO A CB  
2000 C CG  . PRO A 330 ? 1.3379 1.5657 1.3398 -0.3870 0.0717  0.3599  343 PRO A CG  
2001 C CD  . PRO A 330 ? 1.3956 1.5912 1.3689 -0.4238 0.0661  0.3876  343 PRO A CD  
2002 N N   . ARG A 331 ? 1.1587 1.2087 1.0778 -0.3129 0.0331  0.3493  344 ARG A N   
2003 C CA  . ARG A 331 ? 1.1190 1.1428 1.0115 -0.2895 0.0319  0.3483  344 ARG A CA  
2004 C C   . ARG A 331 ? 1.1314 1.2108 1.0184 -0.2803 0.0576  0.3491  344 ARG A C   
2005 O O   . ARG A 331 ? 1.0882 1.2263 1.0001 -0.2758 0.0745  0.3392  344 ARG A O   
2006 C CB  . ARG A 331 ? 1.0261 1.0231 0.9294 -0.2558 0.0191  0.3246  344 ARG A CB  
2007 C CG  . ARG A 331 ? 0.9693 0.9619 0.8571 -0.2256 0.0234  0.3163  344 ARG A CG  
2008 C CD  . ARG A 331 ? 0.9654 0.9303 0.8649 -0.1978 0.0089  0.2942  344 ARG A CD  
2009 N NE  . ARG A 331 ? 0.9177 0.8887 0.8088 -0.1691 0.0150  0.2835  344 ARG A NE  
2010 C CZ  . ARG A 331 ? 0.9218 0.9379 0.8259 -0.1516 0.0313  0.2705  344 ARG A CZ  
2011 N NH1 . ARG A 331 ? 0.9397 1.0015 0.8671 -0.1577 0.0435  0.2658  344 ARG A NH1 
2012 N NH2 . ARG A 331 ? 0.9118 0.9262 0.8054 -0.1278 0.0340  0.2621  344 ARG A NH2 
2013 N N   . VAL A 332 ? 1.2545 1.3139 1.1081 -0.2773 0.0590  0.3604  345 VAL A N   
2014 C CA  . VAL A 332 ? 1.2561 1.3601 1.0993 -0.2649 0.0810  0.3592  345 VAL A CA  
2015 C C   . VAL A 332 ? 1.1572 1.2474 0.9985 -0.2267 0.0775  0.3401  345 VAL A C   
2016 O O   . VAL A 332 ? 1.2916 1.3335 1.1084 -0.2177 0.0639  0.3436  345 VAL A O   
2017 C CB  . VAL A 332 ? 1.2296 1.3215 1.0337 -0.2855 0.0852  0.3834  345 VAL A CB  
2018 N N   . PRO A 333 ? 1.0738 1.2051 0.9406 -0.2048 0.0883  0.3200  346 PRO A N   
2019 C CA  . PRO A 333 ? 1.1321 1.2480 0.9962 -0.1716 0.0838  0.3029  346 PRO A CA  
2020 C C   . PRO A 333 ? 1.1093 1.2267 0.9433 -0.1608 0.0924  0.3078  346 PRO A C   
2021 O O   . PRO A 333 ? 1.2300 1.3891 1.0572 -0.1680 0.1107  0.3141  346 PRO A O   
2022 C CB  . PRO A 333 ? 0.9752 1.1376 0.8707 -0.1551 0.0943  0.2835  346 PRO A CB  
2023 C CG  . PRO A 333 ? 0.9985 1.1913 0.9172 -0.1787 0.0988  0.2884  346 PRO A CG  
2024 C CD  . PRO A 333 ? 1.0274 1.2179 0.9258 -0.2086 0.1030  0.3119  346 PRO A CD  
2025 N N   . PRO A 334 ? 1.2268 1.3010 1.0433 -0.1435 0.0790  0.3040  347 PRO A N   
2026 C CA  . PRO A 334 ? 1.2188 1.2951 1.0077 -0.1306 0.0862  0.3059  347 PRO A CA  
2027 C C   . PRO A 334 ? 1.1908 1.3081 0.9930 -0.1061 0.1001  0.2872  347 PRO A C   
2028 O O   . PRO A 334 ? 1.2776 1.3870 1.0961 -0.0864 0.0931  0.2704  347 PRO A O   
2029 C CB  . PRO A 334 ? 1.1952 1.2138 0.9684 -0.1188 0.0648  0.3048  347 PRO A CB  
2030 C CG  . PRO A 334 ? 1.1462 1.1477 0.9477 -0.1123 0.0512  0.2913  347 PRO A CG  
2031 C CD  . PRO A 334 ? 1.2490 1.2740 1.0713 -0.1340 0.0569  0.2961  347 PRO A CD  
2032 N N   . ALA A 335 ? 1.4137 1.5743 1.2081 -0.1076 0.1193  0.2898  348 ALA A N   
2033 C CA  . ALA A 335 ? 1.4566 1.6547 1.2612 -0.0838 0.1315  0.2721  348 ALA A CA  
2034 C C   . ALA A 335 ? 1.4455 1.6220 1.2260 -0.0613 0.1277  0.2653  348 ALA A C   
2035 O O   . ALA A 335 ? 1.4846 1.6817 1.2709 -0.0399 0.1338  0.2499  348 ALA A O   
2036 C CB  . ALA A 335 ? 1.3547 1.6106 1.1629 -0.0922 0.1529  0.2748  348 ALA A CB  
2037 N N   . THR A 336 ? 1.2986 1.4323 1.0519 -0.0664 0.1162  0.2767  349 THR A N   
2038 C CA  . THR A 336 ? 1.4035 1.5144 1.1329 -0.0472 0.1105  0.2715  349 THR A CA  
2039 C C   . THR A 336 ? 1.3427 1.4031 1.0725 -0.0396 0.0885  0.2685  349 THR A C   
2040 O O   . THR A 336 ? 1.4912 1.5222 1.1964 -0.0327 0.0792  0.2717  349 THR A O   
2041 C CB  . THR A 336 ? 1.3902 1.4986 1.0814 -0.0574 0.1166  0.2871  349 THR A CB  
2042 N N   . ALA A 337 ? 1.1422 1.1951 0.9005 -0.0400 0.0800  0.2611  350 ALA A N   
2043 C CA  . ALA A 337 ? 1.2287 1.2385 0.9915 -0.0332 0.0596  0.2563  350 ALA A CA  
2044 C C   . ALA A 337 ? 1.0641 1.0712 0.8305 -0.0086 0.0556  0.2390  350 ALA A C   
2045 O O   . ALA A 337 ? 1.1064 1.1367 0.8939 0.0015  0.0614  0.2248  350 ALA A O   
2046 C CB  . ALA A 337 ? 1.2986 1.3038 1.0895 -0.0422 0.0526  0.2529  350 ALA A CB  
2047 N N   . PHE A 338 ? 1.0373 1.0150 0.7824 -0.0005 0.0447  0.2409  351 PHE A N   
2048 C CA  . PHE A 338 ? 1.0290 1.0031 0.7731 0.0203  0.0403  0.2266  351 PHE A CA  
2049 C C   . PHE A 338 ? 1.0939 1.1021 0.8349 0.0304  0.0563  0.2187  351 PHE A C   
2050 O O   . PHE A 338 ? 0.9738 0.9959 0.7324 0.0421  0.0582  0.2042  351 PHE A O   
2051 C CB  . PHE A 338 ? 1.0302 0.9952 0.8015 0.0289  0.0294  0.2118  351 PHE A CB  
2052 C CG  . PHE A 338 ? 1.1029 1.0324 0.8776 0.0238  0.0113  0.2157  351 PHE A CG  
2053 C CD1 . PHE A 338 ? 1.0676 0.9658 0.8247 0.0299  -0.0035 0.2190  351 PHE A CD1 
2054 C CD2 . PHE A 338 ? 1.0378 0.9640 0.8330 0.0138  0.0075  0.2152  351 PHE A CD2 
2055 C CE1 . PHE A 338 ? 1.0114 0.8752 0.7720 0.0276  -0.0223 0.2213  351 PHE A CE1 
2056 C CE2 . PHE A 338 ? 1.1409 1.0314 0.9386 0.0109  -0.0109 0.2172  351 PHE A CE2 
2057 C CZ  . PHE A 338 ? 1.1073 0.9663 0.8879 0.0185  -0.0261 0.2201  351 PHE A CZ  
2058 N N   . GLU A 339 ? 1.1261 1.1465 0.8429 0.0259  0.0669  0.2283  352 GLU A N   
2059 C CA  . GLU A 339 ? 1.1347 1.1907 0.8485 0.0345  0.0831  0.2211  352 GLU A CA  
2060 C C   . GLU A 339 ? 1.1354 1.1851 0.8420 0.0550  0.0788  0.2073  352 GLU A C   
2061 O O   . GLU A 339 ? 1.0868 1.1545 0.8087 0.0661  0.0832  0.1941  352 GLU A O   
2062 C CB  . GLU A 339 ? 1.1691 1.2406 0.8566 0.0245  0.0955  0.2340  352 GLU A CB  
2063 N N   . GLY A 340 ? 1.0771 1.0997 0.7596 0.0591  0.0689  0.2107  353 GLY A N   
2064 C CA  . GLY A 340 ? 1.0506 1.0647 0.7235 0.0764  0.0632  0.1988  353 GLY A CA  
2065 C C   . GLY A 340 ? 0.9764 0.9641 0.6616 0.0815  0.0460  0.1924  353 GLY A C   
2066 O O   . GLY A 340 ? 1.0272 0.9954 0.6967 0.0891  0.0357  0.1902  353 GLY A O   
2067 N N   . HIS A 341 ? 0.9383 0.9276 0.6523 0.0773  0.0428  0.1886  354 HIS A N   
2068 C CA  . HIS A 341 ? 0.8923 0.8629 0.6219 0.0820  0.0280  0.1805  354 HIS A CA  
2069 C C   . HIS A 341 ? 0.9072 0.8938 0.6589 0.0893  0.0305  0.1656  354 HIS A C   
2070 O O   . HIS A 341 ? 0.7836 0.7920 0.5483 0.0867  0.0408  0.1633  354 HIS A O   
2071 C CB  . HIS A 341 ? 0.9469 0.9029 0.6905 0.0714  0.0199  0.1869  354 HIS A CB  
2072 C CG  . HIS A 341 ? 0.9860 0.9155 0.7073 0.0646  0.0108  0.2014  354 HIS A CG  
2073 N ND1 . HIS A 341 ? 1.1108 1.0440 0.8091 0.0540  0.0198  0.2164  354 HIS A ND1 
2074 C CD2 . HIS A 341 ? 0.9911 0.8902 0.7087 0.0669  -0.0071 0.2033  354 HIS A CD2 
2075 C CE1 . HIS A 341 ? 1.1007 1.0038 0.7793 0.0485  0.0073  0.2284  354 HIS A CE1 
2076 N NE2 . HIS A 341 ? 1.0245 0.9053 0.7148 0.0572  -0.0100 0.2205  354 HIS A NE2 
2077 N N   . MET A 342 ? 0.9129 0.8894 0.6681 0.0975  0.0203  0.1558  355 MET A N   
2078 C CA  . MET A 342 ? 0.8649 0.8527 0.6420 0.1007  0.0199  0.1430  355 MET A CA  
2079 C C   . MET A 342 ? 0.8475 0.8310 0.6482 0.0953  0.0132  0.1405  355 MET A C   
2080 O O   . MET A 342 ? 0.8395 0.8056 0.6419 0.0967  0.0010  0.1400  355 MET A O   
2081 C CB  . MET A 342 ? 0.8130 0.7946 0.5850 0.1091  0.0122  0.1337  355 MET A CB  
2082 C CG  . MET A 342 ? 0.7382 0.7334 0.5271 0.1102  0.0139  0.1223  355 MET A CG  
2083 S SD  . MET A 342 ? 0.8211 0.8098 0.6000 0.1166  0.0058  0.1134  355 MET A SD  
2084 C CE  . MET A 342 ? 0.9810 0.9681 0.7830 0.1145  -0.0057 0.1058  355 MET A CE  
2085 N N   . LEU A 343 ? 0.8665 0.8656 0.6848 0.0901  0.0202  0.1379  356 LEU A N   
2086 C CA  . LEU A 343 ? 0.8654 0.8616 0.7056 0.0851  0.0144  0.1338  356 LEU A CA  
2087 C C   . LEU A 343 ? 0.8483 0.8547 0.7054 0.0895  0.0118  0.1189  356 LEU A C   
2088 O O   . LEU A 343 ? 0.7641 0.7872 0.6245 0.0897  0.0193  0.1142  356 LEU A O   
2089 C CB  . LEU A 343 ? 0.9794 0.9867 0.8286 0.0752  0.0225  0.1398  356 LEU A CB  
2090 N N   . LEU A 344 ? 0.8737 0.8705 0.7404 0.0930  0.0006  0.1114  357 LEU A N   
2091 C CA  . LEU A 344 ? 0.7905 0.8002 0.6758 0.0949  -0.0015 0.0966  357 LEU A CA  
2092 C C   . LEU A 344 ? 0.7274 0.7325 0.6317 0.0932  -0.0082 0.0908  357 LEU A C   
2093 O O   . LEU A 344 ? 0.7595 0.7462 0.6608 0.0912  -0.0140 0.0988  357 LEU A O   
2094 C CB  . LEU A 344 ? 0.7963 0.8044 0.6792 0.1016  -0.0091 0.0894  357 LEU A CB  
2095 C CG  . LEU A 344 ? 0.8178 0.8253 0.6801 0.1041  -0.0058 0.0937  357 LEU A CG  
2096 C CD1 . LEU A 344 ? 0.9071 0.9141 0.7712 0.1090  -0.0152 0.0854  357 LEU A CD1 
2097 C CD2 . LEU A 344 ? 0.7678 0.7903 0.6278 0.1009  0.0046  0.0924  357 LEU A CD2 
2098 N N   . SER A 345 ? 0.6466 0.6673 0.5688 0.0936  -0.0082 0.0768  358 SER A N   
2099 C CA  . SER A 345 ? 0.7516 0.7691 0.6925 0.0946  -0.0158 0.0670  358 SER A CA  
2100 C C   . SER A 345 ? 0.7870 0.8255 0.7446 0.0978  -0.0164 0.0489  358 SER A C   
2101 O O   . SER A 345 ? 0.9737 1.0313 0.9298 0.0939  -0.0077 0.0456  358 SER A O   
2102 C CB  . SER A 345 ? 0.6647 0.6821 0.6106 0.0862  -0.0111 0.0713  358 SER A CB  
2103 N N   . GLY A 346 ? 0.7117 0.7463 0.6841 0.1051  -0.0274 0.0372  359 GLY A N   
2104 C CA  . GLY A 346 ? 0.7323 0.7894 0.7247 0.1074  -0.0276 0.0176  359 GLY A CA  
2105 C C   . GLY A 346 ? 0.7842 0.8325 0.7874 0.1066  -0.0313 0.0127  359 GLY A C   
2106 O O   . GLY A 346 ? 0.7349 0.7811 0.7327 0.0979  -0.0244 0.0209  359 GLY A O   
2107 N N   . LEU A 347 ? 0.7146 0.7574 0.7334 0.1162  -0.0434 -0.0012 360 LEU A N   
2108 C CA  . LEU A 347 ? 0.7381 0.7626 0.7647 0.1168  -0.0515 -0.0051 360 LEU A CA  
2109 C C   . LEU A 347 ? 0.7918 0.7786 0.8045 0.1151  -0.0608 0.0131  360 LEU A C   
2110 O O   . LEU A 347 ? 0.7642 0.7330 0.7743 0.1078  -0.0630 0.0202  360 LEU A O   
2111 C CB  . LEU A 347 ? 0.7732 0.8032 0.8209 0.1300  -0.0630 -0.0284 360 LEU A CB  
2112 C CG  . LEU A 347 ? 0.7234 0.7935 0.7861 0.1310  -0.0540 -0.0492 360 LEU A CG  
2113 C CD1 . LEU A 347 ? 0.7397 0.8148 0.8240 0.1462  -0.0665 -0.0734 360 LEU A CD1 
2114 C CD2 . LEU A 347 ? 0.6583 0.7394 0.7175 0.1189  -0.0425 -0.0482 360 LEU A CD2 
2115 N N   . GLU A 348 ? 0.8452 0.8205 0.8481 0.1205  -0.0667 0.0210  361 GLU A N   
2116 C CA  . GLU A 348 ? 0.9138 0.8544 0.8986 0.1175  -0.0748 0.0402  361 GLU A CA  
2117 C C   . GLU A 348 ? 0.8600 0.8062 0.8240 0.1101  -0.0626 0.0576  361 GLU A C   
2118 O O   . GLU A 348 ? 0.8729 0.8433 0.8368 0.1116  -0.0536 0.0530  361 GLU A O   
2119 C CB  . GLU A 348 ? 0.9399 0.8586 0.9274 0.1310  -0.0942 0.0353  361 GLU A CB  
2120 C CG  . GLU A 348 ? 0.9743 0.8838 0.9821 0.1409  -0.1087 0.0168  361 GLU A CG  
2121 C CD  . GLU A 348 ? 1.0457 0.9307 1.0561 0.1562  -0.1306 0.0120  361 GLU A CD  
2122 O OE1 . GLU A 348 ? 1.1707 1.0257 1.1603 0.1537  -0.1389 0.0306  361 GLU A OE1 
2123 O OE2 . GLU A 348 ? 1.0544 0.9512 1.0874 0.1709  -0.1400 -0.0108 361 GLU A OE2 
2124 N N   . PRO A 349 ? 0.8796 0.8035 0.8248 0.1015  -0.0626 0.0773  362 PRO A N   
2125 C CA  . PRO A 349 ? 0.8159 0.7463 0.7405 0.0956  -0.0507 0.0924  362 PRO A CA  
2126 C C   . PRO A 349 ? 0.7883 0.7113 0.7006 0.1044  -0.0574 0.0945  362 PRO A C   
2127 O O   . PRO A 349 ? 0.8158 0.7196 0.7309 0.1128  -0.0737 0.0906  362 PRO A O   
2128 C CB  . PRO A 349 ? 0.7643 0.6740 0.6745 0.0836  -0.0505 0.1110  362 PRO A CB  
2129 C CG  . PRO A 349 ? 0.8129 0.6907 0.7273 0.0868  -0.0698 0.1094  362 PRO A CG  
2130 C CD  . PRO A 349 ? 0.8555 0.7460 0.7960 0.0964  -0.0747 0.0865  362 PRO A CD  
2131 N N   . PHE A 350 ? 0.7587 0.6961 0.6574 0.1032  -0.0464 0.0997  363 PHE A N   
2132 C CA  . PHE A 350 ? 0.8776 0.8071 0.7609 0.1099  -0.0523 0.1031  363 PHE A CA  
2133 C C   . PHE A 350 ? 0.8878 0.8192 0.7459 0.1043  -0.0406 0.1175  363 PHE A C   
2134 O O   . PHE A 350 ? 0.8219 0.7740 0.6790 0.1032  -0.0284 0.1145  363 PHE A O   
2135 C CB  . PHE A 350 ? 0.8775 0.8275 0.7750 0.1181  -0.0540 0.0866  363 PHE A CB  
2136 C CG  . PHE A 350 ? 0.8571 0.8011 0.7399 0.1241  -0.0604 0.0891  363 PHE A CG  
2137 C CD1 . PHE A 350 ? 0.8519 0.7761 0.7336 0.1322  -0.0778 0.0889  363 PHE A CD1 
2138 C CD2 . PHE A 350 ? 0.8653 0.8214 0.7344 0.1221  -0.0508 0.0915  363 PHE A CD2 
2139 C CE1 . PHE A 350 ? 0.9153 0.8341 0.7829 0.1376  -0.0849 0.0911  363 PHE A CE1 
2140 C CE2 . PHE A 350 ? 0.9238 0.8731 0.7784 0.1271  -0.0577 0.0932  363 PHE A CE2 
2141 C CZ  . PHE A 350 ? 0.9667 0.8985 0.8207 0.1345  -0.0745 0.0931  363 PHE A CZ  
2142 N N   . ARG A 351 ? 0.8886 0.7975 0.7251 0.1012  -0.0451 0.1327  364 ARG A N   
2143 C CA  . ARG A 351 ? 0.9208 0.8329 0.7327 0.0953  -0.0332 0.1463  364 ARG A CA  
2144 C C   . ARG A 351 ? 0.9036 0.8067 0.6929 0.1021  -0.0382 0.1494  364 ARG A C   
2145 O O   . ARG A 351 ? 1.0271 0.9094 0.8112 0.1073  -0.0538 0.1504  364 ARG A O   
2146 C CB  . ARG A 351 ? 0.9736 0.8703 0.7743 0.0835  -0.0325 0.1625  364 ARG A CB  
2147 C CG  . ARG A 351 ? 0.9315 0.8388 0.7521 0.0745  -0.0260 0.1609  364 ARG A CG  
2148 C CD  . ARG A 351 ? 1.0237 0.9034 0.8442 0.0661  -0.0379 0.1698  364 ARG A CD  
2149 N NE  . ARG A 351 ? 1.0116 0.9010 0.8493 0.0558  -0.0319 0.1689  364 ARG A NE  
2150 C CZ  . ARG A 351 ? 0.9999 0.8684 0.8479 0.0505  -0.0437 0.1690  364 ARG A CZ  
2151 N NH1 . ARG A 351 ? 0.9219 0.7568 0.7653 0.0557  -0.0631 0.1696  364 ARG A NH1 
2152 N NH2 . ARG A 351 ? 1.0247 0.9046 0.8877 0.0406  -0.0376 0.1677  364 ARG A NH2 
2153 N N   . ILE A 352 ? 0.9249 0.8431 0.7009 0.1031  -0.0263 0.1500  365 ILE A N   
2154 C CA  . ILE A 352 ? 0.9374 0.8477 0.6889 0.1090  -0.0298 0.1525  365 ILE A CA  
2155 C C   . ILE A 352 ? 1.0040 0.9141 0.7280 0.1033  -0.0189 0.1665  365 ILE A C   
2156 O O   . ILE A 352 ? 1.0610 0.9906 0.7816 0.1032  -0.0047 0.1649  365 ILE A O   
2157 C CB  . ILE A 352 ? 1.0334 0.9598 0.7895 0.1157  -0.0266 0.1398  365 ILE A CB  
2158 C CG1 . ILE A 352 ? 1.0186 0.9521 0.8031 0.1190  -0.0349 0.1256  365 ILE A CG1 
2159 C CG2 . ILE A 352 ? 1.0263 0.9423 0.7564 0.1217  -0.0319 0.1415  365 ILE A CG2 
2160 C CD1 . ILE A 352 ? 0.9383 0.8853 0.7258 0.1225  -0.0337 0.1146  365 ILE A CD1 
2161 N N   . GLY A 353 ? 0.9547 0.8434 0.6591 0.0986  -0.0260 0.1798  366 GLY A N   
2162 C CA  . GLY A 353 ? 0.9683 0.8577 0.6430 0.0918  -0.0160 0.1938  366 GLY A CA  
2163 C C   . GLY A 353 ? 0.9937 0.8728 0.6390 0.0994  -0.0212 0.1947  366 GLY A C   
2164 O O   . GLY A 353 ? 0.9435 0.8106 0.5921 0.1082  -0.0354 0.1869  366 GLY A O   
2165 N N   . PRO A 354 ? 1.0796 0.9649 0.6960 0.0958  -0.0100 0.2036  367 PRO A N   
2166 C CA  . PRO A 354 ? 1.0948 0.9720 0.6805 0.1035  -0.0138 0.2030  367 PRO A CA  
2167 C C   . PRO A 354 ? 1.1987 1.0449 0.7726 0.1065  -0.0353 0.2069  367 PRO A C   
2168 O O   . PRO A 354 ? 1.2099 1.0499 0.7757 0.1165  -0.0444 0.1986  367 PRO A O   
2169 C CB  . PRO A 354 ? 1.1504 1.0377 0.7067 0.0953  0.0009  0.2153  367 PRO A CB  
2170 C CG  . PRO A 354 ? 1.1512 1.0423 0.7199 0.0802  0.0066  0.2270  367 PRO A CG  
2171 C CD  . PRO A 354 ? 1.1518 1.0511 0.7608 0.0829  0.0051  0.2157  367 PRO A CD  
2172 N N   . TYR A 355 ? 1.4014 1.2275 0.9750 0.0979  -0.0448 0.2190  368 TYR A N   
2173 C CA  . TYR A 355 ? 1.3048 1.0985 0.8661 0.1012  -0.0675 0.2241  368 TYR A CA  
2174 C C   . TYR A 355 ? 1.1950 0.9823 0.7909 0.1105  -0.0839 0.2108  368 TYR A C   
2175 O O   . TYR A 355 ? 1.0157 0.7792 0.6071 0.1163  -0.1046 0.2117  368 TYR A O   
2176 C CB  . TYR A 355 ? 1.6020 1.3722 1.1419 0.0872  -0.0723 0.2447  368 TYR A CB  
2177 C CG  . TYR A 355 ? 1.8986 1.6809 1.4064 0.0749  -0.0540 0.2585  368 TYR A CG  
2178 C CD1 . TYR A 355 ? 1.8159 1.6124 1.2982 0.0807  -0.0441 0.2550  368 TYR A CD1 
2179 C CD2 . TYR A 355 ? 1.9626 1.7430 1.4652 0.0571  -0.0468 0.2745  368 TYR A CD2 
2180 C CE1 . TYR A 355 ? 2.0219 1.8340 1.4757 0.0705  -0.0265 0.2655  368 TYR A CE1 
2181 C CE2 . TYR A 355 ? 2.1675 1.9647 1.6423 0.0446  -0.0288 0.2866  368 TYR A CE2 
2182 C CZ  . TYR A 355 ? 2.2062 2.0209 1.6570 0.0521  -0.0181 0.2814  368 TYR A CZ  
2183 O OH  . TYR A 355 ? 2.2924 2.1284 1.7163 0.0408  0.0006  0.2914  368 TYR A OH  
2184 N N   . THR A 356 ? 1.0948 0.9048 0.7249 0.1122  -0.0751 0.1981  369 THR A N   
2185 C CA  . THR A 356 ? 1.0623 0.8744 0.7256 0.1212  -0.0874 0.1827  369 THR A CA  
2186 C C   . THR A 356 ? 1.0872 0.9027 0.7469 0.1319  -0.0957 0.1721  369 THR A C   
2187 O O   . THR A 356 ? 1.2964 1.1236 0.9406 0.1328  -0.0855 0.1701  369 THR A O   
2188 C CB  . THR A 356 ? 1.0955 0.9339 0.7916 0.1194  -0.0744 0.1714  369 THR A CB  
2189 O OG1 . THR A 356 ? 1.1472 0.9828 0.8475 0.1087  -0.0676 0.1809  369 THR A OG1 
2190 C CG2 . THR A 356 ? 1.0507 0.8951 0.7801 0.1280  -0.0860 0.1547  369 THR A CG2 
2191 N N   . ASN A 357 ? 1.0391 0.8446 0.7135 0.1401  -0.1152 0.1646  370 ASN A N   
2192 C CA  . ASN A 357 ? 1.1141 0.9232 0.7873 0.1491  -0.1257 0.1545  370 ASN A CA  
2193 C C   . ASN A 357 ? 1.0442 0.8832 0.7454 0.1509  -0.1171 0.1376  370 ASN A C   
2194 O O   . ASN A 357 ? 1.0641 0.9199 0.7827 0.1459  -0.1028 0.1343  370 ASN A O   
2195 C CB  . ASN A 357 ? 1.2198 1.0094 0.8993 0.1577  -0.1511 0.1526  370 ASN A CB  
2196 C CG  . ASN A 357 ? 1.2081 1.0057 0.9276 0.1625  -0.1584 0.1405  370 ASN A CG  
2197 O OD1 . ASN A 357 ? 1.4617 1.2805 1.2044 0.1586  -0.1443 0.1331  370 ASN A OD1 
2198 N ND2 . ASN A 357 ? 1.2360 1.0165 0.9631 0.1720  -0.1814 0.1377  370 ASN A ND2 
2199 N N   . PHE A 358 ? 1.0838 0.9291 0.7881 0.1567  -0.1265 0.1276  371 PHE A N   
2200 C CA  . PHE A 358 ? 1.0296 0.9014 0.7556 0.1557  -0.1195 0.1132  371 PHE A CA  
2201 C C   . PHE A 358 ? 0.9383 0.8299 0.7029 0.1548  -0.1165 0.1026  371 PHE A C   
2202 O O   . PHE A 358 ? 1.0376 0.9288 0.8231 0.1608  -0.1301 0.0962  371 PHE A O   
2203 C CB  . PHE A 358 ? 0.9355 0.8097 0.6616 0.1607  -0.1341 0.1045  371 PHE A CB  
2204 C CG  . PHE A 358 ? 0.9307 0.8293 0.6733 0.1566  -0.1278 0.0919  371 PHE A CG  
2205 C CD1 . PHE A 358 ? 0.9168 0.8154 0.6389 0.1520  -0.1163 0.0938  371 PHE A CD1 
2206 C CD2 . PHE A 358 ? 0.9818 0.9033 0.7596 0.1571  -0.1340 0.0779  371 PHE A CD2 
2207 C CE1 . PHE A 358 ? 0.8734 0.7893 0.6075 0.1467  -0.1127 0.0837  371 PHE A CE1 
2208 C CE2 . PHE A 358 ? 0.9359 0.8795 0.7264 0.1502  -0.1283 0.0680  371 PHE A CE2 
2209 C CZ  . PHE A 358 ? 0.9094 0.8478 0.6770 0.1443  -0.1183 0.0719  371 PHE A CZ  
2210 N N   . VAL A 359 ? 0.8306 0.7394 0.6036 0.1483  -0.0996 0.0998  372 VAL A N   
2211 C CA  . VAL A 359 ? 0.8899 0.8195 0.6964 0.1463  -0.0950 0.0892  372 VAL A CA  
2212 C C   . VAL A 359 ? 0.9165 0.8703 0.7428 0.1457  -0.0975 0.0743  372 VAL A C   
2213 O O   . VAL A 359 ? 0.7437 0.7036 0.5590 0.1408  -0.0913 0.0735  372 VAL A O   
2214 C CB  . VAL A 359 ? 0.9189 0.8564 0.7247 0.1388  -0.0765 0.0934  372 VAL A CB  
2215 C CG1 . VAL A 359 ? 0.8984 0.8581 0.7365 0.1363  -0.0722 0.0814  372 VAL A CG1 
2216 C CG2 . VAL A 359 ? 0.9929 0.9109 0.7815 0.1370  -0.0732 0.1081  372 VAL A CG2 
2217 N N   . ASN A 360 ? 0.8862 0.8537 0.7416 0.1503  -0.1073 0.0623  373 ASN A N   
2218 C CA  . ASN A 360 ? 0.8050 0.8020 0.6836 0.1479  -0.1088 0.0472  373 ASN A CA  
2219 C C   . ASN A 360 ? 0.7700 0.7911 0.6676 0.1402  -0.0942 0.0398  373 ASN A C   
2220 O O   . ASN A 360 ? 0.7544 0.7804 0.6699 0.1430  -0.0927 0.0353  373 ASN A O   
2221 C CB  . ASN A 360 ? 0.9099 0.9158 0.8129 0.1580  -0.1262 0.0356  373 ASN A CB  
2222 C CG  . ASN A 360 ? 0.9837 0.9656 0.8677 0.1658  -0.1432 0.0425  373 ASN A CG  
2223 O OD1 . ASN A 360 ? 1.0134 0.9954 0.8837 0.1630  -0.1467 0.0435  373 ASN A OD1 
2224 N ND2 . ASN A 360 ? 0.9827 0.9418 0.8642 0.1753  -0.1551 0.0474  373 ASN A ND2 
2225 N N   . ILE A 361 ? 0.7635 0.7969 0.6549 0.1302  -0.0848 0.0390  374 ILE A N   
2226 C CA  . ILE A 361 ? 0.7094 0.7673 0.6167 0.1211  -0.0727 0.0317  374 ILE A CA  
2227 C C   . ILE A 361 ? 0.7471 0.8362 0.6772 0.1165  -0.0773 0.0172  374 ILE A C   
2228 O O   . ILE A 361 ? 0.8712 0.9618 0.7922 0.1111  -0.0816 0.0175  374 ILE A O   
2229 C CB  . ILE A 361 ? 0.7449 0.7951 0.6295 0.1120  -0.0609 0.0404  374 ILE A CB  
2230 C CG1 . ILE A 361 ? 0.7651 0.7879 0.6254 0.1170  -0.0570 0.0544  374 ILE A CG1 
2231 C CG2 . ILE A 361 ? 0.8324 0.9037 0.7306 0.1031  -0.0493 0.0349  374 ILE A CG2 
2232 C CD1 . ILE A 361 ? 0.7856 0.8014 0.6246 0.1116  -0.0468 0.0614  374 ILE A CD1 
2233 N N   . GLY A 362 ? 0.6707 0.7856 0.6304 0.1185  -0.0766 0.0039  375 GLY A N   
2234 C CA  . GLY A 362 ? 0.7326 0.8842 0.7185 0.1150  -0.0805 -0.0119 375 GLY A CA  
2235 C C   . GLY A 362 ? 0.7442 0.9155 0.7256 0.0970  -0.0712 -0.0127 375 GLY A C   
2236 O O   . GLY A 362 ? 0.8571 1.0294 0.8307 0.0879  -0.0587 -0.0089 375 GLY A O   
2237 N N   . GLU A 363 ? 0.8417 1.0283 0.8279 0.0911  -0.0785 -0.0175 376 GLU A N   
2238 C CA  . GLU A 363 ? 0.7907 0.9891 0.7674 0.0716  -0.0728 -0.0156 376 GLU A CA  
2239 C C   . GLU A 363 ? 0.7343 0.9808 0.7382 0.0589  -0.0662 -0.0299 376 GLU A C   
2240 O O   . GLU A 363 ? 0.6901 0.9457 0.6842 0.0399  -0.0595 -0.0269 376 GLU A O   
2241 C CB  . GLU A 363 ? 0.7728 0.9578 0.7350 0.0689  -0.0849 -0.0112 376 GLU A CB  
2242 C CG  . GLU A 363 ? 0.7633 0.9772 0.7529 0.0726  -0.0974 -0.0243 376 GLU A CG  
2243 C CD  . GLU A 363 ? 0.9474 1.1506 0.9223 0.0661  -0.1092 -0.0203 376 GLU A CD  
2244 O OE1 . GLU A 363 ? 0.9629 1.1263 0.9042 0.0676  -0.1118 -0.0073 376 GLU A OE1 
2245 O OE2 . GLU A 363 ? 0.8294 1.0656 0.8268 0.0594  -0.1162 -0.0312 376 GLU A OE2 
2246 N N   . ARG A 364 ? 0.6928 0.9696 0.7292 0.0690  -0.0687 -0.0456 377 ARG A N   
2247 C CA  . ARG A 364 ? 0.7489 1.0790 0.8144 0.0583  -0.0641 -0.0622 377 ARG A CA  
2248 C C   . ARG A 364 ? 0.7144 1.0661 0.7799 0.0432  -0.0474 -0.0646 377 ARG A C   
2249 O O   . ARG A 364 ? 0.8009 1.1911 0.8771 0.0255  -0.0416 -0.0719 377 ARG A O   
2250 C CB  . ARG A 364 ? 0.8128 1.1716 0.9149 0.0763  -0.0727 -0.0811 377 ARG A CB  
2251 C CG  . ARG A 364 ? 0.7866 1.1306 0.8922 0.0906  -0.0915 -0.0808 377 ARG A CG  
2252 C CD  . ARG A 364 ? 0.8436 1.2361 0.9906 0.0988  -0.0999 -0.1029 377 ARG A CD  
2253 N NE  . ARG A 364 ? 0.9931 1.4307 1.1526 0.0774  -0.0943 -0.1097 377 ARG A NE  
2254 C CZ  . ARG A 364 ? 1.0697 1.5671 1.2651 0.0736  -0.0895 -0.1302 377 ARG A CZ  
2255 N NH1 . ARG A 364 ? 0.9829 1.5034 1.2072 0.0923  -0.0900 -0.1484 377 ARG A NH1 
2256 N NH2 . ARG A 364 ? 1.0213 1.5567 1.2233 0.0500  -0.0841 -0.1330 377 ARG A NH2 
2257 N N   . CYS A 365 ? 0.6709 0.9997 0.7240 0.0487  -0.0401 -0.0584 378 CYS A N   
2258 C CA  . CYS A 365 ? 0.6933 1.0396 0.7435 0.0351  -0.0254 -0.0601 378 CYS A CA  
2259 C C   . CYS A 365 ? 0.6543 0.9819 0.6728 0.0146  -0.0205 -0.0441 378 CYS A C   
2260 O O   . CYS A 365 ? 0.5872 0.8904 0.5849 0.0124  -0.0143 -0.0336 378 CYS A O   
2261 C CB  . CYS A 365 ? 0.6902 1.0193 0.7399 0.0482  -0.0209 -0.0600 378 CYS A CB  
2262 S SG  . CYS A 365 ? 0.7327 1.0856 0.8196 0.0698  -0.0261 -0.0818 378 CYS A SG  
2263 N N   . ASN A 366 ? 0.6899 1.0295 0.7059 -0.0002 -0.0246 -0.0430 379 ASN A N   
2264 C CA  . ASN A 366 ? 0.7190 1.0362 0.7038 -0.0196 -0.0241 -0.0281 379 ASN A CA  
2265 C C   . ASN A 366 ? 0.8025 1.1596 0.7961 -0.0444 -0.0213 -0.0340 379 ASN A C   
2266 O O   . ASN A 366 ? 0.6564 1.0376 0.6687 -0.0463 -0.0282 -0.0422 379 ASN A O   
2267 C CB  . ASN A 366 ? 0.7490 1.0242 0.7133 -0.0114 -0.0364 -0.0168 379 ASN A CB  
2268 C CG  . ASN A 366 ? 0.7748 1.0224 0.7063 -0.0290 -0.0391 -0.0030 379 ASN A CG  
2269 O OD1 . ASN A 366 ? 0.9277 1.1922 0.8547 -0.0515 -0.0348 -0.0022 379 ASN A OD1 
2270 N ND2 . ASN A 366 ? 0.7684 0.9723 0.6754 -0.0189 -0.0469 0.0075  379 ASN A ND2 
2271 N N   . VAL A 367 ? 0.7596 1.1236 0.7388 -0.0643 -0.0117 -0.0291 380 VAL A N   
2272 C CA  . VAL A 367 ? 0.7888 1.1942 0.7743 -0.0916 -0.0065 -0.0338 380 VAL A CA  
2273 C C   . VAL A 367 ? 0.8114 1.2074 0.7856 -0.1082 -0.0172 -0.0263 380 VAL A C   
2274 O O   . VAL A 367 ? 0.8774 1.3165 0.8706 -0.1245 -0.0167 -0.0350 380 VAL A O   
2275 C CB  . VAL A 367 ? 0.8269 1.2314 0.7906 -0.1107 0.0041  -0.0263 380 VAL A CB  
2276 C CG1 . VAL A 367 ? 0.9129 1.3532 0.8748 -0.1436 0.0086  -0.0266 380 VAL A CG1 
2277 C CG2 . VAL A 367 ? 0.8224 1.2480 0.8021 -0.0977 0.0151  -0.0375 380 VAL A CG2 
2278 N N   . ALA A 368 ? 0.8876 1.2289 0.8315 -0.1040 -0.0272 -0.0113 381 ALA A N   
2279 C CA  . ALA A 368 ? 0.9368 1.2620 0.8663 -0.1188 -0.0393 -0.0042 381 ALA A CA  
2280 C C   . ALA A 368 ? 0.9613 1.2939 0.9117 -0.1033 -0.0504 -0.0127 381 ALA A C   
2281 O O   . ALA A 368 ? 1.0370 1.3881 0.9952 -0.1184 -0.0578 -0.0155 381 ALA A O   
2282 C CB  . ALA A 368 ? 0.9284 1.1918 0.8158 -0.1195 -0.0465 0.0132  381 ALA A CB  
2283 N N   . GLY A 369 ? 0.8246 1.1426 0.7833 -0.0745 -0.0523 -0.0162 382 GLY A N   
2284 C CA  . GLY A 369 ? 0.9173 1.2321 0.8891 -0.0574 -0.0650 -0.0216 382 GLY A CA  
2285 C C   . GLY A 369 ? 0.9486 1.3130 0.9634 -0.0462 -0.0650 -0.0402 382 GLY A C   
2286 O O   . GLY A 369 ? 0.8421 1.2033 0.8686 -0.0301 -0.0770 -0.0450 382 GLY A O   
2287 N N   . SER A 370 ? 0.9797 1.3897 1.0174 -0.0536 -0.0525 -0.0513 383 SER A N   
2288 C CA  . SER A 370 ? 0.8957 1.3572 0.9765 -0.0418 -0.0523 -0.0720 383 SER A CA  
2289 C C   . SER A 370 ? 0.9705 1.4939 1.0732 -0.0654 -0.0418 -0.0837 383 SER A C   
2290 O O   . SER A 370 ? 0.9349 1.4646 1.0238 -0.0831 -0.0288 -0.0790 383 SER A O   
2291 C CB  . SER A 370 ? 0.8517 1.3068 0.9425 -0.0173 -0.0474 -0.0783 383 SER A CB  
2292 O OG  . SER A 370 ? 0.8450 1.3431 0.9763 -0.0019 -0.0507 -0.0992 383 SER A OG  
2293 N N   . ARG A 371 ? 1.0272 1.5977 1.1638 -0.0657 -0.0478 -0.0990 384 ARG A N   
2294 C CA  . ARG A 371 ? 0.9419 1.5795 1.1029 -0.0893 -0.0379 -0.1116 384 ARG A CA  
2295 C C   . ARG A 371 ? 0.8645 1.5460 1.0512 -0.0798 -0.0237 -0.1296 384 ARG A C   
2296 O O   . ARG A 371 ? 0.9746 1.6837 1.1560 -0.1013 -0.0085 -0.1302 384 ARG A O   
2297 C CB  . ARG A 371 ? 0.9128 1.5910 1.1058 -0.0907 -0.0496 -0.1240 384 ARG A CB  
2298 N N   . LYS A 372 ? 0.8427 1.5284 1.0549 -0.0478 -0.0299 -0.1442 385 LYS A N   
2299 C CA  . LYS A 372 ? 0.8352 1.5596 1.0732 -0.0344 -0.0192 -0.1642 385 LYS A CA  
2300 C C   . LYS A 372 ? 0.9017 1.5960 1.1103 -0.0391 -0.0062 -0.1534 385 LYS A C   
2301 O O   . LYS A 372 ? 1.1011 1.8332 1.3127 -0.0546 0.0091  -0.1607 385 LYS A O   
2302 C CB  . LYS A 372 ? 0.7858 1.5036 1.0499 0.0026  -0.0324 -0.1786 385 LYS A CB  
2303 N N   . PHE A 373 ? 0.9351 1.5630 1.1147 -0.0265 -0.0127 -0.1360 386 PHE A N   
2304 C CA  . PHE A 373 ? 0.8821 1.4776 1.0353 -0.0272 -0.0030 -0.1256 386 PHE A CA  
2305 C C   . PHE A 373 ? 0.8282 1.4377 0.9598 -0.0593 0.0105  -0.1169 386 PHE A C   
2306 O O   . PHE A 373 ? 0.8303 1.4568 0.9601 -0.0639 0.0231  -0.1222 386 PHE A O   
2307 C CB  . PHE A 373 ? 0.8954 1.4201 1.0176 -0.0151 -0.0122 -0.1052 386 PHE A CB  
2308 C CG  . PHE A 373 ? 0.8482 1.3425 0.9535 -0.0068 -0.0051 -0.0990 386 PHE A CG  
2309 C CD1 . PHE A 373 ? 0.8383 1.3332 0.9626 0.0169  -0.0067 -0.1113 386 PHE A CD1 
2310 C CD2 . PHE A 373 ? 0.9283 1.3925 0.9991 -0.0227 0.0013  -0.0812 386 PHE A CD2 
2311 C CE1 . PHE A 373 ? 0.8338 1.3017 0.9435 0.0230  -0.0009 -0.1056 386 PHE A CE1 
2312 C CE2 . PHE A 373 ? 0.8959 1.3353 0.9534 -0.0151 0.0071  -0.0761 386 PHE A CE2 
2313 C CZ  . PHE A 373 ? 0.8560 1.2983 0.9333 0.0068  0.0063  -0.0882 386 PHE A CZ  
2314 N N   . ALA A 374 ? 0.8258 1.4267 0.9397 -0.0820 0.0067  -0.1036 387 ALA A N   
2315 C CA  . ALA A 374 ? 0.8090 1.4182 0.8988 -0.1152 0.0166  -0.0929 387 ALA A CA  
2316 C C   . ALA A 374 ? 0.7820 1.4642 0.8969 -0.1311 0.0307  -0.1110 387 ALA A C   
2317 O O   . ALA A 374 ? 0.8063 1.4985 0.9046 -0.1487 0.0432  -0.1076 387 ALA A O   
2318 C CB  . ALA A 374 ? 0.7770 1.3638 0.8462 -0.1361 0.0069  -0.0772 387 ALA A CB  
2319 N N   . LYS A 375 ? 0.7827 1.5171 0.9375 -0.1243 0.0284  -0.1308 388 LYS A N   
2320 C CA  . LYS A 375 ? 0.7918 1.6042 0.9758 -0.1370 0.0421  -0.1517 388 LYS A CA  
2321 C C   . LYS A 375 ? 0.7816 1.6114 0.9753 -0.1203 0.0535  -0.1671 388 LYS A C   
2322 O O   . LYS A 375 ? 0.8313 1.7071 1.0265 -0.1384 0.0691  -0.1757 388 LYS A O   
2323 C CB  . LYS A 375 ? 0.7131 1.5772 0.9419 -0.1273 0.0348  -0.1719 388 LYS A CB  
2324 N N   . LEU A 376 ? 0.7061 1.4983 0.9043 -0.0873 0.0453  -0.1703 389 LEU A N   
2325 C CA  . LEU A 376 ? 0.8602 1.6625 1.0678 -0.0692 0.0533  -0.1855 389 LEU A CA  
2326 C C   . LEU A 376 ? 0.8339 1.5975 1.0024 -0.0803 0.0617  -0.1686 389 LEU A C   
2327 O O   . LEU A 376 ? 1.0206 1.8087 1.1918 -0.0798 0.0731  -0.1806 389 LEU A O   
2328 C CB  . LEU A 376 ? 0.9346 1.7116 1.1629 -0.0307 0.0396  -0.1958 389 LEU A CB  
2329 C CG  . LEU A 376 ? 0.9372 1.7674 1.2131 -0.0120 0.0334  -0.2234 389 LEU A CG  
2330 C CD1 . LEU A 376 ? 0.9950 1.8306 1.2809 -0.0176 0.0215  -0.2182 389 LEU A CD1 
2331 C CD2 . LEU A 376 ? 1.0574 1.8623 1.3496 0.0252  0.0220  -0.2357 389 LEU A CD2 
2332 N N   . ILE A 377 ? 0.7502 1.4546 0.8830 -0.0892 0.0553  -0.1422 390 ILE A N   
2333 C CA  . ILE A 377 ? 0.7218 1.3898 0.8175 -0.1004 0.0615  -0.1254 390 ILE A CA  
2334 C C   . ILE A 377 ? 0.7941 1.4935 0.8718 -0.1363 0.0735  -0.1203 390 ILE A C   
2335 O O   . ILE A 377 ? 0.7757 1.4861 0.8410 -0.1444 0.0844  -0.1224 390 ILE A O   
2336 C CB  . ILE A 377 ? 0.7493 1.3453 0.8132 -0.0964 0.0500  -0.1003 390 ILE A CB  
2337 C CG1 . ILE A 377 ? 0.7525 1.3149 0.8288 -0.0630 0.0396  -0.1031 390 ILE A CG1 
2338 C CG2 . ILE A 377 ? 0.7852 1.3483 0.8117 -0.1100 0.0554  -0.0833 390 ILE A CG2 
2339 C CD1 . ILE A 377 ? 0.7476 1.2971 0.8241 -0.0463 0.0439  -0.1084 390 ILE A CD1 
2340 N N   . MET A 378 ? 0.8842 1.5970 0.9590 -0.1590 0.0707  -0.1131 391 MET A N   
2341 C CA  . MET A 378 ? 0.8826 1.6233 0.9381 -0.1971 0.0806  -0.1058 391 MET A CA  
2342 C C   . MET A 378 ? 0.8845 1.7018 0.9651 -0.2048 0.0972  -0.1293 391 MET A C   
2343 O O   . MET A 378 ? 0.8223 1.6588 0.8815 -0.2311 0.1089  -0.1248 391 MET A O   
2344 C CB  . MET A 378 ? 0.9503 1.6913 1.0014 -0.2197 0.0726  -0.0948 391 MET A CB  
2345 C CG  . MET A 378 ? 0.9176 1.5824 0.9350 -0.2187 0.0573  -0.0701 391 MET A CG  
2346 N N   . ALA A 379 ? 0.8630 1.7233 0.9875 -0.1811 0.0974  -0.1549 392 ALA A N   
2347 C CA  . ALA A 379 ? 0.7804 1.7155 0.9333 -0.1813 0.1124  -0.1821 392 ALA A CA  
