data_4CDC
# 
_entry.id   4CDC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4CDC         
PDBE  EBI-58829    
WWPDB D_1290058829 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4CDD unspecified 'HUMAN DPP1 IN COMPLEX WITH (2S)-N-((1S)-1-CYANO-2 -(4-(4-CYANOPHENYL)PHENYL)ETHYL)PIPERIDINE-2- CARBOXAMIDE' 
PDB 4CDE unspecified 
'HUMAN DPP1 IN COMPLEX WITH 4-AMINO-N-((1S)-1-CYANO -2-(4-(4-CYANOPHENYL)PHENYL)ETHYL)TETRAHYDROPYRAN-4- CARBOXAMIDE'       
PDB 4CDF unspecified 
'HUMAN DPP1 IN COMPLEX WITH (2S,4S)-N-((1S)-1-CYANO -2-(4-(4-CYANOPHENYL)PHENYL)ETHYL)-4-HYDROXY- PIPERIDINE-2-CARBOXAMIDE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4CDC 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-10-31 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Debreczeni, J.' 1  
'Edman, K.'      2  
'Furber, M.'     3  
'Tiden, A.'      4  
'Gardiner, P.'   5  
'Mete, T.'       6  
'Ford, R.'       7  
'Millichip, I.'  8  
'Stein, L.'      9  
'Mather, A.'     10 
'Kinchin, E.'    11 
'Luckhurst, C.'  12 
'Cage, P.'       13 
'Sanghanee, H.'  14 
'Breed, J.'      15 
'Wissler, L.'    16 
# 
_citation.id                        primary 
_citation.title                     'Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            57 
_citation.page_first                2357 
_citation.page_last                 ? 
_citation.year                      2014 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24592859 
_citation.pdbx_database_id_DOI      10.1021/JM401705G 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Furber, M.'     1  ? 
primary 'Gardiner, P.'   2  ? 
primary 'Tiden, A.K.'    3  ? 
primary 'Mete, A.'       4  ? 
primary 'Ford, R.'       5  ? 
primary 'Millichip, I.'  6  ? 
primary 'Stein, L.'      7  ? 
primary 'Mather, A.'     8  ? 
primary 'Kinchin, E.'    9  ? 
primary 'Luckhurst, C.'  10 ? 
primary 'Barber, S.'     11 ? 
primary 'Cage, P.'       12 ? 
primary 'Sanganee, H.'   13 ? 
primary 'Austin, R.'     14 ? 
primary 'Chohan, K.'     15 ? 
primary 'Beri, R.'       16 ? 
primary 'Thong, B.'      17 ? 
primary 'Wallace, A.'    18 ? 
primary 'Oreffo, V.'     19 ? 
primary 'Hutchinson, R.' 20 ? 
primary 'Harper, S.'     21 ? 
primary 'Debreczeni, J.' 22 ? 
primary 'Breed, J.'      23 ? 
primary 'Wissler, L.'    24 ? 
primary 'Edman, K.'      25 ? 
# 
_cell.entry_id           4CDC 
_cell.length_a           84.276 
_cell.length_b           84.276 
_cell.length_c           224.626 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4CDC 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                144 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN'                                13500.163 4   3.4.14.1 ? 
'DPP1 EXCLUSION DOMAIN, RESIDUES 25-143' ? 
2 polymer     man 'DIPEPTIDYL PEPTIDASE 1 HEAVY CHAIN'                                           18630.018 4   3.4.14.1 ? 
'DPP1 HEAVY CHAIN, RESIDUES 230-394'     ? 
3 polymer     man 'DIPEPTIDYL PEPTIDASE 1 LIGHT CHAIN'                                           7583.444  4   3.4.14.1 ? ? ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                       221.208   7   ?        ? ? ? 
5 non-polymer syn '(2S)-2-azanyl-N-[(2S)-1-azanylidene-3-(4-phenylphenyl)propan-2-yl]butanamide' 309.405   4   ?        ? ? ? 
6 non-polymer syn 'CHLORIDE ION'                                                                 35.453    4   ?        ? ? ? 
7 non-polymer syn GLYCEROL                                                                       92.094    4   ?        ? ? ? 
8 water       nat water                                                                          18.015    311 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;DIPEPTIDYL PEPTIDASE I EXCLUSION DOMAIN CHAIN, CATHEPSIN C, CATHEPSIN J, DIPEPTIDYL PEPTIDASE I, DPP-I, DPPI, DIPEPTIDYL TRANSFERASE
;
2 'DIPEPTIDYL PEPTIDASE I HEAVY CHAIN, CATHEPSIN C, CATHEPSIN J, DIPEPTIDYL PEPTIDASE I, DPP-I, DPPI, DIPEPTIDYL TRANSFERASE' 
3 'DIPEPTIDYL PEPTIDASE I LIGHT CHAIN, CATHEPSIN C, CATHEPSIN J, DIPEPTIDYL PEPTIDASE I, DPP-I, DPPI, DIPEPTIDYL TRANSFERASE' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAF
FKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVG
;
;DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAF
FKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVG
;
A,D,G,J ? 
2 'polypeptide(L)' no no 
;HLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGK
YAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYH
HTGLR
;
;HLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGK
YAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYH
HTGLR
;
B,E,H,K ? 
3 'polypeptide(L)' no no DPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL 
DPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL C,F,I,L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   THR n 
1 3   PRO n 
1 4   ALA n 
1 5   ASN n 
1 6   CYS n 
1 7   THR n 
1 8   TYR n 
1 9   LEU n 
1 10  ASP n 
1 11  LEU n 
1 12  LEU n 
1 13  GLY n 
1 14  THR n 
1 15  TRP n 
1 16  VAL n 
1 17  PHE n 
1 18  GLN n 
1 19  VAL n 
1 20  GLY n 
1 21  SER n 
1 22  SER n 
1 23  GLY n 
1 24  SER n 
1 25  GLN n 
1 26  ARG n 
1 27  ASP n 
1 28  VAL n 
1 29  ASN n 
1 30  CYS n 
1 31  SER n 
1 32  VAL n 
1 33  MET n 
1 34  GLY n 
1 35  PRO n 
1 36  GLN n 
1 37  GLU n 
1 38  LYS n 
1 39  LYS n 
1 40  VAL n 
1 41  VAL n 
1 42  VAL n 
1 43  TYR n 
1 44  LEU n 
1 45  GLN n 
1 46  LYS n 
1 47  LEU n 
1 48  ASP n 
1 49  THR n 
1 50  ALA n 
1 51  TYR n 
1 52  ASP n 
1 53  ASP n 
1 54  LEU n 
1 55  GLY n 
1 56  ASN n 
1 57  SER n 
1 58  GLY n 
1 59  HIS n 
1 60  PHE n 
1 61  THR n 
1 62  ILE n 
1 63  ILE n 
1 64  TYR n 
1 65  ASN n 
1 66  GLN n 
1 67  GLY n 
1 68  PHE n 
1 69  GLU n 
1 70  ILE n 
1 71  VAL n 
1 72  LEU n 
1 73  ASN n 
1 74  ASP n 
1 75  TYR n 
1 76  LYS n 
1 77  TRP n 
1 78  PHE n 
1 79  ALA n 
1 80  PHE n 
1 81  PHE n 
1 82  LYS n 
1 83  TYR n 
1 84  LYS n 
1 85  GLU n 
1 86  GLU n 
1 87  GLY n 
1 88  SER n 
1 89  LYS n 
1 90  VAL n 
1 91  THR n 
1 92  THR n 
1 93  TYR n 
1 94  CYS n 
1 95  ASN n 
1 96  GLU n 
1 97  THR n 
1 98  MET n 
1 99  THR n 
1 100 GLY n 
1 101 TRP n 
1 102 VAL n 
1 103 HIS n 
1 104 ASP n 
1 105 VAL n 
1 106 LEU n 
1 107 GLY n 
1 108 ARG n 
1 109 ASN n 
1 110 TRP n 
1 111 ALA n 
1 112 CYS n 
1 113 PHE n 
1 114 THR n 
1 115 GLY n 
1 116 LYS n 
1 117 LYS n 
1 118 VAL n 
1 119 GLY n 
2 1   HIS n 
2 2   LEU n 
2 3   PRO n 
2 4   THR n 
2 5   SER n 
2 6   TRP n 
2 7   ASP n 
2 8   TRP n 
2 9   ARG n 
2 10  ASN n 
2 11  VAL n 
2 12  HIS n 
2 13  GLY n 
2 14  ILE n 
2 15  ASN n 
2 16  PHE n 
2 17  VAL n 
2 18  SER n 
2 19  PRO n 
2 20  VAL n 
2 21  ARG n 
2 22  ASN n 
2 23  GLN n 
2 24  ALA n 
2 25  SER n 
2 26  CYS n 
2 27  GLY n 
2 28  SER n 
2 29  CYS n 
2 30  TYR n 
2 31  SER n 
2 32  PHE n 
2 33  ALA n 
2 34  SER n 
2 35  MET n 
2 36  GLY n 
2 37  MET n 
2 38  LEU n 
2 39  GLU n 
2 40  ALA n 
2 41  ARG n 
2 42  ILE n 
2 43  ARG n 
2 44  ILE n 
2 45  LEU n 
2 46  THR n 
2 47  ASN n 
2 48  ASN n 
2 49  SER n 
2 50  GLN n 
2 51  THR n 
2 52  PRO n 
2 53  ILE n 
2 54  LEU n 
2 55  SER n 
2 56  PRO n 
2 57  GLN n 
2 58  GLU n 
2 59  VAL n 
2 60  VAL n 
2 61  SER n 
2 62  CYS n 
2 63  SER n 
2 64  GLN n 
2 65  TYR n 
2 66  ALA n 
2 67  GLN n 
2 68  GLY n 
2 69  CYS n 
2 70  GLU n 
2 71  GLY n 
2 72  GLY n 
2 73  PHE n 
2 74  PRO n 
2 75  TYR n 
2 76  LEU n 
2 77  ILE n 
2 78  ALA n 
2 79  GLY n 
2 80  LYS n 
2 81  TYR n 
2 82  ALA n 
2 83  GLN n 
2 84  ASP n 
2 85  PHE n 
2 86  GLY n 
2 87  LEU n 
2 88  VAL n 
2 89  GLU n 
2 90  GLU n 
2 91  ALA n 
2 92  CYS n 
2 93  PHE n 
2 94  PRO n 
2 95  TYR n 
2 96  THR n 
2 97  GLY n 
2 98  THR n 
2 99  ASP n 
2 100 SER n 
2 101 PRO n 
2 102 CYS n 
2 103 LYS n 
2 104 MET n 
2 105 LYS n 
2 106 GLU n 
2 107 ASP n 
2 108 CYS n 
2 109 PHE n 
2 110 ARG n 
2 111 TYR n 
2 112 TYR n 
2 113 SER n 
2 114 SER n 
2 115 GLU n 
2 116 TYR n 
2 117 HIS n 
2 118 TYR n 
2 119 VAL n 
2 120 GLY n 
2 121 GLY n 
2 122 PHE n 
2 123 TYR n 
2 124 GLY n 
2 125 GLY n 
2 126 CYS n 
2 127 ASN n 
2 128 GLU n 
2 129 ALA n 
2 130 LEU n 
2 131 MET n 
2 132 LYS n 
2 133 LEU n 
2 134 GLU n 
2 135 LEU n 
2 136 VAL n 
2 137 HIS n 
2 138 HIS n 
2 139 GLY n 
2 140 PRO n 
2 141 MET n 
2 142 ALA n 
2 143 VAL n 
2 144 ALA n 
2 145 PHE n 
2 146 GLU n 
2 147 VAL n 
2 148 TYR n 
2 149 ASP n 
2 150 ASP n 
2 151 PHE n 
2 152 LEU n 
2 153 HIS n 
2 154 TYR n 
2 155 LYS n 
2 156 LYS n 
2 157 GLY n 
2 158 ILE n 
2 159 TYR n 
2 160 HIS n 
2 161 HIS n 
2 162 THR n 
2 163 GLY n 
2 164 LEU n 
2 165 ARG n 
3 1   ASP n 
3 2   PRO n 
3 3   PHE n 
3 4   ASN n 
3 5   PRO n 
3 6   PHE n 
3 7   GLU n 
3 8   LEU n 
3 9   THR n 
3 10  ASN n 
3 11  HIS n 
3 12  ALA n 
3 13  VAL n 
3 14  LEU n 
3 15  LEU n 
3 16  VAL n 
3 17  GLY n 
3 18  TYR n 
3 19  GLY n 
3 20  THR n 
3 21  ASP n 
3 22  SER n 
3 23  ALA n 
3 24  SER n 
3 25  GLY n 
3 26  MET n 
3 27  ASP n 
3 28  TYR n 
3 29  TRP n 
3 30  ILE n 
3 31  VAL n 
3 32  LYS n 
3 33  ASN n 
3 34  SER n 
3 35  TRP n 
3 36  GLY n 
3 37  THR n 
3 38  GLY n 
3 39  TRP n 
3 40  GLY n 
3 41  GLU n 
3 42  ASN n 
3 43  GLY n 
3 44  TYR n 
3 45  PHE n 
3 46  ARG n 
3 47  ILE n 
3 48  ARG n 
3 49  ARG n 
3 50  GLY n 
3 51  THR n 
3 52  ASP n 
3 53  GLU n 
3 54  CYS n 
3 55  ALA n 
3 56  ILE n 
3 57  GLU n 
3 58  SER n 
3 59  ILE n 
3 60  ALA n 
3 61  VAL n 
3 62  ALA n 
3 63  ALA n 
3 64  THR n 
3 65  PRO n 
3 66  ILE n 
3 67  PRO n 
3 68  LYS n 
3 69  LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? 
? ? Sf21 ? ? ? ? ? BACULOVIRUS ? ? ? ? ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? 
? ? Sf21 ? ? ? ? ? BACULOVIRUS ? ? ? ? ? ? 
3 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? 
? ? Sf21 ? ? ? ? ? BACULOVIRUS ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP CATC_HUMAN 1 ? ? P53634 ? 
2 UNP CATC_HUMAN 2 ? ? P53634 ? 
3 UNP CATC_HUMAN 3 ? ? P53634 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4CDC A 1 ? 119 ? P53634 25  ? 143 ? 1   119 
2  2 4CDC B 1 ? 165 ? P53634 230 ? 394 ? 206 370 
3  3 4CDC C 1 ? 69  ? P53634 395 ? 463 ? 371 439 
4  1 4CDC D 1 ? 119 ? P53634 25  ? 143 ? 1   119 
5  2 4CDC E 1 ? 165 ? P53634 230 ? 394 ? 206 370 
6  3 4CDC F 1 ? 69  ? P53634 395 ? 463 ? 371 439 
7  1 4CDC G 1 ? 119 ? P53634 25  ? 143 ? 1   119 
8  2 4CDC H 1 ? 165 ? P53634 230 ? 394 ? 206 370 
9  3 4CDC I 1 ? 69  ? P53634 395 ? 463 ? 371 439 
10 1 4CDC J 1 ? 119 ? P53634 25  ? 143 ? 1   119 
11 2 4CDC K 1 ? 165 ? P53634 230 ? 394 ? 206 370 
12 3 4CDC L 1 ? 69  ? P53634 395 ? 463 ? 371 439 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
6AO non-polymer                  . '(2S)-2-azanyl-N-[(2S)-1-azanylidene-3-(4-phenylphenyl)propan-2-yl]butanamide' ? 'C19 H23 N3 O' 
309.405 
ALA 'L-peptide linking'          y ALANINE                                                                        ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking'          y ARGININE                                                                       ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                     ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                ? 'C4 H7 N O4' 
133.103 
CL  non-polymer                  . 'CHLORIDE ION'                                                                 ? 'Cl -1' 35.453 
CYS 'L-peptide linking'          y CYSTEINE                                                                       ? 'C3 H7 N O2 S' 
121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                                      ? 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'            y GLYCINE                                                                        ? 'C2 H5 N O2' 
75.067  
GOL non-polymer                  . GLYCEROL                                                                       
'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking'          y HISTIDINE                                                                      ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                                                          ? 'H2 O' 18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                     ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                        ? 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking'          y LYSINE                                                                         ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                                                     ? 
'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                       ? 'C8 H15 N O6' 
221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                  ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking'          y PROLINE                                                                        ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking'          y SERINE                                                                         ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking'          y THREONINE                                                                      ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                     ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                       ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking'          y VALINE                                                                         ? 'C5 H11 N O2' 
117.146 
# 
_exptl.entry_id          4CDC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.90 
_exptl_crystal.density_percent_sol   57.57 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '21% PEG3350, 200MM AMSO4, 100MM NA ACETATE PH 4.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2011-04-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.07230 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             1.07230 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4CDC 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             75.00 
_reflns.d_resolution_high            2.40 
_reflns.number_obs                   67307 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.1 
_reflns.pdbx_Rmerge_I_obs            0.15 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.10 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.53 
_reflns_shell.percent_possible_all   96.6 
_reflns_shell.Rmerge_I_obs           0.56 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.10 
_reflns_shell.pdbx_redundancy        1.6 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4CDC 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     63603 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    96.12 
_refine.ls_R_factor_obs                          0.19278 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19068 
_refine.ls_R_factor_R_free                       0.23250 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3397 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.931 
_refine.correlation_coeff_Fo_to_Fc_free          0.899 
_refine.B_iso_mean                               26.159 
_refine.aniso_B[1][1]                            0.02 
_refine.aniso_B[2][2]                            0.02 
_refine.aniso_B[3][3]                            -0.07 
_refine.aniso_B[1][2]                            0.02 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES WITH TLS ADDED.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1K3B' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.377 
_refine.pdbx_overall_ESU_R_Free                  0.244 
_refine.overall_SU_ML                            0.162 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             13.001 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10882 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         218 
_refine_hist.number_atoms_solvent             311 
_refine_hist.number_atoms_total               11411 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.019  ? 11460 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 10162 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.176  1.942  ? 15552 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.732  3.004  ? 23290 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.041  5.000  ? 1357  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.119 23.850 ? 535   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.489 15.000 ? 1697  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.296 15.000 ? 40    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.070  0.200  ? 1611  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 13025 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 2833  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.552  1.067  ? 5479  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.552  1.067  ? 5478  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.990  1.795  ? 6819  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.869  1.174  ? 5981  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.400 
_refine_ls_shell.d_res_low                        2.461 
_refine_ls_shell.number_reflns_R_work             4551 
_refine_ls_shell.R_factor_R_work                  0.260 
_refine_ls_shell.percent_reflns_obs               96.47 
_refine_ls_shell.R_factor_R_free                  0.293 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             252 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4CDC 
_struct.title                     'Human DPP1 in complex with (2S)-2-amino-N-((1S)-1-cyano-2-(4- phenylphenyl)ethyl)butanamide' 
_struct.pdbx_descriptor           
;DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN (E.C.3.4.14.1), DIPEPTIDYL PEPTIDASE 1 HEAVY CHAIN (E.C.3.4.14.1), DIPEPTIDYL PEPTIDASE 1 LIGHT CHAIN (E.C.3.4.14.1)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4CDC 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 1 ? 
K  N N 2 ? 
L  N N 3 ? 
M  N N 4 ? 
N  N N 5 ? 
O  N N 4 ? 
P  N N 6 ? 
Q  N N 4 ? 
R  N N 7 ? 
S  N N 5 ? 
T  N N 6 ? 
U  N N 4 ? 
V  N N 7 ? 
W  N N 7 ? 
X  N N 5 ? 
Y  N N 4 ? 
Z  N N 6 ? 
AA N N 4 ? 
BA N N 5 ? 
CA N N 4 ? 
DA N N 7 ? 
EA N N 6 ? 
FA N N 8 ? 
GA N N 8 ? 
HA N N 8 ? 
IA N N 8 ? 
JA N N 8 ? 
KA N N 8 ? 
LA N N 8 ? 
MA N N 8 ? 
NA N N 8 ? 
OA N N 8 ? 
PA N N 8 ? 
QA N N 8 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 7   ? LEU A 12  ? THR A 7   LEU A 12  1 ? 6  
HELX_P HELX_P2  2  SER B 28  ? ASN B 47  ? SER B 233 ASN B 252 1 ? 20 
HELX_P HELX_P3  3  SER B 55  ? SER B 63  ? SER B 260 SER B 268 1 ? 9  
HELX_P HELX_P4  4  GLN B 67  ? CYS B 69  ? GLN B 272 CYS B 274 5 ? 3  
HELX_P HELX_P5  5  PHE B 73  ? ALA B 78  ? PHE B 278 ALA B 283 1 ? 6  
HELX_P HELX_P6  6  GLY B 79  ? PHE B 85  ? GLY B 284 PHE B 290 1 ? 7  
HELX_P HELX_P7  7  ASN B 127 ? GLY B 139 ? ASN B 332 GLY B 344 1 ? 13 
HELX_P HELX_P8  8  TYR B 148 ? HIS B 153 ? TYR B 353 HIS B 358 1 ? 6  
HELX_P HELX_P9  9  ASP C 52  ? ILE C 56  ? ASP C 422 ILE C 426 5 ? 5  
HELX_P HELX_P10 10 THR D 7   ? LEU D 12  ? THR D 7   LEU D 12  1 ? 6  
HELX_P HELX_P11 11 SER E 28  ? THR E 46  ? SER E 233 THR E 251 1 ? 19 
HELX_P HELX_P12 12 SER E 55  ? SER E 63  ? SER E 260 SER E 268 1 ? 9  
HELX_P HELX_P13 13 GLN E 67  ? CYS E 69  ? GLN E 272 CYS E 274 5 ? 3  
HELX_P HELX_P14 14 PHE E 73  ? ALA E 78  ? PHE E 278 ALA E 283 1 ? 6  
HELX_P HELX_P15 15 GLY E 79  ? PHE E 85  ? GLY E 284 PHE E 290 1 ? 7  
HELX_P HELX_P16 16 GLU E 90  ? PHE E 93  ? GLU E 295 PHE E 298 5 ? 4  
HELX_P HELX_P17 17 ASN E 127 ? GLY E 139 ? ASN E 332 GLY E 344 1 ? 13 
HELX_P HELX_P18 18 TYR E 148 ? TYR E 154 ? TYR E 353 TYR E 359 5 ? 7  
HELX_P HELX_P19 19 ASP F 52  ? ILE F 56  ? ASP F 422 ILE F 426 5 ? 5  
HELX_P HELX_P20 20 THR G 7   ? LEU G 12  ? THR G 7   LEU G 12  1 ? 6  
HELX_P HELX_P21 21 ASN G 29  ? MET G 33  ? ASN G 29  MET G 33  5 ? 5  
HELX_P HELX_P22 22 SER H 28  ? THR H 46  ? SER H 233 THR H 251 1 ? 19 
HELX_P HELX_P23 23 SER H 55  ? SER H 63  ? SER H 260 SER H 268 1 ? 9  
HELX_P HELX_P24 24 GLN H 67  ? CYS H 69  ? GLN H 272 CYS H 274 5 ? 3  
HELX_P HELX_P25 25 PHE H 73  ? ALA H 78  ? PHE H 278 ALA H 283 1 ? 6  
HELX_P HELX_P26 26 GLY H 79  ? PHE H 85  ? GLY H 284 PHE H 290 1 ? 7  
HELX_P HELX_P27 27 GLU H 90  ? PHE H 93  ? GLU H 295 PHE H 298 5 ? 4  
HELX_P HELX_P28 28 ASN H 127 ? GLY H 139 ? ASN H 332 GLY H 344 1 ? 13 
HELX_P HELX_P29 29 TYR H 148 ? HIS H 153 ? TYR H 353 HIS H 358 1 ? 6  
HELX_P HELX_P30 30 ASP I 52  ? ILE I 56  ? ASP I 422 ILE I 426 5 ? 5  
HELX_P HELX_P31 31 THR J 7   ? LEU J 12  ? THR J 7   LEU J 12  1 ? 6  
HELX_P HELX_P32 32 SER K 28  ? THR K 46  ? SER K 233 THR K 251 1 ? 19 
HELX_P HELX_P33 33 SER K 55  ? SER K 63  ? SER K 260 SER K 268 1 ? 9  
HELX_P HELX_P34 34 GLN K 67  ? CYS K 69  ? GLN K 272 CYS K 274 5 ? 3  
HELX_P HELX_P35 35 PHE K 73  ? ALA K 78  ? PHE K 278 ALA K 283 1 ? 6  
HELX_P HELX_P36 36 GLY K 79  ? PHE K 85  ? GLY K 284 PHE K 290 1 ? 7  
HELX_P HELX_P37 37 ASN K 127 ? GLY K 139 ? ASN K 332 GLY K 344 1 ? 13 
HELX_P HELX_P38 38 TYR K 148 ? TYR K 154 ? TYR K 353 TYR K 359 5 ? 7  
HELX_P HELX_P39 39 ASP L 52  ? ILE L 56  ? ASP L 422 ILE L 426 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 6  SG  ? ? ? 1_555 A  CYS 94  SG  ? ? A CYS 6   A CYS 94   1_555 ? ? ? ? ? ? ? 2.065 ? ? 
disulf2  disulf ?    ? A CYS 30 SG  ? ? ? 1_555 A  CYS 112 SG  ? ? A CYS 30  A CYS 112  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf3  disulf ?    ? B CYS 26 SG  ? ? ? 1_555 B  CYS 69  SG  ? ? B CYS 231 B CYS 274  1_555 ? ? ? ? ? ? ? 2.076 ? ? 
disulf4  disulf ?    ? B CYS 62 SG  ? ? ? 1_555 B  CYS 102 SG  ? ? B CYS 267 B CYS 307  1_555 ? ? ? ? ? ? ? 2.068 ? ? 
disulf5  disulf ?    ? B CYS 92 SG  ? ? ? 1_555 B  CYS 108 SG  ? ? B CYS 297 B CYS 313  1_555 ? ? ? ? ? ? ? 2.067 ? ? 
disulf6  disulf ?    ? D CYS 6  SG  ? ? ? 1_555 D  CYS 94  SG  ? ? D CYS 6   D CYS 94   1_555 ? ? ? ? ? ? ? 2.074 ? ? 
disulf7  disulf ?    ? D CYS 30 SG  ? ? ? 1_555 D  CYS 112 SG  ? ? D CYS 30  D CYS 112  1_555 ? ? ? ? ? ? ? 2.047 ? ? 
disulf8  disulf ?    ? E CYS 26 SG  ? ? ? 1_555 E  CYS 69  SG  ? ? E CYS 231 E CYS 274  1_555 ? ? ? ? ? ? ? 2.062 ? ? 
disulf9  disulf ?    ? E CYS 62 SG  ? ? ? 1_555 E  CYS 102 SG  ? ? E CYS 267 E CYS 307  1_555 ? ? ? ? ? ? ? 2.058 ? ? 
disulf10 disulf ?    ? G CYS 6  SG  ? ? ? 1_555 G  CYS 94  SG  ? ? G CYS 6   G CYS 94   1_555 ? ? ? ? ? ? ? 2.058 ? ? 
disulf11 disulf ?    ? G CYS 30 SG  ? ? ? 1_555 G  CYS 112 SG  ? ? G CYS 30  G CYS 112  1_555 ? ? ? ? ? ? ? 2.027 ? ? 
disulf12 disulf ?    ? H CYS 26 SG  ? ? ? 1_555 H  CYS 69  SG  ? ? H CYS 231 H CYS 274  1_555 ? ? ? ? ? ? ? 2.075 ? ? 
disulf13 disulf ?    ? H CYS 62 SG  ? ? ? 1_555 H  CYS 102 SG  ? ? H CYS 267 H CYS 307  1_555 ? ? ? ? ? ? ? 2.056 ? ? 
disulf14 disulf ?    ? H CYS 92 SG  ? ? ? 1_555 H  CYS 108 SG  ? ? H CYS 297 H CYS 313  1_555 ? ? ? ? ? ? ? 2.070 ? ? 
disulf15 disulf ?    ? J CYS 6  SG  ? ? ? 1_555 J  CYS 94  SG  ? ? J CYS 6   J CYS 94   1_555 ? ? ? ? ? ? ? 2.073 ? ? 
disulf16 disulf ?    ? J CYS 30 SG  ? ? ? 1_555 J  CYS 112 SG  ? ? J CYS 30  J CYS 112  1_555 ? ? ? ? ? ? ? 2.060 ? ? 
disulf17 disulf ?    ? K CYS 26 SG  ? ? ? 1_555 K  CYS 69  SG  ? ? K CYS 231 K CYS 274  1_555 ? ? ? ? ? ? ? 2.046 ? ? 
disulf18 disulf ?    ? K CYS 62 SG  ? ? ? 1_555 K  CYS 102 SG  ? ? K CYS 267 K CYS 307  1_555 ? ? ? ? ? ? ? 2.050 ? ? 
disulf19 disulf ?    ? K CYS 92 SG  ? ? ? 1_555 K  CYS 108 SG  ? ? K CYS 297 K CYS 313  1_555 ? ? ? ? ? ? ? 2.058 ? ? 
covale1  covale one  ? A ASN 5  ND2 ? ? ? 1_555 M  NAG .   C1  ? ? A ASN 5   A NAG 1120 1_555 ? ? ? ? ? ? ? 1.437 ? 
N-Glycosylation 
covale2  covale none ? B CYS 29 SG  ? ? ? 1_555 N  6AO .   C22 ? ? B CYS 234 B 6AO 1368 1_555 ? ? ? ? ? ? ? 1.793 ? ? 
covale3  covale one  ? B ASN 47 ND2 ? ? ? 1_555 O  NAG .   C1  ? ? B ASN 252 B NAG 1369 1_555 ? ? ? ? ? ? ? 1.454 ? 
N-Glycosylation 
covale4  covale one  ? D ASN 5  ND2 ? ? ? 1_555 Q  NAG .   C1  ? ? D ASN 5   D NAG 1119 1_555 ? ? ? ? ? ? ? 1.447 ? 
N-Glycosylation 
covale5  covale none ? E CYS 29 SG  ? ? ? 1_555 S  6AO .   C22 ? ? E CYS 234 E 6AO 1368 1_555 ? ? ? ? ? ? ? 1.786 ? ? 
covale6  covale one  ? G ASN 5  ND2 ? ? ? 1_555 U  NAG .   C1  ? ? G ASN 5   G NAG 1120 1_555 ? ? ? ? ? ? ? 1.431 ? 
N-Glycosylation 
covale7  covale none ? H CYS 29 SG  ? ? ? 1_555 X  6AO .   C22 ? ? H CYS 234 H 6AO 1368 1_555 ? ? ? ? ? ? ? 1.783 ? ? 
covale8  covale one  ? H ASN 47 ND2 ? ? ? 1_555 Y  NAG .   C1  ? ? H ASN 252 H NAG 1369 1_555 ? ? ? ? ? ? ? 1.454 ? 
N-Glycosylation 
covale9  covale one  ? J ASN 5  ND2 ? ? ? 1_555 AA NAG .   C1  ? ? J ASN 5   J NAG 1120 1_555 ? ? ? ? ? ? ? 1.458 ? 
N-Glycosylation 
covale10 covale none ? K CYS 29 SG  ? ? ? 1_555 BA 6AO .   C22 ? ? K CYS 234 K 6AO 1368 1_555 ? ? ? ? ? ? ? 1.789 ? ? 
covale11 covale one  ? K ASN 47 ND2 ? ? ? 1_555 CA NAG .   C1  ? ? K ASN 252 K NAG 1369 1_555 ? ? ? ? ? ? ? 1.463 ? 
N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 46 A . ? LYS 46 A LEU 47 A ? LEU 47 A 1 4.81 
2 LYS 46 D . ? LYS 46 D LEU 47 D ? LEU 47 D 1 0.40 
3 LYS 46 G . ? LYS 46 G LEU 47 G ? LEU 47 G 1 1.33 
4 LYS 46 J . ? LYS 46 J LEU 47 J ? LEU 47 J 1 1.85 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 10 ? 
BA ? 2  ? 
BB ? 2  ? 
BC ? 5  ? 
BD ? 5  ? 
BE ? 2  ? 
DA ? 10 ? 
EA ? 2  ? 
EB ? 2  ? 
EC ? 5  ? 
ED ? 5  ? 
EE ? 2  ? 
GA ? 10 ? 
HA ? 2  ? 
HB ? 2  ? 
HC ? 5  ? 
HD ? 5  ? 
HE ? 2  ? 
JA ? 10 ? 
KA ? 2  ? 
KB ? 2  ? 
KC ? 5  ? 
KD ? 5  ? 