2348 C C   . ALA A 379 ? 0.7964 1.7211 0.9494 -0.1573 0.1171  -0.1939 392 ALA A C   
2349 O O   . ALA A 379 ? 0.9807 1.9618 1.1590 -0.1496 0.1277  -0.2199 392 ALA A O   
2350 C CB  . ALA A 379 ? 0.7663 1.7556 0.9686 -0.1662 0.1088  -0.2061 392 ALA A CB  
2351 N N   . GLY A 380 ? 0.7871 1.6413 0.9129 -0.1453 0.1089  -0.1760 393 GLY A N   
2352 C CA  . GLY A 380 ? 0.7510 1.5883 0.8716 -0.1268 0.1123  -0.1832 393 GLY A CA  
2353 C C   . GLY A 380 ? 0.7512 1.5956 0.9080 -0.0892 0.1061  -0.2069 393 GLY A C   
2354 O O   . GLY A 380 ? 0.8909 1.7245 1.0460 -0.0739 0.1082  -0.2155 393 GLY A O   
2355 N N   . ASN A 381 ? 0.7920 1.6519 0.9804 -0.0743 0.0969  -0.2173 394 ASN A N   
2356 C CA  . ASN A 381 ? 0.8396 1.7037 1.0622 -0.0381 0.0880  -0.2397 394 ASN A CA  
2357 C C   . ASN A 381 ? 0.8452 1.6338 1.0544 -0.0166 0.0725  -0.2230 394 ASN A C   
2358 O O   . ASN A 381 ? 0.7552 1.5209 0.9730 -0.0053 0.0590  -0.2168 394 ASN A O   
2359 C CB  . ASN A 381 ? 0.9389 1.8552 1.2025 -0.0302 0.0834  -0.2594 394 ASN A CB  
2360 C CG  . ASN A 381 ? 1.0752 2.0109 1.3770 0.0058  0.0760  -0.2891 394 ASN A CG  
2361 O OD1 . ASN A 381 ? 1.0287 1.9337 1.3255 0.0251  0.0732  -0.2939 394 ASN A OD1 
2362 N ND2 . ASN A 381 ? 0.9867 1.9733 1.3275 0.0153  0.0716  -0.3098 394 ASN A ND2 
2363 N N   . TYR A 382 ? 0.9633 1.7155 1.1508 -0.0123 0.0747  -0.2159 395 TYR A N   
2364 C CA  . TYR A 382 ? 0.8615 1.5458 1.0347 0.0051  0.0624  -0.1998 395 TYR A CA  
2365 C C   . TYR A 382 ? 0.7960 1.4723 0.9977 0.0384  0.0505  -0.2179 395 TYR A C   
2366 O O   . TYR A 382 ? 1.0773 1.7056 1.2751 0.0534  0.0371  -0.2060 395 TYR A O   
2367 C CB  . TYR A 382 ? 0.8663 1.5181 1.0076 -0.0036 0.0688  -0.1860 395 TYR A CB  
2368 C CG  . TYR A 382 ? 0.8984 1.5273 1.0035 -0.0305 0.0729  -0.1597 395 TYR A CG  
2369 C CD1 . TYR A 382 ? 0.9434 1.6108 1.0398 -0.0585 0.0833  -0.1586 395 TYR A CD1 
2370 C CD2 . TYR A 382 ? 0.9267 1.4955 1.0057 -0.0281 0.0657  -0.1362 395 TYR A CD2 
2371 C CE1 . TYR A 382 ? 0.9139 1.5547 0.9750 -0.0828 0.0844  -0.1342 395 TYR A CE1 
2372 C CE2 . TYR A 382 ? 0.8917 1.4372 0.9377 -0.0499 0.0674  -0.1137 395 TYR A CE2 
2373 C CZ  . TYR A 382 ? 0.8537 1.4324 0.8900 -0.0770 0.0757  -0.1124 395 TYR A CZ  
2374 O OH  . TYR A 382 ? 0.7569 1.3070 0.7585 -0.0984 0.0748  -0.0898 395 TYR A OH  
2375 N N   . GLU A 383 ? 0.8165 1.5383 1.0449 0.0497  0.0546  -0.2465 396 GLU A N   
2376 C CA  . GLU A 383 ? 1.0580 1.7716 1.3136 0.0822  0.0413  -0.2660 396 GLU A CA  
2377 C C   . GLU A 383 ? 1.1595 1.8684 1.4361 0.0971  0.0257  -0.2669 396 GLU A C   
2378 O O   . GLU A 383 ? 1.4497 2.1135 1.7286 0.1187  0.0097  -0.2630 396 GLU A O   
2379 C CB  . GLU A 383 ? 1.1905 1.9617 1.4728 0.0916  0.0488  -0.3001 396 GLU A CB  
2380 N N   . GLU A 384 ? 1.0752 1.8302 1.3659 0.0844  0.0298  -0.2716 397 GLU A N   
2381 C CA  . GLU A 384 ? 1.1469 1.9019 1.4576 0.0964  0.0146  -0.2725 397 GLU A CA  
2382 C C   . GLU A 384 ? 1.0964 1.7954 1.3774 0.0867  0.0070  -0.2407 397 GLU A C   
2383 O O   . GLU A 384 ? 0.9767 1.6542 1.2660 0.1012  -0.0090 -0.2373 397 GLU A O   
2384 C CB  . GLU A 384 ? 1.2079 2.0380 1.5478 0.0858  0.0212  -0.2910 397 GLU A CB  
2385 C CG  . GLU A 384 ? 1.2232 2.1021 1.6082 0.1126  0.0151  -0.3267 397 GLU A CG  
2386 C CD  . GLU A 384 ? 1.2928 2.1464 1.6979 0.1404  -0.0086 -0.3300 397 GLU A CD  
2387 O OE1 . GLU A 384 ? 1.1201 1.9749 1.5270 0.1323  -0.0155 -0.3190 397 GLU A OE1 
2388 O OE2 . GLU A 384 ? 1.4278 2.2585 1.8454 0.1698  -0.0217 -0.3436 397 GLU A OE2 
2389 N N   . ALA A 385 ? 0.9479 1.6234 1.1937 0.0631  0.0176  -0.2184 398 ALA A N   
2390 C CA  . ALA A 385 ? 0.8364 1.4569 1.0517 0.0554  0.0110  -0.1895 398 ALA A CA  
2391 C C   . ALA A 385 ? 0.8964 1.4571 1.1020 0.0778  -0.0015 -0.1799 398 ALA A C   
2392 O O   . ALA A 385 ? 1.0073 1.5282 1.1983 0.0808  -0.0117 -0.1626 398 ALA A O   
2393 C CB  . ALA A 385 ? 0.7139 1.3227 0.8946 0.0277  0.0240  -0.1702 398 ALA A CB  
2394 N N   . LEU A 386 ? 0.9206 1.4758 1.1334 0.0923  -0.0009 -0.1913 399 LEU A N   
2395 C CA  . LEU A 386 ? 0.8842 1.3860 1.0904 0.1125  -0.0134 -0.1840 399 LEU A CA  
2396 C C   . LEU A 386 ? 0.8939 1.3861 1.1204 0.1349  -0.0323 -0.1912 399 LEU A C   
2397 O O   . LEU A 386 ? 0.9213 1.3631 1.1351 0.1465  -0.0445 -0.1777 399 LEU A O   
2398 C CB  . LEU A 386 ? 0.9122 1.4139 1.1241 0.1221  -0.0099 -0.1976 399 LEU A CB  
2399 C CG  . LEU A 386 ? 0.9645 1.4629 1.1524 0.1034  0.0054  -0.1883 399 LEU A CG  
2400 C CD1 . LEU A 386 ? 0.8893 1.4000 1.0887 0.1134  0.0082  -0.2082 399 LEU A CD1 
2401 C CD2 . LEU A 386 ? 1.0667 1.5089 1.2228 0.0975  0.0034  -0.1596 399 LEU A CD2 
2402 N N   . CYS A 387 ? 0.7664 1.3080 1.0241 0.1406  -0.0353 -0.2125 400 CYS A N   
2403 C CA  . CYS A 387 ? 0.8806 1.4166 1.1586 0.1617  -0.0550 -0.2199 400 CYS A CA  
2404 C C   . CYS A 387 ? 0.8053 1.3086 1.0621 0.1540  -0.0626 -0.1961 400 CYS A C   
2405 O O   . CYS A 387 ? 0.8791 1.3496 1.1361 0.1710  -0.0805 -0.1915 400 CYS A O   
2406 C CB  . CYS A 387 ? 0.9586 1.5621 1.2772 0.1686  -0.0557 -0.2491 400 CYS A CB  
2407 S SG  . CYS A 387 ? 0.9748 1.6188 1.3219 0.1842  -0.0499 -0.2827 400 CYS A SG  
2408 N N   . VAL A 388 ? 0.7148 1.2249 0.9514 0.1287  -0.0501 -0.1813 401 VAL A N   
2409 C CA  . VAL A 388 ? 0.7703 1.2474 0.9830 0.1203  -0.0565 -0.1592 401 VAL A CA  
2410 C C   . VAL A 388 ? 0.8254 1.2376 1.0069 0.1267  -0.0610 -0.1376 401 VAL A C   
2411 O O   . VAL A 388 ? 0.8961 1.2738 1.0647 0.1336  -0.0735 -0.1250 401 VAL A O   
2412 C CB  . VAL A 388 ? 0.8185 1.3148 1.0150 0.0912  -0.0432 -0.1490 401 VAL A CB  
2413 C CG1 . VAL A 388 ? 0.8145 1.2698 0.9824 0.0839  -0.0504 -0.1264 401 VAL A CG1 
2414 C CG2 . VAL A 388 ? 0.7895 1.3523 1.0170 0.0822  -0.0393 -0.1689 401 VAL A CG2 
2415 N N   . ALA A 389 ? 0.7427 1.1407 0.9123 0.1237  -0.0508 -0.1338 402 ALA A N   
2416 C CA  . ALA A 389 ? 0.7356 1.0788 0.8807 0.1301  -0.0543 -0.1160 402 ALA A CA  
2417 C C   . ALA A 389 ? 0.7867 1.1074 0.9451 0.1540  -0.0712 -0.1230 402 ALA A C   
2418 O O   . ALA A 389 ? 0.7141 0.9918 0.8550 0.1608  -0.0817 -0.1074 402 ALA A O   
2419 C CB  . ALA A 389 ? 0.7283 1.0674 0.8608 0.1203  -0.0400 -0.1122 402 ALA A CB  
2420 N N   . LYS A 390 ? 0.8897 1.2391 1.0778 0.1667  -0.0744 -0.1467 403 LYS A N   
2421 C CA  . LYS A 390 ? 0.8636 1.1904 1.0656 0.1907  -0.0927 -0.1559 403 LYS A CA  
2422 C C   . LYS A 390 ? 0.8638 1.1761 1.0691 0.2027  -0.1117 -0.1525 403 LYS A C   
2423 O O   . LYS A 390 ? 0.9276 1.1924 1.1187 0.2134  -0.1260 -0.1403 403 LYS A O   
2424 C CB  . LYS A 390 ? 0.8286 1.1961 1.0648 0.2033  -0.0931 -0.1862 403 LYS A CB  
2425 N N   . VAL A 391 ? 0.7798 1.1333 1.0027 0.1995  -0.1121 -0.1625 404 VAL A N   
2426 C CA  . VAL A 391 ? 0.8002 1.1454 1.0284 0.2106  -0.1310 -0.1611 404 VAL A CA  
2427 C C   . VAL A 391 ? 0.7840 1.0806 0.9746 0.2025  -0.1345 -0.1327 404 VAL A C   
2428 O O   . VAL A 391 ? 0.7457 1.0094 0.9292 0.2158  -0.1530 -0.1259 404 VAL A O   
2429 C CB  . VAL A 391 ? 0.9011 1.3057 1.1575 0.2061  -0.1300 -0.1781 404 VAL A CB  
2430 C CG1 . VAL A 391 ? 0.9095 1.3302 1.1478 0.1782  -0.1128 -0.1651 404 VAL A CG1 
2431 C CG2 . VAL A 391 ? 0.9288 1.3268 1.1965 0.2223  -0.1532 -0.1809 404 VAL A CG2 
2432 N N   . GLN A 392 ? 0.7571 1.0490 0.9227 0.1813  -0.1175 -0.1169 405 GLN A N   
2433 C CA  . GLN A 392 ? 0.7489 0.9972 0.8778 0.1740  -0.1188 -0.0917 405 GLN A CA  
2434 C C   . GLN A 392 ? 0.7960 0.9927 0.9051 0.1843  -0.1265 -0.0780 405 GLN A C   
2435 O O   . GLN A 392 ? 0.8855 1.0478 0.9744 0.1890  -0.1381 -0.0639 405 GLN A O   
2436 C CB  . GLN A 392 ? 0.7616 1.0126 0.8684 0.1519  -0.0996 -0.0793 405 GLN A CB  
2437 C CG  . GLN A 392 ? 0.7410 1.0232 0.8507 0.1370  -0.0957 -0.0819 405 GLN A CG  
2438 C CD  . GLN A 392 ? 0.8334 1.1118 0.9189 0.1162  -0.0792 -0.0693 405 GLN A CD  
2439 O OE1 . GLN A 392 ? 0.8726 1.1247 0.9306 0.1087  -0.0798 -0.0535 405 GLN A OE1 
2440 N NE2 . GLN A 392 ? 0.8488 1.1519 0.9431 0.1075  -0.0653 -0.0768 405 GLN A NE2 
2441 N N   . VAL A 393 ? 0.7291 0.9210 0.8429 0.1864  -0.1201 -0.0819 406 VAL A N   
2442 C CA  . VAL A 393 ? 0.7522 0.8970 0.8493 0.1938  -0.1273 -0.0694 406 VAL A CA  
2443 C C   . VAL A 393 ? 0.8083 0.9342 0.9165 0.2140  -0.1514 -0.0758 406 VAL A C   
2444 O O   . VAL A 393 ? 0.9814 1.0633 1.0670 0.2180  -0.1627 -0.0593 406 VAL A O   
2445 C CB  . VAL A 393 ? 0.7632 0.9097 0.8661 0.1912  -0.1169 -0.0748 406 VAL A CB  
2446 C CG1 . VAL A 393 ? 0.7539 0.8533 0.8441 0.1989  -0.1275 -0.0643 406 VAL A CG1 
2447 C CG2 . VAL A 393 ? 0.7306 0.8867 0.8168 0.1716  -0.0955 -0.0645 406 VAL A CG2 
2448 N N   . GLU A 394 ? 0.8016 0.9621 0.9442 0.2267  -0.1596 -0.1000 407 GLU A N   
2449 C CA  . GLU A 394 ? 0.9409 1.0876 1.0982 0.2486  -0.1850 -0.1095 407 GLU A CA  
2450 C C   . GLU A 394 ? 0.9467 1.0805 1.0901 0.2497  -0.1976 -0.0980 407 GLU A C   
2451 O O   . GLU A 394 ? 0.9631 1.0625 1.0993 0.2637  -0.2194 -0.0928 407 GLU A O   
2452 C CB  . GLU A 394 ? 0.9987 1.1954 1.1995 0.2623  -0.1890 -0.1412 407 GLU A CB  
2453 C CG  . GLU A 394 ? 1.1128 1.2912 1.3307 0.2846  -0.2069 -0.1563 407 GLU A CG  
2454 C CD  . GLU A 394 ? 1.2635 1.4957 1.5206 0.2938  -0.2014 -0.1884 407 GLU A CD  
2455 O OE1 . GLU A 394 ? 1.1152 1.4025 1.3957 0.2912  -0.1947 -0.2033 407 GLU A OE1 
2456 O OE2 . GLU A 394 ? 1.3075 1.5279 1.5715 0.3029  -0.2038 -0.1990 407 GLU A OE2 
2457 N N   . MET A 395 ? 0.9519 1.1113 1.0894 0.2343  -0.1846 -0.0936 408 MET A N   
2458 C CA  . MET A 395 ? 0.8746 1.0274 0.9995 0.2332  -0.1949 -0.0848 408 MET A CA  
2459 C C   . MET A 395 ? 0.9053 1.0121 0.9851 0.2224  -0.1910 -0.0569 408 MET A C   
2460 O O   . MET A 395 ? 0.9118 1.0123 0.9753 0.2183  -0.1960 -0.0482 408 MET A O   
2461 C CB  . MET A 395 ? 0.9444 1.1492 1.0868 0.2209  -0.1843 -0.0958 408 MET A CB  
2462 C CG  . MET A 395 ? 1.0929 1.3106 1.2446 0.2268  -0.2013 -0.1006 408 MET A CG  
2463 S SD  . MET A 395 ? 1.2190 1.4902 1.4251 0.2456  -0.2157 -0.1331 408 MET A SD  
2464 C CE  . MET A 395 ? 1.1109 1.4498 1.3387 0.2231  -0.1917 -0.1461 408 MET A CE  
2465 N N   . GLY A 396 ? 0.9465 1.0239 1.0067 0.2175  -0.1817 -0.0441 409 GLY A N   
2466 C CA  . GLY A 396 ? 0.8691 0.9040 0.8883 0.2096  -0.1787 -0.0189 409 GLY A CA  
2467 C C   . GLY A 396 ? 0.9692 1.0069 0.9691 0.1918  -0.1552 -0.0076 409 GLY A C   
2468 O O   . GLY A 396 ? 0.9108 0.9192 0.8779 0.1855  -0.1512 0.0114  409 GLY A O   
2469 N N   . ALA A 397 ? 0.8277 0.9009 0.8467 0.1839  -0.1402 -0.0194 410 ALA A N   
2470 C CA  . ALA A 397 ? 0.7898 0.8658 0.7916 0.1679  -0.1198 -0.0097 410 ALA A CA  
2471 C C   . ALA A 397 ? 0.7526 0.8046 0.7431 0.1662  -0.1126 0.0002  410 ALA A C   
2472 O O   . ALA A 397 ? 0.8528 0.9099 0.8625 0.1714  -0.1140 -0.0096 410 ALA A O   
2473 C CB  . ALA A 397 ? 0.8177 0.9374 0.8410 0.1587  -0.1075 -0.0244 410 ALA A CB  
2474 N N   . GLN A 398 ? 0.7183 0.7458 0.6783 0.1588  -0.1052 0.0189  411 GLN A N   
2475 C CA  . GLN A 398 ? 0.7473 0.7538 0.6958 0.1553  -0.0982 0.0301  411 GLN A CA  
2476 C C   . GLN A 398 ? 0.6821 0.7060 0.6301 0.1435  -0.0791 0.0305  411 GLN A C   
2477 O O   . GLN A 398 ? 0.6700 0.6883 0.6198 0.1404  -0.0729 0.0334  411 GLN A O   
2478 C CB  . GLN A 398 ? 0.8279 0.8001 0.7441 0.1546  -0.1017 0.0500  411 GLN A CB  
2479 C CG  . GLN A 398 ? 0.9266 0.8758 0.8394 0.1657  -0.1225 0.0518  411 GLN A CG  
2480 C CD  . GLN A 398 ? 1.0031 0.9208 0.8800 0.1632  -0.1252 0.0718  411 GLN A CD  
2481 O OE1 . GLN A 398 ? 1.1775 1.0978 1.0349 0.1589  -0.1188 0.0777  411 GLN A OE1 
2482 N NE2 . GLN A 398 ? 1.1221 1.0092 0.9884 0.1653  -0.1354 0.0821  411 GLN A NE2 
2483 N N   . VAL A 399 ? 0.6858 0.7288 0.6304 0.1366  -0.0714 0.0282  412 VAL A N   
2484 C CA  . VAL A 399 ? 0.6778 0.7397 0.6239 0.1259  -0.0562 0.0262  412 VAL A CA  
2485 C C   . VAL A 399 ? 0.7199 0.8138 0.6827 0.1216  -0.0556 0.0120  412 VAL A C   
2486 O O   . VAL A 399 ? 0.8549 0.9532 0.8203 0.1248  -0.0649 0.0082  412 VAL A O   
2487 C CB  . VAL A 399 ? 0.6963 0.7438 0.6139 0.1194  -0.0472 0.0412  412 VAL A CB  
2488 C CG1 . VAL A 399 ? 0.8195 0.8825 0.7374 0.1095  -0.0338 0.0399  412 VAL A CG1 
2489 C CG2 . VAL A 399 ? 0.7428 0.7632 0.6436 0.1226  -0.0475 0.0554  412 VAL A CG2 
2490 N N   . LEU A 400 ? 0.7432 0.8606 0.7171 0.1135  -0.0452 0.0042  413 LEU A N   
2491 C CA  . LEU A 400 ? 0.6873 0.8381 0.6750 0.1056  -0.0426 -0.0080 413 LEU A CA  
2492 C C   . LEU A 400 ? 0.6582 0.8109 0.6270 0.0911  -0.0325 -0.0002 413 LEU A C   
2493 O O   . LEU A 400 ? 0.7941 0.9412 0.7540 0.0862  -0.0235 0.0053  413 LEU A O   
2494 C CB  . LEU A 400 ? 0.6658 0.8458 0.6806 0.1067  -0.0394 -0.0251 413 LEU A CB  
2495 C CG  . LEU A 400 ? 0.7692 0.9559 0.8088 0.1220  -0.0517 -0.0390 413 LEU A CG  
2496 C CD1 . LEU A 400 ? 0.8184 1.0348 0.8824 0.1232  -0.0467 -0.0574 413 LEU A CD1 
2497 C CD2 . LEU A 400 ? 0.7538 0.9553 0.8031 0.1252  -0.0618 -0.0456 413 LEU A CD2 
2498 N N   . ASP A 401 ? 0.7400 0.8991 0.7025 0.0841  -0.0357 0.0000  414 ASP A N   
2499 C CA  . ASP A 401 ? 0.7319 0.8919 0.6767 0.0692  -0.0289 0.0059  414 ASP A CA  
2500 C C   . ASP A 401 ? 0.7234 0.9199 0.6850 0.0565  -0.0221 -0.0056 414 ASP A C   
2501 O O   . ASP A 401 ? 0.7210 0.9462 0.7048 0.0560  -0.0256 -0.0184 414 ASP A O   
2502 C CB  . ASP A 401 ? 0.7158 0.8637 0.6447 0.0657  -0.0369 0.0112  414 ASP A CB  
2503 C CG  . ASP A 401 ? 0.7913 0.9238 0.6937 0.0541  -0.0329 0.0211  414 ASP A CG  
2504 O OD1 . ASP A 401 ? 0.8857 0.9930 0.7689 0.0593  -0.0296 0.0312  414 ASP A OD1 
2505 O OD2 . ASP A 401 ? 0.7499 0.8954 0.6507 0.0396  -0.0338 0.0186  414 ASP A OD2 
2506 N N   . VAL A 402 ? 0.7480 0.9454 0.6991 0.0464  -0.0127 -0.0016 415 VAL A N   
2507 C CA  . VAL A 402 ? 0.6567 0.8877 0.6178 0.0315  -0.0053 -0.0107 415 VAL A CA  
2508 C C   . VAL A 402 ? 0.5840 0.8061 0.5203 0.0140  -0.0036 -0.0005 415 VAL A C   
2509 O O   . VAL A 402 ? 0.5780 0.7721 0.4918 0.0140  -0.0023 0.0113  415 VAL A O   
2510 C CB  . VAL A 402 ? 0.6139 0.8542 0.5829 0.0334  0.0029  -0.0157 415 VAL A CB  
2511 C CG1 . VAL A 402 ? 0.5972 0.8735 0.5729 0.0170  0.0111  -0.0251 415 VAL A CG1 
2512 C CG2 . VAL A 402 ? 0.6308 0.8739 0.6225 0.0509  -0.0008 -0.0256 415 VAL A CG2 
2513 N N   . ASN A 403 ? 0.6060 0.8520 0.5468 -0.0011 -0.0044 -0.0055 416 ASN A N   
2514 C CA  . ASN A 403 ? 0.6683 0.9035 0.5843 -0.0204 -0.0052 0.0044  416 ASN A CA  
2515 C C   . ASN A 403 ? 0.6529 0.9274 0.5772 -0.0422 0.0013  -0.0030 416 ASN A C   
2516 O O   . ASN A 403 ? 0.6639 0.9723 0.6094 -0.0473 0.0005  -0.0139 416 ASN A O   
2517 C CB  . ASN A 403 ? 0.7183 0.9330 0.6228 -0.0203 -0.0163 0.0102  416 ASN A CB  
2518 C CG  . ASN A 403 ? 0.7330 0.9245 0.6072 -0.0377 -0.0201 0.0219  416 ASN A CG  
2519 O OD1 . ASN A 403 ? 0.7064 0.9131 0.5753 -0.0578 -0.0157 0.0227  416 ASN A OD1 
2520 N ND2 . ASN A 403 ? 0.8129 0.9665 0.6656 -0.0303 -0.0291 0.0308  416 ASN A ND2 
2521 N N   . MET A 404 ? 0.7401 1.0109 0.6468 -0.0552 0.0075  0.0031  417 MET A N   
2522 C CA  . MET A 404 ? 0.7267 1.0344 0.6365 -0.0777 0.0155  -0.0024 417 MET A CA  
2523 C C   . MET A 404 ? 0.6919 0.9815 0.5705 -0.1021 0.0117  0.0115  417 MET A C   
2524 O O   . MET A 404 ? 0.7301 1.0338 0.5975 -0.1214 0.0179  0.0136  417 MET A O   
2525 C CB  . MET A 404 ? 0.7375 1.0576 0.6511 -0.0744 0.0252  -0.0075 417 MET A CB  
2526 C CG  . MET A 404 ? 0.8497 1.1866 0.7933 -0.0523 0.0279  -0.0222 417 MET A CG  
2527 S SD  . MET A 404 ? 0.8139 1.2108 0.7944 -0.0547 0.0318  -0.0447 417 MET A SD  
2528 C CE  . MET A 404 ? 0.7616 1.1520 0.7695 -0.0225 0.0264  -0.0562 417 MET A CE  
2529 N N   . ASP A 405 ? 0.6542 0.9111 0.5170 -0.1018 0.0006  0.0210  418 ASP A N   
2530 C CA  . ASP A 405 ? 0.7434 0.9732 0.5737 -0.1229 -0.0064 0.0349  418 ASP A CA  
2531 C C   . ASP A 405 ? 0.9081 1.1679 0.7433 -0.1493 -0.0075 0.0323  418 ASP A C   
2532 O O   . ASP A 405 ? 0.9403 1.2084 0.7894 -0.1472 -0.0135 0.0274  418 ASP A O   
2533 C CB  . ASP A 405 ? 0.7179 0.8957 0.5264 -0.1094 -0.0189 0.0453  418 ASP A CB  
2534 C CG  . ASP A 405 ? 0.7746 0.9229 0.5733 -0.0881 -0.0177 0.0503  418 ASP A CG  
2535 O OD1 . ASP A 405 ? 0.7330 0.8991 0.5426 -0.0834 -0.0081 0.0460  418 ASP A OD1 
2536 O OD2 . ASP A 405 ? 0.7744 0.8830 0.5545 -0.0762 -0.0265 0.0577  418 ASP A OD2 
2537 N N   . ASP A 406 ? 1.0227 1.2999 0.8462 -0.1751 -0.0016 0.0357  419 ASP A N   
2538 C CA  . ASP A 406 ? 1.0429 1.3448 0.8638 -0.2064 -0.0026 0.0370  419 ASP A CA  
2539 C C   . ASP A 406 ? 1.0638 1.3614 0.8553 -0.2339 0.0005  0.0482  419 ASP A C   
2540 O O   . ASP A 406 ? 1.0810 1.3867 0.8703 -0.2298 0.0095  0.0465  419 ASP A O   
2541 C CB  . ASP A 406 ? 1.2277 1.5961 1.0898 -0.2082 0.0072  0.0179  419 ASP A CB  
2542 C CG  . ASP A 406 ? 1.1734 1.5738 1.0373 -0.2411 0.0065  0.0183  419 ASP A CG  
2543 O OD1 . ASP A 406 ? 1.1034 1.5266 0.9553 -0.2688 0.0145  0.0218  419 ASP A OD1 
2544 O OD2 . ASP A 406 ? 1.1480 1.5523 1.0249 -0.2404 -0.0020 0.0151  419 ASP A OD2 
2545 N N   . GLY A 407 ? 1.1079 1.3909 0.8755 -0.2627 -0.0079 0.0600  420 GLY A N   
2546 C CA  . GLY A 407 ? 1.1688 1.4439 0.9038 -0.2933 -0.0073 0.0731  420 GLY A CA  
2547 C C   . GLY A 407 ? 1.1739 1.5099 0.9236 -0.3094 0.0105  0.0635  420 GLY A C   
2548 O O   . GLY A 407 ? 1.2018 1.5306 0.9256 -0.3248 0.0136  0.0723  420 GLY A O   
2549 N N   . MET A 408 ? 1.0922 1.4882 0.8829 -0.3047 0.0215  0.0445  421 MET A N   
2550 C CA  . MET A 408 ? 1.1050 1.5658 0.9151 -0.3155 0.0395  0.0305  421 MET A CA  
2551 C C   . MET A 408 ? 1.0612 1.5332 0.8912 -0.2840 0.0487  0.0166  421 MET A C   
2552 O O   . MET A 408 ? 1.0903 1.6200 0.9480 -0.2823 0.0626  -0.0017 421 MET A O   
2553 C CB  . MET A 408 ? 1.0543 1.5792 0.9014 -0.3258 0.0461  0.0145  421 MET A CB  
2554 C CG  . MET A 408 ? 1.1546 1.6724 0.9897 -0.3550 0.0358  0.0258  421 MET A CG  
2555 S SD  . MET A 408 ? 1.3767 1.8647 1.1576 -0.4010 0.0315  0.0511  421 MET A SD  
2556 C CE  . MET A 408 ? 1.1550 1.7105 0.9418 -0.4186 0.0546  0.0405  421 MET A CE  
2557 N N   . LEU A 409 ? 1.0669 1.4856 0.8832 -0.2595 0.0407  0.0245  422 LEU A N   
2558 C CA  . LEU A 409 ? 1.0372 1.4607 0.8707 -0.2307 0.0474  0.0131  422 LEU A CA  
2559 C C   . LEU A 409 ? 0.9971 1.3718 0.7995 -0.2239 0.0426  0.0270  422 LEU A C   
2560 O O   . LEU A 409 ? 0.9946 1.3177 0.7685 -0.2260 0.0300  0.0440  422 LEU A O   
2561 C CB  . LEU A 409 ? 1.0818 1.4987 0.9449 -0.1985 0.0426  0.0032  422 LEU A CB  
2562 C CG  . LEU A 409 ? 1.0751 1.5466 0.9806 -0.1910 0.0485  -0.0177 422 LEU A CG  
2563 C CD1 . LEU A 409 ? 0.9254 1.3761 0.8514 -0.1574 0.0411  -0.0235 422 LEU A CD1 
2564 C CD2 . LEU A 409 ? 1.0794 1.6064 1.0046 -0.1935 0.0636  -0.0357 422 LEU A CD2 
2565 N N   . ASP A 410 ? 0.9652 1.3577 0.7747 -0.2147 0.0520  0.0182  423 ASP A N   
2566 C CA  . ASP A 410 ? 0.9957 1.3484 0.7845 -0.2027 0.0478  0.0276  423 ASP A CA  
2567 C C   . ASP A 410 ? 0.9944 1.3243 0.8030 -0.1687 0.0433  0.0232  423 ASP A C   
2568 O O   . ASP A 410 ? 0.9578 1.3110 0.7932 -0.1509 0.0503  0.0084  423 ASP A O   
2569 C CB  . ASP A 410 ? 1.1064 1.4899 0.8948 -0.2083 0.0592  0.0191  423 ASP A CB  
2570 C CG  . ASP A 410 ? 1.2544 1.5999 1.0221 -0.1975 0.0541  0.0285  423 ASP A CG  
2571 O OD1 . ASP A 410 ? 1.3271 1.6231 1.0756 -0.1903 0.0417  0.0436  423 ASP A OD1 
2572 O OD2 . ASP A 410 ? 1.3190 1.6859 1.0898 -0.1958 0.0621  0.0197  423 ASP A OD2 
2573 N N   . GLY A 411 ? 0.8685 1.1525 0.6625 -0.1606 0.0312  0.0361  424 GLY A N   
2574 C CA  . GLY A 411 ? 0.8607 1.1233 0.6703 -0.1315 0.0268  0.0336  424 GLY A CA  
2575 C C   . GLY A 411 ? 0.9439 1.2096 0.7673 -0.1114 0.0323  0.0267  424 GLY A C   
2576 O O   . GLY A 411 ? 0.8069 1.0937 0.6595 -0.0956 0.0368  0.0133  424 GLY A O   
2577 N N   . PRO A 412 ? 0.8751 1.1186 0.6773 -0.1122 0.0305  0.0357  425 PRO A N   
2578 C CA  . PRO A 412 ? 0.7906 1.0331 0.6036 -0.0946 0.0340  0.0308  425 PRO A CA  
2579 C C   . PRO A 412 ? 0.7994 1.0845 0.6387 -0.0923 0.0447  0.0128  425 PRO A C   
2580 O O   . PRO A 412 ? 0.9943 1.2807 0.8543 -0.0729 0.0461  0.0048  425 PRO A O   
2581 C CB  . PRO A 412 ? 0.8872 1.1075 0.6705 -0.1038 0.0299  0.0428  425 PRO A CB  
2582 C CG  . PRO A 412 ? 0.9080 1.0968 0.6640 -0.1151 0.0195  0.0573  425 PRO A CG  
2583 C CD  . PRO A 412 ? 0.9043 1.1165 0.6699 -0.1285 0.0222  0.0520  425 PRO A CD  
2584 N N   . SER A 413 ? 0.8645 1.1841 0.7021 -0.1123 0.0517  0.0061  426 SER A N   
2585 C CA  . SER A 413 ? 0.8404 1.2037 0.7013 -0.1102 0.0621  -0.0134 426 SER A CA  
2586 C C   . SER A 413 ? 0.8667 1.2538 0.7619 -0.0962 0.0637  -0.0288 426 SER A C   
2587 O O   . SER A 413 ? 0.9103 1.3092 0.8288 -0.0785 0.0660  -0.0428 426 SER A O   
2588 C CB  . SER A 413 ? 0.9475 1.3447 0.7949 -0.1370 0.0700  -0.0164 426 SER A CB  
2589 O OG  . SER A 413 ? 0.9986 1.3715 0.8121 -0.1500 0.0667  -0.0017 426 SER A OG  
2590 N N   . ALA A 414 ? 0.8501 1.2427 0.7476 -0.1042 0.0609  -0.0262 427 ALA A N   
2591 C CA  . ALA A 414 ? 0.8085 1.2233 0.7378 -0.0913 0.0602  -0.0400 427 ALA A CA  
2592 C C   . ALA A 414 ? 0.8473 1.2308 0.7887 -0.0641 0.0528  -0.0390 427 ALA A C   
2593 O O   . ALA A 414 ? 0.8612 1.2613 0.8302 -0.0473 0.0530  -0.0542 427 ALA A O   
2594 C CB  . ALA A 414 ? 0.7833 1.2034 0.7090 -0.1061 0.0563  -0.0343 427 ALA A CB  
2595 N N   . MET A 415 ? 0.7399 1.0782 0.6595 -0.0601 0.0458  -0.0213 428 MET A N   
2596 C CA  . MET A 415 ? 0.7338 1.0421 0.6600 -0.0373 0.0400  -0.0179 428 MET A CA  
2597 C C   . MET A 415 ? 0.7112 1.0259 0.6499 -0.0262 0.0442  -0.0270 428 MET A C   
2598 O O   . MET A 415 ? 0.7014 1.0195 0.6623 -0.0095 0.0423  -0.0369 428 MET A O   
2599 C CB  . MET A 415 ? 0.7819 1.0464 0.6808 -0.0366 0.0337  0.0012  428 MET A CB  
2600 C CG  . MET A 415 ? 0.7353 0.9712 0.6382 -0.0155 0.0290  0.0061  428 MET A CG  
2601 S SD  . MET A 415 ? 0.7711 1.0041 0.6897 -0.0028 0.0223  0.0025  428 MET A SD  
2602 C CE  . MET A 415 ? 0.8075 1.0180 0.6997 -0.0142 0.0155  0.0157  428 MET A CE  
2603 N N   . THR A 416 ? 0.6998 1.0140 0.6226 -0.0361 0.0484  -0.0232 429 THR A N   
2604 C CA  . THR A 416 ? 0.6651 0.9864 0.5965 -0.0290 0.0521  -0.0319 429 THR A CA  
2605 C C   . THR A 416 ? 0.6724 1.0301 0.6317 -0.0228 0.0563  -0.0542 429 THR A C   
2606 O O   . THR A 416 ? 0.6603 1.0143 0.6360 -0.0073 0.0544  -0.0631 429 THR A O   
2607 C CB  . THR A 416 ? 0.7858 1.1101 0.6943 -0.0453 0.0560  -0.0267 429 THR A CB  
2608 O OG1 . THR A 416 ? 0.8068 1.0941 0.6915 -0.0463 0.0500  -0.0078 429 THR A OG1 
2609 C CG2 . THR A 416 ? 0.6982 1.0364 0.6161 -0.0402 0.0601  -0.0391 429 THR A CG2 
2610 N N   . ARG A 417 ? 0.6297 1.0229 0.5945 -0.0351 0.0613  -0.0635 430 ARG A N   
2611 C CA  . ARG A 417 ? 0.7171 1.1515 0.7098 -0.0288 0.0658  -0.0873 430 ARG A CA  
2612 C C   . ARG A 417 ? 0.6697 1.0986 0.6881 -0.0079 0.0579  -0.0950 430 ARG A C   
2613 O O   . ARG A 417 ? 0.7903 1.2247 0.8291 0.0085  0.0557  -0.1101 430 ARG A O   
2614 C CB  . ARG A 417 ? 0.7625 1.2415 0.7553 -0.0489 0.0741  -0.0951 430 ARG A CB  
2615 C CG  . ARG A 417 ? 0.8231 1.3513 0.8476 -0.0409 0.0791  -0.1223 430 ARG A CG  
2616 C CD  . ARG A 417 ? 0.9670 1.5458 0.9900 -0.0639 0.0900  -0.1304 430 ARG A CD  
2617 N NE  . ARG A 417 ? 1.1335 1.7273 1.1375 -0.0786 0.0994  -0.1325 430 ARG A NE  
2618 C CZ  . ARG A 417 ? 1.4727 2.1111 1.4697 -0.1013 0.1107  -0.1389 430 ARG A CZ  
2619 N NH1 . ARG A 417 ? 1.3961 2.0712 1.4064 -0.1127 0.1142  -0.1441 430 ARG A NH1 
2620 N NH2 . ARG A 417 ? 1.5292 2.1770 1.5055 -0.1139 0.1182  -0.1399 430 ARG A NH2 
2621 N N   . PHE A 418 ? 0.7196 1.1355 0.7356 -0.0087 0.0522  -0.0846 431 PHE A N   
2622 C CA  . PHE A 418 ? 0.6786 1.0891 0.7164 0.0098  0.0432  -0.0908 431 PHE A CA  
2623 C C   . PHE A 418 ? 0.6198 0.9901 0.6574 0.0282  0.0358  -0.0844 431 PHE A C   
2624 O O   . PHE A 418 ? 0.6619 1.0318 0.7206 0.0457  0.0292  -0.0958 431 PHE A O   
2625 C CB  . PHE A 418 ? 0.5815 0.9847 0.6129 0.0033  0.0381  -0.0801 431 PHE A CB  
2626 C CG  . PHE A 418 ? 0.5791 0.9906 0.6356 0.0191  0.0293  -0.0905 431 PHE A CG  
2627 C CD1 . PHE A 418 ? 0.6002 1.0576 0.6862 0.0234  0.0309  -0.1132 431 PHE A CD1 
2628 C CD2 . PHE A 418 ? 0.6473 1.0224 0.6976 0.0300  0.0188  -0.0783 431 PHE A CD2 
2629 C CE1 . PHE A 418 ? 0.6118 1.0767 0.7219 0.0394  0.0207  -0.1234 431 PHE A CE1 
2630 C CE2 . PHE A 418 ? 0.5915 0.9725 0.6629 0.0444  0.0089  -0.0872 431 PHE A CE2 
2631 C CZ  . PHE A 418 ? 0.5721 0.9972 0.6740 0.0496  0.0091  -0.1096 431 PHE A CZ  
2632 N N   . CYS A 419 ? 0.6332 0.9704 0.6469 0.0239  0.0362  -0.0662 432 CYS A N   
2633 C CA  . CYS A 419 ? 0.6935 0.9960 0.7058 0.0379  0.0308  -0.0586 432 CYS A CA  
2634 C C   . CYS A 419 ? 0.6914 1.0026 0.7193 0.0462  0.0314  -0.0734 432 CYS A C   
2635 O O   . CYS A 419 ? 0.6984 0.9933 0.7389 0.0613  0.0239  -0.0770 432 CYS A O   
2636 C CB  . CYS A 419 ? 0.7180 0.9913 0.7039 0.0310  0.0322  -0.0386 432 CYS A CB  
2637 S SG  . CYS A 419 ? 0.8144 1.0646 0.7806 0.0274  0.0277  -0.0212 432 CYS A SG  
2638 N N   . ASN A 420 ? 0.7987 1.1341 0.8239 0.0359  0.0394  -0.0819 433 ASN A N   
2639 C CA  . ASN A 420 ? 0.6772 1.0235 0.7159 0.0430  0.0401  -0.0986 433 ASN A CA  
2640 C C   . ASN A 420 ? 0.6622 1.0320 0.7292 0.0569  0.0360  -0.1213 433 ASN A C   
2641 O O   . ASN A 420 ? 0.6956 1.0581 0.7759 0.0702  0.0304  -0.1332 433 ASN A O   
2642 C CB  . ASN A 420 ? 0.7045 1.0739 0.7309 0.0277  0.0498  -0.1030 433 ASN A CB  
2643 C CG  . ASN A 420 ? 0.6928 1.0351 0.6951 0.0195  0.0505  -0.0843 433 ASN A CG  
2644 O OD1 . ASN A 420 ? 0.6403 0.9502 0.6402 0.0275  0.0447  -0.0723 433 ASN A OD1 
2645 N ND2 . ASN A 420 ? 0.5907 0.9477 0.5752 0.0031  0.0573  -0.0819 433 ASN A ND2 
2646 N N   . LEU A 421 ? 0.6938 1.0909 0.7701 0.0541  0.0375  -0.1278 434 LEU A N   
2647 C CA  . LEU A 421 ? 0.7630 1.1853 0.8688 0.0692  0.0321  -0.1501 434 LEU A CA  
2648 C C   . LEU A 421 ? 0.7362 1.1243 0.8515 0.0880  0.0176  -0.1458 434 LEU A C   
2649 O O   . LEU A 421 ? 0.9441 1.3295 1.0784 0.1054  0.0090  -0.1614 434 LEU A O   
2650 C CB  . LEU A 421 ? 0.8411 1.3056 0.9555 0.0593  0.0376  -0.1574 434 LEU A CB  
2651 C CG  . LEU A 421 ? 0.8950 1.4098 1.0128 0.0461  0.0507  -0.1740 434 LEU A CG  
2652 C CD1 . LEU A 421 ? 0.8792 1.4296 0.9980 0.0292  0.0569  -0.1731 434 LEU A CD1 
2653 C CD2 . LEU A 421 ? 0.8696 1.4124 1.0155 0.0641  0.0489  -0.2036 434 LEU A CD2 
2654 N N   . ILE A 422 ? 0.8013 1.1622 0.9017 0.0844  0.0141  -0.1248 435 ILE A N   
2655 C CA  . ILE A 422 ? 0.7711 1.0951 0.8735 0.0993  0.0007  -0.1163 435 ILE A CA  
2656 C C   . ILE A 422 ? 0.7600 1.0543 0.8627 0.1092  -0.0049 -0.1162 435 ILE A C   
2657 O O   . ILE A 422 ? 0.7614 1.0408 0.8781 0.1255  -0.0174 -0.1241 435 ILE A O   
2658 C CB  . ILE A 422 ? 0.7685 1.0644 0.8472 0.0914  0.0005  -0.0915 435 ILE A CB  
2659 C CG1 . ILE A 422 ? 0.8350 1.1522 0.9177 0.0866  -0.0004 -0.0930 435 ILE A CG1 
2660 C CG2 . ILE A 422 ? 0.8663 1.1188 0.9387 0.1033  -0.0102 -0.0788 435 ILE A CG2 
2661 C CD1 . ILE A 422 ? 0.9515 1.2447 1.0091 0.0772  0.0000  -0.0714 435 ILE A CD1 
2662 N N   . ALA A 423 ? 0.7370 1.0218 0.8237 0.0987  0.0028  -0.1072 436 ALA A N   
2663 C CA  . ALA A 423 ? 0.8610 1.1188 0.9467 0.1043  -0.0019 -0.1056 436 ALA A CA  
2664 C C   . ALA A 423 ? 0.8014 1.0701 0.9095 0.1179  -0.0088 -0.1302 436 ALA A C   
2665 O O   . ALA A 423 ? 0.7687 1.0075 0.8803 0.1274  -0.0194 -0.1304 436 ALA A O   
2666 C CB  . ALA A 423 ? 0.8080 1.0644 0.8762 0.0900  0.0080  -0.0960 436 ALA A CB  
2667 N N   . SER A 424 ? 0.7726 1.0841 0.8951 0.1183  -0.0032 -0.1513 437 SER A N   
2668 C CA  . SER A 424 ? 0.9088 1.2364 1.0541 0.1333  -0.0095 -0.1787 437 SER A CA  
2669 C C   . SER A 424 ? 0.9319 1.2416 1.0947 0.1537  -0.0267 -0.1855 437 SER A C   
2670 O O   . SER A 424 ? 1.1867 1.4758 1.3593 0.1681  -0.0389 -0.1969 437 SER A O   
2671 C CB  . SER A 424 ? 0.9074 1.2917 1.0644 0.1285  0.0020  -0.2002 437 SER A CB  
2672 O OG  . SER A 424 ? 0.8295 1.2394 1.0014 0.1327  0.0004  -0.2063 437 SER A OG  
2673 N N   . GLU A 425 ? 0.8385 1.1534 1.0036 0.1547  -0.0292 -0.1785 438 GLU A N   
2674 C CA  . GLU A 425 ? 0.7902 1.0915 0.9717 0.1742  -0.0467 -0.1854 438 GLU A CA  
2675 C C   . GLU A 425 ? 0.7872 1.0312 0.9519 0.1772  -0.0590 -0.1621 438 GLU A C   
2676 O O   . GLU A 425 ? 0.8039 1.0329 0.9497 0.1666  -0.0550 -0.1394 438 GLU A O   
2677 C CB  . GLU A 425 ? 0.8403 1.1749 1.0324 0.1734  -0.0450 -0.1890 438 GLU A CB  
2678 C CG  . GLU A 425 ? 1.0924 1.4334 1.3111 0.1962  -0.0622 -0.2076 438 GLU A CG  
2679 C CD  . GLU A 425 ? 1.2365 1.6085 1.4816 0.2112  -0.0646 -0.2402 438 GLU A CD  
2680 O OE1 . GLU A 425 ? 0.9767 1.3870 1.2239 0.2007  -0.0485 -0.2520 438 GLU A OE1 
2681 O OE2 . GLU A 425 ? 1.7780 2.1351 2.0407 0.2340  -0.0833 -0.2544 438 GLU A OE2 
2682 N N   . PRO A 426 ? 0.8129 1.0244 0.9832 0.1912  -0.0744 -0.1679 439 PRO A N   
2683 C CA  . PRO A 426 ? 0.8758 1.0327 1.0274 0.1903  -0.0850 -0.1444 439 PRO A CA  
2684 C C   . PRO A 426 ? 0.8712 1.0099 1.0156 0.1945  -0.0943 -0.1297 439 PRO A C   
2685 O O   . PRO A 426 ? 1.0933 1.2002 1.2149 0.1854  -0.0939 -0.1048 439 PRO A O   
2686 C CB  . PRO A 426 ? 0.8615 0.9910 1.0238 0.2054  -0.1022 -0.1583 439 PRO A CB  
2687 C CG  . PRO A 426 ? 0.8754 1.0439 1.0658 0.2214  -0.1054 -0.1908 439 PRO A CG  
2688 C CD  . PRO A 426 ? 0.8327 1.0553 1.0259 0.2082  -0.0836 -0.1968 439 PRO A CD  
2689 N N   . ASP A 427 ? 0.7951 0.9562 0.9590 0.2080  -0.1027 -0.1455 440 ASP A N   
2690 C CA  . ASP A 427 ? 0.8605 1.0081 1.0184 0.2122  -0.1125 -0.1333 440 ASP A CA  
2691 C C   . ASP A 427 ? 0.8820 1.0379 1.0192 0.1938  -0.0971 -0.1131 440 ASP A C   
2692 O O   . ASP A 427 ? 0.9940 1.1191 1.1107 0.1906  -0.1016 -0.0921 440 ASP A O   
2693 C CB  . ASP A 427 ? 0.9202 1.1005 1.1068 0.2291  -0.1227 -0.1570 440 ASP A CB  
2694 N N   . ILE A 428 ? 0.8601 1.0564 1.0012 0.1816  -0.0796 -0.1198 441 ILE A N   
2695 C CA  . ILE A 428 ? 0.8248 1.0290 0.9467 0.1644  -0.0663 -0.1029 441 ILE A CA  
2696 C C   . ILE A 428 ? 0.8729 1.0487 0.9690 0.1519  -0.0572 -0.0819 441 ILE A C   
2697 O O   . ILE A 428 ? 0.8279 0.9852 0.9024 0.1445  -0.0545 -0.0622 441 ILE A O   
2698 C CB  . ILE A 428 ? 0.8033 1.0587 0.9359 0.1536  -0.0519 -0.1162 441 ILE A CB  
2699 C CG1 . ILE A 428 ? 0.9186 1.2121 1.0818 0.1657  -0.0589 -0.1407 441 ILE A CG1 
2700 C CG2 . ILE A 428 ? 0.7859 1.0436 0.8981 0.1374  -0.0429 -0.0989 441 ILE A CG2 
2701 C CD1 . ILE A 428 ? 0.9659 1.3140 1.1413 0.1538  -0.0439 -0.1558 441 ILE A CD1 
2702 N N   . ALA A 429 ? 0.8111 0.9851 0.9101 0.1501  -0.0531 -0.0875 442 ALA A N   
2703 C CA  . ALA A 429 ? 0.7526 0.9075 0.8313 0.1377  -0.0438 -0.0703 442 ALA A CA  
2704 C C   . ALA A 429 ? 0.7380 0.8489 0.7993 0.1387  -0.0514 -0.0494 442 ALA A C   
2705 O O   . ALA A 429 ? 0.7796 0.8788 0.8227 0.1279  -0.0429 -0.0324 442 ALA A O   
2706 C CB  . ALA A 429 ? 0.6705 0.8348 0.7581 0.1361  -0.0396 -0.0830 442 ALA A CB  
2707 N N   . LYS A 430 ? 0.7342 0.8224 0.8009 0.1514  -0.0678 -0.0510 443 LYS A N   
2708 C CA  . LYS A 430 ? 0.7252 0.7716 0.7732 0.1512  -0.0762 -0.0306 443 LYS A CA  
2709 C C   . LYS A 430 ? 0.6885 0.7302 0.7131 0.1418  -0.0674 -0.0104 443 LYS A C   
2710 O O   . LYS A 430 ? 0.6970 0.7172 0.7033 0.1340  -0.0636 0.0074  443 LYS A O   
2711 C CB  . LYS A 430 ? 0.7394 0.7647 0.7948 0.1669  -0.0969 -0.0358 443 LYS A CB  
2712 N N   . VAL A 431 ? 0.6698 0.7326 0.6954 0.1424  -0.0646 -0.0142 444 VAL A N   
2713 C CA  . VAL A 431 ? 0.7143 0.7693 0.7171 0.1363  -0.0596 0.0026  444 VAL A CA  
2714 C C   . VAL A 431 ? 0.6866 0.7551 0.6781 0.1234  -0.0428 0.0093  444 VAL A C   
2715 O O   . VAL A 431 ? 0.7412 0.8322 0.7438 0.1185  -0.0350 -0.0009 444 VAL A O   
2716 C CB  . VAL A 431 ? 0.7229 0.7909 0.7297 0.1417  -0.0661 -0.0034 444 VAL A CB  
2717 C CG1 . VAL A 431 ? 0.7730 0.8233 0.7882 0.1560  -0.0852 -0.0080 444 VAL A CG1 
2718 C CG2 . VAL A 431 ? 0.7034 0.8123 0.7292 0.1385  -0.0592 -0.0210 444 VAL A CG2 
2719 N N   . PRO A 432 ? 0.6904 0.7451 0.6586 0.1184  -0.0379 0.0262  445 PRO A N   
2720 C CA  . PRO A 432 ? 0.6405 0.7077 0.5980 0.1087  -0.0244 0.0311  445 PRO A CA  
2721 C C   . PRO A 432 ? 0.6434 0.7342 0.6050 0.1053  -0.0220 0.0218  445 PRO A C   
2722 O O   . PRO A 432 ? 0.7164 0.8143 0.6871 0.1104  -0.0300 0.0137  445 PRO A O   
2723 C CB  . PRO A 432 ? 0.6252 0.6716 0.5576 0.1077  -0.0223 0.0487  445 PRO A CB  
2724 C CG  . PRO A 432 ? 0.6784 0.7006 0.6076 0.1137  -0.0324 0.0554  445 PRO A CG  
2725 C CD  . PRO A 432 ? 0.6885 0.7152 0.6377 0.1219  -0.0446 0.0410  445 PRO A CD  
2726 N N   . LEU A 433 ? 0.7172 0.8202 0.6719 0.0959  -0.0118 0.0232  446 LEU A N   
2727 C CA  . LEU A 433 ? 0.6476 0.7699 0.6016 0.0890  -0.0093 0.0174  446 LEU A CA  
2728 C C   . LEU A 433 ? 0.7194 0.8285 0.6486 0.0844  -0.0063 0.0299  446 LEU A C   
2729 O O   . LEU A 433 ? 0.7866 0.8812 0.7021 0.0847  -0.0017 0.0405  446 LEU A O   
2730 C CB  . LEU A 433 ? 0.7063 0.8537 0.6715 0.0806  -0.0019 0.0071  446 LEU A CB  
2731 C CG  . LEU A 433 ? 0.9273 1.0927 0.9179 0.0859  -0.0047 -0.0095 446 LEU A CG  
2732 C CD1 . LEU A 433 ? 0.9962 1.1867 0.9928 0.0764  0.0039  -0.0189 446 LEU A CD1 
2733 C CD2 . LEU A 433 ? 0.9110 1.0905 0.9167 0.0919  -0.0128 -0.0206 446 LEU A CD2 
2734 N N   . CYS A 434 ? 0.7124 0.8272 0.6367 0.0805  -0.0096 0.0278  447 CYS A N   
2735 C CA  . CYS A 434 ? 0.6953 0.7963 0.5957 0.0763  -0.0090 0.0371  447 CYS A CA  
2736 C C   . CYS A 434 ? 0.6808 0.7990 0.5805 0.0627  -0.0053 0.0326  447 CYS A C   
2737 O O   . CYS A 434 ? 0.8001 0.9368 0.7100 0.0565  -0.0082 0.0243  447 CYS A O   
2738 C CB  . CYS A 434 ? 0.7640 0.8533 0.6566 0.0815  -0.0183 0.0391  447 CYS A CB  
2739 S SG  . CYS A 434 ? 0.7597 0.8260 0.6203 0.0796  -0.0201 0.0493  447 CYS A SG  
2740 N N   . ILE A 435 ? 0.7307 0.8445 0.6188 0.0574  0.0006  0.0381  448 ILE A N   
2741 C CA  . ILE A 435 ? 0.6343 0.7610 0.5177 0.0429  0.0036  0.0359  448 ILE A CA  
2742 C C   . ILE A 435 ? 0.6618 0.7724 0.5231 0.0367  -0.0019 0.0423  448 ILE A C   
2743 O O   . ILE A 435 ? 0.6002 0.6863 0.4413 0.0417  -0.0036 0.0513  448 ILE A O   
2744 C CB  . ILE A 435 ? 0.6617 0.7869 0.5392 0.0400  0.0098  0.0397  448 ILE A CB  
2745 C CG1 . ILE A 435 ? 0.7490 0.8836 0.6455 0.0470  0.0140  0.0347  448 ILE A CG1 
2746 C CG2 . ILE A 435 ? 0.7054 0.8450 0.5775 0.0237  0.0121  0.0371  448 ILE A CG2 
2747 C CD1 . ILE A 435 ? 0.7487 0.9092 0.6687 0.0454  0.0147  0.0206  448 ILE A CD1 
2748 N N   . ASP A 436 ? 0.6750 0.8005 0.5408 0.0258  -0.0051 0.0368  449 ASP A N   
2749 C CA  . ASP A 436 ? 0.7611 0.8707 0.6079 0.0189  -0.0128 0.0418  449 ASP A CA  
2750 C C   . ASP A 436 ? 0.7495 0.8635 0.5838 -0.0008 -0.0123 0.0440  449 ASP A C   
2751 O O   . ASP A 436 ? 0.9141 1.0579 0.7622 -0.0143 -0.0087 0.0368  449 ASP A O   
2752 C CB  . ASP A 436 ? 0.8670 0.9889 0.7276 0.0199  -0.0191 0.0349  449 ASP A CB  
2753 C CG  . ASP A 436 ? 0.8900 0.9881 0.7297 0.0179  -0.0290 0.0405  449 ASP A CG  
2754 O OD1 . ASP A 436 ? 0.8451 0.9316 0.6657 0.0047  -0.0318 0.0456  449 ASP A OD1 
2755 O OD2 . ASP A 436 ? 0.9234 1.0127 0.7645 0.0294  -0.0352 0.0399  449 ASP A OD2 
2756 N N   . SER A 437 ? 0.7155 0.8000 0.5229 -0.0025 -0.0163 0.0537  450 SER A N   
2757 C CA  . SER A 437 ? 0.7853 0.8653 0.5750 -0.0222 -0.0192 0.0583  450 SER A CA  
2758 C C   . SER A 437 ? 0.8181 0.8570 0.5762 -0.0206 -0.0292 0.0681  450 SER A C   
2759 O O   . SER A 437 ? 0.8460 0.8634 0.5958 -0.0028 -0.0304 0.0713  450 SER A O   
2760 C CB  . SER A 437 ? 0.7933 0.8892 0.5864 -0.0296 -0.0112 0.0578  450 SER A CB  
2761 O OG  . SER A 437 ? 0.8003 0.8901 0.5731 -0.0504 -0.0149 0.0636  450 SER A OG  
2762 N N   . SER A 438 ? 0.8010 0.8300 0.5416 -0.0397 -0.0366 0.0722  451 SER A N   
2763 C CA  . SER A 438 ? 0.8358 0.8226 0.5438 -0.0407 -0.0484 0.0811  451 SER A CA  
2764 C C   . SER A 438 ? 0.8058 0.7822 0.4997 -0.0444 -0.0479 0.0873  451 SER A C   
2765 O O   . SER A 438 ? 0.8691 0.8093 0.5364 -0.0426 -0.0587 0.0942  451 SER A O   
2766 C CB  . SER A 438 ? 0.8548 0.8318 0.5482 -0.0623 -0.0588 0.0840  451 SER A CB  
2767 O OG  . SER A 438 ? 0.8527 0.8488 0.5451 -0.0875 -0.0557 0.0864  451 SER A OG  
2768 N N   . ASN A 439 ? 0.7631 0.7708 0.4748 -0.0489 -0.0367 0.0839  452 ASN A N   
2769 C CA  . ASN A 439 ? 0.7774 0.7808 0.4775 -0.0546 -0.0359 0.0890  452 ASN A CA  
2770 C C   . ASN A 439 ? 0.8816 0.8964 0.5987 -0.0350 -0.0272 0.0853  452 ASN A C   
2771 O O   . ASN A 439 ? 0.9093 0.9556 0.6527 -0.0318 -0.0166 0.0773  452 ASN A O   
2772 C CB  . ASN A 439 ? 0.8283 0.8613 0.5323 -0.0801 -0.0301 0.0877  452 ASN A CB  
2773 C CG  . ASN A 439 ? 0.8928 0.9192 0.5793 -0.0899 -0.0311 0.0943  452 ASN A CG  
2774 O OD1 . ASN A 439 ? 0.9719 0.9904 0.6588 -0.0746 -0.0302 0.0951  452 ASN A OD1 
2775 N ND2 . ASN A 439 ? 1.0432 1.0748 0.7143 -0.1167 -0.0330 0.0990  452 ASN A ND2 
2776 N N   . PHE A 440 ? 0.9849 0.9745 0.6879 -0.0221 -0.0325 0.0905  453 PHE A N   
2777 C CA  . PHE A 440 ? 0.9694 0.9694 0.6886 -0.0039 -0.0250 0.0876  453 PHE A CA  
2778 C C   . PHE A 440 ? 0.8642 0.8930 0.5983 -0.0120 -0.0160 0.0842  453 PHE A C   
2779 O O   . PHE A 440 ? 0.7960 0.8434 0.5519 -0.0013 -0.0076 0.0790  453 PHE A O   
2780 C CB  . PHE A 440 ? 0.9447 0.9161 0.6470 0.0113  -0.0331 0.0928  453 PHE A CB  
2781 C CG  . PHE A 440 ? 0.9046 0.8885 0.6250 0.0303  -0.0253 0.0898  453 PHE A CG  
2782 C CD1 . PHE A 440 ? 0.9858 0.9725 0.7169 0.0447  -0.0208 0.0867  453 PHE A CD1 
2783 C CD2 . PHE A 440 ? 0.8251 0.8190 0.5513 0.0320  -0.0228 0.0904  453 PHE A CD2 
2784 C CE1 . PHE A 440 ? 1.0625 1.0618 0.8093 0.0591  -0.0133 0.0852  453 PHE A CE1 
2785 C CE2 . PHE A 440 ? 0.9329 0.9402 0.6769 0.0472  -0.0158 0.0880  453 PHE A CE2 
2786 C CZ  . PHE A 440 ? 0.9282 0.9386 0.6825 0.0599  -0.0107 0.0858  453 PHE A CZ  
2787 N N   . ALA A 441 ? 0.7985 0.8300 0.5192 -0.0316 -0.0183 0.0872  454 ALA A N   
2788 C CA  . ALA A 441 ? 0.7512 0.8113 0.4830 -0.0411 -0.0098 0.0828  454 ALA A CA  
2789 C C   . ALA A 441 ? 0.7548 0.8514 0.5148 -0.0435 0.0013  0.0712  454 ALA A C   
2790 O O   . ALA A 441 ? 0.7454 0.8654 0.5224 -0.0413 0.0092  0.0641  454 ALA A O   
2791 C CB  . ALA A 441 ? 0.7934 0.8482 0.5004 -0.0638 -0.0150 0.0893  454 ALA A CB  
2792 N N   . VAL A 442 ? 0.7478 0.8485 0.5128 -0.0472 0.0006  0.0686  455 VAL A N   
2793 C CA  . VAL A 442 ? 0.7310 0.8641 0.5247 -0.0450 0.0088  0.0566  455 VAL A CA  
2794 C C   . VAL A 442 ? 0.7389 0.8681 0.5504 -0.0223 0.0110  0.0534  455 VAL A C   
2795 O O   . VAL A 442 ? 0.7140 0.8648 0.5473 -0.0166 0.0178  0.0447  455 VAL A O   
2796 C CB  . VAL A 442 ? 0.7803 0.9195 0.5755 -0.0545 0.0057  0.0545  455 VAL A CB  
2797 C CG1 . VAL A 442 ? 0.7862 0.9575 0.6132 -0.0476 0.0120  0.0411  455 VAL A CG1 
2798 C CG2 . VAL A 442 ? 0.7779 0.9255 0.5565 -0.0810 0.0046  0.0580  455 VAL A CG2 
2799 N N   . ILE A 443 ? 0.7480 0.8490 0.5488 -0.0099 0.0049  0.0604  456 ILE A N   
2800 C CA  . ILE A 443 ? 0.7085 0.8042 0.5215 0.0095  0.0072  0.0599  456 ILE A CA  
2801 C C   . ILE A 443 ? 0.7399 0.8465 0.5629 0.0129  0.0130  0.0582  456 ILE A C   
2802 O O   . ILE A 443 ? 0.6832 0.8059 0.5275 0.0185  0.0182  0.0514  456 ILE A O   
2803 C CB  . ILE A 443 ? 0.7473 0.8121 0.5418 0.0213  0.0008  0.0682  456 ILE A CB  
2804 C CG1 . ILE A 443 ? 0.8023 0.8531 0.5858 0.0195  -0.0061 0.0693  456 ILE A CG1 
2805 C CG2 . ILE A 443 ? 0.8164 0.8803 0.6222 0.0385  0.0051  0.0686  456 ILE A CG2 
2806 C CD1 . ILE A 443 ? 0.8578 0.9231 0.6601 0.0234  -0.0041 0.0629  456 ILE A CD1 
2807 N N   . GLU A 444 ? 0.6739 0.7697 0.4805 0.0091  0.0102  0.0642  457 GLU A N   
2808 C CA  . GLU A 444 ? 0.7765 0.8801 0.5896 0.0120  0.0136  0.0636  457 GLU A CA  
2809 C C   . GLU A 444 ? 0.7862 0.9184 0.6169 0.0039  0.0205  0.0535  457 GLU A C   
2810 O O   . GLU A 444 ? 0.7974 0.9391 0.6433 0.0102  0.0243  0.0495  457 GLU A O   
2811 C CB  . GLU A 444 ? 0.8833 0.9705 0.6732 0.0071  0.0068  0.0713  457 GLU A CB  
2812 C CG  . GLU A 444 ? 1.0298 1.1175 0.8240 0.0160  0.0070  0.0730  457 GLU A CG  
2813 C CD  . GLU A 444 ? 1.1575 1.2219 0.9286 0.0183  -0.0030 0.0812  457 GLU A CD  
2814 O OE1 . GLU A 444 ? 1.1501 1.1973 0.8987 0.0084  -0.0106 0.0860  457 GLU A OE1 
2815 O OE2 . GLU A 444 ? 1.0468 1.1100 0.8226 0.0300  -0.0043 0.0828  457 GLU A OE2 
2816 N N   . ALA A 445 ? 0.7283 0.8332 0.6356 -0.0214 -0.0583 0.0287  458 ALA A N   
2817 C CA  . ALA A 445 ? 0.6795 0.8187 0.5918 -0.0242 -0.0590 0.0190  458 ALA A CA  
2818 C C   . ALA A 445 ? 0.7739 0.9230 0.6980 -0.0064 -0.0481 0.0102  458 ALA A C   
2819 O O   . ALA A 445 ? 0.7295 0.8853 0.6669 0.0006  -0.0459 0.0023  458 ALA A O   
2820 C CB  . ALA A 445 ? 0.6529 0.8187 0.5390 -0.0448 -0.0643 0.0174  458 ALA A CB  
2821 N N   . GLY A 446 ? 0.7427 0.8884 0.6575 0.0017  -0.0417 0.0113  459 GLY A N   
2822 C CA  . GLY A 446 ? 0.6543 0.8008 0.5707 0.0233  -0.0322 0.0048  459 GLY A CA  
2823 C C   . GLY A 446 ? 0.6699 0.7803 0.6019 0.0357  -0.0225 0.0066  459 GLY A C   
2824 O O   . GLY A 446 ? 0.7014 0.8059 0.6334 0.0487  -0.0162 -0.0003 459 GLY A O   
2825 N N   . LEU A 447 ? 0.6838 0.7693 0.6266 0.0313  -0.0205 0.0147  460 LEU A N   
2826 C CA  . LEU A 447 ? 0.6911 0.7496 0.6516 0.0375  -0.0094 0.0147  460 LEU A CA  
2827 C C   . LEU A 447 ? 0.7462 0.8125 0.7234 0.0313  -0.0110 0.0060  460 LEU A C   
2828 O O   . LEU A 447 ? 0.8235 0.8708 0.8043 0.0364  0.0003  0.0005  460 LEU A O   
2829 C CB  . LEU A 447 ? 0.7176 0.7614 0.6900 0.0340  -0.0090 0.0219  460 LEU A CB  
2830 C CG  . LEU A 447 ? 0.6906 0.7177 0.6472 0.0414  -0.0040 0.0291  460 LEU A CG  
2831 C CD1 . LEU A 447 ? 0.6443 0.6599 0.6093 0.0392  -0.0074 0.0345  460 LEU A CD1 
2832 C CD2 . LEU A 447 ? 0.8223 0.8270 0.7732 0.0550  0.0130  0.0290  460 LEU A CD2 
2833 N N   . LYS A 448 ? 0.6666 0.7566 0.6488 0.0193  -0.0249 0.0045  461 LYS A N   
2834 C CA  . LYS A 448 ? 0.7518 0.8544 0.7476 0.0130  -0.0288 -0.0052 461 LYS A CA  
2835 C C   . LYS A 448 ? 0.7225 0.8283 0.7060 0.0207  -0.0239 -0.0152 461 LYS A C   
2836 O O   . LYS A 448 ? 0.8652 0.9625 0.8572 0.0197  -0.0194 -0.0248 461 LYS A O   
2837 C CB  . LYS A 448 ? 0.6951 0.8217 0.6889 0.0007  -0.0457 -0.0036 461 LYS A CB  
2838 C CG  . LYS A 448 ? 0.7422 0.8611 0.7458 -0.0019 -0.0533 0.0038  461 LYS A CG  
2839 C CD  . LYS A 448 ? 0.7686 0.8978 0.7530 -0.0115 -0.0701 0.0094  461 LYS A CD  
2840 C CE  . LYS A 448 ? 0.7999 0.9125 0.7844 -0.0075 -0.0789 0.0178  461 LYS A CE  
2841 N NZ  . LYS A 448 ? 0.9148 1.0240 0.8695 -0.0158 -0.0952 0.0252  461 LYS A NZ  
2842 N N   . CYS A 449 ? 0.6949 0.8140 0.6573 0.0291  -0.0251 -0.0147 462 CYS A N   
2843 C CA  . CYS A 449 ? 0.8843 1.0128 0.8320 0.0426  -0.0229 -0.0259 462 CYS A CA  
2844 C C   . CYS A 449 ? 0.9178 1.0091 0.8504 0.0645  -0.0095 -0.0268 462 CYS A C   
2845 O O   . CYS A 449 ? 0.7635 0.8504 0.6797 0.0809  -0.0073 -0.0368 462 CYS A O   
2846 C CB  . CYS A 449 ? 0.7852 0.9585 0.7187 0.0414  -0.0316 -0.0285 462 CYS A CB  
2847 S SG  . CYS A 449 ? 1.0649 1.2716 1.0029 0.0140  -0.0453 -0.0270 462 CYS A SG  
2848 N N   . CYS A 450 ? 0.8761 0.9374 0.8095 0.0664  -0.0006 -0.0167 463 CYS A N   
2849 C CA  . CYS A 450 ? 0.9620 0.9821 0.8731 0.0868  0.0126  -0.0149 463 CYS A CA  
2850 C C   . CYS A 450 ? 0.7363 0.7091 0.6523 0.0799  0.0273  -0.0158 463 CYS A C   
2851 O O   . CYS A 450 ? 0.8762 0.8474 0.8172 0.0619  0.0307  -0.0123 463 CYS A O   
2852 C CB  . CYS A 450 ? 1.0987 1.1151 1.0013 0.0933  0.0152  -0.0042 463 CYS A CB  
2853 N N   . GLN A 451 ? 0.8064 0.7405 0.6957 0.0946  0.0361  -0.0216 464 GLN A N   
2854 C CA  . GLN A 451 ? 0.8282 0.7102 0.7135 0.0841  0.0525  -0.0246 464 GLN A CA  
2855 C C   . GLN A 451 ? 0.9346 0.7735 0.8066 0.0854  0.0699  -0.0133 464 GLN A C   
2856 O O   . GLN A 451 ? 1.0225 0.8450 0.9122 0.0637  0.0827  -0.0128 464 GLN A O   
2857 C CB  . GLN A 451 ? 0.8254 0.6700 0.6751 0.1015  0.0558  -0.0347 464 GLN A CB  
2858 C CG  . GLN A 451 ? 0.9183 0.7033 0.7574 0.0856  0.0730  -0.0407 464 GLN A CG  
2859 C CD  . GLN A 451 ? 0.9751 0.7088 0.7679 0.1065  0.0764  -0.0503 464 GLN A CD  
2860 O OE1 . GLN A 451 ? 1.1598 0.8373 0.9358 0.0924  0.0903  -0.0571 464 GLN A OE1 
2861 N NE2 . GLN A 451 ? 0.9734 0.7267 0.7439 0.1400  0.0637  -0.0527 464 GLN A NE2 
2862 N N   . GLY A 452 ? 0.9240 0.7489 0.7641 0.1111  0.0704  -0.0056 465 GLY A N   
2863 C CA  . GLY A 452 ? 0.9692 0.7508 0.7886 0.1156  0.0868  0.0055  465 GLY A CA  
2864 C C   . GLY A 452 ? 0.9446 0.7614 0.7933 0.1045  0.0840  0.0135  465 GLY A C   
2865 O O   . GLY A 452 ? 0.9462 0.8154 0.8256 0.0954  0.0683  0.0114  465 GLY A O   
2866 N N   . LYS A 453 ? 0.8928 0.6758 0.7271 0.1058  0.0999  0.0227  466 LYS A N   
2867 C CA  . LYS A 453 ? 0.7553 0.5646 0.6105 0.1000  0.0984  0.0296  466 LYS A CA  
2868 C C   . LYS A 453 ? 0.7376 0.5691 0.5740 0.1217  0.0848  0.0338  466 LYS A C   
2869 O O   . LYS A 453 ? 0.8473 0.6515 0.6437 0.1453  0.0885  0.0372  466 LYS A O   
2870 C CB  . LYS A 453 ? 0.7521 0.5212 0.5979 0.0928  0.1218  0.0360  466 LYS A CB  
2871 C CG  . LYS A 453 ? 0.7398 0.5353 0.6073 0.0886  0.1211  0.0411  466 LYS A CG  
2872 C CD  . LYS A 453 ? 0.8095 0.5787 0.6797 0.0750  0.1457  0.0434  466 LYS A CD  
2873 C CE  . LYS A 453 ? 0.7688 0.5517 0.6432 0.0811  0.1471  0.0493  466 LYS A CE  
2874 N NZ  . LYS A 453 ? 0.8302 0.5854 0.6982 0.0708  0.1742  0.0516  466 LYS A NZ  
2875 N N   . CYS A 454 ? 0.7965 0.6759 0.6588 0.1132  0.0691  0.0328  467 CYS A N   
2876 C CA  . CYS A 454 ? 0.7791 0.6889 0.6278 0.1257  0.0551  0.0331  467 CYS A CA  
2877 C C   . CYS A 454 ? 0.7805 0.6888 0.6280 0.1245  0.0576  0.0401  467 CYS A C   
2878 O O   . CYS A 454 ? 0.7464 0.6394 0.6103 0.1134  0.0675  0.0440  467 CYS A O   
2879 C CB  . CYS A 454 ? 0.7963 0.7553 0.6668 0.1121  0.0370  0.0267  467 CYS A CB  
2880 S SG  . CYS A 454 ? 1.0099 0.9790 0.8848 0.1120  0.0323  0.0162  467 CYS A SG  
2881 N N   . ILE A 455 ? 0.7921 0.7206 0.6203 0.1361  0.0483  0.0394  468 ILE A N   
2882 C CA  . ILE A 455 ? 0.7183 0.6543 0.5465 0.1306  0.0454  0.0428  468 ILE A CA  
2883 C C   . ILE A 455 ? 0.6842 0.6560 0.5325 0.1098  0.0296  0.0390  468 ILE A C   
2884 O O   . ILE A 455 ? 0.6524 0.6561 0.5021 0.1061  0.0189  0.0324  468 ILE A O   
2885 C CB  . ILE A 455 ? 0.7984 0.7441 0.5949 0.1492  0.0412  0.0412  468 ILE A CB  
2886 C CG1 . ILE A 455 ? 0.7905 0.7003 0.5541 0.1762  0.0530  0.0446  468 ILE A CG1 
2887 C CG2 . ILE A 455 ? 0.7273 0.6713 0.5212 0.1418  0.0407  0.0440  468 ILE A CG2 
2888 C CD1 . ILE A 455 ? 0.9062 0.7665 0.6621 0.1761  0.0727  0.0543  468 ILE A CD1 
2889 N N   . VAL A 456 ? 0.7050 0.6689 0.5642 0.0974  0.0288  0.0429  469 VAL A N   
2890 C CA  . VAL A 456 ? 0.6713 0.6549 0.5358 0.0788  0.0143  0.0414  469 VAL A CA  
2891 C C   . VAL A 456 ? 0.6955 0.6810 0.5369 0.0770  0.0100  0.0405  469 VAL A C   
2892 O O   . VAL A 456 ? 0.9313 0.8935 0.7633 0.0866  0.0181  0.0437  469 VAL A O   
2893 C CB  . VAL A 456 ? 0.6942 0.6631 0.5804 0.0690  0.0134  0.0451  469 VAL A CB  
2894 C CG1 . VAL A 456 ? 0.7322 0.7024 0.6087 0.0537  -0.0004 0.0462  469 VAL A CG1 
2895 C CG2 . VAL A 456 ? 0.6639 0.6425 0.5734 0.0650  0.0133  0.0426  469 VAL A CG2 
2896 N N   . ASN A 457 ? 0.7577 0.7726 0.5891 0.0622  -0.0019 0.0349  470 ASN A N   
2897 C CA  . ASN A 457 ? 0.7521 0.7766 0.5603 0.0556  -0.0065 0.0303  470 ASN A CA  
2898 C C   . ASN A 457 ? 0.7981 0.8328 0.5982 0.0255  -0.0177 0.0278  470 ASN A C   
2899 O O   . ASN A 457 ? 0.8264 0.9007 0.6266 0.0131  -0.0238 0.0208  470 ASN A O   
2900 C CB  . ASN A 457 ? 0.7675 0.8296 0.5649 0.0705  -0.0073 0.0214  470 ASN A CB  
2901 C CG  . ASN A 457 ? 0.8310 0.9107 0.6059 0.0657  -0.0117 0.0137  470 ASN A CG  
2902 O OD1 . ASN A 457 ? 0.9483 1.0025 0.7122 0.0521  -0.0121 0.0158  470 ASN A OD1 
2903 N ND2 . ASN A 457 ? 0.8349 0.9591 0.6011 0.0789  -0.0157 0.0030  470 ASN A ND2 
2904 N N   . SER A 458 ? 0.8001 0.7972 0.5888 0.0138  -0.0200 0.0330  471 SER A N   
2905 C CA  . SER A 458 ? 0.7834 0.7397 0.5697 0.0289  -0.0130 0.0383  471 SER A CA  
2906 C C   . SER A 458 ? 0.7580 0.6755 0.5404 0.0207  -0.0183 0.0445  471 SER A C   
2907 O O   . SER A 458 ? 0.8500 0.7678 0.6277 0.0034  -0.0273 0.0462  471 SER A O   
2908 C CB  . SER A 458 ? 0.7185 0.6733 0.4788 0.0279  -0.0121 0.0323  471 SER A CB  
2909 N N   . ILE A 459 ? 0.7599 0.6436 0.5411 0.0356  -0.0128 0.0475  472 ILE A N   
2910 C CA  . ILE A 459 ? 0.7668 0.6086 0.5326 0.0328  -0.0198 0.0510  472 ILE A CA  
2911 C C   . ILE A 459 ? 0.7780 0.5879 0.5151 0.0361  -0.0171 0.0478  472 ILE A C   
2912 O O   . ILE A 459 ? 0.7560 0.5805 0.4903 0.0421  -0.0093 0.0434  472 ILE A O   
2913 C CB  . ILE A 459 ? 0.7754 0.6096 0.5704 0.0512  -0.0180 0.0550  472 ILE A CB  
2914 C CG1 . ILE A 459 ? 0.7984 0.6388 0.6162 0.0728  -0.0023 0.0534  472 ILE A CG1 
2915 C CG2 . ILE A 459 ? 0.8025 0.6660 0.6219 0.0451  -0.0224 0.0565  472 ILE A CG2 
2916 C CD1 . ILE A 459 ? 0.8803 0.7192 0.7266 0.0885  0.0003  0.0535  472 ILE A CD1 
2917 N N   . SER A 460 ? 0.8636 0.6269 0.5747 0.0335  -0.0246 0.0495  473 SER A N   
2918 C CA  . SER A 460 ? 0.8739 0.5980 0.5534 0.0375  -0.0229 0.0453  473 SER A CA  
2919 C C   . SER A 460 ? 0.9100 0.5788 0.5689 0.0486  -0.0306 0.0485  473 SER A C   
2920 O O   . SER A 460 ? 1.0243 0.6896 0.6943 0.0537  -0.0380 0.0541  473 SER A O   
2921 C CB  . SER A 460 ? 0.8721 0.5946 0.5149 0.0081  -0.0270 0.0387  473 SER A CB  
2922 O OG  . SER A 460 ? 0.9475 0.6336 0.5551 -0.0169 -0.0377 0.0410  473 SER A OG  
2923 N N   . LEU A 461 ? 0.9927 0.6180 0.6190 0.0547  -0.0298 0.0438  474 LEU A N   
2924 C CA  . LEU A 461 ? 1.0718 0.6359 0.6687 0.0698  -0.0381 0.0451  474 LEU A CA  
2925 C C   . LEU A 461 ? 1.1651 0.6694 0.7001 0.0415  -0.0493 0.0460  474 LEU A C   
2926 O O   . LEU A 461 ? 1.2766 0.7134 0.7698 0.0524  -0.0563 0.0459  474 LEU A O   
2927 C CB  . LEU A 461 ? 1.1787 0.7253 0.7735 0.0973  -0.0295 0.0380  474 LEU A CB  
2928 C CG  . LEU A 461 ? 1.1704 0.7653 0.8200 0.1257  -0.0168 0.0369  474 LEU A CG  
2929 C CD1 . LEU A 461 ? 1.2040 0.7921 0.8479 0.1433  -0.0041 0.0290  474 LEU A CD1 
2930 C CD2 . LEU A 461 ? 1.1926 0.7864 0.8634 0.1496  -0.0236 0.0388  474 LEU A CD2 
2931 N N   . LYS A 462 ? 1.2253 0.7531 0.7519 0.0050  -0.0505 0.0460  475 LYS A N   
2932 C CA  . LYS A 462 ? 1.3869 0.8629 0.8539 -0.0311 -0.0583 0.0464  475 LYS A CA  
2933 C C   . LYS A 462 ? 1.3777 0.7822 0.8065 -0.0216 -0.0702 0.0560  475 LYS A C   
2934 O O   . LYS A 462 ? 1.4426 0.7675 0.8085 -0.0312 -0.0752 0.0554  475 LYS A O   
2935 C CB  . LYS A 462 ? 1.3673 0.8969 0.8442 -0.0683 -0.0576 0.0456  475 LYS A CB  
2936 N N   . GLU A 463 ? 1.3904 0.8208 0.8536 -0.0017 -0.0752 0.0641  476 GLU A N   
2937 C CA  . GLU A 463 ? 1.4113 0.7828 0.8406 0.0125  -0.0890 0.0735  476 GLU A CA  
2938 C C   . GLU A 463 ? 1.3991 0.7576 0.8471 0.0644  -0.0932 0.0722  476 GLU A C   
2939 O O   . GLU A 463 ? 1.3830 0.7256 0.8279 0.0871  -0.1053 0.0783  476 GLU A O   
2940 C CB  . GLU A 463 ? 1.3770 0.7877 0.8270 -0.0004 -0.0943 0.0815  476 GLU A CB  
2941 C CG  . GLU A 463 ? 1.5876 1.0120 1.0148 -0.0512 -0.0908 0.0817  476 GLU A CG  
2942 C CD  . GLU A 463 ? 1.9792 1.4347 1.4187 -0.0628 -0.0964 0.0894  476 GLU A CD  
2943 O OE1 . GLU A 463 ? 2.0491 1.5244 1.5224 -0.0316 -0.1029 0.0937  476 GLU A OE1 
2944 O OE2 . GLU A 463 ? 2.2001 1.6646 1.6159 -0.1046 -0.0939 0.0896  476 GLU A OE2 
2945 N N   . GLY A 464 ? 1.3386 0.7079 0.8052 0.0839  -0.0835 0.0629  477 GLY A N   
2946 C CA  . GLY A 464 ? 1.2331 0.5947 0.7159 0.1318  -0.0853 0.0583  477 GLY A CA  
2947 C C   . GLY A 464 ? 1.1484 0.5957 0.7101 0.1542  -0.0767 0.0548  477 GLY A C   
2948 O O   . GLY A 464 ? 1.0762 0.5824 0.6782 0.1356  -0.0712 0.0577  477 GLY A O   
2949 N N   . GLU A 465 ? 1.1243 0.5763 0.7046 0.1940  -0.0750 0.0472  478 GLU A N   
2950 C CA  . GLU A 465 ? 1.0492 0.5792 0.7008 0.2140  -0.0634 0.0407  478 GLU A CA  
2951 C C   . GLU A 465 ? 1.0149 0.5921 0.7064 0.2156  -0.0709 0.0443  478 GLU A C   
2952 O O   . GLU A 465 ? 1.0145 0.6532 0.7548 0.2013  -0.0598 0.0441  478 GLU A O   
2953 C CB  . GLU A 465 ? 1.1246 0.6476 0.7807 0.2562  -0.0613 0.0294  478 GLU A CB  
2954 C CG  . GLU A 465 ? 1.1613 0.7650 0.8878 0.2740  -0.0456 0.0198  478 GLU A CG  
2955 C CD  . GLU A 465 ? 1.2621 0.8643 0.9913 0.3139  -0.0414 0.0061  478 GLU A CD  
2956 O OE1 . GLU A 465 ? 1.2566 0.8102 0.9449 0.3186  -0.0377 0.0028  478 GLU A OE1 
2957 O OE2 . GLU A 465 ? 1.2242 0.8789 0.9976 0.3404  -0.0415 -0.0033 478 GLU A OE2 
2958 N N   . ASP A 466 ? 1.1348 0.6796 0.8010 0.2343  -0.0903 0.0472  479 ASP A N   
2959 C CA  . ASP A 466 ? 1.1232 0.7143 0.8257 0.2410  -0.0999 0.0484  479 ASP A CA  
2960 C C   . ASP A 466 ? 1.0645 0.6849 0.7813 0.2020  -0.0970 0.0566  479 ASP A C   
2961 O O   . ASP A 466 ? 1.0930 0.7773 0.8628 0.1997  -0.0930 0.0533  479 ASP A O   
2962 C CB  . ASP A 466 ? 1.1433 0.6809 0.7992 0.2672  -0.1241 0.0524  479 ASP A CB  
2963 C CG  . ASP A 466 ? 1.2079 0.7276 0.8561 0.3154  -0.1296 0.0414  479 ASP A CG  
2964 O OD1 . ASP A 466 ? 1.2421 0.8196 0.9428 0.3307  -0.1147 0.0285  479 ASP A OD1 
2965 O OD2 . ASP A 466 ? 1.3218 0.7677 0.9078 0.3387  -0.1483 0.0454  479 ASP A OD2 
2966 N N   . ASP A 467 ? 1.1580 0.7327 0.8263 0.1707  -0.0985 0.0653  480 ASP A N   
2967 C CA  . ASP A 467 ? 1.0928 0.6954 0.7691 0.1343  -0.0960 0.0713  480 ASP A CA  
2968 C C   . ASP A 467 ? 1.0336 0.6988 0.7616 0.1230  -0.0767 0.0657  480 ASP A C   
2969 O O   . ASP A 467 ? 0.9364 0.6511 0.7009 0.1118  -0.0734 0.0657  480 ASP A O   
2970 C CB  . ASP A 467 ? 1.2549 0.7987 0.8661 0.1019  -0.1001 0.0786  480 ASP A CB  
2971 C CG  . ASP A 467 ? 1.4477 1.0084 1.0525 0.0709  -0.1049 0.0855  480 ASP A CG  
2972 O OD1 . ASP A 467 ? 1.5690 1.0964 1.1416 0.0736  -0.1198 0.0930  480 ASP A OD1 
2973 O OD2 . ASP A 467 ? 1.3995 1.0061 1.0280 0.0458  -0.0942 0.0830  480 ASP A OD2 
2974 N N   . PHE A 468 ? 0.9436 0.6005 0.6688 0.1275  -0.0643 0.0608  481 PHE A N   
2975 C CA  . PHE A 468 ? 0.8189 0.5234 0.5829 0.1226  -0.0456 0.0563  481 PHE A CA  
2976 C C   . PHE A 468 ? 0.8344 0.5920 0.6560 0.1389  -0.0380 0.0513  481 PHE A C   
2977 O O   . PHE A 468 ? 0.7807 0.5794 0.6340 0.1266  -0.0283 0.0510  481 PHE A O   
2978 C CB  . PHE A 468 ? 0.8960 0.5758 0.6411 0.1316  -0.0356 0.0514  481 PHE A CB  
2979 C CG  . PHE A 468 ? 0.9208 0.6403 0.6965 0.1313  -0.0161 0.0477  481 PHE A CG  
2980 C CD1 . PHE A 468 ? 0.9445 0.6809 0.7149 0.1094  -0.0110 0.0496  481 PHE A CD1 
2981 C CD2 . PHE A 468 ? 0.9014 0.6402 0.7064 0.1540  -0.0027 0.0417  481 PHE A CD2 
2982 C CE1 . PHE A 468 ? 0.9718 0.7353 0.7606 0.1133  0.0056  0.0475  481 PHE A CE1 
2983 C CE2 . PHE A 468 ? 0.9003 0.6655 0.7236 0.1525  0.0164  0.0400  481 PHE A CE2 
2984 C CZ  . PHE A 468 ? 0.9238 0.6970 0.7362 0.1337  0.0199  0.0439  481 PHE A CZ  
2985 N N   . LEU A 469 ? 0.8552 0.6117 0.6882 0.1666  -0.0428 0.0459  482 LEU A N   
2986 C CA  . LEU A 469 ? 0.8594 0.6721 0.7486 0.1805  -0.0349 0.0374  482 LEU A CA  
2987 C C   . LEU A 469 ? 0.8967 0.7422 0.8100 0.1694  -0.0438 0.0389  482 LEU A C   
2988 O O   . LEU A 469 ? 1.0038 0.8971 0.9609 0.1619  -0.0318 0.0336  482 LEU A O   
2989 C CB  . LEU A 469 ? 0.8882 0.7003 0.7836 0.2154  -0.0402 0.0281  482 LEU A CB  
2990 C CG  . LEU A 469 ? 0.9066 0.7027 0.7921 0.2303  -0.0266 0.0223  482 LEU A CG  
2991 C CD1 . LEU A 469 ? 1.0143 0.8107 0.9026 0.2691  -0.0350 0.0114  482 LEU A CD1 
2992 C CD2 . LEU A 469 ? 0.9105 0.7509 0.8346 0.2190  -0.0005 0.0179  482 LEU A CD2 
2993 N N   . GLU A 470 ? 0.8593 0.6752 0.7397 0.1669  -0.0641 0.0458  483 GLU A N   
2994 C CA  . GLU A 470 ? 0.8811 0.7264 0.7794 0.1574  -0.0741 0.0469  483 GLU A CA  
2995 C C   . GLU A 470 ? 0.8871 0.7565 0.7993 0.1279  -0.0625 0.0495  483 GLU A C   
2996 O O   . GLU A 470 ? 1.0088 0.9220 0.9595 0.1219  -0.0583 0.0442  483 GLU A O   
2997 C CB  . GLU A 470 ? 0.9106 0.7105 0.7596 0.1587  -0.0969 0.0557  483 GLU A CB  
2998 C CG  . GLU A 470 ? 0.8943 0.7264 0.7614 0.1586  -0.1103 0.0548  483 GLU A CG  
2999 N N   . LYS A 471 ? 0.8899 0.7313 0.7693 0.1108  -0.0577 0.0557  484 LYS A N   
3000 C CA  . LYS A 471 ? 0.8445 0.7087 0.7316 0.0881  -0.0481 0.0569  484 LYS A CA  
3001 C C   . LYS A 471 ? 0.7656 0.6596 0.6891 0.0924  -0.0280 0.0510  484 LYS A C   
3002 O O   . LYS A 471 ? 0.8736 0.7955 0.8185 0.0826  -0.0214 0.0490  484 LYS A O   
3003 C CB  . LYS A 471 ? 0.9005 0.7354 0.7440 0.0705  -0.0490 0.0619  484 LYS A CB  
3004 C CG  . LYS A 471 ? 0.9387 0.7449 0.7413 0.0548  -0.0653 0.0683  484 LYS A CG  
3005 C CD  . LYS A 471 ? 1.0396 0.8096 0.7952 0.0370  -0.0652 0.0705  484 LYS A CD  
3006 C CE  . LYS A 471 ? 1.1858 0.9293 0.8977 0.0124  -0.0775 0.0766  484 LYS A CE  
3007 N NZ  . LYS A 471 ? 1.4695 1.1692 1.1301 -0.0078 -0.0773 0.0772  484 LYS A NZ  
3008 N N   . ALA A 472 ? 0.7253 0.6089 0.6507 0.1070  -0.0175 0.0482  485 ALA A N   
3009 C CA  . ALA A 472 ? 0.7202 0.6253 0.6732 0.1101  0.0038  0.0436  485 ALA A CA  
3010 C C   . ALA A 472 ? 0.7287 0.6718 0.7270 0.1130  0.0088  0.0356  485 ALA A C   
3011 O O   . ALA A 472 ? 0.6749 0.6363 0.6945 0.1049  0.0255  0.0324  485 ALA A O   
3012 C CB  . ALA A 472 ? 0.8274 0.7131 0.7686 0.1244  0.0140  0.0419  485 ALA A CB  
3013 N N   . ARG A 473 ? 0.8433 0.7965 0.8527 0.1244  -0.0059 0.0315  486 ARG A N   
3014 C CA  . ARG A 473 ? 0.8783 0.8769 0.9325 0.1265  -0.0049 0.0207  486 ARG A CA  
3015 C C   . ARG A 473 ? 0.8248 0.8408 0.8894 0.1070  -0.0087 0.0210  486 ARG A C   
3016 O O   . ARG A 473 ? 0.7870 0.8352 0.8858 0.0976  0.0027  0.0121  486 ARG A O   
3017 C CB  . ARG A 473 ? 0.8709 0.8769 0.9285 0.1493  -0.0239 0.0155  486 ARG A CB  
3018 C CG  . ARG A 473 ? 0.9925 1.0572 1.1012 0.1564  -0.0219 -0.0002 486 ARG A CG  
3019 C CD  . ARG A 473 ? 1.1358 1.2089 1.2444 0.1884  -0.0413 -0.0069 486 ARG A CD  
3020 N NE  . ARG A 473 ? 1.0996 1.1550 1.1965 0.2105  -0.0345 -0.0093 486 ARG A NE  
3021 C CZ  . ARG A 473 ? 1.0972 1.1017 1.1490 0.2327  -0.0497 -0.0027 486 ARG A CZ  
3022 N NH1 . ARG A 473 ? 1.1184 1.0799 1.1279 0.2346  -0.0725 0.0082  486 ARG A NH1 
3023 N NH2 . ARG A 473 ? 1.0742 1.0667 1.1189 0.2525  -0.0411 -0.0077 486 ARG A NH2 
3024 N N   . LYS A 474 ? 0.8365 0.8304 0.8695 0.0991  -0.0236 0.0300  487 LYS A N   
3025 C CA  . LYS A 474 ? 0.8261 0.8356 0.8640 0.0820  -0.0275 0.0299  487 LYS A CA  
3026 C C   . LYS A 474 ? 0.7825 0.7916 0.8223 0.0695  -0.0090 0.0300  487 LYS A C   
3027 O O   . LYS A 474 ? 0.8228 0.8512 0.8823 0.0596  -0.0035 0.0239  487 LYS A O   
3028 C CB  . LYS A 474 ? 0.9182 0.9062 0.9183 0.0753  -0.0462 0.0389  487 LYS A CB  
3029 C CG  . LYS A 474 ? 1.0564 1.0404 1.0480 0.0869  -0.0671 0.0396  487 LYS A CG  
3030 C CD  . LYS A 474 ? 1.1558 1.1158 1.1053 0.0740  -0.0824 0.0491  487 LYS A CD  
3031 C CE  . LYS A 474 ? 1.3817 1.3257 1.3112 0.0883  -0.1037 0.0520  487 LYS A CE  
3032 N NZ  . LYS A 474 ? 1.5401 1.4672 1.4311 0.0716  -0.1168 0.0604  487 LYS A NZ  
3033 N N   . ILE A 475 ? 0.7274 0.7116 0.7425 0.0717  -0.0003 0.0362  488 ILE A N   
3034 C CA  . ILE A 475 ? 0.7520 0.7307 0.7604 0.0662  0.0153  0.0370  488 ILE A CA  
3035 C C   . ILE A 475 ? 0.7098 0.6963 0.7448 0.0655  0.0357  0.0305  488 ILE A C   
3036 O O   . ILE A 475 ? 0.6414 0.6293 0.6810 0.0570  0.0444  0.0274  488 ILE A O   
3037 C CB  . ILE A 475 ? 0.8879 0.8424 0.8636 0.0715  0.0192  0.0435  488 ILE A CB  
3038 C CG1 . ILE A 475 ? 0.8453 0.7954 0.7927 0.0638  0.0021  0.0477  488 ILE A CG1 
3039 C CG2 . ILE A 475 ? 0.8662 0.8133 0.8328 0.0730  0.0357  0.0440  488 ILE A CG2 
3040 C CD1 . ILE A 475 ? 0.9401 0.8684 0.8564 0.0664  0.0018  0.0513  488 ILE A CD1 
3041 N N   . LYS A 476 ? 0.6258 0.6159 0.6755 0.0735  0.0439  0.0273  489 LYS A N   
3042 C CA  . LYS A 476 ? 0.6295 0.6340 0.7071 0.0680  0.0648  0.0189  489 LYS A CA  
3043 C C   . LYS A 476 ? 0.6279 0.6613 0.7362 0.0538  0.0629  0.0086  489 LYS A C   
3044 O O   . LYS A 476 ? 0.6823 0.7153 0.8009 0.0400  0.0818  0.0028  489 LYS A O   