KE ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
AA 7 8 ? parallel      
BA 1 2 ? parallel      
BB 1 2 ? anti-parallel 
BC 1 2 ? parallel      
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BC 4 5 ? anti-parallel 
BD 1 2 ? parallel      
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BD 4 5 ? parallel      
BE 1 2 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DA 4 5 ? anti-parallel 
DA 5 6 ? anti-parallel 
DA 6 7 ? anti-parallel 
DA 7 8 ? parallel      
DA 8 9 ? parallel      
EA 1 2 ? parallel      
EB 1 2 ? anti-parallel 
EC 1 2 ? parallel      
EC 2 3 ? anti-parallel 
EC 3 4 ? anti-parallel 
EC 4 5 ? anti-parallel 
ED 1 2 ? parallel      
ED 2 3 ? anti-parallel 
ED 3 4 ? anti-parallel 
ED 4 5 ? parallel      
EE 1 2 ? anti-parallel 
GA 1 2 ? anti-parallel 
GA 2 3 ? anti-parallel 
GA 3 4 ? anti-parallel 
GA 4 5 ? anti-parallel 
GA 5 6 ? anti-parallel 
GA 6 7 ? anti-parallel 
GA 7 8 ? parallel      
GA 8 9 ? parallel      
HA 1 2 ? parallel      
HB 1 2 ? anti-parallel 
HC 1 2 ? parallel      
HC 2 3 ? anti-parallel 
HC 3 4 ? anti-parallel 
HC 4 5 ? anti-parallel 
HD 1 2 ? parallel      
HD 2 3 ? anti-parallel 
HD 3 4 ? anti-parallel 
HD 4 5 ? parallel      
HE 1 2 ? anti-parallel 
JA 1 2 ? anti-parallel 
JA 2 3 ? anti-parallel 
JA 3 4 ? anti-parallel 
JA 4 5 ? anti-parallel 
JA 5 6 ? anti-parallel 
JA 6 7 ? anti-parallel 
JA 7 8 ? parallel      
JA 8 9 ? parallel      
KA 1 2 ? parallel      
KB 1 2 ? anti-parallel 
KC 1 2 ? parallel      
KC 2 3 ? anti-parallel 
KC 3 4 ? anti-parallel 
KC 4 5 ? anti-parallel 
KD 1 2 ? parallel      
KD 2 3 ? anti-parallel 
KD 3 4 ? anti-parallel 
KD 4 5 ? parallel      
KE 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLY A 13  ? SER A 24  ? GLY A 13  SER A 24  
AA 2 GLN A 36  ? GLN A 45  ? GLN A 36  GLN A 45  
AA 3 THR A 49  ? TYR A 51  ? THR A 49  TYR A 51  
AA 4 SER A 57  ? ILE A 63  ? SER A 57  ILE A 63  
AA 5 GLY A 67  ? LEU A 72  ? GLY A 67  LEU A 72  
AA 6 TYR A 75  ? TYR A 83  ? TYR A 75  TYR A 83  
AA 7 THR A 92  ? THR A 97  ? THR A 92  THR A 97  
AA 8 TRP A 110 ? LYS A 117 ? TRP A 110 LYS A 117 
AA 9 GLY A 13  ? SER A 24  ? GLY A 13  SER A 24  
BA 1 TRP B 6   ? ASP B 7   ? TRP B 211 ASP B 212 
BA 2 HIS C 11  ? THR C 20  ? HIS C 381 THR C 390 
BB 1 MET B 141 ? PHE B 145 ? MET B 346 PHE B 350 
BB 2 HIS C 11  ? THR C 20  ? HIS C 381 THR C 390 
BC 1 ILE B 158 ? TYR B 159 ? ILE B 363 TYR B 364 
BC 2 TYR C 44  ? ARG C 48  ? TYR C 414 ARG C 418 
BC 3 ASP C 27  ? LYS C 32  ? ASP C 397 LYS C 402 
BC 4 HIS C 11  ? THR C 20  ? HIS C 381 THR C 390 
BC 5 MET B 141 ? PHE B 145 ? MET B 346 PHE B 350 
BD 1 ILE B 158 ? TYR B 159 ? ILE B 363 TYR B 364 
BD 2 TYR C 44  ? ARG C 48  ? TYR C 414 ARG C 418 
BD 3 ASP C 27  ? LYS C 32  ? ASP C 397 LYS C 402 
BD 4 HIS C 11  ? THR C 20  ? HIS C 381 THR C 390 
BD 5 TRP B 6   ? ASP B 7   ? TRP B 211 ASP B 212 
BE 1 SER B 113 ? TYR B 118 ? SER B 318 TYR B 323 
BE 2 VAL C 61  ? PRO C 65  ? VAL C 431 PRO C 435 
DA 1 GLY D 13  ? SER D 24  ? GLY D 13  SER D 24  
DA 2 LYS D 38  ? GLN D 45  ? LYS D 38  GLN D 45  
DA 3 THR D 49  ? ASP D 52  ? THR D 49  ASP D 52  
DA 4 SER D 57  ? ILE D 63  ? SER D 57  ILE D 63  
DA 5 GLY D 67  ? LEU D 72  ? GLY D 67  LEU D 72  
DA 6 TYR D 75  ? LYS D 84  ? TYR D 75  LYS D 84  
DA 7 THR D 91  ? THR D 97  ? THR D 91  THR D 97  
DA 8 TRP D 110 ? LYS D 117 ? TRP D 110 LYS D 117 
DA 9 GLY D 13  ? SER D 24  ? GLY D 13  SER D 24  
EA 1 TRP E 6   ? ASP E 7   ? TRP E 211 ASP E 212 
EA 2 HIS F 11  ? THR F 20  ? HIS F 381 THR F 390 
EB 1 MET E 141 ? PHE E 145 ? MET E 346 PHE E 350 
EB 2 HIS F 11  ? THR F 20  ? HIS F 381 THR F 390 
EC 1 ILE E 158 ? TYR E 159 ? ILE E 363 TYR E 364 
EC 2 TYR F 44  ? ARG F 48  ? TYR F 414 ARG F 418 
EC 3 ASP F 27  ? LYS F 32  ? ASP F 397 LYS F 402 
EC 4 HIS F 11  ? THR F 20  ? HIS F 381 THR F 390 
EC 5 MET E 141 ? PHE E 145 ? MET E 346 PHE E 350 
ED 1 ILE E 158 ? TYR E 159 ? ILE E 363 TYR E 364 
ED 2 TYR F 44  ? ARG F 48  ? TYR F 414 ARG F 418 
ED 3 ASP F 27  ? LYS F 32  ? ASP F 397 LYS F 402 
ED 4 HIS F 11  ? THR F 20  ? HIS F 381 THR F 390 
ED 5 TRP E 6   ? ASP E 7   ? TRP E 211 ASP E 212 
EE 1 SER E 113 ? TYR E 118 ? SER E 318 TYR E 323 
EE 2 VAL F 61  ? PRO F 65  ? VAL F 431 PRO F 435 
GA 1 GLY G 13  ? SER G 24  ? GLY G 13  SER G 24  
GA 2 GLN G 36  ? GLN G 45  ? GLN G 36  GLN G 45  
GA 3 THR G 49  ? ASP G 52  ? THR G 49  ASP G 52  
GA 4 SER G 57  ? ILE G 63  ? SER G 57  ILE G 63  
GA 5 GLY G 67  ? LEU G 72  ? GLY G 67  LEU G 72  
GA 6 TYR G 75  ? TYR G 83  ? TYR G 75  TYR G 83  
GA 7 THR G 92  ? THR G 97  ? THR G 92  THR G 97  
GA 8 TRP G 110 ? LYS G 117 ? TRP G 110 LYS G 117 
GA 9 GLY G 13  ? SER G 24  ? GLY G 13  SER G 24  
HA 1 TRP H 6   ? ASP H 7   ? TRP H 211 ASP H 212 
HA 2 HIS I 11  ? THR I 20  ? HIS I 381 THR I 390 
HB 1 MET H 141 ? PHE H 145 ? MET H 346 PHE H 350 
HB 2 HIS I 11  ? THR I 20  ? HIS I 381 THR I 390 
HC 1 ILE H 158 ? TYR H 159 ? ILE H 363 TYR H 364 
HC 2 TYR I 44  ? ARG I 48  ? TYR I 414 ARG I 418 
HC 3 ASP I 27  ? LYS I 32  ? ASP I 397 LYS I 402 
HC 4 HIS I 11  ? THR I 20  ? HIS I 381 THR I 390 
HC 5 MET H 141 ? PHE H 145 ? MET H 346 PHE H 350 
HD 1 ILE H 158 ? TYR H 159 ? ILE H 363 TYR H 364 
HD 2 TYR I 44  ? ARG I 48  ? TYR I 414 ARG I 418 
HD 3 ASP I 27  ? LYS I 32  ? ASP I 397 LYS I 402 
HD 4 HIS I 11  ? THR I 20  ? HIS I 381 THR I 390 
HD 5 TRP H 6   ? ASP H 7   ? TRP H 211 ASP H 212 
HE 1 SER H 113 ? TYR H 118 ? SER H 318 TYR H 323 
HE 2 VAL I 61  ? PRO I 65  ? VAL I 431 PRO I 435 
JA 1 GLY J 13  ? SER J 24  ? GLY J 13  SER J 24  
JA 2 GLN J 36  ? GLN J 45  ? GLN J 36  GLN J 45  
JA 3 THR J 49  ? TYR J 51  ? THR J 49  TYR J 51  
JA 4 SER J 57  ? ILE J 63  ? SER J 57  ILE J 63  
JA 5 GLY J 67  ? LEU J 72  ? GLY J 67  LEU J 72  
JA 6 TYR J 75  ? TYR J 83  ? TYR J 75  TYR J 83  
JA 7 THR J 92  ? THR J 97  ? THR J 92  THR J 97  
JA 8 TRP J 110 ? GLY J 119 ? TRP J 110 GLY J 119 
JA 9 GLY J 13  ? SER J 24  ? GLY J 13  SER J 24  
KA 1 TRP K 6   ? ASP K 7   ? TRP K 211 ASP K 212 
KA 2 HIS L 11  ? THR L 20  ? HIS L 381 THR L 390 
KB 1 MET K 141 ? PHE K 145 ? MET K 346 PHE K 350 
KB 2 HIS L 11  ? THR L 20  ? HIS L 381 THR L 390 
KC 1 ILE K 158 ? TYR K 159 ? ILE K 363 TYR K 364 
KC 2 TYR L 44  ? ARG L 48  ? TYR L 414 ARG L 418 
KC 3 ASP L 27  ? LYS L 32  ? ASP L 397 LYS L 402 
KC 4 HIS L 11  ? THR L 20  ? HIS L 381 THR L 390 
KC 5 MET K 141 ? PHE K 145 ? MET K 346 PHE K 350 
KD 1 ILE K 158 ? TYR K 159 ? ILE K 363 TYR K 364 
KD 2 TYR L 44  ? ARG L 48  ? TYR L 414 ARG L 418 
KD 3 ASP L 27  ? LYS L 32  ? ASP L 397 LYS L 402 
KD 4 HIS L 11  ? THR L 20  ? HIS L 381 THR L 390 
KD 5 TRP K 6   ? ASP K 7   ? TRP K 211 ASP K 212 
KE 1 TYR K 112 ? TYR K 118 ? TYR K 317 TYR K 323 
KE 2 VAL L 61  ? ILE L 66  ? VAL L 431 ILE L 436 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 O VAL A 19  ? O VAL A 19  N GLU A 37  ? N GLU A 37  
AA 2 3 N GLN A 45  ? N GLN A 45  O THR A 49  ? O THR A 49  
AA 3 4 N ALA A 50  ? N ALA A 50  O GLY A 58  ? O GLY A 58  
AA 4 5 N ILE A 63  ? N ILE A 63  O GLY A 67  ? O GLY A 67  
AA 5 6 N LEU A 72  ? N LEU A 72  O TYR A 75  ? O TYR A 75  
AA 6 7 O LYS A 82  ? O LYS A 82  N TYR A 93  ? N TYR A 93  
AA 7 8 N THR A 97  ? N THR A 97  O GLY A 115 ? O GLY A 115 
BA 1 2 N TRP B 6   ? N TRP B 211 O TYR C 18  ? O TYR C 388 
BB 1 2 N PHE B 145 ? N PHE B 350 O HIS C 11  ? O HIS C 381 
BC 1 2 N TYR B 159 ? N TYR B 364 O ARG C 46  ? O ARG C 416 
BC 2 3 N ILE C 47  ? N ILE C 417 O TRP C 29  ? O TRP C 399 
BC 3 4 N LYS C 32  ? N LYS C 402 O LEU C 14  ? O LEU C 384 
BC 4 5 N LEU C 15  ? N LEU C 385 O MET B 141 ? O MET B 346 
BD 1 2 N TYR B 159 ? N TYR B 364 O ARG C 46  ? O ARG C 416 
BD 2 3 N ILE C 47  ? N ILE C 417 O TRP C 29  ? O TRP C 399 
BD 3 4 N LYS C 32  ? N LYS C 402 O LEU C 14  ? O LEU C 384 
BD 4 5 N TYR C 18  ? N TYR C 388 O TRP B 6   ? O TRP B 211 
BE 1 2 N HIS B 117 ? N HIS B 322 O ALA C 62  ? O ALA C 432 
DA 1 2 N VAL D 19  ? N VAL D 19  O LYS D 38  ? O LYS D 38  
DA 2 3 N GLN D 45  ? N GLN D 45  O THR D 49  ? O THR D 49  
DA 3 4 N ALA D 50  ? N ALA D 50  O GLY D 58  ? O GLY D 58  
DA 4 5 N ILE D 63  ? N ILE D 63  O GLY D 67  ? O GLY D 67  
DA 5 6 N LEU D 72  ? N LEU D 72  O TYR D 75  ? O TYR D 75  
DA 6 7 N LYS D 84  ? N LYS D 84  O THR D 91  ? O THR D 91  
DA 7 8 N THR D 97  ? N THR D 97  O GLY D 115 ? O GLY D 115 
DA 8 9 N SER D 24  ? N SER D 24  O SER D 21  ? O SER D 21  
EA 1 2 N TRP E 6   ? N TRP E 211 O TYR F 18  ? O TYR F 388 
EB 1 2 N PHE E 145 ? N PHE E 350 O HIS F 11  ? O HIS F 381 
EC 1 2 N TYR E 159 ? N TYR E 364 O ARG F 46  ? O ARG F 416 
EC 2 3 N ILE F 47  ? N ILE F 417 O TRP F 29  ? O TRP F 399 
EC 3 4 N LYS F 32  ? N LYS F 402 O LEU F 14  ? O LEU F 384 
EC 4 5 N LEU F 15  ? N LEU F 385 O MET E 141 ? O MET E 346 
ED 1 2 N TYR E 159 ? N TYR E 364 O ARG F 46  ? O ARG F 416 
ED 2 3 N ILE F 47  ? N ILE F 417 O TRP F 29  ? O TRP F 399 
ED 3 4 N LYS F 32  ? N LYS F 402 O LEU F 14  ? O LEU F 384 
ED 4 5 N TYR F 18  ? N TYR F 388 O TRP E 6   ? O TRP E 211 
EE 1 2 N HIS E 117 ? N HIS E 322 O ALA F 62  ? O ALA F 432 
GA 1 2 O VAL G 19  ? O VAL G 19  N GLU G 37  ? N GLU G 37  
GA 2 3 N GLN G 45  ? N GLN G 45  O THR G 49  ? O THR G 49  
GA 3 4 N ALA G 50  ? N ALA G 50  O GLY G 58  ? O GLY G 58  
GA 4 5 N ILE G 63  ? N ILE G 63  O GLY G 67  ? O GLY G 67  
GA 5 6 N LEU G 72  ? N LEU G 72  O TYR G 75  ? O TYR G 75  
GA 6 7 O LYS G 82  ? O LYS G 82  N TYR G 93  ? N TYR G 93  
GA 7 8 N THR G 97  ? N THR G 97  O GLY G 115 ? O GLY G 115 
GA 8 9 N SER G 24  ? N SER G 24  O SER G 21  ? O SER G 21  
HA 1 2 N TRP H 6   ? N TRP H 211 O TYR I 18  ? O TYR I 388 
HB 1 2 N PHE H 145 ? N PHE H 350 O HIS I 11  ? O HIS I 381 
HC 1 2 N TYR H 159 ? N TYR H 364 O ARG I 46  ? O ARG I 416 
HC 2 3 N ILE I 47  ? N ILE I 417 O TRP I 29  ? O TRP I 399 
HC 3 4 N LYS I 32  ? N LYS I 402 O LEU I 14  ? O LEU I 384 
HC 4 5 N LEU I 15  ? N LEU I 385 O MET H 141 ? O MET H 346 
HD 1 2 N TYR H 159 ? N TYR H 364 O ARG I 46  ? O ARG I 416 
HD 2 3 N ILE I 47  ? N ILE I 417 O TRP I 29  ? O TRP I 399 
HD 3 4 N LYS I 32  ? N LYS I 402 O LEU I 14  ? O LEU I 384 
HD 4 5 N TYR I 18  ? N TYR I 388 O TRP H 6   ? O TRP H 211 
HE 1 2 N HIS H 117 ? N HIS H 322 O ALA I 62  ? O ALA I 432 
JA 1 2 O VAL J 19  ? O VAL J 19  N GLU J 37  ? N GLU J 37  
JA 2 3 N GLN J 45  ? N GLN J 45  O THR J 49  ? O THR J 49  
JA 3 4 N ALA J 50  ? N ALA J 50  O GLY J 58  ? O GLY J 58  
JA 4 5 N ILE J 63  ? N ILE J 63  O GLY J 67  ? O GLY J 67  
JA 5 6 N LEU J 72  ? N LEU J 72  O TYR J 75  ? O TYR J 75  
JA 6 7 O LYS J 82  ? O LYS J 82  N TYR J 93  ? N TYR J 93  
JA 7 8 N THR J 97  ? N THR J 97  O GLY J 115 ? O GLY J 115 
JA 8 9 N SER J 24  ? N SER J 24  O SER J 21  ? O SER J 21  
KA 1 2 N TRP K 6   ? N TRP K 211 O TYR L 18  ? O TYR L 388 
KB 1 2 N PHE K 145 ? N PHE K 350 O HIS L 11  ? O HIS L 381 
KC 1 2 N TYR K 159 ? N TYR K 364 O ARG L 46  ? O ARG L 416 
KC 2 3 N ILE L 47  ? N ILE L 417 O TRP L 29  ? O TRP L 399 
KC 3 4 N LYS L 32  ? N LYS L 402 O LEU L 14  ? O LEU L 384 
KC 4 5 N LEU L 15  ? N LEU L 385 O MET K 141 ? O MET K 346 
KD 1 2 N TYR K 159 ? N TYR K 364 O ARG L 46  ? O ARG L 416 
KD 2 3 N ILE L 47  ? N ILE L 417 O TRP L 29  ? O TRP L 399 
KD 3 4 N LYS L 32  ? N LYS L 402 O LEU L 14  ? O LEU L 384 
KD 4 5 N TYR L 18  ? N TYR L 388 O TRP K 6   ? O TRP K 211 
KE 1 2 N HIS K 117 ? N HIS K 322 O ALA L 62  ? O ALA L 432 
# 
_database_PDB_matrix.entry_id          4CDC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4CDC 
_atom_sites.fract_transf_matrix[1][1]   0.011866 
_atom_sites.fract_transf_matrix[1][2]   0.006851 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013701 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004452 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . ASP A  1 1   ? 3.819   13.079  3.164   1.00 28.68 ? 1    ASP A N   1 
ATOM   2     C  CA  . ASP A  1 1   ? 3.239   13.987  4.189   1.00 28.26 ? 1    ASP A CA  1 
ATOM   3     C  C   . ASP A  1 1   ? 3.823   15.375  4.032   1.00 28.63 ? 1    ASP A C   1 
ATOM   4     O  O   . ASP A  1 1   ? 5.016   15.519  3.753   1.00 29.95 ? 1    ASP A O   1 
ATOM   5     C  CB  . ASP A  1 1   ? 3.530   13.481  5.608   1.00 29.49 ? 1    ASP A CB  1 
ATOM   6     C  CG  . ASP A  1 1   ? 3.091   12.039  5.829   1.00 29.10 ? 1    ASP A CG  1 
ATOM   7     O  OD1 . ASP A  1 1   ? 3.135   11.233  4.870   1.00 29.08 ? 1    ASP A OD1 1 
ATOM   8     O  OD2 . ASP A  1 1   ? 2.727   11.707  6.980   1.00 29.15 ? 1    ASP A OD2 1 
ATOM   9     N  N   . THR A  1 2   ? 2.979   16.389  4.188   1.00 27.46 ? 2    THR A N   1 
ATOM   10    C  CA  . THR A  1 2   ? 3.441   17.761  4.377   1.00 28.39 ? 2    THR A CA  1 
ATOM   11    C  C   . THR A  1 2   ? 3.730   17.922  5.858   1.00 29.49 ? 2    THR A C   1 
ATOM   12    O  O   . THR A  1 2   ? 3.340   17.065  6.644   1.00 29.21 ? 2    THR A O   1 
ATOM   13    C  CB  . THR A  1 2   ? 2.374   18.794  3.985   1.00 27.31 ? 2    THR A CB  1 
ATOM   14    O  OG1 . THR A  1 2   ? 1.345   18.830  4.986   1.00 26.39 ? 2    THR A OG1 1 
ATOM   15    C  CG2 . THR A  1 2   ? 1.765   18.462  2.624   1.00 26.22 ? 2    THR A CG2 1 
ATOM   16    N  N   . PRO A  1 3   ? 4.393   19.024  6.257   1.00 30.92 ? 3    PRO A N   1 
ATOM   17    C  CA  . PRO A  1 3   ? 4.641   19.237  7.688   1.00 32.30 ? 3    PRO A CA  1 
ATOM   18    C  C   . PRO A  1 3   ? 3.383   19.473  8.542   1.00 31.90 ? 3    PRO A C   1 
ATOM   19    O  O   . PRO A  1 3   ? 3.467   19.427  9.770   1.00 32.85 ? 3    PRO A O   1 
ATOM   20    C  CB  . PRO A  1 3   ? 5.542   20.487  7.707   1.00 33.96 ? 3    PRO A CB  1 
ATOM   21    C  CG  . PRO A  1 3   ? 6.122   20.576  6.340   1.00 33.81 ? 3    PRO A CG  1 
ATOM   22    C  CD  . PRO A  1 3   ? 5.064   20.044  5.432   1.00 31.69 ? 3    PRO A CD  1 
ATOM   23    N  N   . ALA A  1 4   ? 2.232   19.698  7.901   1.00 30.89 ? 4    ALA A N   1 
ATOM   24    C  CA  . ALA A  1 4   ? 0.994   20.037  8.607   1.00 30.71 ? 4    ALA A CA  1 
ATOM   25    C  C   . ALA A  1 4   ? 0.479   18.917  9.479   1.00 31.11 ? 4    ALA A C   1 
ATOM   26    O  O   . ALA A  1 4   ? 0.707   17.740  9.192   1.00 30.54 ? 4    ALA A O   1 
ATOM   27    C  CB  . ALA A  1 4   ? -0.079  20.451  7.624   1.00 29.17 ? 4    ALA A CB  1 
ATOM   28    N  N   . ASN A  1 5   ? -0.212  19.309  10.551  1.00 32.98 ? 5    ASN A N   1 
ATOM   29    C  CA  . ASN A  1 5   ? -0.844  18.383  11.496  1.00 34.18 ? 5    ASN A CA  1 
ATOM   30    C  C   . ASN A  1 5   ? -2.139  18.985  12.025  1.00 33.54 ? 5    ASN A C   1 
ATOM   31    O  O   . ASN A  1 5   ? -2.276  19.259  13.218  1.00 34.76 ? 5    ASN A O   1 
ATOM   32    C  CB  . ASN A  1 5   ? 0.095   18.064  12.660  1.00 38.28 ? 5    ASN A CB  1 
ATOM   33    C  CG  . ASN A  1 5   ? -0.380  16.885  13.490  1.00 41.60 ? 5    ASN A CG  1 
ATOM   34    O  OD1 . ASN A  1 5   ? -1.347  16.208  13.144  1.00 40.15 ? 5    ASN A OD1 1 
ATOM   35    N  ND2 . ASN A  1 5   ? 0.308   16.636  14.594  1.00 49.92 ? 5    ASN A ND2 1 
ATOM   36    N  N   . CYS A  1 6   ? -3.078  19.188  11.110  1.00 31.12 ? 6    CYS A N   1 
ATOM   37    C  CA  . CYS A  1 6   ? -4.366  19.796  11.415  1.00 30.21 ? 6    CYS A CA  1 
ATOM   38    C  C   . CYS A  1 6   ? -5.430  18.750  11.746  1.00 28.03 ? 6    CYS A C   1 
ATOM   39    O  O   . CYS A  1 6   ? -5.325  17.583  11.365  1.00 26.69 ? 6    CYS A O   1 
ATOM   40    C  CB  . CYS A  1 6   ? -4.817  20.648  10.230  1.00 30.22 ? 6    CYS A CB  1 
ATOM   41    S  SG  . CYS A  1 6   ? -3.618  21.960  9.833   1.00 32.11 ? 6    CYS A SG  1 
ATOM   42    N  N   . THR A  1 7   ? -6.454  19.189  12.465  1.00 27.27 ? 7    THR A N   1 
ATOM   43    C  CA  . THR A  1 7   ? -7.455  18.302  13.017  1.00 26.30 ? 7    THR A CA  1 
ATOM   44    C  C   . THR A  1 7   ? -8.776  18.489  12.303  1.00 24.49 ? 7    THR A C   1 
ATOM   45    O  O   . THR A  1 7   ? -9.007  19.507  11.636  1.00 23.81 ? 7    THR A O   1 
ATOM   46    C  CB  . THR A  1 7   ? -7.674  18.562  14.521  1.00 27.89 ? 7    THR A CB  1 
ATOM   47    O  OG1 . THR A  1 7   ? -8.248  19.859  14.715  1.00 28.36 ? 7    THR A OG1 1 
ATOM   48    C  CG2 . THR A  1 7   ? -6.366  18.454  15.286  1.00 29.20 ? 7    THR A CG2 1 
ATOM   49    N  N   . TYR A  1 8   ? -9.631  17.486  12.463  1.00 23.67 ? 8    TYR A N   1 
ATOM   50    C  CA  . TYR A  1 8   ? -10.986 17.519  11.948  1.00 22.44 ? 8    TYR A CA  1 
ATOM   51    C  C   . TYR A  1 8   ? -11.729 18.759  12.463  1.00 23.01 ? 8    TYR A C   1 
ATOM   52    O  O   . TYR A  1 8   ? -12.470 19.405  11.723  1.00 22.21 ? 8    TYR A O   1 
ATOM   53    C  CB  . TYR A  1 8   ? -11.700 16.225  12.351  1.00 22.36 ? 8    TYR A CB  1 
ATOM   54    C  CG  . TYR A  1 8   ? -13.159 16.154  11.978  1.00 21.79 ? 8    TYR A CG  1 
ATOM   55    C  CD1 . TYR A  1 8   ? -13.547 15.723  10.720  1.00 20.60 ? 8    TYR A CD1 1 
ATOM   56    C  CD2 . TYR A  1 8   ? -14.148 16.515  12.894  1.00 22.80 ? 8    TYR A CD2 1 
ATOM   57    C  CE1 . TYR A  1 8   ? -14.878 15.655  10.367  1.00 20.43 ? 8    TYR A CE1 1 
ATOM   58    C  CE2 . TYR A  1 8   ? -15.486 16.451  12.556  1.00 22.71 ? 8    TYR A CE2 1 
ATOM   59    C  CZ  . TYR A  1 8   ? -15.845 16.007  11.289  1.00 21.41 ? 8    TYR A CZ  1 
ATOM   60    O  OH  . TYR A  1 8   ? -17.156 15.945  10.937  1.00 21.02 ? 8    TYR A OH  1 
ATOM   61    N  N   . LEU A  1 9   ? -11.503 19.089  13.725  1.00 24.33 ? 9    LEU A N   1 
ATOM   62    C  CA  . LEU A  1 9   ? -12.099 20.273  14.350  1.00 25.50 ? 9    LEU A CA  1 
ATOM   63    C  C   . LEU A  1 9   ? -11.750 21.599  13.646  1.00 25.26 ? 9    LEU A C   1 
ATOM   64    O  O   . LEU A  1 9   ? -12.619 22.448  13.459  1.00 25.48 ? 9    LEU A O   1 
ATOM   65    C  CB  . LEU A  1 9   ? -11.678 20.359  15.823  1.00 27.40 ? 9    LEU A CB  1 
ATOM   66    C  CG  . LEU A  1 9   ? -12.819 20.763  16.753  1.00 28.94 ? 9    LEU A CG  1 
ATOM   67    C  CD1 . LEU A  1 9   ? -13.966 19.746  16.658  1.00 28.34 ? 9    LEU A CD1 1 
ATOM   68    C  CD2 . LEU A  1 9   ? -12.330 20.905  18.194  1.00 30.95 ? 9    LEU A CD2 1 
ATOM   69    N  N   . ASP A  1 10  ? -10.485 21.767  13.266  1.00 24.92 ? 10   ASP A N   1 
ATOM   70    C  CA  . ASP A  1 10  ? -10.044 22.945  12.494  1.00 24.93 ? 10   ASP A CA  1 
ATOM   71    C  C   . ASP A  1 10  ? -10.740 23.052  11.150  1.00 23.47 ? 10   ASP A C   1 
ATOM   72    O  O   . ASP A  1 10  ? -10.917 24.149  10.623  1.00 23.77 ? 10   ASP A O   1 
ATOM   73    C  CB  . ASP A  1 10  ? -8.542  22.880  12.186  1.00 24.99 ? 10   ASP A CB  1 
ATOM   74    C  CG  . ASP A  1 10  ? -7.689  22.892  13.419  1.00 26.51 ? 10   ASP A CG  1 
ATOM   75    O  OD1 . ASP A  1 10  ? -8.074  23.575  14.395  1.00 28.00 ? 10   ASP A OD1 1 
ATOM   76    O  OD2 . ASP A  1 10  ? -6.629  22.219  13.397  1.00 26.44 ? 10   ASP A OD2 1 
ATOM   77    N  N   . LEU A  1 11  ? -11.098 21.909  10.582  1.00 21.95 ? 11   LEU A N   1 
ATOM   78    C  CA  . LEU A  1 11  ? -11.749 21.880  9.293   1.00 20.68 ? 11   LEU A CA  1 
ATOM   79    C  C   . LEU A  1 11  ? -13.213 22.361  9.328   1.00 20.93 ? 11   LEU A C   1 
ATOM   80    O  O   . LEU A  1 11  ? -13.674 23.002  8.388   1.00 20.64 ? 11   LEU A O   1 
ATOM   81    C  CB  . LEU A  1 11  ? -11.643 20.477  8.725   1.00 19.44 ? 11   LEU A CB  1 
ATOM   82    C  CG  . LEU A  1 11  ? -12.075 20.220  7.288   1.00 18.29 ? 11   LEU A CG  1 
ATOM   83    C  CD1 . LEU A  1 11  ? -11.459 21.191  6.304   1.00 18.23 ? 11   LEU A CD1 1 
ATOM   84    C  CD2 . LEU A  1 11  ? -11.685 18.801  6.940   1.00 17.51 ? 11   LEU A CD2 1 
ATOM   85    N  N   . LEU A  1 12  ? -13.933 22.079  10.405  1.00 21.67 ? 12   LEU A N   1 
ATOM   86    C  CA  . LEU A  1 12  ? -15.352 22.458  10.508  1.00 22.19 ? 12   LEU A CA  1 
ATOM   87    C  C   . LEU A  1 12  ? -15.542 23.968  10.623  1.00 23.38 ? 12   LEU A C   1 
ATOM   88    O  O   . LEU A  1 12  ? -14.756 24.642  11.281  1.00 24.45 ? 12   LEU A O   1 
ATOM   89    C  CB  . LEU A  1 12  ? -16.002 21.802  11.735  1.00 23.04 ? 12   LEU A CB  1 
ATOM   90    C  CG  . LEU A  1 12  ? -16.026 20.273  11.788  1.00 22.29 ? 12   LEU A CG  1 
ATOM   91    C  CD1 . LEU A  1 12  ? -16.416 19.815  13.192  1.00 23.58 ? 12   LEU A CD1 1 
ATOM   92    C  CD2 . LEU A  1 12  ? -16.961 19.708  10.728  1.00 21.28 ? 12   LEU A CD2 1 
ATOM   93    N  N   . GLY A  1 13  ? -16.614 24.476  10.014  1.00 23.42 ? 13   GLY A N   1 
ATOM   94    C  CA  . GLY A  1 13  ? -16.938 25.897  10.027  1.00 24.64 ? 13   GLY A CA  1 
ATOM   95    C  C   . GLY A  1 13  ? -17.151 26.392  8.612   1.00 23.97 ? 13   GLY A C   1 
ATOM   96    O  O   . GLY A  1 13  ? -17.477 25.605  7.713   1.00 22.65 ? 13   GLY A O   1 
ATOM   97    N  N   . THR A  1 14  ? -16.961 27.696  8.414   1.00 25.10 ? 14   THR A N   1 
ATOM   98    C  CA  . THR A  1 14  ? -17.187 28.352  7.122   1.00 24.62 ? 14   THR A CA  1 
ATOM   99    C  C   . THR A  1 14  ? -15.859 28.563  6.382   1.00 23.90 ? 14   THR A C   1 
ATOM   100   O  O   . THR A  1 14  ? -14.918 29.115  6.940   1.00 24.82 ? 14   THR A O   1 
ATOM   101   C  CB  . THR A  1 14  ? -17.861 29.724  7.340   1.00 26.44 ? 14   THR A CB  1 
ATOM   102   O  OG1 . THR A  1 14  ? -19.076 29.551  8.077   1.00 27.29 ? 14   THR A OG1 1 
ATOM   103   C  CG2 . THR A  1 14  ? -18.168 30.419  6.025   1.00 26.40 ? 14   THR A CG2 1 
ATOM   104   N  N   . TRP A  1 15  ? -15.777 28.104  5.138   1.00 22.54 ? 15   TRP A N   1 
ATOM   105   C  CA  . TRP A  1 15  ? -14.589 28.314  4.310   1.00 22.01 ? 15   TRP A CA  1 
ATOM   106   C  C   . TRP A  1 15  ? -14.903 29.221  3.121   1.00 22.38 ? 15   TRP A C   1 
ATOM   107   O  O   . TRP A  1 15  ? -15.952 29.085  2.468   1.00 22.18 ? 15   TRP A O   1 
ATOM   108   C  CB  . TRP A  1 15  ? -14.039 26.970  3.822   1.00 20.47 ? 15   TRP A CB  1 
ATOM   109   C  CG  . TRP A  1 15  ? -13.326 26.228  4.874   1.00 20.28 ? 15   TRP A CG  1 
ATOM   110   C  CD1 . TRP A  1 15  ? -13.872 25.421  5.832   1.00 20.11 ? 15   TRP A CD1 1 
ATOM   111   C  CD2 . TRP A  1 15  ? -11.915 26.252  5.123   1.00 20.46 ? 15   TRP A CD2 1 
ATOM   112   N  NE1 . TRP A  1 15  ? -12.884 24.932  6.658   1.00 20.17 ? 15   TRP A NE1 1 
ATOM   113   C  CE2 . TRP A  1 15  ? -11.673 25.423  6.243   1.00 20.36 ? 15   TRP A CE2 1 
ATOM   114   C  CE3 . TRP A  1 15  ? -10.832 26.895  4.509   1.00 20.85 ? 15   TRP A CE3 1 
ATOM   115   C  CZ2 . TRP A  1 15  ? -10.392 25.218  6.761   1.00 20.72 ? 15   TRP A CZ2 1 
ATOM   116   C  CZ3 . TRP A  1 15  ? -9.545  26.686  5.031   1.00 21.17 ? 15   TRP A CZ3 1 
ATOM   117   C  CH2 . TRP A  1 15  ? -9.343  25.850  6.142   1.00 21.06 ? 15   TRP A CH2 1 
ATOM   118   N  N   . VAL A  1 16  ? -14.000 30.159  2.855   1.00 23.12 ? 16   VAL A N   1 
ATOM   119   C  CA  . VAL A  1 16  ? -14.081 30.979  1.654   1.00 23.64 ? 16   VAL A CA  1 
ATOM   120   C  C   . VAL A  1 16  ? -13.051 30.465  0.664   1.00 22.84 ? 16   VAL A C   1 
ATOM   121   O  O   . VAL A  1 16  ? -11.874 30.392  0.983   1.00 22.96 ? 16   VAL A O   1 
ATOM   122   C  CB  . VAL A  1 16  ? -13.848 32.466  1.947   1.00 25.44 ? 16   VAL A CB  1 
ATOM   123   C  CG1 . VAL A  1 16  ? -13.817 33.258  0.651   1.00 26.08 ? 16   VAL A CG1 1 
ATOM   124   C  CG2 . VAL A  1 16  ? -14.930 32.998  2.868   1.00 26.54 ? 16   VAL A CG2 1 
ATOM   125   N  N   . PHE A  1 17  ? -13.507 30.060  -0.519  1.00 22.35 ? 17   PHE A N   1 
ATOM   126   C  CA  . PHE A  1 17  ? -12.607 29.605  -1.571  1.00 21.88 ? 17   PHE A CA  1 
ATOM   127   C  C   . PHE A  1 17  ? -12.458 30.667  -2.646  1.00 23.21 ? 17   PHE A C   1 
ATOM   128   O  O   . PHE A  1 17  ? -13.438 31.236  -3.113  1.00 24.08 ? 17   PHE A O   1 
ATOM   129   C  CB  . PHE A  1 17  ? -13.083 28.300  -2.200  1.00 20.51 ? 17   PHE A CB  1 
ATOM   130   C  CG  . PHE A  1 17  ? -13.082 27.121  -1.262  1.00 19.41 ? 17   PHE A CG  1 
ATOM   131   C  CD1 . PHE A  1 17  ? -12.246 27.075  -0.158  1.00 19.47 ? 17   PHE A CD1 1 
ATOM   132   C  CD2 . PHE A  1 17  ? -13.919 26.041  -1.509  1.00 18.51 ? 17   PHE A CD2 1 
ATOM   133   C  CE1 . PHE A  1 17  ? -12.248 25.991  0.687   1.00 18.65 ? 17   PHE A CE1 1 
ATOM   134   C  CE2 . PHE A  1 17  ? -13.934 24.956  -0.660  1.00 17.74 ? 17   PHE A CE2 1 
ATOM   135   C  CZ  . PHE A  1 17  ? -13.085 24.931  0.444   1.00 17.81 ? 17   PHE A CZ  1 
ATOM   136   N  N   . GLN A  1 18  ? -11.211 30.925  -3.028  1.00 23.82 ? 18   GLN A N   1 
ATOM   137   C  CA  . GLN A  1 18  ? -10.891 31.973  -3.986  1.00 25.30 ? 18   GLN A CA  1 
ATOM   138   C  C   . GLN A  1 18  ? -10.335 31.266  -5.205  1.00 25.00 ? 18   GLN A C   1 
ATOM   139   O  O   . GLN A  1 18  ? -9.308  30.614  -5.127  1.00 24.54 ? 18   GLN A O   1 
ATOM   140   C  CB  . GLN A  1 18  ? -9.860  32.927  -3.380  1.00 26.59 ? 18   GLN A CB  1 
ATOM   141   C  CG  . GLN A  1 18  ? -10.264 33.512  -2.032  1.00 27.20 ? 18   GLN A CG  1 
ATOM   142   C  CD  . GLN A  1 18  ? -11.072 34.786  -2.158  1.00 28.78 ? 18   GLN A CD  1 
ATOM   143   O  OE1 . GLN A  1 18  ? -11.510 35.138  -3.247  1.00 29.29 ? 18   GLN A OE1 1 
ATOM   144   N  NE2 . GLN A  1 18  ? -11.256 35.497  -1.048  1.00 29.87 ? 18   GLN A NE2 1 
ATOM   145   N  N   . VAL A  1 19  ? -11.025 31.381  -6.326  1.00 25.68 ? 19   VAL A N   1 
ATOM   146   C  CA  . VAL A  1 19  ? -10.745 30.537  -7.476  1.00 25.50 ? 19   VAL A CA  1 
ATOM   147   C  C   . VAL A  1 19  ? -10.149 31.364  -8.606  1.00 27.36 ? 19   VAL A C   1 
ATOM   148   O  O   . VAL A  1 19  ? -10.654 32.436  -8.929  1.00 28.58 ? 19   VAL A O   1 
ATOM   149   C  CB  . VAL A  1 19  ? -12.031 29.834  -7.977  1.00 24.78 ? 19   VAL A CB  1 
ATOM   150   C  CG1 . VAL A  1 19  ? -11.708 28.843  -9.084  1.00 24.43 ? 19   VAL A CG1 1 
ATOM   151   C  CG2 . VAL A  1 19  ? -12.755 29.140  -6.821  1.00 23.61 ? 19   VAL A CG2 1 
ATOM   152   N  N   . GLY A  1 20  ? -9.082  30.840  -9.199  1.00 27.99 ? 20   GLY A N   1 
ATOM   153   C  CA  . GLY A  1 20  ? -8.434  31.455  -10.357 1.00 30.20 ? 20   GLY A CA  1 
ATOM   154   C  C   . GLY A  1 20  ? -8.077  30.422  -11.413 1.00 30.45 ? 20   GLY A C   1 
ATOM   155   O  O   . GLY A  1 20  ? -8.251  29.222  -11.194 1.00 28.95 ? 20   GLY A O   1 
ATOM   156   N  N   . SER A  1 21  ? -7.562  30.891  -12.552 1.00 32.55 ? 21   SER A N   1 
ATOM   157   C  CA  . SER A  1 21  ? -7.233  30.019  -13.685 1.00 32.83 ? 21   SER A CA  1 
ATOM   158   C  C   . SER A  1 21  ? -8.457  29.213  -14.121 1.00 32.13 ? 21   SER A C   1 
ATOM   159   O  O   . SER A  1 21  ? -8.353  28.014  -14.374 1.00 31.36 ? 21   SER A O   1 
ATOM   160   C  CB  . SER A  1 21  ? -6.082  29.051  -13.334 1.00 32.23 ? 21   SER A CB  1 
ATOM   161   O  OG  . SER A  1 21  ? -4.883  29.729  -12.985 1.00 33.38 ? 21   SER A OG  1 
ATOM   162   N  N   . SER A  1 22  ? -9.615  29.863  -14.189 1.00 32.56 ? 22   SER A N   1 
ATOM   163   C  CA  . SER A  1 22  ? -10.865 29.143  -14.464 1.00 32.19 ? 22   SER A CA  1 
ATOM   164   C  C   . SER A  1 22  ? -10.921 28.712  -15.928 1.00 33.52 ? 22   SER A C   1 
ATOM   165   O  O   . SER A  1 22  ? -10.270 29.312  -16.779 1.00 35.36 ? 22   SER A O   1 
ATOM   166   C  CB  . SER A  1 22  ? -12.086 30.006  -14.115 1.00 32.50 ? 22   SER A CB  1 
ATOM   167   O  OG  . SER A  1 22  ? -12.201 31.117  -14.993 1.00 34.58 ? 22   SER A OG  1 
ATOM   168   N  N   . GLY A  1 23  ? -11.694 27.671  -16.217 1.00 33.15 ? 23   GLY A N   1 
ATOM   169   C  CA  . GLY A  1 23  ? -11.859 27.203  -17.595 1.00 34.44 ? 23   GLY A CA  1 
ATOM   170   C  C   . GLY A  1 23  ? -10.592 26.560  -18.143 1.00 34.99 ? 23   GLY A C   1 
ATOM   171   O  O   . GLY A  1 23  ? -10.313 26.628  -19.343 1.00 36.77 ? 23   GLY A O   1 
ATOM   172   N  N   . SER A  1 24  ? -9.824  25.935  -17.261 1.00 33.61 ? 24   SER A N   1 
ATOM   173   C  CA  . SER A  1 24  ? -8.624  25.215  -17.662 1.00 34.08 ? 24   SER A CA  1 
ATOM   174   C  C   . SER A  1 24  ? -8.980  23.746  -17.852 1.00 33.25 ? 24   SER A C   1 
ATOM   175   O  O   . SER A  1 24  ? -10.073 23.330  -17.491 1.00 31.96 ? 24   SER A O   1 
ATOM   176   C  CB  . SER A  1 24  ? -7.525  25.359  -16.587 1.00 33.35 ? 24   SER A CB  1 
ATOM   177   O  OG  . SER A  1 24  ? -7.135  26.717  -16.388 1.00 33.94 ? 24   SER A OG  1 
ATOM   178   N  N   . GLN A  1 25  ? -8.047  22.985  -18.415 1.00 34.58 ? 25   GLN A N   1 
ATOM   179   C  CA  . GLN A  1 25  ? -8.135  21.527  -18.526 1.00 34.58 ? 25   GLN A CA  1 
ATOM   180   C  C   . GLN A  1 25  ? -7.189  20.900  -17.490 1.00 33.62 ? 25   GLN A C   1 
ATOM   181   O  O   . GLN A  1 25  ? -6.528  21.631  -16.757 1.00 32.93 ? 25   GLN A O   1 
ATOM   182   C  CB  . GLN A  1 25  ? -7.759  21.088  -19.942 1.00 36.93 ? 25   GLN A CB  1 
ATOM   183   C  CG  . GLN A  1 25  ? -8.422  21.924  -21.029 1.00 38.70 ? 25   GLN A CG  1 
ATOM   184   C  CD  . GLN A  1 25  ? -8.315  21.287  -22.405 1.00 41.22 ? 25   GLN A CD  1 
ATOM   185   O  OE1 . GLN A  1 25  ? -7.331  21.496  -23.136 1.00 43.12 ? 25   GLN A OE1 1 
ATOM   186   N  NE2 . GLN A  1 25  ? -9.334  20.504  -22.772 1.00 41.29 ? 25   GLN A NE2 1 
ATOM   187   N  N   . ARG A  1 26  ? -7.107  19.568  -17.437 1.00 33.55 ? 26   ARG A N   1 
ATOM   188   C  CA  . ARG A  1 26  ? -6.414  18.883  -16.320 1.00 32.47 ? 26   ARG A CA  1 
ATOM   189   C  C   . ARG A  1 26  ? -4.907  19.146  -16.191 1.00 33.80 ? 26   ARG A C   1 
ATOM   190   O  O   . ARG A  1 26  ? -4.332  18.884  -15.128 1.00 32.67 ? 26   ARG A O   1 
ATOM   191   C  CB  . ARG A  1 26  ? -6.658  17.356  -16.324 1.00 32.33 ? 26   ARG A CB  1 
ATOM   192   C  CG  . ARG A  1 26  ? -5.642  16.539  -17.122 1.00 33.90 ? 26   ARG A CG  1 
ATOM   193   C  CD  . ARG A  1 26  ? -5.896  15.033  -17.029 1.00 33.89 ? 26   ARG A CD  1 
ATOM   194   N  NE  . ARG A  1 26  ? -5.771  14.381  -18.335 1.00 35.44 ? 26   ARG A NE  1 
ATOM   195   C  CZ  . ARG A  1 26  ? -5.861  13.068  -18.552 1.00 35.81 ? 26   ARG A CZ  1 
ATOM   196   N  NH1 . ARG A  1 26  ? -6.057  12.215  -17.557 1.00 34.26 ? 26   ARG A NH1 1 
ATOM   197   N  NH2 . ARG A  1 26  ? -5.745  12.602  -19.792 1.00 37.87 ? 26   ARG A NH2 1 
ATOM   198   N  N   . ASP A  1 27  ? -4.265  19.658  -17.239 1.00 36.21 ? 27   ASP A N   1 
ATOM   199   C  CA  . ASP A  1 27  ? -2.825  19.955  -17.165 1.00 37.82 ? 27   ASP A CA  1 
ATOM   200   C  C   . ASP A  1 27  ? -2.483  21.294  -16.479 1.00 38.02 ? 27   ASP A C   1 
ATOM   201   O  O   . ASP A  1 27  ? -1.303  21.651  -16.362 1.00 39.54 ? 27   ASP A O   1 
ATOM   202   C  CB  . ASP A  1 27  ? -2.174  19.888  -18.557 1.00 40.38 ? 27   ASP A CB  1 
ATOM   203   C  CG  . ASP A  1 27  ? -2.756  20.885  -19.535 1.00 41.54 ? 27   ASP A CG  1 
ATOM   204   O  OD1 . ASP A  1 27  ? -3.852  21.423  -19.271 1.00 40.41 ? 27   ASP A OD1 1 
ATOM   205   O  OD2 . ASP A  1 27  ? -2.106  21.115  -20.585 1.00 44.35 ? 27   ASP A OD2 1 
ATOM   206   N  N   . VAL A  1 28  ? -3.502  22.025  -16.033 1.00 36.91 ? 28   VAL A N   1 
ATOM   207   C  CA  . VAL A  1 28  ? -3.311  23.317  -15.382 1.00 36.69 ? 28   VAL A CA  1 
ATOM   208   C  C   . VAL A  1 28  ? -2.243  23.231  -14.307 1.00 36.33 ? 28   VAL A C   1 
ATOM   209   O  O   . VAL A  1 28  ? -2.302  22.374  -13.434 1.00 35.30 ? 28   VAL A O   1 
ATOM   210   C  CB  . VAL A  1 28  ? -4.618  23.833  -14.731 1.00 35.49 ? 28   VAL A CB  1 
ATOM   211   C  CG1 . VAL A  1 28  ? -5.096  22.907  -13.611 1.00 33.60 ? 28   VAL A CG1 1 
ATOM   212   C  CG2 . VAL A  1 28  ? -4.429  25.257  -14.210 1.00 36.16 ? 28   VAL A CG2 1 
ATOM   213   N  N   . ASN A  1 29  ? -1.261  24.119  -14.393 1.00 37.67 ? 29   ASN A N   1 
ATOM   214   C  CA  . ASN A  1 29  ? -0.247  24.249  -13.365 1.00 37.50 ? 29   ASN A CA  1 
ATOM   215   C  C   . ASN A  1 29  ? -0.778  25.244  -12.348 1.00 36.18 ? 29   ASN A C   1 
ATOM   216   O  O   . ASN A  1 29  ? -0.922  26.436  -12.647 1.00 37.33 ? 29   ASN A O   1 
ATOM   217   C  CB  . ASN A  1 29  ? 1.094   24.729  -13.962 1.00 39.95 ? 29   ASN A CB  1 
ATOM   218   C  CG  . ASN A  1 29  ? 2.267   24.494  -13.024 1.00 40.40 ? 29   ASN A CG  1 
ATOM   219   O  OD1 . ASN A  1 29  ? 2.096   24.443  -11.803 1.00 39.59 ? 29   ASN A OD1 1 
ATOM   220   N  ND2 . ASN A  1 29  ? 3.457   24.333  -13.585 1.00 42.49 ? 29   ASN A ND2 1 
ATOM   221   N  N   . CYS A  1 30  ? -1.086  24.753  -11.155 1.00 33.79 ? 30   CYS A N   1 
ATOM   222   C  CA  . CYS A  1 30  ? -1.679  25.597  -10.128 1.00 32.66 ? 30   CYS A CA  1 
ATOM   223   C  C   . CYS A  1 30  ? -0.626  26.323  -9.273  1.00 34.27 ? 30   CYS A C   1 
ATOM   224   O  O   . CYS A  1 30  ? -0.968  27.201  -8.481  1.00 33.75 ? 30   CYS A O   1 
ATOM   225   C  CB  . CYS A  1 30  ? -2.633  24.782  -9.254  1.00 29.87 ? 30   CYS A CB  1 
ATOM   226   S  SG  . CYS A  1 30  ? -4.255  24.448  -10.007 1.00 28.54 ? 30   CYS A SG  1 
ATOM   227   N  N   . SER A  1 31  ? 0.645   25.969  -9.438  1.00 36.19 ? 31   SER A N   1 
ATOM   228   C  CA  . SER A  1 31  ? 1.716   26.622  -8.693  1.00 37.86 ? 31   SER A CA  1 
ATOM   229   C  C   . SER A  1 31  ? 1.989   28.033  -9.239  1.00 39.96 ? 31   SER A C   1 
ATOM   230   O  O   . SER A  1 31  ? 2.409   28.917  -8.493  1.00 41.17 ? 31   SER A O   1 
ATOM   231   C  CB  . SER A  1 31  ? 2.999   25.778  -8.731  1.00 38.86 ? 31   SER A CB  1 
ATOM   232   O  OG  . SER A  1 31  ? 3.585   25.813  -10.019 1.00 40.75 ? 31   SER A OG  1 
ATOM   233   N  N   . VAL A  1 32  ? 1.758   28.231  -10.537 1.00 40.96 ? 32   VAL A N   1 
ATOM   234   C  CA  . VAL A  1 32  ? 1.900   29.556  -11.162 1.00 42.87 ? 32   VAL A CA  1 
ATOM   235   C  C   . VAL A  1 32  ? 0.580   30.345  -11.213 1.00 42.53 ? 32   VAL A C   1 
ATOM   236   O  O   . VAL A  1 32  ? 0.483   31.327  -11.960 1.00 44.23 ? 32   VAL A O   1 
ATOM   237   C  CB  . VAL A  1 32  ? 2.499   29.463  -12.587 1.00 44.43 ? 32   VAL A CB  1 
ATOM   238   C  CG1 . VAL A  1 32  ? 3.798   28.667  -12.563 1.00 45.25 ? 32   VAL A CG1 1 
ATOM   239   C  CG2 . VAL A  1 32  ? 1.506   28.867  -13.582 1.00 43.60 ? 32   VAL A CG2 1 
ATOM   240   N  N   . MET A  1 33  ? -0.416  29.934  -10.414 1.00 40.54 ? 33   MET A N   1 
ATOM   241   C  CA  . MET A  1 33  ? -1.713  30.619  -10.370 1.00 40.10 ? 33   MET A CA  1 
ATOM   242   C  C   . MET A  1 33  ? -1.519  32.139  -10.333 1.00 41.83 ? 33   MET A C   1 
ATOM   243   O  O   . MET A  1 33  ? -0.857  32.689  -9.429  1.00 42.43 ? 33   MET A O   1 
ATOM   244   C  CB  . MET A  1 33  ? -2.544  30.173  -9.150  1.00 38.57 ? 33   MET A CB  1 
ATOM   245   C  CG  . MET A  1 33  ? -3.951  30.787  -9.083  1.00 38.51 ? 33   MET A CG  1 
ATOM   246   S  SD  . MET A  1 33  ? -5.048  30.151  -7.774  1.00 36.74 ? 33   MET A SD  1 
ATOM   247   C  CE  . MET A  1 33  ? -4.163  30.654  -6.299  1.00 36.83 ? 33   MET A CE  1 
ATOM   248   N  N   . GLY A  1 34  ? -2.088  32.809  -11.332 1.00 42.36 ? 34   GLY A N   1 
ATOM   249   C  CA  . GLY A  1 34  ? -2.084  34.263  -11.388 1.00 43.34 ? 34   GLY A CA  1 
ATOM   250   C  C   . GLY A  1 34  ? -3.232  34.813  -10.569 1.00 41.90 ? 34   GLY A C   1 
ATOM   251   O  O   . GLY A  1 34  ? -3.406  34.437  -9.403  1.00 40.53 ? 34   GLY A O   1 
ATOM   252   N  N   . PRO A  1 35  ? -4.027  35.704  -11.169 1.00 42.26 ? 35   PRO A N   1 
ATOM   253   C  CA  . PRO A  1 35  ? -5.105  36.305  -10.404 1.00 41.78 ? 35   PRO A CA  1 
ATOM   254   C  C   . PRO A  1 35  ? -6.219  35.314  -10.102 1.00 39.55 ? 35   PRO A C   1 
ATOM   255   O  O   . PRO A  1 35  ? -6.379  34.311  -10.804 1.00 38.92 ? 35   PRO A O   1 
ATOM   256   C  CB  . PRO A  1 35  ? -5.615  37.429  -11.310 1.00 43.66 ? 35   PRO A CB  1 
ATOM   257   C  CG  . PRO A  1 35  ? -5.150  37.096  -12.679 1.00 44.41 ? 35   PRO A CG  1 
ATOM   258   C  CD  . PRO A  1 35  ? -4.025  36.115  -12.581 1.00 43.81 ? 35   PRO A CD  1 
ATOM   259   N  N   . GLN A  1 36  ? -6.962  35.592  -9.042  1.00 38.54 ? 36   GLN A N   1 
ATOM   260   C  CA  . GLN A  1 36  ? -8.170  34.856  -8.727  1.00 36.59 ? 36   GLN A CA  1 
ATOM   261   C  C   . GLN A  1 36  ? -9.366  35.751  -9.074  1.00 37.44 ? 36   GLN A C   1 
ATOM   262   O  O   . GLN A  1 36  ? -9.316  36.961  -8.877  1.00 38.67 ? 36   GLN A O   1 
ATOM   263   C  CB  . GLN A  1 36  ? -8.144  34.428  -7.268  1.00 35.25 ? 36   GLN A CB  1 
ATOM   264   C  CG  . GLN A  1 36  ? -7.159  33.297  -7.031  1.00 34.29 ? 36   GLN A CG  1 
ATOM   265   C  CD  . GLN A  1 36  ? -6.559  33.281  -5.637  1.00 34.19 ? 36   GLN A CD  1 
ATOM   266   O  OE1 . GLN A  1 36  ? -6.776  32.357  -4.862  1.00 33.20 ? 36   GLN A OE1 1 
ATOM   267   N  NE2 . GLN A  1 36  ? -5.770  34.281  -5.331  1.00 35.86 ? 36   GLN A NE2 1 
ATOM   268   N  N   . GLU A  1 37  ? -10.418 35.157  -9.636  1.00 36.69 ? 37   GLU A N   1 
ATOM   269   C  CA  . GLU A  1 37  ? -11.541 35.936  -10.185 1.00 38.01 ? 37   GLU A CA  1 
ATOM   270   C  C   . GLU A  1 37  ? -12.910 35.646  -9.564  1.00 36.66 ? 37   GLU A C   1 
ATOM   271   O  O   . GLU A  1 37  ? -13.835 36.421  -9.746  1.00 37.75 ? 37   GLU A O   1 
ATOM   272   C  CB  . GLU A  1 37  ? -11.621 35.770  -11.718 1.00 39.07 ? 37   GLU A CB  1 
ATOM   273   C  CG  . GLU A  1 37  ? -11.543 34.329  -12.234 1.00 37.82 ? 37   GLU A CG  1 
ATOM   274   C  CD  . GLU A  1 37  ? -10.197 33.958  -12.868 1.00 38.65 ? 37   GLU A CD  1 
ATOM   275   O  OE1 . GLU A  1 37  ? -9.423  34.868  -13.247 1.00 40.81 ? 37   GLU A OE1 1 
ATOM   276   O  OE2 . GLU A  1 37  ? -9.918  32.740  -13.023 1.00 37.87 ? 37   GLU A OE2 1 
ATOM   277   N  N   . LYS A  1 38  ? -13.035 34.556  -8.815  1.00 34.39 ? 38   LYS A N   1 
ATOM   278   C  CA  . LYS A  1 38  ? -14.325 34.112  -8.319  1.00 33.30 ? 38   LYS A CA  1 
ATOM   279   C  C   . LYS A  1 38  ? -14.170 33.642  -6.879  1.00 31.58 ? 38   LYS A C   1 
ATOM   280   O  O   . LYS A  1 38  ? -13.145 33.044  -6.543  1.00 30.36 ? 38   LYS A O   1 
ATOM   281   C  CB  . LYS A  1 38  ? -14.819 32.967  -9.218  1.00 32.68 ? 38   LYS A CB  1 
ATOM   282   C  CG  . LYS A  1 38  ? -16.077 32.249  -8.756  1.00 32.13 ? 38   LYS A CG  1 
ATOM   283   C  CD  . LYS A  1 38  ? -17.245 33.216  -8.635  1.00 33.65 ? 38   LYS A CD  1 
ATOM   284   C  CE  . LYS A  1 38  ? -18.544 32.489  -8.327  1.00 33.36 ? 38   LYS A CE  1 
ATOM   285   N  NZ  . LYS A  1 38  ? -19.665 33.470  -8.196  1.00 35.20 ? 38   LYS A NZ  1 
ATOM   286   N  N   . LYS A  1 39  ? -15.169 33.915  -6.033  1.00 31.14 ? 39   LYS A N   1 
ATOM   287   C  CA  . LYS A  1 39  ? -15.212 33.339  -4.689  1.00 29.65 ? 39   LYS A CA  1 
ATOM   288   C  C   . LYS A  1 39  ? -16.426 32.423  -4.466  1.00 28.38 ? 39   LYS A C   1 
ATOM   289   O  O   . LYS A  1 39  ? -17.496 32.630  -5.047  1.00 29.17 ? 39   LYS A O   1 
ATOM   290   C  CB  . LYS A  1 39  ? -15.127 34.421  -3.596  1.00 31.18 ? 39   LYS A CB  1 
ATOM   291   C  CG  . LYS A  1 39  ? -16.439 35.066  -3.154  1.00 32.44 ? 39   LYS A CG  1 
ATOM   292   C  CD  . LYS A  1 39  ? -16.369 35.518  -1.691  1.00 33.34 ? 39   LYS A CD  1 
ATOM   293   C  CE  . LYS A  1 39  ? -17.633 36.256  -1.265  1.00 34.99 ? 39   LYS A CE  1 
ATOM   294   N  NZ  . LYS A  1 39  ? -17.636 36.631  0.188   1.00 36.03 ? 39   LYS A NZ  1 
ATOM   295   N  N   . VAL A  1 40  ? -16.230 31.418  -3.611  1.00 26.55 ? 40   VAL A N   1 
ATOM   296   C  CA  . VAL A  1 40  ? -17.243 30.429  -3.267  1.00 25.35 ? 40   VAL A CA  1 
ATOM   297   C  C   . VAL A  1 40  ? -17.213 30.195  -1.762  1.00 24.77 ? 40   VAL A C   1 
ATOM   298   O  O   . VAL A  1 40  ? -16.157 29.893  -1.207  1.00 24.08 ? 40   VAL A O   1 
ATOM   299   C  CB  . VAL A  1 40  ? -16.964 29.077  -3.959  1.00 24.01 ? 40   VAL A CB  1 
ATOM   300   C  CG1 . VAL A  1 40  ? -18.057 28.065  -3.620  1.00 23.36 ? 40   VAL A CG1 1 
ATOM   301   C  CG2 . VAL A  1 40  ? -16.824 29.247  -5.469  1.00 24.48 ? 40   VAL A CG2 1 
ATOM   302   N  N   . VAL A  1 41  ? -18.363 30.325  -1.105  1.00 25.01 ? 41   VAL A N   1 
ATOM   303   C  CA  . VAL A  1 41  ? -18.477 29.986  0.314   1.00 24.71 ? 41   VAL A CA  1 
ATOM   304   C  C   . VAL A  1 41  ? -19.031 28.570  0.525   1.00 23.25 ? 41   VAL A C   1 
ATOM   305   O  O   . VAL A  1 41  ? -20.066 28.204  -0.013  1.00 23.23 ? 41   VAL A O   1 
ATOM   306   C  CB  . VAL A  1 41  ? -19.345 30.990  1.079   1.00 26.43 ? 41   VAL A CB  1 
ATOM   307   C  CG1 . VAL A  1 41  ? -19.326 30.676  2.573   1.00 26.52 ? 41   VAL A CG1 1 
ATOM   308   C  CG2 . VAL A  1 41  ? -18.836 32.403  0.840   1.00 27.90 ? 41   VAL A CG2 1 
ATOM   309   N  N   . VAL A  1 42  ? -18.317 27.798  1.325   1.00 22.19 ? 42   VAL A N   1 
ATOM   310   C  CA  . VAL A  1 42  ? -18.660 26.430  1.653   1.00 21.09 ? 42   VAL A CA  1 
ATOM   311   C  C   . VAL A  1 42  ? -18.719 26.274  3.180   1.00 21.34 ? 42   VAL A C   1 
ATOM   312   O  O   . VAL A  1 42  ? -17.901 26.847  3.902   1.00 21.74 ? 42   VAL A O   1 
ATOM   313   C  CB  . VAL A  1 42  ? -17.606 25.469  1.079   1.00 19.81 ? 42   VAL A CB  1 
ATOM   314   C  CG1 . VAL A  1 42  ? -17.990 24.025  1.333   1.00 18.98 ? 42   VAL A CG1 1 
ATOM   315   C  CG2 . VAL A  1 42  ? -17.457 25.700  -0.414  1.00 19.79 ? 42   VAL A CG2 1 
ATOM   316   N  N   . TYR A  1 43  ? -19.695 25.512  3.661   1.00 21.20 ? 43   TYR A N   1 
ATOM   317   C  CA  . TYR A  1 43  ? -19.860 25.263  5.092   1.00 21.65 ? 43   TYR A CA  1 
ATOM   318   C  C   . TYR A  1 43  ? -19.663 23.778  5.326   1.00 20.57 ? 43   TYR A C   1 
ATOM   319   O  O   . TYR A  1 43  ? -20.209 22.962  4.598   1.00 20.05 ? 43   TYR A O   1 
ATOM   320   C  CB  . TYR A  1 43  ? -21.249 25.674  5.579   1.00 22.91 ? 43   TYR A CB  1 
ATOM   321   C  CG  . TYR A  1 43  ? -21.638 27.089  5.249   1.00 24.15 ? 43   TYR A CG  1 
ATOM   322   C  CD1 . TYR A  1 43  ? -21.307 28.141  6.090   1.00 25.43 ? 43   TYR A CD1 1 
ATOM   323   C  CD2 . TYR A  1 43  ? -22.352 27.374  4.100   1.00 24.29 ? 43   TYR A CD2 1 
ATOM   324   C  CE1 . TYR A  1 43  ? -21.667 29.444  5.787   1.00 26.77 ? 43   TYR A CE1 1 
ATOM   325   C  CE2 . TYR A  1 43  ? -22.718 28.668  3.783   1.00 25.60 ? 43   TYR A CE2 1 
ATOM   326   C  CZ  . TYR A  1 43  ? -22.378 29.704  4.631   1.00 26.85 ? 43   TYR A CZ  1 
ATOM   327   O  OH  . TYR A  1 43  ? -22.755 30.986  4.303   1.00 28.33 ? 43   TYR A OH  1 
ATOM   328   N  N   . LEU A  1 44  ? -18.882 23.439  6.343   1.00 20.48 ? 44   LEU A N   1 
ATOM   329   C  CA  . LEU A  1 44  ? -18.618 22.060  6.679   1.00 19.72 ? 44   LEU A CA  1 
ATOM   330   C  C   . LEU A  1 44  ? -19.154 21.779  8.085   1.00 20.84 ? 44   LEU A C   1 
ATOM   331   O  O   . LEU A  1 44  ? -18.734 22.399  9.063   1.00 21.68 ? 44   LEU A O   1 
ATOM   332   C  CB  . LEU A  1 44  ? -17.123 21.771  6.577   1.00 18.87 ? 44   LEU A CB  1 
ATOM   333   C  CG  . LEU A  1 44  ? -16.454 22.149  5.244   1.00 18.16 ? 44   LEU A CG  1 
ATOM   334   C  CD1 . LEU A  1 44  ? -14.969 21.817  5.264   1.00 17.66 ? 44   LEU A CD1 1 
ATOM   335   C  CD2 . LEU A  1 44  ? -17.133 21.459  4.063   1.00 17.45 ? 44   LEU A CD2 1 
ATOM   336   N  N   . GLN A  1 45  ? -20.112 20.860  8.169   1.00 21.09 ? 45   GLN A N   1 
ATOM   337   C  CA  . GLN A  1 45  ? -20.659 20.424  9.446   1.00 22.28 ? 45   GLN A CA  1 
ATOM   338   C  C   . GLN A  1 45  ? -20.426 18.925  9.618   1.00 21.66 ? 45   GLN A C   1 
ATOM   339   O  O   . GLN A  1 45  ? -20.366 18.169  8.627   1.00 20.43 ? 45   GLN A O   1 
ATOM   340   C  CB  . GLN A  1 45  ? -22.139 20.744  9.524   1.00 23.58 ? 45   GLN A CB  1 
ATOM   341   C  CG  . GLN A  1 45  ? -22.455 22.192  9.219   1.00 24.54 ? 45   GLN A CG  1 
ATOM   342   C  CD  . GLN A  1 45  ? -23.943 22.483  9.157   1.00 26.20 ? 45   GLN A CD  1 
ATOM   343   O  OE1 . GLN A  1 45  ? -24.788 21.589  9.252   1.00 26.49 ? 45   GLN A OE1 1 
ATOM   344   N  NE2 . GLN A  1 45  ? -24.275 23.755  9.013   1.00 27.55 ? 45   GLN A NE2 1 
ATOM   345   N  N   . LYS A  1 46  ? -20.287 18.511  10.878  1.00 22.54 ? 46   LYS A N   1 
ATOM   346   C  CA  . LYS A  1 46  ? -20.065 17.106  11.202  1.00 22.33 ? 46   LYS A CA  1 
ATOM   347   C  C   . LYS A  1 46  ? -21.328 16.306  10.879  1.00 22.51 ? 46   LYS A C   1 
ATOM   348   O  O   . LYS A  1 46  ? -22.412 16.837  10.993  1.00 23.40 ? 46   LYS A O   1 
ATOM   349   C  CB  . LYS A  1 46  ? -19.626 16.926  12.666  1.00 23.57 ? 46   LYS A CB  1 
ATOM   350   C  CG  . LYS A  1 46  ? -20.540 17.534  13.727  1.00 25.50 ? 46   LYS A CG  1 
ATOM   351   C  CD  . LYS A  1 46  ? -21.635 16.584  14.149  1.00 26.58 ? 46   LYS A CD  1 
ATOM   352   C  CE  . LYS A  1 46  ? -22.354 17.098  15.373  1.00 28.97 ? 46   LYS A CE  1 
ATOM   353   N  NZ  . LYS A  1 46  ? -23.486 16.191  15.698  1.00 30.16 ? 46   LYS A NZ  1 
ATOM   354   N  N   . LEU A  1 47  ? -21.207 15.048  10.455  1.00 21.78 ? 47   LEU A N   1 
ATOM   355   C  CA  . LEU A  1 47  ? -19.942 14.303  10.358  1.00 20.86 ? 47   LEU A CA  1 
ATOM   356   C  C   . LEU A  1 47  ? -19.240 14.466  9.028   1.00 19.54 ? 47   LEU A C   1 
ATOM   357   O  O   . LEU A  1 47  ? -18.015 14.405  8.968   1.00 18.94 ? 47   LEU A O   1 
ATOM   358   C  CB  . LEU A  1 47  ? -20.202 12.816  10.560  1.00 21.13 ? 47   LEU A CB  1 
ATOM   359   C  CG  . LEU A  1 47  ? -20.643 12.391  11.953  1.00 22.55 ? 47   LEU A CG  1 
ATOM   360   C  CD1 . LEU A  1 47  ? -21.168 10.972  11.914  1.00 23.03 ? 47   LEU A CD1 1 
ATOM   361   C  CD2 . LEU A  1 47  ? -19.476 12.507  12.923  1.00 22.77 ? 47   LEU A CD2 1 
ATOM   362   N  N   . ASP A  1 48  ? -19.998 14.632  7.953   1.00 19.25 ? 48   ASP A N   1 
ATOM   363   C  CA  . ASP A  1 48  ? -19.392 14.770  6.625   1.00 18.28 ? 48   ASP A CA  1 
ATOM   364   C  C   . ASP A  1 48  ? -20.248 15.568  5.635   1.00 18.25 ? 48   ASP A C   1 
ATOM   365   O  O   . ASP A  1 48  ? -20.265 15.275  4.461   1.00 17.74 ? 48   ASP A O   1 
ATOM   366   C  CB  . ASP A  1 48  ? -19.074 13.377  6.063   1.00 17.92 ? 48   ASP A CB  1 
ATOM   367   C  CG  . ASP A  1 48  ? -20.318 12.607  5.635   1.00 18.54 ? 48   ASP A CG  1 
ATOM   368   O  OD1 . ASP A  1 48  ? -21.380 12.691  6.305   1.00 19.58 ? 48   ASP A OD1 1 
ATOM   369   O  OD2 . ASP A  1 48  ? -20.224 11.902  4.618   1.00 18.51 ? 48   ASP A OD2 1 
ATOM   370   N  N   . THR A  1 49  ? -20.941 16.581  6.124   1.00 19.05 ? 49   THR A N   1 
ATOM   371   C  CA  . THR A  1 49  ? -21.849 17.384  5.316   1.00 19.46 ? 49   THR A CA  1 
ATOM   372   C  C   . THR A  1 49  ? -21.223 18.715  4.889   1.00 19.33 ? 49   THR A C   1 
ATOM   373   O  O   . THR A  1 49  ? -20.739 19.487  5.718   1.00 19.53 ? 49   THR A O   1 
ATOM   374   C  CB  . THR A  1 49  ? -23.137 17.674  6.108   1.00 20.80 ? 49   THR A CB  1 
ATOM   375   O  OG1 . THR A  1 49  ? -23.793 16.441  6.419   1.00 21.24 ? 49   THR A OG1 1 
ATOM   376   C  CG2 . THR A  1 49  ? -24.072 18.555  5.309   1.00 21.39 ? 49   THR A CG2 1 
ATOM   377   N  N   . ALA A  1 50  ? -21.238 18.963  3.581   1.00 19.19 ? 50   ALA A N   1 
ATOM   378   C  CA  . ALA A  1 50  ? -20.820 20.236  3.004   1.00 19.41 ? 50   ALA A CA  1 
ATOM   379   C  C   . ALA A  1 50  ? -22.046 20.911  2.406   1.00 20.74 ? 50   ALA A C   1 
ATOM   380   O  O   . ALA A  1 50  ? -22.904 20.235  1.840   1.00 21.06 ? 50   ALA A O   1 
ATOM   381   C  CB  . ALA A  1 50  ? -19.773 20.005  1.926   1.00 18.51 ? 50   ALA A CB  1 
ATOM   382   N  N   . TYR A  1 51  ? -22.157 22.228  2.547   1.00 22.03 ? 51   TYR A N   1 
ATOM   383   C  CA  . TYR A  1 51  ? -23.173 22.956  1.790   1.00 23.53 ? 51   TYR A CA  1 
ATOM   384   C  C   . TYR A  1 51  ? -22.770 24.367  1.381   1.00 24.58 ? 51   TYR A C   1 
ATOM   385   O  O   . TYR A  1 51  ? -21.751 24.892  1.842   1.00 24.02 ? 51   TYR A O   1 
ATOM   386   C  CB  . TYR A  1 51  ? -24.552 22.893  2.473   1.00 24.80 ? 51   TYR A CB  1 
ATOM   387   C  CG  . TYR A  1 51  ? -24.749 23.745  3.692   1.00 26.06 ? 51   TYR A CG  1 
ATOM   388   C  CD1 . TYR A  1 51  ? -24.306 23.333  4.932   1.00 26.08 ? 51   TYR A CD1 1 
ATOM   389   C  CD2 . TYR A  1 51  ? -25.426 24.960  3.608   1.00 27.78 ? 51   TYR A CD2 1 
ATOM   390   C  CE1 . TYR A  1 51  ? -24.505 24.117  6.056   1.00 27.41 ? 51   TYR A CE1 1 
ATOM   391   C  CE2 . TYR A  1 51  ? -25.642 25.752  4.722   1.00 29.12 ? 51   TYR A CE2 1 
ATOM   392   C  CZ  . TYR A  1 51  ? -25.178 25.333  5.953   1.00 29.11 ? 51   TYR A CZ  1 
ATOM   393   O  OH  . TYR A  1 51  ? -25.395 26.139  7.069   1.00 30.96 ? 51   TYR A OH  1 
ATOM   394   N  N   . ASP A  1 52  ? -23.535 24.933  0.447   1.00 26.44 ? 52   ASP A N   1 
ATOM   395   C  CA  . ASP A  1 52  ? -23.296 26.284  -0.078  1.00 28.05 ? 52   ASP A CA  1 
ATOM   396   C  C   . ASP A  1 52  ? -24.468 27.208  0.257   1.00 30.75 ? 52   ASP A C   1 
ATOM   397   O  O   . ASP A  1 52  ? -25.444 26.769  0.852   1.00 31.33 ? 52   ASP A O   1 
ATOM   398   C  CB  . ASP A  1 52  ? -23.022 26.241  -1.585  1.00 27.95 ? 52   ASP A CB  1 
ATOM   399   C  CG  . ASP A  1 52  ? -24.217 25.751  -2.411  1.00 28.54 ? 52   ASP A CG  1 
ATOM   400   O  OD1 . ASP A  1 52  ? -25.363 25.630  -1.890  1.00 30.37 ? 52   ASP A OD1 1 
ATOM   401   O  OD2 . ASP A  1 52  ? -24.009 25.483  -3.622  1.00 28.45 ? 52   ASP A OD2 1 
ATOM   402   N  N   . ASP A  1 53  ? -24.380 28.477  -0.130  1.00 33.16 ? 53   ASP A N   1 
ATOM   403   C  CA  . ASP A  1 53  ? -25.415 29.478  0.227   1.00 35.97 ? 53   ASP A CA  1 
ATOM   404   C  C   . ASP A  1 53  ? -26.776 29.165  -0.382  1.00 36.81 ? 53   ASP A C   1 
ATOM   405   O  O   . ASP A  1 53  ? -27.815 29.445  0.224   1.00 38.50 ? 53   ASP A O   1 
ATOM   406   C  CB  . ASP A  1 53  ? -24.983 30.893  -0.184  1.00 37.47 ? 53   ASP A CB  1 
ATOM   407   C  CG  . ASP A  1 53  ? -23.595 31.233  0.305   1.00 37.37 ? 53   ASP A CG  1 
ATOM   408   O  OD1 . ASP A  1 53  ? -22.695 30.372  0.144   1.00 36.54 ? 53   ASP A OD1 1 
ATOM   409   O  OD2 . ASP A  1 53  ? -23.395 32.333  0.855   1.00 39.32 ? 53   ASP A OD2 1 
ATOM   410   N  N   . LEU A  1 54  ? -26.765 28.557  -1.571  1.00 36.30 ? 54   LEU A N   1 
ATOM   411   C  CA  . LEU A  1 54  ? -28.005 28.111  -2.233  1.00 36.90 ? 54   LEU A CA  1 
ATOM   412   C  C   . LEU A  1 54  ? -28.692 26.956  -1.519  1.00 36.61 ? 54   LEU A C   1 
ATOM   413   O  O   . LEU A  1 54  ? -29.857 26.646  -1.809  1.00 38.34 ? 54   LEU A O   1 
ATOM   414   C  CB  . LEU A  1 54  ? -27.725 27.728  -3.685  1.00 36.07 ? 54   LEU A CB  1 
ATOM   415   C  CG  . LEU A  1 54  ? -27.232 28.925  -4.498  1.00 36.86 ? 54   LEU A CG  1 
ATOM   416   C  CD1 . LEU A  1 54  ? -26.846 28.513  -5.903  1.00 36.39 ? 54   LEU A CD1 1 
ATOM   417   C  CD2 . LEU A  1 54  ? -28.292 30.021  -4.530  1.00 39.10 ? 54   LEU A CD2 1 
ATOM   418   N  N   . GLY A  1 55  ? -27.976 26.310  -0.602  1.00 34.77 ? 55   GLY A N   1 
ATOM   419   C  CA  . GLY A  1 55  ? -28.549 25.224  0.192   1.00 34.45 ? 55   GLY A CA  1 
ATOM   420   C  C   . GLY A  1 55  ? -28.470 23.880  -0.511  1.00 32.56 ? 55   GLY A C   1 
ATOM   421   O  O   . GLY A  1 55  ? -29.274 23.000  -0.213  1.00 32.96 ? 55   GLY A O   1 
ATOM   422   N  N   . ASN A  1 56  ? -27.523 23.744  -1.455  1.00 30.25 ? 56   ASN A N   1 
ATOM   423   C  CA  . ASN A  1 56  ? -27.162 22.446  -2.043  1.00 28.41 ? 56   ASN A CA  1 
ATOM   424   C  C   . ASN A  1 56  ? -26.276 21.686  -1.068  1.00 26.49 ? 56   ASN A C   1 
ATOM   425   O  O   . ASN A  1 56  ? -25.343 22.274  -0.505  1.00 25.29 ? 56   ASN A O   1 
ATOM   426   C  CB  . ASN A  1 56  ? -26.309 22.614  -3.305  1.00 27.68 ? 56   ASN A CB  1 
ATOM   427   C  CG  . ASN A  1 56  ? -27.011 23.372  -4.419  1.00 28.98 ? 56   ASN A CG  1 
ATOM   428   O  OD1 . ASN A  1 56  ? -28.122 23.046  -4.803  1.00 30.26 ? 56   ASN A OD1 1 
ATOM   429   N  ND2 . ASN A  1 56  ? -26.330 24.373  -4.970  1.00 29.12 ? 56   ASN A ND2 1 
ATOM   430   N  N   . SER A  1 57  ? -26.517 20.386  -0.898  1.00 25.29 ? 57   SER A N   1 
ATOM   431   C  CA  . SER A  1 57  ? -25.667 19.593  -0.020  1.00 23.73 ? 57   SER A CA  1 
ATOM   432   C  C   . SER A  1 57  ? -24.664 18.705  -0.773  1.00 22.01 ? 57   SER A C   1 
ATOM   433   O  O   . SER A  1 57  ? -24.801 18.426  -1.971  1.00 21.99 ? 57   SER A O   1 
ATOM   434   C  CB  . SER A  1 57  ? -26.496 18.777  0.965   1.00 24.49 ? 57   SER A CB  1 
ATOM   435   O  OG  . SER A  1 57  ? -27.187 17.730  0.310   1.00 25.35 ? 57   SER A OG  1 
ATOM   436   N  N   . GLY A  1 58  ? -23.634 18.308  -0.035  1.00 20.41 ? 58   GLY A N   1 
ATOM   437   C  CA  . GLY A  1 58  ? -22.615 17.421  -0.504  1.00 18.99 ? 58   GLY A CA  1 
ATOM   438   C  C   . GLY A  1 58  ? -21.886 16.856  0.691   1.00 18.12 ? 58   GLY A C   1 
ATOM   439   O  O   . GLY A  1 58  ? -22.406 16.842  1.810   1.00 18.46 ? 58   GLY A O   1 
ATOM   440   N  N   . HIS A  1 59  ? -20.660 16.413  0.456   1.00 17.01 ? 59   HIS A N   1 
ATOM   441   C  CA  . HIS A  1 59  ? -19.906 15.692  1.455   1.00 16.49 ? 59   HIS A CA  1 
ATOM   442   C  C   . HIS A  1 59  ? -18.460 16.113  1.498   1.00 15.61 ? 59   HIS A C   1 
ATOM   443   O  O   . HIS A  1 59  ? -17.953 16.714  0.565   1.00 15.29 ? 59   HIS A O   1 
ATOM   444   C  CB  . HIS A  1 59  ? -19.991 14.191  1.176   1.00 16.58 ? 59   HIS A CB  1 
ATOM   445   C  CG  . HIS A  1 59  ? -21.383 13.654  1.231   1.00 17.48 ? 59   HIS A CG  1 
ATOM   446   N  ND1 . HIS A  1 59  ? -22.188 13.560  0.114   1.00 17.97 ? 59   HIS A ND1 1 
ATOM   447   C  CD2 . HIS A  1 59  ? -22.124 13.203  2.271   1.00 18.19 ? 59   HIS A CD2 1 
ATOM   448   C  CE1 . HIS A  1 59  ? -23.364 13.064  0.460   1.00 18.92 ? 59   HIS A CE1 1 
ATOM   449   N  NE2 . HIS A  1 59  ? -23.351 12.834  1.764   1.00 19.09 ? 59   HIS A NE2 1 
ATOM   450   N  N   . PHE A  1 60  ? -17.799 15.785  2.599   1.00 15.32 ? 60   PHE A N   1 
ATOM   451   C  CA  . PHE A  1 60  ? -16.378 16.068  2.745   1.00 14.84 ? 60   PHE A CA  1 
ATOM   452   C  C   . PHE A  1 60  ? -15.707 15.078  3.665   1.00 14.80 ? 60   PHE A C   1 
ATOM   453   O  O   . PHE A  1 60  ? -16.341 14.401  4.490   1.00 15.23 ? 60   PHE A O   1 
ATOM   454   C  CB  . PHE A  1 60  ? -16.132 17.479  3.275   1.00 15.06 ? 60   PHE A CB  1 
ATOM   455   C  CG  . PHE A  1 60  ? -16.353 17.618  4.740   1.00 15.61 ? 60   PHE A CG  1 
ATOM   456   C  CD1 . PHE A  1 60  ? -17.602 17.933  5.235   1.00 16.27 ? 60   PHE A CD1 1 
ATOM   457   C  CD2 . PHE A  1 60  ? -15.310 17.417  5.638   1.00 15.70 ? 60   PHE A CD2 1 
ATOM   458   C  CE1 . PHE A  1 60  ? -17.807 18.045  6.598   1.00 17.07 ? 60   PHE A CE1 1 
ATOM   459   C  CE2 . PHE A  1 60  ? -15.516 17.519  7.000   1.00 16.42 ? 60   PHE A CE2 1 
ATOM   460   C  CZ  . PHE A  1 60  ? -16.763 17.840  7.480   1.00 17.09 ? 60   PHE A CZ  1 
ATOM   461   N  N   . THR A  1 61  ? -14.402 14.985  3.496   1.00 14.47 ? 61   THR A N   1 
ATOM   462   C  CA  . THR A  1 61  ? -13.602 14.228  4.418   1.00 14.65 ? 61   THR A CA  1 
ATOM   463   C  C   . THR A  1 61  ? -12.298 14.958  4.638   1.00 14.74 ? 61   THR A C   1 
ATOM   464   O  O   . THR A  1 61  ? -11.820 15.647  3.740   1.00 14.47 ? 61   THR A O   1 
ATOM   465   C  CB  . THR A  1 61  ? -13.371 12.798  3.924   1.00 14.53 ? 61   THR A CB  1 
ATOM   466   O  OG1 . THR A  1 61  ? -12.598 12.090  4.902   1.00 14.87 ? 61   THR A OG1 1 
ATOM   467   C  CG2 . THR A  1 61  ? -12.672 12.781  2.557   1.00 14.24 ? 61   THR A CG2 1 
ATOM   468   N  N   . ILE A  1 62  ? -11.772 14.864  5.859   1.00 15.28 ? 62   ILE A N   1 
ATOM   469   C  CA  . ILE A  1 62  ? -10.394 15.258  6.089   1.00 15.63 ? 62   ILE A CA  1 
ATOM   470   C  C   . ILE A  1 62  ? -9.554  14.085  5.608   1.00 15.59 ? 62   ILE A C   1 
ATOM   471   O  O   . ILE A  1 62  ? -10.012 12.950  5.620   1.00 15.54 ? 62   ILE A O   1 
ATOM   472   C  CB  . ILE A  1 62  ? -10.085 15.666  7.560   1.00 16.50 ? 62   ILE A CB  1 
ATOM   473   C  CG1 . ILE A  1 62  ? -8.725  16.374  7.632   1.00 16.95 ? 62   ILE A CG1 1 
ATOM   474   C  CG2 . ILE A  1 62  ? -10.128 14.482  8.520   1.00 16.97 ? 62   ILE A CG2 1 
ATOM   475   C  CD1 . ILE A  1 62  ? -8.370  16.902  9.004   1.00 18.02 ? 62   ILE A CD1 1 
ATOM   476   N  N   . ILE A  1 63  ? -8.360  14.380  5.115   1.00 15.80 ? 63   ILE A N   1 
ATOM   477   C  CA  . ILE A  1 63  ? -7.428  13.365  4.659   1.00 16.10 ? 63   ILE A CA  1 
ATOM   478   C  C   . ILE A  1 63  ? -6.323  13.323  5.701   1.00 17.08 ? 63   ILE A C   1 
ATOM   479   O  O   . ILE A  1 63  ? -5.431  14.177  5.723   1.00 17.58 ? 63   ILE A O   1 
ATOM   480   C  CB  . ILE A  1 63  ? -6.945  13.692  3.223   1.00 15.90 ? 63   ILE A CB  1 
ATOM   481   C  CG1 . ILE A  1 63  ? -8.073  13.399  2.235   1.00 15.34 ? 63   ILE A CG1 1 
ATOM   482   C  CG2 . ILE A  1 63  ? -5.701  12.899  2.843   1.00 16.49 ? 63   ILE A CG2 1 
ATOM   483   C  CD1 . ILE A  1 63  ? -8.202  14.422  1.129   1.00 15.15 ? 63   ILE A CD1 1 
ATOM   484   N  N   . TYR A  1 64  ? -6.417  12.345  6.594   1.00 17.72 ? 64   TYR A N   1 
ATOM   485   C  CA  . TYR A  1 64  ? -5.532  12.242  7.749   1.00 19.00 ? 64   TYR A CA  1 
ATOM   486   C  C   . TYR A  1 64  ? -5.462  13.617  8.459   1.00 19.52 ? 64   TYR A C   1 
ATOM   487   O  O   . TYR A  1 64  ? -6.473  14.082  8.957   1.00 19.76 ? 64   TYR A O   1 
ATOM   488   C  CB  . TYR A  1 64  ? -4.180  11.694  7.293   1.00 19.65 ? 64   TYR A CB  1 
ATOM   489   C  CG  . TYR A  1 64  ? -3.224  11.267  8.381   1.00 21.03 ? 64   TYR A CG  1 
ATOM   490   C  CD1 . TYR A  1 64  ? -3.606  10.379  9.374   1.00 21.57 ? 64   TYR A CD1 1 
ATOM   491   C  CD2 . TYR A  1 64  ? -1.902  11.706  8.373   1.00 21.99 ? 64   TYR A CD2 1 
ATOM   492   C  CE1 . TYR A  1 64  ? -2.710  9.969   10.352  1.00 23.10 ? 64   TYR A CE1 1 
ATOM   493   C  CE2 . TYR A  1 64  ? -1.000  11.301  9.337   1.00 23.33 ? 64   TYR A CE2 1 
ATOM   494   C  CZ  . TYR A  1 64  ? -1.402  10.435  10.326  1.00 23.94 ? 64   TYR A CZ  1 
ATOM   495   O  OH  . TYR A  1 64  ? -0.487  10.045  11.284  1.00 25.46 ? 64   TYR A OH  1 
ATOM   496   N  N   . ASN A  1 65  ? -4.303  14.270  8.466   1.00 20.32 ? 65   ASN A N   1 
ATOM   497   C  CA  . ASN A  1 65  ? -4.128  15.601  9.050   1.00 21.01 ? 65   ASN A CA  1 
ATOM   498   C  C   . ASN A  1 65  ? -3.600  16.614  8.023   1.00 20.77 ? 65   ASN A C   1 
ATOM   499   O  O   . ASN A  1 65  ? -3.111  17.668  8.387   1.00 21.56 ? 65   ASN A O   1 
ATOM   500   C  CB  . ASN A  1 65  ? -3.141  15.514  10.215  1.00 22.54 ? 65   ASN A CB  1 
ATOM   501   C  CG  . ASN A  1 65  ? -1.774  14.978  9.794   1.00 23.16 ? 65   ASN A CG  1 
ATOM   502   O  OD1 . ASN A  1 65  ? -1.477  14.866  8.609   1.00 22.45 ? 65   ASN A OD1 1 
ATOM   503   N  ND2 . ASN A  1 65  ? -0.945  14.642  10.768  1.00 24.29 ? 65   ASN A ND2 1 
ATOM   504   N  N   . GLN A  1 66  ? -3.729  16.288  6.742   1.00 19.83 ? 66   GLN A N   1 
ATOM   505   C  CA  . GLN A  1 66  ? -2.976  16.944  5.673   1.00 19.91 ? 66   GLN A CA  1 
ATOM   506   C  C   . GLN A  1 66  ? -3.762  17.951  4.871   1.00 19.10 ? 66   GLN A C   1 
ATOM   507   O  O   . GLN A  1 66  ? -3.224  18.974  4.442   1.00 19.54 ? 66   GLN A O   1 
ATOM   508   C  CB  . GLN A  1 66  ? -2.503  15.891  4.687   1.00 19.86 ? 66   GLN A CB  1 
ATOM   509   C  CG  . GLN A  1 66  ? -1.543  14.892  5.274   1.00 20.80 ? 66   GLN A CG  1 
ATOM   510   C  CD  . GLN A  1 66  ? -0.143  15.449  5.314   1.00 22.16 ? 66   GLN A CD  1 
ATOM   511   O  OE1 . GLN A  1 66  ? 0.440   15.728  4.272   1.00 22.69 ? 66   GLN A OE1 1 
ATOM   512   N  NE2 . GLN A  1 66  ? 0.397   15.622  6.510   1.00 23.11 ? 66   GLN A NE2 1 
ATOM   513   N  N   . GLY A  1 67  ? -5.029  17.623  4.639   1.00 18.02 ? 67   GLY A N   1 
ATOM   514   C  CA  . GLY A  1 67  ? -5.892  18.386  3.749   1.00 17.31 ? 67   GLY A CA  1 
ATOM   515   C  C   . GLY A  1 67  ? -7.291  17.832  3.821   1.00 16.42 ? 67   GLY A C   1 
ATOM   516   O  O   . GLY A  1 67  ? -7.592  17.082  4.731   1.00 16.34 ? 67   GLY A O   1 
ATOM   517   N  N   . PHE A  1 68  ? -8.129  18.204  2.856   1.00 15.90 ? 68   PHE A N   1 
ATOM   518   C  CA  . PHE A  1 68  ? -9.539  17.779  2.794   1.00 15.35 ? 68   PHE A CA  1 
ATOM   519   C  C   . PHE A  1 68  ? -9.946  17.553  1.336   1.00 14.91 ? 68   PHE A C   1 
ATOM   520   O  O   . PHE A  1 68  ? -9.303  18.077  0.423   1.00 15.11 ? 68   PHE A O   1 
ATOM   521   C  CB  . PHE A  1 68  ? -10.453 18.853  3.425   1.00 15.67 ? 68   PHE A CB  1 
ATOM   522   C  CG  . PHE A  1 68  ? -10.266 20.224  2.832   1.00 16.11 ? 68   PHE A CG  1 
ATOM   523   C  CD1 . PHE A  1 68  ? -10.757 20.524  1.562   1.00 15.97 ? 68   PHE A CD1 1 
ATOM   524   C  CD2 . PHE A  1 68  ? -9.544  21.186  3.501   1.00 16.98 ? 68   PHE A CD2 1 
ATOM   525   C  CE1 . PHE A  1 68  ? -10.535 21.769  0.984   1.00 16.57 ? 68   PHE A CE1 1 