3045 C CB  . LYS A 476 ? 0.7696 0.7892 0.8648 0.0800  0.0694  0.0133  489 LYS A CB  
3046 C CG  . LYS A 476 ? 0.7604 0.7958 0.8795 0.0716  0.0961  0.0044  489 LYS A CG  
3047 N N   . LYS A 477 ? 0.6510 0.7051 0.7690 0.0562  0.0404  0.0062  490 LYS A N   
3048 C CA  . LYS A 477 ? 0.6070 0.6923 0.7525 0.0440  0.0346  -0.0047 490 LYS A CA  
3049 C C   . LYS A 477 ? 0.6020 0.6700 0.7318 0.0303  0.0385  -0.0032 490 LYS A C   
3050 O O   . LYS A 477 ? 0.6678 0.7445 0.8147 0.0152  0.0499  -0.0133 490 LYS A O   
3051 C CB  . LYS A 477 ? 0.7119 0.8173 0.8614 0.0541  0.0076  -0.0054 490 LYS A CB  
3052 C CG  . LYS A 477 ? 0.7388 0.8891 0.9240 0.0477  -0.0005 -0.0203 490 LYS A CG  
3053 C CD  . LYS A 477 ? 0.8868 1.0544 1.0728 0.0675  -0.0258 -0.0207 490 LYS A CD  
3054 C CE  . LYS A 477 ? 0.9631 1.1681 1.1685 0.0631  -0.0425 -0.0314 490 LYS A CE  
3055 N NZ  . LYS A 477 ? 1.1781 1.4277 1.4284 0.0467  -0.0282 -0.0509 490 LYS A NZ  
3056 N N   . TYR A 478 ? 0.6445 1.0713 0.6420 -0.1310 -0.0752 0.0510  491 TYR A N   
3057 C CA  . TYR A 478 ? 0.7227 1.1193 0.6993 -0.1361 -0.0763 0.0326  491 TYR A CA  
3058 C C   . TYR A 478 ? 0.7652 1.1242 0.7511 -0.1356 -0.0539 0.0387  491 TYR A C   
3059 O O   . TYR A 478 ? 0.8594 1.1948 0.8444 -0.1443 -0.0522 0.0242  491 TYR A O   
3060 C CB  . TYR A 478 ? 0.7386 1.1219 0.6658 -0.1222 -0.0795 0.0292  491 TYR A CB  
3061 C CG  . TYR A 478 ? 0.6943 1.1063 0.6058 -0.1209 -0.0981 0.0221  491 TYR A CG  
3062 C CD1 . TYR A 478 ? 0.7856 1.2091 0.6952 -0.1310 -0.1155 0.0015  491 TYR A CD1 
3063 C CD2 . TYR A 478 ? 0.7193 1.1443 0.6155 -0.1074 -0.0968 0.0361  491 TYR A CD2 
3064 C CE1 . TYR A 478 ? 0.7890 1.2379 0.6790 -0.1251 -0.1307 -0.0030 491 TYR A CE1 
3065 C CE2 . TYR A 478 ? 0.8194 1.2676 0.6994 -0.1031 -0.1097 0.0328  491 TYR A CE2 
3066 C CZ  . TYR A 478 ? 0.8183 1.2793 0.6937 -0.1106 -0.1263 0.0141  491 TYR A CZ  
3067 O OH  . TYR A 478 ? 0.8272 1.3104 0.6816 -0.1017 -0.1371 0.0128  491 TYR A OH  
3068 N N   . GLY A 479 ? 0.7635 1.1146 0.7540 -0.1225 -0.0353 0.0609  492 GLY A N   
3069 C CA  . GLY A 479 ? 0.7356 1.0532 0.7359 -0.1173 -0.0103 0.0719  492 GLY A CA  
3070 C C   . GLY A 479 ? 0.6859 0.9655 0.6398 -0.0978 0.0003  0.0722  492 GLY A C   
3071 O O   . GLY A 479 ? 0.7336 0.9808 0.6867 -0.0951 0.0169  0.0729  492 GLY A O   
3072 N N   . ALA A 480 ? 0.6246 0.9087 0.5421 -0.0833 -0.0081 0.0718  493 ALA A N   
3073 C CA  . ALA A 480 ? 0.6429 0.8985 0.5189 -0.0641 -0.0021 0.0688  493 ALA A CA  
3074 C C   . ALA A 480 ? 0.6376 0.8796 0.4994 -0.0397 0.0141  0.0869  493 ALA A C   
3075 O O   . ALA A 480 ? 0.6075 0.8650 0.4839 -0.0360 0.0177  0.1015  493 ALA A O   
3076 C CB  . ALA A 480 ? 0.6244 0.8924 0.4733 -0.0629 -0.0203 0.0551  493 ALA A CB  
3077 N N   . ALA A 481 ? 0.6611 0.8742 0.4920 -0.0205 0.0237  0.0854  494 ALA A N   
3078 C CA  . ALA A 481 ? 0.7288 0.9313 0.5333 0.0075  0.0323  0.0957  494 ALA A CA  
3079 C C   . ALA A 481 ? 0.7344 0.9571 0.5239 0.0089  0.0133  0.0855  494 ALA A C   
3080 O O   . ALA A 481 ? 0.7112 0.9505 0.5062 -0.0085 -0.0021 0.0726  494 ALA A O   
3081 C CB  . ALA A 481 ? 0.7163 0.8871 0.4891 0.0299  0.0440  0.0936  494 ALA A CB  
3082 N N   . MET A 482 ? 0.8215 1.0412 0.5923 0.0304  0.0157  0.0909  495 MET A N   
3083 C CA  . MET A 482 ? 0.7605 0.9983 0.5270 0.0294  0.0017  0.0845  495 MET A CA  
3084 C C   . MET A 482 ? 0.7627 0.9888 0.5005 0.0560  0.0017  0.0804  495 MET A C   
3085 O O   . MET A 482 ? 0.6947 0.9061 0.4206 0.0775  0.0146  0.0924  495 MET A O   
3086 C CB  . MET A 482 ? 0.8199 1.0772 0.6121 0.0197  0.0033  0.0994  495 MET A CB  
3087 C CG  . MET A 482 ? 0.9378 1.2106 0.7275 0.0192  -0.0069 0.0966  495 MET A CG  
3088 S SD  . MET A 482 ? 0.9122 1.2099 0.7314 0.0100  -0.0039 0.1160  495 MET A SD  
3089 C CE  . MET A 482 ? 0.8091 1.0901 0.6254 0.0328  0.0162  0.1363  495 MET A CE  
3090 N N   . VAL A 483 ? 0.7579 0.9914 0.4863 0.0553  -0.0124 0.0629  496 VAL A N   
3091 C CA  . VAL A 483 ? 0.7802 1.0075 0.4875 0.0775  -0.0169 0.0533  496 VAL A CA  
3092 C C   . VAL A 483 ? 0.7761 1.0135 0.4938 0.0740  -0.0202 0.0569  496 VAL A C   
3093 O O   . VAL A 483 ? 0.7896 1.0427 0.5256 0.0540  -0.0264 0.0549  496 VAL A O   
3094 C CB  . VAL A 483 ? 0.7179 0.9487 0.4156 0.0788  -0.0299 0.0300  496 VAL A CB  
3095 C CG1 . VAL A 483 ? 0.7329 0.9614 0.4152 0.1001  -0.0377 0.0159  496 VAL A CG1 
3096 C CG2 . VAL A 483 ? 0.7352 0.9538 0.4186 0.0859  -0.0255 0.0271  496 VAL A CG2 
3097 N N   . VAL A 484 ? 0.7191 0.9454 0.4222 0.0960  -0.0144 0.0629  497 VAL A N   
3098 C CA  . VAL A 484 ? 0.7645 0.9946 0.4727 0.0972  -0.0160 0.0652  497 VAL A CA  
3099 C C   . VAL A 484 ? 0.7683 0.9911 0.4599 0.1131  -0.0270 0.0425  497 VAL A C   
3100 O O   . VAL A 484 ? 0.8160 1.0250 0.4814 0.1400  -0.0265 0.0372  497 VAL A O   
3101 C CB  . VAL A 484 ? 0.8089 1.0321 0.5147 0.1108  -0.0010 0.0885  497 VAL A CB  
3102 C CG1 . VAL A 484 ? 0.8681 1.0877 0.5689 0.1208  -0.0019 0.0883  497 VAL A CG1 
3103 C CG2 . VAL A 484 ? 0.8762 1.1148 0.6105 0.0899  0.0065  0.1078  497 VAL A CG2 
3104 N N   . MET A 485 ? 0.7951 1.0280 0.5036 0.0971  -0.0364 0.0288  498 MET A N   
3105 C CA  . MET A 485 ? 0.8254 1.0551 0.5300 0.1059  -0.0480 0.0037  498 MET A CA  
3106 C C   . MET A 485 ? 0.8225 1.0385 0.5160 0.1235  -0.0455 0.0045  498 MET A C   
3107 O O   . MET A 485 ? 0.8872 1.1007 0.5859 0.1202  -0.0348 0.0249  498 MET A O   
3108 C CB  . MET A 485 ? 0.8871 1.1303 0.6202 0.0812  -0.0535 -0.0068 498 MET A CB  
3109 C CG  . MET A 485 ? 0.9344 1.1839 0.6732 0.0822  -0.0666 -0.0350 498 MET A CG  
3110 S SD  . MET A 485 ? 1.0418 1.2974 0.7664 0.0866  -0.0702 -0.0385 498 MET A SD  
3111 C CE  . MET A 485 ? 0.9848 1.2434 0.7005 0.1088  -0.0869 -0.0715 498 MET A CE  
3112 N N   . ALA A 486 ? 0.8718 1.0797 0.5492 0.1437  -0.0563 -0.0187 499 ALA A N   
3113 C CA  . ALA A 486 ? 0.9266 1.1191 0.5918 0.1612  -0.0565 -0.0240 499 ALA A CA  
3114 C C   . ALA A 486 ? 0.9435 1.1373 0.6383 0.1416  -0.0605 -0.0374 499 ALA A C   
3115 O O   . ALA A 486 ? 0.9425 1.1327 0.6417 0.1469  -0.0732 -0.0663 499 ALA A O   
3116 C CB  . ALA A 486 ? 0.9271 1.1107 0.5603 0.1939  -0.0682 -0.0461 499 ALA A CB  
3117 N N   . PHE A 487 ? 0.8838 1.0831 0.6001 0.1197  -0.0489 -0.0165 500 PHE A N   
3118 C CA  . PHE A 487 ? 0.8964 1.0946 0.6408 0.1011  -0.0462 -0.0215 500 PHE A CA  
3119 C C   . PHE A 487 ? 0.9245 1.1163 0.6672 0.1013  -0.0305 0.0071  500 PHE A C   
3120 O O   . PHE A 487 ? 0.9370 1.1393 0.6758 0.0989  -0.0228 0.0317  500 PHE A O   
3121 C CB  . PHE A 487 ? 0.7879 1.0048 0.5593 0.0754  -0.0468 -0.0222 500 PHE A CB  
3122 C CG  . PHE A 487 ? 0.8200 1.0358 0.6226 0.0602  -0.0475 -0.0399 500 PHE A CG  
3123 C CD1 . PHE A 487 ? 0.9125 1.1184 0.7307 0.0513  -0.0339 -0.0276 500 PHE A CD1 
3124 C CD2 . PHE A 487 ? 0.8528 1.0780 0.6722 0.0551  -0.0598 -0.0678 500 PHE A CD2 
3125 C CE1 . PHE A 487 ? 0.9235 1.1250 0.7743 0.0369  -0.0303 -0.0421 500 PHE A CE1 
3126 C CE2 . PHE A 487 ? 0.8585 1.0835 0.7145 0.0393  -0.0579 -0.0837 500 PHE A CE2 
3127 C CZ  . PHE A 487 ? 0.9389 1.1502 0.8113 0.0297  -0.0419 -0.0704 500 PHE A CZ  
3128 N N   . ASP A 488 ? 0.8890 1.0641 0.6364 0.1045  -0.0255 0.0033  501 ASP A N   
3129 C CA  . ASP A 488 ? 0.8946 1.0650 0.6428 0.1047  -0.0094 0.0311  501 ASP A CA  
3130 C C   . ASP A 488 ? 0.8898 1.0491 0.6612 0.0920  -0.0015 0.0271  501 ASP A C   
3131 O O   . ASP A 488 ? 0.8635 1.0240 0.6576 0.0773  -0.0067 0.0068  501 ASP A O   
3132 C CB  . ASP A 488 ? 0.9181 1.0731 0.6370 0.1318  -0.0044 0.0412  501 ASP A CB  
3133 C CG  . ASP A 488 ? 0.9832 1.1116 0.6890 0.1487  -0.0099 0.0163  501 ASP A CG  
3134 O OD1 . ASP A 488 ? 0.9473 1.0713 0.6698 0.1389  -0.0206 -0.0129 501 ASP A OD1 
3135 O OD2 . ASP A 488 ? 0.9151 1.0275 0.5951 0.1726  -0.0036 0.0254  501 ASP A OD2 
3136 N N   . GLU A 489 ? 0.9770 1.1254 0.7445 0.0986  0.0130  0.0480  502 GLU A N   
3137 C CA  . GLU A 489 ? 1.0194 1.1529 0.8066 0.0895  0.0256  0.0495  502 GLU A CA  
3138 C C   . GLU A 489 ? 1.0586 1.1670 0.8572 0.0891  0.0197  0.0152  502 GLU A C   
3139 O O   . GLU A 489 ? 1.0641 1.1641 0.8915 0.0734  0.0275  0.0076  502 GLU A O   
3140 C CB  . GLU A 489 ? 1.0565 1.1807 0.8316 0.1027  0.0424  0.0779  502 GLU A CB  
3141 C CG  . GLU A 489 ? 1.0849 1.2385 0.8588 0.1003  0.0486  0.1109  502 GLU A CG  
3142 C CD  . GLU A 489 ? 1.1378 1.3033 0.8924 0.1151  0.0444  0.1229  502 GLU A CD  
3143 O OE1 . GLU A 489 ? 0.9563 1.1165 0.6979 0.1224  0.0332  0.1053  502 GLU A OE1 
3144 O OE2 . GLU A 489 ? 1.2318 1.4132 0.9857 0.1205  0.0535  0.1508  502 GLU A OE2 
3145 N N   . GLU A 490 ? 1.1461 1.2429 0.9231 0.1074  0.0065  -0.0056 503 GLU A N   
3146 C CA  . GLU A 490 ? 1.1758 1.2528 0.9632 0.1091  -0.0047 -0.0444 503 GLU A CA  
3147 C C   . GLU A 490 ? 1.1139 1.2089 0.9302 0.0913  -0.0194 -0.0722 503 GLU A C   
3148 O O   . GLU A 490 ? 1.3967 1.4806 1.2386 0.0843  -0.0263 -0.1041 503 GLU A O   
3149 C CB  . GLU A 490 ? 1.2772 1.3402 1.0264 0.1391  -0.0168 -0.0592 503 GLU A CB  
3150 C CG  . GLU A 490 ? 1.4414 1.4784 1.1659 0.1590  -0.0023 -0.0414 503 GLU A CG  
3151 C CD  . GLU A 490 ? 1.6615 1.6653 1.4004 0.1574  0.0011  -0.0642 503 GLU A CD  
3152 O OE1 . GLU A 490 ? 1.7850 1.7793 1.5291 0.1605  -0.0168 -0.1047 503 GLU A OE1 
3153 O OE2 . GLU A 490 ? 1.7922 1.7793 1.5378 0.1540  0.0218  -0.0425 503 GLU A OE2 
3154 N N   . GLY A 491 ? 1.0044 1.1271 0.8189 0.0844  -0.0242 -0.0614 504 GLY A N   
3155 C CA  . GLY A 491 ? 0.9720 1.1145 0.8105 0.0703  -0.0374 -0.0847 504 GLY A CA  
3156 C C   . GLY A 491 ? 0.9484 1.1069 0.7594 0.0859  -0.0546 -0.0931 504 GLY A C   
3157 O O   . GLY A 491 ? 0.9317 1.0903 0.7096 0.1016  -0.0514 -0.0718 504 GLY A O   
3158 N N   . GLN A 492 ? 0.8747 1.0469 0.7014 0.0826  -0.0712 -0.1235 505 GLN A N   
3159 C CA  . GLN A 492 ? 0.8065 0.9941 0.6072 0.0992  -0.0866 -0.1322 505 GLN A CA  
3160 C C   . GLN A 492 ? 0.8667 1.0402 0.6310 0.1316  -0.0992 -0.1496 505 GLN A C   
3161 O O   . GLN A 492 ? 0.8769 1.0398 0.6511 0.1369  -0.1097 -0.1794 505 GLN A O   
3162 C CB  . GLN A 492 ? 0.8073 1.0176 0.6380 0.0867  -0.1000 -0.1584 505 GLN A CB  
3163 C CG  . GLN A 492 ? 0.7946 1.0220 0.5990 0.1025  -0.1121 -0.1619 505 GLN A CG  
3164 C CD  . GLN A 492 ? 0.8179 1.0700 0.6529 0.0922  -0.1252 -0.1879 505 GLN A CD  
3165 O OE1 . GLN A 492 ? 0.8950 1.1527 0.7555 0.0922  -0.1393 -0.2217 505 GLN A OE1 
3166 N NE2 . GLN A 492 ? 0.8193 1.0872 0.6539 0.0837  -0.1210 -0.1735 505 GLN A NE2 
3167 N N   . ALA A 493 ? 0.8732 1.0464 0.5963 0.1540  -0.0977 -0.1318 506 ALA A N   
3168 C CA  . ALA A 493 ? 0.8979 1.0568 0.5783 0.1905  -0.1060 -0.1424 506 ALA A CA  
3169 C C   . ALA A 493 ? 0.8611 1.0339 0.5329 0.2078  -0.1299 -0.1784 506 ALA A C   
3170 O O   . ALA A 493 ? 0.8161 1.0047 0.4765 0.2136  -0.1330 -0.1736 506 ALA A O   
3171 C CB  . ALA A 493 ? 0.9234 1.0761 0.5667 0.2087  -0.0910 -0.1067 506 ALA A CB  
3172 N N   . THR A 494 ? 0.8828 1.0500 0.5608 0.2170  -0.1470 -0.2153 507 THR A N   
3173 C CA  . THR A 494 ? 0.9600 1.1454 0.6355 0.2338  -0.1736 -0.2555 507 THR A CA  
3174 C C   . THR A 494 ? 1.0345 1.2069 0.6557 0.2799  -0.1870 -0.2721 507 THR A C   
3175 O O   . THR A 494 ? 1.1290 1.3181 0.7377 0.3023  -0.2105 -0.3042 507 THR A O   
3176 C CB  . THR A 494 ? 0.9403 1.1362 0.6732 0.2081  -0.1876 -0.2935 507 THR A CB  
3177 O OG1 . THR A 494 ? 0.8951 1.0647 0.6307 0.2110  -0.1880 -0.3083 507 THR A OG1 
3178 C CG2 . THR A 494 ? 0.8795 1.0864 0.6636 0.1660  -0.1713 -0.2751 507 THR A CG2 
3179 N N   . GLU A 495 ? 0.9512 0.9613 0.8032 -0.1211 0.0412  -0.0297 508 GLU A N   
3180 C CA  . GLU A 495 ? 0.9335 0.9563 0.7945 -0.0945 -0.0139 -0.0413 508 GLU A CA  
3181 C C   . GLU A 495 ? 0.9925 0.9919 0.7992 -0.0392 -0.0407 -0.0135 508 GLU A C   
3182 O O   . GLU A 495 ? 1.0791 1.0428 0.8477 -0.0316 -0.0305 0.0170  508 GLU A O   
3183 C CB  . GLU A 495 ? 0.9998 0.9174 0.8057 -0.1219 -0.0001 -0.0371 508 GLU A CB  
3184 C CG  . GLU A 495 ? 1.2159 1.1177 1.0546 -0.2005 0.0386  -0.0712 508 GLU A CG  
3185 C CD  . GLU A 495 ? 1.5732 1.2932 1.3054 -0.2215 0.0801  -0.0445 508 GLU A CD  
3186 O OE1 . GLU A 495 ? 1.5257 1.1639 1.2032 -0.1690 0.0642  -0.0237 508 GLU A OE1 
3187 O OE2 . GLU A 495 ? 1.8522 1.4956 1.5539 -0.2880 0.1407  -0.0450 508 GLU A OE2 
3188 N N   . THR A 496 ? 0.9529 0.9561 0.7381 -0.0113 -0.0768 -0.0270 509 THR A N   
3189 C CA  . THR A 496 ? 0.9120 0.8640 0.6275 0.0231  -0.0779 -0.0054 509 THR A CA  
3190 C C   . THR A 496 ? 0.8739 0.7869 0.5872 0.0149  -0.0434 0.0179  509 THR A C   
3191 O O   . THR A 496 ? 0.9285 0.8424 0.6454 0.0158  -0.0355 0.0336  509 THR A O   
3192 C CB  . THR A 496 ? 0.9337 0.8270 0.5529 0.0443  -0.1096 -0.0179 509 THR A CB  
3193 O OG1 . THR A 496 ? 0.9884 0.9503 0.6475 0.0605  -0.1771 -0.0440 509 THR A OG1 
3194 C CG2 . THR A 496 ? 1.0222 0.8270 0.5400 0.0698  -0.0912 0.0059  509 THR A CG2 
3195 N N   . ASP A 497 ? 0.9096 0.7914 0.6332 0.0081  -0.0259 0.0141  510 ASP A N   
3196 C CA  . ASP A 497 ? 0.9826 0.8543 0.7583 0.0241  -0.0001 0.0325  510 ASP A CA  
3197 C C   . ASP A 497 ? 0.9528 0.8553 0.7714 0.0257  -0.0330 0.0640  510 ASP A C   
3198 O O   . ASP A 497 ? 0.9420 0.8911 0.8255 0.0352  -0.0500 0.0775  510 ASP A O   
3199 C CB  . ASP A 497 ? 1.1195 0.9185 0.8868 0.0347  0.0343  0.0177  510 ASP A CB  
3200 C CG  . ASP A 497 ? 1.4886 1.2154 1.1543 0.0257  0.0663  -0.0190 510 ASP A CG  
3201 O OD1 . ASP A 497 ? 1.3707 1.0818 1.0096 0.0328  0.1070  -0.0217 510 ASP A OD1 
3202 O OD2 . ASP A 497 ? 1.6341 1.3008 1.2249 0.0005  0.0526  -0.0486 510 ASP A OD2 
3203 N N   . THR A 498 ? 0.9197 0.7872 0.6902 0.0064  -0.0419 0.0715  511 THR A N   
3204 C CA  . THR A 498 ? 1.0558 0.8901 0.7810 0.0020  -0.0711 0.1056  511 THR A CA  
3205 C C   . THR A 498 ? 1.0095 0.8848 0.7111 -0.0131 -0.0929 0.1030  511 THR A C   
3206 O O   . THR A 498 ? 1.1818 1.0486 0.8590 -0.0119 -0.1437 0.1246  511 THR A O   
3207 C CB  . THR A 498 ? 1.1668 0.9169 0.8042 -0.0366 -0.0386 0.1086  511 THR A CB  
3208 O OG1 . THR A 498 ? 1.2918 1.1085 0.9583 -0.0707 -0.0035 0.0686  511 THR A OG1 
3209 C CG2 . THR A 498 ? 1.1725 0.8338 0.8022 -0.0358 -0.0134 0.1090  511 THR A CG2 
3210 N N   . LYS A 499 ? 0.8948 0.8011 0.5957 -0.0238 -0.0644 0.0741  512 LYS A N   
3211 C CA  . LYS A 499 ? 0.9107 0.8156 0.5725 -0.0337 -0.0677 0.0645  512 LYS A CA  
3212 C C   . LYS A 499 ? 0.8724 0.8020 0.5782 -0.0387 -0.0945 0.0679  512 LYS A C   
3213 O O   . LYS A 499 ? 0.9888 0.9064 0.6602 -0.0667 -0.1286 0.0676  512 LYS A O   
3214 C CB  . LYS A 499 ? 0.9273 0.8470 0.5981 -0.0153 -0.0377 0.0377  512 LYS A CB  
3215 C CG  . LYS A 499 ? 0.9480 0.8926 0.6394 -0.0197 -0.0028 0.0178  512 LYS A CG  
3216 C CD  . LYS A 499 ? 0.8925 0.8970 0.6576 0.0229  -0.0046 -0.0094 512 LYS A CD  
3217 C CE  . LYS A 499 ? 0.8468 0.9392 0.7209 0.0124  0.0331  -0.0432 512 LYS A CE  
3218 N NZ  . LYS A 499 ? 0.9123 0.9658 0.7472 -0.0076 0.1113  -0.0557 512 LYS A NZ  
3219 N N   . ILE A 500 ? 1.0621 0.6961 0.5409 0.0367  -0.0465 0.0564  513 ILE A N   
3220 C CA  . ILE A 500 ? 1.0672 0.6936 0.5395 0.0380  -0.0280 0.0537  513 ILE A CA  
3221 C C   . ILE A 500 ? 1.0150 0.6619 0.5157 0.0405  -0.0174 0.0529  513 ILE A C   
3222 O O   . ILE A 500 ? 1.1193 0.7824 0.6374 0.0411  -0.0065 0.0507  513 ILE A O   
3223 C CB  . ILE A 500 ? 1.1101 0.6962 0.5426 0.0385  -0.0207 0.0496  513 ILE A CB  
3224 C CG1 . ILE A 500 ? 1.1676 0.7295 0.5668 0.0381  -0.0326 0.0501  513 ILE A CG1 
3225 C CG2 . ILE A 500 ? 1.1501 0.7290 0.5795 0.0384  0.0024  0.0456  513 ILE A CG2 
3226 C CD1 . ILE A 500 ? 1.1989 0.7200 0.5549 0.0395  -0.0333 0.0463  513 ILE A CD1 
3227 N N   . ARG A 501 ? 0.9382 0.5833 0.4441 0.0423  -0.0213 0.0537  514 ARG A N   
3228 C CA  . ARG A 501 ? 1.0486 0.7099 0.5798 0.0468  -0.0144 0.0532  514 ARG A CA  
3229 C C   . ARG A 501 ? 1.0006 0.6970 0.5618 0.0483  -0.0165 0.0560  514 ARG A C   
3230 O O   . ARG A 501 ? 0.9872 0.6977 0.5665 0.0514  -0.0065 0.0515  514 ARG A O   
3231 C CB  . ARG A 501 ? 1.0043 0.6588 0.5368 0.0482  -0.0225 0.0563  514 ARG A CB  
3232 C CG  . ARG A 501 ? 1.0130 0.6782 0.5675 0.0548  -0.0174 0.0563  514 ARG A CG  
3233 C CD  . ARG A 501 ? 1.1701 0.8446 0.7362 0.0557  -0.0290 0.0644  514 ARG A CD  
3234 N NE  . ARG A 501 ? 1.1278 0.7804 0.6775 0.0511  -0.0364 0.0658  514 ARG A NE  
3235 C CZ  . ARG A 501 ? 1.1793 0.8359 0.7342 0.0475  -0.0460 0.0721  514 ARG A CZ  
3236 N NH1 . ARG A 501 ? 1.2343 0.9139 0.8057 0.0482  -0.0493 0.0790  514 ARG A NH1 
3237 N NH2 . ARG A 501 ? 1.3366 0.9732 0.8798 0.0426  -0.0517 0.0707  514 ARG A NH2 
3238 N N   . VAL A 502 ? 0.9819 0.6922 0.5490 0.0459  -0.0294 0.0618  515 VAL A N   
3239 C CA  . VAL A 502 ? 1.0025 0.7444 0.5939 0.0473  -0.0329 0.0646  515 VAL A CA  
3240 C C   . VAL A 502 ? 0.9548 0.7097 0.5546 0.0465  -0.0256 0.0597  515 VAL A C   
3241 O O   . VAL A 502 ? 0.9870 0.7637 0.6088 0.0502  -0.0215 0.0567  515 VAL A O   
3242 C CB  . VAL A 502 ? 0.9514 0.7024 0.5443 0.0432  -0.0454 0.0706  515 VAL A CB  
3243 C CG1 . VAL A 502 ? 0.9720 0.7536 0.5846 0.0439  -0.0478 0.0723  515 VAL A CG1 
3244 C CG2 . VAL A 502 ? 0.9201 0.6613 0.5106 0.0433  -0.0505 0.0755  515 VAL A CG2 
3245 N N   . CYS A 503 ? 0.9129 0.6533 0.4950 0.0421  -0.0250 0.0583  516 CYS A N   
3246 C CA  . CYS A 503 ? 0.9502 0.6979 0.5375 0.0403  -0.0173 0.0541  516 CYS A CA  
3247 C C   . CYS A 503 ? 0.9324 0.6753 0.5252 0.0417  0.0001  0.0470  516 CYS A C   
3248 O O   . CYS A 503 ? 0.9857 0.7474 0.5995 0.0414  0.0075  0.0419  516 CYS A O   
3249 C CB  . CYS A 503 ? 1.0473 0.7736 0.6094 0.0366  -0.0214 0.0551  516 CYS A CB  
3250 S SG  . CYS A 503 ? 1.0218 0.7598 0.5873 0.0347  -0.0412 0.0600  516 CYS A SG  
3251 N N   . THR A 504 ? 1.0718 0.7905 0.6481 0.0428  0.0073  0.0452  517 THR A N   
3252 C CA  . THR A 504 ? 1.1102 0.8234 0.6933 0.0435  0.0264  0.0369  517 THR A CA  
3253 C C   . THR A 504 ? 1.0408 0.7849 0.6624 0.0494  0.0272  0.0324  517 THR A C   
3254 O O   . THR A 504 ? 1.0124 0.7711 0.6573 0.0494  0.0393  0.0237  517 THR A O   
3255 C CB  . THR A 504 ? 1.0680 0.7470 0.6227 0.0436  0.0339  0.0353  517 THR A CB  
3256 O OG1 . THR A 504 ? 1.1548 0.8040 0.6707 0.0399  0.0291  0.0392  517 THR A OG1 
3257 C CG2 . THR A 504 ? 1.1275 0.7989 0.6883 0.0430  0.0572  0.0253  517 THR A CG2 
3258 N N   . ARG A 505 ? 1.0465 0.7989 0.6743 0.0545  0.0140  0.0379  518 ARG A N   
3259 C CA  . ARG A 505 ? 0.9694 0.7485 0.6288 0.0623  0.0099  0.0356  518 ARG A CA  
3260 C C   . ARG A 505 ? 0.9846 0.7948 0.6663 0.0623  0.0048  0.0340  518 ARG A C   
3261 O O   . ARG A 505 ? 1.1573 0.9892 0.8680 0.0667  0.0090  0.0252  518 ARG A O   
3262 C CB  . ARG A 505 ? 0.9331 0.7088 0.5866 0.0668  -0.0041 0.0447  518 ARG A CB  
3263 C CG  . ARG A 505 ? 1.0033 0.7983 0.6816 0.0770  -0.0102 0.0440  518 ARG A CG  
3264 C CD  . ARG A 505 ? 1.1339 0.9221 0.8008 0.0796  -0.0237 0.0556  518 ARG A CD  
3265 N NE  . ARG A 505 ? 1.0925 0.8983 0.7774 0.0901  -0.0326 0.0575  518 ARG A NE  
3266 C CZ  . ARG A 505 ? 1.1248 0.9278 0.8008 0.0931  -0.0439 0.0684  518 ARG A CZ  
3267 N NH1 . ARG A 505 ? 1.1000 0.8864 0.7548 0.0853  -0.0467 0.0772  518 ARG A NH1 
3268 N NH2 . ARG A 505 ? 1.1146 0.9306 0.8029 0.1043  -0.0525 0.0699  518 ARG A NH2 
3269 N N   . ALA A 506 ? 1.0102 0.8232 0.6802 0.0577  -0.0045 0.0409  519 ALA A N   
3270 C CA  . ALA A 506 ? 0.9952 0.8361 0.6828 0.0572  -0.0101 0.0395  519 ALA A CA  
3271 C C   . ALA A 506 ? 0.9329 0.7810 0.6357 0.0538  0.0033  0.0288  519 ALA A C   
3272 O O   . ALA A 506 ? 0.8999 0.7748 0.6314 0.0571  0.0034  0.0211  519 ALA A O   
3273 C CB  . ALA A 506 ? 0.9576 0.7963 0.6292 0.0520  -0.0200 0.0474  519 ALA A CB  
3274 N N   . TYR A 507 ? 0.8533 0.6756 0.5356 0.0474  0.0146  0.0280  520 TYR A N   
3275 C CA  . TYR A 507 ? 0.8878 0.7089 0.5797 0.0425  0.0314  0.0186  520 TYR A CA  
3276 C C   . TYR A 507 ? 0.9287 0.7655 0.6527 0.0461  0.0429  0.0066  520 TYR A C   
3277 O O   . TYR A 507 ? 1.0641 0.9207 0.8158 0.0442  0.0504  -0.0035 520 TYR A O   
3278 C CB  . TYR A 507 ? 0.9817 0.7633 0.6380 0.0366  0.0431  0.0210  520 TYR A CB  
3279 C CG  . TYR A 507 ? 0.9583 0.7310 0.6172 0.0301  0.0626  0.0133  520 TYR A CG  
3280 C CD1 . TYR A 507 ? 0.9377 0.7095 0.5918 0.0256  0.0610  0.0150  520 TYR A CD1 
3281 C CD2 . TYR A 507 ? 1.0007 0.7642 0.6675 0.0281  0.0841  0.0039  520 TYR A CD2 
3282 C CE1 . TYR A 507 ? 0.9307 0.6904 0.5857 0.0190  0.0803  0.0086  520 TYR A CE1 
3283 C CE2 . TYR A 507 ? 1.0338 0.7866 0.7028 0.0206  0.1050  -0.0032 520 TYR A CE2 
3284 C CZ  . TYR A 507 ? 0.9766 0.7263 0.6386 0.0159  0.1030  -0.0003 520 TYR A CZ  
3285 O OH  . TYR A 507 ? 0.9562 0.6916 0.6194 0.0079  0.1253  -0.0070 520 TYR A OH  
3286 N N   . HIS A 508 ? 0.9054 0.7343 0.6284 0.0515  0.0438  0.0064  521 HIS A N   
3287 C CA  . HIS A 508 ? 0.9101 0.7545 0.6667 0.0567  0.0532  -0.0061 521 HIS A CA  
3288 C C   . HIS A 508 ? 0.9311 0.8149 0.7246 0.0648  0.0389  -0.0110 521 HIS A C   
3289 O O   . HIS A 508 ? 0.9636 0.8695 0.7935 0.0663  0.0463  -0.0253 521 HIS A O   
3290 C CB  . HIS A 508 ? 0.9430 0.7688 0.6890 0.0619  0.0551  -0.0045 521 HIS A CB  
3291 N N   . LEU A 509 ? 0.9201 0.8117 0.7036 0.0699  0.0187  -0.0001 522 LEU A N   
3292 C CA  . LEU A 509 ? 0.8792 0.8037 0.6886 0.0785  0.0032  -0.0032 522 LEU A CA  
3293 C C   . LEU A 509 ? 0.9001 0.8471 0.7265 0.0734  0.0038  -0.0105 522 LEU A C   
3294 O O   . LEU A 509 ? 0.8657 0.8409 0.7263 0.0784  0.0010  -0.0229 522 LEU A O   
3295 C CB  . LEU A 509 ? 0.9279 0.8494 0.7157 0.0837  -0.0154 0.0115  522 LEU A CB  
3296 C CG  . LEU A 509 ? 1.0359 0.9385 0.8126 0.0906  -0.0186 0.0177  522 LEU A CG  
3297 C CD1 . LEU A 509 ? 1.0586 0.9498 0.8077 0.0910  -0.0320 0.0336  522 LEU A CD1 
3298 C CD2 . LEU A 509 ? 0.9601 0.8803 0.7672 0.1036  -0.0236 0.0086  522 LEU A CD2 
3299 N N   . LEU A 510 ? 0.8401 0.7743 0.6442 0.0641  0.0068  -0.0040 523 LEU A N   
3300 C CA  . LEU A 510 ? 0.8817 0.8339 0.6995 0.0589  0.0075  -0.0103 523 LEU A CA  
3301 C C   . LEU A 510 ? 0.8887 0.8460 0.7337 0.0536  0.0264  -0.0259 523 LEU A C   
3302 O O   . LEU A 510 ? 0.7604 0.7466 0.6392 0.0552  0.0247  -0.0386 523 LEU A O   
3303 C CB  . LEU A 510 ? 0.8276 0.7621 0.6154 0.0512  0.0061  0.0001  523 LEU A CB  
3304 C CG  . LEU A 510 ? 0.8188 0.7537 0.5863 0.0541  -0.0111 0.0131  523 LEU A CG  
3305 C CD1 . LEU A 510 ? 0.7840 0.7047 0.5302 0.0466  -0.0116 0.0194  523 LEU A CD1 
3306 C CD2 . LEU A 510 ? 0.7807 0.7469 0.5655 0.0607  -0.0250 0.0107  523 LEU A CD2 
3307 N N   . VAL A 511 ? 0.9692 0.8972 0.7988 0.0471  0.0450  -0.0258 524 VAL A N   
3308 C CA  . VAL A 511 ? 0.9943 0.9202 0.8440 0.0394  0.0674  -0.0394 524 VAL A CA  
3309 C C   . VAL A 511 ? 1.0180 0.9658 0.9100 0.0445  0.0743  -0.0555 524 VAL A C   
3310 O O   . VAL A 511 ? 0.9245 0.8971 0.8556 0.0424  0.0805  -0.0712 524 VAL A O   
3311 C CB  . VAL A 511 ? 1.1191 1.0016 0.9318 0.0307  0.0863  -0.0334 524 VAL A CB  
3312 C CG1 . VAL A 511 ? 1.3150 1.1913 1.1466 0.0218  0.1135  -0.0473 524 VAL A CG1 
3313 C CG2 . VAL A 511 ? 1.0272 0.8904 0.8035 0.0268  0.0776  -0.0200 524 VAL A CG2 
3314 N N   . LYS A 512 ? 1.0363 0.9761 0.9236 0.0517  0.0724  -0.0531 525 LYS A N   
3315 C CA  . LYS A 512 ? 1.1124 1.0727 1.0420 0.0584  0.0777  -0.0692 525 LYS A CA  
3316 C C   . LYS A 512 ? 0.9670 0.9670 0.9302 0.0706  0.0542  -0.0754 525 LYS A C   
3317 O O   . LYS A 512 ? 0.9182 0.9476 0.9244 0.0710  0.0561  -0.0927 525 LYS A O   
3318 C CB  . LYS A 512 ? 1.1211 1.0588 1.0350 0.0631  0.0828  -0.0651 525 LYS A CB  
3319 N N   . LYS A 513 ? 0.9658 0.9648 0.9077 0.0805  0.0320  -0.0617 526 LYS A N   
3320 C CA  . LYS A 513 ? 0.9916 1.0212 0.9569 0.0946  0.0087  -0.0656 526 LYS A CA  
3321 C C   . LYS A 513 ? 0.9653 1.0226 0.9448 0.0936  -0.0025 -0.0712 526 LYS A C   
3322 O O   . LYS A 513 ? 1.0698 1.1576 1.0816 0.1037  -0.0166 -0.0832 526 LYS A O   
3323 C CB  . LYS A 513 ? 1.0692 1.0839 1.0009 0.1038  -0.0095 -0.0473 526 LYS A CB  
3324 C CG  . LYS A 513 ? 1.1925 1.2265 1.1443 0.1212  -0.0297 -0.0511 526 LYS A CG  
3325 C CD  . LYS A 513 ? 1.2737 1.3037 1.2493 0.1285  -0.0218 -0.0609 526 LYS A CD  
3326 N N   . LEU A 514 ? 0.8913 0.9378 0.8472 0.0823  0.0026  -0.0635 527 LEU A N   
3327 C CA  . LEU A 514 ? 0.8187 0.8884 0.7831 0.0809  -0.0079 -0.0675 527 LEU A CA  
3328 C C   . LEU A 514 ? 0.8562 0.9314 0.8417 0.0684  0.0097  -0.0805 527 LEU A C   
3329 O O   . LEU A 514 ? 0.8326 0.9321 0.8366 0.0680  0.0019  -0.0895 527 LEU A O   
3330 C CB  . LEU A 514 ? 0.8093 0.8660 0.7316 0.0796  -0.0200 -0.0484 527 LEU A CB  
3331 C CG  . LEU A 514 ? 0.8870 0.9552 0.7979 0.0920  -0.0436 -0.0405 527 LEU A CG  
3332 C CD1 . LEU A 514 ? 0.9974 1.0615 0.9130 0.1041  -0.0499 -0.0393 527 LEU A CD1 
3333 C CD2 . LEU A 514 ? 0.9539 1.0037 0.8234 0.0876  -0.0488 -0.0219 527 LEU A CD2 
3334 N N   . GLY A 515 ? 0.8536 0.9039 0.8338 0.0583  0.0337  -0.0815 528 GLY A N   
3335 C CA  . GLY A 515 ? 0.7987 0.8456 0.7919 0.0452  0.0532  -0.0912 528 GLY A CA  
3336 C C   . GLY A 515 ? 0.7706 0.8061 0.7344 0.0387  0.0489  -0.0800 528 GLY A C   
3337 O O   . GLY A 515 ? 0.7796 0.8222 0.7593 0.0310  0.0566  -0.0891 528 GLY A O   
3338 N N   . PHE A 516 ? 0.8130 0.8306 0.7363 0.0417  0.0369  -0.0614 529 PHE A N   
3339 C CA  . PHE A 516 ? 0.8522 0.8582 0.7478 0.0367  0.0316  -0.0505 529 PHE A CA  
3340 C C   . PHE A 516 ? 0.8267 0.8007 0.7066 0.0255  0.0527  -0.0494 529 PHE A C   
3341 O O   . PHE A 516 ? 1.0885 1.0358 0.9529 0.0229  0.0669  -0.0463 529 PHE A O   
3342 C CB  . PHE A 516 ? 0.9676 0.9596 0.8269 0.0419  0.0168  -0.0324 529 PHE A CB  
3343 C CG  . PHE A 516 ? 1.0113 1.0086 0.8552 0.0411  0.0036  -0.0247 529 PHE A CG  
3344 C CD1 . PHE A 516 ? 1.1333 1.1585 0.9864 0.0478  -0.0132 -0.0258 529 PHE A CD1 
3345 C CD2 . PHE A 516 ? 1.0693 1.0425 0.8881 0.0342  0.0079  -0.0167 529 PHE A CD2 
3346 C CE1 . PHE A 516 ? 1.1247 1.1547 0.9640 0.0464  -0.0229 -0.0198 529 PHE A CE1 
3347 C CE2 . PHE A 516 ? 1.0827 1.0627 0.8919 0.0337  -0.0035 -0.0113 529 PHE A CE2 
3348 C CZ  . PHE A 516 ? 1.0501 1.0591 0.8703 0.0391  -0.0176 -0.0132 529 PHE A CZ  
3349 N N   . ASN A 517 ? 0.9074 0.8821 0.7896 0.0191  0.0554  -0.0521 530 ASN A N   
3350 C CA  . ASN A 517 ? 0.9646 0.9039 0.8259 0.0095  0.0737  -0.0490 530 ASN A CA  
3351 C C   . ASN A 517 ? 0.9885 0.8933 0.8018 0.0110  0.0685  -0.0310 530 ASN A C   
3352 O O   . ASN A 517 ? 0.9799 0.8895 0.7783 0.0151  0.0503  -0.0217 530 ASN A O   
3353 C CB  . ASN A 517 ? 1.0215 0.9675 0.8925 0.0042  0.0736  -0.0539 530 ASN A CB  
3354 C CG  . ASN A 517 ? 1.1952 1.1028 1.0476 -0.0054 0.0945  -0.0522 530 ASN A CG  
3355 O OD1 . ASN A 517 ? 1.1894 1.0592 1.0053 -0.0069 0.1028  -0.0415 530 ASN A OD1 
3356 N ND2 . ASN A 517 ? 1.2034 1.1184 1.0786 -0.0119 0.1028  -0.0629 530 ASN A ND2 
3357 N N   . PRO A 518 ? 0.9700 0.8398 0.7592 0.0075  0.0847  -0.0272 531 PRO A N   
3358 C CA  . PRO A 518 ? 0.9592 0.7962 0.7027 0.0097  0.0775  -0.0118 531 PRO A CA  
3359 C C   . PRO A 518 ? 0.9064 0.7243 0.6239 0.0078  0.0698  -0.0033 531 PRO A C   
3360 O O   . PRO A 518 ? 0.9261 0.7269 0.6132 0.0113  0.0569  0.0078  531 PRO A O   
3361 C CB  . PRO A 518 ? 1.0063 0.8090 0.7301 0.0055  0.0994  -0.0126 531 PRO A CB  
3362 C CG  . PRO A 518 ? 1.0346 0.8432 0.7878 -0.0020 0.1218  -0.0266 531 PRO A CG  
3363 C CD  . PRO A 518 ? 0.9570 0.8150 0.7592 0.0011  0.1106  -0.0378 531 PRO A CD  
3364 N N   . ASN A 519 ? 0.9431 0.7645 0.6750 0.0028  0.0769  -0.0096 532 ASN A N   
3365 C CA  . ASN A 519 ? 0.9816 0.7886 0.6950 0.0023  0.0681  -0.0032 532 ASN A CA  
3366 C C   . ASN A 519 ? 0.9564 0.7968 0.6859 0.0072  0.0462  -0.0025 532 ASN A C   
3367 O O   . ASN A 519 ? 1.0811 0.9124 0.7971 0.0083  0.0363  0.0026  532 ASN A O   
3368 C CB  . ASN A 519 ? 1.0088 0.8022 0.7299 -0.0051 0.0857  -0.0102 532 ASN A CB  
3369 C CG  . ASN A 519 ? 1.0868 0.8341 0.7774 -0.0106 0.1081  -0.0073 532 ASN A CG  
3370 O OD1 . ASN A 519 ? 1.0524 0.7630 0.6987 -0.0078 0.1044  0.0043  532 ASN A OD1 
3371 N ND2 . ASN A 519 ? 1.1529 0.9009 0.8664 -0.0185 0.1318  -0.0187 532 ASN A ND2 
3372 N N   . ASP A 520 ? 0.9002 0.7778 0.6574 0.0107  0.0389  -0.0079 533 ASP A N   
3373 C CA  . ASP A 520 ? 0.8923 0.7986 0.6585 0.0154  0.0196  -0.0060 533 ASP A CA  
3374 C C   . ASP A 520 ? 0.8538 0.7551 0.5992 0.0204  0.0069  0.0052  533 ASP A C   
3375 O O   . ASP A 520 ? 0.7413 0.6621 0.4902 0.0235  -0.0071 0.0081  533 ASP A O   
3376 C CB  . ASP A 520 ? 0.8745 0.8213 0.6776 0.0172  0.0170  -0.0179 533 ASP A CB  
3377 C CG  . ASP A 520 ? 0.9264 0.8841 0.7538 0.0121  0.0249  -0.0304 533 ASP A CG  
3378 O OD1 . ASP A 520 ? 0.9416 0.8886 0.7603 0.0095  0.0235  -0.0283 533 ASP A OD1 
3379 O OD2 . ASP A 520 ? 1.3471 1.3249 1.2050 0.0109  0.0321  -0.0435 533 ASP A OD2 
3380 N N   . ILE A 521 ? 0.7710 0.6452 0.4946 0.0206  0.0131  0.0107  534 ILE A N   
3381 C CA  . ILE A 521 ? 0.8028 0.6706 0.5084 0.0246  0.0023  0.0200  534 ILE A CA  
3382 C C   . ILE A 521 ? 0.8194 0.6581 0.4939 0.0241  -0.0047 0.0286  534 ILE A C   
3383 O O   . ILE A 521 ? 0.9410 0.7467 0.5919 0.0222  0.0034  0.0304  534 ILE A O   
3384 C CB  . ILE A 521 ? 0.8214 0.6789 0.5233 0.0263  0.0111  0.0197  534 ILE A CB  
3385 C CG1 . ILE A 521 ? 0.8581 0.7468 0.5942 0.0290  0.0145  0.0101  534 ILE A CG1 
3386 C CG2 . ILE A 521 ? 0.8754 0.7238 0.5585 0.0301  0.0000  0.0289  534 ILE A CG2 
3387 C CD1 . ILE A 521 ? 0.8809 0.7608 0.6208 0.0305  0.0264  0.0061  534 ILE A CD1 
3388 N N   . ILE A 522 ? 0.8585 0.7094 0.5331 0.0261  -0.0199 0.0331  535 ILE A N   
3389 C CA  . ILE A 522 ? 0.7663 0.5957 0.4177 0.0268  -0.0304 0.0396  535 ILE A CA  
3390 C C   . ILE A 522 ? 0.8097 0.6377 0.4535 0.0287  -0.0365 0.0449  535 ILE A C   
3391 O O   . ILE A 522 ? 0.8049 0.6570 0.4651 0.0299  -0.0390 0.0451  535 ILE A O   
3392 C CB  . ILE A 522 ? 0.7899 0.6368 0.4534 0.0267  -0.0420 0.0386  535 ILE A CB  