ATOM   526   C  CE2 . PHE A  1 68  ? -9.342  22.438  2.947   1.00 17.56 ? 68   PHE A CE2 1 
ATOM   527   C  CZ  . PHE A  1 68  ? -9.830  22.732  1.685   1.00 17.32 ? 68   PHE A CZ  1 
ATOM   528   N  N   . GLU A  1 69  ? -10.985 16.754  1.105   1.00 14.49 ? 69   GLU A N   1 
ATOM   529   C  CA  . GLU A  1 69  ? -11.690 16.775  -0.173  1.00 14.28 ? 69   GLU A CA  1 
ATOM   530   C  C   . GLU A  1 69  ? -13.179 17.045  0.050   1.00 14.21 ? 69   GLU A C   1 
ATOM   531   O  O   . GLU A  1 69  ? -13.791 16.458  0.928   1.00 14.15 ? 69   GLU A O   1 
ATOM   532   C  CB  . GLU A  1 69  ? -11.510 15.483  -0.983  1.00 14.29 ? 69   GLU A CB  1 
ATOM   533   C  CG  . GLU A  1 69  ? -12.052 15.673  -2.404  1.00 14.48 ? 69   GLU A CG  1 
ATOM   534   C  CD  . GLU A  1 69  ? -11.962 14.464  -3.300  1.00 14.82 ? 69   GLU A CD  1 
ATOM   535   O  OE1 . GLU A  1 69  ? -12.557 13.417  -2.955  1.00 14.85 ? 69   GLU A OE1 1 
ATOM   536   O  OE2 . GLU A  1 69  ? -11.309 14.580  -4.373  1.00 15.32 ? 69   GLU A OE2 1 
ATOM   537   N  N   . ILE A  1 70  ? -13.742 17.943  -0.763  1.00 14.35 ? 70   ILE A N   1 
ATOM   538   C  CA  . ILE A  1 70  ? -15.155 18.272  -0.720  1.00 14.51 ? 70   ILE A CA  1 
ATOM   539   C  C   . ILE A  1 70  ? -15.778 17.962  -2.079  1.00 14.72 ? 70   ILE A C   1 
ATOM   540   O  O   . ILE A  1 70  ? -15.243 18.343  -3.110  1.00 14.86 ? 70   ILE A O   1 
ATOM   541   C  CB  . ILE A  1 70  ? -15.382 19.763  -0.414  1.00 14.88 ? 70   ILE A CB  1 
ATOM   542   C  CG1 . ILE A  1 70  ? -14.821 20.141  0.955   1.00 14.98 ? 70   ILE A CG1 1 
ATOM   543   C  CG2 . ILE A  1 70  ? -16.869 20.094  -0.478  1.00 15.29 ? 70   ILE A CG2 1 
ATOM   544   C  CD1 . ILE A  1 70  ? -14.609 21.635  1.134   1.00 15.59 ? 70   ILE A CD1 1 
ATOM   545   N  N   . VAL A  1 71  ? -16.902 17.252  -2.071  1.00 14.98 ? 71   VAL A N   1 
ATOM   546   C  CA  . VAL A  1 71  ? -17.671 17.007  -3.281  1.00 15.49 ? 71   VAL A CA  1 
ATOM   547   C  C   . VAL A  1 71  ? -19.021 17.683  -3.113  1.00 16.19 ? 71   VAL A C   1 
ATOM   548   O  O   . VAL A  1 71  ? -19.772 17.351  -2.202  1.00 16.38 ? 71   VAL A O   1 
ATOM   549   C  CB  . VAL A  1 71  ? -17.883 15.508  -3.533  1.00 15.55 ? 71   VAL A CB  1 
ATOM   550   C  CG1 . VAL A  1 71  ? -18.734 15.286  -4.790  1.00 16.22 ? 71   VAL A CG1 1 
ATOM   551   C  CG2 . VAL A  1 71  ? -16.532 14.816  -3.640  1.00 15.19 ? 71   VAL A CG2 1 
ATOM   552   N  N   . LEU A  1 72  ? -19.322 18.622  -4.005  1.00 16.86 ? 72   LEU A N   1 
ATOM   553   C  CA  . LEU A  1 72  ? -20.481 19.487  -3.846  1.00 17.75 ? 72   LEU A CA  1 
ATOM   554   C  C   . LEU A  1 72  ? -20.805 20.205  -5.163  1.00 18.62 ? 72   LEU A C   1 
ATOM   555   O  O   . LEU A  1 72  ? -19.925 20.796  -5.778  1.00 18.76 ? 72   LEU A O   1 
ATOM   556   C  CB  . LEU A  1 72  ? -20.158 20.495  -2.741  1.00 17.76 ? 72   LEU A CB  1 
ATOM   557   C  CG  . LEU A  1 72  ? -21.109 21.657  -2.462  1.00 18.82 ? 72   LEU A CG  1 
ATOM   558   C  CD1 . LEU A  1 72  ? -22.371 21.164  -1.786  1.00 19.40 ? 72   LEU A CD1 1 
ATOM   559   C  CD2 . LEU A  1 72  ? -20.397 22.683  -1.593  1.00 18.84 ? 72   LEU A CD2 1 
ATOM   560   N  N   . ASN A  1 73  ? -22.066 20.150  -5.587  1.00 19.63 ? 73   ASN A N   1 
ATOM   561   C  CA  . ASN A  1 73  ? -22.523 20.794  -6.837  1.00 20.66 ? 73   ASN A CA  1 
ATOM   562   C  C   . ASN A  1 73  ? -21.765 20.348  -8.085  1.00 20.31 ? 73   ASN A C   1 
ATOM   563   O  O   . ASN A  1 73  ? -21.448 21.164  -8.955  1.00 20.73 ? 73   ASN A O   1 
ATOM   564   C  CB  . ASN A  1 73  ? -22.434 22.322  -6.743  1.00 21.47 ? 73   ASN A CB  1 
ATOM   565   C  CG  . ASN A  1 73  ? -23.267 22.890  -5.620  1.00 22.50 ? 73   ASN A CG  1 
ATOM   566   O  OD1 . ASN A  1 73  ? -24.414 22.484  -5.403  1.00 23.81 ? 73   ASN A OD1 1 
ATOM   567   N  ND2 . ASN A  1 73  ? -22.698 23.866  -4.905  1.00 22.87 ? 73   ASN A ND2 1 
ATOM   568   N  N   . ASP A  1 74  ? -21.476 19.055  -8.160  1.00 19.71 ? 74   ASP A N   1 
ATOM   569   C  CA  . ASP A  1 74  ? -20.739 18.480  -9.278  1.00 19.78 ? 74   ASP A CA  1 
ATOM   570   C  C   . ASP A  1 74  ? -19.310 19.047  -9.441  1.00 19.13 ? 74   ASP A C   1 
ATOM   571   O  O   . ASP A  1 74  ? -18.738 18.969  -10.517 1.00 19.53 ? 74   ASP A O   1 
ATOM   572   C  CB  . ASP A  1 74  ? -21.563 18.582  -10.574 1.00 21.18 ? 74   ASP A CB  1 
ATOM   573   C  CG  . ASP A  1 74  ? -22.719 17.566  -10.618 1.00 21.93 ? 74   ASP A CG  1 
ATOM   574   O  OD1 . ASP A  1 74  ? -22.601 16.524  -9.938  1.00 21.38 ? 74   ASP A OD1 1 
ATOM   575   O  OD2 . ASP A  1 74  ? -23.733 17.792  -11.330 1.00 23.34 ? 74   ASP A OD2 1 
ATOM   576   N  N   . TYR A  1 75  ? -18.740 19.570  -8.351  1.00 18.18 ? 75   TYR A N   1 
ATOM   577   C  CA  . TYR A  1 75  ? -17.319 19.908  -8.295  1.00 17.68 ? 75   TYR A CA  1 
ATOM   578   C  C   . TYR A  1 75  ? -16.618 19.183  -7.130  1.00 16.70 ? 75   TYR A C   1 
ATOM   579   O  O   . TYR A  1 75  ? -17.200 19.004  -6.054  1.00 16.32 ? 75   TYR A O   1 
ATOM   580   C  CB  . TYR A  1 75  ? -17.109 21.436  -8.201  1.00 17.96 ? 75   TYR A CB  1 
ATOM   581   C  CG  . TYR A  1 75  ? -17.371 22.130  -9.513  1.00 19.05 ? 75   TYR A CG  1 
ATOM   582   C  CD1 . TYR A  1 75  ? -16.391 22.194  -10.488 1.00 19.50 ? 75   TYR A CD1 1 
ATOM   583   C  CD2 . TYR A  1 75  ? -18.607 22.693  -9.800  1.00 19.82 ? 75   TYR A CD2 1 
ATOM   584   C  CE1 . TYR A  1 75  ? -16.628 22.800  -11.697 1.00 20.66 ? 75   TYR A CE1 1 
ATOM   585   C  CE2 . TYR A  1 75  ? -18.844 23.303  -11.010 1.00 20.98 ? 75   TYR A CE2 1 
ATOM   586   C  CZ  . TYR A  1 75  ? -17.851 23.355  -11.955 1.00 21.40 ? 75   TYR A CZ  1 
ATOM   587   O  OH  . TYR A  1 75  ? -18.068 23.970  -13.174 1.00 22.83 ? 75   TYR A OH  1 
ATOM   588   N  N   . LYS A  1 76  ? -15.371 18.775  -7.368  1.00 16.49 ? 76   LYS A N   1 
ATOM   589   C  CA  . LYS A  1 76  ? -14.509 18.208  -6.342  1.00 15.80 ? 76   LYS A CA  1 
ATOM   590   C  C   . LYS A  1 76  ? -13.361 19.185  -5.997  1.00 15.75 ? 76   LYS A C   1 
ATOM   591   O  O   . LYS A  1 76  ? -12.559 19.548  -6.857  1.00 16.27 ? 76   LYS A O   1 
ATOM   592   C  CB  . LYS A  1 76  ? -13.921 16.886  -6.816  1.00 15.91 ? 76   LYS A CB  1 
ATOM   593   C  CG  . LYS A  1 76  ? -14.955 15.830  -7.148  1.00 16.24 ? 76   LYS A CG  1 
ATOM   594   C  CD  . LYS A  1 76  ? -14.281 14.476  -7.328  1.00 16.52 ? 76   LYS A CD  1 
ATOM   595   C  CE  . LYS A  1 76  ? -15.275 13.328  -7.383  1.00 16.97 ? 76   LYS A CE  1 
ATOM   596   N  NZ  . LYS A  1 76  ? -14.608 12.023  -7.123  1.00 17.27 ? 76   LYS A NZ  1 
ATOM   597   N  N   . TRP A  1 77  ? -13.303 19.589  -4.731  1.00 15.34 ? 77   TRP A N   1 
ATOM   598   C  CA  . TRP A  1 77  ? -12.276 20.476  -4.223  1.00 15.49 ? 77   TRP A CA  1 
ATOM   599   C  C   . TRP A  1 77  ? -11.286 19.673  -3.406  1.00 15.19 ? 77   TRP A C   1 
ATOM   600   O  O   . TRP A  1 77  ? -11.699 18.880  -2.569  1.00 14.77 ? 77   TRP A O   1 
ATOM   601   C  CB  . TRP A  1 77  ? -12.874 21.525  -3.300  1.00 15.61 ? 77   TRP A CB  1 
ATOM   602   C  CG  . TRP A  1 77  ? -14.006 22.310  -3.871  1.00 16.09 ? 77   TRP A CG  1 
ATOM   603   C  CD1 . TRP A  1 77  ? -15.292 21.899  -4.005  1.00 16.07 ? 77   TRP A CD1 1 
ATOM   604   C  CD2 . TRP A  1 77  ? -13.965 23.661  -4.332  1.00 16.86 ? 77   TRP A CD2 1 
ATOM   605   N  NE1 . TRP A  1 77  ? -16.052 22.900  -4.535  1.00 16.89 ? 77   TRP A NE1 1 
ATOM   606   C  CE2 . TRP A  1 77  ? -15.264 23.995  -4.748  1.00 17.28 ? 77   TRP A CE2 1 
ATOM   607   C  CE3 . TRP A  1 77  ? -12.948 24.618  -4.447  1.00 17.43 ? 77   TRP A CE3 1 
ATOM   608   C  CZ2 . TRP A  1 77  ? -15.593 25.257  -5.264  1.00 18.22 ? 77   TRP A CZ2 1 
ATOM   609   C  CZ3 . TRP A  1 77  ? -13.271 25.878  -4.955  1.00 18.38 ? 77   TRP A CZ3 1 
ATOM   610   C  CH2 . TRP A  1 77  ? -14.589 26.186  -5.353  1.00 18.75 ? 77   TRP A CH2 1 
ATOM   611   N  N   . PHE A  1 78  ? -9.992  19.899  -3.639  1.00 15.61 ? 78   PHE A N   1 
ATOM   612   C  CA  . PHE A  1 78  ? -8.944  19.343  -2.802  1.00 15.63 ? 78   PHE A CA  1 
ATOM   613   C  C   . PHE A  1 78  ? -7.790  20.326  -2.617  1.00 16.34 ? 78   PHE A C   1 
ATOM   614   O  O   . PHE A  1 78  ? -7.339  20.958  -3.576  1.00 16.96 ? 78   PHE A O   1 
ATOM   615   C  CB  . PHE A  1 78  ? -8.403  18.059  -3.400  1.00 15.67 ? 78   PHE A CB  1 
ATOM   616   C  CG  . PHE A  1 78  ? -7.044  17.692  -2.898  1.00 16.05 ? 78   PHE A CG  1 
ATOM   617   C  CD1 . PHE A  1 78  ? -6.845  17.397  -1.571  1.00 15.90 ? 78   PHE A CD1 1 
ATOM   618   C  CD2 . PHE A  1 78  ? -5.973  17.651  -3.745  1.00 16.83 ? 78   PHE A CD2 1 
ATOM   619   C  CE1 . PHE A  1 78  ? -5.597  17.081  -1.083  1.00 16.44 ? 78   PHE A CE1 1 
ATOM   620   C  CE2 . PHE A  1 78  ? -4.713  17.316  -3.280  1.00 17.41 ? 78   PHE A CE2 1 
ATOM   621   C  CZ  . PHE A  1 78  ? -4.525  17.037  -1.944  1.00 17.20 ? 78   PHE A CZ  1 
ATOM   622   N  N   . ALA A  1 79  ? -7.314  20.427  -1.375  1.00 16.46 ? 79   ALA A N   1 
ATOM   623   C  CA  . ALA A  1 79  ? -6.143  21.207  -1.052  1.00 17.38 ? 79   ALA A CA  1 
ATOM   624   C  C   . ALA A  1 79  ? -5.472  20.641  0.171   1.00 17.51 ? 79   ALA A C   1 
ATOM   625   O  O   . ALA A  1 79  ? -6.122  20.034  1.010   1.00 16.99 ? 79   ALA A O   1 
ATOM   626   C  CB  . ALA A  1 79  ? -6.525  22.653  -0.798  1.00 17.96 ? 79   ALA A CB  1 
ATOM   627   N  N   . PHE A  1 80  ? -4.162  20.851  0.259   1.00 18.42 ? 80   PHE A N   1 
ATOM   628   C  CA  . PHE A  1 80  ? -3.422  20.609  1.490   1.00 18.97 ? 80   PHE A CA  1 
ATOM   629   C  C   . PHE A  1 80  ? -3.520  21.838  2.386   1.00 19.73 ? 80   PHE A C   1 
ATOM   630   O  O   . PHE A  1 80  ? -3.632  22.956  1.901   1.00 20.12 ? 80   PHE A O   1 
ATOM   631   C  CB  . PHE A  1 80  ? -1.961  20.349  1.181   1.00 19.90 ? 80   PHE A CB  1 
ATOM   632   C  CG  . PHE A  1 80  ? -1.703  19.043  0.513   1.00 19.54 ? 80   PHE A CG  1 
ATOM   633   C  CD1 . PHE A  1 80  ? -1.869  17.860  1.203   1.00 19.12 ? 80   PHE A CD1 1 
ATOM   634   C  CD2 . PHE A  1 80  ? -1.241  19.002  -0.787  1.00 19.92 ? 80   PHE A CD2 1 
ATOM   635   C  CE1 . PHE A  1 80  ? -1.609  16.648  0.599   1.00 19.09 ? 80   PHE A CE1 1 
ATOM   636   C  CE2 . PHE A  1 80  ? -0.971  17.798  -1.399  1.00 19.93 ? 80   PHE A CE2 1 
ATOM   637   C  CZ  . PHE A  1 80  ? -1.164  16.617  -0.705  1.00 19.58 ? 80   PHE A CZ  1 
ATOM   638   N  N   . PHE A  1 81  ? -3.493  21.623  3.695   1.00 20.12 ? 81   PHE A N   1 
ATOM   639   C  CA  . PHE A  1 81  ? -3.443  22.734  4.648   1.00 21.29 ? 81   PHE A CA  1 
ATOM   640   C  C   . PHE A  1 81  ? -2.131  23.512  4.503   1.00 22.93 ? 81   PHE A C   1 
ATOM   641   O  O   . PHE A  1 81  ? -1.087  22.950  4.180   1.00 23.35 ? 81   PHE A O   1 
ATOM   642   C  CB  . PHE A  1 81  ? -3.600  22.241  6.085   1.00 21.46 ? 81   PHE A CB  1 
ATOM   643   C  CG  . PHE A  1 81  ? -4.968  21.714  6.391   1.00 20.48 ? 81   PHE A CG  1 
ATOM   644   C  CD1 . PHE A  1 81  ? -6.048  22.578  6.497   1.00 20.51 ? 81   PHE A CD1 1 
ATOM   645   C  CD2 . PHE A  1 81  ? -5.179  20.358  6.568   1.00 19.77 ? 81   PHE A CD2 1 
ATOM   646   C  CE1 . PHE A  1 81  ? -7.314  22.095  6.779   1.00 19.88 ? 81   PHE A CE1 1 
ATOM   647   C  CE2 . PHE A  1 81  ? -6.444  19.855  6.851   1.00 19.10 ? 81   PHE A CE2 1 
ATOM   648   C  CZ  . PHE A  1 81  ? -7.516  20.724  6.957   1.00 19.17 ? 81   PHE A CZ  1 
ATOM   649   N  N   . LYS A  1 82  ? -2.215  24.810  4.744   1.00 24.25 ? 82   LYS A N   1 
ATOM   650   C  CA  . LYS A  1 82  ? -1.093  25.704  4.529   1.00 26.22 ? 82   LYS A CA  1 
ATOM   651   C  C   . LYS A  1 82  ? 0.022   25.527  5.557   1.00 27.79 ? 82   LYS A C   1 
ATOM   652   O  O   . LYS A  1 82  ? -0.229  25.386  6.756   1.00 28.35 ? 82   LYS A O   1 
ATOM   653   C  CB  . LYS A  1 82  ? -1.559  27.154  4.538   1.00 27.18 ? 82   LYS A CB  1 
ATOM   654   C  CG  . LYS A  1 82  ? -0.589  28.106  3.862   1.00 28.68 ? 82   LYS A CG  1 
ATOM   655   C  CD  . LYS A  1 82  ? -0.935  29.537  4.200   1.00 30.01 ? 82   LYS A CD  1 
ATOM   656   C  CE  . LYS A  1 82  ? -0.227  30.511  3.287   1.00 31.41 ? 82   LYS A CE  1 
ATOM   657   N  NZ  . LYS A  1 82  ? -0.653  31.898  3.622   1.00 32.89 ? 82   LYS A NZ  1 
ATOM   658   N  N   . TYR A  1 83  ? 1.252   25.530  5.049   1.00 29.24 ? 83   TYR A N   1 
ATOM   659   C  CA  . TYR A  1 83  ? 2.465   25.547  5.859   1.00 31.33 ? 83   TYR A CA  1 
ATOM   660   C  C   . TYR A  1 83  ? 3.496   26.407  5.126   1.00 33.37 ? 83   TYR A C   1 
ATOM   661   O  O   . TYR A  1 83  ? 3.441   26.537  3.909   1.00 32.97 ? 83   TYR A O   1 
ATOM   662   C  CB  . TYR A  1 83  ? 2.996   24.122  6.086   1.00 30.80 ? 83   TYR A CB  1 
ATOM   663   C  CG  . TYR A  1 83  ? 3.317   23.398  4.801   1.00 30.05 ? 83   TYR A CG  1 
ATOM   664   C  CD1 . TYR A  1 83  ? 2.312   22.794  4.055   1.00 28.25 ? 83   TYR A CD1 1 
ATOM   665   C  CD2 . TYR A  1 83  ? 4.618   23.336  4.323   1.00 31.42 ? 83   TYR A CD2 1 
ATOM   666   C  CE1 . TYR A  1 83  ? 2.592   22.140  2.872   1.00 27.95 ? 83   TYR A CE1 1 
ATOM   667   C  CE2 . TYR A  1 83  ? 4.917   22.682  3.139   1.00 31.06 ? 83   TYR A CE2 1 
ATOM   668   C  CZ  . TYR A  1 83  ? 3.903   22.095  2.410   1.00 29.41 ? 83   TYR A CZ  1 
ATOM   669   O  OH  . TYR A  1 83  ? 4.198   21.462  1.221   1.00 29.38 ? 83   TYR A OH  1 
ATOM   670   N  N   . LYS A  1 84  ? 4.434   26.984  5.869   1.00 36.25 ? 84   LYS A N   1 
ATOM   671   C  CA  . LYS A  1 84  ? 5.431   27.897  5.301   1.00 38.87 ? 84   LYS A CA  1 
ATOM   672   C  C   . LYS A  1 84  ? 6.797   27.689  5.946   1.00 40.85 ? 84   LYS A C   1 
ATOM   673   O  O   . LYS A  1 84  ? 6.872   27.237  7.086   1.00 41.05 ? 84   LYS A O   1 
ATOM   674   C  CB  . LYS A  1 84  ? 4.984   29.343  5.504   1.00 40.76 ? 84   LYS A CB  1 
ATOM   675   C  CG  . LYS A  1 84  ? 5.892   30.348  4.820   1.00 43.69 ? 84   LYS A CG  1 
ATOM   676   C  CD  . LYS A  1 84  ? 5.385   31.780  4.941   1.00 45.66 ? 84   LYS A CD  1 
ATOM   677   C  CE  . LYS A  1 84  ? 6.443   32.754  4.437   1.00 48.68 ? 84   LYS A CE  1 
ATOM   678   N  NZ  . LYS A  1 84  ? 6.028   34.177  4.595   1.00 50.83 ? 84   LYS A NZ  1 
ATOM   679   N  N   . VAL A  1 90  ? 9.406   26.166  10.118  1.00 46.47 ? 90   VAL A N   1 
ATOM   680   C  CA  . VAL A  1 90  ? 8.218   25.452  9.627   1.00 43.84 ? 90   VAL A CA  1 
ATOM   681   C  C   . VAL A  1 90  ? 6.965   25.823  10.422  1.00 42.81 ? 90   VAL A C   1 
ATOM   682   O  O   . VAL A  1 90  ? 6.732   25.280  11.500  1.00 42.94 ? 90   VAL A O   1 
ATOM   683   C  CB  . VAL A  1 90  ? 8.430   23.916  9.679   1.00 43.06 ? 90   VAL A CB  1 
ATOM   684   C  CG1 . VAL A  1 90  ? 7.144   23.160  9.361   1.00 40.25 ? 90   VAL A CG1 1 
ATOM   685   C  CG2 . VAL A  1 90  ? 9.549   23.504  8.724   1.00 43.87 ? 90   VAL A CG2 1 
ATOM   686   N  N   . THR A  1 91  ? 6.160   26.742  9.894   1.00 41.89 ? 91   THR A N   1 
ATOM   687   C  CA  . THR A  1 91  ? 4.923   27.143  10.569  1.00 41.15 ? 91   THR A CA  1 
ATOM   688   C  C   . THR A  1 91  ? 3.710   26.634  9.791   1.00 38.45 ? 91   THR A C   1 
ATOM   689   O  O   . THR A  1 91  ? 3.705   26.639  8.566   1.00 37.31 ? 91   THR A O   1 
ATOM   690   C  CB  . THR A  1 91  ? 4.836   28.674  10.756  1.00 42.84 ? 91   THR A CB  1 
ATOM   691   O  OG1 . THR A  1 91  ? 5.946   29.130  11.547  1.00 45.60 ? 91   THR A OG1 1 
ATOM   692   C  CG2 . THR A  1 91  ? 3.537   29.067  11.464  1.00 42.35 ? 91   THR A CG2 1 
ATOM   693   N  N   . THR A  1 92  ? 2.688   26.201  10.523  1.00 37.62 ? 92   THR A N   1 
ATOM   694   C  CA  . THR A  1 92  ? 1.487   25.608  9.951   1.00 35.51 ? 92   THR A CA  1 
ATOM   695   C  C   . THR A  1 92  ? 0.303   26.509  10.210  1.00 35.61 ? 92   THR A C   1 
ATOM   696   O  O   . THR A  1 92  ? 0.192   27.097  11.281  1.00 36.98 ? 92   THR A O   1 
ATOM   697   C  CB  . THR A  1 92  ? 1.222   24.237  10.573  1.00 34.72 ? 92   THR A CB  1 
ATOM   698   O  OG1 . THR A  1 92  ? 2.179   23.314  10.052  1.00 34.54 ? 92   THR A OG1 1 
ATOM   699   C  CG2 . THR A  1 92  ? -0.206  23.724  10.258  1.00 33.02 ? 92   THR A CG2 1 
ATOM   700   N  N   . TYR A  1 93  ? -0.564  26.628  9.208   1.00 34.25 ? 93   TYR A N   1 
ATOM   701   C  CA  . TYR A  1 93  ? -1.749  27.464  9.298   1.00 34.50 ? 93   TYR A CA  1 
ATOM   702   C  C   . TYR A  1 93  ? -2.949  26.597  8.988   1.00 32.73 ? 93   TYR A C   1 
ATOM   703   O  O   . TYR A  1 93  ? -3.325  26.430  7.835   1.00 31.52 ? 93   TYR A O   1 
ATOM   704   C  CB  . TYR A  1 93  ? -1.666  28.626  8.312   1.00 35.14 ? 93   TYR A CB  1 
ATOM   705   C  CG  . TYR A  1 93  ? -0.504  29.541  8.552   1.00 37.57 ? 93   TYR A CG  1 
ATOM   706   C  CD1 . TYR A  1 93  ? -0.621  30.630  9.406   1.00 39.73 ? 93   TYR A CD1 1 
ATOM   707   C  CD2 . TYR A  1 93  ? 0.715   29.327  7.925   1.00 38.07 ? 93   TYR A CD2 1 
ATOM   708   C  CE1 . TYR A  1 93  ? 0.442   31.477  9.631   1.00 41.90 ? 93   TYR A CE1 1 
ATOM   709   C  CE2 . TYR A  1 93  ? 1.786   30.171  8.146   1.00 40.48 ? 93   TYR A CE2 1 
ATOM   710   C  CZ  . TYR A  1 93  ? 1.642   31.240  9.002   1.00 42.36 ? 93   TYR A CZ  1 
ATOM   711   O  OH  . TYR A  1 93  ? 2.703   32.082  9.233   1.00 45.32 ? 93   TYR A OH  1 
ATOM   712   N  N   . CYS A  1 94  ? -3.547  26.050  10.031  1.00 33.22 ? 94   CYS A N   1 
ATOM   713   C  CA  . CYS A  1 94  ? -4.652  25.132  9.884   1.00 32.06 ? 94   CYS A CA  1 
ATOM   714   C  C   . CYS A  1 94  ? -5.939  25.794  9.398   1.00 30.98 ? 94   CYS A C   1 
ATOM   715   O  O   . CYS A  1 94  ? -6.860  25.107  8.969   1.00 29.79 ? 94   CYS A O   1 
ATOM   716   C  CB  . CYS A  1 94  ? -4.883  24.395  11.204  1.00 33.64 ? 94   CYS A CB  1 
ATOM   717   S  SG  . CYS A  1 94  ? -3.598  23.143  11.525  1.00 36.00 ? 94   CYS A SG  1 
ATOM   718   N  N   . ASN A  1 95  ? -5.990  27.118  9.454   1.00 31.57 ? 95   ASN A N   1 
ATOM   719   C  CA  . ASN A  1 95  ? -7.142  27.885  8.971   1.00 31.00 ? 95   ASN A CA  1 
ATOM   720   C  C   . ASN A  1 95  ? -6.969  28.399  7.527   1.00 30.01 ? 95   ASN A C   1 
ATOM   721   O  O   . ASN A  1 95  ? -7.716  29.274  7.084   1.00 30.12 ? 95   ASN A O   1 
ATOM   722   C  CB  . ASN A  1 95  ? -7.411  29.065  9.935   1.00 32.99 ? 95   ASN A CB  1 
ATOM   723   C  CG  . ASN A  1 95  ? -6.229  30.011  10.057  1.00 34.70 ? 95   ASN A CG  1 
ATOM   724   O  OD1 . ASN A  1 95  ? -5.266  29.914  9.302   1.00 34.33 ? 95   ASN A OD1 1 
ATOM   725   N  ND2 . ASN A  1 95  ? -6.290  30.925  11.019  1.00 36.98 ? 95   ASN A ND2 1 
ATOM   726   N  N   . GLU A  1 96  ? -5.966  27.882  6.814   1.00 29.01 ? 96   GLU A N   1 
ATOM   727   C  CA  . GLU A  1 96  ? -5.731  28.238  5.411   1.00 28.18 ? 96   GLU A CA  1 
ATOM   728   C  C   . GLU A  1 96  ? -5.219  27.035  4.638   1.00 26.25 ? 96   GLU A C   1 
ATOM   729   O  O   . GLU A  1 96  ? -4.803  26.033  5.221   1.00 25.75 ? 96   GLU A O   1 
ATOM   730   C  CB  . GLU A  1 96  ? -4.713  29.381  5.285   1.00 30.37 ? 96   GLU A CB  1 
ATOM   731   C  CG  . GLU A  1 96  ? -5.112  30.668  5.989   1.00 32.28 ? 96   GLU A CG  1 
ATOM   732   C  CD  . GLU A  1 96  ? -4.030  31.729  5.939   1.00 34.71 ? 96   GLU A CD  1 
ATOM   733   O  OE1 . GLU A  1 96  ? -3.527  32.003  4.826   1.00 35.27 ? 96   GLU A OE1 1 
ATOM   734   O  OE2 . GLU A  1 96  ? -3.686  32.291  7.007   1.00 36.50 ? 96   GLU A OE2 1 
ATOM   735   N  N   . THR A  1 97  ? -5.248  27.149  3.317   1.00 25.25 ? 97   THR A N   1 
ATOM   736   C  CA  . THR A  1 97  ? -4.808  26.080  2.439   1.00 23.94 ? 97   THR A CA  1 
ATOM   737   C  C   . THR A  1 97  ? -3.667  26.547  1.555   1.00 24.62 ? 97   THR A C   1 
ATOM   738   O  O   . THR A  1 97  ? -3.544  27.738  1.270   1.00 26.03 ? 97   THR A O   1 
ATOM   739   C  CB  . THR A  1 97  ? -5.944  25.596  1.520   1.00 22.57 ? 97   THR A CB  1 
ATOM   740   O  OG1 . THR A  1 97  ? -6.042  26.442  0.366   1.00 22.93 ? 97   THR A OG1 1 
ATOM   741   C  CG2 . THR A  1 97  ? -7.287  25.573  2.264   1.00 22.09 ? 97   THR A CG2 1 
ATOM   742   N  N   . MET A  1 98  ? -2.845  25.588  1.130   1.00 24.04 ? 98   MET A N   1 
ATOM   743   C  CA  . MET A  1 98  ? -2.004  25.755  -0.046  1.00 24.52 ? 98   MET A CA  1 
ATOM   744   C  C   . MET A  1 98  ? -2.893  25.912  -1.272  1.00 23.88 ? 98   MET A C   1 
ATOM   745   O  O   . MET A  1 98  ? -4.121  25.783  -1.195  1.00 22.88 ? 98   MET A O   1 
ATOM   746   C  CB  . MET A  1 98  ? -1.091  24.539  -0.249  1.00 24.31 ? 98   MET A CB  1 
ATOM   747   C  CG  . MET A  1 98  ? -0.105  24.276  0.873   1.00 25.12 ? 98   MET A CG  1 
ATOM   748   S  SD  . MET A  1 98  ? 0.906   25.720  1.263   1.00 27.24 ? 98   MET A SD  1 
ATOM   749   C  CE  . MET A  1 98  ? 2.413   25.376  0.344   1.00 28.40 ? 98   MET A CE  1 
ATOM   750   N  N   . THR A  1 99  ? -2.276  26.186  -2.410  1.00 24.57 ? 99   THR A N   1 
ATOM   751   C  CA  . THR A  1 99  ? -3.022  26.262  -3.635  1.00 24.33 ? 99   THR A CA  1 
ATOM   752   C  C   . THR A  1 99  ? -3.565  24.879  -3.953  1.00 22.86 ? 99   THR A C   1 
ATOM   753   O  O   . THR A  1 99  ? -2.826  23.893  -3.924  1.00 22.84 ? 99   THR A O   1 
ATOM   754   C  CB  . THR A  1 99  ? -2.182  26.757  -4.808  1.00 25.87 ? 99   THR A CB  1 
ATOM   755   O  OG1 . THR A  1 99  ? -1.695  28.062  -4.508  1.00 27.38 ? 99   THR A OG1 1 
ATOM   756   C  CG2 . THR A  1 99  ? -3.042  26.828  -6.065  1.00 26.00 ? 99   THR A CG2 1 
ATOM   757   N  N   . GLY A  1 100 ? -4.863  24.827  -4.237  1.00 21.72 ? 100  GLY A N   1 
ATOM   758   C  CA  . GLY A  1 100 ? -5.555  23.569  -4.462  1.00 20.50 ? 100  GLY A CA  1 
ATOM   759   C  C   . GLY A  1 100 ? -6.127  23.418  -5.859  1.00 20.39 ? 100  GLY A C   1 
ATOM   760   O  O   . GLY A  1 100 ? -6.082  24.329  -6.664  1.00 21.36 ? 100  GLY A O   1 
ATOM   761   N  N   . TRP A  1 101 ? -6.692  22.247  -6.114  1.00 19.51 ? 101  TRP A N   1 
ATOM   762   C  CA  . TRP A  1 101 ? -7.315  21.931  -7.388  1.00 19.54 ? 101  TRP A CA  1 
ATOM   763   C  C   . TRP A  1 101 ? -8.809  21.707  -7.176  1.00 18.56 ? 101  TRP A C   1 
ATOM   764   O  O   . TRP A  1 101 ? -9.225  20.926  -6.312  1.00 17.73 ? 101  TRP A O   1 
ATOM   765   C  CB  . TRP A  1 101 ? -6.692  20.673  -7.981  1.00 19.75 ? 101  TRP A CB  1 
ATOM   766   C  CG  . TRP A  1 101 ? -5.219  20.755  -8.178  1.00 20.78 ? 101  TRP A CG  1 
ATOM   767   C  CD1 . TRP A  1 101 ? -4.566  21.058  -9.339  1.00 22.20 ? 101  TRP A CD1 1 
ATOM   768   C  CD2 . TRP A  1 101 ? -4.201  20.504  -7.196  1.00 20.79 ? 101  TRP A CD2 1 
ATOM   769   N  NE1 . TRP A  1 101 ? -3.213  21.015  -9.135  1.00 22.89 ? 101  TRP A NE1 1 
ATOM   770   C  CE2 . TRP A  1 101 ? -2.961  20.678  -7.830  1.00 22.11 ? 101  TRP A CE2 1 
ATOM   771   C  CE3 . TRP A  1 101 ? -4.222  20.155  -5.844  1.00 20.01 ? 101  TRP A CE3 1 
ATOM   772   C  CZ2 . TRP A  1 101 ? -1.743  20.523  -7.154  1.00 22.71 ? 101  TRP A CZ2 1 
ATOM   773   C  CZ3 . TRP A  1 101 ? -3.019  19.988  -5.173  1.00 20.54 ? 101  TRP A CZ3 1 
ATOM   774   C  CH2 . TRP A  1 101 ? -1.796  20.180  -5.826  1.00 21.84 ? 101  TRP A CH2 1 
ATOM   775   N  N   . VAL A  1 102 ? -9.600  22.418  -7.969  1.00 18.82 ? 102  VAL A N   1 
ATOM   776   C  CA  . VAL A  1 102 ? -11.019 22.186  -8.092  1.00 18.33 ? 102  VAL A CA  1 
ATOM   777   C  C   . VAL A  1 102 ? -11.316 21.800  -9.547  1.00 18.98 ? 102  VAL A C   1 
ATOM   778   O  O   . VAL A  1 102 ? -10.741 22.365  -10.480 1.00 19.99 ? 102  VAL A O   1 
ATOM   779   C  CB  . VAL A  1 102 ? -11.837 23.414  -7.646  1.00 18.47 ? 102  VAL A CB  1 
ATOM   780   C  CG1 . VAL A  1 102 ? -11.544 24.632  -8.510  1.00 19.70 ? 102  VAL A CG1 1 
ATOM   781   C  CG2 . VAL A  1 102 ? -13.321 23.123  -7.668  1.00 18.17 ? 102  VAL A CG2 1 
ATOM   782   N  N   . HIS A  1 103 ? -12.202 20.824  -9.731  1.00 18.64 ? 103  HIS A N   1 
ATOM   783   C  CA  . HIS A  1 103 ? -12.706 20.450  -11.055 1.00 19.45 ? 103  HIS A CA  1 
ATOM   784   C  C   . HIS A  1 103 ? -14.069 19.767  -10.951 1.00 19.08 ? 103  HIS A C   1 
ATOM   785   O  O   . HIS A  1 103 ? -14.432 19.262  -9.899  1.00 18.13 ? 103  HIS A O   1 
ATOM   786   C  CB  . HIS A  1 103 ? -11.719 19.535  -11.771 1.00 20.00 ? 103  HIS A CB  1 
ATOM   787   C  CG  . HIS A  1 103 ? -11.399 18.289  -11.014 1.00 19.30 ? 103  HIS A CG  1 
ATOM   788   N  ND1 . HIS A  1 103 ? -12.256 17.211  -10.963 1.00 19.15 ? 103  HIS A ND1 1 
ATOM   789   C  CD2 . HIS A  1 103 ? -10.322 17.949  -10.269 1.00 18.96 ? 103  HIS A CD2 1 
ATOM   790   C  CE1 . HIS A  1 103 ? -11.718 16.257  -10.224 1.00 18.75 ? 103  HIS A CE1 1 
ATOM   791   N  NE2 . HIS A  1 103 ? -10.549 16.685  -9.781  1.00 18.56 ? 103  HIS A NE2 1 
ATOM   792   N  N   . ASP A  1 104 ? -14.826 19.761  -12.045 1.00 19.96 ? 104  ASP A N   1 
ATOM   793   C  CA  . ASP A  1 104 ? -16.133 19.115  -12.038 1.00 20.00 ? 104  ASP A CA  1 
ATOM   794   C  C   . ASP A  1 104 ? -15.943 17.609  -11.916 1.00 19.64 ? 104  ASP A C   1 
ATOM   795   O  O   . ASP A  1 104 ? -14.863 17.093  -12.188 1.00 19.72 ? 104  ASP A O   1 
ATOM   796   C  CB  . ASP A  1 104 ? -16.976 19.486  -13.265 1.00 21.36 ? 104  ASP A CB  1 
ATOM   797   C  CG  . ASP A  1 104 ? -16.333 19.069  -14.586 1.00 22.57 ? 104  ASP A CG  1 
ATOM   798   O  OD1 . ASP A  1 104 ? -16.001 17.871  -14.763 1.00 22.53 ? 104  ASP A OD1 1 
ATOM   799   O  OD2 . ASP A  1 104 ? -16.177 19.957  -15.467 1.00 23.76 ? 104  ASP A OD2 1 
ATOM   800   N  N   . VAL A  1 105 ? -16.991 16.909  -11.510 1.00 19.43 ? 105  VAL A N   1 
ATOM   801   C  CA  . VAL A  1 105 ? -16.881 15.462  -11.220 1.00 19.25 ? 105  VAL A CA  1 
ATOM   802   C  C   . VAL A  1 105 ? -16.391 14.626  -12.402 1.00 20.34 ? 105  VAL A C   1 
ATOM   803   O  O   . VAL A  1 105 ? -15.785 13.597  -12.192 1.00 20.36 ? 105  VAL A O   1 
ATOM   804   C  CB  . VAL A  1 105 ? -18.181 14.866  -10.625 1.00 19.17 ? 105  VAL A CB  1 
ATOM   805   C  CG1 . VAL A  1 105 ? -18.454 15.478  -9.259  1.00 18.18 ? 105  VAL A CG1 1 
ATOM   806   C  CG2 . VAL A  1 105 ? -19.369 15.090  -11.543 1.00 20.33 ? 105  VAL A CG2 1 
ATOM   807   N  N   . LEU A  1 106 ? -16.626 15.089  -13.628 1.00 21.52 ? 106  LEU A N   1 
ATOM   808   C  CA  . LEU A  1 106 ? -16.140 14.411  -14.819 1.00 22.86 ? 106  LEU A CA  1 
ATOM   809   C  C   . LEU A  1 106 ? -14.650 14.618  -15.052 1.00 23.02 ? 106  LEU A C   1 
ATOM   810   O  O   . LEU A  1 106 ? -13.997 13.767  -15.666 1.00 23.96 ? 106  LEU A O   1 
ATOM   811   C  CB  . LEU A  1 106 ? -16.902 14.904  -16.051 1.00 24.29 ? 106  LEU A CB  1 
ATOM   812   C  CG  . LEU A  1 106 ? -18.410 14.617  -16.095 1.00 24.82 ? 106  LEU A CG  1 
ATOM   813   C  CD1 . LEU A  1 106 ? -18.987 15.172  -17.393 1.00 26.50 ? 106  LEU A CD1 1 
ATOM   814   C  CD2 . LEU A  1 106 ? -18.710 13.123  -15.948 1.00 25.16 ? 106  LEU A CD2 1 
ATOM   815   N  N   . GLY A  1 107 ? -14.131 15.757  -14.590 1.00 22.43 ? 107  GLY A N   1 
ATOM   816   C  CA  . GLY A  1 107 ? -12.736 16.152  -14.799 1.00 22.80 ? 107  GLY A CA  1 
ATOM   817   C  C   . GLY A  1 107 ? -12.530 16.971  -16.061 1.00 24.43 ? 107  GLY A C   1 
ATOM   818   O  O   . GLY A  1 107 ? -11.433 16.983  -16.632 1.00 25.57 ? 107  GLY A O   1 
ATOM   819   N  N   . ARG A  1 108 ? -13.576 17.654  -16.512 1.00 24.98 ? 108  ARG A N   1 
ATOM   820   C  CA  . ARG A  1 108 ? -13.484 18.409  -17.754 1.00 26.68 ? 108  ARG A CA  1 
ATOM   821   C  C   . ARG A  1 108 ? -12.885 19.769  -17.480 1.00 26.60 ? 108  ARG A C   1 
ATOM   822   O  O   . ARG A  1 108 ? -11.871 20.113  -18.053 1.00 27.98 ? 108  ARG A O   1 
ATOM   823   C  CB  . ARG A  1 108 ? -14.847 18.579  -18.420 1.00 27.56 ? 108  ARG A CB  1 
ATOM   824   C  CG  . ARG A  1 108 ? -15.540 17.275  -18.776 1.00 28.11 ? 108  ARG A CG  1 
ATOM   825   C  CD  . ARG A  1 108 ? -14.938 16.573  -19.976 1.00 29.85 ? 108  ARG A CD  1 
ATOM   826   N  NE  . ARG A  1 108 ? -15.756 15.409  -20.297 1.00 30.56 ? 108  ARG A NE  1 
ATOM   827   C  CZ  . ARG A  1 108 ? -15.608 14.198  -19.760 1.00 30.02 ? 108  ARG A CZ  1 
ATOM   828   N  NH1 . ARG A  1 108 ? -14.639 13.936  -18.882 1.00 28.72 ? 108  ARG A NH1 1 
ATOM   829   N  NH2 . ARG A  1 108 ? -16.436 13.235  -20.111 1.00 30.95 ? 108  ARG A NH2 1 
ATOM   830   N  N   . ASN A  1 109 ? -13.515 20.532  -16.597 1.00 25.62 ? 109  ASN A N   1 
ATOM   831   C  CA  . ASN A  1 109 ? -13.119 21.909  -16.364 1.00 25.78 ? 109  ASN A CA  1 
ATOM   832   C  C   . ASN A  1 109 ? -12.444 22.026  -15.023 1.00 24.39 ? 109  ASN A C   1 
ATOM   833   O  O   . ASN A  1 109 ? -13.015 21.654  -14.006 1.00 22.98 ? 109  ASN A O   1 
ATOM   834   C  CB  . ASN A  1 109 ? -14.321 22.845  -16.428 1.00 26.14 ? 109  ASN A CB  1 
ATOM   835   C  CG  . ASN A  1 109 ? -14.861 23.007  -17.840 1.00 27.91 ? 109  ASN A CG  1 
ATOM   836   O  OD1 . ASN A  1 109 ? -14.104 23.119  -18.808 1.00 29.11 ? 109  ASN A OD1 1 
ATOM   837   N  ND2 . ASN A  1 109 ? -16.186 23.022  -17.962 1.00 28.24 ? 109  ASN A ND2 1 
ATOM   838   N  N   . TRP A  1 110 ? -11.212 22.527  -15.048 1.00 24.88 ? 110  TRP A N   1 
ATOM   839   C  CA  . TRP A  1 110 ? -10.405 22.689  -13.854 1.00 23.98 ? 110  TRP A CA  1 
ATOM   840   C  C   . TRP A  1 110 ? -10.156 24.156  -13.547 1.00 24.56 ? 110  TRP A C   1 
ATOM   841   O  O   . TRP A  1 110 ? -10.357 25.042  -14.389 1.00 25.83 ? 110  TRP A O   1 
ATOM   842   C  CB  . TRP A  1 110 ? -9.056  22.010  -14.030 1.00 24.29 ? 110  TRP A CB  1 
ATOM   843   C  CG  . TRP A  1 110 ? -9.108  20.543  -14.101 1.00 23.91 ? 110  TRP A CG  1 
ATOM   844   C  CD1 . TRP A  1 110 ? -9.765  19.793  -15.015 1.00 24.52 ? 110  TRP A CD1 1 
ATOM   845   C  CD2 . TRP A  1 110 ? -8.427  19.632  -13.245 1.00 23.27 ? 110  TRP A CD2 1 
ATOM   846   N  NE1 . TRP A  1 110 ? -9.560  18.469  -14.770 1.00 24.20 ? 110  TRP A NE1 1 
ATOM   847   C  CE2 . TRP A  1 110 ? -8.736  18.336  -13.691 1.00 23.48 ? 110  TRP A CE2 1 
ATOM   848   C  CE3 . TRP A  1 110 ? -7.596  19.785  -12.127 1.00 22.54 ? 110  TRP A CE3 1 
ATOM   849   C  CZ2 . TRP A  1 110 ? -8.239  17.194  -13.070 1.00 23.12 ? 110  TRP A CZ2 1 
ATOM   850   C  CZ3 . TRP A  1 110 ? -7.099  18.650  -11.510 1.00 22.05 ? 110  TRP A CZ3 1 
ATOM   851   C  CH2 . TRP A  1 110 ? -7.419  17.372  -11.985 1.00 22.32 ? 110  TRP A CH2 1 
ATOM   852   N  N   . ALA A  1 111 ? -9.696  24.380  -12.322 1.00 23.85 ? 111  ALA A N   1 
ATOM   853   C  CA  . ALA A  1 111 ? -9.281  25.681  -11.849 1.00 24.44 ? 111  ALA A CA  1 
ATOM   854   C  C   . ALA A  1 111 ? -8.447  25.448  -10.610 1.00 23.84 ? 111  ALA A C   1 
ATOM   855   O  O   . ALA A  1 111 ? -8.367  24.325  -10.123 1.00 22.83 ? 111  ALA A O   1 
ATOM   856   C  CB  . ALA A  1 111 ? -10.485 26.534  -11.525 1.00 24.37 ? 111  ALA A CB  1 
ATOM   857   N  N   . CYS A  1 112 ? -7.810  26.504  -10.120 1.00 24.83 ? 112  CYS A N   1 
ATOM   858   C  CA  . CYS A  1 112 ? -7.013  26.450  -8.900  1.00 24.55 ? 112  CYS A CA  1 
ATOM   859   C  C   . CYS A  1 112 ? -7.669  27.323  -7.869  1.00 23.83 ? 112  CYS A C   1 
ATOM   860   O  O   . CYS A  1 112 ? -8.424  28.211  -8.233  1.00 24.31 ? 112  CYS A O   1 
ATOM   861   C  CB  . CYS A  1 112 ? -5.612  26.960  -9.168  1.00 26.66 ? 112  CYS A CB  1 
ATOM   862   S  SG  . CYS A  1 112 ? -4.900  26.258  -10.670 1.00 28.20 ? 112  CYS A SG  1 
ATOM   863   N  N   . PHE A  1 113 ? -7.384  27.082  -6.593  1.00 22.74 ? 113  PHE A N   1 
ATOM   864   C  CA  . PHE A  1 113 ? -8.036  27.834  -5.518  1.00 22.54 ? 113  PHE A CA  1 
ATOM   865   C  C   . PHE A  1 113 ? -7.231  27.874  -4.217  1.00 22.52 ? 113  PHE A C   1 
ATOM   866   O  O   . PHE A  1 113 ? -6.452  26.980  -3.929  1.00 22.09 ? 113  PHE A O   1 
ATOM   867   C  CB  . PHE A  1 113 ? -9.451  27.256  -5.239  1.00 21.39 ? 113  PHE A CB  1 
ATOM   868   C  CG  . PHE A  1 113 ? -9.445  26.030  -4.356  1.00 20.12 ? 113  PHE A CG  1 
ATOM   869   C  CD1 . PHE A  1 113 ? -9.137  24.783  -4.877  1.00 19.41 ? 113  PHE A CD1 1 
ATOM   870   C  CD2 . PHE A  1 113 ? -9.724  26.131  -2.994  1.00 19.83 ? 113  PHE A CD2 1 
ATOM   871   C  CE1 . PHE A  1 113 ? -9.098  23.659  -4.065  1.00 18.49 ? 113  PHE A CE1 1 
ATOM   872   C  CE2 . PHE A  1 113 ? -9.687  25.009  -2.174  1.00 18.90 ? 113  PHE A CE2 1 
ATOM   873   C  CZ  . PHE A  1 113 ? -9.380  23.767  -2.713  1.00 18.20 ? 113  PHE A CZ  1 
ATOM   874   N  N   . THR A  1 114 ? -7.443  28.920  -3.434  1.00 23.30 ? 114  THR A N   1 
ATOM   875   C  CA  . THR A  1 114 ? -6.927  28.990  -2.065  1.00 23.55 ? 114  THR A CA  1 
ATOM   876   C  C   . THR A  1 114 ? -8.104  29.181  -1.140  1.00 23.21 ? 114  THR A C   1 
ATOM   877   O  O   . THR A  1 114 ? -9.126  29.748  -1.524  1.00 23.29 ? 114  THR A O   1 
ATOM   878   C  CB  . THR A  1 114 ? -5.920  30.146  -1.831  1.00 25.30 ? 114  THR A CB  1 
ATOM   879   O  OG1 . THR A  1 114 ? -6.539  31.401  -2.123  1.00 26.41 ? 114  THR A OG1 1 
ATOM   880   C  CG2 . THR A  1 114 ? -4.704  29.999  -2.701  1.00 25.98 ? 114  THR A CG2 1 
ATOM   881   N  N   . GLY A  1 115 ? -7.947  28.704  0.083   1.00 23.01 ? 115  GLY A N   1 
ATOM   882   C  CA  . GLY A  1 115 ? -9.030  28.686  1.037   1.00 22.97 ? 115  GLY A CA  1 
ATOM   883   C  C   . GLY A  1 115 ? -8.642  29.363  2.333   1.00 24.37 ? 115  GLY A C   1 
ATOM   884   O  O   . GLY A  1 115 ? -7.538  29.178  2.837   1.00 24.81 ? 115  GLY A O   1 
ATOM   885   N  N   . LYS A  1 116 ? -9.564  30.157  2.864   1.00 25.50 ? 116  LYS A N   1 
ATOM   886   C  CA  . LYS A  1 116 ? -9.422  30.731  4.188   1.00 27.01 ? 116  LYS A CA  1 
ATOM   887   C  C   . LYS A  1 116 ? -10.678 30.432  4.984   1.00 26.75 ? 116  LYS A C   1 
ATOM   888   O  O   . LYS A  1 116 ? -11.790 30.682  4.527   1.00 26.42 ? 116  LYS A O   1 
ATOM   889   C  CB  . LYS A  1 116 ? -9.203  32.239  4.109   1.00 29.29 ? 116  LYS A CB  1 
ATOM   890   C  CG  . LYS A  1 116 ? -7.810  32.624  3.680   1.00 30.46 ? 116  LYS A CG  1 
ATOM   891   C  CD  . LYS A  1 116 ? -7.664  34.133  3.554   1.00 33.05 ? 116  LYS A CD  1 
ATOM   892   C  CE  . LYS A  1 116 ? -6.275  34.577  3.954   1.00 34.60 ? 116  LYS A CE  1 
ATOM   893   N  NZ  . LYS A  1 116 ? -5.985  35.975  3.531   1.00 36.80 ? 116  LYS A NZ  1 
ATOM   894   N  N   . LYS A  1 117 ? -10.477 29.881  6.173   1.00 26.88 ? 117  LYS A N   1 
ATOM   895   C  CA  . LYS A  1 117 ? -11.532 29.732  7.140   1.00 27.29 ? 117  LYS A CA  1 
ATOM   896   C  C   . LYS A  1 117 ? -11.695 31.066  7.785   1.00 29.70 ? 117  LYS A C   1 
ATOM   897   O  O   . LYS A  1 117 ? -10.727 31.596  8.321   1.00 31.23 ? 117  LYS A O   1 
ATOM   898   C  CB  . LYS A  1 117 ? -11.138 28.704  8.201   1.00 26.77 ? 117  LYS A CB  1 
ATOM   899   C  CG  . LYS A  1 117 ? -12.276 28.345  9.135   1.00 26.88 ? 117  LYS A CG  1 
ATOM   900   C  CD  . LYS A  1 117 ? -12.023 27.031  9.851   1.00 26.01 ? 117  LYS A CD  1 
ATOM   901   C  CE  . LYS A  1 117 ? -12.822 26.982  11.141  1.00 27.05 ? 117  LYS A CE  1 
ATOM   902   N  NZ  . LYS A  1 117 ? -12.445 25.798  11.968  1.00 26.70 ? 117  LYS A NZ  1 
ATOM   903   N  N   . VAL A  1 118 ? -12.872 31.662  7.739   1.00 30.86 ? 118  VAL A N   1 
ATOM   904   C  CA  . VAL A  1 118 ? -13.017 32.870  8.539   1.00 33.82 ? 118  VAL A CA  1 
ATOM   905   C  C   . VAL A  1 118 ? -14.292 32.824  9.366   1.00 35.03 ? 118  VAL A C   1 
ATOM   906   O  O   . VAL A  1 118 ? -15.373 32.508  8.850   1.00 34.55 ? 118  VAL A O   1 
ATOM   907   C  CB  . VAL A  1 118 ? -12.847 34.220  7.744   1.00 35.09 ? 118  VAL A CB  1 
ATOM   908   C  CG1 . VAL A  1 118 ? -12.747 35.405  8.713   1.00 37.65 ? 118  VAL A CG1 1 
ATOM   909   C  CG2 . VAL A  1 118 ? -11.596 34.216  6.858   1.00 34.29 ? 118  VAL A CG2 1 
ATOM   910   N  N   . GLY A  1 119 ? -14.123 33.114  10.662  1.00 37.26 ? 119  GLY A N   1 
ATOM   911   C  CA  . GLY A  1 119 ? -15.243 33.223  11.604  1.00 38.91 ? 119  GLY A CA  1 
ATOM   912   C  C   . GLY A  1 119 ? -14.809 33.835  12.920  1.00 41.26 ? 119  GLY A C   1 
ATOM   913   O  O   . GLY A  1 119 ? -14.394 33.118  13.831  1.00 41.67 ? 119  GLY A O   1 
ATOM   914   N  N   . HIS B  2 1   ? -23.869 -13.433 4.847   1.00 52.51 ? 206  HIS B N   1 
ATOM   915   C  CA  . HIS B  2 1   ? -22.841 -14.469 5.179   1.00 55.63 ? 206  HIS B CA  1 
ATOM   916   C  C   . HIS B  2 1   ? -21.442 -14.022 4.770   1.00 48.91 ? 206  HIS B C   1 
ATOM   917   O  O   . HIS B  2 1   ? -21.142 -13.920 3.585   1.00 50.17 ? 206  HIS B O   1 
ATOM   918   C  CB  . HIS B  2 1   ? -23.157 -15.813 4.496   1.00 63.21 ? 206  HIS B CB  1 
ATOM   919   C  CG  . HIS B  2 1   ? -22.034 -16.811 4.573   1.00 71.82 ? 206  HIS B CG  1 
ATOM   920   N  ND1 . HIS B  2 1   ? -21.096 -16.957 3.571   1.00 73.10 ? 206  HIS B ND1 1 
ATOM   921   C  CD2 . HIS B  2 1   ? -21.692 -17.701 5.538   1.00 77.26 ? 206  HIS B CD2 1 
ATOM   922   C  CE1 . HIS B  2 1   ? -20.230 -17.897 3.910   1.00 76.53 ? 206  HIS B CE1 1 
ATOM   923   N  NE2 . HIS B  2 1   ? -20.569 -18.365 5.100   1.00 79.89 ? 206  HIS B NE2 1 
ATOM   924   N  N   . LEU B  2 2   ? -20.600 -13.752 5.762   1.00 42.76 ? 207  LEU B N   1 
ATOM   925   C  CA  . LEU B  2 2   ? -19.171 -13.527 5.554   1.00 37.95 ? 207  LEU B CA  1 
ATOM   926   C  C   . LEU B  2 2   ? -18.440 -14.780 6.045   1.00 35.63 ? 207  LEU B C   1 
ATOM   927   O  O   . LEU B  2 2   ? -18.719 -15.264 7.143   1.00 36.10 ? 207  LEU B O   1 
ATOM   928   C  CB  . LEU B  2 2   ? -18.713 -12.302 6.346   1.00 36.58 ? 207  LEU B CB  1 
ATOM   929   C  CG  . LEU B  2 2   ? -17.967 -11.171 5.641   1.00 35.27 ? 207  LEU B CG  1 
ATOM   930   C  CD1 . LEU B  2 2   ? -18.511 -10.894 4.245   1.00 34.90 ? 207  LEU B CD1 1 
ATOM   931   C  CD2 . LEU B  2 2   ? -18.036 -9.910  6.502   1.00 34.30 ? 207  LEU B CD2 1 
ATOM   932   N  N   . PRO B  2 3   ? -17.512 -15.318 5.239   1.00 33.70 ? 208  PRO B N   1 
ATOM   933   C  CA  . PRO B  2 3   ? -16.776 -16.498 5.701   1.00 33.62 ? 208  PRO B CA  1 
ATOM   934   C  C   . PRO B  2 3   ? -15.822 -16.183 6.858   1.00 32.22 ? 208  PRO B C   1 
ATOM   935   O  O   . PRO B  2 3   ? -15.462 -15.023 7.067   1.00 30.18 ? 208  PRO B O   1 
ATOM   936   C  CB  . PRO B  2 3   ? -16.010 -16.960 4.461   1.00 33.77 ? 208  PRO B CB  1 
ATOM   937   C  CG  . PRO B  2 3   ? -15.925 -15.761 3.573   1.00 33.01 ? 208  PRO B CG  1 
ATOM   938   C  CD  . PRO B  2 3   ? -17.056 -14.837 3.922   1.00 32.83 ? 208  PRO B CD  1 
ATOM   939   N  N   . THR B  2 4   ? -15.440 -17.216 7.602   1.00 32.56 ? 209  THR B N   1 
ATOM   940   C  CA  . THR B  2 4   ? -14.585 -17.066 8.778   1.00 32.61 ? 209  THR B CA  1 
ATOM   941   C  C   . THR B  2 4   ? -13.132 -16.756 8.432   1.00 31.02 ? 209  THR B C   1 
ATOM   942   O  O   . THR B  2 4   ? -12.373 -16.287 9.275   1.00 30.88 ? 209  THR B O   1 
ATOM   943   C  CB  . THR B  2 4   ? -14.596 -18.352 9.626   1.00 35.04 ? 209  THR B CB  1 
ATOM   944   O  OG1 . THR B  2 4   ? -14.525 -19.490 8.759   1.00 35.70 ? 209  THR B OG1 1 
ATOM   945   C  CG2 . THR B  2 4   ? -15.864 -18.431 10.454  1.00 36.33 ? 209  THR B CG2 1 
ATOM   946   N  N   . SER B  2 5   ? -12.736 -17.058 7.203   1.00 29.97 ? 210  SER B N   1 
ATOM   947   C  CA  . SER B  2 5   ? -11.420 -16.696 6.717   1.00 28.58 ? 210  SER B CA  1 
ATOM   948   C  C   . SER B  2 5   ? -11.496 -16.381 5.231   1.00 26.97 ? 210  SER B C   1 
ATOM   949   O  O   . SER B  2 5   ? -12.431 -16.797 4.518   1.00 26.97 ? 210  SER B O   1 
ATOM   950   C  CB  . SER B  2 5   ? -10.404 -17.811 6.981   1.00 30.04 ? 210  SER B CB  1 
ATOM   951   O  OG  . SER B  2 5   ? -10.658 -18.949 6.169   1.00 31.14 ? 210  SER B OG  1 
ATOM   952   N  N   . TRP B  2 6   ? -10.511 -15.616 4.781   1.00 25.24 ? 211  TRP B N   1 
ATOM   953   C  CA  . TRP B  2 6   ? -10.469 -15.160 3.420   1.00 23.80 ? 211  TRP B CA  1 
ATOM   954   C  C   . TRP B  2 6   ? -9.041  -14.822 3.096   1.00 23.28 ? 211  TRP B C   1 
ATOM   955   O  O   . TRP B  2 6   ? -8.332  -14.265 3.928   1.00 22.95 ? 211  TRP B O   1 
ATOM   956   C  CB  . TRP B  2 6   ? -11.354 -13.928 3.222   1.00 22.46 ? 211  TRP B CB  1 
ATOM   957   C  CG  . TRP B  2 6   ? -11.532 -13.615 1.771   1.00 21.65 ? 211  TRP B CG  1 
ATOM   958   C  CD1 . TRP B  2 6   ? -10.817 -12.717 1.042   1.00 20.72 ? 211  TRP B CD1 1 
ATOM   959   C  CD2 . TRP B  2 6   ? -12.445 -14.246 0.856   1.00 21.81 ? 211  TRP B CD2 1 
ATOM   960   N  NE1 . TRP B  2 6   ? -11.234 -12.734 -0.255  1.00 20.42 ? 211  TRP B NE1 1 
ATOM   961   C  CE2 . TRP B  2 6   ? -12.237 -13.657 -0.401  1.00 21.18 ? 211  TRP B CE2 1 
ATOM   962   C  CE3 . TRP B  2 6   ? -13.414 -15.239 0.983   1.00 22.76 ? 211  TRP B CE3 1 
ATOM   963   C  CZ2 . TRP B  2 6   ? -12.972 -14.027 -1.540  1.00 21.39 ? 211  TRP B CZ2 1 
ATOM   964   C  CZ3 . TRP B  2 6   ? -14.158 -15.612 -0.153  1.00 22.99 ? 211  TRP B CZ3 1 
ATOM   965   C  CH2 . TRP B  2 6   ? -13.927 -15.004 -1.394  1.00 22.31 ? 211  TRP B CH2 1 
ATOM   966   N  N   . ASP B  2 7   ? -8.625  -15.165 1.884   1.00 23.18 ? 212  ASP B N   1 
ATOM   967   C  CA  . ASP B  2 7   ? -7.272  -14.906 1.434   1.00 22.96 ? 212  ASP B CA  1 
ATOM   968   C  C   . ASP B  2 7   ? -7.300  -14.692 -0.074  1.00 22.54 ? 212  ASP B C   1 
ATOM   969   O  O   . ASP B  2 7   ? -7.514  -15.627 -0.822  1.00 23.26 ? 212  ASP B O   1 
ATOM   970   C  CB  . ASP B  2 7   ? -6.415  -16.111 1.808   1.00 24.20 ? 212  ASP B CB  1 
ATOM   971   C  CG  . ASP B  2 7   ? -4.939  -15.798 1.864   1.00 24.33 ? 212  ASP B CG  1 
ATOM   972   O  OD1 . ASP B  2 7   ? -4.448  -14.956 1.064   1.00 23.53 ? 212  ASP B OD1 1 
ATOM   973   O  OD2 . ASP B  2 7   ? -4.269  -16.428 2.720   1.00 25.28 ? 212  ASP B OD2 1 
ATOM   974   N  N   . TRP B  2 8   ? -7.103  -13.460 -0.525  1.00 21.48 ? 213  TRP B N   1 
ATOM   975   C  CA  . TRP B  2 8   ? -7.090  -13.159 -1.970  1.00 21.15 ? 213  TRP B CA  1 
ATOM   976   C  C   . TRP B  2 8   ? -5.914  -13.802 -2.750  1.00 22.20 ? 213  TRP B C   1 
ATOM   977   O  O   . TRP B  2 8   ? -5.902  -13.756 -3.972  1.00 22.16 ? 213  TRP B O   1 
ATOM   978   C  CB  . TRP B  2 8   ? -7.145  -11.642 -2.231  1.00 19.77 ? 213  TRP B CB  1 
ATOM   979   C  CG  . TRP B  2 8   ? -8.542  -11.077 -2.162  1.00 19.05 ? 213  TRP B CG  1 
ATOM   980   C  CD1 . TRP B  2 8   ? -9.039  -10.223 -1.215  1.00 18.25 ? 213  TRP B CD1 1 
ATOM   981   C  CD2 . TRP B  2 8   ? -9.626  -11.340 -3.068  1.00 18.88 ? 213  TRP B CD2 1 
ATOM   982   N  NE1 . TRP B  2 8   ? -10.347 -9.939  -1.482  1.00 17.82 ? 213  TRP B NE1 1 
ATOM   983   C  CE2 . TRP B  2 8   ? -10.735 -10.607 -2.611  1.00 18.22 ? 213  TRP B CE2 1 
ATOM   984   C  CE3 . TRP B  2 8   ? -9.762  -12.131 -4.217  1.00 19.46 ? 213  TRP B CE3 1 
ATOM   985   C  CZ2 . TRP B  2 8   ? -11.975 -10.641 -3.258  1.00 18.24 ? 213  TRP B CZ2 1 
ATOM   986   C  CZ3 . TRP B  2 8   ? -10.979 -12.164 -4.864  1.00 19.31 ? 213  TRP B CZ3 1 
ATOM   987   C  CH2 . TRP B  2 8   ? -12.076 -11.420 -4.388  1.00 18.77 ? 213  TRP B CH2 1 
ATOM   988   N  N   . ARG B  2 9   ? -4.948  -14.405 -2.065  1.00 23.25 ? 214  ARG B N   1 
ATOM   989   C  CA  . ARG B  2 9   ? -3.934  -15.230 -2.762  1.00 24.62 ? 214  ARG B CA  1 
ATOM   990   C  C   . ARG B  2 9   ? -4.415  -16.650 -2.999  1.00 26.11 ? 214  ARG B C   1 
ATOM   991   O  O   . ARG B  2 9   ? -3.770  -17.407 -3.718  1.00 27.77 ? 214  ARG B O   1 
ATOM   992   C  CB  . ARG B  2 9   ? -2.619  -15.308 -1.978  1.00 24.97 ? 214  ARG B CB  1 
ATOM   993   C  CG  . ARG B  2 9   ? -2.011  -13.969 -1.621  1.00 24.09 ? 214  ARG B CG  1 
ATOM   994   C  CD  . ARG B  2 9   ? -0.930  -14.130 -0.557  1.00 24.77 ? 214  ARG B CD  1 
ATOM   995   N  NE  . ARG B  2 9   ? -1.464  -14.623 0.719   1.00 25.10 ? 214  ARG B NE  1 
ATOM   996   C  CZ  . ARG B  2 9   ? -0.729  -14.921 1.792   1.00 25.81 ? 214  ARG B CZ  1 
ATOM   997   N  NH1 . ARG B  2 9   ? 0.600   -14.787 1.781   1.00 26.31 ? 214  ARG B NH1 1 
ATOM   998   N  NH2 . ARG B  2 9   ? -1.329  -15.361 2.892   1.00 26.02 ? 214  ARG B NH2 1 
ATOM   999   N  N   . ASN B  2 10  ? -5.528  -17.019 -2.379  1.00 26.49 ? 215  ASN B N   1 
ATOM   1000  C  CA  . ASN B  2 10  ? -6.011  -18.402 -2.414  1.00 28.43 ? 215  ASN B CA  1 
ATOM   1001  C  C   . ASN B  2 10  ? -7.523  -18.419 -2.287  1.00 28.51 ? 215  ASN B C   1 
ATOM   1002  O  O   . ASN B  2 10  ? -8.078  -18.625 -1.208  1.00 29.27 ? 215  ASN B O   1 
ATOM   1003  C  CB  . ASN B  2 10  ? -5.353  -19.216 -1.289  1.00 29.58 ? 215  ASN B CB  1 
ATOM   1004  C  CG  . ASN B  2 10  ? -5.657  -20.696 -1.373  1.00 31.21 ? 215  ASN B CG  1 
ATOM   1005  O  OD1 . ASN B  2 10  ? -6.441  -21.141 -2.209  1.00 31.74 ? 215  ASN B OD1 1 
ATOM   1006  N  ND2 . ASN B  2 10  ? -5.034  -21.470 -0.504  1.00 32.35 ? 215  ASN B ND2 1 
ATOM   1007  N  N   . VAL B  2 11  ? -8.176  -18.141 -3.404  1.00 28.97 ? 216  VAL B N   1 
ATOM   1008  C  CA  . VAL B  2 11  ? -9.620  -18.175 -3.495  1.00 29.67 ? 216  VAL B CA  1 
ATOM   1009  C  C   . VAL B  2 11  ? -9.939  -19.441 -4.253  1.00 32.23 ? 216  VAL B C   1 
ATOM   1010  O  O   . VAL B  2 11  ? -9.905  -19.469 -5.488  1.00 32.47 ? 216  VAL B O   1 
ATOM   1011  C  CB  . VAL B  2 11  ? -10.179 -16.951 -4.232  1.00 28.31 ? 216  VAL B CB  1 
ATOM   1012  C  CG1 . VAL B  2 11  ? -11.699 -17.033 -4.325  1.00 28.42 ? 216  VAL B CG1 1 
ATOM   1013  C  CG2 . VAL B  2 11  ? -9.742  -15.675 -3.523  1.00 26.99 ? 216  VAL B CG2 1 
ATOM   1014  N  N   . HIS B  2 12  ? -10.214 -20.495 -3.491  1.00 35.41 ? 217  HIS B N   1 
ATOM   1015  C  CA  . HIS B  2 12  ? -10.383 -21.838 -4.025  1.00 38.58 ? 217  HIS B CA  1 
ATOM   1016  C  C   . HIS B  2 12  ? -9.387  -22.122 -5.153  1.00 37.86 ? 217  HIS B C   1 
ATOM   1017  O  O   . HIS B  2 12  ? -9.764  -22.437 -6.288  1.00 38.43 ? 217  HIS B O   1 
ATOM   1018  C  CB  . HIS B  2 12  ? -11.853 -22.086 -4.393  1.00 40.89 ? 217  HIS B CB  1 
ATOM   1019  C  CG  . HIS B  2 12  ? -12.719 -22.288 -3.184  1.00 43.64 ? 217  HIS B CG  1 
ATOM   1020  N  ND1 . HIS B  2 12  ? -13.356 -21.246 -2.540  1.00 43.59 ? 217  HIS B ND1 1 
ATOM   1021  C  CD2 . HIS B  2 12  ? -12.984 -23.401 -2.454  1.00 46.64 ? 217  HIS B CD2 1 
ATOM   1022  C  CE1 . HIS B  2 12  ? -14.003 -21.714 -1.486  1.00 46.02 ? 217  HIS B CE1 1 
ATOM   1023  N  NE2 . HIS B  2 12  ? -13.795 -23.018 -1.412  1.00 47.23 ? 217  HIS B NE2 1 
ATOM   1024  N  N   . GLY B  2 13  ? -8.107  -21.950 -4.802  1.00 36.70 ? 218  GLY B N   1 
ATOM   1025  C  CA  . GLY B  2 13  ? -6.973  -22.321 -5.651  1.00 36.63 ? 218  GLY B CA  1 
ATOM   1026  C  C   . GLY B  2 13  ? -6.288  -21.189 -6.399  1.00 34.31 ? 218  GLY B C   1 
ATOM   1027  O  O   . GLY B  2 13  ? -5.124  -21.316 -6.780  1.00 34.57 ? 218  GLY B O   1 
ATOM   1028  N  N   . ILE B  2 14  ? -6.996  -20.084 -6.613  1.00 31.84 ? 219  ILE B N   1 
ATOM   1029  C  CA  . ILE B  2 14  ? -6.515  -19.051 -7.516  1.00 30.30 ? 219  ILE B CA  1 
ATOM   1030  C  C   . ILE B  2 14  ? -5.969  -17.845 -6.753  1.00 28.62 ? 219  ILE B C   1 
ATOM   1031  O  O   . ILE B  2 14  ? -6.531  -17.430 -5.728  1.00 27.56 ? 219  ILE B O   1 
ATOM   1032  C  CB  . ILE B  2 14  ? -7.636  -18.634 -8.481  1.00 29.89 ? 219  ILE B CB  1 
ATOM   1033  C  CG1 . ILE B  2 14  ? -8.084  -19.855 -9.309  1.00 31.33 ? 219  ILE B CG1 1 
ATOM   1034  C  CG2 . ILE B  2 14  ? -7.171  -17.510 -9.396  1.00 28.97 ? 219  ILE B CG2 1 
ATOM   1035  C  CD1 . ILE B  2 14  ? -9.584  -20.042 -9.333  1.00 31.42 ? 219  ILE B CD1 1 
ATOM   1036  N  N   . ASN B  2 15  ? -4.864  -17.297 -7.265  1.00 27.87 ? 220  ASN B N   1 
ATOM   1037  C  CA  . ASN B  2 15  ? -4.251  -16.096 -6.712  1.00 26.38 ? 220  ASN B CA  1 
ATOM   1038  C  C   . ASN B  2 15  ? -4.671  -14.856 -7.501  1.00 25.05 ? 220  ASN B C   1 
ATOM   1039  O  O   . ASN B  2 15  ? -4.600  -14.837 -8.730  1.00 25.47 ? 220  ASN B O   1 
ATOM   1040  C  CB  . ASN B  2 15  ? -2.724  -16.212 -6.699  1.00 26.83 ? 220  ASN B CB  1 
ATOM   1041  C  CG  . ASN B  2 15  ? -2.046  -14.883 -6.405  1.00 25.90 ? 220  ASN B CG  1 
ATOM   1042  O  OD1 . ASN B  2 15  ? -2.243  -14.291 -5.344  1.00 25.08 ? 220  ASN B OD1 1 
ATOM   1043  N  ND2 . ASN B  2 15  ? -1.263  -14.393 -7.357  1.00 26.04 ? 220  ASN B ND2 1 
ATOM   1044  N  N   . PHE B  2 16  ? -5.078  -13.813 -6.786  1.00 23.49 ? 221  PHE B N   1 
ATOM   1045  C  CA  . PHE B  2 16  ? -5.472  -12.564 -7.411  1.00 22.34 ? 221  PHE B CA  1 
ATOM   1046  C  C   . PHE B  2 16  ? -4.565  -11.398 -7.037  1.00 21.62 ? 221  PHE B C   1 
ATOM   1047  O  O   . PHE B  2 16  ? -4.818  -10.277 -7.455  1.00 20.43 ? 221  PHE B O   1 
ATOM   1048  C  CB  . PHE B  2 16  ? -6.914  -12.241 -7.022  1.00 21.57 ? 221  PHE B CB  1 
ATOM   1049  C  CG  . PHE B  2 16  ? -7.916  -13.110 -7.695  1.00 22.05 ? 221  PHE B CG  1 
ATOM   1050  C  CD1 . PHE B  2 16  ? -8.290  -12.857 -9.003  1.00 22.11 ? 221  PHE B CD1 1 
ATOM   1051  C  CD2 . PHE B  2 16  ? -8.484  -14.184 -7.032  1.00 22.60 ? 221  PHE B CD2 1 
ATOM   1052  C  CE1 . PHE B  2 16  ? -9.215  -13.669 -9.642  1.00 22.71 ? 221  PHE B CE1 1 
ATOM   1053  C  CE2 . PHE B  2 16  ? -9.409  -14.998 -7.663  1.00 23.25 ? 221  PHE B CE2 1 
ATOM   1054  C  CZ  . PHE B  2 16  ? -9.776  -14.742 -8.969  1.00 23.20 ? 221  PHE B CZ  1 
ATOM   1055  N  N   . VAL B  2 17  ? -3.528  -11.663 -6.241  1.00 22.23 ? 222  VAL B N   1 
ATOM   1056  C  CA  . VAL B  2 17  ? -2.637  -10.616 -5.736  1.00 21.92 ? 222  VAL B CA  1 
ATOM   1057  C  C   . VAL B  2 17  ? -1.319  -10.633 -6.487  1.00 22.75 ? 222  VAL B C   1 
ATOM   1058  O  O   . VAL B  2 17  ? -0.726  -11.688 -6.679  1.00 23.63 ? 222  VAL B O   1 
ATOM   1059  C  CB  . VAL B  2 17  ? -2.359  -10.777 -4.233  1.00 21.90 ? 222  VAL B CB  1 
ATOM   1060  C  CG1 . VAL B  2 17  ? -1.578  -9.581  -3.707  1.00 21.56 ? 222  VAL B CG1 1 
ATOM   1061  C  CG2 . VAL B  2 17  ? -3.668  -10.931 -3.480  1.00 21.47 ? 222  VAL B CG2 1 
ATOM   1062  N  N   . SER B  2 18  ? -0.875  -9.450  -6.900  1.00 22.59 ? 223  SER B N   1 
ATOM   1063  C  CA  . SER B  2 18  ? 0.361   -9.293  -7.667  1.00 23.53 ? 223  SER B CA  1 
ATOM   1064  C  C   . SER B  2 18  ? 1.604   -9.505  -6.775  1.00 24.22 ? 223  SER B C   1 
ATOM   1065  O  O   . SER B  2 18  ? 1.505   -9.467  -5.553  1.00 24.12 ? 223  SER B O   1 
ATOM   1066  C  CB  . SER B  2 18  ? 0.389   -7.894  -8.273  1.00 23.05 ? 223  SER B CB  1 
ATOM   1067  O  OG  . SER B  2 18  ? 0.646   -6.945  -7.250  1.00 22.66 ? 223  SER B OG  1 
ATOM   1068  N  N   . PRO B  2 19  ? 2.784   -9.714  -7.383  1.00 25.49 ? 224  PRO B N   1 
ATOM   1069  C  CA  . PRO B  2 19  ? 3.935   -10.082 -6.546  1.00 26.33 ? 224  PRO B CA  1 
ATOM   1070  C  C   . PRO B  2 19  ? 4.397   -8.988  -5.566  1.00 25.76 ? 224  PRO B C   1 
ATOM   1071  O  O   . PRO B  2 19  ? 4.198   -7.788  -5.811  1.00 25.24 ? 224  PRO B O   1 
ATOM   1072  C  CB  . PRO B  2 19  ? 5.039   -10.389 -7.571  1.00 27.58 ? 224  PRO B CB  1 
ATOM   1073  C  CG  . PRO B  2 19  ? 4.351   -10.514 -8.891  1.00 27.42 ? 224  PRO B CG  1 
ATOM   1074  C  CD  . PRO B  2 19  ? 3.147   -9.638  -8.809  1.00 26.09 ? 224  PRO B CD  1 
ATOM   1075  N  N   . VAL B  2 20  ? 4.999   -9.419  -4.459  1.00 25.94 ? 225  VAL B N   1 
ATOM   1076  C  CA  . VAL B  2 20  ? 5.558   -8.500  -3.474  1.00 25.57 ? 225  VAL B CA  1 
ATOM   1077  C  C   . VAL B  2 20  ? 6.725   -7.733  -4.096  1.00 26.09 ? 225  VAL B C   1 
ATOM   1078  O  O   . VAL B  2 20  ? 7.481   -8.265  -4.899  1.00 27.89 ? 225  VAL B O   1 
ATOM   1079  C  CB  . VAL B  2 20  ? 5.997   -9.246  -2.190  1.00 26.02 ? 225  VAL B CB  1 
ATOM   1080  C  CG1 . VAL B  2 20  ? 6.823   -8.355  -1.266  1.00 26.09 ? 225  VAL B CG1 1 
ATOM   1081  C  CG2 . VAL B  2 20  ? 4.782   -9.775  -1.445  1.00 25.40 ? 225  VAL B CG2 1 
ATOM   1082  N  N   . ARG B  2 21  ? 6.851   -6.470  -3.728  1.00 25.38 ? 226  ARG B N   1 
ATOM   1083  C  CA  . ARG B  2 21  ? 7.888   -5.606  -4.257  1.00 25.76 ? 226  ARG B CA  1 
ATOM   1084  C  C   . ARG B  2 21  ? 8.691   -4.970  -3.114  1.00 25.87 ? 226  ARG B C   1 
ATOM   1085  O  O   . ARG B  2 21  ? 8.369   -5.139  -1.938  1.00 25.14 ? 226  ARG B O   1 
ATOM   1086  C  CB  . ARG B  2 21  ? 7.263   -4.522  -5.133  1.00 25.07 ? 226  ARG B CB  1 
ATOM   1087  C  CG  . ARG B  2 21  ? 6.469   -5.057  -6.308  1.00 25.11 ? 226  ARG B CG  1 
ATOM   1088  C  CD  . ARG B  2 21  ? 6.202   -3.979  -7.347  1.00 25.04 ? 226  ARG B CD  1 
ATOM   1089  N  NE  . ARG B  2 21  ? 7.452   -3.553  -7.990  1.00 26.17 ? 226  ARG B NE  1 
ATOM   1090  C  CZ  . ARG B  2 21  ? 7.532   -2.651  -8.963  1.00 26.58 ? 226  ARG B CZ  1 
ATOM   1091  N  NH1 . ARG B  2 21  ? 6.438   -2.062  -9.445  1.00 26.17 ? 226  ARG B NH1 1 
ATOM   1092  N  NH2 . ARG B  2 21  ? 8.714   -2.327  -9.454  1.00 27.90 ? 226  ARG B NH2 1 
ATOM   1093  N  N   . ASN B  2 22  ? 9.746   -4.251  -3.479  1.00 26.59 ? 227  ASN B N   1 
ATOM   1094  C  CA  . ASN B  2 22  ? 10.600  -3.573  -2.519  1.00 27.26 ? 227  ASN B CA  1 
ATOM   1095  C  C   . ASN B  2 22  ? 10.624  -2.077  -2.833  1.00 27.05 ? 227  ASN B C   1 
ATOM   1096  O  O   . ASN B  2 22  ? 11.092  -1.668  -3.876  1.00 27.51 ? 227  ASN B O   1 
ATOM   1097  C  CB  . ASN B  2 22  ? 12.014  -4.165  -2.576  1.00 28.73 ? 227  ASN B CB  1 
ATOM   1098  C  CG  . ASN B  2 22  ? 12.939  -3.591  -1.516  1.00 29.47 ? 227  ASN B CG  1 
ATOM   1099  O  OD1 . ASN B  2 22  ? 12.523  -3.311  -0.397  1.00 29.21 ? 227  ASN B OD1 1 
ATOM   1100  N  ND2 . ASN B  2 22  ? 14.208  -3.420  -1.869  1.00 30.79 ? 227  ASN B ND2 1 
ATOM   1101  N  N   . GLN B  2 23  ? 10.092  -1.270  -1.931  1.00 26.64 ? 228  GLN B N   1 
ATOM   1102  C  CA  . GLN B  2 23  ? 10.101  0.185   -2.087  1.00 26.52 ? 228  GLN B CA  1 
ATOM   1103  C  C   . GLN B  2 23  ? 11.494  0.798   -1.868  1.00 27.77 ? 228  GLN B C   1 
ATOM   1104  O  O   . GLN B  2 23  ? 11.732  1.961   -2.221  1.00 28.14 ? 228  GLN B O   1 
ATOM   1105  C  CB  . GLN B  2 23  ? 9.116   0.805   -1.100  1.00 25.76 ? 228  GLN B CB  1 
ATOM   1106  C  CG  . GLN B  2 23  ? 9.528   0.637   0.359   1.00 26.23 ? 228  GLN B CG  1 
ATOM   1107  C  CD  . GLN B  2 23  ? 8.568   1.295   1.303   1.00 25.54 ? 228  GLN B CD  1 
ATOM   1108  O  OE1 . GLN B  2 23  ? 7.539   0.733   1.642   1.00 24.84 ? 228  GLN B OE1 1 
ATOM   1109  N  NE2 . GLN B  2 23  ? 8.893   2.495   1.724   1.00 25.99 ? 228  GLN B NE2 1 
ATOM   1110  N  N   . ALA B  2 24  ? 12.405  0.033   -1.268  1.00 28.62 ? 229  ALA B N   1 
ATOM   1111  C  CA  . ALA B  2 24  ? 13.778  0.507   -1.011  1.00 29.98 ? 229  ALA B CA  1 
ATOM   1112  C  C   . ALA B  2 24  ? 13.763  1.692   -0.023  1.00 29.80 ? 229  ALA B C   1 
ATOM   1113  O  O   . ALA B  2 24  ? 12.850  1.773   0.784   1.00 28.99 ? 229  ALA B O   1 
ATOM   1114  C  CB  . ALA B  2 24  ? 14.471  0.843   -2.327  1.00 30.81 ? 229  ALA B CB  1 
ATOM   1115  N  N   . SER B  2 25  ? 14.735  2.604   -0.049  1.00 31.08 ? 230  SER B N   1 
ATOM   1116  C  CA  . SER B  2 25  ? 14.753  3.669   0.980   1.00 31.37 ? 230  SER B CA  1 
ATOM   1117  C  C   . SER B  2 25  ? 13.749  4.822   0.761   1.00 30.75 ? 230  SER B C   1 
ATOM   1118  O  O   . SER B  2 25  ? 13.349  5.488   1.718   1.00 30.81 ? 230  SER B O   1 
ATOM   1119  C  CB  . SER B  2 25  ? 16.178  4.179   1.277   1.00 32.81 ? 230  SER B CB  1 
ATOM   1120  O  OG  . SER B  2 25  ? 16.887  4.549   0.121   1.00 33.58 ? 230  SER B OG  1 
ATOM   1121  N  N   . CYS B  2 26  ? 13.317  5.033   -0.476  1.00 30.68 ? 231  CYS B N   1 
ATOM   1122  C  CA  . CYS B  2 26  ? 12.268  6.006   -0.789  1.00 29.67 ? 231  CYS B CA  1 
ATOM   1123  C  C   . CYS B  2 26  ? 11.090  5.782   0.149   1.00 28.18 ? 231  CYS B C   1 
ATOM   1124  O  O   . CYS B  2 26  ? 10.761  4.648   0.469   1.00 28.01 ? 231  CYS B O   1 
ATOM   1125  C  CB  . CYS B  2 26  ? 11.840  5.825   -2.251  1.00 29.70 ? 231  CYS B CB  1 
ATOM   1126  S  SG  . CYS B  2 26  ? 10.769  7.084   -3.003  1.00 29.32 ? 231  CYS B SG  1 
ATOM   1127  N  N   . GLY B  2 27  ? 10.456  6.853   0.606   1.00 27.45 ? 232  GLY B N   1 
ATOM   1128  C  CA  . GLY B  2 27  ? 9.221   6.719   1.371   1.00 26.25 ? 232  GLY B CA  1 
ATOM   1129  C  C   . GLY B  2 27  ? 7.999   6.600   0.458   1.00 25.09 ? 232  GLY B C   1 
ATOM   1130  O  O   . GLY B  2 27  ? 7.135   7.474   0.470   1.00 24.31 ? 232  GLY B O   1 
ATOM   1131  N  N   . SER B  2 28  ? 7.919   5.507   -0.304  1.00 24.68 ? 233  SER B N   1 
ATOM   1132  C  CA  . SER B  2 28  ? 6.881   5.319   -1.323  1.00 23.78 ? 233  SER B CA  1 
ATOM   1133  C  C   . SER B  2 28  ? 5.810   4.285   -0.953  1.00 22.71 ? 233  SER B C   1 
ATOM   1134  O  O   . SER B  2 28  ? 5.065   3.808   -1.812  1.00 22.18 ? 233  SER B O   1 
ATOM   1135  C  CB  . SER B  2 28  ? 7.546   4.918   -2.648  1.00 24.34 ? 233  SER B CB  1 
ATOM   1136  O  OG  . SER B  2 28  ? 8.540   3.946   -2.422  1.00 24.98 ? 233  SER B OG  1 
ATOM   1137  N  N   . CYS B  2 29  ? 5.709   3.941   0.320   1.00 22.85 ? 234  CYS B N   1 
ATOM   1138  C  CA  . CYS B  2 29  ? 4.759   2.919   0.740   1.00 22.05 ? 234  CYS B CA  1 
ATOM   1139  C  C   . CYS B  2 29  ? 3.334   3.234   0.259   1.00 20.46 ? 234  CYS B C   1 
ATOM   1140  O  O   . CYS B  2 29  ? 2.591   2.338   -0.135  1.00 19.85 ? 234  CYS B O   1 
ATOM   1141  C  CB  . CYS B  2 29  ? 4.791   2.778   2.260   1.00 22.44 ? 234  CYS B CB  1 
ATOM   1142  S  SG  . CYS B  2 29  ? 4.464   4.323   3.128   1.00 24.09 ? 234  CYS B SG  1 
ATOM   1143  N  N   . TYR B  2 30  ? 2.972   4.512   0.288   1.00 19.83 ? 235  TYR B N   1 
ATOM   1144  C  CA  . TYR B  2 30  ? 1.640   4.954   -0.115  1.00 18.80 ? 235  TYR B CA  1 
ATOM   1145  C  C   . TYR B  2 30  ? 1.385   4.621   -1.593  1.00 18.60 ? 235  TYR B C   1 
ATOM   1146  O  O   . TYR B  2 30  ? 0.263   4.304   -1.994  1.00 17.68 ? 235  TYR B O   1 
ATOM   1147  C  CB  . TYR B  2 30  ? 1.468   6.457   0.141   1.00 18.70 ? 235  TYR B CB  1 
ATOM   1148  C  CG  . TYR B  2 30  ? 2.324   7.323   -0.750  1.00 19.31 ? 235  TYR B CG  1 
ATOM   1149  C  CD1 . TYR B  2 30  ? 3.629   7.655   -0.392  1.00 20.18 ? 235  TYR B CD1 1 
ATOM   1150  C  CD2 . TYR B  2 30  ? 1.835   7.799   -1.955  1.00 19.12 ? 235  TYR B CD2 1 
ATOM   1151  C  CE1 . TYR B  2 30  ? 4.427   8.432   -1.217  1.00 20.89 ? 235  TYR B CE1 1 
ATOM   1152  C  CE2 . TYR B  2 30  ? 2.619   8.571   -2.792  1.00 19.94 ? 235  TYR B CE2 1 
ATOM   1153  C  CZ  . TYR B  2 30  ? 3.916   8.888   -2.412  1.00 20.79 ? 235  TYR B CZ  1 
ATOM   1154  O  OH  . TYR B  2 30  ? 4.674   9.663   -3.229  1.00 21.60 ? 235  TYR B OH  1 
ATOM   1155  N  N   . SER B  2 31  ? 2.443   4.698   -2.389  1.00 19.12 ? 236  SER B N   1 
ATOM   1156  C  CA  . SER B  2 31  ? 2.354   4.414   -3.802  1.00 19.17 ? 236  SER B CA  1 
ATOM   1157  C  C   . SER B  2 31  ? 2.239   2.919   -4.047  1.00 18.71 ? 236  SER B C   1 
ATOM   1158  O  O   . SER B  2 31  ? 1.430   2.498   -4.847  1.00 18.05 ? 236  SER B O   1 
ATOM   1159  C  CB  . SER B  2 31  ? 3.589   4.952   -4.535  1.00 20.33 ? 236  SER B CB  1 
ATOM   1160  O  OG  . SER B  2 31  ? 3.321   4.926   -5.922  1.00 20.82 ? 236  SER B OG  1 
ATOM   1161  N  N   . PHE B  2 32  ? 3.065   2.139   -3.350  1.00 18.88 ? 237  PHE B N   1 
ATOM   1162  C  CA  . PHE B  2 32  ? 3.075   0.688   -3.492  1.00 18.91 ? 237  PHE B CA  1 
ATOM   1163  C  C   . PHE B  2 32  ? 1.767   0.041   -3.045  1.00 17.91 ? 237  PHE B C   1 
ATOM   1164  O  O   . PHE B  2 32  ? 1.249   -0.854  -3.727  1.00 17.66 ? 237  PHE B O   1 
ATOM   1165  C  CB  . PHE B  2 32  ? 4.265   0.072   -2.747  1.00 19.79 ? 237  PHE B CB  1 
ATOM   1166  C  CG  . PHE B  2 32  ? 5.549   0.124   -3.531  1.00 20.92 ? 237  PHE B CG  1 
ATOM   1167  C  CD1 . PHE B  2 32  ? 6.268   1.299   -3.626  1.00 21.42 ? 237  PHE B CD1 1 
ATOM   1168  C  CD2 . PHE B  2 32  ? 6.009   -0.984  -4.210  1.00 21.55 ? 237  PHE B CD2 1 
ATOM   1169  C  CE1 . PHE B  2 32  ? 7.428   1.356   -4.359  1.00 22.54 ? 237  PHE B CE1 1 
ATOM   1170  C  CE2 . PHE B  2 32  ? 7.174   -0.932  -4.942  1.00 22.61 ? 237  PHE B CE2 1 
ATOM   1171  C  CZ  . PHE B  2 32  ? 7.890   0.236   -5.014  1.00 23.13 ? 237  PHE B CZ  1 
ATOM   1172  N  N   . ALA B  2 33  ? 1.243   0.497   -1.906  1.00 17.23 ? 238  ALA B N   1 
ATOM   1173  C  CA  . ALA B  2 33  ? -0.062  0.048   -1.412  1.00 16.46 ? 238  ALA B CA  1 
ATOM   1174  C  C   . ALA B  2 33  ? -1.203  0.428   -2.371  1.00 15.91 ? 238  ALA B C   1 
ATOM   1175  O  O   . ALA B  2 33  ? -2.102  -0.370  -2.620  1.00 15.67 ? 238  ALA B O   1 
ATOM   1176  C  CB  . ALA B  2 33  ? -0.329  0.630   -0.039  1.00 16.25 ? 238  ALA B CB  1 