3393 C CG1 . ILE A 522 ? 0.8445 0.6926 0.5175 0.0251  -0.0359 0.0326  535 ILE A CG1 
3394 C CG2 . ILE A 522 ? 0.9467 0.7752 0.5923 0.0282  -0.0549 0.0431  535 ILE A CG2 
3395 C CD1 . ILE A 522 ? 0.9123 0.7871 0.6063 0.0251  -0.0441 0.0285  535 ILE A CD1 
3396 N N   . PHE A 523 ? 0.8877 0.6852 0.5046 0.0292  -0.0390 0.0490  536 PHE A N   
3397 C CA  . PHE A 523 ? 0.8689 0.6617 0.4780 0.0304  -0.0455 0.0532  536 PHE A CA  
3398 C C   . PHE A 523 ? 0.8991 0.6860 0.5007 0.0302  -0.0607 0.0554  536 PHE A C   
3399 O O   . PHE A 523 ? 0.8509 0.6195 0.4379 0.0310  -0.0658 0.0545  536 PHE A O   
3400 C CB  . PHE A 523 ? 0.8982 0.6613 0.4838 0.0312  -0.0367 0.0539  536 PHE A CB  
3401 C CG  . PHE A 523 ? 0.9375 0.7107 0.5372 0.0320  -0.0228 0.0506  536 PHE A CG  
3402 C CD1 . PHE A 523 ? 0.8930 0.6892 0.5122 0.0344  -0.0258 0.0514  536 PHE A CD1 
3403 C CD2 . PHE A 523 ? 1.0134 0.7719 0.6073 0.0305  -0.0065 0.0460  536 PHE A CD2 
3404 C CE1 . PHE A 523 ? 0.9346 0.7414 0.5699 0.0369  -0.0157 0.0469  536 PHE A CE1 
3405 C CE2 . PHE A 523 ? 0.9172 0.6881 0.5304 0.0313  0.0060  0.0404  536 PHE A CE2 
3406 C CZ  . PHE A 523 ? 0.8845 0.6807 0.5197 0.0353  0.0000  0.0405  536 PHE A CZ  
3407 N N   . ASP A 524 ? 0.9202 0.7219 0.5326 0.0293  -0.0680 0.0576  537 ASP A N   
3408 C CA  . ASP A 524 ? 0.9028 0.7015 0.5141 0.0281  -0.0816 0.0576  537 ASP A CA  
3409 C C   . ASP A 524 ? 1.0501 0.8331 0.6495 0.0276  -0.0848 0.0601  537 ASP A C   
3410 O O   . ASP A 524 ? 0.9182 0.7148 0.5299 0.0256  -0.0843 0.0627  537 ASP A O   
3411 C CB  . ASP A 524 ? 0.8020 0.6323 0.4398 0.0255  -0.0855 0.0564  537 ASP A CB  
3412 C CG  . ASP A 524 ? 0.9336 0.7642 0.5775 0.0238  -0.0985 0.0534  537 ASP A CG  
3413 O OD1 . ASP A 524 ? 0.9753 0.7852 0.6055 0.0242  -0.1063 0.0530  537 ASP A OD1 
3414 O OD2 . ASP A 524 ? 1.0354 0.8880 0.6997 0.0221  -0.1010 0.0499  537 ASP A OD2 
3415 N N   . PRO A 525 ? 1.2113 0.9630 0.7841 0.0295  -0.0877 0.0593  538 PRO A N   
3416 C CA  . PRO A 525 ? 1.1413 0.8790 0.7050 0.0286  -0.0951 0.0593  538 PRO A CA  
3417 C C   . PRO A 525 ? 1.2183 0.9705 0.8001 0.0260  -0.1088 0.0562  538 PRO A C   
3418 O O   . PRO A 525 ? 1.6238 1.3803 1.2100 0.0275  -0.1159 0.0530  538 PRO A O   
3419 C CB  . PRO A 525 ? 1.1888 0.8895 0.7172 0.0319  -0.0970 0.0576  538 PRO A CB  
3420 C CG  . PRO A 525 ? 1.1015 0.7954 0.6199 0.0339  -0.0869 0.0581  538 PRO A CG  
3421 C CD  . PRO A 525 ? 1.1025 0.8288 0.6510 0.0324  -0.0864 0.0579  538 PRO A CD  
3422 N N   . ASN A 526 ? 1.0617 0.8218 0.6564 0.0220  -0.1116 0.0565  539 ASN A N   
3423 C CA  . ASN A 526 ? 1.0248 0.8063 0.6455 0.0176  -0.1193 0.0529  539 ASN A CA  
3424 C C   . ASN A 526 ? 1.0332 0.8031 0.6519 0.0187  -0.1363 0.0450  539 ASN A C   
3425 O O   . ASN A 526 ? 1.1869 0.9354 0.7906 0.0191  -0.1433 0.0425  539 ASN A O   
3426 C CB  . ASN A 526 ? 0.9466 0.7382 0.5813 0.0118  -0.1137 0.0562  539 ASN A CB  
3427 C CG  . ASN A 526 ? 1.0191 0.8176 0.6515 0.0133  -0.1002 0.0640  539 ASN A CG  
3428 O OD1 . ASN A 526 ? 1.1373 0.9569 0.7811 0.0135  -0.0947 0.0658  539 ASN A OD1 
3429 N ND2 . ASN A 526 ? 1.0963 0.8767 0.7142 0.0151  -0.0957 0.0674  539 ASN A ND2 
3430 N N   . ILE A 527 ? 1.0085 0.7922 0.6423 0.0200  -0.1440 0.0401  540 ILE A N   
3431 C CA  . ILE A 527 ? 0.9325 0.7110 0.5723 0.0220  -0.1628 0.0308  540 ILE A CA  
3432 C C   . ILE A 527 ? 0.8875 0.6871 0.5608 0.0141  -0.1651 0.0250  540 ILE A C   
3433 O O   . ILE A 527 ? 0.8944 0.7218 0.5963 0.0095  -0.1592 0.0235  540 ILE A O   
3434 C CB  . ILE A 527 ? 0.9545 0.7398 0.6013 0.0274  -0.1705 0.0269  540 ILE A CB  
3435 C CG1 . ILE A 527 ? 0.9952 0.7531 0.6058 0.0346  -0.1678 0.0323  540 ILE A CG1 
3436 C CG2 . ILE A 527 ? 1.0018 0.7877 0.6635 0.0303  -0.1919 0.0155  540 ILE A CG2 
3437 C CD1 . ILE A 527 ? 0.9806 0.7380 0.5929 0.0407  -0.1753 0.0294  540 ILE A CD1 
3438 N N   . LEU A 528 ? 0.9162 0.7015 0.5853 0.0118  -0.1724 0.0211  541 LEU A N   
3439 C CA  . LEU A 528 ? 0.9459 0.7472 0.6463 0.0027  -0.1721 0.0152  541 LEU A CA  
3440 C C   . LEU A 528 ? 0.9917 0.7943 0.7107 0.0037  -0.1931 0.0004  541 LEU A C   
3441 O O   . LEU A 528 ? 1.0133 0.7962 0.7113 0.0128  -0.2101 -0.0040 541 LEU A O   
3442 C CB  . LEU A 528 ? 1.0230 0.8082 0.7103 -0.0018 -0.1637 0.0204  541 LEU A CB  
3443 C CG  . LEU A 528 ? 1.0050 0.7856 0.6729 -0.0007 -0.1460 0.0338  541 LEU A CG  
3444 C CD1 . LEU A 528 ? 1.1718 0.9339 0.8288 -0.0039 -0.1407 0.0369  541 LEU A CD1 
3445 C CD2 . LEU A 528 ? 0.9638 0.7715 0.6514 -0.0049 -0.1325 0.0394  541 LEU A CD2 
3446 N N   . THR A 529 ? 1.0103 0.8351 0.7683 -0.0054 -0.1915 -0.0075 542 THR A N   
3447 C CA  . THR A 529 ? 1.0416 0.8750 0.8290 -0.0056 -0.2107 -0.0246 542 THR A CA  
3448 C C   . THR A 529 ? 1.1042 0.9106 0.8724 -0.0022 -0.2276 -0.0311 542 THR A C   
3449 O O   . THR A 529 ? 1.2880 1.0785 1.0400 -0.0069 -0.2187 -0.0257 542 THR A O   
3450 C CB  . THR A 529 ? 1.0697 0.9314 0.9048 -0.0191 -0.2002 -0.0323 542 THR A CB  
3451 O OG1 . THR A 529 ? 1.0400 0.9246 0.8879 -0.0227 -0.1825 -0.0257 542 THR A OG1 
3452 C CG2 . THR A 529 ? 1.0196 0.8958 0.8939 -0.0191 -0.2201 -0.0527 542 THR A CG2 
3453 N N   . ILE A 530 ? 1.0935 0.8933 0.8617 0.0068  -0.2527 -0.0432 543 ILE A N   
3454 C CA  . ILE A 530 ? 1.1604 0.9382 0.9164 0.0101  -0.2731 -0.0541 543 ILE A CA  
3455 C C   . ILE A 530 ? 1.0987 0.8991 0.9042 0.0082  -0.2923 -0.0750 543 ILE A C   
3456 O O   . ILE A 530 ? 1.0827 0.9142 0.9292 0.0045  -0.2878 -0.0801 543 ILE A O   
3457 C CB  . ILE A 530 ? 1.1722 0.9140 0.8742 0.0249  -0.2891 -0.0504 543 ILE A CB  
3458 C CG1 . ILE A 530 ? 1.1896 0.9361 0.8955 0.0365  -0.3074 -0.0556 543 ILE A CG1 
3459 C CG2 . ILE A 530 ? 1.1532 0.8753 0.8124 0.0257  -0.2678 -0.0318 543 ILE A CG2 
3460 C CD1 . ILE A 530 ? 1.2309 0.9372 0.8799 0.0512  -0.3231 -0.0516 543 ILE A CD1 
3461 N N   . GLY A 531 ? 1.0537 0.8395 0.8569 0.0107  -0.3135 -0.0886 544 GLY A N   
3462 C CA  . GLY A 531 ? 1.0612 0.8684 0.9142 0.0097  -0.3349 -0.1117 544 GLY A CA  
3463 C C   . GLY A 531 ? 1.1048 0.9425 1.0148 -0.0084 -0.3173 -0.1199 544 GLY A C   
3464 O O   . GLY A 531 ? 1.0737 0.9398 1.0377 -0.0119 -0.3267 -0.1384 544 GLY A O   
3465 N N   . THR A 532 ? 1.1144 0.9446 1.0125 -0.0199 -0.2912 -0.1067 545 THR A N   
3466 C CA  . THR A 532 ? 1.1833 1.0362 1.1265 -0.0381 -0.2690 -0.1101 545 THR A CA  
3467 C C   . THR A 532 ? 1.3059 1.1586 1.2808 -0.0470 -0.2791 -0.1294 545 THR A C   
3468 O O   . THR A 532 ? 1.3958 1.2718 1.4213 -0.0619 -0.2662 -0.1395 545 THR A O   
3469 C CB  . THR A 532 ? 1.2610 1.1019 1.1760 -0.0456 -0.2386 -0.0878 545 THR A CB  
3470 O OG1 . THR A 532 ? 1.3615 1.1679 1.2314 -0.0409 -0.2425 -0.0807 545 THR A OG1 
3471 C CG2 . THR A 532 ? 1.2253 1.0732 1.1202 -0.0395 -0.2262 -0.0713 545 THR A CG2 
3472 N N   . GLY A 533 ? 1.3904 1.2160 1.3350 -0.0384 -0.3011 -0.1353 546 GLY A N   
3473 C CA  . GLY A 533 ? 1.3278 1.1473 1.2940 -0.0467 -0.3100 -0.1525 546 GLY A CA  
3474 C C   . GLY A 533 ? 1.4314 1.2266 1.3708 -0.0559 -0.2878 -0.1388 546 GLY A C   
3475 O O   . GLY A 533 ? 1.3599 1.1553 1.3278 -0.0692 -0.2818 -0.1492 546 GLY A O   
3476 N N   . MET A 534 ? 1.4239 1.1979 1.3105 -0.0489 -0.2754 -0.1163 547 MET A N   
3477 C CA  . MET A 534 ? 1.4958 1.2443 1.3523 -0.0540 -0.2565 -0.1026 547 MET A CA  
3478 C C   . MET A 534 ? 1.3970 1.1133 1.1911 -0.0392 -0.2652 -0.0926 547 MET A C   
3479 O O   . MET A 534 ? 1.4490 1.1641 1.2155 -0.0303 -0.2602 -0.0784 547 MET A O   
3480 C CB  . MET A 534 ? 1.5217 1.2808 1.3841 -0.0632 -0.2244 -0.0837 547 MET A CB  
3481 C CG  . MET A 534 ? 1.5243 1.3115 1.4432 -0.0792 -0.2107 -0.0919 547 MET A CG  
3482 S SD  . MET A 534 ? 1.7737 1.5639 1.6888 -0.0899 -0.1728 -0.0688 547 MET A SD  
3483 C CE  . MET A 534 ? 1.7361 1.5595 1.7179 -0.1080 -0.1606 -0.0839 547 MET A CE  
3484 N N   . GLU A 535 ? 1.4130 1.1027 1.1859 -0.0374 -0.2766 -0.1010 548 GLU A N   
3485 C CA  . GLU A 535 ? 1.5491 1.2052 1.2620 -0.0238 -0.2861 -0.0955 548 GLU A CA  
3486 C C   . GLU A 535 ? 1.5668 1.2107 1.2415 -0.0198 -0.2630 -0.0722 548 GLU A C   
3487 O O   . GLU A 535 ? 1.5597 1.1826 1.1886 -0.0079 -0.2682 -0.0662 548 GLU A O   
3488 C CB  . GLU A 535 ? 1.4196 1.0495 1.1190 -0.0258 -0.2956 -0.1079 548 GLU A CB  
3489 N N   . GLU A 536 ? 1.4664 1.1222 1.1598 -0.0294 -0.2378 -0.0599 549 GLU A N   
3490 C CA  . GLU A 536 ? 1.4453 1.0936 1.1098 -0.0255 -0.2169 -0.0396 549 GLU A CA  
3491 C C   . GLU A 536 ? 1.3962 1.0560 1.0478 -0.0164 -0.2186 -0.0316 549 GLU A C   
3492 O O   . GLU A 536 ? 1.4458 1.0901 1.0604 -0.0082 -0.2119 -0.0209 549 GLU A O   
3493 C CB  . GLU A 536 ? 1.3220 0.9825 1.0110 -0.0366 -0.1928 -0.0287 549 GLU A CB  
3494 C CG  . GLU A 536 ? 1.4389 1.0806 1.1324 -0.0448 -0.1858 -0.0318 549 GLU A CG  
3495 C CD  . GLU A 536 ? 1.6675 1.3173 1.4005 -0.0557 -0.1962 -0.0506 549 GLU A CD  
3496 O OE1 . GLU A 536 ? 1.6123 1.2868 1.3758 -0.0580 -0.2068 -0.0607 549 GLU A OE1 
3497 O OE2 . GLU A 536 ? 1.5840 1.2157 1.3203 -0.0622 -0.1937 -0.0564 549 GLU A OE2 
3498 N N   . HIS A 537 ? 1.3146 1.0010 0.9987 -0.0180 -0.2272 -0.0384 550 HIS A N   
3499 C CA  . HIS A 537 ? 1.3048 1.0044 0.9832 -0.0105 -0.2277 -0.0316 550 HIS A CA  
3500 C C   . HIS A 537 ? 1.3123 0.9938 0.9592 0.0027  -0.2498 -0.0374 550 HIS A C   
3501 O O   . HIS A 537 ? 1.2325 0.9211 0.8730 0.0095  -0.2516 -0.0325 550 HIS A O   
3502 C CB  . HIS A 537 ? 1.2073 0.9430 0.9350 -0.0175 -0.2264 -0.0371 550 HIS A CB  
3503 C CG  . HIS A 537 ? 1.0816 0.8328 0.8371 -0.0309 -0.2038 -0.0311 550 HIS A CG  
3504 N ND1 . HIS A 537 ? 1.1383 0.9168 0.9414 -0.0413 -0.2003 -0.0400 550 HIS A ND1 
3505 C CD2 . HIS A 537 ? 1.0981 0.8390 0.8391 -0.0350 -0.1835 -0.0173 550 HIS A CD2 
3506 C CE1 . HIS A 537 ? 1.2068 0.9885 1.0190 -0.0520 -0.1775 -0.0306 550 HIS A CE1 
3507 N NE2 . HIS A 537 ? 1.1479 0.9067 0.9226 -0.0476 -0.1684 -0.0165 550 HIS A NE2 
3508 N N   . ASN A 538 ? 1.4225 1.0784 1.0471 0.0067  -0.2666 -0.0476 551 ASN A N   
3509 C CA  . ASN A 538 ? 1.4410 1.0767 1.0343 0.0197  -0.2914 -0.0551 551 ASN A CA  
3510 C C   . ASN A 538 ? 1.3910 1.0013 0.9313 0.0298  -0.2842 -0.0413 551 ASN A C   
3511 O O   . ASN A 538 ? 1.4548 1.0577 0.9777 0.0399  -0.2983 -0.0420 551 ASN A O   
3512 C CB  . ASN A 538 ? 1.6266 1.2390 1.2055 0.0214  -0.3111 -0.0703 551 ASN A CB  
3513 C CG  . ASN A 538 ? 1.6252 1.2622 1.2592 0.0131  -0.3248 -0.0889 551 ASN A CG  
3514 O OD1 . ASN A 538 ? 1.6222 1.2935 1.3053 0.0057  -0.3185 -0.0905 551 ASN A OD1 
3515 N ND2 . ASN A 538 ? 1.6852 1.3048 1.3120 0.0138  -0.3430 -0.1044 551 ASN A ND2 
3516 N N   . LEU A 539 ? 1.3345 0.9309 0.8510 0.0272  -0.2619 -0.0295 552 LEU A N   
3517 C CA  . LEU A 539 ? 1.3238 0.8959 0.7931 0.0348  -0.2511 -0.0178 552 LEU A CA  
3518 C C   . LEU A 539 ? 1.3512 0.9452 0.8343 0.0339  -0.2335 -0.0051 552 LEU A C   
3519 O O   . LEU A 539 ? 1.3183 0.8957 0.7687 0.0395  -0.2239 0.0034  552 LEU A O   
3520 C CB  . LEU A 539 ? 1.3244 0.8718 0.7645 0.0330  -0.2355 -0.0137 552 LEU A CB  
3521 C CG  . LEU A 539 ? 1.3072 0.8236 0.7183 0.0359  -0.2515 -0.0258 552 LEU A CG  
3522 C CD1 . LEU A 539 ? 1.2815 0.7861 0.6868 0.0304  -0.2346 -0.0243 552 LEU A CD1 
3523 C CD2 . LEU A 539 ? 1.3246 0.8044 0.6782 0.0475  -0.2620 -0.0262 552 LEU A CD2 
3524 N N   . TYR A 540 ? 1.1955 0.8256 0.7263 0.0265  -0.2285 -0.0048 553 TYR A N   
3525 C CA  . TYR A 540 ? 1.1759 0.8294 0.7230 0.0245  -0.2111 0.0059  553 TYR A CA  
3526 C C   . TYR A 540 ? 1.2527 0.8990 0.7787 0.0331  -0.2141 0.0099  553 TYR A C   
3527 O O   . TYR A 540 ? 1.2334 0.8758 0.7435 0.0344  -0.1972 0.0199  553 TYR A O   
3528 C CB  . TYR A 540 ? 1.1560 0.8466 0.7546 0.0160  -0.2096 0.0024  553 TYR A CB  
3529 C CG  . TYR A 540 ? 1.1928 0.8916 0.8106 0.0059  -0.1953 0.0052  553 TYR A CG  
3530 C CD1 . TYR A 540 ? 1.2443 0.9187 0.8386 0.0054  -0.1894 0.0077  553 TYR A CD1 
3531 C CD2 . TYR A 540 ? 1.1961 0.9246 0.8540 -0.0030 -0.1869 0.0054  553 TYR A CD2 
3532 C CE1 . TYR A 540 ? 1.2475 0.9260 0.8582 -0.0028 -0.1768 0.0109  553 TYR A CE1 
3533 C CE2 . TYR A 540 ? 1.3156 1.0465 0.9865 -0.0120 -0.1731 0.0093  553 TYR A CE2 
3534 C CZ  . TYR A 540 ? 1.2874 0.9929 0.9349 -0.0115 -0.1688 0.0124  553 TYR A CZ  
3535 O OH  . TYR A 540 ? 1.3022 1.0066 0.9613 -0.0195 -0.1556 0.0170  553 TYR A OH  
3536 N N   . ALA A 541 ? 1.3015 0.9452 0.8287 0.0393  -0.2359 0.0014  554 ALA A N   
3537 C CA  . ALA A 541 ? 1.2561 0.8874 0.7603 0.0484  -0.2405 0.0051  554 ALA A CA  
3538 C C   . ALA A 541 ? 1.3398 0.9303 0.7875 0.0539  -0.2325 0.0124  554 ALA A C   
3539 O O   . ALA A 541 ? 1.2579 0.8438 0.6915 0.0549  -0.2161 0.0217  554 ALA A O   
3540 C CB  . ALA A 541 ? 1.2532 0.8829 0.7644 0.0563  -0.2690 -0.0062 554 ALA A CB  
3541 N N   . ILE A 542 ? 1.2323 0.7932 0.6487 0.0568  -0.2429 0.0070  555 ILE A N   
3542 C CA  . ILE A 542 ? 1.2878 0.8067 0.6471 0.0615  -0.2342 0.0124  555 ILE A CA  
3543 C C   . ILE A 542 ? 1.3517 0.8763 0.7118 0.0551  -0.2036 0.0224  555 ILE A C   
3544 O O   . ILE A 542 ? 1.2841 0.7906 0.6160 0.0576  -0.1890 0.0297  555 ILE A O   
3545 C CB  . ILE A 542 ? 1.3190 0.8084 0.6479 0.0640  -0.2480 0.0036  555 ILE A CB  
3546 N N   . ASN A 543 ? 1.2308 0.7802 0.6247 0.0471  -0.1940 0.0223  556 ASN A N   
3547 C CA  . ASN A 543 ? 1.3067 0.8636 0.7055 0.0426  -0.1681 0.0304  556 ASN A CA  
3548 C C   . ASN A 543 ? 1.3690 0.9431 0.7795 0.0428  -0.1549 0.0379  556 ASN A C   
3549 O O   . ASN A 543 ? 1.4104 0.9754 0.8059 0.0429  -0.1359 0.0432  556 ASN A O   
3550 C CB  . ASN A 543 ? 1.2092 0.7912 0.6450 0.0352  -0.1627 0.0301  556 ASN A CB  
3551 C CG  . ASN A 543 ? 1.3339 0.8978 0.7600 0.0338  -0.1720 0.0222  556 ASN A CG  
3552 O OD1 . ASN A 543 ? 1.3646 0.8954 0.7517 0.0387  -0.1797 0.0173  556 ASN A OD1 
3553 N ND2 . ASN A 543 ? 1.2649 0.8485 0.7249 0.0269  -0.1709 0.0207  556 ASN A ND2 
3554 N N   . PHE A 544 ? 1.2509 0.8503 0.6903 0.0426  -0.1647 0.0368  557 PHE A N   
3555 C CA  . PHE A 544 ? 1.1968 0.8133 0.6491 0.0427  -0.1541 0.0422  557 PHE A CA  
3556 C C   . PHE A 544 ? 1.1951 0.7791 0.6072 0.0487  -0.1513 0.0449  557 PHE A C   
3557 O O   . PHE A 544 ? 1.1206 0.7054 0.5299 0.0475  -0.1329 0.0500  557 PHE A O   
3558 C CB  . PHE A 544 ? 1.1500 0.7983 0.6405 0.0416  -0.1658 0.0388  557 PHE A CB  
3559 C CG  . PHE A 544 ? 1.2064 0.8697 0.7082 0.0425  -0.1574 0.0425  557 PHE A CG  
3560 C CD1 . PHE A 544 ? 1.1892 0.8337 0.6711 0.0491  -0.1654 0.0420  557 PHE A CD1 
3561 C CD2 . PHE A 544 ? 1.0915 0.7853 0.6216 0.0373  -0.1421 0.0463  557 PHE A CD2 
3562 C CE1 . PHE A 544 ? 1.0744 0.7311 0.5677 0.0495  -0.1571 0.0447  557 PHE A CE1 
3563 C CE2 . PHE A 544 ? 1.0968 0.8043 0.6377 0.0380  -0.1349 0.0480  557 PHE A CE2 
3564 C CZ  . PHE A 544 ? 1.0485 0.7378 0.5724 0.0435  -0.1418 0.0470  557 PHE A CZ  
3565 N N   . ILE A 545 ? 1.2646 0.8189 0.6454 0.0552  -0.1695 0.0411  558 ILE A N   
3566 C CA  . ILE A 545 ? 1.2184 0.7343 0.5533 0.0616  -0.1679 0.0446  558 ILE A CA  
3567 C C   . ILE A 545 ? 1.2763 0.7610 0.5724 0.0600  -0.1475 0.0482  558 ILE A C   
3568 O O   . ILE A 545 ? 1.3599 0.8275 0.6354 0.0599  -0.1299 0.0534  558 ILE A O   
3569 C CB  . ILE A 545 ? 1.2335 0.7222 0.5403 0.0709  -0.1958 0.0394  558 ILE A CB  
3570 C CG1 . ILE A 545 ? 1.2992 0.8200 0.6490 0.0731  -0.2157 0.0338  558 ILE A CG1 
3571 C CG2 . ILE A 545 ? 1.2955 0.7388 0.5484 0.0779  -0.1926 0.0450  558 ILE A CG2 
3572 C CD1 . ILE A 545 ? 1.3418 0.8472 0.6798 0.0818  -0.2473 0.0246  558 ILE A CD1 
3573 N N   . HIS A 546 ? 1.3427 0.8198 0.6306 0.0584  -0.1487 0.0443  559 HIS A N   
3574 C CA  . HIS A 546 ? 1.4127 0.8635 0.6691 0.0565  -0.1281 0.0459  559 HIS A CA  
3575 C C   . HIS A 546 ? 1.2808 0.7565 0.5664 0.0504  -0.1017 0.0500  559 HIS A C   
3576 O O   . HIS A 546 ? 1.5454 1.0014 0.8086 0.0493  -0.0806 0.0523  559 HIS A O   
3577 C CB  . HIS A 546 ? 1.5116 0.9549 0.7621 0.0556  -0.1350 0.0396  559 HIS A CB  
3578 C CG  . HIS A 546 ? 1.6251 1.0368 0.8383 0.0621  -0.1594 0.0334  559 HIS A CG  
3579 N ND1 . HIS A 546 ? 1.6547 1.0204 0.8092 0.0687  -0.1615 0.0347  559 HIS A ND1 
3580 C CD2 . HIS A 546 ? 1.6846 1.1028 0.9101 0.0632  -0.1830 0.0249  559 HIS A CD2 
3581 C CE1 . HIS A 546 ? 1.7054 1.0509 0.8361 0.0750  -0.1879 0.0273  559 HIS A CE1 
3582 N NE2 . HIS A 546 ? 1.5759 0.9543 0.7517 0.0714  -0.2014 0.0203  559 HIS A NE2 
3583 N N   . ALA A 547 ? 1.2936 0.8121 0.6292 0.0465  -0.1030 0.0502  560 ALA A N   
3584 C CA  . ALA A 547 ? 1.2317 0.7767 0.5975 0.0423  -0.0823 0.0531  560 ALA A CA  
3585 C C   . ALA A 547 ? 1.2742 0.8233 0.6429 0.0421  -0.0715 0.0562  560 ALA A C   
3586 O O   . ALA A 547 ? 1.3300 0.8832 0.7052 0.0396  -0.0506 0.0567  560 ALA A O   
3587 C CB  . ALA A 547 ? 1.2182 0.8033 0.6298 0.0392  -0.0886 0.0534  560 ALA A CB  
3588 N N   . THR A 548 ? 1.2851 0.8334 0.6516 0.0449  -0.0861 0.0568  561 THR A N   
3589 C CA  . THR A 548 ? 1.1984 0.7461 0.5652 0.0450  -0.0780 0.0593  561 THR A CA  
3590 C C   . THR A 548 ? 1.2201 0.7260 0.5433 0.0452  -0.0600 0.0612  561 THR A C   
3591 O O   . THR A 548 ? 1.2325 0.7425 0.5645 0.0417  -0.0404 0.0621  561 THR A O   
3592 C CB  . THR A 548 ? 1.2925 0.8419 0.6618 0.0496  -0.0998 0.0588  561 THR A CB  
3593 O OG1 . THR A 548 ? 1.2496 0.8406 0.6638 0.0475  -0.1112 0.0562  561 THR A OG1 
3594 C CG2 . THR A 548 ? 1.3443 0.8877 0.7107 0.0503  -0.0918 0.0614  561 THR A CG2 
3595 N N   . LYS A 549 ? 1.2977 0.7630 0.5740 0.0489  -0.0660 0.0610  562 LYS A N   
3596 C CA  . LYS A 549 ? 1.3648 0.7844 0.5920 0.0487  -0.0473 0.0629  562 LYS A CA  
3597 C C   . LYS A 549 ? 1.3389 0.7670 0.5799 0.0423  -0.0187 0.0605  562 LYS A C   
3598 O O   . LYS A 549 ? 1.2535 0.6719 0.4902 0.0383  0.0044  0.0611  562 LYS A O   
3599 C CB  . LYS A 549 ? 1.4999 0.8756 0.6728 0.0545  -0.0612 0.0619  562 LYS A CB  
3600 C CG  . LYS A 549 ? 1.6467 0.9688 0.7594 0.0545  -0.0415 0.0641  562 LYS A CG  
3601 C CD  . LYS A 549 ? 1.7874 1.0746 0.8632 0.0585  -0.0432 0.0702  562 LYS A CD  
3602 C CE  . LYS A 549 ? 1.9158 1.1703 0.9481 0.0693  -0.0746 0.0708  562 LYS A CE  
3603 N NZ  . LYS A 549 ? 2.0273 1.2333 0.9971 0.0725  -0.0737 0.0692  562 LYS A NZ  
3604 N N   . VAL A 550 ? 1.2513 0.6969 0.5107 0.0414  -0.0204 0.0569  563 VAL A N   
3605 C CA  . VAL A 550 ? 1.3045 0.7563 0.5768 0.0372  0.0040  0.0532  563 VAL A CA  
3606 C C   . VAL A 550 ? 1.2277 0.7195 0.5499 0.0333  0.0173  0.0523  563 VAL A C   
3607 O O   . VAL A 550 ? 1.3783 0.8688 0.7072 0.0297  0.0416  0.0486  563 VAL A O   
3608 C CB  . VAL A 550 ? 1.0919 0.5527 0.3742 0.0384  -0.0029 0.0497  563 VAL A CB  
3609 N N   . ILE A 551 ? 1.1915 0.7187 0.5490 0.0341  0.0016  0.0543  564 ILE A N   
3610 C CA  . ILE A 551 ? 1.1455 0.7115 0.5487 0.0313  0.0103  0.0528  564 ILE A CA  
3611 C C   . ILE A 551 ? 1.1810 0.7347 0.5767 0.0283  0.0247  0.0526  564 ILE A C   
3612 O O   . ILE A 551 ? 1.2733 0.8441 0.6955 0.0245  0.0430  0.0481  564 ILE A O   
3613 C CB  . ILE A 551 ? 1.1034 0.7072 0.5409 0.0328  -0.0100 0.0548  564 ILE A CB  
3614 C CG1 . ILE A 551 ? 1.1199 0.7401 0.5734 0.0341  -0.0177 0.0546  564 ILE A CG1 
3615 C CG2 . ILE A 551 ? 1.0863 0.7246 0.5622 0.0306  -0.0034 0.0529  564 ILE A CG2 
3616 C CD1 . ILE A 551 ? 1.1733 0.8188 0.6483 0.0347  -0.0379 0.0570  564 ILE A CD1 
3617 N N   . LYS A 552 ? 1.1795 0.7034 0.5408 0.0304  0.0156  0.0569  565 LYS A N   
3618 C CA  . LYS A 552 ? 1.2226 0.7267 0.5703 0.0278  0.0291  0.0581  565 LYS A CA  
3619 C C   . LYS A 552 ? 1.2734 0.7434 0.5931 0.0231  0.0580  0.0559  565 LYS A C   
3620 O O   . LYS A 552 ? 1.3749 0.8382 0.6989 0.0179  0.0779  0.0542  565 LYS A O   
3621 C CB  . LYS A 552 ? 1.3040 0.7789 0.6167 0.0332  0.0102  0.0637  565 LYS A CB  
3622 N N   . GLU A 553 ? 1.3380 0.7863 0.6304 0.0243  0.0613  0.0549  566 GLU A N   
3623 C CA  . GLU A 553 ? 1.3404 0.7559 0.6053 0.0196  0.0903  0.0515  566 GLU A CA  
3624 C C   . GLU A 553 ? 1.3533 0.8017 0.6630 0.0157  0.1084  0.0427  566 GLU A C   
3625 O O   . GLU A 553 ? 1.5975 1.0350 0.9083 0.0096  0.1372  0.0369  566 GLU A O   
3626 C CB  . GLU A 553 ? 1.3930 0.7630 0.5990 0.0237  0.0845  0.0540  566 GLU A CB  
3627 N N   . THR A 554 ? 1.4103 0.8973 0.7566 0.0195  0.0917  0.0412  567 THR A N   
3628 C CA  . THR A 554 ? 1.2648 0.7816 0.6517 0.0187  0.1034  0.0332  567 THR A CA  
3629 C C   . THR A 554 ? 1.2529 0.8119 0.6944 0.0160  0.1111  0.0277  567 THR A C   
3630 O O   . THR A 554 ? 1.3425 0.9129 0.8102 0.0130  0.1321  0.0184  567 THR A O   
3631 C CB  . THR A 554 ? 1.0990 0.6366 0.5005 0.0245  0.0816  0.0349  567 THR A CB  
3632 N N   . LEU A 555 ? 1.2315 0.8139 0.6911 0.0173  0.0936  0.0319  568 LEU A N   
3633 C CA  . LEU A 555 ? 1.1157 0.7435 0.6281 0.0165  0.0935  0.0265  568 LEU A CA  
3634 C C   . LEU A 555 ? 1.1362 0.7612 0.6516 0.0115  0.1011  0.0258  568 LEU A C   
3635 O O   . LEU A 555 ? 1.1508 0.7793 0.6614 0.0132  0.0841  0.0317  568 LEU A O   
3636 C CB  . LEU A 555 ? 0.9946 0.6550 0.5283 0.0221  0.0673  0.0310  568 LEU A CB  
3637 C CG  . LEU A 555 ? 1.0435 0.7001 0.5685 0.0268  0.0578  0.0336  568 LEU A CG  
3638 C CD1 . LEU A 555 ? 1.0210 0.7037 0.5618 0.0307  0.0340  0.0391  568 LEU A CD1 
3639 C CD2 . LEU A 555 ? 1.0870 0.7540 0.6351 0.0279  0.0732  0.0253  568 LEU A CD2 
3640 N N   . PRO A 556 ? 1.1766 0.7950 0.7023 0.0050  0.1276  0.0176  569 PRO A N   
3641 C CA  . PRO A 556 ? 1.1788 0.7869 0.7027 -0.0006 0.1374  0.0172  569 PRO A CA  
3642 C C   . PRO A 556 ? 1.0808 0.7330 0.6495 0.0001  0.1241  0.0137  569 PRO A C   
3643 O O   . PRO A 556 ? 1.1457 0.8394 0.7584 0.0021  0.1205  0.0061  569 PRO A O   
3644 C CB  . PRO A 556 ? 1.1163 0.7114 0.6484 -0.0090 0.1714  0.0069  569 PRO A CB  
3645 C CG  . PRO A 556 ? 1.1885 0.8107 0.7525 -0.0062 0.1749  -0.0017 569 PRO A CG  
3646 C CD  . PRO A 556 ? 1.2118 0.8326 0.7546 0.0023  0.1505  0.0073  569 PRO A CD  
3647 N N   . GLY A 557 ? 1.1228 0.7642 0.6781 -0.0004 0.1160  0.0191  570 GLY A N   
3648 C CA  . GLY A 557 ? 1.0032 0.6818 0.5965 -0.0003 0.1052  0.0151  570 GLY A CA  
3649 C C   . GLY A 557 ? 0.9432 0.6401 0.5359 0.0067  0.0762  0.0223  570 GLY A C   
3650 O O   . GLY A 557 ? 1.0636 0.7648 0.6588 0.0073  0.0659  0.0242  570 GLY A O   
3651 N N   . ALA A 558 ? 0.9572 0.6640 0.5479 0.0117  0.0643  0.0256  571 ALA A N   
3652 C CA  . ALA A 558 ? 0.9747 0.7003 0.5684 0.0171  0.0394  0.0314  571 ALA A CA  
3653 C C   . ALA A 558 ? 0.9157 0.6129 0.4760 0.0189  0.0270  0.0390  571 ALA A C   
3654 O O   . ALA A 558 ? 1.0326 0.6888 0.5564 0.0181  0.0348  0.0424  571 ALA A O   
3655 C CB  . ALA A 558 ? 1.0424 0.7744 0.6344 0.0210  0.0321  0.0340  571 ALA A CB  
3656 N N   . ARG A 559 ? 1.0339 0.7526 0.6068 0.0220  0.0077  0.0411  572 ARG A N   
3657 C CA  . ARG A 559 ? 1.0579 0.7556 0.6068 0.0252  -0.0075 0.0463  572 ARG A CA  
3658 C C   . ARG A 559 ? 1.0279 0.7379 0.5781 0.0288  -0.0268 0.0496  572 ARG A C   
3659 O O   . ARG A 559 ? 0.9325 0.6669 0.5017 0.0284  -0.0274 0.0488  572 ARG A O   
3660 C CB  . ARG A 559 ? 1.0763 0.7867 0.6432 0.0247  -0.0106 0.0434  572 ARG A CB  
3661 C CG  . ARG A 559 ? 1.1481 0.8308 0.7018 0.0211  0.0072  0.0419  572 ARG A CG  
3662 C CD  . ARG A 559 ? 1.0633 0.7659 0.6451 0.0191  0.0085  0.0362  572 ARG A CD  
3663 N NE  . ARG A 559 ? 1.0389 0.7114 0.6078 0.0147  0.0272  0.0349  572 ARG A NE  
3664 C CZ  . ARG A 559 ? 1.0669 0.7398 0.6475 0.0079  0.0500  0.0289  572 ARG A CZ  
3665 N NH1 . ARG A 559 ? 1.1445 0.8475 0.7507 0.0062  0.0552  0.0234  572 ARG A NH1 
3666 N NH2 . ARG A 559 ? 1.1273 0.7695 0.6951 0.0029  0.0682  0.0280  572 ARG A NH2 
3667 N N   . ILE A 560 ? 1.1637 0.8552 0.6940 0.0325  -0.0426 0.0526  573 ILE A N   
3668 C CA  . ILE A 560 ? 1.0907 0.7903 0.6225 0.0349  -0.0603 0.0541  573 ILE A CA  
3669 C C   . ILE A 560 ? 1.0104 0.7292 0.5617 0.0368  -0.0766 0.0520  573 ILE A C   
3670 O O   . ILE A 560 ? 0.8257 0.5292 0.3677 0.0399  -0.0821 0.0514  573 ILE A O   
3671 C CB  . ILE A 560 ? 1.1927 0.8524 0.6838 0.0382  -0.0671 0.0571  573 ILE A CB  
3672 C CG1 . ILE A 560 ? 1.2376 0.8788 0.7100 0.0360  -0.0496 0.0581  573 ILE A CG1 
3673 C CG2 . ILE A 560 ? 1.1774 0.8469 0.6751 0.0400  -0.0865 0.0564  573 ILE A CG2 
3674 C CD1 . ILE A 560 ? 1.1528 0.8216 0.6502 0.0338  -0.0456 0.0570  573 ILE A CD1 
3675 N N   . SER A 561 ? 0.9762 0.7266 0.5539 0.0351  -0.0834 0.0507  574 SER A N   
3676 C CA  . SER A 561 ? 0.9956 0.7677 0.5959 0.0358  -0.0971 0.0472  574 SER A CA  
3677 C C   . SER A 561 ? 1.0049 0.7837 0.6107 0.0349  -0.1088 0.0471  574 SER A C   
3678 O O   . SER A 561 ? 0.9324 0.7020 0.5265 0.0337  -0.1058 0.0501  574 SER A O   
3679 C CB  . SER A 561 ? 0.9327 0.7418 0.5654 0.0326  -0.0898 0.0441  574 SER A CB  
3680 O OG  . SER A 561 ? 0.9519 0.7803 0.6060 0.0330  -0.1002 0.0394  574 SER A OG  
3681 N N   . GLY A 562 ? 1.0346 0.8301 0.6611 0.0352  -0.1210 0.0424  575 GLY A N   
3682 C CA  . GLY A 562 ? 0.9263 0.7315 0.5650 0.0327  -0.1306 0.0402  575 GLY A CA  
3683 C C   . GLY A 562 ? 0.9091 0.7385 0.5786 0.0320  -0.1402 0.0329  575 GLY A C   
3684 O O   . GLY A 562 ? 1.0663 0.8935 0.7395 0.0366  -0.1469 0.0288  575 GLY A O   
3685 N N   . GLY A 563 ? 0.9370 0.7885 0.6289 0.0261  -0.1395 0.0309  576 GLY A N   
3686 C CA  . GLY A 563 ? 0.9122 0.7875 0.6367 0.0240  -0.1466 0.0222  576 GLY A CA  
3687 C C   . GLY A 563 ? 0.9232 0.7842 0.6483 0.0276  -0.1656 0.0153  576 GLY A C   
3688 O O   . GLY A 563 ? 1.0353 0.8918 0.7608 0.0240  -0.1692 0.0144  576 GLY A O   
3689 N N   . LEU A 564 ? 0.9062 0.7591 0.6314 0.0354  -0.1787 0.0098  577 LEU A N   
3690 C CA  . LEU A 564 ? 0.9603 0.7924 0.6772 0.0423  -0.2006 0.0036  577 LEU A CA  
3691 C C   . LEU A 564 ? 0.9296 0.7839 0.6842 0.0384  -0.2112 -0.0082 577 LEU A C   
3692 O O   . LEU A 564 ? 1.0224 0.8636 0.7713 0.0391  -0.2237 -0.0122 577 LEU A O   
3693 C CB  . LEU A 564 ? 0.9102 0.7258 0.6162 0.0531  -0.2128 0.0014  577 LEU A CB  
3694 C CG  . LEU A 564 ? 0.9679 0.7546 0.6551 0.0635  -0.2380 -0.0037 577 LEU A CG  
3695 C CD1 . LEU A 564 ? 1.0460 0.8002 0.6918 0.0639  -0.2392 0.0025  577 LEU A CD1 
3696 C CD2 . LEU A 564 ? 1.0887 0.8536 0.7581 0.0746  -0.2466 -0.0026 577 LEU A CD2 
3697 N N   . SER A 565 ? 0.9140 0.8019 0.7080 0.0338  -0.2052 -0.0150 578 SER A N   
3698 C CA  . SER A 565 ? 0.8865 0.7982 0.7228 0.0290  -0.2128 -0.0286 578 SER A CA  
3699 C C   . SER A 565 ? 0.9483 0.8645 0.7909 0.0180  -0.2043 -0.0276 578 SER A C   
3700 O O   . SER A 565 ? 1.1312 1.0620 1.0069 0.0133  -0.2111 -0.0396 578 SER A O   
3701 C CB  . SER A 565 ? 0.8894 0.8354 0.7646 0.0254  -0.2036 -0.0361 578 SER A CB  
3702 O OG  . SER A 565 ? 0.9669 0.9084 0.8419 0.0361  -0.2141 -0.0397 578 SER A OG  
3703 N N   . ASN A 566 ? 0.9814 0.8849 0.7949 0.0140  -0.1896 -0.0142 579 ASN A N   
3704 C CA  . ASN A 566 ? 0.9902 0.8903 0.8031 0.0052  -0.1826 -0.0116 579 ASN A CA  
3705 C C   . ASN A 566 ? 1.0908 0.9695 0.8957 0.0087  -0.2020 -0.0185 579 ASN A C   
3706 O O   . ASN A 566 ? 1.1333 1.0160 0.9556 0.0008  -0.2018 -0.0240 579 ASN A O   
3707 C CB  . ASN A 566 ? 0.9881 0.8748 0.7684 0.0036  -0.1662 0.0037  579 ASN A CB  
3708 C CG  . ASN A 566 ? 0.9217 0.8296 0.7089 -0.0002 -0.1478 0.0098  579 ASN A CG  
3709 O OD1 . ASN A 566 ? 0.9422 0.8451 0.7097 0.0047  -0.1425 0.0168  579 ASN A OD1 
3710 N ND2 . ASN A 566 ? 0.8956 0.8264 0.7102 -0.0094 -0.1376 0.0064  579 ASN A ND2 
3711 N N   . LEU A 567 ? 1.0602 0.9143 0.8369 0.0203  -0.2182 -0.0184 580 LEU A N   
3712 C CA  . LEU A 567 ? 1.0621 0.8913 0.8222 0.0259  -0.2389 -0.0249 580 LEU A CA  
3713 C C   . LEU A 567 ? 0.9929 0.8408 0.7963 0.0238  -0.2556 -0.0429 580 LEU A C   
3714 O O   . LEU A 567 ? 0.8939 0.7322 0.6984 0.0215  -0.2657 -0.0499 580 LEU A O   
3715 C CB  . LEU A 567 ? 1.0522 0.8512 0.7734 0.0399  -0.2535 -0.0220 580 LEU A CB  
3716 C CG  . LEU A 567 ? 1.0807 0.8454 0.7696 0.0482  -0.2755 -0.0266 580 LEU A CG  
3717 C CD1 . LEU A 567 ? 1.0239 0.7621 0.6727 0.0452  -0.2634 -0.0164 580 LEU A CD1 
3718 C CD2 . LEU A 567 ? 1.0549 0.7946 0.7150 0.0628  -0.2931 -0.0265 580 LEU A CD2 
3719 N N   . SER A 568 ? 1.0450 0.9206 0.8868 0.0241  -0.2579 -0.0517 581 SER A N   
3720 C CA  . SER A 568 ? 1.0169 0.9100 0.9020 0.0257  -0.2779 -0.0716 581 SER A CA  
3721 C C   . SER A 568 ? 0.9951 0.9268 0.9367 0.0115  -0.2629 -0.0816 581 SER A C   
3722 O O   . SER A 568 ? 1.0693 1.0246 1.0560 0.0128  -0.2740 -0.0986 581 SER A O   
3723 C CB  . SER A 568 ? 1.0008 0.8915 0.8867 0.0404  -0.2973 -0.0773 581 SER A CB  
3724 O OG  . SER A 568 ? 0.9853 0.8914 0.8768 0.0393  -0.2798 -0.0700 581 SER A OG  
3725 N N   . PHE A 569 ? 1.0111 0.9477 0.9499 -0.0016 -0.2375 -0.0717 582 PHE A N   
3726 C CA  . PHE A 569 ? 0.9590 0.9250 0.9445 -0.0169 -0.2207 -0.0802 582 PHE A CA  
3727 C C   . PHE A 569 ? 1.0264 0.9972 1.0467 -0.0218 -0.2351 -0.0985 582 PHE A C   
3728 O O   . PHE A 569 ? 0.9325 0.9310 1.0032 -0.0326 -0.2269 -0.1122 582 PHE A O   
3729 C CB  . PHE A 569 ? 0.9771 0.9387 0.9436 -0.0287 -0.1926 -0.0641 582 PHE A CB  
3730 C CG  . PHE A 569 ? 1.0157 0.9835 0.9634 -0.0278 -0.1744 -0.0501 582 PHE A CG  
3731 C CD1 . PHE A 569 ? 1.0479 1.0394 1.0188 -0.0254 -0.1721 -0.0563 582 PHE A CD1 
3732 C CD2 . PHE A 569 ? 1.1112 1.0620 1.0203 -0.0294 -0.1593 -0.0321 582 PHE A CD2 
3733 C CE1 . PHE A 569 ? 1.0723 1.0695 1.0258 -0.0249 -0.1559 -0.0448 582 PHE A CE1 
3734 C CE2 . PHE A 569 ? 1.0710 1.0287 0.9647 -0.0283 -0.1443 -0.0210 582 PHE A CE2 
3735 C CZ  . PHE A 569 ? 1.0716 1.0524 0.9866 -0.0263 -0.1426 -0.0275 582 PHE A CZ  
3736 N N   . SER A 570 ? 0.9755 0.9193 0.9693 -0.0146 -0.2552 -0.0997 583 SER A N   
3737 C CA  . SER A 570 ? 1.0064 0.9528 1.0308 -0.0186 -0.2712 -0.1183 583 SER A CA  
3738 C C   . SER A 570 ? 0.9986 0.9684 1.0714 -0.0118 -0.2949 -0.1415 583 SER A C   
3739 O O   . SER A 570 ? 0.9875 0.9739 1.1069 -0.0191 -0.3022 -0.1611 583 SER A O   
3740 C CB  . SER A 570 ? 1.1375 1.0470 1.1163 -0.0109 -0.2885 -0.1145 583 SER A CB  