ATOM   1177  N  N   . SER B  2 34  ? -1.163  1.649   -2.884  1.00 15.75 ? 239  SER B N   1 
ATOM   1178  C  CA  . SER B  2 34  ? -2.112  2.107   -3.898  1.00 15.51 ? 239  SER B CA  1 
ATOM   1179  C  C   . SER B  2 34  ? -2.083  1.268   -5.179  1.00 15.76 ? 239  SER B C   1 
ATOM   1180  O  O   . SER B  2 34  ? -3.117  0.831   -5.661  1.00 15.49 ? 239  SER B O   1 
ATOM   1181  C  CB  . SER B  2 34  ? -1.857  3.588   -4.230  1.00 15.67 ? 239  SER B CB  1 
ATOM   1182  O  OG  . SER B  2 34  ? -2.296  4.407   -3.158  1.00 15.33 ? 239  SER B OG  1 
ATOM   1183  N  N   . MET B  2 35  ? -0.893  1.069   -5.732  1.00 16.50 ? 240  MET B N   1 
ATOM   1184  C  CA  . MET B  2 35  ? -0.724  0.265   -6.937  1.00 16.95 ? 240  MET B CA  1 
ATOM   1185  C  C   . MET B  2 35  ? -1.150  -1.180  -6.689  1.00 16.78 ? 240  MET B C   1 
ATOM   1186  O  O   . MET B  2 35  ? -1.831  -1.774  -7.518  1.00 16.83 ? 240  MET B O   1 
ATOM   1187  C  CB  . MET B  2 35  ? 0.735   0.275   -7.401  1.00 17.80 ? 240  MET B CB  1 
ATOM   1188  C  CG  . MET B  2 35  ? 1.287   1.634   -7.814  1.00 18.25 ? 240  MET B CG  1 
ATOM   1189  S  SD  . MET B  2 35  ? 0.260   2.542   -8.980  1.00 18.34 ? 240  MET B SD  1 
ATOM   1190  C  CE  . MET B  2 35  ? -0.782  3.485   -7.861  1.00 17.51 ? 240  MET B CE  1 
ATOM   1191  N  N   . GLY B  2 36  ? -0.740  -1.749  -5.559  1.00 16.69 ? 241  GLY B N   1 
ATOM   1192  C  CA  . GLY B  2 36  ? -1.141  -3.111  -5.216  1.00 16.76 ? 241  GLY B CA  1 
ATOM   1193  C  C   . GLY B  2 36  ? -2.648  -3.321  -5.130  1.00 16.14 ? 241  GLY B C   1 
ATOM   1194  O  O   . GLY B  2 36  ? -3.148  -4.356  -5.538  1.00 16.61 ? 241  GLY B O   1 
ATOM   1195  N  N   . MET B  2 37  ? -3.375  -2.332  -4.610  1.00 15.46 ? 242  MET B N   1 
ATOM   1196  C  CA  . MET B  2 37  ? -4.823  -2.423  -4.538  1.00 14.92 ? 242  MET B CA  1 
ATOM   1197  C  C   . MET B  2 37  ? -5.460  -2.414  -5.913  1.00 14.88 ? 242  MET B C   1 
ATOM   1198  O  O   . MET B  2 37  ? -6.349  -3.211  -6.199  1.00 14.83 ? 242  MET B O   1 
ATOM   1199  C  CB  . MET B  2 37  ? -5.431  -1.283  -3.710  1.00 14.44 ? 242  MET B CB  1 
ATOM   1200  C  CG  . MET B  2 37  ? -6.915  -1.124  -3.980  1.00 14.08 ? 242  MET B CG  1 
ATOM   1201  S  SD  . MET B  2 37  ? -7.772  -0.124  -2.779  1.00 13.88 ? 242  MET B SD  1 
ATOM   1202  C  CE  . MET B  2 37  ? -7.208  1.507   -3.233  1.00 13.71 ? 242  MET B CE  1 
ATOM   1203  N  N   . LEU B  2 38  ? -5.039  -1.490  -6.758  1.00 14.93 ? 243  LEU B N   1 
ATOM   1204  C  CA  . LEU B  2 38  ? -5.604  -1.412  -8.099  1.00 15.07 ? 243  LEU B CA  1 
ATOM   1205  C  C   . LEU B  2 38  ? -5.210  -2.633  -8.957  1.00 15.67 ? 243  LEU B C   1 
ATOM   1206  O  O   . LEU B  2 38  ? -6.020  -3.128  -9.747  1.00 15.69 ? 243  LEU B O   1 
ATOM   1207  C  CB  . LEU B  2 38  ? -5.228  -0.091  -8.764  1.00 15.19 ? 243  LEU B CB  1 
ATOM   1208  C  CG  . LEU B  2 38  ? -5.681  1.143   -7.975  1.00 14.78 ? 243  LEU B CG  1 
ATOM   1209  C  CD1 . LEU B  2 38  ? -5.107  2.414   -8.556  1.00 15.21 ? 243  LEU B CD1 1 
ATOM   1210  C  CD2 . LEU B  2 38  ? -7.201  1.247   -7.922  1.00 14.43 ? 243  LEU B CD2 1 
ATOM   1211  N  N   . GLU B  2 39  ? -3.987  -3.125  -8.780  1.00 16.20 ? 244  GLU B N   1 
ATOM   1212  C  CA  . GLU B  2 39  ? -3.520  -4.281  -9.535  1.00 16.96 ? 244  GLU B CA  1 
ATOM   1213  C  C   . GLU B  2 39  ? -4.340  -5.515  -9.151  1.00 16.80 ? 244  GLU B C   1 
ATOM   1214  O  O   . GLU B  2 39  ? -4.878  -6.201  -10.013 1.00 17.10 ? 244  GLU B O   1 
ATOM   1215  C  CB  . GLU B  2 39  ? -2.040  -4.535  -9.285  1.00 17.81 ? 244  GLU B CB  1 
ATOM   1216  C  CG  . GLU B  2 39  ? -1.106  -3.532  -9.934  1.00 18.48 ? 244  GLU B CG  1 
ATOM   1217  C  CD  . GLU B  2 39  ? 0.314   -3.557  -9.345  1.00 19.46 ? 244  GLU B CD  1 
ATOM   1218  O  OE1 . GLU B  2 39  ? 0.564   -4.295  -8.358  1.00 19.48 ? 244  GLU B OE1 1 
ATOM   1219  O  OE2 . GLU B  2 39  ? 1.205   -2.830  -9.870  1.00 20.75 ? 244  GLU B OE2 1 
ATOM   1220  N  N   . ALA B  2 40  ? -4.457  -5.767  -7.849  1.00 16.37 ? 245  ALA B N   1 
ATOM   1221  C  CA  . ALA B  2 40  ? -5.231  -6.890  -7.362  1.00 16.42 ? 245  ALA B CA  1 
ATOM   1222  C  C   . ALA B  2 40  ? -6.658  -6.786  -7.858  1.00 16.12 ? 245  ALA B C   1 
ATOM   1223  O  O   . ALA B  2 40  ? -7.232  -7.766  -8.324  1.00 16.57 ? 245  ALA B O   1 
ATOM   1224  C  CB  . ALA B  2 40  ? -5.214  -6.932  -5.848  1.00 16.14 ? 245  ALA B CB  1 
ATOM   1225  N  N   . ARG B  2 41  ? -7.233  -5.585  -7.756  1.00 15.46 ? 246  ARG B N   1 
ATOM   1226  C  CA  . ARG B  2 41  ? -8.624  -5.383  -8.140  1.00 15.19 ? 246  ARG B CA  1 
ATOM   1227  C  C   . ARG B  2 41  ? -8.877  -5.535  -9.636  1.00 15.68 ? 246  ARG B C   1 
ATOM   1228  O  O   . ARG B  2 41  ? -9.941  -6.023  -10.010 1.00 15.81 ? 246  ARG B O   1 
ATOM   1229  C  CB  . ARG B  2 41  ? -9.151  -4.049  -7.619  1.00 14.51 ? 246  ARG B CB  1 
ATOM   1230  C  CG  . ARG B  2 41  ? -9.408  -4.089  -6.123  1.00 14.13 ? 246  ARG B CG  1 
ATOM   1231  C  CD  . ARG B  2 41  ? -9.958  -2.794  -5.580  1.00 13.54 ? 246  ARG B CD  1 
ATOM   1232  N  NE  . ARG B  2 41  ? -10.316 -2.987  -4.180  1.00 13.35 ? 246  ARG B NE  1 
ATOM   1233  C  CZ  . ARG B  2 41  ? -11.320 -2.382  -3.546  1.00 13.11 ? 246  ARG B CZ  1 
ATOM   1234  N  NH1 . ARG B  2 41  ? -12.109 -1.504  -4.157  1.00 12.96 ? 246  ARG B NH1 1 
ATOM   1235  N  NH2 . ARG B  2 41  ? -11.549 -2.679  -2.277  1.00 13.15 ? 246  ARG B NH2 1 
ATOM   1236  N  N   . ILE B  2 42  ? -7.921  -5.127  -10.476 1.00 15.98 ? 247  ILE B N   1 
ATOM   1237  C  CA  . ILE B  2 42  ? -8.026  -5.312  -11.926 1.00 16.62 ? 247  ILE B CA  1 
ATOM   1238  C  C   . ILE B  2 42  ? -8.076  -6.810  -12.247 1.00 17.49 ? 247  ILE B C   1 
ATOM   1239  O  O   . ILE B  2 42  ? -8.873  -7.262  -13.072 1.00 17.94 ? 247  ILE B O   1 
ATOM   1240  C  CB  . ILE B  2 42  ? -6.863  -4.625  -12.685 1.00 16.90 ? 247  ILE B CB  1 
ATOM   1241  C  CG1 . ILE B  2 42  ? -7.060  -3.111  -12.689 1.00 16.43 ? 247  ILE B CG1 1 
ATOM   1242  C  CG2 . ILE B  2 42  ? -6.774  -5.107  -14.132 1.00 17.75 ? 247  ILE B CG2 1 
ATOM   1243  C  CD1 . ILE B  2 42  ? -5.844  -2.322  -13.106 1.00 16.75 ? 247  ILE B CD1 1 
ATOM   1244  N  N   . ARG B  2 43  ? -7.213  -7.576  -11.587 1.00 17.99 ? 248  ARG B N   1 
ATOM   1245  C  CA  . ARG B  2 43  ? -7.245  -9.035  -11.704 1.00 18.90 ? 248  ARG B CA  1 
ATOM   1246  C  C   . ARG B  2 43  ? -8.588  -9.628  -11.279 1.00 18.87 ? 248  ARG B C   1 
ATOM   1247  O  O   . ARG B  2 43  ? -9.078  -10.580 -11.896 1.00 19.54 ? 248  ARG B O   1 
ATOM   1248  C  CB  . ARG B  2 43  ? -6.174  -9.673  -10.838 1.00 19.25 ? 248  ARG B CB  1 
ATOM   1249  C  CG  . ARG B  2 43  ? -4.734  -9.425  -11.250 1.00 19.80 ? 248  ARG B CG  1 
ATOM   1250  C  CD  . ARG B  2 43  ? -3.878  -10.120 -10.209 1.00 20.26 ? 248  ARG B CD  1 
ATOM   1251  N  NE  . ARG B  2 43  ? -2.454  -10.191 -10.488 1.00 21.11 ? 248  ARG B NE  1 
ATOM   1252  C  CZ  . ARG B  2 43  ? -1.759  -11.313 -10.658 1.00 22.04 ? 248  ARG B CZ  1 
ATOM   1253  N  NH1 . ARG B  2 43  ? -2.349  -12.517 -10.644 1.00 22.56 ? 248  ARG B NH1 1 
ATOM   1254  N  NH2 . ARG B  2 43  ? -0.467  -11.208 -10.871 1.00 22.62 ? 248  ARG B NH2 1 
ATOM   1255  N  N   . ILE B  2 44  ? -9.153  -9.111  -10.193 1.00 18.29 ? 249  ILE B N   1 
ATOM   1256  C  CA  . ILE B  2 44  ? -10.405 -9.660  -9.694  1.00 18.48 ? 249  ILE B CA  1 
ATOM   1257  C  C   . ILE B  2 44  ? -11.506 -9.352  -10.694 1.00 18.90 ? 249  ILE B C   1 
ATOM   1258  O  O   . ILE B  2 44  ? -12.221 -10.257 -11.088 1.00 19.60 ? 249  ILE B O   1 
ATOM   1259  C  CB  . ILE B  2 44  ? -10.751 -9.179  -8.270  1.00 17.79 ? 249  ILE B CB  1 
ATOM   1260  C  CG1 . ILE B  2 44  ? -9.727  -9.747  -7.282  1.00 17.91 ? 249  ILE B CG1 1 
ATOM   1261  C  CG2 . ILE B  2 44  ? -12.139 -9.659  -7.859  1.00 17.91 ? 249  ILE B CG2 1 
ATOM   1262  C  CD1 . ILE B  2 44  ? -9.686  -9.030  -5.956  1.00 17.31 ? 249  ILE B CD1 1 
ATOM   1263  N  N   . LEU B  2 45  ? -11.606 -8.102  -11.142 1.00 18.96 ? 250  LEU B N   1 
ATOM   1264  C  CA  . LEU B  2 45  ? -12.620 -7.729  -12.145 1.00 19.61 ? 250  LEU B CA  1 
ATOM   1265  C  C   . LEU B  2 45  ? -12.509 -8.455  -13.510 1.00 20.79 ? 250  LEU B C   1 
ATOM   1266  O  O   . LEU B  2 45  ? -13.524 -8.605  -14.203 1.00 21.45 ? 250  LEU B O   1 
ATOM   1267  C  CB  . LEU B  2 45  ? -12.626 -6.226  -12.405 1.00 19.18 ? 250  LEU B CB  1 
ATOM   1268  C  CG  . LEU B  2 45  ? -13.070 -5.323  -11.260 1.00 18.57 ? 250  LEU B CG  1 
ATOM   1269  C  CD1 . LEU B  2 45  ? -12.487 -3.926  -11.461 1.00 18.30 ? 250  LEU B CD1 1 
ATOM   1270  C  CD2 . LEU B  2 45  ? -14.581 -5.265  -11.116 1.00 18.65 ? 250  LEU B CD2 1 
ATOM   1271  N  N   . THR B  2 46  ? -11.307 -8.876  -13.900 1.00 21.27 ? 251  THR B N   1 
ATOM   1272  C  CA  . THR B  2 46  ? -11.103 -9.510  -15.205 1.00 22.63 ? 251  THR B CA  1 
ATOM   1273  C  C   . THR B  2 46  ? -10.857 -11.021 -15.118 1.00 24.19 ? 251  THR B C   1 
ATOM   1274  O  O   . THR B  2 46  ? -10.548 -11.640 -16.117 1.00 25.33 ? 251  THR B O   1 
ATOM   1275  C  CB  . THR B  2 46  ? -9.914  -8.874  -15.957 1.00 22.71 ? 251  THR B CB  1 
ATOM   1276  O  OG1 . THR B  2 46  ? -8.703  -9.082  -15.212 1.00 22.43 ? 251  THR B OG1 1 
ATOM   1277  C  CG2 . THR B  2 46  ? -10.158 -7.376  -16.195 1.00 21.89 ? 251  THR B CG2 1 
ATOM   1278  N  N   . ASN B  2 47  ? -11.009 -11.605 -13.931 1.00 24.85 ? 252  ASN B N   1 
ATOM   1279  C  CA  . ASN B  2 47  ? -10.722 -13.022 -13.708 1.00 27.01 ? 252  ASN B CA  1 
ATOM   1280  C  C   . ASN B  2 47  ? -9.322  -13.430 -14.221 1.00 26.79 ? 252  ASN B C   1 
ATOM   1281  O  O   . ASN B  2 47  ? -9.166  -14.393 -14.990 1.00 27.89 ? 252  ASN B O   1 
ATOM   1282  C  CB  . ASN B  2 47  ? -11.825 -13.894 -14.321 1.00 29.64 ? 252  ASN B CB  1 
ATOM   1283  C  CG  . ASN B  2 47  ? -11.816 -15.312 -13.789 1.00 32.76 ? 252  ASN B CG  1 
ATOM   1284  O  OD1 . ASN B  2 47  ? -11.623 -15.538 -12.595 1.00 32.95 ? 252  ASN B OD1 1 
ATOM   1285  N  ND2 . ASN B  2 47  ? -12.034 -16.282 -14.686 1.00 38.31 ? 252  ASN B ND2 1 
ATOM   1286  N  N   . ASN B  2 48  ? -8.319  -12.671 -13.778 1.00 25.40 ? 253  ASN B N   1 
ATOM   1287  C  CA  . ASN B  2 48  ? -6.905  -12.866 -14.143 1.00 25.71 ? 253  ASN B CA  1 
ATOM   1288  C  C   . ASN B  2 48  ? -6.606  -12.828 -15.640 1.00 26.24 ? 253  ASN B C   1 
ATOM   1289  O  O   . ASN B  2 48  ? -5.553  -13.272 -16.093 1.00 26.86 ? 253  ASN B O   1 
ATOM   1290  C  CB  . ASN B  2 48  ? -6.343  -14.135 -13.496 1.00 26.34 ? 253  ASN B CB  1 
ATOM   1291  C  CG  . ASN B  2 48  ? -5.949  -13.919 -12.054 1.00 25.57 ? 253  ASN B CG  1 
ATOM   1292  O  OD1 . ASN B  2 48  ? -5.390  -12.889 -11.707 1.00 24.67 ? 253  ASN B OD1 1 
ATOM   1293  N  ND2 . ASN B  2 48  ? -6.217  -14.903 -11.210 1.00 25.97 ? 253  ASN B ND2 1 
ATOM   1294  N  N   . SER B  2 49  ? -7.535  -12.268 -16.400 1.00 25.97 ? 254  SER B N   1 
ATOM   1295  C  CA  . SER B  2 49  ? -7.332  -12.035 -17.819 1.00 26.49 ? 254  SER B CA  1 
ATOM   1296  C  C   . SER B  2 49  ? -6.383  -10.845 -18.015 1.00 25.76 ? 254  SER B C   1 
ATOM   1297  O  O   . SER B  2 49  ? -5.621  -10.797 -18.971 1.00 26.50 ? 254  SER B O   1 
ATOM   1298  C  CB  . SER B  2 49  ? -8.675  -11.767 -18.491 1.00 26.56 ? 254  SER B CB  1 
ATOM   1299  O  OG  . SER B  2 49  ? -8.473  -11.117 -19.716 1.00 27.28 ? 254  SER B OG  1 
ATOM   1300  N  N   . GLN B  2 50  ? -6.441  -9.890  -17.097 1.00 24.39 ? 255  GLN B N   1 
ATOM   1301  C  CA  . GLN B  2 50  ? -5.557  -8.733  -17.109 1.00 23.82 ? 255  GLN B CA  1 
ATOM   1302  C  C   . GLN B  2 50  ? -4.778  -8.720  -15.811 1.00 23.12 ? 255  GLN B C   1 
ATOM   1303  O  O   . GLN B  2 50  ? -5.374  -8.817  -14.724 1.00 22.30 ? 255  GLN B O   1 
ATOM   1304  C  CB  . GLN B  2 50  ? -6.353  -7.443  -17.254 1.00 23.17 ? 255  GLN B CB  1 
ATOM   1305  C  CG  . GLN B  2 50  ? -6.873  -7.207  -18.656 1.00 23.98 ? 255  GLN B CG  1 
ATOM   1306  C  CD  . GLN B  2 50  ? -7.696  -5.930  -18.766 1.00 23.56 ? 255  GLN B CD  1 
ATOM   1307  O  OE1 . GLN B  2 50  ? -7.256  -4.860  -18.355 1.00 23.34 ? 255  GLN B OE1 1 
ATOM   1308  N  NE2 . GLN B  2 50  ? -8.900  -6.042  -19.331 1.00 23.63 ? 255  GLN B NE2 1 
ATOM   1309  N  N   . THR B  2 51  ? -3.452  -8.591  -15.934 1.00 23.39 ? 256  THR B N   1 
ATOM   1310  C  CA  . THR B  2 51  ? -2.536  -8.679  -14.801 1.00 23.04 ? 256  THR B CA  1 
ATOM   1311  C  C   . THR B  2 51  ? -1.446  -7.602  -14.852 1.00 23.07 ? 256  THR B C   1 
ATOM   1312  O  O   . THR B  2 51  ? -0.280  -7.896  -14.609 1.00 23.65 ? 256  THR B O   1 
ATOM   1313  C  CB  . THR B  2 51  ? -1.853  -10.064 -14.787 1.00 23.95 ? 256  THR B CB  1 
ATOM   1314  O  OG1 . THR B  2 51  ? -1.255  -10.308 -16.067 1.00 25.06 ? 256  THR B OG1 1 
ATOM   1315  C  CG2 . THR B  2 51  ? -2.863  -11.177 -14.489 1.00 23.98 ? 256  THR B CG2 1 
ATOM   1316  N  N   . PRO B  2 52  ? -1.813  -6.350  -15.160 1.00 22.66 ? 257  PRO B N   1 
ATOM   1317  C  CA  . PRO B  2 52  ? -0.784  -5.329  -15.304 1.00 22.89 ? 257  PRO B CA  1 
ATOM   1318  C  C   . PRO B  2 52  ? -0.111  -4.984  -13.981 1.00 22.49 ? 257  PRO B C   1 
ATOM   1319  O  O   . PRO B  2 52  ? -0.748  -5.073  -12.922 1.00 21.69 ? 257  PRO B O   1 
ATOM   1320  C  CB  . PRO B  2 52  ? -1.575  -4.112  -15.792 1.00 22.46 ? 257  PRO B CB  1 
ATOM   1321  C  CG  . PRO B  2 52  ? -2.902  -4.278  -15.142 1.00 21.58 ? 257  PRO B CG  1 
ATOM   1322  C  CD  . PRO B  2 52  ? -3.164  -5.761  -15.260 1.00 21.99 ? 257  PRO B CD  1 
ATOM   1323  N  N   . ILE B  2 53  ? 1.159   -4.600  -14.066 1.00 23.15 ? 258  ILE B N   1 
ATOM   1324  C  CA  . ILE B  2 53  ? 1.893   -4.054  -12.953 1.00 23.14 ? 258  ILE B CA  1 
ATOM   1325  C  C   . ILE B  2 53  ? 1.994   -2.549  -13.198 1.00 23.18 ? 258  ILE B C   1 
ATOM   1326  O  O   . ILE B  2 53  ? 2.524   -2.107  -14.217 1.00 23.96 ? 258  ILE B O   1 
ATOM   1327  C  CB  . ILE B  2 53  ? 3.325   -4.637  -12.829 1.00 24.17 ? 258  ILE B CB  1 
ATOM   1328  C  CG1 . ILE B  2 53  ? 3.334   -6.167  -12.889 1.00 24.64 ? 258  ILE B CG1 1 
ATOM   1329  C  CG2 . ILE B  2 53  ? 3.949   -4.181  -11.522 1.00 23.93 ? 258  ILE B CG2 1 
ATOM   1330  C  CD1 . ILE B  2 53  ? 2.676   -6.818  -11.691 1.00 24.03 ? 258  ILE B CD1 1 
ATOM   1331  N  N   . LEU B  2 54  ? 1.439   -1.779  -12.270 1.00 22.46 ? 259  LEU B N   1 
ATOM   1332  C  CA  . LEU B  2 54  ? 1.370   -0.342  -12.397 1.00 22.46 ? 259  LEU B CA  1 
ATOM   1333  C  C   . LEU B  2 54  ? 2.600   0.275   -11.769 1.00 23.03 ? 259  LEU B C   1 
ATOM   1334  O  O   . LEU B  2 54  ? 3.203   -0.326  -10.884 1.00 23.54 ? 259  LEU B O   1 
ATOM   1335  C  CB  . LEU B  2 54  ? 0.134   0.178   -11.684 1.00 21.46 ? 259  LEU B CB  1 
ATOM   1336  C  CG  . LEU B  2 54  ? -1.211  -0.281  -12.217 1.00 20.97 ? 259  LEU B CG  1 
ATOM   1337  C  CD1 . LEU B  2 54  ? -2.287  0.281   -11.312 1.00 20.08 ? 259  LEU B CD1 1 
ATOM   1338  C  CD2 . LEU B  2 54  ? -1.426  0.182   -13.644 1.00 21.61 ? 259  LEU B CD2 1 
ATOM   1339  N  N   . SER B  2 55  ? 2.937   1.489   -12.202 1.00 23.35 ? 260  SER B N   1 
ATOM   1340  C  CA  . SER B  2 55  ? 4.206   2.135   -11.864 1.00 23.92 ? 260  SER B CA  1 
ATOM   1341  C  C   . SER B  2 55  ? 4.135   3.049   -10.639 1.00 23.25 ? 260  SER B C   1 
ATOM   1342  O  O   . SER B  2 55  ? 3.637   4.170   -10.748 1.00 23.33 ? 260  SER B O   1 
ATOM   1343  C  CB  . SER B  2 55  ? 4.655   2.989   -13.045 1.00 24.97 ? 260  SER B CB  1 
ATOM   1344  O  OG  . SER B  2 55  ? 5.686   3.871   -12.660 1.00 25.93 ? 260  SER B OG  1 
ATOM   1345  N  N   . PRO B  2 56  ? 4.663   2.599   -9.484  1.00 22.97 ? 261  PRO B N   1 
ATOM   1346  C  CA  . PRO B  2 56  ? 4.761   3.502   -8.330  1.00 22.59 ? 261  PRO B CA  1 
ATOM   1347  C  C   . PRO B  2 56  ? 5.646   4.711   -8.570  1.00 23.35 ? 261  PRO B C   1 
ATOM   1348  O  O   . PRO B  2 56  ? 5.431   5.749   -7.950  1.00 22.99 ? 261  PRO B O   1 
ATOM   1349  C  CB  . PRO B  2 56  ? 5.389   2.644   -7.222  1.00 22.64 ? 261  PRO B CB  1 
ATOM   1350  C  CG  . PRO B  2 56  ? 5.593   1.286   -7.774  1.00 23.02 ? 261  PRO B CG  1 
ATOM   1351  C  CD  . PRO B  2 56  ? 5.234   1.269   -9.221  1.00 23.32 ? 261  PRO B CD  1 
ATOM   1352  N  N   . GLN B  2 57  ? 6.642   4.561   -9.447  1.00 24.38 ? 262  GLN B N   1 
ATOM   1353  C  CA  . GLN B  2 57  ? 7.588   5.626   -9.730  1.00 25.38 ? 262  GLN B CA  1 
ATOM   1354  C  C   . GLN B  2 57  ? 6.925   6.809   -10.426 1.00 25.44 ? 262  GLN B C   1 
ATOM   1355  O  O   . GLN B  2 57  ? 7.306   7.952   -10.199 1.00 25.77 ? 262  GLN B O   1 
ATOM   1356  C  CB  . GLN B  2 57  ? 8.736   5.087   -10.589 1.00 26.71 ? 262  GLN B CB  1 
ATOM   1357  C  CG  . GLN B  2 57  ? 9.901   6.046   -10.788 1.00 27.94 ? 262  GLN B CG  1 
ATOM   1358  C  CD  . GLN B  2 57  ? 10.599  6.409   -9.487  1.00 27.97 ? 262  GLN B CD  1 
ATOM   1359  O  OE1 . GLN B  2 57  ? 11.057  5.534   -8.755  1.00 27.70 ? 262  GLN B OE1 1 
ATOM   1360  N  NE2 . GLN B  2 57  ? 10.688  7.708   -9.199  1.00 28.30 ? 262  GLN B NE2 1 
ATOM   1361  N  N   . GLU B  2 58  ? 5.941   6.545   -11.283 1.00 25.16 ? 263  GLU B N   1 
ATOM   1362  C  CA  . GLU B  2 58  ? 5.263   7.637   -11.978 1.00 25.61 ? 263  GLU B CA  1 
ATOM   1363  C  C   . GLU B  2 58  ? 4.590   8.531   -10.957 1.00 24.80 ? 263  GLU B C   1 
ATOM   1364  O  O   . GLU B  2 58  ? 4.601   9.745   -11.088 1.00 25.72 ? 263  GLU B O   1 
ATOM   1365  C  CB  . GLU B  2 58  ? 4.246   7.119   -12.984 1.00 25.65 ? 263  GLU B CB  1 
ATOM   1366  C  CG  . GLU B  2 58  ? 3.607   8.204   -13.844 1.00 26.16 ? 263  GLU B CG  1 
ATOM   1367  C  CD  . GLU B  2 58  ? 2.292   8.721   -13.288 1.00 25.40 ? 263  GLU B CD  1 
ATOM   1368  O  OE1 . GLU B  2 58  ? 1.571   7.953   -12.607 1.00 24.60 ? 263  GLU B OE1 1 
ATOM   1369  O  OE2 . GLU B  2 58  ? 1.971   9.903   -13.543 1.00 25.70 ? 263  GLU B OE2 1 
ATOM   1370  N  N   . VAL B  2 59  ? 4.031   7.924   -9.924  1.00 23.47 ? 264  VAL B N   1 
ATOM   1371  C  CA  . VAL B  2 59  ? 3.431   8.682   -8.833  1.00 22.81 ? 264  VAL B CA  1 
ATOM   1372  C  C   . VAL B  2 59  ? 4.479   9.428   -8.015  1.00 23.42 ? 264  VAL B C   1 
ATOM   1373  O  O   . VAL B  2 59  ? 4.278   10.585  -7.675  1.00 23.78 ? 264  VAL B O   1 
ATOM   1374  C  CB  . VAL B  2 59  ? 2.585   7.766   -7.922  1.00 21.49 ? 264  VAL B CB  1 
ATOM   1375  C  CG1 . VAL B  2 59  ? 2.142   8.507   -6.673  1.00 20.95 ? 264  VAL B CG1 1 
ATOM   1376  C  CG2 . VAL B  2 59  ? 1.375   7.253   -8.691  1.00 20.90 ? 264  VAL B CG2 1 
ATOM   1377  N  N   . VAL B  2 60  ? 5.597   8.772   -7.713  1.00 23.96 ? 265  VAL B N   1 
ATOM   1378  C  CA  . VAL B  2 60  ? 6.655   9.390   -6.912  1.00 24.67 ? 265  VAL B CA  1 
ATOM   1379  C  C   . VAL B  2 60  ? 7.267   10.590  -7.635  1.00 26.07 ? 265  VAL B C   1 
ATOM   1380  O  O   . VAL B  2 60  ? 7.545   11.613  -7.019  1.00 26.70 ? 265  VAL B O   1 
ATOM   1381  C  CB  . VAL B  2 60  ? 7.748   8.375   -6.548  1.00 25.04 ? 265  VAL B CB  1 
ATOM   1382  C  CG1 . VAL B  2 60  ? 8.982   9.067   -5.962  1.00 26.07 ? 265  VAL B CG1 1 
ATOM   1383  C  CG2 . VAL B  2 60  ? 7.205   7.328   -5.582  1.00 24.00 ? 265  VAL B CG2 1 
ATOM   1384  N  N   . SER B  2 61  ? 7.439   10.467  -8.946  1.00 26.98 ? 266  SER B N   1 
ATOM   1385  C  CA  . SER B  2 61  ? 8.084   11.506  -9.740  1.00 28.61 ? 266  SER B CA  1 
ATOM   1386  C  C   . SER B  2 61  ? 7.116   12.564  -10.259 1.00 29.03 ? 266  SER B C   1 
ATOM   1387  O  O   . SER B  2 61  ? 7.518   13.700  -10.472 1.00 29.87 ? 266  SER B O   1 
ATOM   1388  C  CB  . SER B  2 61  ? 8.851   10.886  -10.923 1.00 29.64 ? 266  SER B CB  1 
ATOM   1389  O  OG  . SER B  2 61  ? 9.891   10.021  -10.483 1.00 29.52 ? 266  SER B OG  1 
ATOM   1390  N  N   . CYS B  2 62  ? 5.850   12.203  -10.469 1.00 28.81 ? 267  CYS B N   1 
ATOM   1391  C  CA  . CYS B  2 62  ? 4.934   13.102  -11.168 1.00 29.46 ? 267  CYS B CA  1 
ATOM   1392  C  C   . CYS B  2 62  ? 3.767   13.634  -10.382 1.00 28.01 ? 267  CYS B C   1 
ATOM   1393  O  O   . CYS B  2 62  ? 3.231   14.660  -10.780 1.00 28.43 ? 267  CYS B O   1 
ATOM   1394  C  CB  . CYS B  2 62  ? 4.369   12.445  -12.425 1.00 30.70 ? 267  CYS B CB  1 
ATOM   1395  S  SG  . CYS B  2 62  ? 5.631   11.820  -13.538 1.00 33.98 ? 267  CYS B SG  1 
ATOM   1396  N  N   . SER B  2 63  ? 3.335   12.946  -9.320  1.00 26.24 ? 268  SER B N   1 
ATOM   1397  C  CA  . SER B  2 63  ? 2.089   13.332  -8.625  1.00 24.90 ? 268  SER B CA  1 
ATOM   1398  C  C   . SER B  2 63  ? 2.228   14.552  -7.690  1.00 24.99 ? 268  SER B C   1 
ATOM   1399  O  O   . SER B  2 63  ? 2.981   14.554  -6.715  1.00 25.18 ? 268  SER B O   1 
ATOM   1400  C  CB  . SER B  2 63  ? 1.445   12.161  -7.855  1.00 23.41 ? 268  SER B CB  1 
ATOM   1401  O  OG  . SER B  2 63  ? 0.139   12.519  -7.405  1.00 22.09 ? 268  SER B OG  1 
ATOM   1402  N  N   . GLN B  2 64  ? 1.465   15.573  -8.041  1.00 25.18 ? 269  GLN B N   1 
ATOM   1403  C  CA  . GLN B  2 64  ? 1.253   16.769  -7.249  1.00 25.59 ? 269  GLN B CA  1 
ATOM   1404  C  C   . GLN B  2 64  ? 0.352   16.522  -6.007  1.00 24.17 ? 269  GLN B C   1 
ATOM   1405  O  O   . GLN B  2 64  ? 0.220   17.409  -5.153  1.00 24.48 ? 269  GLN B O   1 
ATOM   1406  C  CB  . GLN B  2 64  ? 0.622   17.848  -8.164  1.00 26.71 ? 269  GLN B CB  1 
ATOM   1407  C  CG  . GLN B  2 64  ? -0.641  17.389  -8.949  1.00 26.38 ? 269  GLN B CG  1 
ATOM   1408  C  CD  . GLN B  2 64  ? -0.401  17.000  -10.429 1.00 27.09 ? 269  GLN B CD  1 
ATOM   1409  O  OE1 . GLN B  2 64  ? -0.413  15.815  -10.797 1.00 26.34 ? 269  GLN B OE1 1 
ATOM   1410  N  NE2 . GLN B  2 64  ? -0.190  18.008  -11.279 1.00 28.54 ? 269  GLN B NE2 1 
ATOM   1411  N  N   . TYR B  2 65  ? -0.264  15.337  -5.908  1.00 22.42 ? 270  TYR B N   1 
ATOM   1412  C  CA  . TYR B  2 65  ? -1.127  14.979  -4.768  1.00 21.13 ? 270  TYR B CA  1 
ATOM   1413  C  C   . TYR B  2 65  ? -0.384  14.227  -3.642  1.00 21.00 ? 270  TYR B C   1 
ATOM   1414  O  O   . TYR B  2 65  ? -0.980  13.868  -2.613  1.00 20.28 ? 270  TYR B O   1 
ATOM   1415  C  CB  . TYR B  2 65  ? -2.312  14.112  -5.237  1.00 19.96 ? 270  TYR B CB  1 
ATOM   1416  C  CG  . TYR B  2 65  ? -3.259  14.747  -6.238  1.00 19.95 ? 270  TYR B CG  1 
ATOM   1417  C  CD1 . TYR B  2 65  ? -3.421  16.132  -6.324  1.00 20.62 ? 270  TYR B CD1 1 
ATOM   1418  C  CD2 . TYR B  2 65  ? -4.038  13.954  -7.069  1.00 19.30 ? 270  TYR B CD2 1 
ATOM   1419  C  CE1 . TYR B  2 65  ? -4.302  16.692  -7.235  1.00 20.90 ? 270  TYR B CE1 1 
ATOM   1420  C  CE2 . TYR B  2 65  ? -4.934  14.509  -7.975  1.00 19.52 ? 270  TYR B CE2 1 
ATOM   1421  C  CZ  . TYR B  2 65  ? -5.058  15.868  -8.054  1.00 20.34 ? 270  TYR B CZ  1 
ATOM   1422  O  OH  . TYR B  2 65  ? -5.937  16.411  -8.943  1.00 20.75 ? 270  TYR B OH  1 
ATOM   1423  N  N   . ALA B  2 66  ? 0.906   13.981  -3.846  1.00 21.78 ? 271  ALA B N   1 
ATOM   1424  C  CA  . ALA B  2 66  ? 1.783   13.386  -2.825  1.00 21.90 ? 271  ALA B CA  1 
ATOM   1425  C  C   . ALA B  2 66  ? 3.107   14.167  -2.790  1.00 22.94 ? 271  ALA B C   1 
ATOM   1426  O  O   . ALA B  2 66  ? 3.270   15.118  -3.533  1.00 23.64 ? 271  ALA B O   1 
ATOM   1427  C  CB  . ALA B  2 66  ? 2.019   11.911  -3.132  1.00 21.47 ? 271  ALA B CB  1 
ATOM   1428  N  N   . GLN B  2 67  ? 4.033   13.759  -1.922  1.00 23.26 ? 272  GLN B N   1 
ATOM   1429  C  CA  . GLN B  2 67  ? 5.329   14.431  -1.749  1.00 24.37 ? 272  GLN B CA  1 
ATOM   1430  C  C   . GLN B  2 67  ? 6.488   13.506  -2.138  1.00 25.08 ? 272  GLN B C   1 
ATOM   1431  O  O   . GLN B  2 67  ? 7.520   13.455  -1.454  1.00 25.73 ? 272  GLN B O   1 
ATOM   1432  C  CB  . GLN B  2 67  ? 5.493   14.905  -0.296  1.00 24.40 ? 272  GLN B CB  1 
ATOM   1433  C  CG  . GLN B  2 67  ? 4.533   16.015  0.130   1.00 24.30 ? 272  GLN B CG  1 
ATOM   1434  C  CD  . GLN B  2 67  ? 3.098   15.536  0.357   1.00 23.12 ? 272  GLN B CD  1 
ATOM   1435  O  OE1 . GLN B  2 67  ? 2.856   14.481  0.947   1.00 22.14 ? 272  GLN B OE1 1 
ATOM   1436  N  NE2 . GLN B  2 67  ? 2.140   16.321  -0.112  1.00 22.97 ? 272  GLN B NE2 1 
ATOM   1437  N  N   . GLY B  2 68  ? 6.317   12.775  -3.239  1.00 25.11 ? 273  GLY B N   1 
ATOM   1438  C  CA  . GLY B  2 68  ? 7.351   11.871  -3.745  1.00 26.04 ? 273  GLY B CA  1 
ATOM   1439  C  C   . GLY B  2 68  ? 7.905   10.882  -2.728  1.00 26.44 ? 273  GLY B C   1 
ATOM   1440  O  O   . GLY B  2 68  ? 7.152   10.101  -2.156  1.00 25.23 ? 273  GLY B O   1 
ATOM   1441  N  N   . CYS B  2 69  ? 9.226   10.904  -2.516  1.00 28.23 ? 274  CYS B N   1 
ATOM   1442  C  CA  . CYS B  2 69  ? 9.884   9.976   -1.586  1.00 28.74 ? 274  CYS B CA  1 
ATOM   1443  C  C   . CYS B  2 69  ? 9.670   10.391  -0.126  1.00 28.64 ? 274  CYS B C   1 
ATOM   1444  O  O   . CYS B  2 69  ? 10.019  9.635   0.779   1.00 28.23 ? 274  CYS B O   1 
ATOM   1445  C  CB  . CYS B  2 69  ? 11.402  9.875   -1.853  1.00 30.97 ? 274  CYS B CB  1 
ATOM   1446  S  SG  . CYS B  2 69  ? 11.964  8.772   -3.188  1.00 32.63 ? 274  CYS B SG  1 
ATOM   1447  N  N   . GLU B  2 70  ? 9.119   11.587  0.103   1.00 28.89 ? 275  GLU B N   1 
ATOM   1448  C  CA  . GLU B  2 70  ? 8.818   12.039  1.455   1.00 29.13 ? 275  GLU B CA  1 
ATOM   1449  C  C   . GLU B  2 70  ? 7.327   11.857  1.777   1.00 27.37 ? 275  GLU B C   1 
ATOM   1450  O  O   . GLU B  2 70  ? 6.734   12.670  2.490   1.00 27.29 ? 275  GLU B O   1 
ATOM   1451  C  CB  . GLU B  2 70  ? 9.247   13.506  1.692   1.00 30.91 ? 275  GLU B CB  1 
ATOM   1452  C  CG  . GLU B  2 70  ? 10.378  14.068  0.829   1.00 32.80 ? 275  GLU B CG  1 
ATOM   1453  C  CD  . GLU B  2 70  ? 11.579  13.143  0.679   1.00 34.44 ? 275  GLU B CD  1 
ATOM   1454  O  OE1 . GLU B  2 70  ? 12.018  12.548  1.700   1.00 34.97 ? 275  GLU B OE1 1 
ATOM   1455  O  OE2 . GLU B  2 70  ? 12.075  13.007  -0.478  1.00 36.34 ? 275  GLU B OE2 1 
ATOM   1456  N  N   . GLY B  2 71  ? 6.720   10.806  1.226   1.00 25.89 ? 276  GLY B N   1 
ATOM   1457  C  CA  . GLY B  2 71  ? 5.431   10.315  1.702   1.00 24.35 ? 276  GLY B CA  1 
ATOM   1458  C  C   . GLY B  2 71  ? 4.188   10.802  0.989   1.00 22.81 ? 276  GLY B C   1 
ATOM   1459  O  O   . GLY B  2 71  ? 4.224   11.674  0.127   1.00 23.10 ? 276  GLY B O   1 
ATOM   1460  N  N   . GLY B  2 72  ? 3.068   10.218  1.372   1.00 21.23 ? 277  GLY B N   1 
ATOM   1461  C  CA  . GLY B  2 72  ? 1.776   10.555  0.785   1.00 20.18 ? 277  GLY B CA  1 
ATOM   1462  C  C   . GLY B  2 72  ? 0.694   9.630   1.295   1.00 18.67 ? 277  GLY B C   1 
ATOM   1463  O  O   . GLY B  2 72  ? 0.903   8.852   2.223   1.00 18.41 ? 277  GLY B O   1 
ATOM   1464  N  N   . PHE B  2 73  ? -0.464  9.708   0.664   1.00 17.76 ? 278  PHE B N   1 
ATOM   1465  C  CA  . PHE B  2 73  ? -1.656  9.036   1.177   1.00 16.80 ? 278  PHE B CA  1 
ATOM   1466  C  C   . PHE B  2 73  ? -2.461  8.361   0.079   1.00 15.95 ? 278  PHE B C   1 
ATOM   1467  O  O   . PHE B  2 73  ? -2.829  9.001   -0.901  1.00 15.85 ? 278  PHE B O   1 
ATOM   1468  C  CB  . PHE B  2 73  ? -2.474  10.039  1.957   1.00 16.89 ? 278  PHE B CB  1 
ATOM   1469  C  CG  . PHE B  2 73  ? -1.792  10.466  3.208   1.00 17.46 ? 278  PHE B CG  1 
ATOM   1470  C  CD1 . PHE B  2 73  ? -1.927  9.722   4.369   1.00 17.36 ? 278  PHE B CD1 1 
ATOM   1471  C  CD2 . PHE B  2 73  ? -0.966  11.560  3.213   1.00 18.23 ? 278  PHE B CD2 1 
ATOM   1472  C  CE1 . PHE B  2 73  ? -1.280  10.086  5.524   1.00 17.94 ? 278  PHE B CE1 1 
ATOM   1473  C  CE2 . PHE B  2 73  ? -0.302  11.933  4.364   1.00 18.79 ? 278  PHE B CE2 1 
ATOM   1474  C  CZ  . PHE B  2 73  ? -0.462  11.198  5.520   1.00 18.81 ? 278  PHE B CZ  1 
ATOM   1475  N  N   . PRO B  2 74  ? -2.711  7.047   0.243   1.00 15.32 ? 279  PRO B N   1 
ATOM   1476  C  CA  . PRO B  2 74  ? -3.414  6.232   -0.743  1.00 14.77 ? 279  PRO B CA  1 
ATOM   1477  C  C   . PRO B  2 74  ? -4.722  6.822   -1.242  1.00 14.30 ? 279  PRO B C   1 
ATOM   1478  O  O   . PRO B  2 74  ? -5.025  6.674   -2.417  1.00 14.15 ? 279  PRO B O   1 
ATOM   1479  C  CB  . PRO B  2 74  ? -3.669  4.917   -0.006  1.00 14.54 ? 279  PRO B CB  1 
ATOM   1480  C  CG  . PRO B  2 74  ? -2.578  4.823   0.981   1.00 15.03 ? 279  PRO B CG  1 
ATOM   1481  C  CD  . PRO B  2 74  ? -2.233  6.236   1.380   1.00 15.43 ? 279  PRO B CD  1 
ATOM   1482  N  N   . TYR B  2 75  ? -5.477  7.490   -0.369  1.00 14.15 ? 280  TYR B N   1 
ATOM   1483  C  CA  . TYR B  2 75  ? -6.721  8.147   -0.788  1.00 13.97 ? 280  TYR B CA  1 
ATOM   1484  C  C   . TYR B  2 75  ? -6.467  9.083   -1.970  1.00 14.23 ? 280  TYR B C   1 
ATOM   1485  O  O   . TYR B  2 75  ? -7.259  9.119   -2.914  1.00 14.12 ? 280  TYR B O   1 
ATOM   1486  C  CB  . TYR B  2 75  ? -7.374  8.906   0.374   1.00 14.17 ? 280  TYR B CB  1 
ATOM   1487  C  CG  . TYR B  2 75  ? -8.671  9.623   0.040   1.00 14.01 ? 280  TYR B CG  1 
ATOM   1488  C  CD1 . TYR B  2 75  ? -8.660  10.889  -0.515  1.00 14.41 ? 280  TYR B CD1 1 
ATOM   1489  C  CD2 . TYR B  2 75  ? -9.905  9.048   0.313   1.00 13.71 ? 280  TYR B CD2 1 
ATOM   1490  C  CE1 . TYR B  2 75  ? -9.832  11.563  -0.812  1.00 14.52 ? 280  TYR B CE1 1 
ATOM   1491  C  CE2 . TYR B  2 75  ? -11.092 9.712   0.019   1.00 13.82 ? 280  TYR B CE2 1 
ATOM   1492  C  CZ  . TYR B  2 75  ? -11.047 10.977  -0.546  1.00 14.24 ? 280  TYR B CZ  1 
ATOM   1493  O  OH  . TYR B  2 75  ? -12.204 11.669  -0.839  1.00 14.43 ? 280  TYR B OH  1 
ATOM   1494  N  N   . LEU B  2 76  ? -5.348  9.798   -1.931  1.00 14.62 ? 281  LEU B N   1 
ATOM   1495  C  CA  . LEU B  2 76  ? -5.007  10.762  -2.980  1.00 15.13 ? 281  LEU B CA  1 
ATOM   1496  C  C   . LEU B  2 76  ? -4.338  10.142  -4.219  1.00 15.27 ? 281  LEU B C   1 
ATOM   1497  O  O   . LEU B  2 76  ? -4.274  10.771  -5.265  1.00 15.69 ? 281  LEU B O   1 
ATOM   1498  C  CB  . LEU B  2 76  ? -4.128  11.882  -2.391  1.00 15.73 ? 281  LEU B CB  1 
ATOM   1499  C  CG  . LEU B  2 76  ? -4.827  12.773  -1.363  1.00 15.82 ? 281  LEU B CG  1 
ATOM   1500  C  CD1 . LEU B  2 76  ? -3.842  13.642  -0.602  1.00 16.48 ? 281  LEU B CD1 1 
ATOM   1501  C  CD2 . LEU B  2 76  ? -5.885  13.635  -2.037  1.00 16.06 ? 281  LEU B CD2 1 