3741 O OG  . SER A 570 ? 1.1435 1.0354 1.0915 -0.0195 -0.2667 -0.0982 583 SER A OG  
3742 N N   . PHE A 571 ? 1.0413 1.0120 1.1053 0.0021  -0.3071 -0.1403 584 PHE A N   
3743 C CA  . PHE A 571 ? 1.0161 1.0078 1.1251 0.0114  -0.3314 -0.1619 584 PHE A CA  
3744 C C   . PHE A 571 ? 0.9581 0.9787 1.0972 0.0102  -0.3165 -0.1628 584 PHE A C   
3745 O O   . PHE A 571 ? 0.9911 1.0104 1.1276 0.0252  -0.3335 -0.1656 584 PHE A O   
3746 C CB  . PHE A 571 ? 1.0052 0.9663 1.0756 0.0327  -0.3666 -0.1628 584 PHE A CB  
3747 N N   . ARG A 572 ? 0.9568 1.0013 1.1226 -0.0072 -0.2845 -0.1606 585 ARG A N   
3748 C CA  . ARG A 572 ? 0.9589 1.0341 1.1589 -0.0102 -0.2686 -0.1651 585 ARG A CA  
3749 C C   . ARG A 572 ? 0.9551 1.0605 1.2227 -0.0073 -0.2868 -0.1936 585 ARG A C   
3750 O O   . ARG A 572 ? 0.9175 1.0289 1.2169 -0.0115 -0.2992 -0.2101 585 ARG A O   
3751 C CB  . ARG A 572 ? 0.9263 1.0169 1.1355 -0.0300 -0.2299 -0.1570 585 ARG A CB  
3752 C CG  . ARG A 572 ? 0.9898 1.0527 1.1415 -0.0350 -0.2127 -0.1322 585 ARG A CG  
3753 C CD  . ARG A 572 ? 1.0584 1.1331 1.2050 -0.0471 -0.1783 -0.1201 585 ARG A CD  
3754 N NE  . ARG A 572 ? 1.1133 1.1623 1.2105 -0.0517 -0.1636 -0.0984 585 ARG A NE  
3755 C CZ  . ARG A 572 ? 1.1155 1.1654 1.1924 -0.0591 -0.1374 -0.0836 585 ARG A CZ  
3756 N NH1 . ARG A 572 ? 1.3157 1.3901 1.4139 -0.0638 -0.1210 -0.0875 585 ARG A NH1 
3757 N NH2 . ARG A 572 ? 1.2605 1.2861 1.2948 -0.0610 -0.1282 -0.0655 585 ARG A NH2 
3758 N N   . GLY A 573 ? 0.9948 1.1198 1.2867 0.0000  -0.2884 -0.2007 586 GLY A N   
3759 C CA  . GLY A 573 ? 1.0219 1.1757 1.3789 0.0064  -0.3086 -0.2286 586 GLY A CA  
3760 C C   . GLY A 573 ? 1.0690 1.2011 1.4048 0.0309  -0.3487 -0.2316 586 GLY A C   
3761 O O   . GLY A 573 ? 1.1708 1.3118 1.5218 0.0434  -0.3591 -0.2378 586 GLY A O   
3762 N N   . MET A 574 ? 1.0943 1.1949 1.3919 0.0380  -0.3709 -0.2271 587 MET A N   
3763 C CA  . MET A 574 ? 1.1762 1.2463 1.4384 0.0615  -0.4085 -0.2264 587 MET A CA  
3764 C C   . MET A 574 ? 1.1227 1.1618 1.3191 0.0699  -0.3998 -0.2005 587 MET A C   
3765 O O   . MET A 574 ? 1.1870 1.1894 1.3204 0.0719  -0.3992 -0.1817 587 MET A O   
3766 C CB  . MET A 574 ? 1.0803 1.1234 1.3150 0.0650  -0.4315 -0.2287 587 MET A CB  
3767 N N   . GLU A 575 ? 1.1159 1.1707 1.3299 0.0743  -0.3923 -0.2010 588 GLU A N   
3768 C CA  . GLU A 575 ? 1.1179 1.1476 1.2783 0.0809  -0.3819 -0.1791 588 GLU A CA  
3769 C C   . GLU A 575 ? 1.2039 1.1875 1.3082 0.1016  -0.4119 -0.1706 588 GLU A C   
3770 O O   . GLU A 575 ? 1.3097 1.2597 1.3523 0.1029  -0.4022 -0.1490 588 GLU A O   
3771 C CB  . GLU A 575 ? 1.0025 1.0601 1.1993 0.0815  -0.3692 -0.1849 588 GLU A CB  
3772 C CG  . GLU A 575 ? 1.1306 1.2180 1.3479 0.0608  -0.3294 -0.1807 588 GLU A CG  
3773 C CD  . GLU A 575 ? 1.2568 1.3209 1.4138 0.0540  -0.3059 -0.1544 588 GLU A CD  
3774 O OE1 . GLU A 575 ? 1.1556 1.1927 1.2692 0.0651  -0.3110 -0.1411 588 GLU A OE1 
3775 O OE2 . GLU A 575 ? 1.3839 1.4560 1.5379 0.0376  -0.2819 -0.1475 588 GLU A OE2 
3776 N N   . ALA A 576 ? 1.0606 1.0417 1.1860 0.1179  -0.4478 -0.1882 589 ALA A N   
3777 C CA  . ALA A 576 ? 1.0643 0.9977 1.1333 0.1392  -0.4788 -0.1811 589 ALA A CA  
3778 C C   . ALA A 576 ? 1.2019 1.0965 1.2065 0.1365  -0.4789 -0.1658 589 ALA A C   
3779 O O   . ALA A 576 ? 1.3769 1.2260 1.3147 0.1472  -0.4846 -0.1490 589 ALA A O   
3780 C CB  . ALA A 576 ? 1.0999 1.0395 1.2061 0.1570  -0.5201 -0.2050 589 ALA A CB  
3781 N N   . ILE A 577 ? 1.1648 1.0762 1.1898 0.1218  -0.4706 -0.1722 590 ILE A N   
3782 C CA  . ILE A 577 ? 1.1395 1.0181 1.1091 0.1172  -0.4669 -0.1591 590 ILE A CA  
3783 C C   . ILE A 577 ? 1.1647 1.0323 1.0943 0.1055  -0.4302 -0.1346 590 ILE A C   
3784 O O   . ILE A 577 ? 1.2680 1.0947 1.1329 0.1102  -0.4288 -0.1179 590 ILE A O   
3785 C CB  . ILE A 577 ? 1.2148 1.1148 1.2217 0.1041  -0.4675 -0.1740 590 ILE A CB  
3786 C CG1 . ILE A 577 ? 1.3834 1.2937 1.4305 0.1165  -0.5072 -0.2007 590 ILE A CG1 
3787 C CG2 . ILE A 577 ? 1.2747 1.1403 1.2239 0.0989  -0.4609 -0.1600 590 ILE A CG2 
3788 C CD1 . ILE A 577 ? 1.4284 1.3658 1.5259 0.1026  -0.5079 -0.2200 590 ILE A CD1 
3789 N N   . ARG A 578 ? 1.1521 1.0559 1.1204 0.0906  -0.4008 -0.1334 591 ARG A N   
3790 C CA  . ARG A 578 ? 1.1525 1.0506 1.0893 0.0801  -0.3675 -0.1123 591 ARG A CA  
3791 C C   . ARG A 578 ? 1.1384 1.0047 1.0259 0.0924  -0.3687 -0.0974 591 ARG A C   
3792 O O   . ARG A 578 ? 1.2093 1.0455 1.0438 0.0913  -0.3571 -0.0802 591 ARG A O   
3793 C CB  . ARG A 578 ? 1.0772 1.0185 1.0630 0.0653  -0.3398 -0.1155 591 ARG A CB  
3794 C CG  . ARG A 578 ? 1.1025 1.0709 1.1301 0.0493  -0.3294 -0.1261 591 ARG A CG  
3795 C CD  . ARG A 578 ? 1.0327 1.0324 1.0878 0.0331  -0.2956 -0.1226 591 ARG A CD  
3796 N NE  . ARG A 578 ? 1.0129 0.9961 1.0215 0.0272  -0.2720 -0.1003 591 ARG A NE  
3797 C CZ  . ARG A 578 ? 1.0372 1.0386 1.0538 0.0136  -0.2429 -0.0931 591 ARG A CZ  
3798 N NH1 . ARG A 578 ? 1.0795 1.1149 1.1461 0.0029  -0.2301 -0.1054 591 ARG A NH1 
3799 N NH2 . ARG A 578 ? 1.0862 1.0709 1.0598 0.0111  -0.2263 -0.0740 591 ARG A NH2 
3800 N N   . GLU A 579 ? 1.1117 0.9843 1.0191 0.1039  -0.3822 -0.1051 592 GLU A N   
3801 C CA  . GLU A 579 ? 1.1206 0.9609 0.9844 0.1160  -0.3844 -0.0925 592 GLU A CA  
3802 C C   . GLU A 579 ? 1.1787 0.9661 0.9782 0.1288  -0.4048 -0.0842 592 GLU A C   
3803 O O   . GLU A 579 ? 1.3205 1.0738 1.0663 0.1306  -0.3929 -0.0669 592 GLU A O   
3804 C CB  . GLU A 579 ? 1.1573 1.0131 1.0584 0.1273  -0.3985 -0.1046 592 GLU A CB  
3805 C CG  . GLU A 579 ? 1.2072 1.1101 1.1625 0.1150  -0.3741 -0.1109 592 GLU A CG  
3806 C CD  . GLU A 579 ? 1.2281 1.1475 1.2237 0.1263  -0.3874 -0.1248 592 GLU A CD  
3807 O OE1 . GLU A 579 ? 1.2940 1.1814 1.2639 0.1443  -0.4105 -0.1234 592 GLU A OE1 
3808 O OE2 . GLU A 579 ? 1.2525 1.2154 1.3045 0.1173  -0.3737 -0.1372 592 GLU A OE2 
3809 N N   . ALA A 580 ? 1.1912 0.9716 0.9960 0.1374  -0.4347 -0.0975 593 ALA A N   
3810 C CA  . ALA A 580 ? 1.2792 1.0079 1.0198 0.1499  -0.4559 -0.0913 593 ALA A CA  
3811 C C   . ALA A 580 ? 1.4139 1.1223 1.1095 0.1383  -0.4342 -0.0767 593 ALA A C   
3812 O O   . ALA A 580 ? 1.4886 1.1517 1.1195 0.1440  -0.4309 -0.0619 593 ALA A O   
3813 C CB  . ALA A 580 ? 1.2797 1.0105 1.0414 0.1608  -0.4935 -0.1115 593 ALA A CB  
3814 N N   . MET A 581 ? 1.3345 1.0748 1.0645 0.1220  -0.4183 -0.0812 594 MET A N   
3815 C CA  . MET A 581 ? 1.4075 1.1340 1.1033 0.1102  -0.3951 -0.0679 594 MET A CA  
3816 C C   . MET A 581 ? 1.4107 1.1223 1.0719 0.1070  -0.3677 -0.0485 594 MET A C   
3817 O O   . MET A 581 ? 1.4941 1.1686 1.0998 0.1083  -0.3601 -0.0360 594 MET A O   
3818 C CB  . MET A 581 ? 1.3794 1.1463 1.1242 0.0924  -0.3774 -0.0740 594 MET A CB  
3819 C CG  . MET A 581 ? 1.3736 1.1494 1.1447 0.0906  -0.3973 -0.0914 594 MET A CG  
3820 S SD  . MET A 581 ? 1.4133 1.2175 1.2162 0.0681  -0.3685 -0.0906 594 MET A SD  
3821 C CE  . MET A 581 ? 1.6494 1.4848 1.5186 0.0649  -0.3907 -0.1181 594 MET A CE  
3822 N N   . HIS A 582 ? 1.2993 1.0410 0.9957 0.1026  -0.3526 -0.0477 595 HIS A N   
3823 C CA  . HIS A 582 ? 1.2198 0.9546 0.8938 0.0986  -0.3266 -0.0323 595 HIS A CA  
3824 C C   . HIS A 582 ? 1.2599 0.9454 0.8759 0.1113  -0.3338 -0.0224 595 HIS A C   
3825 O O   . HIS A 582 ? 1.1685 0.8297 0.7437 0.1077  -0.3148 -0.0088 595 HIS A O   
3826 C CB  . HIS A 582 ? 1.2047 0.9786 0.9270 0.0942  -0.3150 -0.0366 595 HIS A CB  
3827 C CG  . HIS A 582 ? 1.1579 0.9772 0.9329 0.0807  -0.3035 -0.0451 595 HIS A CG  
3828 N ND1 . HIS A 582 ? 1.1227 0.9800 0.9501 0.0781  -0.3011 -0.0561 595 HIS A ND1 
3829 C CD2 . HIS A 582 ? 1.1057 0.9357 0.8872 0.0690  -0.2928 -0.0444 595 HIS A CD2 
3830 C CE1 . HIS A 582 ? 0.9927 0.8811 0.8545 0.0646  -0.2880 -0.0612 595 HIS A CE1 
3831 N NE2 . HIS A 582 ? 0.9785 0.8503 0.8133 0.0591  -0.2833 -0.0538 595 HIS A NE2 
3832 N N   . GLY A 583 ? 1.2906 0.9605 0.9037 0.1263  -0.3609 -0.0296 596 GLY A N   
3833 C CA  . GLY A 583 ? 1.3150 0.9327 0.8695 0.1397  -0.3696 -0.0200 596 GLY A CA  
3834 C C   . GLY A 583 ? 1.3904 0.9623 0.8825 0.1430  -0.3748 -0.0130 596 GLY A C   
3835 O O   . GLY A 583 ? 1.5221 1.0526 0.9591 0.1449  -0.3622 0.0005  596 GLY A O   
3836 N N   . VAL A 584 ? 1.3382 0.9172 0.8396 0.1429  -0.3922 -0.0235 597 VAL A N   
3837 C CA  . VAL A 584 ? 1.4446 0.9825 0.8891 0.1456  -0.3982 -0.0195 597 VAL A CA  
3838 C C   . VAL A 584 ? 1.4088 0.9459 0.8358 0.1307  -0.3637 -0.0075 597 VAL A C   
3839 O O   . VAL A 584 ? 1.4812 0.9750 0.8485 0.1325  -0.3547 0.0027  597 VAL A O   
3840 C CB  . VAL A 584 ? 1.3478 0.8975 0.8135 0.1485  -0.4260 -0.0364 597 VAL A CB  
3841 C CG1 . VAL A 584 ? 1.3855 0.9001 0.7987 0.1473  -0.4261 -0.0331 597 VAL A CG1 
3842 C CG2 . VAL A 584 ? 1.3226 0.8615 0.7922 0.1672  -0.4646 -0.0484 597 VAL A CG2 
3843 N N   . PHE A 585 ? 1.3924 0.9761 0.8710 0.1165  -0.3444 -0.0094 598 PHE A N   
3844 C CA  . PHE A 585 ? 1.3004 0.8880 0.7697 0.1035  -0.3132 0.0009  598 PHE A CA  
3845 C C   . PHE A 585 ? 1.3270 0.8934 0.7652 0.1036  -0.2914 0.0145  598 PHE A C   
3846 O O   . PHE A 585 ? 1.4377 0.9739 0.8322 0.1013  -0.2758 0.0235  598 PHE A O   
3847 C CB  . PHE A 585 ? 1.2840 0.9240 0.8133 0.0901  -0.2985 -0.0030 598 PHE A CB  
3848 C CG  . PHE A 585 ? 1.2607 0.9052 0.7825 0.0786  -0.2706 0.0063  598 PHE A CG  
3849 C CD1 . PHE A 585 ? 1.1558 0.7895 0.6631 0.0744  -0.2700 0.0053  598 PHE A CD1 
3850 C CD2 . PHE A 585 ? 1.1434 0.8020 0.6730 0.0728  -0.2462 0.0151  598 PHE A CD2 
3851 C CE1 . PHE A 585 ? 1.1536 0.7905 0.6553 0.0653  -0.2456 0.0134  598 PHE A CE1 
3852 C CE2 . PHE A 585 ? 1.1556 0.8185 0.6800 0.0639  -0.2231 0.0226  598 PHE A CE2 
3853 C CZ  . PHE A 585 ? 1.1440 0.7958 0.6546 0.0606  -0.2229 0.0220  598 PHE A CZ  
3854 N N   . LEU A 586 ? 1.3479 0.9303 0.8107 0.1058  -0.2896 0.0146  599 LEU A N   
3855 C CA  . LEU A 586 ? 1.3393 0.9061 0.7812 0.1045  -0.2680 0.0255  599 LEU A CA  
3856 C C   . LEU A 586 ? 1.4778 0.9843 0.8506 0.1128  -0.2692 0.0342  599 LEU A C   
3857 O O   . LEU A 586 ? 1.5460 1.0331 0.8892 0.1066  -0.2452 0.0432  599 LEU A O   
3858 C CB  . LEU A 586 ? 1.1576 0.7470 0.6355 0.1075  -0.2706 0.0220  599 LEU A CB  
3859 C CG  . LEU A 586 ? 1.1119 0.7580 0.6508 0.0965  -0.2578 0.0166  599 LEU A CG  
3860 C CD1 . LEU A 586 ? 1.0564 0.7216 0.6284 0.1010  -0.2629 0.0110  599 LEU A CD1 
3861 C CD2 . LEU A 586 ? 1.0936 0.7508 0.6310 0.0845  -0.2276 0.0249  599 LEU A CD2 
3862 N N   . TYR A 587 ? 1.5529 1.0291 0.9000 0.1270  -0.2973 0.0308  600 TYR A N   
3863 C CA  . TYR A 587 ? 1.5868 0.9995 0.8610 0.1365  -0.3007 0.0395  600 TYR A CA  
3864 C C   . TYR A 587 ? 1.5691 0.9560 0.8002 0.1287  -0.2790 0.0468  600 TYR A C   
3865 O O   . TYR A 587 ? 1.5642 0.9155 0.7532 0.1268  -0.2575 0.0572  600 TYR A O   
3866 C CB  . TYR A 587 ? 1.6011 0.9881 0.8526 0.1530  -0.3394 0.0321  600 TYR A CB  
3867 C CG  . TYR A 587 ? 1.7434 1.0606 0.9113 0.1635  -0.3452 0.0409  600 TYR A CG  
3868 C CD1 . TYR A 587 ? 1.8927 1.1668 1.0199 0.1717  -0.3419 0.0510  600 TYR A CD1 
3869 C CD2 . TYR A 587 ? 1.8363 1.1277 0.9629 0.1648  -0.3528 0.0391  600 TYR A CD2 
3870 C CE1 . TYR A 587 ? 1.8825 1.0877 0.9271 0.1811  -0.3454 0.0601  600 TYR A CE1 
3871 C CE2 . TYR A 587 ? 2.0686 1.2930 1.1131 0.1744  -0.3571 0.0470  600 TYR A CE2 
3872 C CZ  . TYR A 587 ? 1.9746 1.1551 0.9767 0.1825  -0.3530 0.0580  600 TYR A CZ  
3873 O OH  . TYR A 587 ? 2.0507 1.1601 0.9657 0.1917  -0.3555 0.0669  600 TYR A OH  
3874 N N   . HIS A 588 ? 1.4709 0.8759 0.7149 0.1237  -0.2834 0.0404  601 HIS A N   
3875 C CA  . HIS A 588 ? 1.5033 0.8868 0.7114 0.1168  -0.2642 0.0452  601 HIS A CA  
3876 C C   . HIS A 588 ? 1.4653 0.8768 0.7012 0.1027  -0.2292 0.0507  601 HIS A C   
3877 O O   . HIS A 588 ? 1.3505 0.7341 0.5514 0.0988  -0.2051 0.0586  601 HIS A O   
3878 C CB  . HIS A 588 ? 1.5299 0.9235 0.7457 0.1163  -0.2813 0.0354  601 HIS A CB  
3879 C CG  . HIS A 588 ? 1.6860 1.0508 0.8724 0.1308  -0.3174 0.0279  601 HIS A CG  
3880 N ND1 . HIS A 588 ? 1.6823 1.0784 0.9140 0.1355  -0.3461 0.0148  601 HIS A ND1 
3881 C CD2 . HIS A 588 ? 1.6193 0.9261 0.7350 0.1422  -0.3299 0.0310  601 HIS A CD2 
3882 C CE1 . HIS A 588 ? 1.7259 1.0867 0.9192 0.1500  -0.3770 0.0091  601 HIS A CE1 
3883 N NE2 . HIS A 588 ? 1.6755 0.9802 0.7950 0.1547  -0.3685 0.0195  601 HIS A NE2 
3884 N N   . ALA A 589 ? 1.3568 0.8225 0.6555 0.0954  -0.2267 0.0458  602 ALA A N   
3885 C CA  . ALA A 589 ? 1.2314 0.7281 0.5611 0.0838  -0.1981 0.0497  602 ALA A CA  
3886 C C   . ALA A 589 ? 1.2886 0.7663 0.5998 0.0829  -0.1776 0.0574  602 ALA A C   
3887 O O   . ALA A 589 ? 1.3468 0.8173 0.6463 0.0759  -0.1522 0.0620  602 ALA A O   
3888 C CB  . ALA A 589 ? 1.2463 0.7982 0.6401 0.0789  -0.2022 0.0438  602 ALA A CB  
3889 N N   . ILE A 590 ? 1.4224 0.8916 0.7331 0.0900  -0.1888 0.0577  603 ILE A N   
3890 C CA  . ILE A 590 ? 1.4501 0.8990 0.7451 0.0892  -0.1706 0.0642  603 ILE A CA  
3891 C C   . ILE A 590 ? 1.4789 0.8720 0.7097 0.0896  -0.1557 0.0718  603 ILE A C   
3892 O O   . ILE A 590 ? 1.6993 1.0833 0.9230 0.0823  -0.1279 0.0763  603 ILE A O   
3893 C CB  . ILE A 590 ? 1.4755 0.9142 0.7719 0.0993  -0.1892 0.0633  603 ILE A CB  
3894 C CG1 . ILE A 590 ? 1.3304 0.8225 0.6894 0.0997  -0.2054 0.0538  603 ILE A CG1 
3895 C CG2 . ILE A 590 ? 1.4068 0.8244 0.6898 0.0969  -0.1678 0.0698  603 ILE A CG2 
3896 C CD1 . ILE A 590 ? 1.2714 0.8001 0.6751 0.0928  -0.1893 0.0523  603 ILE A CD1 
3897 N N   . LYS A 591 ? 1.4201 0.7758 0.6048 0.0980  -0.1739 0.0720  604 LYS A N   
3898 C CA  . LYS A 591 ? 1.5829 0.8816 0.6999 0.0989  -0.1604 0.0786  604 LYS A CA  
3899 C C   . LYS A 591 ? 1.5692 0.8795 0.6917 0.0871  -0.1325 0.0784  604 LYS A C   
3900 O O   . LYS A 591 ? 1.6999 0.9785 0.7886 0.0822  -0.1061 0.0835  604 LYS A O   
3901 C CB  . LYS A 591 ? 1.5113 0.7711 0.5790 0.1113  -0.1894 0.0769  604 LYS A CB  
3902 N N   . SER A 592 ? 1.6165 0.9712 0.7826 0.0826  -0.1378 0.0720  605 SER A N   
3903 C CA  . SER A 592 ? 1.6351 1.0041 0.8121 0.0729  -0.1144 0.0709  605 SER A CA  
3904 C C   . SER A 592 ? 1.4852 0.8848 0.7014 0.0635  -0.0873 0.0721  605 SER A C   
3905 O O   . SER A 592 ? 1.4352 0.8338 0.6499 0.0566  -0.0630 0.0720  605 SER A O   
3906 C CB  . SER A 592 ? 1.5981 1.0008 0.8073 0.0717  -0.1294 0.0644  605 SER A CB  
3907 O OG  . SER A 592 ? 1.7564 1.1264 0.9246 0.0787  -0.1490 0.0615  605 SER A OG  
3908 N N   . GLY A 593 ? 1.3596 0.7868 0.6122 0.0636  -0.0922 0.0717  606 GLY A N   
3909 C CA  . GLY A 593 ? 1.3598 0.8137 0.6475 0.0557  -0.0691 0.0715  606 GLY A CA  
3910 C C   . GLY A 593 ? 1.2121 0.7222 0.5606 0.0533  -0.0764 0.0671  606 GLY A C   
3911 O O   . GLY A 593 ? 1.1135 0.6525 0.4949 0.0465  -0.0589 0.0651  606 GLY A O   
3912 N N   . MET A 594 ? 1.2356 0.7610 0.5991 0.0588  -0.1018 0.0645  607 MET A N   
3913 C CA  . MET A 594 ? 1.2190 0.7949 0.6366 0.0563  -0.1080 0.0599  607 MET A CA  
3914 C C   . MET A 594 ? 1.1371 0.7178 0.5686 0.0566  -0.1027 0.0596  607 MET A C   
3915 O O   . MET A 594 ? 1.4453 1.0006 0.8575 0.0636  -0.1147 0.0607  607 MET A O   
3916 C CB  . MET A 594 ? 1.2162 0.8056 0.6474 0.0613  -0.1346 0.0556  607 MET A CB  
3917 C CG  . MET A 594 ? 1.1067 0.7477 0.5919 0.0572  -0.1377 0.0506  607 MET A CG  
3918 S SD  . MET A 594 ? 1.0805 0.7371 0.5845 0.0603  -0.1642 0.0437  607 MET A SD  
3919 C CE  . MET A 594 ? 1.1610 0.8745 0.7237 0.0532  -0.1587 0.0391  607 MET A CE  
3920 N N   . ASP A 595 ? 1.1323 0.7451 0.5975 0.0496  -0.0859 0.0574  608 ASP A N   
3921 C CA  . ASP A 595 ? 1.2409 0.8585 0.7207 0.0481  -0.0765 0.0557  608 ASP A CA  
3922 C C   . ASP A 595 ? 1.1042 0.7564 0.6222 0.0503  -0.0909 0.0503  608 ASP A C   
3923 O O   . ASP A 595 ? 1.2174 0.8646 0.7408 0.0523  -0.0909 0.0486  608 ASP A O   
3924 C CB  . ASP A 595 ? 1.1889 0.8254 0.6884 0.0397  -0.0521 0.0535  608 ASP A CB  
3925 C CG  . ASP A 595 ? 1.3054 0.9119 0.7734 0.0368  -0.0355 0.0569  608 ASP A CG  
3926 O OD1 . ASP A 595 ? 1.7327 1.3018 1.1716 0.0356  -0.0216 0.0595  608 ASP A OD1 
3927 O OD2 . ASP A 595 ? 1.1981 0.8166 0.6698 0.0355  -0.0351 0.0568  608 ASP A OD2 
3928 N N   . MET A 596 ? 1.0464 0.7320 0.5903 0.0495  -0.1016 0.0471  609 MET A N   
3929 C CA  . MET A 596 ? 0.9610 0.6850 0.5451 0.0494  -0.1101 0.0408  609 MET A CA  
3930 C C   . MET A 596 ? 0.9606 0.7072 0.5609 0.0488  -0.1227 0.0387  609 MET A C   
3931 O O   . MET A 596 ? 1.1306 0.8660 0.7139 0.0478  -0.1234 0.0421  609 MET A O   
3932 C CB  . MET A 596 ? 1.0122 0.7684 0.6251 0.0428  -0.0934 0.0376  609 MET A CB  
3933 C CG  . MET A 596 ? 0.9897 0.7614 0.6068 0.0375  -0.0826 0.0396  609 MET A CG  
3934 S SD  . MET A 596 ? 0.9854 0.7984 0.6377 0.0320  -0.0685 0.0342  609 MET A SD  
3935 C CE  . MET A 596 ? 0.9692 0.7583 0.6089 0.0295  -0.0493 0.0336  609 MET A CE  
3936 N N   . GLY A 597 ? 0.8535 0.6312 0.4875 0.0487  -0.1311 0.0323  610 GLY A N   
3937 C CA  . GLY A 597 ? 0.8908 0.6915 0.5445 0.0463  -0.1398 0.0292  610 GLY A CA  
3938 C C   . GLY A 597 ? 0.9255 0.7642 0.6190 0.0438  -0.1412 0.0216  610 GLY A C   
3939 O O   . GLY A 597 ? 0.9365 0.7810 0.6418 0.0461  -0.1405 0.0174  610 GLY A O   
3940 N N   . ILE A 598 ? 0.8511 0.7141 0.5644 0.0386  -0.1415 0.0196  611 ILE A N   
3941 C CA  . ILE A 598 ? 0.8794 0.7769 0.6289 0.0353  -0.1414 0.0116  611 ILE A CA  
3942 C C   . ILE A 598 ? 0.8670 0.7631 0.6310 0.0392  -0.1595 0.0038  611 ILE A C   
3943 O O   . ILE A 598 ? 0.8561 0.7503 0.6212 0.0370  -0.1660 0.0031  611 ILE A O   
3944 C CB  . ILE A 598 ? 0.8442 0.7668 0.6057 0.0270  -0.1294 0.0139  611 ILE A CB  
3945 C CG1 . ILE A 598 ? 0.7939 0.7168 0.5411 0.0254  -0.1150 0.0205  611 ILE A CG1 
3946 C CG2 . ILE A 598 ? 0.8271 0.7827 0.6224 0.0230  -0.1269 0.0052  611 ILE A CG2 
3947 C CD1 . ILE A 598 ? 0.8315 0.7710 0.5815 0.0197  -0.1052 0.0248  611 ILE A CD1 
3948 N N   . VAL A 599 ? 0.9368 0.8337 0.7136 0.0454  -0.1684 -0.0032 612 VAL A N   
3949 C CA  . VAL A 599 ? 0.9365 0.8261 0.7240 0.0526  -0.1895 -0.0114 612 VAL A CA  
3950 C C   . VAL A 599 ? 0.8778 0.7959 0.7066 0.0539  -0.1931 -0.0240 612 VAL A C   
3951 O O   . VAL A 599 ? 0.9004 0.8391 0.7436 0.0499  -0.1790 -0.0255 612 VAL A O   
3952 C CB  . VAL A 599 ? 0.9602 0.8072 0.7111 0.0636  -0.2025 -0.0068 612 VAL A CB  
3953 C CG1 . VAL A 599 ? 0.9400 0.7575 0.6493 0.0621  -0.1975 0.0041  612 VAL A CG1 
3954 C CG2 . VAL A 599 ? 0.9005 0.7396 0.6464 0.0675  -0.1958 -0.0054 612 VAL A CG2 
3955 N N   . ASN A 600 ? 0.9387 0.8585 0.7877 0.0598  -0.2125 -0.0344 613 ASN A N   
3956 C CA  . ASN A 600 ? 0.8983 0.8426 0.7889 0.0632  -0.2185 -0.0484 613 ASN A CA  
3957 C C   . ASN A 600 ? 0.8776 0.7946 0.7528 0.0768  -0.2323 -0.0483 613 ASN A C   
3958 O O   . ASN A 600 ? 0.8619 0.7564 0.7285 0.0879  -0.2553 -0.0515 613 ASN A O   
3959 C CB  . ASN A 600 ? 0.8802 0.8433 0.8072 0.0625  -0.2321 -0.0619 613 ASN A CB  
3960 C CG  . ASN A 600 ? 0.9730 0.9710 0.9518 0.0621  -0.2313 -0.0782 613 ASN A CG  
3961 O OD1 . ASN A 600 ? 0.9412 0.9469 0.9268 0.0640  -0.2232 -0.0797 613 ASN A OD1 
3962 N ND2 . ASN A 600 ? 0.9662 0.9860 0.9843 0.0592  -0.2390 -0.0920 613 ASN A ND2 
3963 N N   . ALA A 601 ? 0.9007 0.8188 0.7717 0.0760  -0.2185 -0.0451 614 ALA A N   
3964 C CA  . ALA A 601 ? 0.9047 0.7877 0.7476 0.0861  -0.2242 -0.0397 614 ALA A CA  
3965 C C   . ALA A 601 ? 1.0456 0.9149 0.8998 0.1009  -0.2488 -0.0486 614 ALA A C   
3966 O O   . ALA A 601 ? 1.1654 0.9922 0.9832 0.1116  -0.2610 -0.0418 614 ALA A O   
3967 C CB  . ALA A 601 ? 0.9048 0.7987 0.7519 0.0809  -0.2039 -0.0382 614 ALA A CB  
3968 N N   . GLY A 602 ? 0.9607 0.8640 0.8642 0.1019  -0.2558 -0.0642 615 GLY A N   
3969 C CA  . GLY A 602 ? 1.0640 0.9579 0.9849 0.1173  -0.2816 -0.0751 615 GLY A CA  
3970 C C   . GLY A 602 ? 1.0297 0.9020 0.9360 0.1264  -0.3078 -0.0762 615 GLY A C   
3971 O O   . GLY A 602 ? 1.0687 0.9121 0.9623 0.1425  -0.3321 -0.0783 615 GLY A O   
3972 N N   . ASN A 603 ? 1.0647 0.9489 0.9704 0.1165  -0.3033 -0.0747 616 ASN A N   
3973 C CA  . ASN A 603 ? 1.1576 1.0363 1.0677 0.1224  -0.3275 -0.0820 616 ASN A CA  
3974 C C   . ASN A 603 ? 1.2482 1.0875 1.1009 0.1229  -0.3312 -0.0677 616 ASN A C   
3975 O O   . ASN A 603 ? 1.2336 1.0817 1.0885 0.1149  -0.3301 -0.0686 616 ASN A O   
3976 C CB  . ASN A 603 ? 1.2223 1.1490 1.1865 0.1099  -0.3199 -0.0956 616 ASN A CB  
3977 C CG  . ASN A 603 ? 1.0822 1.0490 1.0987 0.1058  -0.3074 -0.1082 616 ASN A CG  
3978 O OD1 . ASN A 603 ? 0.9912 0.9863 1.0235 0.0910  -0.2815 -0.1072 616 ASN A OD1 
3979 N ND2 . ASN A 603 ? 1.0811 1.0482 1.1219 0.1197  -0.3260 -0.1201 616 ASN A ND2 
3980 N N   . LEU A 604 ? 1.2045 0.9986 1.0056 0.1318  -0.3340 -0.0550 617 LEU A N   
3981 C CA  . LEU A 604 ? 1.2053 0.9560 0.9467 0.1340  -0.3375 -0.0420 617 LEU A CA  
3982 C C   . LEU A 604 ? 1.3366 1.0386 1.0383 0.1531  -0.3643 -0.0399 617 LEU A C   
3983 O O   . LEU A 604 ? 1.3917 1.0604 1.0588 0.1585  -0.3579 -0.0295 617 LEU A O   
3984 C CB  . LEU A 604 ? 1.1535 0.8915 0.8611 0.1232  -0.3075 -0.0260 617 LEU A CB  
3985 C CG  . LEU A 604 ? 1.1282 0.9011 0.8558 0.1060  -0.2838 -0.0243 617 LEU A CG  
3986 C CD1 . LEU A 604 ? 1.1844 0.9415 0.8784 0.0986  -0.2582 -0.0099 617 LEU A CD1 
3987 C CD2 . LEU A 604 ? 1.1631 0.9376 0.8886 0.1028  -0.2933 -0.0271 617 LEU A CD2 
3988 N N   . PRO A 605 ? 1.3553 1.0514 1.0613 0.1636  -0.3947 -0.0503 618 PRO A N   
3989 C CA  . PRO A 605 ? 1.3943 1.0423 1.0597 0.1840  -0.4253 -0.0494 618 PRO A CA  
3990 C C   . PRO A 605 ? 1.4241 1.0117 1.0090 0.1870  -0.4172 -0.0298 618 PRO A C   
3991 O O   . PRO A 605 ? 1.4705 1.0543 1.0313 0.1737  -0.3937 -0.0197 618 PRO A O   
3992 C CB  . PRO A 605 ? 1.4928 1.1501 1.1741 0.1893  -0.4538 -0.0635 618 PRO A CB  
3993 C CG  . PRO A 605 ? 1.3612 1.0810 1.1146 0.1745  -0.4416 -0.0774 618 PRO A CG  
3994 C CD  . PRO A 605 ? 1.3829 1.1190 1.1355 0.1565  -0.4021 -0.0649 618 PRO A CD  
3995 N N   . VAL A 606 ? 1.5068 1.0464 1.0508 0.2047  -0.4362 -0.0250 619 VAL A N   
3996 C CA  . VAL A 606 ? 1.5834 1.0585 1.0456 0.2091  -0.4307 -0.0073 619 VAL A CA  
3997 C C   . VAL A 606 ? 1.6909 1.1397 1.1138 0.2157  -0.4531 -0.0090 619 VAL A C   
3998 O O   . VAL A 606 ? 1.5404 0.9954 0.9814 0.2287  -0.4877 -0.0229 619 VAL A O   
3999 C CB  . VAL A 606 ? 1.6299 1.0572 1.0575 0.2262  -0.4429 -0.0007 619 VAL A CB  
4000 C CG1 . VAL A 606 ? 1.8124 1.1676 1.1500 0.2305  -0.4365 0.0176  619 VAL A CG1 
4001 C CG2 . VAL A 606 ? 1.5281 0.9798 0.9940 0.2190  -0.4199 0.0000  619 VAL A CG2 
4002 N N   . TYR A 607 ? 1.7046 1.1250 1.0757 0.2067  -0.4332 0.0036  620 TYR A N   
4003 C CA  . TYR A 607 ? 1.7304 1.1262 1.0615 0.2103  -0.4492 0.0021  620 TYR A CA  
4004 C C   . TYR A 607 ? 1.7675 1.1145 1.0531 0.2339  -0.4898 -0.0008 620 TYR A C   
4005 O O   . TYR A 607 ? 1.7216 1.0731 1.0114 0.2409  -0.5182 -0.0132 620 TYR A O   
4006 C CB  . TYR A 607 ? 1.7148 1.0790 0.9900 0.1984  -0.4179 0.0178  620 TYR A CB  
4007 C CG  . TYR A 607 ? 1.7400 1.0807 0.9741 0.1995  -0.4288 0.0162  620 TYR A CG  
4008 C CD1 . TYR A 607 ? 1.7218 1.1061 0.9999 0.1903  -0.4325 0.0041  620 TYR A CD1 
4009 C CD2 . TYR A 607 ? 1.7774 1.0500 0.9267 0.2092  -0.4339 0.0265  620 TYR A CD2 
4010 C CE1 . TYR A 607 ? 1.7660 1.1285 1.0078 0.1911  -0.4425 0.0014  620 TYR A CE1 
4011 C CE2 . TYR A 607 ? 1.7316 0.9818 0.8414 0.2103  -0.4437 0.0239  620 TYR A CE2 
4012 C CZ  . TYR A 607 ? 1.7533 1.0496 0.9110 0.2014  -0.4486 0.0108  620 TYR A CZ  
4013 O OH  . TYR A 607 ? 1.7351 1.0086 0.8546 0.2023  -0.4583 0.0070  620 TYR A OH  
4014 N N   . ASP A 608 ? 1.8946 1.1944 1.1371 0.2464  -0.4931 0.0097  621 ASP A N   
4015 C CA  . ASP A 608 ? 2.1379 1.3835 1.3285 0.2710  -0.5320 0.0091  621 ASP A CA  
4016 C C   . ASP A 608 ? 2.0189 1.2961 1.2677 0.2873  -0.5723 -0.0104 621 ASP A C   
4017 O O   . ASP A 608 ? 1.9314 1.1777 1.1505 0.3074  -0.6119 -0.0170 621 ASP A O   
4018 C CB  . ASP A 608 ? 2.1333 1.3145 1.2580 0.2791  -0.5209 0.0278  621 ASP A CB  
4019 N N   . ASP A 609 ? 1.9394 1.2773 1.2703 0.2790  -0.5624 -0.0206 622 ASP A N   
4020 C CA  . ASP A 609 ? 1.8721 1.2459 1.2682 0.2927  -0.5959 -0.0410 622 ASP A CA  
4021 C C   . ASP A 609 ? 1.7863 1.2238 1.2542 0.2834  -0.6048 -0.0622 622 ASP A C   
4022 O O   . ASP A 609 ? 1.5763 1.0552 1.1126 0.2901  -0.6254 -0.0816 622 ASP A O   
4023 C CB  . ASP A 609 ? 2.0036 1.4022 1.4466 0.2911  -0.5806 -0.0413 622 ASP A CB  
4024 C CG  . ASP A 609 ? 2.2356 1.5702 1.6173 0.3052  -0.5814 -0.0248 622 ASP A CG  
4025 O OD1 . ASP A 609 ? 2.6000 1.8693 1.9031 0.3193  -0.5987 -0.0143 622 ASP A OD1 
4026 O OD2 . ASP A 609 ? 2.2127 1.5608 1.6238 0.3019  -0.5640 -0.0227 622 ASP A OD2 
4027 N N   . ILE A 610 ? 1.8521 1.2965 1.3060 0.2677  -0.5883 -0.0592 623 ILE A N   
4028 C CA  . ILE A 610 ? 1.8308 1.3276 1.3449 0.2581  -0.5958 -0.0782 623 ILE A CA  
4029 C C   . ILE A 610 ? 1.7459 1.2169 1.2339 0.2750  -0.6387 -0.0903 623 ILE A C   
4030 O O   . ILE A 610 ? 1.8403 1.2541 1.2478 0.2824  -0.6454 -0.0783 623 ILE A O   
4031 C CB  . ILE A 610 ? 1.6499 1.1658 1.1630 0.2336  -0.5580 -0.0698 623 ILE A CB  
4032 N N   . HIS A 611 ? 1.7175 1.2308 1.2738 0.2807  -0.6671 -0.1150 624 HIS A N   
4033 C CA  . HIS A 611 ? 1.7183 1.2138 1.2613 0.2982  -0.7130 -0.1312 624 HIS A CA  
4034 C C   . HIS A 611 ? 1.7279 1.1909 1.2092 0.2918  -0.7095 -0.1242 624 HIS A C   
4035 O O   . HIS A 611 ? 1.6950 1.1847 1.1941 0.2696  -0.6786 -0.1215 624 HIS A O   
4036 C CB  . HIS A 611 ? 1.4996 1.0598 1.1411 0.2966  -0.7330 -0.1612 624 HIS A CB  
4037 N N   . LYS A 612 ? 1.7462 1.1500 1.1536 0.3122  -0.7416 -0.1215 625 LYS A N   
4038 C CA  . LYS A 612 ? 1.8218 1.1819 1.1536 0.3085  -0.7369 -0.1120 625 LYS A CA  
4039 C C   . LYS A 612 ? 1.8544 1.2511 1.2261 0.2957  -0.7414 -0.1303 625 LYS A C   
4040 O O   . LYS A 612 ? 1.9669 1.3446 1.2960 0.2838  -0.7215 -0.1215 625 LYS A O   
4041 C CB  . LYS A 612 ? 1.8169 1.1038 1.0595 0.3351  -0.7740 -0.1072 625 LYS A CB  
4042 N N   . GLU A 613 ? 1.8800 1.3283 1.3346 0.2979  -0.7664 -0.1565 626 GLU A N   
4043 C CA  . GLU A 613 ? 1.8446 1.3312 1.3468 0.2841  -0.7692 -0.1758 626 GLU A CA  
4044 C C   . GLU A 613 ? 1.7308 1.2625 1.2801 0.2549  -0.7198 -0.1688 626 GLU A C   
4045 O O   . GLU A 613 ? 1.6749 1.2043 1.2080 0.2398  -0.7012 -0.1654 626 GLU A O   
4046 C CB  . GLU A 613 ? 1.9057 1.4354 1.4882 0.2945  -0.8090 -0.2076 626 GLU A CB  
4047 N N   . LEU A 614 ? 1.6542 1.2247 1.2596 0.2479  -0.6997 -0.1668 627 LEU A N   
4048 C CA  . LEU A 614 ? 1.4666 1.0801 1.1171 0.2220  -0.6544 -0.1601 627 LEU A CA  
4049 C C   . LEU A 614 ? 1.5268 1.1058 1.1096 0.2116  -0.6179 -0.1328 627 LEU A C   
4050 O O   . LEU A 614 ? 1.4854 1.0812 1.0777 0.1922  -0.5889 -0.1281 627 LEU A O   
4051 C CB  . LEU A 614 ? 1.3461 1.0022 1.0619 0.2197  -0.6431 -0.1639 627 LEU A CB  
4052 C CG  . LEU A 614 ? 1.2990 0.9989 1.0600 0.1948  -0.5976 -0.1570 627 LEU A CG  
4053 C CD1 . LEU A 614 ? 1.2997 1.0342 1.1058 0.1769  -0.5892 -0.1705 627 LEU A CD1 
4054 C CD2 . LEU A 614 ? 1.2350 0.9742 1.0581 0.1953  -0.5916 -0.1640 627 LEU A CD2 
4055 N N   . LEU A 615 ? 1.5427 1.0726 1.0588 0.2248  -0.6191 -0.1155 628 LEU A N   
4056 C CA  . LEU A 615 ? 1.5625 1.0553 1.0120 0.2167  -0.5859 -0.0909 628 LEU A CA  
4057 C C   . LEU A 615 ? 1.7070 1.1757 1.1131 0.2108  -0.5839 -0.0901 628 LEU A C   
4058 O O   . LEU A 615 ? 1.7468 1.2254 1.1518 0.1929  -0.5501 -0.0808 628 LEU A O   
4059 C CB  . LEU A 615 ? 1.6733 1.1095 1.0538 0.2341  -0.5937 -0.0757 628 LEU A CB  
4060 C CG  . LEU A 615 ? 1.7459 1.1482 1.0691 0.2254  -0.5551 -0.0508 628 LEU A CG  
4061 C CD1 . LEU A 615 ? 1.8246 1.1878 1.1095 0.2401  -0.5595 -0.0389 628 LEU A CD1 
4062 C CD2 . LEU A 615 ? 1.6627 1.0210 0.9148 0.2223  -0.5471 -0.0424 628 LEU A CD2 
4063 N N   . GLN A 616 ? 1.7182 1.1553 1.0894 0.2268  -0.6216 -0.1010 629 GLN A N   
4064 C CA  . GLN A 616 ? 1.7127 1.1227 1.0386 0.2236  -0.6243 -0.1027 629 GLN A CA  
4065 C C   . GLN A 616 ? 1.7018 1.1617 1.0920 0.2042  -0.6122 -0.1161 629 GLN A C   
4066 O O   . GLN A 616 ? 1.7385 1.1855 1.1009 0.1932  -0.5940 -0.1111 629 GLN A O   
4067 C CB  . GLN A 616 ? 1.6199 0.9895 0.9008 0.2463  -0.6722 -0.1150 629 GLN A CB  
4068 N N   . LEU A 617 ? 1.6250 1.1400 1.1009 0.2000  -0.6211 -0.1334 630 LEU A N   
4069 C CA  . LEU A 617 ? 1.5296 1.0919 1.0708 0.1807  -0.6080 -0.1464 630 LEU A CA  
4070 C C   . LEU A 617 ? 1.5450 1.1242 1.0940 0.1600  -0.5597 -0.1283 630 LEU A C   
4071 O O   . LEU A 617 ? 1.5268 1.1065 1.0705 0.1465  -0.5419 -0.1264 630 LEU A O   
4072 C CB  . LEU A 617 ? 1.5391 1.1551 1.1705 0.1807  -0.6254 -0.1690 630 LEU A CB  
4073 N N   . CYS A 618 ? 1.5165 1.1085 1.0777 0.1585  -0.5400 -0.1158 631 CYS A N   
4074 C CA  . CYS A 618 ? 1.4136 1.0201 0.9790 0.1414  -0.4967 -0.0985 631 CYS A CA  
4075 C C   . CYS A 618 ? 1.4853 1.0460 0.9758 0.1400  -0.4786 -0.0805 631 CYS A C   
4076 O O   . CYS A 618 ? 1.4431 1.0127 0.9362 0.1251  -0.4509 -0.0734 631 CYS A O   
4077 C CB  . CYS A 618 ? 1.4658 1.0894 1.0520 0.1428  -0.4834 -0.0901 631 CYS A CB  
4078 S SG  . CYS A 618 ? 1.3817 1.0683 1.0654 0.1389  -0.4909 -0.1100 631 CYS A SG  
4079 N N   . GLU A 619 ? 1.6688 1.1789 1.0921 0.1558  -0.4939 -0.0736 632 GLU A N   
4080 C CA  . GLU A 619 ? 1.7133 1.1754 1.0617 0.1553  -0.4776 -0.0587 632 GLU A CA  
4081 C C   . GLU A 619 ? 1.7190 1.1801 1.0633 0.1463  -0.4756 -0.0661 632 GLU A C   
4082 O O   . GLU A 619 ? 1.8076 1.2559 1.1249 0.1365  -0.4474 -0.0548 632 GLU A O   
4083 C CB  . GLU A 619 ? 1.6937 1.0973 0.9684 0.1749  -0.5009 -0.0543 632 GLU A CB  
4084 N N   . ASP A 620 ? 1.7133 1.1888 1.0879 0.1497  -0.5055 -0.0863 633 ASP A N   
4085 C CA  . ASP A 620 ? 1.8513 1.3276 1.2285 0.1411  -0.5063 -0.0963 633 ASP A CA  
4086 C C   . ASP A 620 ? 1.7342 1.2551 1.1704 0.1202  -0.4757 -0.0953 633 ASP A C   
4087 O O   . ASP A 620 ? 1.6655 1.1780 1.0877 0.1106  -0.4595 -0.0929 633 ASP A O   
4088 C CB  . ASP A 620 ? 2.0703 1.5509 1.4680 0.1509  -0.5487 -0.1207 633 ASP A CB  
4089 N N   . LEU A 621 ? 1.5896 1.1556 1.0893 0.1139  -0.4679 -0.0972 634 LEU A N   
4090 C CA  . LEU A 621 ? 1.4720 1.0786 1.0252 0.0948  -0.4389 -0.0951 634 LEU A CA  
4091 C C   . LEU A 621 ? 1.4588 1.0560 0.9831 0.0870  -0.4020 -0.0732 634 LEU A C   
4092 O O   . LEU A 621 ? 1.4436 1.0463 0.9736 0.0747  -0.3812 -0.0693 634 LEU A O   
4093 C CB  . LEU A 621 ? 1.3573 1.0118 0.9815 0.0911  -0.4401 -0.1036 634 LEU A CB  
4094 C CG  . LEU A 621 ? 1.3504 1.0457 1.0272 0.0721  -0.4090 -0.1002 634 LEU A CG  
4095 C CD1 . LEU A 621 ? 1.3764 1.0763 1.0695 0.0594  -0.4030 -0.1077 634 LEU A CD1 
4096 C CD2 . LEU A 621 ? 1.3485 1.0870 1.0912 0.0701  -0.4136 -0.1117 634 LEU A CD2 
4097 N N   . ILE A 622 ? 1.3238 0.9068 0.8193 0.0943  -0.3947 -0.0600 635 ILE A N   
4098 C CA  . ILE A 622 ? 1.3630 0.9379 0.8334 0.0880  -0.3615 -0.0412 635 ILE A CA  
4099 C C   . ILE A 622 ? 1.5330 1.0686 0.9473 0.0876  -0.3525 -0.0352 635 ILE A C   
4100 O O   . ILE A 622 ? 1.5874 1.1278 1.0015 0.0776  -0.3254 -0.0262 635 ILE A O   
4101 C CB  . ILE A 622 ? 1.4473 1.0110 0.8971 0.0964  -0.3575 -0.0304 635 ILE A CB  
4102 C CG1 . ILE A 622 ? 1.3655 0.9751 0.8752 0.0912  -0.3500 -0.0318 635 ILE A CG1 
4103 C CG2 . ILE A 622 ? 1.6531 1.1904 1.0567 0.0938  -0.3295 -0.0134 635 ILE A CG2 
4104 C CD1 . ILE A 622 ? 1.3209 0.9505 0.8704 0.0986  -0.3788 -0.0479 635 ILE A CD1 
4105 N N   . TRP A 623 ? 1.5637 1.0601 0.9304 0.0991  -0.3758 -0.0411 636 TRP A N   
4106 C CA  . TRP A 623 ? 1.5393 0.9940 0.8469 0.0999  -0.3681 -0.0370 636 TRP A CA  
4107 C C   . TRP A 623 ? 1.5895 1.0444 0.9061 0.0958  -0.3806 -0.0513 636 TRP A C   
4108 O O   . TRP A 623 ? 1.5944 1.0121 0.8602 0.0985  -0.3807 -0.0519 636 TRP A O   
4109 C CB  . TRP A 623 ? 1.4971 0.9001 0.7340 0.1151  -0.3825 -0.0329 636 TRP A CB  
4110 C CG  . TRP A 623 ? 1.5077 0.9000 0.7243 0.1172  -0.3632 -0.0170 636 TRP A CG  
4111 C CD1 . TRP A 623 ? 1.6048 1.0001 0.8289 0.1257  -0.3746 -0.0147 636 TRP A CD1 
4112 C CD2 . TRP A 623 ? 1.5719 0.9488 0.7604 0.1105  -0.3284 -0.0025 636 TRP A CD2 
4113 N NE1 . TRP A 623 ? 1.6520 1.0335 0.8531 0.1239  -0.3486 0.0006  636 TRP A NE1 
4114 C CE2 . TRP A 623 ? 1.6143 0.9856 0.7947 0.1144  -0.3200 0.0077  636 TRP A CE2 
4115 C CE3 . TRP A 623 ? 1.5894 0.9573 0.7614 0.1017  -0.3037 0.0013  636 TRP A CE3 
4116 C CZ2 . TRP A 623 ? 1.6466 1.0048 0.8049 0.1089  -0.2875 0.0210  636 TRP A CZ2 
4117 C CZ3 . TRP A 623 ? 1.7098 1.0660 0.8611 0.0972  -0.2720 0.0143  636 TRP A CZ3 
4118 C CH2 . TRP A 623 ? 1.7763 1.1282 0.9216 0.1004  -0.2640 0.0236  636 TRP A CH2 
4119 N N   . ASN A 624 ? 1.4567 0.9522 0.8376 0.0888  -0.3901 -0.0638 637 ASN A N   
4120 C CA  . ASN A 624 ? 1.5088 1.0091 0.9086 0.0825  -0.3998 -0.0787 637 ASN A CA  
4121 C C   . ASN A 624 ? 1.6027 1.0584 0.9453 0.0932  -0.4237 -0.0883 637 ASN A C   
4122 O O   . ASN A 624 ? 1.6031 1.0450 0.9322 0.0878  -0.4193 -0.0935 637 ASN A O   
4123 C CB  . ASN A 624 ? 1.4678 0.9792 0.8823 0.0677  -0.3674 -0.0704 637 ASN A CB  
4124 C CG  . ASN A 624 ? 1.4315 0.9580 0.8839 0.0579  -0.3734 -0.0854 637 ASN A CG  
4125 O OD1 . ASN A 624 ? 1.3426 0.8981 0.8465 0.0548  -0.3894 -0.0995 637 ASN A OD1 
4126 N ND2 . ASN A 624 ? 1.4031 0.9096 0.8323 0.0527  -0.3594 -0.0833 637 ASN A ND2 
4127 N N   . LYS A 625 ? 1.7946 1.2259 1.1018 0.1090  -0.4495 -0.0907 638 LYS A N   
4128 C CA  . LYS A 625 ? 1.9472 1.3314 1.1913 0.1216  -0.4747 -0.0991 638 LYS A CA  
4129 C C   . LYS A 625 ? 1.9549 1.3551 1.2357 0.1233  -0.5088 -0.1241 638 LYS A C   
4130 O O   . LYS A 625 ? 2.1629 1.5377 1.4128 0.1252  -0.5212 -0.1350 638 LYS A O   
4131 C CB  . LYS A 625 ? 2.0181 1.3657 1.2059 0.1389  -0.4899 -0.0911 638 LYS A CB  
4132 C CG  . LYS A 625 ? 2.0011 1.3309 1.1532 0.1366  -0.4556 -0.0680 638 LYS A CG  
4133 C CD  . LYS A 625 ? 1.9595 1.2445 1.0482 0.1533  -0.4693 -0.0597 638 LYS A CD  
4134 C CE  . LYS A 625 ? 1.8676 1.1773 0.9970 0.1621  -0.4921 -0.0637 638 LYS A CE  
4135 N NZ  . LYS A 625 ? 2.0126 1.2754 1.0788 0.1783  -0.5025 -0.0533 638 LYS A NZ  
4136 N N   . ASP A 626 ? 2.0157 1.4587 1.3643 0.1225  -0.5233 -0.1345 639 ASP A N   
4137 C CA  . ASP A 626 ? 2.0690 1.5373 1.4699 0.1210  -0.5518 -0.1603 639 ASP A CA  
4138 C C   . ASP A 626 ? 2.0530 1.5604 1.5179 0.0996  -0.5260 -0.1637 639 ASP A C   
4139 O O   . ASP A 626 ? 1.7844 1.3219 1.2865 0.0890  -0.4982 -0.1514 639 ASP A O   
4140 C CB  . ASP A 626 ? 2.0532 1.5484 1.4988 0.1310  -0.5798 -0.1719 639 ASP A CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   14  ?   ?   ?   A . n 
A 1 2   MET 2   15  ?   ?   ?   A . n 
A 1 3   LYS 3   16  ?   ?   ?   A . n 
A 1 4   THR 4   17  17  THR THR A . n 
A 1 5   LEU 5   18  18  LEU LEU A . n 
A 1 6   ARG 6   19  19  ARG ARG A . n 
A 1 7   ASP 7   20  20  ASP ASP A . n 
A 1 8   GLU 8   21  21  GLU GLU A . n 
A 1 9   ILE 9   22  22  ILE ILE A . n 
A 1 10  ASN 10  23  23  ASN ASN A . n 
A 1 11  ALA 11  24  24  ALA ALA A . n 
A 1 12  ILE 12  25  25  ILE ILE A . n 
A 1 13  LEU 13  26  26  LEU LEU A . n 
A 1 14  GLN 14  27  27  GLN GLN A . n 
A 1 15  LYS 15  28  28  LYS LYS A . n 
A 1 16  ARG 16  29  29  ARG ARG A . n 
A 1 17  ILE 17  30  30  ILE ILE A . n 
A 1 18  MET 18  31  31  MET MET A . n 
A 1 19  VAL 19  32  32  VAL VAL A . n 
A 1 20  LEU 20  33  33  LEU LEU A . n 
A 1 21  ASP 21  34  34  ASP ASP A . n 
A 1 22  GLY 22  35  35  GLY GLY A . n 
A 1 23  GLY 23  36  36  GLY GLY A . n 
A 1 24  MET 24  37  37  MET MET A . n 
A 1 25  GLY 25  38  38  GLY GLY A . n 
A 1 26  THR 26  39  39  THR THR A . n 
A 1 27  MET 27  40  40  MET MET A . n 
A 1 28  ILE 28  41  41  ILE ILE A . n 
A 1 29  GLN 29  42  42  GLN GLN A . n 
A 1 30  ARG 30  43  43  ARG ARG A . n 
A 1 31  GLU 31  44  44  GLU GLU A . n 
A 1 32  LYS 32  45  45  LYS LYS A . n 
A 1 33  LEU 33  46  46  LEU LEU A . n 
A 1 34  ASN 34  47  ?   ?   ?   A . n 
A 1 35  GLU 35  48  48  GLU GLU A . n 
A 1 36  GLU 36  49  49  GLU GLU A . n 
A 1 37  HIS 37  50  50  HIS HIS A . n 
A 1 38  PHE 38  51  51  PHE PHE A . n 
A 1 39  ARG 39  52  52  ARG ARG A . n 
A 1 40  GLY 40  53  53  GLY GLY A . n 
A 1 41  GLN 41  54  54  GLN GLN A . n 
A 1 42  GLU 42  55  55  GLU GLU A . n 
A 1 43  PHE 43  56  56  PHE PHE A . n 
A 1 44  LYS 44  57  57  LYS LYS A . n 
A 1 45  ASP 45  58  58  ASP ASP A . n 
A 1 46  HIS 46  59  59  HIS HIS A . n 
A 1 47  ALA 47  60  60  ALA ALA A . n 
A 1 48  ARG 48  61  61  ARG ARG A . n 
A 1 49  PRO 49  62  62  PRO PRO A . n 
A 1 50  LEU 50  63  63  LEU LEU A . n 
A 1 51  LYS 51  64  64  LYS LYS A . n 
A 1 52  GLY 52  65  65  GLY GLY A . n 
A 1 53  ASN 53  66  66  ASN ASN A . n 
A 1 54  ASN 54  67  67  ASN ASN A . n 
A 1 55  ASP 55  68  68  ASP ASP A . n 
A 1 56  ILE 56  69  69  ILE ILE A . n 
A 1 57  LEU 57  70  70  LEU LEU A . n 
A 1 58  SER 58  71  71  SER SER A . n 
A 1 59  ILE 59  72  72  ILE ILE A . n 
A 1 60  THR 60  73  73  THR THR A . n 
A 1 61  GLN 61  74  74  GLN GLN A . n 
A 1 62  PRO 62  75  75  PRO PRO A . n 
A 1 63  ASP 63  76  76  ASP ASP A . n 
A 1 64  VAL 64  77  77  VAL VAL A . n 
A 1 65  ILE 65  78  78  ILE ILE A . n 
A 1 66  TYR 66  79  79  TYR TYR A . n 
A 1 67  GLN 67  80  80  GLN GLN A . n 
A 1 68  ILE 68  81  81  ILE ILE A . n 
A 1 69  HIS 69  82  82  HIS HIS A . n 
A 1 70  LYS 70  83  83  LYS LYS A . n 
A 1 71  GLU 71  84  84  GLU GLU A . n 
A 1 72  TYR 72  85  85  TYR TYR A . n 
A 1 73  LEU 73  86  86  LEU LEU A . n 
A 1 74  LEU 74  87  87  LEU LEU A . n 
A 1 75  ALA 75  88  88  ALA ALA A . n 
A 1 76  GLY 76  89  ?   ?   ?   A . n 
A 1 77  ALA 77  90  ?   ?   ?   A . n 
A 1 78  ASP 78  91  91  ASP ASP A . n 
A 1 79  ILE 79  92  92  ILE ILE A . n 
A 1 80  ILE 80  93  93  ILE ILE A . n 
A 1 81  GLU 81  94  94  GLU GLU A . n 
A 1 82  THR 82  95  95  THR THR A . n 
A 1 83  ASN 83  96  96  ASN ASN A . n 
A 1 84  THR 84  97  97  THR THR A . n 
A 1 85  PHE 85  98  98  PHE PHE A . n 
A 1 86  SER 86  99  99  SER SER A . n 
A 1 87  SER 87  100 100 SER SER A . n 
A 1 88  THR 88  101 101 THR THR A . n 
A 1 89  SER 89  102 102 SER SER A . n 
A 1 90  ILE 90  103 103 ILE ILE A . n 
A 1 91  ALA 91  104 104 ALA ALA A . n 
A 1 92  GLN 92  105 105 GLN GLN A . n 
A 1 93  ALA 93  106 106 ALA ALA A . n 
A 1 94  ASP 94  107 107 ASP ASP A . n 
A 1 95  TYR 95  108 108 TYR TYR A . n 
A 1 96  GLY 96  109 109 GLY GLY A . n 
A 1 97  LEU 97  110 110 LEU LEU A . n 
A 1 98  GLU 98  111 111 GLU GLU A . n 
A 1 99  HIS 99  112 112 HIS HIS A . n 
A 1 100 LEU 100 113 113 LEU LEU A . n 
A 1 101 ALA 101 114 114 ALA ALA A . n 
A 1 102 TYR 102 115 115 TYR TYR A . n 
A 1 103 ARG 103 116 116 ARG ARG A . n 
A 1 104 MET 104 117 117 MET MET A . n 
A 1 105 ASN 105 118 118 ASN ASN A . n 
A 1 106 MET 106 119 119 MET MET A . n 
A 1 107 CYS 107 120 120 CYS CYS A . n 
A 1 108 SER 108 121 121 SER SER A . n 
A 1 109 ALA 109 122 122 ALA ALA A . n 
A 1 110 GLY 110 123 123 GLY GLY A . n 
A 1 111 VAL 111 124 124 VAL VAL A . n 
A 1 112 ALA 112 125 125 ALA ALA A . n 
A 1 113 ARG 113 126 126 ARG ARG A . n 
A 1 114 LYS 114 127 127 LYS LYS A . n 
A 1 115 ALA 115 128 128 ALA ALA A . n 
A 1 116 ALA 116 129 129 ALA ALA A . n 
A 1 117 GLU 117 130 130 GLU GLU A . n 
A 1 118 GLU 118 131 131 GLU GLU A . n 
A 1 119 VAL 119 132 132 VAL VAL A . n 
A 1 120 THR 120 133 133 THR THR A . n 
A 1 121 LEU 121 134 134 LEU LEU A . n 
A 1 122 GLN 122 135 135 GLN GLN A . n 
A 1 123 THR 123 136 136 THR THR A . n 
A 1 124 GLY 124 137 137 GLY GLY A . n 
A 1 125 ILE 125 138 138 ILE ILE A . n 
A 1 126 LYS 126 139 139 LYS LYS A . n 
A 1 127 ARG 127 140 140 ARG ARG A . n 
A 1 128 PHE 128 141 141 PHE PHE A . n 
A 1 129 VAL 129 142 142 VAL VAL A . n 
A 1 130 ALA 130 143 143 ALA ALA A . n 
A 1 131 GLY 131 144 144 GLY GLY A . n 
A 1 132 ALA 132 145 145 ALA ALA A . n 
A 1 133 LEU 133 146 146 LEU LEU A . n 
A 1 134 GLY 134 147 147 GLY GLY A . n 
A 1 135 PRO 135 148 148 PRO PRO A . n 
A 1 136 THR 136 149 149 THR THR A . n 
A 1 137 ASN 137 150 150 ASN ASN A . n 
A 1 138 LYS 138 151 151 LYS LYS A . n 
A 1 139 THR 139 152 152 THR THR A . n 
A 1 140 LEU 140 153 153 LEU LEU A . n 
A 1 141 SER 141 154 154 SER SER A . n 
A 1 142 VAL 142 155 155 VAL VAL A . n 
A 1 143 SER 143 156 156 SER SER A . n 
A 1 144 PRO 144 157 157 PRO PRO A . n 
A 1 145 SER 145 158 158 SER SER A . n 
A 1 146 VAL 146 159 159 VAL VAL A . n 
A 1 147 GLU 147 160 160 GLU GLU A . n 
A 1 148 ARG 148 161 161 ARG ARG A . n 
A 1 149 PRO 149 162 162 PRO PRO A . n 
A 1 150 ASP 150 163 163 ASP ASP A . n 
A 1 151 TYR 151 164 164 TYR TYR A . n 
A 1 152 ARG 152 165 165 ARG ARG A . n 
A 1 153 ASN 153 166 166 ASN ASN A . n 
A 1 154 ILE 154 167 167 ILE ILE A . n 
A 1 155 THR 155 168 168 THR THR A . n 
A 1 156 PHE 156 169 169 PHE PHE A . n 
A 1 157 ASP 157 170 170 ASP ASP A . n 
A 1 158 GLU 158 171 171 GLU GLU A . n 
A 1 159 LEU 159 172 172 LEU LEU A . n 
A 1 160 VAL 160 173 173 VAL VAL A . n 
A 1 161 GLU 161 174 174 GLU GLU A . n 
A 1 162 ALA 162 175 175 ALA ALA A . n 
A 1 163 TYR 163 176 176 TYR TYR A . n 
A 1 164 GLN 164 177 177 GLN GLN A . n 
A 1 165 GLU 165 178 178 GLU GLU A . n 
A 1 166 GLN 166 179 179 GLN GLN A . n 
A 1 167 ALA 167 180 180 ALA ALA A . n 
A 1 168 LYS 168 181 181 LYS LYS A . n 
A 1 169 GLY 169 182 182 GLY GLY A . n 
A 1 170 LEU 170 183 183 LEU LEU A . n 
A 1 171 LEU 171 184 184 LEU LEU A . n 
A 1 172 ASP 172 185 185 ASP ASP A . n 
A 1 173 GLY 173 186 186 GLY GLY A . n 
A 1 174 GLY 174 187 187 GLY GLY A . n 
A 1 175 VAL 175 188 188 VAL VAL A . n 
A 1 176 ASP 176 189 189 ASP ASP A . n 
A 1 177 ILE 177 190 190 ILE ILE A . n 
A 1 178 LEU 178 191 191 LEU LEU A . n 
A 1 179 LEU 179 192 192 LEU LEU A . n 
A 1 180 ILE 180 193 193 ILE ILE A . n 
A 1 181 GLU 181 194 194 GLU GLU A . n 
A 1 182 THR 182 195 195 THR THR A . n 
A 1 183 ILE 183 196 196 ILE ILE A . n 
A 1 184 PHE 184 197 197 PHE PHE A . n 
A 1 185 ASP 185 198 198 ASP ASP A . n 
A 1 186 THR 186 199 199 THR THR A . n 
A 1 187 ALA 187 200 200 ALA ALA A . n 
A 1 188 ASN 188 201 201 ASN ASN A . n 
A 1 189 ALA 189 202 202 ALA ALA A . n 
A 1 190 LYS 190 203 203 LYS LYS A . n 
A 1 191 ALA 191 204 204 ALA ALA A . n 
A 1 192 ALA 192 205 205 ALA ALA A . n 
A 1 193 LEU 193 206 206 LEU LEU A . n 
A 1 194 PHE 194 207 207 PHE PHE A . n 
A 1 195 ALA 195 208 208 ALA ALA A . n 
A 1 196 LEU 196 209 209 LEU LEU A . n 
A 1 197 GLN 197 210 210 GLN GLN A . n 
A 1 198 ASN 198 211 211 ASN ASN A . n 
A 1 199 LEU 199 212 212 LEU LEU A . n 
A 1 200 PHE 200 213 213 PHE PHE A . n 
A 1 201 GLU 201 214 214 GLU GLU A . n 
A 1 202 GLU 202 215 215 GLU GLU A . n 
A 1 203 LYS 203 216 216 LYS LYS A . n 
A 1 204 TYR 204 217 217 TYR TYR A . n 
A 1 205 ALA 205 218 218 ALA ALA A . n 
A 1 206 PRO 206 219 219 PRO PRO A . n 
A 1 207 ARG 207 220 220 ARG ARG A . n 
A 1 208 PRO 208 221 221 PRO PRO A . n 
A 1 209 ILE 209 222 222 ILE ILE A . n 
A 1 210 PHE 210 223 223 PHE PHE A . n 
A 1 211 ILE 211 224 224 ILE ILE A . n 
A 1 212 SER 212 225 225 SER SER A . n 
A 1 213 GLY 213 226 226 GLY GLY A . n 
A 1 214 THR 214 227 227 THR THR A . n 
A 1 215 ILE 215 228 228 ILE ILE A . n 
A 1 216 VAL 216 229 229 VAL VAL A . n 
A 1 217 ASP 217 230 230 ASP ASP A . n 
A 1 218 LYS 218 231 231 LYS LYS A . n 
A 1 219 SER 219 232 232 SER SER A . n 
A 1 220 GLY 220 233 233 GLY GLY A . n 
A 1 221 ARG 221 234 234 ARG ARG A . n 
A 1 222 THR 222 235 235 THR THR A . n 
A 1 223 LEU 223 236 236 LEU LEU A . n 
A 1 224 SER 224 237 237 SER SER A . n 
A 1 225 GLY 225 238 238 GLY GLY A . n 
A 1 226 GLN 226 239 239 GLN GLN A . n 
A 1 227 THR 227 240 240 THR THR A . n 
A 1 228 GLY 228 241 241 GLY GLY A . n 
A 1 229 GLU 229 242 242 GLU GLU A . n 
A 1 230 GLY 230 243 243 GLY GLY A . n 
A 1 231 PHE 231 244 244 PHE PHE A . n 
A 1 232 VAL 232 245 245 VAL VAL A . n 
A 1 233 ILE 233 246 246 ILE ILE A . n 
A 1 234 SER 234 247 247 SER SER A . n 
A 1 235 VAL 235 248 248 VAL VAL A . n 
A 1 236 SER 236 249 249 SER SER A . n 
A 1 237 HIS 237 250 250 HIS HIS A . n 
A 1 238 GLY 238 251 251 GLY GLY A . n 
A 1 239 GLU 239 252 252 GLU GLU A . n 
A 1 240 PRO 240 253 253 PRO PRO A . n 
A 1 241 LEU 241 254 254 LEU LEU A . n 
A 1 242 CYS 242 255 255 CYS CYS A . n 
A 1 243 ILE 243 256 256 ILE ILE A . n 
A 1 244 GLY 244 257 257 GLY GLY A . n 
A 1 245 LEU 245 258 258 LEU LEU A . n 
A 1 246 ASN 246 259 259 ASN ASN A . n 
A 1 247 CYS 247 260 260 CYS CYS A . n 
A 1 248 ALA 248 261 261 ALA ALA A . n 
A 1 249 LEU 249 262 262 LEU LEU A . n 
A 1 250 GLY 250 263 263 GLY GLY A . n 
A 1 251 ALA 251 264 264 ALA ALA A . n 
A 1 252 ALA 252 265 265 ALA ALA A . n 
A 1 253 GLU 253 266 266 GLU GLU A . n 
A 1 254 MET 254 267 267 MET MET A . n 
A 1 255 ARG 255 268 268 ARG ARG A . n 
A 1 256 PRO 256 269 269 PRO PRO A . n 
A 1 257 PHE 257 270 270 PHE PHE A . n 
A 1 258 ILE 258 271 271 ILE ILE A . n 
A 1 259 GLU 259 272 272 GLU GLU A . n 
A 1 260 ILE 260 273 273 ILE ILE A . n 
A 1 261 ILE 261 274 274 ILE ILE A . n 
A 1 262 GLY 262 275 275 GLY GLY A . n 
A 1 263 LYS 263 276 276 LYS LYS A . n 
A 1 264 CYS 264 277 277 CYS CYS A . n 
A 1 265 THR 265 278 278 THR THR A . n 
A 1 266 THR 266 279 279 THR THR A . n 
A 1 267 ALA 267 280 280 ALA ALA A . n 
A 1 268 TYR 268 281 281 TYR TYR A . n 
A 1 269 VAL 269 282 282 VAL VAL A . n 
A 1 270 LEU 270 283 283 LEU LEU A . n 
A 1 271 CYS 271 284 284 CYS CYS A . n 
A 1 272 TYR 272 285 285 TYR TYR A . n 
A 1 273 PRO 273 286 286 PRO PRO A . n 
A 1 274 ASN 274 287 287 ASN ASN A . n 
A 1 275 ALA 275 288 288 ALA ALA A . n 
A 1 276 GLY 276 289 289 GLY GLY A . n 
A 1 277 LEU 277 290 ?   ?   ?   A . n 
A 1 278 PRO 278 291 ?   ?   ?   A . n 
A 1 279 ASN 279 292 ?   ?   ?   A . n 
A 1 280 THR 280 293 ?   ?   ?   A . n 
A 1 281 PHE 281 294 ?   ?   ?   A . n 
A 1 282 GLY 282 295 ?   ?   ?   A . n 
A 1 283 ASP 283 296 ?   ?   ?   A . n 
A 1 284 TYR 284 297 ?   ?   ?   A . n 
A 1 285 ASP 285 298 ?   ?   ?   A . n 
A 1 286 GLU 286 299 ?   ?   ?   A . n 
A 1 287 THR 287 300 ?   ?   ?   A . n 
A 1 288 PRO 288 301 ?   ?   ?   A . n 
A 1 289 SER 289 302 ?   ?   ?   A . n 
A 1 290 MET 290 303 ?   ?   ?   A . n 
A 1 291 MET 291 304 ?   ?   ?   A . n 
A 1 292 ALA 292 305 ?   ?   ?   A . n 
A 1 293 LYS 293 306 ?   ?   ?   A . n 
A 1 294 HIS 294 307 ?   ?   ?   A . n 
A 1 295 LEU 295 308 ?   ?   ?   A . n 
A 1 296 LYS 296 309 ?   ?   ?   A . n 
A 1 297 ASP 297 310 ?   ?   ?   A . n 
A 1 298 PHE 298 311 311 PHE PHE A . n 
A 1 299 ALA 299 312 312 ALA ALA A . n 
A 1 300 MET 300 313 313 MET MET A . n 
A 1 301 ASP 301 314 314 ASP ASP A . n 
A 1 302 GLY 302 315 315 GLY GLY A . n 
A 1 303 LEU 303 316 316 LEU LEU A . n 
A 1 304 VAL 304 317 317 VAL VAL A . n 
A 1 305 ASN 305 318 318 ASN ASN A . n 
A 1 306 ILE 306 319 319 ILE ILE A . n 
A 1 307 VAL 307 320 320 VAL VAL A . n 
A 1 308 GLY 308 321 321 GLY GLY A . n 
A 1 309 GLY 309 322 322 GLY GLY A . n 
A 1 310 CYS 310 323 323 CYS CYS A . n 
A 1 311 CYS 311 324 324 CYS CYS A . n 
A 1 312 GLY 312 325 325 GLY GLY A . n 
A 1 313 SER 313 326 326 SER SER A . n 
A 1 314 THR 314 327 327 THR THR A . n 
A 1 315 PRO 315 328 328 PRO PRO A . n 
A 1 316 ASP 316 329 329 ASP ASP A . n 
A 1 317 HIS 317 330 330 HIS HIS A . n 
A 1 318 ILE 318 331 331 ILE ILE A . n 
A 1 319 ARG 319 332 332 ARG ARG A . n 
A 1 320 GLU 320 333 333 GLU GLU A . n 
A 1 321 ILE 321 334 334 ILE ILE A . n 
A 1 322 ALA 322 335 335 ALA ALA A . n 
A 1 323 GLU 323 336 336 GLU GLU A . n 
A 1 324 ALA 324 337 337 ALA ALA A . n 
A 1 325 VAL 325 338 338 VAL VAL A . n 
A 1 326 LYS 326 339 339 LYS LYS A . n 
A 1 327 ASN 327 340 340 ASN ASN A . n 
A 1 328 CYS 328 341 341 CYS CYS A . n 
A 1 329 LYS 329 342 342 LYS LYS A . n 
A 1 330 PRO 330 343 343 PRO PRO A . n 
A 1 331 ARG 331 344 344 ARG ARG A . n 
A 1 332 VAL 332 345 345 VAL VAL A . n 
A 1 333 PRO 333 346 346 PRO PRO A . n 
A 1 334 PRO 334 347 347 PRO PRO A . n 
A 1 335 ALA 335 348 348 ALA ALA A . n 
A 1 336 THR 336 349 349 THR THR A . n 
A 1 337 ALA 337 350 350 ALA ALA A . n 
A 1 338 PHE 338 351 351 PHE PHE A . n 
A 1 339 GLU 339 352 352 GLU GLU A . n 
A 1 340 GLY 340 353 353 GLY GLY A . n 
A 1 341 HIS 341 354 354 HIS HIS A . n 
A 1 342 MET 342 355 355 MET MET A . n 
A 1 343 LEU 343 356 356 LEU LEU A . n 
A 1 344 LEU 344 357 357 LEU LEU A . n 
A 1 345 SER 345 358 358 SER SER A . n 
A 1 346 GLY 346 359 359 GLY GLY A . n 
A 1 347 LEU 347 360 360 LEU LEU A . n 
A 1 348 GLU 348 361 361 GLU GLU A . n 
A 1 349 PRO 349 362 362 PRO PRO A . n 
A 1 350 PHE 350 363 363 PHE PHE A . n 
A 1 351 ARG 351 364 364 ARG ARG A . n 
A 1 352 ILE 352 365 365 ILE ILE A . n 
A 1 353 GLY 353 366 366 GLY GLY A . n 
A 1 354 PRO 354 367 367 PRO PRO A . n 
A 1 355 TYR 355 368 368 TYR TYR A . n 
A 1 356 THR 356 369 369 THR THR A . n 
A 1 357 ASN 357 370 370 ASN ASN A . n 
A 1 358 PHE 358 371 371 PHE PHE A . n 
A 1 359 VAL 359 372 372 VAL VAL A . n 
A 1 360 ASN 360 373 373 ASN ASN A . n 
A 1 361 ILE 361 374 374 ILE ILE A . n 
A 1 362 GLY 362 375 375 GLY GLY A . n 
A 1 363 GLU 363 376 376 GLU GLU A . n 
A 1 364 ARG 364 377 377 ARG ARG A . n 
A 1 365 CYS 365 378 378 CYS CYS A . n 
A 1 366 ASN 366 379 379 ASN ASN A . n 
A 1 367 VAL 367 380 380 VAL VAL A . n 
A 1 368 ALA 368 381 381 ALA ALA A . n 
A 1 369 GLY 369 382 382 GLY GLY A . n 
A 1 370 SER 370 383 383 SER SER A . n 
A 1 371 ARG 371 384 384 ARG ARG A . n 
A 1 372 LYS 372 385 385 LYS LYS A . n 
A 1 373 PHE 373 386 386 PHE PHE A . n 
A 1 374 ALA 374 387 387 ALA ALA A . n 
A 1 375 LYS 375 388 388 LYS LYS A . n 
A 1 376 LEU 376 389 389 LEU LEU A . n 
A 1 377 ILE 377 390 390 ILE ILE A . n 
A 1 378 MET 378 391 391 MET MET A . n 
A 1 379 ALA 379 392 392 ALA ALA A . n 
A 1 380 GLY 380 393 393 GLY GLY A . n 
A 1 381 ASN 381 394 394 ASN ASN A . n 
A 1 382 TYR 382 395 395 TYR TYR A . n 
A 1 383 GLU 383 396 396 GLU GLU A . n 
A 1 384 GLU 384 397 397 GLU GLU A . n 
A 1 385 ALA 385 398 398 ALA ALA A . n 
A 1 386 LEU 386 399 399 LEU LEU A . n 
A 1 387 CYS 387 400 400 CYS CYS A . n 
A 1 388 VAL 388 401 401 VAL VAL A . n 
A 1 389 ALA 389 402 402 ALA ALA A . n 
A 1 390 LYS 390 403 403 LYS LYS A . n 
A 1 391 VAL 391 404 404 VAL VAL A . n 
A 1 392 GLN 392 405 405 GLN GLN A . n 
A 1 393 VAL 393 406 406 VAL VAL A . n 
A 1 394 GLU 394 407 407 GLU GLU A . n 
A 1 395 MET 395 408 408 MET MET A . n 
A 1 396 GLY 396 409 409 GLY GLY A . n 
A 1 397 ALA 397 410 410 ALA ALA A . n 
A 1 398 GLN 398 411 411 GLN GLN A . n 
A 1 399 VAL 399 412 412 VAL VAL A . n 
A 1 400 LEU 400 413 413 LEU LEU A . n 
A 1 401 ASP 401 414 414 ASP ASP A . n 
A 1 402 VAL 402 415 415 VAL VAL A . n 
A 1 403 ASN 403 416 416 ASN ASN A . n 
A 1 404 MET 404 417 417 MET MET A . n 
A 1 405 ASP 405 418 418 ASP ASP A . n 
A 1 406 ASP 406 419 419 ASP ASP A . n 
A 1 407 GLY 407 420 420 GLY GLY A . n 
A 1 408 MET 408 421 421 MET MET A . n 
A 1 409 LEU 409 422 422 LEU LEU A . n 
A 1 410 ASP 410 423 423 ASP ASP A . n 
A 1 411 GLY 411 424 424 GLY GLY A . n 
A 1 412 PRO 412 425 425 PRO PRO A . n 
A 1 413 SER 413 426 426 SER SER A . n 
A 1 414 ALA 414 427 427 ALA ALA A . n 
A 1 415 MET 415 428 428 MET MET A . n 
A 1 416 THR 416 429 429 THR THR A . n 
A 1 417 ARG 417 430 430 ARG ARG A . n 
A 1 418 PHE 418 431 431 PHE PHE A . n 
A 1 419 CYS 419 432 432 CYS CYS A . n 
A 1 420 ASN 420 433 433 ASN ASN A . n 
A 1 421 LEU 421 434 434 LEU LEU A . n 
A 1 422 ILE 422 435 435 ILE ILE A . n 
A 1 423 ALA 423 436 436 ALA ALA A . n 
A 1 424 SER 424 437 437 SER SER A . n 
A 1 425 GLU 425 438 438 GLU GLU A . n 
A 1 426 PRO 426 439 439 PRO PRO A . n 
A 1 427 ASP 427 440 440 ASP ASP A . n 
A 1 428 ILE 428 441 441 ILE ILE A . n 
A 1 429 ALA 429 442 442 ALA ALA A . n 
A 1 430 LYS 430 443 443 LYS LYS A . n 
A 1 431 VAL 431 444 444 VAL VAL A . n 
A 1 432 PRO 432 445 445 PRO PRO A . n 
A 1 433 LEU 433 446 446 LEU LEU A . n 
A 1 434 CYS 434 447 447 CYS CYS A . n 
A 1 435 ILE 435 448 448 ILE ILE A . n 
A 1 436 ASP 436 449 449 ASP ASP A . n 
A 1 437 SER 437 450 450 SER SER A . n 
A 1 438 SER 438 451 451 SER SER A . n 
A 1 439 ASN 439 452 452 ASN ASN A . n 
A 1 440 PHE 440 453 453 PHE PHE A . n 
A 1 441 ALA 441 454 454 ALA ALA A . n 
A 1 442 VAL 442 455 455 VAL VAL A . n 
A 1 443 ILE 443 456 456 ILE ILE A . n 
A 1 444 GLU 444 457 457 GLU GLU A . n 
A 1 445 ALA 445 458 458 ALA ALA A . n 
A 1 446 GLY 446 459 459 GLY GLY A . n 
A 1 447 LEU 447 460 460 LEU LEU A . n 
A 1 448 LYS 448 461 461 LYS LYS A . n 
A 1 449 CYS 449 462 462 CYS CYS A . n 
A 1 450 CYS 450 463 463 CYS CYS A . n 
A 1 451 GLN 451 464 464 GLN GLN A . n 
A 1 452 GLY 452 465 465 GLY GLY A . n 
A 1 453 LYS 453 466 466 LYS LYS A . n 
A 1 454 CYS 454 467 467 CYS CYS A . n 
A 1 455 ILE 455 468 468 ILE ILE A . n 
A 1 456 VAL 456 469 469 VAL VAL A . n 
A 1 457 ASN 457 470 470 ASN ASN A . n 
A 1 458 SER 458 471 471 SER SER A . n 
A 1 459 ILE 459 472 472 ILE ILE A . n 
A 1 460 SER 460 473 473 SER SER A . n 
A 1 461 LEU 461 474 474 LEU LEU A . n 
A 1 462 LYS 462 475 475 LYS LYS A . n 
A 1 463 GLU 463 476 476 GLU GLU A . n 
A 1 464 GLY 464 477 477 GLY GLY A . n 
A 1 465 GLU 465 478 478 GLU GLU A . n 
A 1 466 ASP 466 479 479 ASP ASP A . n 
A 1 467 ASP 467 480 480 ASP ASP A . n 
A 1 468 PHE 468 481 481 PHE PHE A . n 
A 1 469 LEU 469 482 482 LEU LEU A . n 
A 1 470 GLU 470 483 483 GLU GLU A . n 
A 1 471 LYS 471 484 484 LYS LYS A . n 
A 1 472 ALA 472 485 485 ALA ALA A . n 
A 1 473 ARG 473 486 486 ARG ARG A . n 
A 1 474 LYS 474 487 487 LYS LYS A . n 
A 1 475 ILE 475 488 488 ILE ILE A . n 
A 1 476 LYS 476 489 489 LYS LYS A . n 
A 1 477 LYS 477 490 490 LYS LYS A . n 
A 1 478 TYR 478 491 491 TYR TYR A . n 
A 1 479 GLY 479 492 492 GLY GLY A . n 
A 1 480 ALA 480 493 493 ALA ALA A . n 
A 1 481 ALA 481 494 494 ALA ALA A . n 
A 1 482 MET 482 495 495 MET MET A . n 
A 1 483 VAL 483 496 496 VAL VAL A . n 
A 1 484 VAL 484 497 497 VAL VAL A . n 
A 1 485 MET 485 498 498 MET MET A . n 
A 1 486 ALA 486 499 499 ALA ALA A . n 
A 1 487 PHE 487 500 500 PHE PHE A . n 
A 1 488 ASP 488 501 501 ASP ASP A . n 
A 1 489 GLU 489 502 502 GLU GLU A . n 
A 1 490 GLU 490 503 503 GLU GLU A . n 
A 1 491 GLY 491 504 504 GLY GLY A . n 
A 1 492 GLN 492 505 505 GLN GLN A . n 
A 1 493 ALA 493 506 506 ALA ALA A . n 
A 1 494 THR 494 507 507 THR THR A . n 
A 1 495 GLU 495 508 508 GLU GLU A . n 
A 1 496 THR 496 509 509 THR THR A . n 
A 1 497 ASP 497 510 510 ASP ASP A . n 
A 1 498 THR 498 511 511 THR THR A . n 
A 1 499 LYS 499 512 512 LYS LYS A . n 
A 1 500 ILE 500 513 513 ILE ILE A . n 
A 1 501 ARG 501 514 514 ARG ARG A . n 
A 1 502 VAL 502 515 515 VAL VAL A . n 
A 1 503 CYS 503 516 516 CYS CYS A . n 
A 1 504 THR 504 517 517 THR THR A . n 
A 1 505 ARG 505 518 518 ARG ARG A . n 
A 1 506 ALA 506 519 519 ALA ALA A . n 
A 1 507 TYR 507 520 520 TYR TYR A . n 
A 1 508 HIS 508 521 521 HIS HIS A . n 
A 1 509 LEU 509 522 522 LEU LEU A . n 
A 1 510 LEU 510 523 523 LEU LEU A . n 
A 1 511 VAL 511 524 524 VAL VAL A . n 
A 1 512 LYS 512 525 525 LYS LYS A . n 
A 1 513 LYS 513 526 526 LYS LYS A . n 
A 1 514 LEU 514 527 527 LEU LEU A . n 
A 1 515 GLY 515 528 528 GLY GLY A . n 
A 1 516 PHE 516 529 529 PHE PHE A . n 
A 1 517 ASN 517 530 530 ASN ASN A . n 
A 1 518 PRO 518 531 531 PRO PRO A . n 
A 1 519 ASN 519 532 532 ASN ASN A . n 
A 1 520 ASP 520 533 533 ASP ASP A . n 
A 1 521 ILE 521 534 534 ILE ILE A . n 
A 1 522 ILE 522 535 535 ILE ILE A . n 
A 1 523 PHE 523 536 536 PHE PHE A . n 
A 1 524 ASP 524 537 537 ASP ASP A . n 
A 1 525 PRO 525 538 538 PRO PRO A . n 
A 1 526 ASN 526 539 539 ASN ASN A . n 
A 1 527 ILE 527 540 540 ILE ILE A . n 
A 1 528 LEU 528 541 541 LEU LEU A . n 
A 1 529 THR 529 542 542 THR THR A . n 
A 1 530 ILE 530 543 543 ILE ILE A . n 
A 1 531 GLY 531 544 544 GLY GLY A . n 
A 1 532 THR 532 545 545 THR THR A . n 
A 1 533 GLY 533 546 546 GLY GLY A . n 
A 1 534 MET 534 547 547 MET MET A . n 
A 1 535 GLU 535 548 548 GLU GLU A . n 
A 1 536 GLU 536 549 549 GLU GLU A . n 
A 1 537 HIS 537 550 550 HIS HIS A . n 
A 1 538 ASN 538 551 551 ASN ASN A . n 
A 1 539 LEU 539 552 552 LEU LEU A . n 
A 1 540 TYR 540 553 553 TYR TYR A . n 
A 1 541 ALA 541 554 554 ALA ALA A . n 
A 1 542 ILE 542 555 555 ILE ILE A . n 
A 1 543 ASN 543 556 556 ASN ASN A . n 
A 1 544 PHE 544 557 557 PHE PHE A . n 
A 1 545 ILE 545 558 558 ILE ILE A . n 
A 1 546 HIS 546 559 559 HIS HIS A . n 
A 1 547 ALA 547 560 560 ALA ALA A . n 
A 1 548 THR 548 561 561 THR THR A . n 
A 1 549 LYS 549 562 562 LYS LYS A . n 
A 1 550 VAL 550 563 563 VAL VAL A . n 
A 1 551 ILE 551 564 564 ILE ILE A . n 
A 1 552 LYS 552 565 565 LYS LYS A . n 
A 1 553 GLU 553 566 566 GLU GLU A . n 
A 1 554 THR 554 567 567 THR THR A . n 
A 1 555 LEU 555 568 568 LEU LEU A . n 
A 1 556 PRO 556 569 569 PRO PRO A . n 
A 1 557 GLY 557 570 570 GLY GLY A . n 
A 1 558 ALA 558 571 571 ALA ALA A . n 
A 1 559 ARG 559 572 572 ARG ARG A . n 
A 1 560 ILE 560 573 573 ILE ILE A . n 
A 1 561 SER 561 574 574 SER SER A . n 
A 1 562 GLY 562 575 575 GLY GLY A . n 
A 1 563 GLY 563 576 576 GLY GLY A . n 
A 1 564 LEU 564 577 577 LEU LEU A . n 
A 1 565 SER 565 578 578 SER SER A . n 
A 1 566 ASN 566 579 579 ASN ASN A . n 
A 1 567 LEU 567 580 580 LEU LEU A . n 
A 1 568 SER 568 581 581 SER SER A . n 
A 1 569 PHE 569 582 582 PHE PHE A . n 
A 1 570 SER 570 583 583 SER SER A . n 
A 1 571 PHE 571 584 584 PHE PHE A . n 
A 1 572 ARG 572 585 585 ARG ARG A . n 
A 1 573 GLY 573 586 586 GLY GLY A . n 
A 1 574 MET 574 587 587 MET MET A . n 
A 1 575 GLU 575 588 588 GLU GLU A . n 
A 1 576 ALA 576 589 589 ALA ALA A . n 
A 1 577 ILE 577 590 590 ILE ILE A . n 
A 1 578 ARG 578 591 591 ARG ARG A . n 
A 1 579 GLU 579 592 592 GLU GLU A . n 
A 1 580 ALA 580 593 593 ALA ALA A . n 
A 1 581 MET 581 594 594 MET MET A . n 
A 1 582 HIS 582 595 595 HIS HIS A . n 
A 1 583 GLY 583 596 596 GLY GLY A . n 
A 1 584 VAL 584 597 597 VAL VAL A . n 
A 1 585 PHE 585 598 598 PHE PHE A . n 
A 1 586 LEU 586 599 599 LEU LEU A . n 
A 1 587 TYR 587 600 600 TYR TYR A . n 
A 1 588 HIS 588 601 601 HIS HIS A . n 
A 1 589 ALA 589 602 602 ALA ALA A . n 
A 1 590 ILE 590 603 603 ILE ILE A . n 
A 1 591 LYS 591 604 604 LYS LYS A . n 
A 1 592 SER 592 605 605 SER SER A . n 
A 1 593 GLY 593 606 606 GLY GLY A . n 
A 1 594 MET 594 607 607 MET MET A . n 
A 1 595 ASP 595 608 608 ASP ASP A . n 
A 1 596 MET 596 609 609 MET MET A . n 
A 1 597 GLY 597 610 610 GLY GLY A . n 
A 1 598 ILE 598 611 611 ILE ILE A . n 
A 1 599 VAL 599 612 612 VAL VAL A . n 
A 1 600 ASN 600 613 613 ASN ASN A . n 
A 1 601 ALA 601 614 614 ALA ALA A . n 
A 1 602 GLY 602 615 615 GLY GLY A . n 
A 1 603 ASN 603 616 616 ASN ASN A . n 
A 1 604 LEU 604 617 617 LEU LEU A . n 
A 1 605 PRO 605 618 618 PRO PRO A . n 
A 1 606 VAL 606 619 619 VAL VAL A . n 
A 1 607 TYR 607 620 620 TYR TYR A . n 
A 1 608 ASP 608 621 621 ASP ASP A . n 
A 1 609 ASP 609 622 622 ASP ASP A . n 
A 1 610 ILE 610 623 623 ILE ILE A . n 
A 1 611 HIS 611 624 624 HIS HIS A . n 
A 1 612 LYS 612 625 625 LYS LYS A . n 
A 1 613 GLU 613 626 626 GLU GLU A . n 
A 1 614 LEU 614 627 627 LEU LEU A . n 
A 1 615 LEU 615 628 628 LEU LEU A . n 
A 1 616 GLN 616 629 629 GLN GLN A . n 
A 1 617 LEU 617 630 630 LEU LEU A . n 
A 1 618 CYS 618 631 631 CYS CYS A . n 
A 1 619 GLU 619 632 632 GLU GLU A . n 
A 1 620 ASP 620 633 633 ASP ASP A . n 
A 1 621 LEU 621 634 634 LEU LEU A . n 
A 1 622 ILE 622 635 635 ILE ILE A . n 
A 1 623 TRP 623 636 636 TRP TRP A . n 
A 1 624 ASN 624 637 637 ASN ASN A . n 
A 1 625 LYS 625 638 638 LYS LYS A . n 
A 1 626 ASP 626 639 639 ASP ASP A . n 
A 1 627 PRO 627 640 640 PRO PRO A . n 
A 1 628 GLU 628 641 641 GLU GLU A . n 
A 1 629 ALA 629 642 642 ALA ALA A . n 
A 1 630 THR 630 643 643 THR THR A . n 
A 1 631 GLU 631 644 644 GLU GLU A . n 
A 1 632 LYS 632 645 645 LYS LYS A . n 
A 1 633 LEU 633 646 646 LEU LEU A . n 
A 1 634 LEU 634 647 647 LEU LEU A . n 
A 1 635 ARG 635 648 648 ARG ARG A . n 
A 1 636 TYR 636 649 649 TYR TYR A . n 
A 1 637 ALA 637 650 650 ALA ALA A . n 
A 1 638 GLN 638 651 651 GLN GLN A . n 
A 1 639 THR 639 652 ?   ?   ?   A . n 
A 1 640 GLN 640 653 ?   ?   ?   A . n 
A 1 641 GLY 641 654 ?   ?   ?   A . n 
A 1 642 THR 642 655 ?   ?   ?   A . n 
A 1 643 GLY 643 656 ?   ?   ?   A . n 
A 1 644 GLY 644 657 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 THG 1 1652 1652 THG THG A . 