ATOM   1502  N  N   . ILE B  2 77  ? -3.839  8.918   -4.091  1.00 15.05 ? 282  ILE B N   1 
ATOM   1503  C  CA  . ILE B  2 77  ? -3.131  8.241   -5.185  1.00 15.32 ? 282  ILE B CA  1 
ATOM   1504  C  C   . ILE B  2 77  ? -4.007  7.171   -5.824  1.00 14.87 ? 282  ILE B C   1 
ATOM   1505  O  O   . ILE B  2 77  ? -4.388  7.298   -6.989  1.00 15.02 ? 282  ILE B O   1 
ATOM   1506  C  CB  . ILE B  2 77  ? -1.800  7.649   -4.675  1.00 15.63 ? 282  ILE B CB  1 
ATOM   1507  C  CG1 . ILE B  2 77  ? -0.895  8.788   -4.198  1.00 16.26 ? 282  ILE B CG1 1 
ATOM   1508  C  CG2 . ILE B  2 77  ? -1.111  6.811   -5.742  1.00 16.05 ? 282  ILE B CG2 1 
ATOM   1509  C  CD1 . ILE B  2 77  ? -0.838  9.994   -5.119  1.00 16.80 ? 282  ILE B CD1 1 
ATOM   1510  N  N   . ALA B  2 78  ? -4.338  6.129   -5.064  1.00 14.40 ? 283  ALA B N   1 
ATOM   1511  C  CA  . ALA B  2 78  ? -5.227  5.085   -5.571  1.00 14.15 ? 283  ALA B CA  1 
ATOM   1512  C  C   . ALA B  2 78  ? -6.565  5.677   -5.976  1.00 13.96 ? 283  ALA B C   1 
ATOM   1513  O  O   . ALA B  2 78  ? -7.185  5.231   -6.928  1.00 13.98 ? 283  ALA B O   1 
ATOM   1514  C  CB  . ALA B  2 78  ? -5.445  4.003   -4.532  1.00 13.89 ? 283  ALA B CB  1 
ATOM   1515  N  N   . GLY B  2 79  ? -7.004  6.678   -5.226  1.00 13.89 ? 284  GLY B N   1 
ATOM   1516  C  CA  . GLY B  2 79  ? -8.235  7.365   -5.514  1.00 13.91 ? 284  GLY B CA  1 
ATOM   1517  C  C   . GLY B  2 79  ? -8.052  8.532   -6.448  1.00 14.43 ? 284  GLY B C   1 
ATOM   1518  O  O   . GLY B  2 79  ? -8.290  8.410   -7.646  1.00 14.66 ? 284  GLY B O   1 
ATOM   1519  N  N   . LYS B  2 80  ? -7.619  9.666   -5.904  1.00 14.75 ? 285  LYS B N   1 
ATOM   1520  C  CA  . LYS B  2 80  ? -7.755  10.923  -6.627  1.00 15.45 ? 285  LYS B CA  1 
ATOM   1521  C  C   . LYS B  2 80  ? -6.823  11.077  -7.834  1.00 16.06 ? 285  LYS B C   1 
ATOM   1522  O  O   . LYS B  2 80  ? -7.256  11.566  -8.868  1.00 16.55 ? 285  LYS B O   1 
ATOM   1523  C  CB  . LYS B  2 80  ? -7.637  12.118  -5.698  1.00 15.81 ? 285  LYS B CB  1 
ATOM   1524  C  CG  . LYS B  2 80  ? -8.321  13.347  -6.269  1.00 16.52 ? 285  LYS B CG  1 
ATOM   1525  C  CD  . LYS B  2 80  ? -8.188  14.552  -5.357  1.00 16.99 ? 285  LYS B CD  1 
ATOM   1526  C  CE  . LYS B  2 80  ? -8.646  15.799  -6.086  1.00 17.91 ? 285  LYS B CE  1 
ATOM   1527  N  NZ  . LYS B  2 80  ? -10.029 15.608  -6.600  1.00 17.80 ? 285  LYS B NZ  1 
ATOM   1528  N  N   . TYR B  2 81  ? -5.571  10.649  -7.713  1.00 16.16 ? 286  TYR B N   1 
ATOM   1529  C  CA  . TYR B  2 81  ? -4.641  10.738  -8.815  1.00 16.91 ? 286  TYR B CA  1 
ATOM   1530  C  C   . TYR B  2 81  ? -5.036  9.787   -9.933  1.00 16.78 ? 286  TYR B C   1 
ATOM   1531  O  O   . TYR B  2 81  ? -5.036  10.138  -11.114 1.00 17.32 ? 286  TYR B O   1 
ATOM   1532  C  CB  . TYR B  2 81  ? -3.230  10.423  -8.346  1.00 17.21 ? 286  TYR B CB  1 
ATOM   1533  C  CG  . TYR B  2 81  ? -2.186  10.708  -9.402  1.00 18.28 ? 286  TYR B CG  1 
ATOM   1534  C  CD1 . TYR B  2 81  ? -1.923  12.011  -9.817  1.00 19.29 ? 286  TYR B CD1 1 
ATOM   1535  C  CD2 . TYR B  2 81  ? -1.479  9.683   -9.992  1.00 18.50 ? 286  TYR B CD2 1 
ATOM   1536  C  CE1 . TYR B  2 81  ? -0.953  12.285  -10.783 1.00 20.36 ? 286  TYR B CE1 1 
ATOM   1537  C  CE2 . TYR B  2 81  ? -0.524  9.939   -10.960 1.00 19.62 ? 286  TYR B CE2 1 
ATOM   1538  C  CZ  . TYR B  2 81  ? -0.257  11.241  -11.349 1.00 20.48 ? 286  TYR B CZ  1 
ATOM   1539  O  OH  . TYR B  2 81  ? 0.691   11.474  -12.315 1.00 21.77 ? 286  TYR B OH  1 
ATOM   1540  N  N   . ALA B  2 82  ? -5.367  8.569   -9.530  1.00 16.11 ? 287  ALA B N   1 
ATOM   1541  C  CA  . ALA B  2 82  ? -5.833  7.557   -10.445 1.00 16.03 ? 287  ALA B CA  1 
ATOM   1542  C  C   . ALA B  2 82  ? -7.040  8.047   -11.213 1.00 16.30 ? 287  ALA B C   1 
ATOM   1543  O  O   . ALA B  2 82  ? -7.150  7.772   -12.396 1.00 17.00 ? 287  ALA B O   1 
ATOM   1544  C  CB  . ALA B  2 82  ? -6.154  6.279   -9.699  1.00 15.30 ? 287  ALA B CB  1 
ATOM   1545  N  N   . GLN B  2 83  ? -7.939  8.786   -10.573 1.00 16.07 ? 288  GLN B N   1 
ATOM   1546  C  CA  . GLN B  2 83  ? -9.137  9.263   -11.279 1.00 16.36 ? 288  GLN B CA  1 
ATOM   1547  C  C   . GLN B  2 83  ? -8.827  10.446  -12.205 1.00 17.45 ? 288  GLN B C   1 
ATOM   1548  O  O   . GLN B  2 83  ? -9.285  10.490  -13.351 1.00 18.03 ? 288  GLN B O   1 
ATOM   1549  C  CB  . GLN B  2 83  ? -10.258 9.620   -10.297 1.00 15.78 ? 288  GLN B CB  1 
ATOM   1550  C  CG  . GLN B  2 83  ? -11.499 10.185  -10.963 1.00 16.15 ? 288  GLN B CG  1 
ATOM   1551  C  CD  . GLN B  2 83  ? -12.704 10.294  -10.033 1.00 15.78 ? 288  GLN B CD  1 
ATOM   1552  O  OE1 . GLN B  2 83  ? -13.088 11.387  -9.615  1.00 16.13 ? 288  GLN B OE1 1 
ATOM   1553  N  NE2 . GLN B  2 83  ? -13.305 9.169   -9.719  1.00 15.19 ? 288  GLN B NE2 1 
ATOM   1554  N  N   . ASP B  2 84  ? -8.051  11.394  -11.696 1.00 17.92 ? 289  ASP B N   1 
ATOM   1555  C  CA  . ASP B  2 84  ? -7.796  12.626  -12.402 1.00 19.14 ? 289  ASP B CA  1 
ATOM   1556  C  C   . ASP B  2 84  ? -6.794  12.468  -13.526 1.00 20.07 ? 289  ASP B C   1 
ATOM   1557  O  O   . ASP B  2 84  ? -6.980  13.004  -14.605 1.00 21.29 ? 289  ASP B O   1 
ATOM   1558  C  CB  . ASP B  2 84  ? -7.305  13.676  -11.419 1.00 19.35 ? 289  ASP B CB  1 
ATOM   1559  C  CG  . ASP B  2 84  ? -8.360  14.041  -10.400 1.00 18.91 ? 289  ASP B CG  1 
ATOM   1560  O  OD1 . ASP B  2 84  ? -9.498  13.520  -10.507 1.00 18.74 ? 289  ASP B OD1 1 
ATOM   1561  O  OD2 . ASP B  2 84  ? -8.052  14.834  -9.487  1.00 19.11 ? 289  ASP B OD2 1 
ATOM   1562  N  N   . PHE B  2 85  ? -5.733  11.716  -13.266 1.00 20.07 ? 290  PHE B N   1 
ATOM   1563  C  CA  . PHE B  2 85  ? -4.614  11.625  -14.199 1.00 21.13 ? 290  PHE B CA  1 
ATOM   1564  C  C   . PHE B  2 85  ? -4.328  10.247  -14.742 1.00 20.92 ? 290  PHE B C   1 
ATOM   1565  O  O   . PHE B  2 85  ? -3.730  10.119  -15.805 1.00 21.84 ? 290  PHE B O   1 
ATOM   1566  C  CB  . PHE B  2 85  ? -3.371  12.225  -13.533 1.00 21.57 ? 290  PHE B CB  1 
ATOM   1567  C  CG  . PHE B  2 85  ? -3.525  13.682  -13.267 1.00 22.29 ? 290  PHE B CG  1 
ATOM   1568  C  CD1 . PHE B  2 85  ? -3.465  14.585  -14.317 1.00 23.70 ? 290  PHE B CD1 1 
ATOM   1569  C  CD2 . PHE B  2 85  ? -3.830  14.149  -11.998 1.00 21.84 ? 290  PHE B CD2 1 
ATOM   1570  C  CE1 . PHE B  2 85  ? -3.640  15.941  -14.097 1.00 24.62 ? 290  PHE B CE1 1 
ATOM   1571  C  CE2 . PHE B  2 85  ? -4.017  15.504  -11.768 1.00 22.60 ? 290  PHE B CE2 1 
ATOM   1572  C  CZ  . PHE B  2 85  ? -3.922  16.405  -12.818 1.00 23.91 ? 290  PHE B CZ  1 
ATOM   1573  N  N   . GLY B  2 86  ? -4.731  9.215   -14.017 1.00 19.97 ? 291  GLY B N   1 
ATOM   1574  C  CA  . GLY B  2 86  ? -4.524  7.845   -14.466 1.00 19.96 ? 291  GLY B CA  1 
ATOM   1575  C  C   . GLY B  2 86  ? -3.110  7.369   -14.224 1.00 20.32 ? 291  GLY B C   1 
ATOM   1576  O  O   . GLY B  2 86  ? -2.180  8.171   -14.159 1.00 20.99 ? 291  GLY B O   1 
ATOM   1577  N  N   . LEU B  2 87  ? -2.962  6.054   -14.110 1.00 20.02 ? 292  LEU B N   1 
ATOM   1578  C  CA  . LEU B  2 87  ? -1.703  5.420   -13.768 1.00 20.38 ? 292  LEU B CA  1 
ATOM   1579  C  C   . LEU B  2 87  ? -1.165  4.627   -14.958 1.00 21.58 ? 292  LEU B C   1 
ATOM   1580  O  O   . LEU B  2 87  ? -1.928  4.070   -15.733 1.00 21.84 ? 292  LEU B O   1 
ATOM   1581  C  CB  . LEU B  2 87  ? -1.904  4.494   -12.567 1.00 19.34 ? 292  LEU B CB  1 
ATOM   1582  C  CG  . LEU B  2 87  ? -2.387  5.167   -11.276 1.00 18.53 ? 292  LEU B CG  1 
ATOM   1583  C  CD1 . LEU B  2 87  ? -2.928  4.123   -10.333 1.00 17.69 ? 292  LEU B CD1 1 
ATOM   1584  C  CD2 . LEU B  2 87  ? -1.281  5.954   -10.595 1.00 18.88 ? 292  LEU B CD2 1 
ATOM   1585  N  N   . VAL B  2 88  ? 0.155   4.572   -15.096 1.00 22.74 ? 293  VAL B N   1 
ATOM   1586  C  CA  . VAL B  2 88  ? 0.774   3.833   -16.197 1.00 23.99 ? 293  VAL B CA  1 
ATOM   1587  C  C   . VAL B  2 88  ? 1.368   2.516   -15.712 1.00 24.51 ? 293  VAL B C   1 
ATOM   1588  O  O   . VAL B  2 88  ? 1.623   2.340   -14.525 1.00 24.08 ? 293  VAL B O   1 
ATOM   1589  C  CB  . VAL B  2 88  ? 1.872   4.661   -16.899 1.00 25.08 ? 293  VAL B CB  1 
ATOM   1590  C  CG1 . VAL B  2 88  ? 1.297   5.946   -17.470 1.00 25.45 ? 293  VAL B CG1 1 
ATOM   1591  C  CG2 . VAL B  2 88  ? 3.033   4.979   -15.963 1.00 25.21 ? 293  VAL B CG2 1 
ATOM   1592  N  N   . GLU B  2 89  ? 1.602   1.605   -16.647 1.00 26.01 ? 294  GLU B N   1 
ATOM   1593  C  CA  . GLU B  2 89  ? 2.310   0.358   -16.371 1.00 26.87 ? 294  GLU B CA  1 
ATOM   1594  C  C   . GLU B  2 89  ? 3.772   0.593   -15.964 1.00 27.96 ? 294  GLU B C   1 
ATOM   1595  O  O   . GLU B  2 89  ? 4.364   1.634   -16.264 1.00 28.41 ? 294  GLU B O   1 
ATOM   1596  C  CB  . GLU B  2 89  ? 2.217   -0.597  -17.583 1.00 28.11 ? 294  GLU B CB  1 
ATOM   1597  C  CG  . GLU B  2 89  ? 0.882   -1.332  -17.630 1.00 27.82 ? 294  GLU B CG  1 
ATOM   1598  C  CD  . GLU B  2 89  ? 0.559   -1.973  -18.964 1.00 29.17 ? 294  GLU B CD  1 
ATOM   1599  O  OE1 . GLU B  2 89  ? 1.483   -2.406  -19.680 1.00 30.90 ? 294  GLU B OE1 1 
ATOM   1600  O  OE2 . GLU B  2 89  ? -0.637  -2.060  -19.308 1.00 28.93 ? 294  GLU B OE2 1 
ATOM   1601  N  N   . GLU B  2 90  ? 4.331   -0.396  -15.270 1.00 28.29 ? 295  GLU B N   1 
ATOM   1602  C  CA  . GLU B  2 90  ? 5.695   -0.349  -14.740 1.00 29.21 ? 295  GLU B CA  1 
ATOM   1603  C  C   . GLU B  2 90  ? 6.710   -0.239  -15.858 1.00 31.45 ? 295  GLU B C   1 
ATOM   1604  O  O   . GLU B  2 90  ? 7.717   0.436   -15.700 1.00 32.36 ? 295  GLU B O   1 
ATOM   1605  C  CB  . GLU B  2 90  ? 5.971   -1.598  -13.882 1.00 28.90 ? 295  GLU B CB  1 
ATOM   1606  C  CG  . GLU B  2 90  ? 7.415   -1.827  -13.422 1.00 29.73 ? 295  GLU B CG  1 
ATOM   1607  C  CD  . GLU B  2 90  ? 7.889   -0.859  -12.348 1.00 29.29 ? 295  GLU B CD  1 
ATOM   1608  O  OE1 . GLU B  2 90  ? 7.051   -0.170  -11.729 1.00 27.98 ? 295  GLU B OE1 1 
ATOM   1609  O  OE2 . GLU B  2 90  ? 9.122   -0.791  -12.109 1.00 30.39 ? 295  GLU B OE2 1 
ATOM   1610  N  N   . ALA B  2 91  ? 6.444   -0.909  -16.980 1.00 32.90 ? 296  ALA B N   1 
ATOM   1611  C  CA  . ALA B  2 91  ? 7.334   -0.875  -18.150 1.00 35.02 ? 296  ALA B CA  1 
ATOM   1612  C  C   . ALA B  2 91  ? 7.439   0.518   -18.740 1.00 36.29 ? 296  ALA B C   1 
ATOM   1613  O  O   . ALA B  2 91  ? 8.420   0.846   -19.384 1.00 39.15 ? 296  ALA B O   1 
ATOM   1614  C  CB  . ALA B  2 91  ? 6.838   -1.840  -19.219 1.00 35.66 ? 296  ALA B CB  1 
ATOM   1615  N  N   . CYS B  2 92  ? 6.408   1.329   -18.551 1.00 36.25 ? 297  CYS B N   1 
ATOM   1616  C  CA  . CYS B  2 92  ? 6.419   2.694   -19.044 1.00 38.44 ? 297  CYS B CA  1 
ATOM   1617  C  C   . CYS B  2 92  ? 7.405   3.565   -18.245 1.00 37.88 ? 297  CYS B C   1 
ATOM   1618  O  O   . CYS B  2 92  ? 8.086   4.419   -18.818 1.00 38.94 ? 297  CYS B O   1 
ATOM   1619  C  CB  . CYS B  2 92  ? 5.004   3.269   -18.990 1.00 39.58 ? 297  CYS B CB  1 
ATOM   1620  S  SG  . CYS B  2 92  ? 4.854   4.984   -19.545 1.00 45.32 ? 297  CYS B SG  1 
ATOM   1621  N  N   . PHE B  2 93  ? 7.495   3.304   -16.938 1.00 36.00 ? 298  PHE B N   1 
ATOM   1622  C  CA  . PHE B  2 93  ? 8.265   4.114   -15.991 1.00 35.70 ? 298  PHE B CA  1 
ATOM   1623  C  C   . PHE B  2 93  ? 8.785   3.213   -14.850 1.00 34.43 ? 298  PHE B C   1 
ATOM   1624  O  O   . PHE B  2 93  ? 8.179   3.148   -13.778 1.00 33.32 ? 298  PHE B O   1 
ATOM   1625  C  CB  . PHE B  2 93  ? 7.355   5.210   -15.421 1.00 35.28 ? 298  PHE B CB  1 
ATOM   1626  C  CG  . PHE B  2 93  ? 8.078   6.433   -14.926 1.00 36.24 ? 298  PHE B CG  1 
ATOM   1627  C  CD1 . PHE B  2 93  ? 9.374   6.369   -14.442 1.00 37.32 ? 298  PHE B CD1 1 
ATOM   1628  C  CD2 . PHE B  2 93  ? 7.431   7.658   -14.926 1.00 36.58 ? 298  PHE B CD2 1 
ATOM   1629  C  CE1 . PHE B  2 93  ? 10.021  7.511   -13.996 1.00 38.58 ? 298  PHE B CE1 1 
ATOM   1630  C  CE2 . PHE B  2 93  ? 8.067   8.799   -14.478 1.00 37.32 ? 298  PHE B CE2 1 
ATOM   1631  C  CZ  . PHE B  2 93  ? 9.363   8.726   -14.009 1.00 38.17 ? 298  PHE B CZ  1 
ATOM   1632  N  N   . PRO B  2 94  ? 9.907   2.509   -15.076 1.00 34.63 ? 299  PRO B N   1 
ATOM   1633  C  CA  . PRO B  2 94  ? 10.429  1.586   -14.061 1.00 33.87 ? 299  PRO B CA  1 
ATOM   1634  C  C   . PRO B  2 94  ? 10.840  2.251   -12.747 1.00 32.96 ? 299  PRO B C   1 
ATOM   1635  O  O   . PRO B  2 94  ? 11.233  3.418   -12.741 1.00 33.59 ? 299  PRO B O   1 
ATOM   1636  C  CB  . PRO B  2 94  ? 11.651  0.971   -14.747 1.00 35.41 ? 299  PRO B CB  1 
ATOM   1637  C  CG  . PRO B  2 94  ? 11.346  1.080   -16.205 1.00 36.39 ? 299  PRO B CG  1 
ATOM   1638  C  CD  . PRO B  2 94  ? 10.652  2.400   -16.345 1.00 36.09 ? 299  PRO B CD  1 
ATOM   1639  N  N   . TYR B  2 95  ? 10.766  1.490   -11.658 1.00 31.48 ? 300  TYR B N   1 
ATOM   1640  C  CA  . TYR B  2 95  ? 11.079  1.984   -10.323 1.00 30.84 ? 300  TYR B CA  1 
ATOM   1641  C  C   . TYR B  2 95  ? 12.595  2.129   -10.065 1.00 32.77 ? 300  TYR B C   1 
ATOM   1642  O  O   . TYR B  2 95  ? 13.345  1.143   -10.090 1.00 33.52 ? 300  TYR B O   1 
ATOM   1643  C  CB  . TYR B  2 95  ? 10.457  1.057   -9.266  1.00 29.46 ? 300  TYR B CB  1 
ATOM   1644  C  CG  . TYR B  2 95  ? 10.467  1.628   -7.855  1.00 28.53 ? 300  TYR B CG  1 
ATOM   1645  C  CD1 . TYR B  2 95  ? 9.715   2.753   -7.535  1.00 27.66 ? 300  TYR B CD1 1 
ATOM   1646  C  CD2 . TYR B  2 95  ? 11.221  1.041   -6.848  1.00 28.61 ? 300  TYR B CD2 1 
ATOM   1647  C  CE1 . TYR B  2 95  ? 9.729   3.286   -6.258  1.00 27.06 ? 300  TYR B CE1 1 
ATOM   1648  C  CE2 . TYR B  2 95  ? 11.236  1.561   -5.568  1.00 28.05 ? 300  TYR B CE2 1 
ATOM   1649  C  CZ  . TYR B  2 95  ? 10.487  2.681   -5.276  1.00 27.47 ? 300  TYR B CZ  1 
ATOM   1650  O  OH  . TYR B  2 95  ? 10.487  3.203   -4.009  1.00 26.78 ? 300  TYR B OH  1 
ATOM   1651  N  N   . THR B  2 96  ? 13.023  3.372   -9.834  1.00 33.53 ? 301  THR B N   1 
ATOM   1652  C  CA  . THR B  2 96  ? 14.337  3.677   -9.290  1.00 34.89 ? 301  THR B CA  1 
ATOM   1653  C  C   . THR B  2 96  ? 14.284  3.784   -7.757  1.00 35.13 ? 301  THR B C   1 
ATOM   1654  O  O   . THR B  2 96  ? 15.235  3.431   -7.080  1.00 36.67 ? 301  THR B O   1 
ATOM   1655  C  CB  . THR B  2 96  ? 14.894  5.008   -9.850  1.00 35.64 ? 301  THR B CB  1 
ATOM   1656  O  OG1 . THR B  2 96  ? 14.107  6.115   -9.393  1.00 34.62 ? 301  THR B OG1 1 
ATOM   1657  C  CG2 . THR B  2 96  ? 14.907  5.003   -11.371 1.00 36.34 ? 301  THR B CG2 1 
ATOM   1658  N  N   . GLY B  2 97  ? 13.183  4.286   -7.204  1.00 34.45 ? 302  GLY B N   1 
ATOM   1659  C  CA  . GLY B  2 97  ? 13.141  4.598   -5.768  1.00 34.19 ? 302  GLY B CA  1 
ATOM   1660  C  C   . GLY B  2 97  ? 13.974  5.816   -5.400  1.00 36.16 ? 302  GLY B C   1 
ATOM   1661  O  O   . GLY B  2 97  ? 14.648  5.832   -4.365  1.00 36.97 ? 302  GLY B O   1 
ATOM   1662  N  N   . THR B  2 98  ? 13.945  6.829   -6.267  1.00 37.84 ? 303  THR B N   1 
ATOM   1663  C  CA  . THR B  2 98  ? 14.555  8.127   -5.996  1.00 39.22 ? 303  THR B CA  1 
ATOM   1664  C  C   . THR B  2 98  ? 13.601  9.191   -6.496  1.00 39.38 ? 303  THR B C   1 
ATOM   1665  O  O   . THR B  2 98  ? 12.600  8.869   -7.139  1.00 38.37 ? 303  THR B O   1 
ATOM   1666  C  CB  . THR B  2 98  ? 15.900  8.302   -6.728  1.00 41.86 ? 303  THR B CB  1 
ATOM   1667  O  OG1 . THR B  2 98  ? 15.698  8.206   -8.145  1.00 42.71 ? 303  THR B OG1 1 
ATOM   1668  C  CG2 . THR B  2 98  ? 16.902  7.248   -6.282  1.00 42.30 ? 303  THR B CG2 1 
ATOM   1669  N  N   . ASP B  2 99  ? 13.907  10.457  -6.221  1.00 40.80 ? 304  ASP B N   1 
ATOM   1670  C  CA  . ASP B  2 99  ? 13.075  11.556  -6.704  1.00 40.80 ? 304  ASP B CA  1 
ATOM   1671  C  C   . ASP B  2 99  ? 13.546  11.952  -8.104  1.00 41.83 ? 304  ASP B C   1 
ATOM   1672  O  O   . ASP B  2 99  ? 14.000  13.065  -8.319  1.00 43.48 ? 304  ASP B O   1 
ATOM   1673  C  CB  . ASP B  2 99  ? 13.120  12.744  -5.738  1.00 41.42 ? 304  ASP B CB  1 
ATOM   1674  C  CG  . ASP B  2 99  ? 12.385  12.465  -4.410  1.00 41.79 ? 304  ASP B CG  1 
ATOM   1675  O  OD1 . ASP B  2 99  ? 11.201  12.023  -4.426  1.00 40.31 ? 304  ASP B OD1 1 
ATOM   1676  O  OD2 . ASP B  2 99  ? 12.990  12.712  -3.337  1.00 42.24 ? 304  ASP B OD2 1 
ATOM   1677  N  N   . SER B  2 100 ? 13.426  11.025  -9.053  1.00 41.96 ? 305  SER B N   1 
ATOM   1678  C  CA  . SER B  2 100 ? 13.853  11.249  -10.433 1.00 43.09 ? 305  SER B CA  1 
ATOM   1679  C  C   . SER B  2 100 ? 12.851  12.133  -11.183 1.00 42.55 ? 305  SER B C   1 
ATOM   1680  O  O   . SER B  2 100 ? 11.711  12.288  -10.744 1.00 39.62 ? 305  SER B O   1 
ATOM   1681  C  CB  . SER B  2 100 ? 14.089  9.914   -11.156 1.00 43.17 ? 305  SER B CB  1 
ATOM   1682  O  OG  . SER B  2 100 ? 12.897  9.203   -11.377 1.00 42.09 ? 305  SER B OG  1 
ATOM   1683  N  N   . PRO B  2 101 ? 13.291  12.757  -12.294 1.00 44.36 ? 306  PRO B N   1 
ATOM   1684  C  CA  . PRO B  2 101 ? 12.400  13.684  -13.004 1.00 44.89 ? 306  PRO B CA  1 
ATOM   1685  C  C   . PRO B  2 101 ? 11.259  12.967  -13.711 1.00 44.42 ? 306  PRO B C   1 
ATOM   1686  O  O   . PRO B  2 101 ? 11.365  11.774  -13.992 1.00 44.48 ? 306  PRO B O   1 
ATOM   1687  C  CB  . PRO B  2 101 ? 13.324  14.396  -14.003 1.00 46.86 ? 306  PRO B CB  1 
ATOM   1688  C  CG  . PRO B  2 101 ? 14.576  13.588  -14.068 1.00 47.72 ? 306  PRO B CG  1 
ATOM   1689  C  CD  . PRO B  2 101 ? 14.676  12.806  -12.796 1.00 46.41 ? 306  PRO B CD  1 
ATOM   1690  N  N   . CYS B  2 102 ? 10.172  13.691  -13.971 1.00 45.23 ? 307  CYS B N   1 
ATOM   1691  C  CA  . CYS B  2 102 ? 8.952   13.109  -14.557 1.00 44.93 ? 307  CYS B CA  1 
ATOM   1692  C  C   . CYS B  2 102 ? 9.137   12.900  -16.070 1.00 47.37 ? 307  CYS B C   1 
ATOM   1693  O  O   . CYS B  2 102 ? 8.725   13.729  -16.884 1.00 49.00 ? 307  CYS B O   1 
ATOM   1694  C  CB  . CYS B  2 102 ? 7.734   13.998  -14.233 1.00 43.11 ? 307  CYS B CB  1 
ATOM   1695  S  SG  . CYS B  2 102 ? 6.099   13.403  -14.783 1.00 43.41 ? 307  CYS B SG  1 
ATOM   1696  N  N   . LYS B  2 103 ? 9.790   11.793  -16.425 1.00 48.60 ? 308  LYS B N   1 
ATOM   1697  C  CA  . LYS B  2 103 ? 10.056  11.426  -17.821 1.00 50.42 ? 308  LYS B CA  1 
ATOM   1698  C  C   . LYS B  2 103 ? 9.838   9.929   -18.018 1.00 49.83 ? 308  LYS B C   1 
ATOM   1699  O  O   . LYS B  2 103 ? 10.229  9.115   -17.182 1.00 48.64 ? 308  LYS B O   1 
ATOM   1700  C  CB  . LYS B  2 103 ? 11.493  11.782  -18.211 1.00 53.11 ? 308  LYS B CB  1 
ATOM   1701  C  CG  . LYS B  2 103 ? 11.771  13.278  -18.245 1.00 55.68 ? 308  LYS B CG  1 
ATOM   1702  C  CD  . LYS B  2 103 ? 13.245  13.580  -18.479 1.00 59.64 ? 308  LYS B CD  1 
ATOM   1703  C  CE  . LYS B  2 103 ? 13.551  15.051  -18.247 1.00 61.22 ? 308  LYS B CE  1 
ATOM   1704  N  NZ  . LYS B  2 103 ? 15.008  15.327  -18.363 1.00 63.95 ? 308  LYS B NZ  1 
ATOM   1705  N  N   . MET B  2 104 ? 9.227   9.567   -19.137 1.00 50.52 ? 309  MET B N   1 
ATOM   1706  C  CA  . MET B  2 104 ? 8.840   8.187   -19.370 1.00 50.67 ? 309  MET B CA  1 
ATOM   1707  C  C   . MET B  2 104 ? 8.645   7.930   -20.856 1.00 52.69 ? 309  MET B C   1 
ATOM   1708  O  O   . MET B  2 104 ? 8.760   8.848   -21.671 1.00 54.70 ? 309  MET B O   1 
ATOM   1709  C  CB  . MET B  2 104 ? 7.545   7.884   -18.594 1.00 48.81 ? 309  MET B CB  1 
ATOM   1710  C  CG  . MET B  2 104 ? 6.341   8.732   -18.994 1.00 48.31 ? 309  MET B CG  1 
ATOM   1711  S  SD  . MET B  2 104 ? 5.044   8.817   -17.735 1.00 47.27 ? 309  MET B SD  1 
ATOM   1712  C  CE  . MET B  2 104 ? 5.518   10.288  -16.821 1.00 47.15 ? 309  MET B CE  1 
ATOM   1713  N  N   . LYS B  2 105 ? 8.353   6.680   -21.206 1.00 53.51 ? 310  LYS B N   1 
ATOM   1714  C  CA  . LYS B  2 105 ? 8.031   6.323   -22.592 1.00 55.62 ? 310  LYS B CA  1 
ATOM   1715  C  C   . LYS B  2 105 ? 6.785   7.087   -23.061 1.00 54.76 ? 310  LYS B C   1 
ATOM   1716  O  O   . LYS B  2 105 ? 5.974   7.522   -22.246 1.00 53.89 ? 310  LYS B O   1 
ATOM   1717  C  CB  . LYS B  2 105 ? 7.810   4.811   -22.734 1.00 55.73 ? 310  LYS B CB  1 
ATOM   1718  C  CG  . LYS B  2 105 ? 9.045   3.955   -22.470 1.00 56.40 ? 310  LYS B CG  1 
ATOM   1719  C  CD  . LYS B  2 105 ? 8.730   2.475   -22.685 1.00 56.70 ? 310  LYS B CD  1 
ATOM   1720  C  CE  . LYS B  2 105 ? 9.870   1.567   -22.237 1.00 56.56 ? 310  LYS B CE  1 
ATOM   1721  N  NZ  . LYS B  2 105 ? 11.138  1.853   -22.959 1.00 58.79 ? 310  LYS B NZ  1 
ATOM   1722  N  N   . GLU B  2 106 ? 6.640   7.245   -24.371 1.00 56.11 ? 311  GLU B N   1 
ATOM   1723  C  CA  . GLU B  2 106 ? 5.617   8.130   -24.935 1.00 56.10 ? 311  GLU B CA  1 
ATOM   1724  C  C   . GLU B  2 106 ? 4.296   7.409   -25.210 1.00 53.60 ? 311  GLU B C   1 
ATOM   1725  O  O   . GLU B  2 106 ? 4.271   6.195   -25.416 1.00 53.06 ? 311  GLU B O   1 
ATOM   1726  C  CB  . GLU B  2 106 ? 6.157   8.808   -26.202 1.00 59.42 ? 311  GLU B CB  1 
ATOM   1727  C  CG  . GLU B  2 106 ? 7.256   9.830   -25.905 1.00 60.90 ? 311  GLU B CG  1 
ATOM   1728  C  CD  . GLU B  2 106 ? 7.910   10.412  -27.154 1.00 64.28 ? 311  GLU B CD  1 
ATOM   1729  O  OE1 . GLU B  2 106 ? 7.465   10.094  -28.282 1.00 64.40 ? 311  GLU B OE1 1 
ATOM   1730  O  OE2 . GLU B  2 106 ? 8.878   11.195  -27.003 1.00 65.52 ? 311  GLU B OE2 1 
ATOM   1731  N  N   . ASP B  2 107 ? 3.208   8.179   -25.204 1.00 52.90 ? 312  ASP B N   1 
ATOM   1732  C  CA  . ASP B  2 107 ? 1.820   7.661   -25.280 1.00 50.75 ? 312  ASP B CA  1 
ATOM   1733  C  C   . ASP B  2 107 ? 1.597   6.281   -24.629 1.00 47.78 ? 312  ASP B C   1 
ATOM   1734  O  O   . ASP B  2 107 ? 1.176   5.321   -25.279 1.00 47.77 ? 312  ASP B O   1 
ATOM   1735  C  CB  . ASP B  2 107 ? 1.269   7.708   -26.726 1.00 52.35 ? 312  ASP B CB  1 
ATOM   1736  C  CG  . ASP B  2 107 ? 2.121   6.933   -27.723 1.00 54.39 ? 312  ASP B CG  1 
ATOM   1737  O  OD1 . ASP B  2 107 ? 2.346   5.719   -27.521 1.00 54.22 ? 312  ASP B OD1 1 
ATOM   1738  O  OD2 . ASP B  2 107 ? 2.547   7.541   -28.731 1.00 56.36 ? 312  ASP B OD2 1 
ATOM   1739  N  N   . CYS B  2 108 ? 1.883   6.197   -23.335 1.00 44.80 ? 313  CYS B N   1 
ATOM   1740  C  CA  . CYS B  2 108 ? 1.551   5.013   -22.559 1.00 42.02 ? 313  CYS B CA  1 
ATOM   1741  C  C   . CYS B  2 108 ? 0.059   5.022   -22.225 1.00 37.76 ? 313  CYS B C   1 
ATOM   1742  O  O   . CYS B  2 108 ? -0.522  6.080   -21.980 1.00 35.98 ? 313  CYS B O   1 
ATOM   1743  C  CB  . CYS B  2 108 ? 2.362   4.978   -21.264 1.00 43.28 ? 313  CYS B CB  1 
ATOM   1744  S  SG  . CYS B  2 108 ? 4.154   4.809   -21.482 1.00 48.19 ? 313  CYS B SG  1 
ATOM   1745  N  N   . PHE B  2 109 ? -0.550  3.840   -22.219 1.00 34.97 ? 314  PHE B N   1 
ATOM   1746  C  CA  . PHE B  2 109 ? -1.954  3.685   -21.826 1.00 32.51 ? 314  PHE B CA  1 
ATOM   1747  C  C   . PHE B  2 109 ? -2.109  4.046   -20.346 1.00 29.91 ? 314  PHE B C   1 
ATOM   1748  O  O   . PHE B  2 109 ? -1.238  3.734   -19.543 1.00 29.70 ? 314  PHE B O   1 
ATOM   1749  C  CB  . PHE B  2 109 ? -2.431  2.247   -22.068 1.00 31.96 ? 314  PHE B CB  1 
ATOM   1750  C  CG  . PHE B  2 109 ? -3.891  2.044   -21.789 1.00 30.96 ? 314  PHE B CG  1 
ATOM   1751  C  CD1 . PHE B  2 109 ? -4.836  2.254   -22.778 1.00 31.68 ? 314  PHE B CD1 1 
ATOM   1752  C  CD2 . PHE B  2 109 ? -4.321  1.657   -20.531 1.00 29.65 ? 314  PHE B CD2 1 
ATOM   1753  C  CE1 . PHE B  2 109 ? -6.184  2.076   -22.523 1.00 31.03 ? 314  PHE B CE1 1 
ATOM   1754  C  CE2 . PHE B  2 109 ? -5.666  1.484   -20.263 1.00 29.01 ? 314  PHE B CE2 1 
ATOM   1755  C  CZ  . PHE B  2 109 ? -6.601  1.689   -21.263 1.00 29.45 ? 314  PHE B CZ  1 
ATOM   1756  N  N   . ARG B  2 110 ? -3.201  4.712   -19.990 1.00 27.51 ? 315  ARG B N   1 
ATOM   1757  C  CA  . ARG B  2 110 ? -3.416  5.121   -18.599 1.00 25.58 ? 315  ARG B CA  1 
ATOM   1758  C  C   . ARG B  2 110 ? -4.690  4.527   -18.012 1.00 23.75 ? 315  ARG B C   1 
ATOM   1759  O  O   . ARG B  2 110 ? -5.770  4.684   -18.579 1.00 23.62 ? 315  ARG B O   1 
ATOM   1760  C  CB  . ARG B  2 110 ? -3.394  6.650   -18.475 1.00 25.75 ? 315  ARG B CB  1 
ATOM   1761  C  CG  . ARG B  2 110 ? -2.031  7.224   -18.835 1.00 26.90 ? 315  ARG B CG  1 
ATOM   1762  C  CD  . ARG B  2 110 ? -1.871  8.707   -18.520 1.00 27.28 ? 315  ARG B CD  1 
ATOM   1763  N  NE  . ARG B  2 110 ? -1.496  8.937   -17.121 1.00 26.45 ? 315  ARG B NE  1 
ATOM   1764  C  CZ  . ARG B  2 110 ? -0.296  9.319   -16.684 1.00 26.80 ? 315  ARG B CZ  1 
ATOM   1765  N  NH1 . ARG B  2 110 ? 0.717   9.528   -17.513 1.00 27.94 ? 315  ARG B NH1 1 
ATOM   1766  N  NH2 . ARG B  2 110 ? -0.110  9.483   -15.379 1.00 26.02 ? 315  ARG B NH2 1 
ATOM   1767  N  N   . TYR B  2 111 ? -4.527  3.831   -16.883 1.00 22.38 ? 316  TYR B N   1 
ATOM   1768  C  CA  . TYR B  2 111 ? -5.619  3.244   -16.111 1.00 21.10 ? 316  TYR B CA  1 
ATOM   1769  C  C   . TYR B  2 111 ? -6.168  4.240   -15.072 1.00 19.81 ? 316  TYR B C   1 
ATOM   1770  O  O   . TYR B  2 111 ? -5.402  4.804   -14.297 1.00 19.27 ? 316  TYR B O   1 
ATOM   1771  C  CB  . TYR B  2 111 ? -5.134  2.003   -15.356 1.00 20.88 ? 316  TYR B CB  1 
ATOM   1772  C  CG  . TYR B  2 111 ? -4.700  0.832   -16.207 1.00 21.72 ? 316  TYR B CG  1 
ATOM   1773  C  CD1 . TYR B  2 111 ? -3.433  0.799   -16.790 1.00 22.71 ? 316  TYR B CD1 1 
ATOM   1774  C  CD2 . TYR B  2 111 ? -5.527  -0.263  -16.384 1.00 21.76 ? 316  TYR B CD2 1 
ATOM   1775  C  CE1 . TYR B  2 111 ? -3.017  -0.279  -17.553 1.00 23.61 ? 316  TYR B CE1 1 
ATOM   1776  C  CE2 . TYR B  2 111 ? -5.124  -1.349  -17.148 1.00 22.82 ? 316  TYR B CE2 1 
ATOM   1777  C  CZ  . TYR B  2 111 ? -3.863  -1.348  -17.723 1.00 23.68 ? 316  TYR B CZ  1 
ATOM   1778  O  OH  . TYR B  2 111 ? -3.457  -2.417  -18.469 1.00 25.03 ? 316  TYR B OH  1 
ATOM   1779  N  N   . TYR B  2 112 ? -7.491  4.405   -15.034 1.00 18.98 ? 317  TYR B N   1 
ATOM   1780  C  CA  . TYR B  2 112 ? -8.153  5.334   -14.115 1.00 18.13 ? 317  TYR B CA  1 
ATOM   1781  C  C   . TYR B  2 112 ? -9.003  4.621   -13.071 1.00 17.17 ? 317  TYR B C   1 
ATOM   1782  O  O   . TYR B  2 112 ? -9.319  3.432   -13.211 1.00 17.03 ? 317  TYR B O   1 
ATOM   1783  C  CB  . TYR B  2 112 ? -9.052  6.276   -14.888 1.00 18.62 ? 317  TYR B CB  1 
ATOM   1784  C  CG  . TYR B  2 112 ? -8.313  7.132   -15.850 1.00 19.62 ? 317  TYR B CG  1 
ATOM   1785  C  CD1 . TYR B  2 112 ? -7.992  6.672   -17.124 1.00 20.46 ? 317  TYR B CD1 1 
ATOM   1786  C  CD2 . TYR B  2 112 ? -7.915  8.399   -15.490 1.00 19.90 ? 317  TYR B CD2 1 
ATOM   1787  C  CE1 . TYR B  2 112 ? -7.287  7.469   -18.016 1.00 21.56 ? 317  TYR B CE1 1 
ATOM   1788  C  CE2 . TYR B  2 112 ? -7.218  9.202   -16.367 1.00 21.17 ? 317  TYR B CE2 1 
ATOM   1789  C  CZ  . TYR B  2 112 ? -6.896  8.734   -17.623 1.00 21.85 ? 317  TYR B CZ  1 
ATOM   1790  O  OH  . TYR B  2 112 ? -6.205  9.558   -18.463 1.00 22.89 ? 317  TYR B OH  1 
ATOM   1791  N  N   . SER B  2 113 ? -9.378  5.362   -12.033 1.00 16.50 ? 318  SER B N   1 
ATOM   1792  C  CA  . SER B  2 113 ? -10.322 4.888   -11.025 1.00 15.78 ? 318  SER B CA  1 
ATOM   1793  C  C   . SER B  2 113 ? -11.678 5.579   -11.180 1.00 15.87 ? 318  SER B C   1 
ATOM   1794  O  O   . SER B  2 113 ? -11.748 6.802   -11.314 1.00 16.16 ? 318  SER B O   1 
ATOM   1795  C  CB  . SER B  2 113 ? -9.780  5.176   -9.630  1.00 15.34 ? 318  SER B CB  1 
ATOM   1796  O  OG  . SER B  2 113 ? -8.784  4.240   -9.275  1.00 15.21 ? 318  SER B OG  1 
ATOM   1797  N  N   . SER B  2 114 ? -12.752 4.800   -11.140 1.00 15.75 ? 319  SER B N   1 
ATOM   1798  C  CA  . SER B  2 114 ? -14.105 5.347   -11.279 1.00 16.01 ? 319  SER B CA  1 
ATOM   1799  C  C   . SER B  2 114 ? -14.670 5.853   -9.965  1.00 15.82 ? 319  SER B C   1 
ATOM   1800  O  O   . SER B  2 114 ? -15.602 6.651   -9.954  1.00 16.07 ? 319  SER B O   1 
ATOM   1801  C  CB  . SER B  2 114 ? -15.049 4.296   -11.850 1.00 16.15 ? 319  SER B CB  1 
ATOM   1802  O  OG  . SER B  2 114 ? -14.963 3.098   -11.125 1.00 15.70 ? 319  SER B OG  1 
ATOM   1803  N  N   . GLU B  2 115 ? -14.104 5.391   -8.859  1.00 15.48 ? 320  GLU B N   1 
ATOM   1804  C  CA  . GLU B  2 115 ? -14.666 5.662   -7.543  1.00 15.49 ? 320  GLU B CA  1 
ATOM   1805  C  C   . GLU B  2 115 ? -13.601 5.426   -6.498  1.00 14.78 ? 320  GLU B C   1 
ATOM   1806  O  O   . GLU B  2 115 ? -12.726 4.574   -6.672  1.00 14.36 ? 320  GLU B O   1 
ATOM   1807  C  CB  . GLU B  2 115 ? -15.876 4.746   -7.276  1.00 15.90 ? 320  GLU B CB  1 
ATOM   1808  C  CG  . GLU B  2 115 ? -16.925 5.300   -6.311  1.00 16.64 ? 320  GLU B CG  1 
ATOM   1809  C  CD  . GLU B  2 115 ? -16.624 5.017   -4.831  1.00 16.83 ? 320  GLU B CD  1 
ATOM   1810  O  OE1 . GLU B  2 115 ? -15.764 4.127   -4.519  1.00 16.86 ? 320  GLU B OE1 1 
ATOM   1811  O  OE2 . GLU B  2 115 ? -17.246 5.701   -3.966  1.00 18.08 ? 320  GLU B OE2 1 
ATOM   1812  N  N   . TYR B  2 116 ? -13.659 6.205   -5.429  1.00 14.27 ? 321  TYR B N   1 
ATOM   1813  C  CA  . TYR B  2 116 ? -12.766 6.022   -4.309  1.00 13.78 ? 321  TYR B CA  1 
ATOM   1814  C  C   . TYR B  2 116 ? -13.434 6.601   -3.071  1.00 13.80 ? 321  TYR B C   1 
ATOM   1815  O  O   . TYR B  2 116 ? -14.140 7.590   -3.159  1.00 14.38 ? 321  TYR B O   1 
ATOM   1816  C  CB  . TYR B  2 116 ? -11.387 6.653   -4.575  1.00 13.72 ? 321  TYR B CB  1 
ATOM   1817  C  CG  . TYR B  2 116 ? -11.419 8.128   -4.915  1.00 14.09 ? 321  TYR B CG  1 
ATOM   1818  C  CD1 . TYR B  2 116 ? -11.641 8.557   -6.227  1.00 14.44 ? 321  TYR B CD1 1 
ATOM   1819  C  CD2 . TYR B  2 116 ? -11.217 9.095   -3.928  1.00 14.18 ? 321  TYR B CD2 1 
ATOM   1820  C  CE1 . TYR B  2 116 ? -11.676 9.901   -6.543  1.00 14.92 ? 321  TYR B CE1 1 
ATOM   1821  C  CE2 . TYR B  2 116 ? -11.253 10.445  -4.231  1.00 14.69 ? 321  TYR B CE2 1 
ATOM   1822  C  CZ  . TYR B  2 116 ? -11.482 10.843  -5.538  1.00 15.09 ? 321  TYR B CZ  1 
ATOM   1823  O  OH  . TYR B  2 116 ? -11.530 12.180  -5.840  1.00 15.76 ? 321  TYR B OH  1 
ATOM   1824  N  N   . HIS B  2 117 ? -13.243 5.945   -1.936  1.00 13.62 ? 322  HIS B N   1 
ATOM   1825  C  CA  . HIS B  2 117 ? -13.746 6.433   -0.654  1.00 13.79 ? 322  HIS B CA  1 
ATOM   1826  C  C   . HIS B  2 117 ? -12.959 5.850   0.507   1.00 13.54 ? 322  HIS B C   1 
ATOM   1827  O  O   . HIS B  2 117 ? -12.389 4.771   0.412   1.00 13.21 ? 322  HIS B O   1 