C 3 HOH 1 2001 2001 HOH HOH A . 
C 3 HOH 2 2002 2002 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-11-27 
2 'Structure model' 1 1 2018-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation_author 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    2 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_citation_author.name' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -71.4038 20.1199 -4.7353  0.7925 1.0226 0.8629 -0.1511 0.1844  0.1614  13.5850 13.0710 13.4983 
-12.8708 1.7291  1.6990  -0.1014 -0.1108 0.7896  0.3159  -0.2666 -0.7069 -0.0057 -1.7263 0.3681  
'X-RAY DIFFRACTION' 2 ? refined -65.4353 16.3311 -33.9154 0.6809 0.8554 0.7630 -0.0946 -0.0705 -0.0504 4.2733  0.1991  6.2503  
-0.1012  -1.2895 0.6935  -0.0220 0.2013  -0.8274 -0.1714 -0.1709 0.1718  0.5526  -0.9379 0.1929  
'X-RAY DIFFRACTION' 3 ? refined -63.7827 23.8949 -27.5317 0.1348 0.6336 0.3200 -0.0135 -0.0174 0.0700  2.0766  1.1241  6.4053  
-0.6122  -1.4083 -0.5521 0.0197  -0.0914 -0.3815 -0.2886 0.2154  0.2797  0.4608  -0.9506 -0.2352 
'X-RAY DIFFRACTION' 4 ? refined -48.8914 26.5851 -9.8098  0.2255 0.3129 0.2243 0.0502  0.0099  0.0433  1.6922  1.5267  2.6196  
0.3223   1.2377  0.5466  0.0896  0.1314  -0.5361 0.1696  0.1760  -0.0178 0.3391  -0.0657 -0.2656 
'X-RAY DIFFRACTION' 5 ? refined -47.2303 44.8793 -5.9175  0.2891 0.2205 0.2147 0.0631  -0.0114 0.0514  1.7384  1.9553  6.3039  
-0.2631  -0.2095 1.7826  -0.2826 0.1476  -0.0068 0.1293  0.0919  0.5373  -0.4815 -0.0194 0.1907  
'X-RAY DIFFRACTION' 6 ? refined -42.4221 50.4169 1.6515   0.3380 0.5787 0.0719 0.0788  -0.0333 0.0374  2.8520  2.9427  2.3578  
-2.4036  -1.2600 0.1333  -0.3392 -0.1393 0.2248  0.4659  0.6817  -0.0067 -0.0756 0.0054  -0.3425 
'X-RAY DIFFRACTION' 7 ? refined -39.4042 55.8973 13.7201  0.3373 0.2815 0.0965 -0.0234 -0.0363 0.0248  11.1775 36.6783 25.7994 
3.0131   -5.3539 5.7316  -0.0667 0.0472  0.7905  -0.2497 0.6031  -0.4982 -0.7311 0.8427  -0.5364 
'X-RAY DIFFRACTION' 8 ? refined -33.4874 45.2773 12.1124  0.5603 0.2407 0.0855 0.0492  -0.1746 0.0376  1.3870  3.0490  1.3688  
-0.2431  -0.2519 1.2415  -0.0645 -0.0312 -0.0025 0.8551  0.1931  -0.3875 0.0964  0.2032  -0.1287 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 15  ? ? A 33  ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 34  ? ? A 84  ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 85  ? ? A 123 ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 A 124 ? ? A 457 ? ? ? ? 
'X-RAY DIFFRACTION' 5 5 A 458 ? ? A 490 ? ? ? ? 
'X-RAY DIFFRACTION' 6 6 A 491 ? ? A 507 ? ? ? ? 
'X-RAY DIFFRACTION' 7 7 A 508 ? ? A 512 ? ? ? ? 
'X-RAY DIFFRACTION' 8 8 A 513 ? ? A 639 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC  refinement       5.7.0032 ? 1 
XDS     'data reduction' .        ? 2 
Aimless 'data scaling'   .        ? 3 
PHASER  phasing          .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 57  ? ? 67.70   -54.38  
2  1 GLN A 74  ? ? -148.72 56.63   
3  1 THR A 149 ? ? 64.64   171.12  
4  1 GLU A 215 ? ? -149.67 -52.00  
5  1 CYS A 260 ? ? 64.79   -174.25 
6  1 ALA A 261 ? ? 65.42   -47.92  
7  1 CYS A 284 ? ? -169.86 108.53  
8  1 PRO A 286 ? ? -71.42  -163.72 
9  1 ASP A 314 ? ? -108.94 64.70   
10 1 CYS A 323 ? ? -132.58 -130.27 
11 1 ASN A 616 ? ? -113.01 56.36   
12 1 ASN A 637 ? ? 39.91   39.32   
13 1 GLU A 641 ? ? -100.86 63.95   
14 1 TYR A 649 ? ? -58.13  -2.23   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A THR 17  ? OG1 ? A THR 4   OG1 
2   1 Y 1 A THR 17  ? CG2 ? A THR 4   CG2 
3   1 Y 1 A LEU 18  ? CG  ? A LEU 5   CG  
4   1 Y 1 A LEU 18  ? CD1 ? A LEU 5   CD1 
5   1 Y 1 A LEU 18  ? CD2 ? A LEU 5   CD2 
6   1 Y 1 A ARG 19  ? CG  ? A ARG 6   CG  
7   1 Y 1 A ARG 19  ? CD  ? A ARG 6   CD  
8   1 Y 1 A ARG 19  ? NE  ? A ARG 6   NE  
9   1 Y 1 A ARG 19  ? CZ  ? A ARG 6   CZ  
10  1 Y 1 A ARG 19  ? NH1 ? A ARG 6   NH1 
11  1 Y 1 A ARG 19  ? NH2 ? A ARG 6   NH2 
12  1 Y 1 A ASP 20  ? CG  ? A ASP 7   CG  
13  1 Y 1 A ASP 20  ? OD1 ? A ASP 7   OD1 
14  1 Y 1 A ASP 20  ? OD2 ? A ASP 7   OD2 
15  1 Y 1 A GLU 21  ? CG  ? A GLU 8   CG  
16  1 Y 1 A GLU 21  ? CD  ? A GLU 8   CD  
17  1 Y 1 A GLU 21  ? OE1 ? A GLU 8   OE1 
18  1 Y 1 A GLU 21  ? OE2 ? A GLU 8   OE2 
19  1 Y 1 A ILE 22  ? CG1 ? A ILE 9   CG1 
20  1 Y 1 A ILE 22  ? CG2 ? A ILE 9   CG2 
21  1 Y 1 A ILE 22  ? CD1 ? A ILE 9   CD1 
22  1 Y 1 A ASN 23  ? CG  ? A ASN 10  CG  
23  1 Y 1 A ASN 23  ? OD1 ? A ASN 10  OD1 
24  1 Y 1 A ASN 23  ? ND2 ? A ASN 10  ND2 
25  1 Y 1 A ILE 25  ? CG1 ? A ILE 12  CG1 
26  1 Y 1 A ILE 25  ? CG2 ? A ILE 12  CG2 
27  1 Y 1 A ILE 25  ? CD1 ? A ILE 12  CD1 
28  1 Y 1 A GLN 27  ? CG  ? A GLN 14  CG  
29  1 Y 1 A GLN 27  ? CD  ? A GLN 14  CD  
30  1 Y 1 A GLN 27  ? OE1 ? A GLN 14  OE1 
31  1 Y 1 A GLN 27  ? NE2 ? A GLN 14  NE2 
32  1 Y 1 A LYS 28  ? CG  ? A LYS 15  CG  
33  1 Y 1 A LYS 28  ? CD  ? A LYS 15  CD  
34  1 Y 1 A LYS 28  ? CE  ? A LYS 15  CE  
35  1 Y 1 A LYS 28  ? NZ  ? A LYS 15  NZ  
36  1 Y 1 A ARG 29  ? CG  ? A ARG 16  CG  
37  1 Y 1 A ARG 29  ? CD  ? A ARG 16  CD  
38  1 Y 1 A ARG 29  ? NE  ? A ARG 16  NE  
39  1 Y 1 A ARG 29  ? CZ  ? A ARG 16  CZ  
40  1 Y 1 A ARG 29  ? NH1 ? A ARG 16  NH1 
41  1 Y 1 A ARG 29  ? NH2 ? A ARG 16  NH2 
42  1 Y 1 A ILE 30  ? CG1 ? A ILE 17  CG1 
43  1 Y 1 A ILE 30  ? CG2 ? A ILE 17  CG2 
44  1 Y 1 A ILE 30  ? CD1 ? A ILE 17  CD1 
45  1 Y 1 A MET 37  ? CG  ? A MET 24  CG  
46  1 Y 1 A MET 37  ? SD  ? A MET 24  SD  
47  1 Y 1 A MET 37  ? CE  ? A MET 24  CE  
48  1 Y 1 A THR 39  ? OG1 ? A THR 26  OG1 
49  1 Y 1 A THR 39  ? CG2 ? A THR 26  CG2 
50  1 Y 1 A MET 40  ? CG  ? A MET 27  CG  
51  1 Y 1 A MET 40  ? SD  ? A MET 27  SD  
52  1 Y 1 A MET 40  ? CE  ? A MET 27  CE  
53  1 Y 1 A GLN 42  ? CG  ? A GLN 29  CG  
54  1 Y 1 A GLN 42  ? CD  ? A GLN 29  CD  
55  1 Y 1 A GLN 42  ? OE1 ? A GLN 29  OE1 
56  1 Y 1 A GLN 42  ? NE2 ? A GLN 29  NE2 
57  1 Y 1 A ARG 43  ? CG  ? A ARG 30  CG  
58  1 Y 1 A ARG 43  ? CD  ? A ARG 30  CD  
59  1 Y 1 A ARG 43  ? NE  ? A ARG 30  NE  
60  1 Y 1 A ARG 43  ? CZ  ? A ARG 30  CZ  
61  1 Y 1 A ARG 43  ? NH1 ? A ARG 30  NH1 
62  1 Y 1 A ARG 43  ? NH2 ? A ARG 30  NH2 
63  1 Y 1 A GLU 44  ? CG  ? A GLU 31  CG  
64  1 Y 1 A GLU 44  ? CD  ? A GLU 31  CD  
65  1 Y 1 A GLU 44  ? OE1 ? A GLU 31  OE1 
66  1 Y 1 A GLU 44  ? OE2 ? A GLU 31  OE2 
67  1 Y 1 A LYS 45  ? CG  ? A LYS 32  CG  
68  1 Y 1 A LYS 45  ? CD  ? A LYS 32  CD  
69  1 Y 1 A LYS 45  ? CE  ? A LYS 32  CE  
70  1 Y 1 A LYS 45  ? NZ  ? A LYS 32  NZ  
71  1 Y 1 A LEU 46  ? CG  ? A LEU 33  CG  
72  1 Y 1 A LEU 46  ? CD1 ? A LEU 33  CD1 
73  1 Y 1 A LEU 46  ? CD2 ? A LEU 33  CD2 
74  1 Y 1 A GLU 48  ? CG  ? A GLU 35  CG  
75  1 Y 1 A GLU 48  ? CD  ? A GLU 35  CD  
76  1 Y 1 A GLU 48  ? OE1 ? A GLU 35  OE1 
77  1 Y 1 A GLU 48  ? OE2 ? A GLU 35  OE2 
78  1 Y 1 A HIS 50  ? CG  ? A HIS 37  CG  
79  1 Y 1 A HIS 50  ? ND1 ? A HIS 37  ND1 
80  1 Y 1 A HIS 50  ? CD2 ? A HIS 37  CD2 
81  1 Y 1 A HIS 50  ? CE1 ? A HIS 37  CE1 
82  1 Y 1 A HIS 50  ? NE2 ? A HIS 37  NE2 
83  1 Y 1 A GLN 54  ? CG  ? A GLN 41  CG  
84  1 Y 1 A GLN 54  ? CD  ? A GLN 41  CD  
85  1 Y 1 A GLN 54  ? OE1 ? A GLN 41  OE1 
86  1 Y 1 A GLN 54  ? NE2 ? A GLN 41  NE2 
87  1 Y 1 A LYS 57  ? CG  ? A LYS 44  CG  
88  1 Y 1 A LYS 57  ? CD  ? A LYS 44  CD  
89  1 Y 1 A LYS 57  ? CE  ? A LYS 44  CE  
90  1 Y 1 A LYS 57  ? NZ  ? A LYS 44  NZ  
91  1 Y 1 A LEU 63  ? CG  ? A LEU 50  CG  
92  1 Y 1 A LEU 63  ? CD1 ? A LEU 50  CD1 
93  1 Y 1 A LEU 63  ? CD2 ? A LEU 50  CD2 
94  1 Y 1 A LYS 64  ? CG  ? A LYS 51  CG  
95  1 Y 1 A LYS 64  ? CD  ? A LYS 51  CD  
96  1 Y 1 A LYS 64  ? CE  ? A LYS 51  CE  
97  1 Y 1 A LYS 64  ? NZ  ? A LYS 51  NZ  
98  1 Y 1 A GLN 74  ? CG  ? A GLN 61  CG  
99  1 Y 1 A GLN 74  ? CD  ? A GLN 61  CD  
100 1 Y 1 A GLN 74  ? OE1 ? A GLN 61  OE1 
101 1 Y 1 A GLN 74  ? NE2 ? A GLN 61  NE2 
102 1 Y 1 A ASP 76  ? CG  ? A ASP 63  CG  
103 1 Y 1 A ASP 76  ? OD1 ? A ASP 63  OD1 
104 1 Y 1 A ASP 76  ? OD2 ? A ASP 63  OD2 
105 1 Y 1 A GLN 80  ? CG  ? A GLN 67  CG  
106 1 Y 1 A GLN 80  ? CD  ? A GLN 67  CD  
107 1 Y 1 A GLN 80  ? OE1 ? A GLN 67  OE1 
108 1 Y 1 A GLN 80  ? NE2 ? A GLN 67  NE2 
109 1 Y 1 A ILE 81  ? CG1 ? A ILE 68  CG1 
110 1 Y 1 A ILE 81  ? CG2 ? A ILE 68  CG2 
111 1 Y 1 A ILE 81  ? CD1 ? A ILE 68  CD1 
112 1 Y 1 A LYS 83  ? CG  ? A LYS 70  CG  
113 1 Y 1 A LYS 83  ? CD  ? A LYS 70  CD  
114 1 Y 1 A LYS 83  ? CE  ? A LYS 70  CE  
115 1 Y 1 A LYS 83  ? NZ  ? A LYS 70  NZ  
116 1 Y 1 A LEU 87  ? CG  ? A LEU 74  CG  
117 1 Y 1 A LEU 87  ? CD1 ? A LEU 74  CD1 
118 1 Y 1 A LEU 87  ? CD2 ? A LEU 74  CD2 
119 1 Y 1 A ASP 91  ? CG  ? A ASP 78  CG  
120 1 Y 1 A ASP 91  ? OD1 ? A ASP 78  OD1 
121 1 Y 1 A ASP 91  ? OD2 ? A ASP 78  OD2 
122 1 Y 1 A ILE 92  ? CG1 ? A ILE 79  CG1 
123 1 Y 1 A ILE 92  ? CG2 ? A ILE 79  CG2 
124 1 Y 1 A ILE 92  ? CD1 ? A ILE 79  CD1 
125 1 Y 1 A ILE 93  ? CG1 ? A ILE 80  CG1 
126 1 Y 1 A ILE 93  ? CG2 ? A ILE 80  CG2 
127 1 Y 1 A ILE 93  ? CD1 ? A ILE 80  CD1 
128 1 Y 1 A THR 101 ? OG1 ? A THR 88  OG1 
129 1 Y 1 A THR 101 ? CG2 ? A THR 88  CG2 
130 1 Y 1 A SER 102 ? OG  ? A SER 89  OG  
131 1 Y 1 A ILE 103 ? CG1 ? A ILE 90  CG1 
132 1 Y 1 A ILE 103 ? CG2 ? A ILE 90  CG2 
133 1 Y 1 A ILE 103 ? CD1 ? A ILE 90  CD1 
134 1 Y 1 A ASP 107 ? CG  ? A ASP 94  CG  
135 1 Y 1 A ASP 107 ? OD1 ? A ASP 94  OD1 
136 1 Y 1 A ASP 107 ? OD2 ? A ASP 94  OD2 
137 1 Y 1 A SER 121 ? OG  ? A SER 108 OG  
138 1 Y 1 A ARG 126 ? CG  ? A ARG 113 CG  
139 1 Y 1 A ARG 126 ? CD  ? A ARG 113 CD  
140 1 Y 1 A ARG 126 ? NE  ? A ARG 113 NE  
141 1 Y 1 A ARG 126 ? CZ  ? A ARG 113 CZ  
142 1 Y 1 A ARG 126 ? NH1 ? A ARG 113 NH1 
143 1 Y 1 A ARG 126 ? NH2 ? A ARG 113 NH2 
144 1 Y 1 A LYS 127 ? CG  ? A LYS 114 CG  
145 1 Y 1 A LYS 127 ? CD  ? A LYS 114 CD  
146 1 Y 1 A LYS 127 ? CE  ? A LYS 114 CE  
147 1 Y 1 A LYS 127 ? NZ  ? A LYS 114 NZ  
148 1 Y 1 A GLU 131 ? CG  ? A GLU 118 CG  
149 1 Y 1 A GLU 131 ? CD  ? A GLU 118 CD  
150 1 Y 1 A GLU 131 ? OE1 ? A GLU 118 OE1 
151 1 Y 1 A GLU 131 ? OE2 ? A GLU 118 OE2 
152 1 Y 1 A VAL 132 ? CG1 ? A VAL 119 CG1 
153 1 Y 1 A VAL 132 ? CG2 ? A VAL 119 CG2 
154 1 Y 1 A LEU 134 ? CG  ? A LEU 121 CG  
155 1 Y 1 A LEU 134 ? CD1 ? A LEU 121 CD1 
156 1 Y 1 A LEU 134 ? CD2 ? A LEU 121 CD2 
157 1 Y 1 A GLN 135 ? CG  ? A GLN 122 CG  
158 1 Y 1 A GLN 135 ? CD  ? A GLN 122 CD  
159 1 Y 1 A GLN 135 ? OE1 ? A GLN 122 OE1 
160 1 Y 1 A GLN 135 ? NE2 ? A GLN 122 NE2 
161 1 Y 1 A THR 136 ? OG1 ? A THR 123 OG1 
162 1 Y 1 A THR 136 ? CG2 ? A THR 123 CG2 
163 1 Y 1 A ILE 138 ? CG1 ? A ILE 125 CG1 
164 1 Y 1 A ILE 138 ? CG2 ? A ILE 125 CG2 
165 1 Y 1 A ILE 138 ? CD1 ? A ILE 125 CD1 
166 1 Y 1 A VAL 142 ? CG1 ? A VAL 129 CG1 
167 1 Y 1 A VAL 142 ? CG2 ? A VAL 129 CG2 
168 1 Y 1 A LYS 151 ? CG  ? A LYS 138 CG  
169 1 Y 1 A LYS 151 ? CD  ? A LYS 138 CD  
170 1 Y 1 A LYS 151 ? CE  ? A LYS 138 CE  
171 1 Y 1 A LYS 151 ? NZ  ? A LYS 138 NZ  
172 1 Y 1 A THR 152 ? OG1 ? A THR 139 OG1 
173 1 Y 1 A THR 152 ? CG2 ? A THR 139 CG2 
174 1 Y 1 A LEU 153 ? CG  ? A LEU 140 CG  
175 1 Y 1 A LEU 153 ? CD1 ? A LEU 140 CD1 
176 1 Y 1 A LEU 153 ? CD2 ? A LEU 140 CD2 
177 1 Y 1 A SER 154 ? OG  ? A SER 141 OG  
178 1 Y 1 A VAL 155 ? CG1 ? A VAL 142 CG1 
179 1 Y 1 A VAL 155 ? CG2 ? A VAL 142 CG2 
180 1 Y 1 A SER 158 ? OG  ? A SER 145 OG  
181 1 Y 1 A VAL 159 ? CG1 ? A VAL 146 CG1 
182 1 Y 1 A VAL 159 ? CG2 ? A VAL 146 CG2 
183 1 Y 1 A GLU 160 ? CG  ? A GLU 147 CG  
184 1 Y 1 A GLU 160 ? CD  ? A GLU 147 CD  
185 1 Y 1 A GLU 160 ? OE1 ? A GLU 147 OE1 
186 1 Y 1 A GLU 160 ? OE2 ? A GLU 147 OE2 
187 1 Y 1 A ARG 161 ? CG  ? A ARG 148 CG  
188 1 Y 1 A ARG 161 ? CD  ? A ARG 148 CD  
189 1 Y 1 A ARG 161 ? NE  ? A ARG 148 NE  
190 1 Y 1 A ARG 161 ? CZ  ? A ARG 148 CZ  
191 1 Y 1 A ARG 161 ? NH1 ? A ARG 148 NH1 
192 1 Y 1 A ARG 161 ? NH2 ? A ARG 148 NH2 
193 1 Y 1 A ASP 163 ? CG  ? A ASP 150 CG  
194 1 Y 1 A ASP 163 ? OD1 ? A ASP 150 OD1 
195 1 Y 1 A ASP 163 ? OD2 ? A ASP 150 OD2 
196 1 Y 1 A ASN 166 ? CG  ? A ASN 153 CG  
197 1 Y 1 A ASN 166 ? OD1 ? A ASN 153 OD1 
198 1 Y 1 A ASN 166 ? ND2 ? A ASN 153 ND2 
199 1 Y 1 A ILE 167 ? CG1 ? A ILE 154 CG1 
200 1 Y 1 A ILE 167 ? CG2 ? A ILE 154 CG2 
201 1 Y 1 A ILE 167 ? CD1 ? A ILE 154 CD1 
202 1 Y 1 A GLU 174 ? CG  ? A GLU 161 CG  
203 1 Y 1 A GLU 174 ? CD  ? A GLU 161 CD  
204 1 Y 1 A GLU 174 ? OE1 ? A GLU 161 OE1 
205 1 Y 1 A GLU 174 ? OE2 ? A GLU 161 OE2 
206 1 Y 1 A ILE 190 ? CG1 ? A ILE 177 CG1 
207 1 Y 1 A ILE 190 ? CG2 ? A ILE 177 CG2 
208 1 Y 1 A ILE 190 ? CD1 ? A ILE 177 CD1 
209 1 Y 1 A PHE 197 ? CG  ? A PHE 184 CG  
210 1 Y 1 A PHE 197 ? CD1 ? A PHE 184 CD1 
211 1 Y 1 A PHE 197 ? CD2 ? A PHE 184 CD2 
212 1 Y 1 A PHE 197 ? CE1 ? A PHE 184 CE1 
213 1 Y 1 A PHE 197 ? CE2 ? A PHE 184 CE2 
214 1 Y 1 A PHE 197 ? CZ  ? A PHE 184 CZ  
215 1 Y 1 A LEU 206 ? CG  ? A LEU 193 CG  
216 1 Y 1 A LEU 206 ? CD1 ? A LEU 193 CD1 
217 1 Y 1 A LEU 206 ? CD2 ? A LEU 193 CD2 
218 1 Y 1 A GLN 210 ? CG  ? A GLN 197 CG  
219 1 Y 1 A GLN 210 ? CD  ? A GLN 197 CD  
220 1 Y 1 A GLN 210 ? OE1 ? A GLN 197 OE1 
221 1 Y 1 A GLN 210 ? NE2 ? A GLN 197 NE2 
222 1 Y 1 A GLU 214 ? CG  ? A GLU 201 CG  
223 1 Y 1 A GLU 214 ? CD  ? A GLU 201 CD  
224 1 Y 1 A GLU 214 ? OE1 ? A GLU 201 OE1 
225 1 Y 1 A GLU 214 ? OE2 ? A GLU 201 OE2 
226 1 Y 1 A GLU 215 ? CG  ? A GLU 202 CG  
227 1 Y 1 A GLU 215 ? CD  ? A GLU 202 CD  
228 1 Y 1 A GLU 215 ? OE1 ? A GLU 202 OE1 
229 1 Y 1 A GLU 215 ? OE2 ? A GLU 202 OE2 
230 1 Y 1 A LYS 216 ? CG  ? A LYS 203 CG  
231 1 Y 1 A LYS 216 ? CD  ? A LYS 203 CD  
232 1 Y 1 A LYS 216 ? CE  ? A LYS 203 CE  
233 1 Y 1 A LYS 216 ? NZ  ? A LYS 203 NZ  
234 1 Y 1 A ARG 220 ? CG  ? A ARG 207 CG  
235 1 Y 1 A ARG 220 ? CD  ? A ARG 207 CD  
236 1 Y 1 A ARG 220 ? NE  ? A ARG 207 NE  
237 1 Y 1 A ARG 220 ? CZ  ? A ARG 207 CZ  
238 1 Y 1 A ARG 220 ? NH1 ? A ARG 207 NH1 
239 1 Y 1 A ARG 220 ? NH2 ? A ARG 207 NH2 
240 1 Y 1 A SER 225 ? OG  ? A SER 212 OG  
241 1 Y 1 A LYS 231 ? CG  ? A LYS 218 CG  
242 1 Y 1 A LYS 231 ? CD  ? A LYS 218 CD  
243 1 Y 1 A LYS 231 ? CE  ? A LYS 218 CE  
244 1 Y 1 A LYS 231 ? NZ  ? A LYS 218 NZ  
245 1 Y 1 A GLU 266 ? CG  ? A GLU 253 CG  
246 1 Y 1 A GLU 266 ? CD  ? A GLU 253 CD  
247 1 Y 1 A GLU 266 ? OE1 ? A GLU 253 OE1 
248 1 Y 1 A GLU 266 ? OE2 ? A GLU 253 OE2 
249 1 Y 1 A MET 267 ? CG  ? A MET 254 CG  
250 1 Y 1 A MET 267 ? SD  ? A MET 254 SD  
251 1 Y 1 A MET 267 ? CE  ? A MET 254 CE  
252 1 Y 1 A ARG 268 ? CG  ? A ARG 255 CG  
253 1 Y 1 A ARG 268 ? CD  ? A ARG 255 CD  
254 1 Y 1 A ARG 268 ? NE  ? A ARG 255 NE  
255 1 Y 1 A ARG 268 ? CZ  ? A ARG 255 CZ  
256 1 Y 1 A ARG 268 ? NH1 ? A ARG 255 NH1 
257 1 Y 1 A ARG 268 ? NH2 ? A ARG 255 NH2 
258 1 Y 1 A ILE 273 ? CG1 ? A ILE 260 CG1 
259 1 Y 1 A ILE 273 ? CG2 ? A ILE 260 CG2 
260 1 Y 1 A ILE 273 ? CD1 ? A ILE 260 CD1 
261 1 Y 1 A LYS 276 ? CG  ? A LYS 263 CG  
262 1 Y 1 A LYS 276 ? CD  ? A LYS 263 CD  
263 1 Y 1 A LYS 276 ? CE  ? A LYS 263 CE  
264 1 Y 1 A LYS 276 ? NZ  ? A LYS 263 NZ  
265 1 Y 1 A LEU 283 ? CG  ? A LEU 270 CG  
266 1 Y 1 A LEU 283 ? CD1 ? A LEU 270 CD1 
267 1 Y 1 A LEU 283 ? CD2 ? A LEU 270 CD2 
268 1 Y 1 A MET 313 ? CG  ? A MET 300 CG  
269 1 Y 1 A MET 313 ? SD  ? A MET 300 SD  
270 1 Y 1 A MET 313 ? CE  ? A MET 300 CE  
271 1 Y 1 A ASP 314 ? CG  ? A ASP 301 CG  
272 1 Y 1 A ASP 314 ? OD1 ? A ASP 301 OD1 
273 1 Y 1 A ASP 314 ? OD2 ? A ASP 301 OD2 
274 1 Y 1 A LEU 316 ? CG  ? A LEU 303 CG  
275 1 Y 1 A LEU 316 ? CD1 ? A LEU 303 CD1 
276 1 Y 1 A LEU 316 ? CD2 ? A LEU 303 CD2 
277 1 Y 1 A VAL 317 ? CG1 ? A VAL 304 CG1 
278 1 Y 1 A VAL 317 ? CG2 ? A VAL 304 CG2 
279 1 Y 1 A ASN 318 ? CG  ? A ASN 305 CG  
280 1 Y 1 A ASN 318 ? OD1 ? A ASN 305 OD1 
281 1 Y 1 A ASN 318 ? ND2 ? A ASN 305 ND2 
282 1 Y 1 A VAL 320 ? CG1 ? A VAL 307 CG1 
283 1 Y 1 A VAL 320 ? CG2 ? A VAL 307 CG2 
284 1 Y 1 A CYS 324 ? SG  ? A CYS 311 SG  
285 1 Y 1 A SER 326 ? OG  ? A SER 313 OG  
286 1 Y 1 A ILE 331 ? CG1 ? A ILE 318 CG1 
287 1 Y 1 A ILE 331 ? CG2 ? A ILE 318 CG2 
288 1 Y 1 A ILE 331 ? CD1 ? A ILE 318 CD1 
289 1 Y 1 A ARG 332 ? CG  ? A ARG 319 CG  
290 1 Y 1 A ARG 332 ? CD  ? A ARG 319 CD  
291 1 Y 1 A ARG 332 ? NE  ? A ARG 319 NE  
292 1 Y 1 A ARG 332 ? CZ  ? A ARG 319 CZ  
293 1 Y 1 A ARG 332 ? NH1 ? A ARG 319 NH1 
294 1 Y 1 A ARG 332 ? NH2 ? A ARG 319 NH2 
295 1 Y 1 A GLU 333 ? CG  ? A GLU 320 CG  
296 1 Y 1 A GLU 333 ? CD  ? A GLU 320 CD  
297 1 Y 1 A GLU 333 ? OE1 ? A GLU 320 OE1 
298 1 Y 1 A GLU 333 ? OE2 ? A GLU 320 OE2 
299 1 Y 1 A GLU 336 ? CG  ? A GLU 323 CG  
300 1 Y 1 A GLU 336 ? CD  ? A GLU 323 CD  
301 1 Y 1 A GLU 336 ? OE1 ? A GLU 323 OE1 
302 1 Y 1 A GLU 336 ? OE2 ? A GLU 323 OE2 
303 1 Y 1 A VAL 338 ? CG1 ? A VAL 325 CG1 
304 1 Y 1 A VAL 338 ? CG2 ? A VAL 325 CG2 
305 1 Y 1 A LYS 339 ? CG  ? A LYS 326 CG  
306 1 Y 1 A LYS 339 ? CD  ? A LYS 326 CD  
307 1 Y 1 A LYS 339 ? CE  ? A LYS 326 CE  
308 1 Y 1 A LYS 339 ? NZ  ? A LYS 326 NZ  
309 1 Y 1 A ASN 340 ? CG  ? A ASN 327 CG  
310 1 Y 1 A ASN 340 ? OD1 ? A ASN 327 OD1 
311 1 Y 1 A ASN 340 ? ND2 ? A ASN 327 ND2 
312 1 Y 1 A LYS 342 ? CG  ? A LYS 329 CG  
313 1 Y 1 A LYS 342 ? CD  ? A LYS 329 CD  
314 1 Y 1 A LYS 342 ? CE  ? A LYS 329 CE  
315 1 Y 1 A LYS 342 ? NZ  ? A LYS 329 NZ  
316 1 Y 1 A VAL 345 ? CG1 ? A VAL 332 CG1 
317 1 Y 1 A VAL 345 ? CG2 ? A VAL 332 CG2 
318 1 Y 1 A THR 349 ? OG1 ? A THR 336 OG1 
319 1 Y 1 A THR 349 ? CG2 ? A THR 336 CG2 
320 1 Y 1 A GLU 352 ? CG  ? A GLU 339 CG  
321 1 Y 1 A GLU 352 ? CD  ? A GLU 339 CD  
322 1 Y 1 A GLU 352 ? OE1 ? A GLU 339 OE1 
323 1 Y 1 A GLU 352 ? OE2 ? A GLU 339 OE2 
324 1 Y 1 A LEU 356 ? CG  ? A LEU 343 CG  
325 1 Y 1 A LEU 356 ? CD1 ? A LEU 343 CD1 
326 1 Y 1 A LEU 356 ? CD2 ? A LEU 343 CD2 
327 1 Y 1 A SER 358 ? OG  ? A SER 345 OG  
328 1 Y 1 A ARG 384 ? CG  ? A ARG 371 CG  
329 1 Y 1 A ARG 384 ? CD  ? A ARG 371 CD  
330 1 Y 1 A ARG 384 ? NE  ? A ARG 371 NE  
331 1 Y 1 A ARG 384 ? CZ  ? A ARG 371 CZ  
332 1 Y 1 A ARG 384 ? NH1 ? A ARG 371 NH1 
333 1 Y 1 A ARG 384 ? NH2 ? A ARG 371 NH2 
334 1 Y 1 A LYS 385 ? CG  ? A LYS 372 CG  
335 1 Y 1 A LYS 385 ? CD  ? A LYS 372 CD  
336 1 Y 1 A LYS 385 ? CE  ? A LYS 372 CE  
337 1 Y 1 A LYS 385 ? NZ  ? A LYS 372 NZ  
338 1 Y 1 A LYS 388 ? CG  ? A LYS 375 CG  
339 1 Y 1 A LYS 388 ? CD  ? A LYS 375 CD  
340 1 Y 1 A LYS 388 ? CE  ? A LYS 375 CE  
341 1 Y 1 A LYS 388 ? NZ  ? A LYS 375 NZ  
342 1 Y 1 A MET 391 ? SD  ? A MET 378 SD  
343 1 Y 1 A MET 391 ? CE  ? A MET 378 CE  
344 1 Y 1 A GLU 396 ? CG  ? A GLU 383 CG  
345 1 Y 1 A GLU 396 ? CD  ? A GLU 383 CD  
346 1 Y 1 A GLU 396 ? OE1 ? A GLU 383 OE1 
347 1 Y 1 A GLU 396 ? OE2 ? A GLU 383 OE2 
348 1 Y 1 A LYS 403 ? CG  ? A LYS 390 CG  
349 1 Y 1 A LYS 403 ? CD  ? A LYS 390 CD  
350 1 Y 1 A LYS 403 ? CE  ? A LYS 390 CE  
351 1 Y 1 A LYS 403 ? NZ  ? A LYS 390 NZ  
352 1 Y 1 A ASP 440 ? CG  ? A ASP 427 CG  
353 1 Y 1 A ASP 440 ? OD1 ? A ASP 427 OD1 
354 1 Y 1 A ASP 440 ? OD2 ? A ASP 427 OD2 
355 1 Y 1 A LYS 443 ? CG  ? A LYS 430 CG  
356 1 Y 1 A LYS 443 ? CD  ? A LYS 430 CD  
357 1 Y 1 A LYS 443 ? CE  ? A LYS 430 CE  
358 1 Y 1 A LYS 443 ? NZ  ? A LYS 430 NZ  
359 1 Y 1 A CYS 463 ? SG  ? A CYS 450 SG  
360 1 Y 1 A SER 471 ? OG  ? A SER 458 OG  
361 1 Y 1 A LYS 475 ? CG  ? A LYS 462 CG  
362 1 Y 1 A LYS 475 ? CD  ? A LYS 462 CD  
363 1 Y 1 A LYS 475 ? CE  ? A LYS 462 CE  
364 1 Y 1 A LYS 475 ? NZ  ? A LYS 462 NZ  
365 1 Y 1 A GLU 483 ? CD  ? A GLU 470 CD  
366 1 Y 1 A GLU 483 ? OE1 ? A GLU 470 OE1 
367 1 Y 1 A GLU 483 ? OE2 ? A GLU 470 OE2 
368 1 Y 1 A LYS 489 ? CD  ? A LYS 476 CD  
369 1 Y 1 A LYS 489 ? CE  ? A LYS 476 CE  
370 1 Y 1 A LYS 489 ? NZ  ? A LYS 476 NZ  
371 1 Y 1 A HIS 521 ? CG  ? A HIS 508 CG  
372 1 Y 1 A HIS 521 ? ND1 ? A HIS 508 ND1 
373 1 Y 1 A HIS 521 ? CD2 ? A HIS 508 CD2 
374 1 Y 1 A HIS 521 ? CE1 ? A HIS 508 CE1 
375 1 Y 1 A HIS 521 ? NE2 ? A HIS 508 NE2 
376 1 Y 1 A LYS 525 ? CG  ? A LYS 512 CG  
377 1 Y 1 A LYS 525 ? CD  ? A LYS 512 CD  
378 1 Y 1 A LYS 525 ? CE  ? A LYS 512 CE  
379 1 Y 1 A LYS 525 ? NZ  ? A LYS 512 NZ  
380 1 Y 1 A LYS 526 ? CE  ? A LYS 513 CE  
381 1 Y 1 A LYS 526 ? NZ  ? A LYS 513 NZ  
382 1 Y 1 A GLU 548 ? CG  ? A GLU 535 CG  
383 1 Y 1 A GLU 548 ? CD  ? A GLU 535 CD  
384 1 Y 1 A GLU 548 ? OE1 ? A GLU 535 OE1 
385 1 Y 1 A GLU 548 ? OE2 ? A GLU 535 OE2 
386 1 Y 1 A ILE 555 ? CG1 ? A ILE 542 CG1 
387 1 Y 1 A ILE 555 ? CG2 ? A ILE 542 CG2 
388 1 Y 1 A ILE 555 ? CD1 ? A ILE 542 CD1 
389 1 Y 1 A VAL 563 ? CG1 ? A VAL 550 CG1 
390 1 Y 1 A VAL 563 ? CG2 ? A VAL 550 CG2 
391 1 Y 1 A LYS 565 ? CG  ? A LYS 552 CG  
392 1 Y 1 A LYS 565 ? CD  ? A LYS 552 CD  
393 1 Y 1 A LYS 565 ? CE  ? A LYS 552 CE  
394 1 Y 1 A LYS 565 ? NZ  ? A LYS 552 NZ  
395 1 Y 1 A GLU 566 ? CG  ? A GLU 553 CG  
396 1 Y 1 A GLU 566 ? CD  ? A GLU 553 CD  
397 1 Y 1 A GLU 566 ? OE1 ? A GLU 553 OE1 
398 1 Y 1 A GLU 566 ? OE2 ? A GLU 553 OE2 
399 1 Y 1 A THR 567 ? OG1 ? A THR 554 OG1 
400 1 Y 1 A THR 567 ? CG2 ? A THR 554 CG2 
401 1 Y 1 A PHE 584 ? CG  ? A PHE 571 CG  
402 1 Y 1 A PHE 584 ? CD1 ? A PHE 571 CD1 
403 1 Y 1 A PHE 584 ? CD2 ? A PHE 571 CD2 
404 1 Y 1 A PHE 584 ? CE1 ? A PHE 571 CE1 
405 1 Y 1 A PHE 584 ? CE2 ? A PHE 571 CE2 
406 1 Y 1 A PHE 584 ? CZ  ? A PHE 571 CZ  
407 1 Y 1 A MET 587 ? CG  ? A MET 574 CG  
408 1 Y 1 A MET 587 ? SD  ? A MET 574 SD  
409 1 Y 1 A MET 587 ? CE  ? A MET 574 CE  
410 1 Y 1 A LYS 604 ? CG  ? A LYS 591 CG  
411 1 Y 1 A LYS 604 ? CD  ? A LYS 591 CD  
412 1 Y 1 A LYS 604 ? CE  ? A LYS 591 CE  
413 1 Y 1 A LYS 604 ? NZ  ? A LYS 591 NZ  
414 1 Y 1 A ASP 621 ? CG  ? A ASP 608 CG  
415 1 Y 1 A ASP 621 ? OD1 ? A ASP 608 OD1 
416 1 Y 1 A ASP 621 ? OD2 ? A ASP 608 OD2 
417 1 Y 1 A ILE 623 ? CG1 ? A ILE 610 CG1 
418 1 Y 1 A ILE 623 ? CG2 ? A ILE 610 CG2 
419 1 Y 1 A ILE 623 ? CD1 ? A ILE 610 CD1 
420 1 Y 1 A HIS 624 ? CG  ? A HIS 611 CG  
421 1 Y 1 A HIS 624 ? ND1 ? A HIS 611 ND1 
422 1 Y 1 A HIS 624 ? CD2 ? A HIS 611 CD2 
423 1 Y 1 A HIS 624 ? CE1 ? A HIS 611 CE1 
424 1 Y 1 A HIS 624 ? NE2 ? A HIS 611 NE2 
425 1 Y 1 A LYS 625 ? CG  ? A LYS 612 CG  
426 1 Y 1 A LYS 625 ? CD  ? A LYS 612 CD  
427 1 Y 1 A LYS 625 ? CE  ? A LYS 612 CE  
428 1 Y 1 A LYS 625 ? NZ  ? A LYS 612 NZ  
429 1 Y 1 A GLU 626 ? CG  ? A GLU 613 CG  
430 1 Y 1 A GLU 626 ? CD  ? A GLU 613 CD  
431 1 Y 1 A GLU 626 ? OE1 ? A GLU 613 OE1 
432 1 Y 1 A GLU 626 ? OE2 ? A GLU 613 OE2 
433 1 Y 1 A GLN 629 ? CG  ? A GLN 616 CG  
434 1 Y 1 A GLN 629 ? CD  ? A GLN 616 CD  
435 1 Y 1 A GLN 629 ? OE1 ? A GLN 616 OE1 
436 1 Y 1 A GLN 629 ? NE2 ? A GLN 616 NE2 
437 1 Y 1 A LEU 630 ? CG  ? A LEU 617 CG  
438 1 Y 1 A LEU 630 ? CD1 ? A LEU 617 CD1 
439 1 Y 1 A LEU 630 ? CD2 ? A LEU 617 CD2 
440 1 Y 1 A GLU 632 ? CG  ? A GLU 619 CG  
441 1 Y 1 A GLU 632 ? CD  ? A GLU 619 CD  
442 1 Y 1 A GLU 632 ? OE1 ? A GLU 619 OE1 
443 1 Y 1 A GLU 632 ? OE2 ? A GLU 619 OE2 
444 1 Y 1 A ASP 633 ? CG  ? A ASP 620 CG  
445 1 Y 1 A ASP 633 ? OD1 ? A ASP 620 OD1 
446 1 Y 1 A ASP 633 ? OD2 ? A ASP 620 OD2 
447 1 Y 1 A ASP 639 ? CG  ? A ASP 626 CG  
448 1 Y 1 A ASP 639 ? OD1 ? A ASP 626 OD1 
449 1 Y 1 A ASP 639 ? OD2 ? A ASP 626 OD2 
450 1 Y 1 A GLU 644 ? CG  ? A GLU 631 CG  
451 1 Y 1 A GLU 644 ? CD  ? A GLU 631 CD  
452 1 Y 1 A GLU 644 ? OE1 ? A GLU 631 OE1 
453 1 Y 1 A GLU 644 ? OE2 ? A GLU 631 OE2 
454 1 Y 1 A LYS 645 ? CG  ? A LYS 632 CG  
455 1 Y 1 A LYS 645 ? CD  ? A LYS 632 CD  
456 1 Y 1 A LYS 645 ? CE  ? A LYS 632 CE  
457 1 Y 1 A LYS 645 ? NZ  ? A LYS 632 NZ  
458 1 Y 1 A LEU 646 ? CG  ? A LEU 633 CG  
459 1 Y 1 A LEU 646 ? CD1 ? A LEU 633 CD1 
460 1 Y 1 A LEU 646 ? CD2 ? A LEU 633 CD2 
461 1 Y 1 A LEU 647 ? CG  ? A LEU 634 CG  
462 1 Y 1 A LEU 647 ? CD1 ? A LEU 634 CD1 
463 1 Y 1 A LEU 647 ? CD2 ? A LEU 634 CD2 
464 1 Y 1 A TYR 649 ? CG  ? A TYR 636 CG  
465 1 Y 1 A TYR 649 ? CD1 ? A TYR 636 CD1 
466 1 Y 1 A TYR 649 ? CD2 ? A TYR 636 CD2 
467 1 Y 1 A TYR 649 ? CE1 ? A TYR 636 CE1 
468 1 Y 1 A TYR 649 ? CE2 ? A TYR 636 CE2 
469 1 Y 1 A TYR 649 ? CZ  ? A TYR 636 CZ  
470 1 Y 1 A TYR 649 ? OH  ? A TYR 636 OH  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 14  ? A SER 1   
2  1 Y 1 A MET 15  ? A MET 2   
3  1 Y 1 A LYS 16  ? A LYS 3   
4  1 Y 1 A ASN 47  ? A ASN 34  
5  1 Y 1 A GLY 89  ? A GLY 76  
6  1 Y 1 A ALA 90  ? A ALA 77  
7  1 Y 1 A LEU 290 ? A LEU 277 
8  1 Y 1 A PRO 291 ? A PRO 278 
9  1 Y 1 A ASN 292 ? A ASN 279 
10 1 Y 1 A THR 293 ? A THR 280 
11 1 Y 1 A PHE 294 ? A PHE 281 
12 1 Y 1 A GLY 295 ? A GLY 282 
13 1 Y 1 A ASP 296 ? A ASP 283 
14 1 Y 1 A TYR 297 ? A TYR 284 
15 1 Y 1 A ASP 298 ? A ASP 285 
16 1 Y 1 A GLU 299 ? A GLU 286 
17 1 Y 1 A THR 300 ? A THR 287 
18 1 Y 1 A PRO 301 ? A PRO 288 
19 1 Y 1 A SER 302 ? A SER 289 
20 1 Y 1 A MET 303 ? A MET 290 
21 1 Y 1 A MET 304 ? A MET 291 
22 1 Y 1 A ALA 305 ? A ALA 292 
23 1 Y 1 A LYS 306 ? A LYS 293 
24 1 Y 1 A HIS 307 ? A HIS 294 
25 1 Y 1 A LEU 308 ? A LEU 295 
26 1 Y 1 A LYS 309 ? A LYS 296 
27 1 Y 1 A ASP 310 ? A ASP 297 
28 1 Y 1 A THR 652 ? A THR 639 
29 1 Y 1 A GLN 653 ? A GLN 640 
30 1 Y 1 A GLY 654 ? A GLY 641 
31 1 Y 1 A THR 655 ? A THR 642 
32 1 Y 1 A GLY 656 ? A GLY 643 
33 1 Y 1 A GLY 657 ? A GLY 644 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(6S)-5,6,7,8-TETRAHYDROFOLATE' THG 
3 water                           HOH 
#