ATOM   1828  C  CB  . HIS B  2 117 ? -15.238 6.085   -0.463  1.00 14.01 ? 322  HIS B CB  1 
ATOM   1829  C  CG  . HIS B  2 117 ? -15.526 4.617   -0.495  1.00 14.04 ? 322  HIS B CG  1 
ATOM   1830  N  ND1 . HIS B  2 117 ? -15.862 3.950   -1.658  1.00 14.21 ? 322  HIS B ND1 1 
ATOM   1831  C  CD2 . HIS B  2 117 ? -15.548 3.686   0.490   1.00 14.14 ? 322  HIS B CD2 1 
ATOM   1832  C  CE1 . HIS B  2 117 ? -16.051 2.670   -1.391  1.00 14.23 ? 322  HIS B CE1 1 
ATOM   1833  N  NE2 . HIS B  2 117 ? -15.868 2.483   -0.093  1.00 14.31 ? 322  HIS B NE2 1 
ATOM   1834  N  N   . TYR B  2 118 ? -12.951 6.574   1.613   1.00 13.72 ? 323  TYR B N   1 
ATOM   1835  C  CA  . TYR B  2 118 ? -12.551 5.984   2.879   1.00 13.77 ? 323  TYR B CA  1 
ATOM   1836  C  C   . TYR B  2 118 ? -13.605 4.947   3.255   1.00 13.73 ? 323  TYR B C   1 
ATOM   1837  O  O   . TYR B  2 118 ? -14.787 5.163   3.051   1.00 13.80 ? 323  TYR B O   1 
ATOM   1838  C  CB  . TYR B  2 118 ? -12.399 7.066   3.957   1.00 14.21 ? 323  TYR B CB  1 
ATOM   1839  C  CG  . TYR B  2 118 ? -11.061 7.795   3.896   1.00 14.35 ? 323  TYR B CG  1 
ATOM   1840  C  CD1 . TYR B  2 118 ? -9.867  7.094   4.013   1.00 14.33 ? 323  TYR B CD1 1 
ATOM   1841  C  CD2 . TYR B  2 118 ? -10.993 9.158   3.730   1.00 14.70 ? 323  TYR B CD2 1 
ATOM   1842  C  CE1 . TYR B  2 118 ? -8.644  7.735   3.958   1.00 14.66 ? 323  TYR B CE1 1 
ATOM   1843  C  CE2 . TYR B  2 118 ? -9.768  9.818   3.682   1.00 15.00 ? 323  TYR B CE2 1 
ATOM   1844  C  CZ  . TYR B  2 118 ? -8.601  9.094   3.792   1.00 14.97 ? 323  TYR B CZ  1 
ATOM   1845  O  OH  . TYR B  2 118 ? -7.378  9.716   3.753   1.00 15.63 ? 323  TYR B OH  1 
ATOM   1846  N  N   . VAL B  2 119 ? -13.169 3.798   3.749   1.00 13.68 ? 324  VAL B N   1 
ATOM   1847  C  CA  . VAL B  2 119 ? -14.089 2.797   4.251   1.00 13.86 ? 324  VAL B CA  1 
ATOM   1848  C  C   . VAL B  2 119 ? -14.843 3.398   5.429   1.00 14.23 ? 324  VAL B C   1 
ATOM   1849  O  O   . VAL B  2 119 ? -14.230 3.928   6.371   1.00 14.40 ? 324  VAL B O   1 
ATOM   1850  C  CB  . VAL B  2 119 ? -13.369 1.502   4.678   1.00 14.03 ? 324  VAL B CB  1 
ATOM   1851  C  CG1 . VAL B  2 119 ? -14.315 0.589   5.448   1.00 14.47 ? 324  VAL B CG1 1 
ATOM   1852  C  CG2 . VAL B  2 119 ? -12.839 0.769   3.458   1.00 13.81 ? 324  VAL B CG2 1 
ATOM   1853  N  N   . GLY B  2 120 ? -16.174 3.328   5.352   1.00 14.38 ? 325  GLY B N   1 
ATOM   1854  C  CA  . GLY B  2 120 ? -17.046 4.015   6.307   1.00 14.85 ? 325  GLY B CA  1 
ATOM   1855  C  C   . GLY B  2 120 ? -17.552 5.366   5.813   1.00 14.91 ? 325  GLY B C   1 
ATOM   1856  O  O   . GLY B  2 120 ? -18.266 6.036   6.545   1.00 15.40 ? 325  GLY B O   1 
ATOM   1857  N  N   . GLY B  2 121 ? -17.181 5.768   4.590   1.00 14.50 ? 326  GLY B N   1 
ATOM   1858  C  CA  . GLY B  2 121 ? -17.650 7.016   3.982   1.00 14.71 ? 326  GLY B CA  1 
ATOM   1859  C  C   . GLY B  2 121 ? -16.722 8.225   4.117   1.00 14.90 ? 326  GLY B C   1 
ATOM   1860  O  O   . GLY B  2 121 ? -16.683 9.105   3.233   1.00 15.39 ? 326  GLY B O   1 
ATOM   1861  N  N   . PHE B  2 122 ? -15.983 8.288   5.217   1.00 14.90 ? 327  PHE B N   1 
ATOM   1862  C  CA  . PHE B  2 122 ? -15.122 9.424   5.517   1.00 15.09 ? 327  PHE B CA  1 
ATOM   1863  C  C   . PHE B  2 122 ? -14.065 8.979   6.531   1.00 15.15 ? 327  PHE B C   1 
ATOM   1864  O  O   . PHE B  2 122 ? -14.245 7.978   7.231   1.00 15.14 ? 327  PHE B O   1 
ATOM   1865  C  CB  . PHE B  2 122 ? -15.943 10.591  6.076   1.00 15.70 ? 327  PHE B CB  1 
ATOM   1866  C  CG  . PHE B  2 122 ? -16.888 10.190  7.178   1.00 16.10 ? 327  PHE B CG  1 
ATOM   1867  C  CD1 . PHE B  2 122 ? -18.175 9.743   6.878   1.00 16.19 ? 327  PHE B CD1 1 
ATOM   1868  C  CD2 . PHE B  2 122 ? -16.479 10.206  8.505   1.00 16.47 ? 327  PHE B CD2 1 
ATOM   1869  C  CE1 . PHE B  2 122 ? -19.034 9.323   7.875   1.00 16.67 ? 327  PHE B CE1 1 
ATOM   1870  C  CE2 . PHE B  2 122 ? -17.345 9.807   9.511   1.00 17.00 ? 327  PHE B CE2 1 
ATOM   1871  C  CZ  . PHE B  2 122 ? -18.625 9.359   9.192   1.00 17.11 ? 327  PHE B CZ  1 
ATOM   1872  N  N   . TYR B  2 123 ? -12.959 9.713   6.597   1.00 15.37 ? 328  TYR B N   1 
ATOM   1873  C  CA  . TYR B  2 123 ? -11.933 9.426   7.588   1.00 15.71 ? 328  TYR B CA  1 
ATOM   1874  C  C   . TYR B  2 123 ? -12.539 9.599   8.970   1.00 16.36 ? 328  TYR B C   1 
ATOM   1875  O  O   . TYR B  2 123 ? -13.090 10.654  9.288   1.00 16.82 ? 328  TYR B O   1 
ATOM   1876  C  CB  . TYR B  2 123 ? -10.719 10.335  7.430   1.00 15.92 ? 328  TYR B CB  1 
ATOM   1877  C  CG  . TYR B  2 123 ? -9.625  10.094  8.441   1.00 16.29 ? 328  TYR B CG  1 
ATOM   1878  C  CD1 . TYR B  2 123 ? -8.927  8.889   8.464   1.00 16.10 ? 328  TYR B CD1 1 
ATOM   1879  C  CD2 . TYR B  2 123 ? -9.277  11.062  9.367   1.00 16.99 ? 328  TYR B CD2 1 
ATOM   1880  C  CE1 . TYR B  2 123 ? -7.908  8.663   9.378   1.00 16.57 ? 328  TYR B CE1 1 
ATOM   1881  C  CE2 . TYR B  2 123 ? -8.256  10.844  10.293  1.00 17.48 ? 328  TYR B CE2 1 
ATOM   1882  C  CZ  . TYR B  2 123 ? -7.567  9.644   10.291  1.00 17.26 ? 328  TYR B CZ  1 
ATOM   1883  O  OH  . TYR B  2 123 ? -6.550  9.402   11.193  1.00 17.98 ? 328  TYR B OH  1 
ATOM   1884  N  N   . GLY B  2 124 ? -12.443 8.538   9.762   1.00 16.57 ? 329  GLY B N   1 
ATOM   1885  C  CA  . GLY B  2 124 ? -13.087 8.474   11.063  1.00 17.49 ? 329  GLY B CA  1 
ATOM   1886  C  C   . GLY B  2 124 ? -14.115 7.364   11.138  1.00 17.31 ? 329  GLY B C   1 
ATOM   1887  O  O   . GLY B  2 124 ? -14.481 6.943   12.219  1.00 18.07 ? 329  GLY B O   1 
ATOM   1888  N  N   . GLY B  2 125 ? -14.567 6.871   9.993   1.00 16.63 ? 330  GLY B N   1 
ATOM   1889  C  CA  . GLY B  2 125 ? -15.693 5.931   9.943   1.00 16.64 ? 330  GLY B CA  1 
ATOM   1890  C  C   . GLY B  2 125 ? -15.280 4.487   9.751   1.00 16.25 ? 330  GLY B C   1 
ATOM   1891  O  O   . GLY B  2 125 ? -16.110 3.630   9.546   1.00 16.31 ? 330  GLY B O   1 
ATOM   1892  N  N   . CYS B  2 126 ? -13.994 4.210   9.827   1.00 16.03 ? 331  CYS B N   1 
ATOM   1893  C  CA  . CYS B  2 126 ? -13.517 2.869   9.568   1.00 15.88 ? 331  CYS B CA  1 
ATOM   1894  C  C   . CYS B  2 126 ? -13.761 1.947   10.762  1.00 16.50 ? 331  CYS B C   1 
ATOM   1895  O  O   . CYS B  2 126 ? -13.678 2.375   11.916  1.00 17.05 ? 331  CYS B O   1 
ATOM   1896  C  CB  . CYS B  2 126 ? -12.015 2.902   9.242   1.00 15.67 ? 331  CYS B CB  1 
ATOM   1897  S  SG  . CYS B  2 126 ? -11.473 1.398   8.410   1.00 15.45 ? 331  CYS B SG  1 
ATOM   1898  N  N   . ASN B  2 127 ? -14.073 0.688   10.482  1.00 16.45 ? 332  ASN B N   1 
ATOM   1899  C  CA  . ASN B  2 127 ? -14.049 -0.350  11.508  1.00 17.17 ? 332  ASN B CA  1 
ATOM   1900  C  C   . ASN B  2 127 ? -13.819 -1.713  10.872  1.00 17.12 ? 332  ASN B C   1 
ATOM   1901  O  O   . ASN B  2 127 ? -13.881 -1.860  9.655   1.00 16.49 ? 332  ASN B O   1 
ATOM   1902  C  CB  . ASN B  2 127 ? -15.328 -0.342  12.360  1.00 17.87 ? 332  ASN B CB  1 
ATOM   1903  C  CG  . ASN B  2 127 ? -16.580 -0.738  11.571  1.00 17.75 ? 332  ASN B CG  1 
ATOM   1904  O  OD1 . ASN B  2 127 ? -16.624 -1.785  10.940  1.00 17.62 ? 332  ASN B OD1 1 
ATOM   1905  N  ND2 . ASN B  2 127 ? -17.600 0.097   11.624  1.00 17.90 ? 332  ASN B ND2 1 
ATOM   1906  N  N   . GLU B  2 128 ? -13.570 -2.699  11.720  1.00 17.94 ? 333  GLU B N   1 
ATOM   1907  C  CA  . GLU B  2 128 ? -13.214 -4.046  11.305  1.00 18.26 ? 333  GLU B CA  1 
ATOM   1908  C  C   . GLU B  2 128 ? -14.225 -4.695  10.354  1.00 17.93 ? 333  GLU B C   1 
ATOM   1909  O  O   . GLU B  2 128 ? -13.844 -5.249  9.326   1.00 17.41 ? 333  GLU B O   1 
ATOM   1910  C  CB  . GLU B  2 128 ? -13.077 -4.920  12.553  1.00 19.76 ? 333  GLU B CB  1 
ATOM   1911  C  CG  . GLU B  2 128 ? -12.565 -6.317  12.272  1.00 20.48 ? 333  GLU B CG  1 
ATOM   1912  C  CD  . GLU B  2 128 ? -13.155 -7.362  13.171  1.00 22.26 ? 333  GLU B CD  1 
ATOM   1913  O  OE1 . GLU B  2 128 ? -13.947 -7.009  14.069  1.00 22.86 ? 333  GLU B OE1 1 
ATOM   1914  O  OE2 . GLU B  2 128 ? -12.828 -8.550  12.981  1.00 23.25 ? 333  GLU B OE2 1 
ATOM   1915  N  N   . ALA B  2 129 ? -15.502 -4.639  10.730  1.00 18.10 ? 334  ALA B N   1 
ATOM   1916  C  CA  . ALA B  2 129 ? -16.572 -5.279  9.983   1.00 18.05 ? 334  ALA B CA  1 
ATOM   1917  C  C   . ALA B  2 129 ? -16.721 -4.710  8.581   1.00 17.09 ? 334  ALA B C   1 
ATOM   1918  O  O   . ALA B  2 129 ? -16.862 -5.456  7.611   1.00 16.88 ? 334  ALA B O   1 
ATOM   1919  C  CB  . ALA B  2 129 ? -17.880 -5.148  10.740  1.00 18.73 ? 334  ALA B CB  1 
ATOM   1920  N  N   . LEU B  2 130 ? -16.692 -3.385  8.478   1.00 16.58 ? 335  LEU B N   1 
ATOM   1921  C  CA  . LEU B  2 130 ? -16.720 -2.722  7.172   1.00 15.87 ? 335  LEU B CA  1 
ATOM   1922  C  C   . LEU B  2 130 ? -15.489 -3.092  6.335   1.00 15.51 ? 335  LEU B C   1 
ATOM   1923  O  O   . LEU B  2 130 ? -15.591 -3.262  5.124   1.00 15.70 ? 335  LEU B O   1 
ATOM   1924  C  CB  . LEU B  2 130 ? -16.840 -1.202  7.316   1.00 15.50 ? 335  LEU B CB  1 
ATOM   1925  C  CG  . LEU B  2 130 ? -18.135 -0.625  7.912   1.00 15.96 ? 335  LEU B CG  1 
ATOM   1926  C  CD1 . LEU B  2 130 ? -18.027 0.888   7.949   1.00 15.68 ? 335  LEU B CD1 1 
ATOM   1927  C  CD2 . LEU B  2 130 ? -19.401 -1.026  7.164   1.00 16.13 ? 335  LEU B CD2 1 
ATOM   1928  N  N   . MET B  2 131 ? -14.343 -3.248  6.982   1.00 15.60 ? 336  MET B N   1 
ATOM   1929  C  CA  . MET B  2 131 ? -13.140 -3.687  6.291   1.00 15.37 ? 336  MET B CA  1 
ATOM   1930  C  C   . MET B  2 131 ? -13.275 -5.109  5.774   1.00 15.72 ? 336  MET B C   1 
ATOM   1931  O  O   . MET B  2 131 ? -12.902 -5.388  4.646   1.00 15.46 ? 336  MET B O   1 
ATOM   1932  C  CB  . MET B  2 131 ? -11.895 -3.552  7.189   1.00 15.59 ? 336  MET B CB  1 
ATOM   1933  C  CG  . MET B  2 131 ? -11.493 -2.109  7.418   1.00 15.27 ? 336  MET B CG  1 
ATOM   1934  S  SD  . MET B  2 131 ? -10.287 -1.891  8.729   1.00 15.98 ? 336  MET B SD  1 
ATOM   1935  C  CE  . MET B  2 131 ? -8.811  -2.551  7.934   1.00 15.82 ? 336  MET B CE  1 
ATOM   1936  N  N   . LYS B  2 132 ? -13.806 -6.011  6.585   1.00 16.47 ? 337  LYS B N   1 
ATOM   1937  C  CA  . LYS B  2 132 ? -14.017 -7.385  6.121   1.00 17.04 ? 337  LYS B CA  1 
ATOM   1938  C  C   . LYS B  2 132 ? -14.952 -7.412  4.914   1.00 16.84 ? 337  LYS B C   1 
ATOM   1939  O  O   . LYS B  2 132 ? -14.660 -8.056  3.941   1.00 16.87 ? 337  LYS B O   1 
ATOM   1940  C  CB  . LYS B  2 132 ? -14.586 -8.263  7.221   1.00 17.99 ? 337  LYS B CB  1 
ATOM   1941  C  CG  . LYS B  2 132 ? -13.645 -8.484  8.383   1.00 18.53 ? 337  LYS B CG  1 
ATOM   1942  C  CD  . LYS B  2 132 ? -14.423 -9.008  9.595   1.00 19.56 ? 337  LYS B CD  1 
ATOM   1943  C  CE  . LYS B  2 132 ? -14.770 -10.480 9.429   1.00 20.45 ? 337  LYS B CE  1 
ATOM   1944  N  NZ  . LYS B  2 132 ? -15.735 -10.924 10.459  1.00 21.52 ? 337  LYS B NZ  1 
ATOM   1945  N  N   . LEU B  2 133 ? -16.062 -6.686  4.995   1.00 16.90 ? 338  LEU B N   1 
ATOM   1946  C  CA  . LEU B  2 133 ? -17.050 -6.616  3.915   1.00 16.91 ? 338  LEU B CA  1 
ATOM   1947  C  C   . LEU B  2 133 ? -16.443 -6.065  2.622   1.00 16.26 ? 338  LEU B C   1 
ATOM   1948  O  O   . LEU B  2 133 ? -16.626 -6.637  1.537   1.00 16.42 ? 338  LEU B O   1 
ATOM   1949  C  CB  . LEU B  2 133 ? -18.213 -5.729  4.341   1.00 17.06 ? 338  LEU B CB  1 
ATOM   1950  C  CG  . LEU B  2 133 ? -19.383 -5.654  3.359   1.00 17.30 ? 338  LEU B CG  1 
ATOM   1951  C  CD1 . LEU B  2 133 ? -20.250 -6.900  3.498   1.00 18.25 ? 338  LEU B CD1 1 
ATOM   1952  C  CD2 . LEU B  2 133 ? -20.238 -4.407  3.602   1.00 17.25 ? 338  LEU B CD2 1 
ATOM   1953  N  N   . GLU B  2 134 ? -15.717 -4.958  2.735   1.00 15.68 ? 339  GLU B N   1 
ATOM   1954  C  CA  . GLU B  2 134 ? -15.112 -4.340  1.568   1.00 15.20 ? 339  GLU B CA  1 
ATOM   1955  C  C   . GLU B  2 134 ? -14.124 -5.306  0.929   1.00 15.20 ? 339  GLU B C   1 
ATOM   1956  O  O   . GLU B  2 134 ? -14.077 -5.443  -0.286  1.00 14.93 ? 339  GLU B O   1 
ATOM   1957  C  CB  . GLU B  2 134 ? -14.425 -3.028  1.964   1.00 14.91 ? 339  GLU B CB  1 
ATOM   1958  C  CG  . GLU B  2 134 ? -13.633 -2.358  0.854   1.00 14.61 ? 339  GLU B CG  1 
ATOM   1959  C  CD  . GLU B  2 134 ? -14.483 -1.752  -0.248  1.00 14.61 ? 339  GLU B CD  1 
ATOM   1960  O  OE1 . GLU B  2 134 ? -15.528 -1.132  0.059   1.00 14.88 ? 339  GLU B OE1 1 
ATOM   1961  O  OE2 . GLU B  2 134 ? -14.081 -1.856  -1.441  1.00 14.81 ? 339  GLU B OE2 1 
ATOM   1962  N  N   . LEU B  2 135 ? -13.353 -5.980  1.779   1.00 15.50 ? 340  LEU B N   1 
ATOM   1963  C  CA  . LEU B  2 135 ? -12.340 -6.929  1.345   1.00 15.73 ? 340  LEU B CA  1 
ATOM   1964  C  C   . LEU B  2 135 ? -12.926 -8.095  0.555   1.00 16.14 ? 340  LEU B C   1 
ATOM   1965  O  O   . LEU B  2 135 ? -12.449 -8.408  -0.532  1.00 16.10 ? 340  LEU B O   1 
ATOM   1966  C  CB  . LEU B  2 135 ? -11.551 -7.465  2.542   1.00 16.22 ? 340  LEU B CB  1 
ATOM   1967  C  CG  . LEU B  2 135 ? -10.347 -8.360  2.234   1.00 16.63 ? 340  LEU B CG  1 
ATOM   1968  C  CD1 . LEU B  2 135 ? -9.224  -7.590  1.561   1.00 16.16 ? 340  LEU B CD1 1 
ATOM   1969  C  CD2 . LEU B  2 135 ? -9.860  -8.988  3.524   1.00 17.35 ? 340  LEU B CD2 1 
ATOM   1970  N  N   . VAL B  2 136 ? -13.955 -8.733  1.095   1.00 16.61 ? 341  VAL B N   1 
ATOM   1971  C  CA  . VAL B  2 136 ? -14.523 -9.927  0.452   1.00 17.22 ? 341  VAL B CA  1 
ATOM   1972  C  C   . VAL B  2 136 ? -15.354 -9.593  -0.790  1.00 17.04 ? 341  VAL B C   1 
ATOM   1973  O  O   . VAL B  2 136 ? -15.380 -10.359 -1.739  1.00 17.42 ? 341  VAL B O   1 
ATOM   1974  C  CB  . VAL B  2 136 ? -15.380 -10.741 1.433   1.00 17.99 ? 341  VAL B CB  1 
ATOM   1975  C  CG1 . VAL B  2 136 ? -16.078 -11.895 0.717   1.00 18.72 ? 341  VAL B CG1 1 
ATOM   1976  C  CG2 . VAL B  2 136 ? -14.511 -11.274 2.564   1.00 18.49 ? 341  VAL B CG2 1 
ATOM   1977  N  N   . HIS B  2 137 ? -16.034 -8.452  -0.782  1.00 16.67 ? 342  HIS B N   1 
ATOM   1978  C  CA  . HIS B  2 137 ? -16.932 -8.105  -1.873  1.00 16.62 ? 342  HIS B CA  1 
ATOM   1979  C  C   . HIS B  2 137 ? -16.283 -7.277  -2.961  1.00 16.01 ? 342  HIS B C   1 
ATOM   1980  O  O   . HIS B  2 137 ? -16.761 -7.307  -4.097  1.00 16.05 ? 342  HIS B O   1 
ATOM   1981  C  CB  . HIS B  2 137 ? -18.156 -7.386  -1.334  1.00 16.75 ? 342  HIS B CB  1 
ATOM   1982  C  CG  . HIS B  2 137 ? -19.073 -8.276  -0.558  1.00 17.65 ? 342  HIS B CG  1 
ATOM   1983  N  ND1 . HIS B  2 137 ? -19.863 -7.817  0.473   1.00 17.97 ? 342  HIS B ND1 1 
ATOM   1984  C  CD2 . HIS B  2 137 ? -19.319 -9.605  -0.658  1.00 18.54 ? 342  HIS B CD2 1 
ATOM   1985  C  CE1 . HIS B  2 137 ? -20.564 -8.825  0.972   1.00 18.79 ? 342  HIS B CE1 1 
ATOM   1986  N  NE2 . HIS B  2 137 ? -20.251 -9.920  0.304   1.00 19.22 ? 342  HIS B NE2 1 
ATOM   1987  N  N   . HIS B  2 138 ? -15.218 -6.537  -2.630  1.00 15.47 ? 343  HIS B N   1 
ATOM   1988  C  CA  . HIS B  2 138 ? -14.552 -5.679  -3.613  1.00 15.04 ? 343  HIS B CA  1 
ATOM   1989  C  C   . HIS B  2 138 ? -13.048 -5.866  -3.765  1.00 14.99 ? 343  HIS B C   1 
ATOM   1990  O  O   . HIS B  2 138 ? -12.489 -5.341  -4.718  1.00 14.86 ? 343  HIS B O   1 
ATOM   1991  C  CB  . HIS B  2 138 ? -14.839 -4.218  -3.320  1.00 14.61 ? 343  HIS B CB  1 
ATOM   1992  C  CG  . HIS B  2 138 ? -16.291 -3.915  -3.181  1.00 14.79 ? 343  HIS B CG  1 
ATOM   1993  N  ND1 . HIS B  2 138 ? -17.138 -3.805  -4.266  1.00 15.01 ? 343  HIS B ND1 1 
ATOM   1994  C  CD2 . HIS B  2 138 ? -17.065 -3.742  -2.081  1.00 14.95 ? 343  HIS B CD2 1 
ATOM   1995  C  CE1 . HIS B  2 138 ? -18.367 -3.562  -3.845  1.00 15.19 ? 343  HIS B CE1 1 
ATOM   1996  N  NE2 . HIS B  2 138 ? -18.351 -3.522  -2.522  1.00 15.21 ? 343  HIS B NE2 1 
ATOM   1997  N  N   . GLY B  2 139 ? -12.384 -6.562  -2.841  1.00 15.22 ? 344  GLY B N   1 
ATOM   1998  C  CA  . GLY B  2 139 ? -10.985 -6.955  -3.027  1.00 15.35 ? 344  GLY B CA  1 
ATOM   1999  C  C   . GLY B  2 139 ? -10.023 -6.222  -2.116  1.00 15.05 ? 344  GLY B C   1 
ATOM   2000  O  O   . GLY B  2 139 ? -10.445 -5.421  -1.295  1.00 14.75 ? 344  GLY B O   1 
ATOM   2001  N  N   . PRO B  2 140 ? -8.708  -6.484  -2.263  1.00 15.24 ? 345  PRO B N   1 
ATOM   2002  C  CA  . PRO B  2 140 ? -7.707  -5.862  -1.407  1.00 15.13 ? 345  PRO B CA  1 
ATOM   2003  C  C   . PRO B  2 140 ? -7.807  -4.349  -1.339  1.00 14.57 ? 345  PRO B C   1 
ATOM   2004  O  O   . PRO B  2 140 ? -8.183  -3.708  -2.307  1.00 14.29 ? 345  PRO B O   1 
ATOM   2005  C  CB  . PRO B  2 140 ? -6.395  -6.279  -2.059  1.00 15.48 ? 345  PRO B CB  1 
ATOM   2006  C  CG  . PRO B  2 140 ? -6.712  -7.606  -2.619  1.00 16.02 ? 345  PRO B CG  1 
ATOM   2007  C  CD  . PRO B  2 140 ? -8.091  -7.456  -3.176  1.00 15.74 ? 345  PRO B CD  1 
ATOM   2008  N  N   . MET B  2 141 ? -7.448  -3.798  -0.190  1.00 14.57 ? 346  MET B N   1 
ATOM   2009  C  CA  . MET B  2 141 ? -7.571  -2.377  0.040   1.00 14.20 ? 346  MET B CA  1 
ATOM   2010  C  C   . MET B  2 141 ? -6.359  -1.854  0.780   1.00 14.27 ? 346  MET B C   1 
ATOM   2011  O  O   . MET B  2 141 ? -5.704  -2.599  1.514   1.00 14.67 ? 346  MET B O   1 
ATOM   2012  C  CB  . MET B  2 141 ? -8.844  -2.088  0.842   1.00 14.25 ? 346  MET B CB  1 
ATOM   2013  C  CG  . MET B  2 141 ? -8.722  -2.336  2.336   1.00 14.60 ? 346  MET B CG  1 
ATOM   2014  S  SD  . MET B  2 141 ? -10.331 -2.692  3.055   1.00 15.15 ? 346  MET B SD  1 
ATOM   2015  C  CE  . MET B  2 141 ? -10.534 -4.269  2.250   1.00 15.21 ? 346  MET B CE  1 
ATOM   2016  N  N   . ALA B  2 142 ? -6.073  -0.573  0.568   1.00 13.96 ? 347  ALA B N   1 
ATOM   2017  C  CA  . ALA B  2 142 ? -4.965  0.093   1.227   1.00 14.14 ? 347  ALA B CA  1 
ATOM   2018  C  C   . ALA B  2 142 ? -5.336  0.411   2.667   1.00 14.25 ? 347  ALA B C   1 
ATOM   2019  O  O   . ALA B  2 142 ? -6.428  0.912   2.930   1.00 13.96 ? 347  ALA B O   1 
ATOM   2020  C  CB  . ALA B  2 142 ? -4.598  1.363   0.489   1.00 13.98 ? 347  ALA B CB  1 
ATOM   2021  N  N   . VAL B  2 143 ? -4.429  0.089   3.583   1.00 14.74 ? 348  VAL B N   1 
ATOM   2022  C  CA  . VAL B  2 143 ? -4.572  0.434   4.982   1.00 15.14 ? 348  VAL B CA  1 
ATOM   2023  C  C   . VAL B  2 143 ? -3.271  1.032   5.500   1.00 15.84 ? 348  VAL B C   1 
ATOM   2024  O  O   . VAL B  2 143 ? -2.198  0.817   4.936   1.00 16.11 ? 348  VAL B O   1 
ATOM   2025  C  CB  . VAL B  2 143 ? -4.963  -0.777  5.853   1.00 15.41 ? 348  VAL B CB  1 
ATOM   2026  C  CG1 . VAL B  2 143 ? -6.311  -1.322  5.419   1.00 15.07 ? 348  VAL B CG1 1 
ATOM   2027  C  CG2 . VAL B  2 143 ? -3.900  -1.872  5.806   1.00 15.91 ? 348  VAL B CG2 1 
ATOM   2028  N  N   . ALA B  2 144 ? -3.371  1.796   6.574   1.00 16.41 ? 349  ALA B N   1 
ATOM   2029  C  CA  . ALA B  2 144 ? -2.203  2.424   7.155   1.00 17.23 ? 349  ALA B CA  1 
ATOM   2030  C  C   . ALA B  2 144 ? -2.119  2.005   8.603   1.00 17.90 ? 349  ALA B C   1 
ATOM   2031  O  O   . ALA B  2 144 ? -3.142  1.723   9.225   1.00 18.00 ? 349  ALA B O   1 
ATOM   2032  C  CB  . ALA B  2 144 ? -2.300  3.937   7.032   1.00 17.37 ? 349  ALA B CB  1 
ATOM   2033  N  N   . PHE B  2 145 ? -0.903  1.934   9.128   1.00 18.65 ? 350  PHE B N   1 
ATOM   2034  C  CA  . PHE B  2 145 ? -0.692  1.705   10.553  1.00 19.46 ? 350  PHE B CA  1 
ATOM   2035  C  C   . PHE B  2 145 ? 0.647   2.315   11.009  1.00 20.25 ? 350  PHE B C   1 
ATOM   2036  O  O   . PHE B  2 145 ? 1.411   2.838   10.199  1.00 20.28 ? 350  PHE B O   1 
ATOM   2037  C  CB  . PHE B  2 145 ? -0.786  0.212   10.888  1.00 19.82 ? 350  PHE B CB  1 
ATOM   2038  C  CG  . PHE B  2 145 ? 0.420   -0.582  10.482  1.00 20.34 ? 350  PHE B CG  1 
ATOM   2039  C  CD1 . PHE B  2 145 ? 0.741   -0.741  9.153   1.00 20.00 ? 350  PHE B CD1 1 
ATOM   2040  C  CD2 . PHE B  2 145 ? 1.240   -1.164  11.438  1.00 21.45 ? 350  PHE B CD2 1 
ATOM   2041  C  CE1 . PHE B  2 145 ? 1.862   -1.463  8.771   1.00 20.69 ? 350  PHE B CE1 1 
ATOM   2042  C  CE2 . PHE B  2 145 ? 2.364   -1.885  11.065  1.00 22.08 ? 350  PHE B CE2 1 
ATOM   2043  C  CZ  . PHE B  2 145 ? 2.676   -2.037  9.729   1.00 21.64 ? 350  PHE B CZ  1 
ATOM   2044  N  N   . GLU B  2 146 ? 0.892   2.253   12.313  1.00 21.15 ? 351  GLU B N   1 
ATOM   2045  C  CA  . GLU B  2 146 ? 2.087   2.776   12.931  1.00 22.27 ? 351  GLU B CA  1 
ATOM   2046  C  C   . GLU B  2 146 ? 3.128   1.673   13.099  1.00 23.29 ? 351  GLU B C   1 
ATOM   2047  O  O   . GLU B  2 146 ? 2.910   0.707   13.833  1.00 23.87 ? 351  GLU B O   1 
ATOM   2048  C  CB  . GLU B  2 146 ? 1.737   3.361   14.291  1.00 22.89 ? 351  GLU B CB  1 
ATOM   2049  C  CG  . GLU B  2 146 ? 2.869   4.068   15.013  1.00 23.98 ? 351  GLU B CG  1 
ATOM   2050  C  CD  . GLU B  2 146 ? 3.307   5.374   14.358  1.00 23.82 ? 351  GLU B CD  1 
ATOM   2051  O  OE1 . GLU B  2 146 ? 2.657   5.860   13.411  1.00 22.75 ? 351  GLU B OE1 1 
ATOM   2052  O  OE2 . GLU B  2 146 ? 4.330   5.928   14.816  1.00 24.96 ? 351  GLU B OE2 1 
ATOM   2053  N  N   . VAL B  2 147 ? 4.253   1.826   12.400  1.00 23.68 ? 352  VAL B N   1 
ATOM   2054  C  CA  . VAL B  2 147 ? 5.412   0.949   12.567  1.00 24.89 ? 352  VAL B CA  1 
ATOM   2055  C  C   . VAL B  2 147 ? 6.222   1.395   13.792  1.00 26.24 ? 352  VAL B C   1 
ATOM   2056  O  O   . VAL B  2 147 ? 6.623   2.538   13.886  1.00 26.50 ? 352  VAL B O   1 
ATOM   2057  C  CB  . VAL B  2 147 ? 6.299   0.950   11.294  1.00 24.70 ? 352  VAL B CB  1 
ATOM   2058  C  CG1 . VAL B  2 147 ? 7.590   0.166   11.509  1.00 25.84 ? 352  VAL B CG1 1 
ATOM   2059  C  CG2 . VAL B  2 147 ? 5.527   0.383   10.109  1.00 23.58 ? 352  VAL B CG2 1 
ATOM   2060  N  N   . TYR B  2 148 ? 6.410   0.488   14.743  1.00 27.65 ? 353  TYR B N   1 
ATOM   2061  C  CA  . TYR B  2 148 ? 7.304   0.704   15.877  1.00 29.34 ? 353  TYR B CA  1 
ATOM   2062  C  C   . TYR B  2 148 ? 8.539   -0.156  15.688  1.00 31.00 ? 353  TYR B C   1 
ATOM   2063  O  O   . TYR B  2 148 ? 8.609   -0.921  14.744  1.00 30.88 ? 353  TYR B O   1 
ATOM   2064  C  CB  . TYR B  2 148 ? 6.617   0.328   17.184  1.00 29.76 ? 353  TYR B CB  1 
ATOM   2065  C  CG  . TYR B  2 148 ? 5.454   1.209   17.546  1.00 28.88 ? 353  TYR B CG  1 
ATOM   2066  C  CD1 . TYR B  2 148 ? 5.653   2.426   18.176  1.00 29.16 ? 353  TYR B CD1 1 
ATOM   2067  C  CD2 . TYR B  2 148 ? 4.140   0.818   17.267  1.00 27.88 ? 353  TYR B CD2 1 
ATOM   2068  C  CE1 . TYR B  2 148 ? 4.582   3.232   18.525  1.00 28.69 ? 353  TYR B CE1 1 
ATOM   2069  C  CE2 . TYR B  2 148 ? 3.068   1.621   17.616  1.00 27.27 ? 353  TYR B CE2 1 
ATOM   2070  C  CZ  . TYR B  2 148 ? 3.296   2.822   18.243  1.00 27.68 ? 353  TYR B CZ  1 
ATOM   2071  O  OH  . TYR B  2 148 ? 2.243   3.622   18.590  1.00 27.36 ? 353  TYR B OH  1 
ATOM   2072  N  N   . ASP B  2 149 ? 9.507   -0.039  16.587  1.00 33.23 ? 354  ASP B N   1 
ATOM   2073  C  CA  . ASP B  2 149 ? 10.764  -0.783  16.446  1.00 35.08 ? 354  ASP B CA  1 
ATOM   2074  C  C   . ASP B  2 149 ? 10.587  -2.307  16.499  1.00 35.64 ? 354  ASP B C   1 
ATOM   2075  O  O   . ASP B  2 149 ? 11.233  -3.029  15.735  1.00 36.16 ? 354  ASP B O   1 
ATOM   2076  C  CB  . ASP B  2 149 ? 11.790  -0.324  17.494  1.00 37.07 ? 354  ASP B CB  1 
ATOM   2077  C  CG  . ASP B  2 149 ? 12.266  1.107   17.260  1.00 37.58 ? 354  ASP B CG  1 
ATOM   2078  O  OD1 . ASP B  2 149 ? 12.246  1.557   16.089  1.00 37.71 ? 354  ASP B OD1 1 
ATOM   2079  O  OD2 . ASP B  2 149 ? 12.668  1.785   18.241  1.00 39.43 ? 354  ASP B OD2 1 
ATOM   2080  N  N   . ASP B  2 150 ? 9.709   -2.801  17.372  1.00 36.08 ? 355  ASP B N   1 
ATOM   2081  C  CA  . ASP B  2 150 ? 9.487   -4.254  17.469  1.00 36.87 ? 355  ASP B CA  1 
ATOM   2082  C  C   . ASP B  2 150 ? 8.894   -4.884  16.188  1.00 35.96 ? 355  ASP B C   1 
ATOM   2083  O  O   . ASP B  2 150 ? 8.942   -6.098  16.015  1.00 37.32 ? 355  ASP B O   1 
ATOM   2084  C  CB  . ASP B  2 150 ? 8.658   -4.615  18.714  1.00 37.42 ? 355  ASP B CB  1 
ATOM   2085  C  CG  . ASP B  2 150 ? 7.207   -4.176  18.621  1.00 36.49 ? 355  ASP B CG  1 
ATOM   2086  O  OD1 . ASP B  2 150 ? 6.880   -3.265  17.828  1.00 35.56 ? 355  ASP B OD1 1 
ATOM   2087  O  OD2 . ASP B  2 150 ? 6.378   -4.742  19.367  1.00 37.18 ? 355  ASP B OD2 1 
ATOM   2088  N  N   . PHE B  2 151 ? 8.354   -4.059  15.297  1.00 34.60 ? 356  PHE B N   1 
ATOM   2089  C  CA  . PHE B  2 151 ? 7.827   -4.524  14.013  1.00 33.73 ? 356  PHE B CA  1 
ATOM   2090  C  C   . PHE B  2 151 ? 8.925   -4.765  12.974  1.00 35.00 ? 356  PHE B C   1 
ATOM   2091  O  O   . PHE B  2 151 ? 8.801   -5.634  12.116  1.00 34.47 ? 356  PHE B O   1 
ATOM   2092  C  CB  . PHE B  2 151 ? 6.821   -3.511  13.462  1.00 31.47 ? 356  PHE B CB  1 
ATOM   2093  C  CG  . PHE B  2 151 ? 6.146   -3.959  12.201  1.00 29.99 ? 356  PHE B CG  1 
ATOM   2094  C  CD1 . PHE B  2 151 ? 5.142   -4.914  12.245  1.00 29.56 ? 356  PHE B CD1 1 
ATOM   2095  C  CD2 . PHE B  2 151 ? 6.513   -3.424  10.972  1.00 29.04 ? 356  PHE B CD2 1 
ATOM   2096  C  CE1 . PHE B  2 151 ? 4.513   -5.333  11.085  1.00 28.42 ? 356  PHE B CE1 1 
ATOM   2097  C  CE2 . PHE B  2 151 ? 5.895   -3.841  9.812   1.00 27.81 ? 356  PHE B CE2 1 
ATOM   2098  C  CZ  . PHE B  2 151 ? 4.893   -4.797  9.868   1.00 27.46 ? 356  PHE B CZ  1 
ATOM   2099  N  N   . LEU B  2 152 ? 10.001  -3.988  13.048  1.00 37.50 ? 357  LEU B N   1 
ATOM   2100  C  CA  . LEU B  2 152 ? 11.127  -4.158  12.126  1.00 38.48 ? 357  LEU B CA  1 
ATOM   2101  C  C   . LEU B  2 152 ? 11.732  -5.551  12.327  1.00 40.09 ? 357  LEU B C   1 
ATOM   2102  O  O   . LEU B  2 152 ? 12.040  -6.237  11.356  1.00 42.09 ? 357  LEU B O   1 
ATOM   2103  C  CB  . LEU B  2 152 ? 12.159  -3.050  12.324  1.00 39.34 ? 357  LEU B CB  1 
ATOM   2104  C  CG  . LEU B  2 152 ? 11.602  -1.618  12.263  1.00 38.31 ? 357  LEU B CG  1 
ATOM   2105  C  CD1 . LEU B  2 152 ? 12.696  -0.606  12.576  1.00 39.16 ? 357  LEU B CD1 1 
ATOM   2106  C  CD2 . LEU B  2 152 ? 10.963  -1.334  10.910  1.00 36.77 ? 357  LEU B CD2 1 
ATOM   2107  N  N   . HIS B  2 153 ? 11.807  -5.997  13.579  1.00 41.50 ? 358  HIS B N   1 
ATOM   2108  C  CA  . HIS B  2 153 ? 12.294  -7.350  13.908  1.00 43.64 ? 358  HIS B CA  1 
ATOM   2109  C  C   . HIS B  2 153 ? 11.258  -8.502  13.800  1.00 41.81 ? 358  HIS B C   1 
ATOM   2110  O  O   . HIS B  2 153 ? 11.511  -9.602  14.294  1.00 42.93 ? 358  HIS B O   1 
ATOM   2111  C  CB  . HIS B  2 153 ? 12.900  -7.349  15.318  1.00 46.13 ? 358  HIS B CB  1 
ATOM   2112  C  CG  . HIS B  2 153 ? 13.920  -6.273  15.537  1.00 48.05 ? 358  HIS B CG  1 
ATOM   2113  N  ND1 . HIS B  2 153 ? 14.734  -5.797  14.527  1.00 48.47 ? 358  HIS B ND1 1 
ATOM   2114  C  CD2 . HIS B  2 153 ? 14.270  -5.592  16.655  1.00 50.14 ? 358  HIS B CD2 1 
ATOM   2115  C  CE1 . HIS B  2 153 ? 15.531  -4.861  15.011  1.00 50.26 ? 358  HIS B CE1 1 
ATOM   2116  N  NE2 . HIS B  2 153 ? 15.275  -4.722  16.301  1.00 51.39 ? 358  HIS B NE2 1 
ATOM   2117  N  N   . TYR B  2 154 ? 10.116  -8.259  13.151  1.00 39.01 ? 359  TYR B N   1 
ATOM   2118  C  CA  . TYR B  2 154 ? 9.103   -9.303  12.911  1.00 37.13 ? 359  TYR B CA  1 
ATOM   2119  C  C   . TYR B  2 154 ? 9.566   -10.310 11.866  1.00 37.35 ? 359  TYR B C   1 
ATOM   2120  O  O   . TYR B  2 154 ? 10.075  -9.925  10.807  1.00 37.32 ? 359  TYR B O   1 
ATOM   2121  C  CB  . TYR B  2 154 ? 7.786   -8.670  12.441  1.00 34.75 ? 359  TYR B CB  1 
ATOM   2122  C  CG  . TYR B  2 154 ? 6.757   -9.640  11.883  1.00 33.40 ? 359  TYR B CG  1 
ATOM   2123  C  CD1 . TYR B  2 154 ? 6.775   -10.008 10.539  1.00 32.72 ? 359  TYR B CD1 1 
ATOM   2124  C  CD2 . TYR B  2 154 ? 5.755   -10.158 12.686  1.00 33.17 ? 359  TYR B CD2 1 
ATOM   2125  C  CE1 . TYR B  2 154 ? 5.841   -10.879 10.011  1.00 31.61 ? 359  TYR B CE1 1 
ATOM   2126  C  CE2 . TYR B  2 154 ? 4.803   -11.023 12.167  1.00 32.61 ? 359  TYR B CE2 1 
ATOM   2127  C  CZ  . TYR B  2 154 ? 4.852   -11.384 10.824  1.00 31.88 ? 359  TYR B CZ  1 
ATOM   2128  O  OH  . TYR B  2 154 ? 3.916   -12.250 10.295  1.00 31.02 ? 359  TYR B OH  1 
ATOM   2129  N  N   . LYS B  2 155 ? 9.371   -11.592 12.157  1.00 37.86 ? 360  LYS B N   1 
ATOM   2130  C  CA  . LYS B  2 155 ? 9.602   -12.646 11.168  1.00 38.31 ? 360  LYS B CA  1 
ATOM   2131  C  C   . LYS B  2 155 ? 8.348   -13.439 10.850  1.00 36.86 ? 360  LYS B C   1 
ATOM   2132  O  O   . LYS B  2 155 ? 8.127   -13.802 9.701   1.00 35.93 ? 360  LYS B O   1 
ATOM   2133  C  CB  . LYS B  2 155 ? 10.720  -13.602 11.624  1.00 40.75 ? 360  LYS B CB  1 
ATOM   2134  C  CG  . LYS B  2 155 ? 12.137  -13.182 11.224  1.00 41.86 ? 360  LYS B CG  1 
ATOM   2135  C  CD  . LYS B  2 155 ? 12.304  -12.825 9.738   1.00 41.28 ? 360  LYS B CD  1 
ATOM   2136  C  CE  . LYS B  2 155 ? 12.106  -14.012 8.793   1.00 42.10 ? 360  LYS B CE  1 
ATOM   2137  N  NZ  . LYS B  2 155 ? 11.960  -13.596 7.358   1.00 41.24 ? 360  LYS B NZ  1 
ATOM   2138  N  N   . LYS B  2 156 ? 7.538   -13.727 11.863  1.00 36.58 ? 361  LYS B N   1 
ATOM   2139  C  CA  . LYS B  2 156 ? 6.364   -14.565 11.665  1.00 35.93 ? 361  LYS B CA  1 
ATOM   2140  C  C   . LYS B  2 156 ? 5.377   -14.490 12.822  1.00 35.33 ? 361  LYS B C   1 
ATOM   2141  O  O   . LYS B  2 156 ? 5.662   -13.914 13.875  1.00 35.35 ? 361  LYS B O   1 
ATOM   2142  C  CB  . LYS B  2 156 ? 6.785   -16.028 11.437  1.00 37.50 ? 361  LYS B CB  1 
ATOM   2143  C  CG  . LYS B  2 156 ? 7.540   -16.658 12.595  1.00 39.38 ? 361  LYS B CG  1 
ATOM   2144  C  CD  . LYS B  2 156 ? 7.845   -18.123 12.329  1.00 41.07 ? 361  LYS B CD  1 
ATOM   2145  C  CE  . LYS B  2 156 ? 8.492   -18.747 13.554  1.00 43.15 ? 361  LYS B CE  1 
ATOM   2146  N  NZ  . LYS B  2 156 ? 8.963   -20.132 13.300  1.00 44.94 ? 361  LYS B NZ  1 
ATOM   2147  N  N   . GLY B  2 157 ? 4.212   -15.089 12.604  1.00 34.52 ? 362  GLY B N   1 
ATOM   2148  C  CA  . GLY B  2 157 ? 3.164   -15.124 13.610  1.00 34.28 ? 362  GLY B CA  1 
ATOM   2149  C  C   . GLY B  2 157 ? 2.299   -13.885 13.527  1.00 32.36 ? 362  GLY B C   1 
ATOM   2150  O  O   . GLY B  2 157 ? 2.287   -13.184 12.514  1.00 31.10 ? 362  GLY B O   1 
ATOM   2151  N  N   . ILE B  2 158 ? 1.591   -13.610 14.610  1.00 32.25 ? 363  ILE B N   1 
ATOM   2152  C  CA  . ILE B  2 158 ? 0.607   -12.552 14.641  1.00 30.88 ? 363  ILE B CA  1 
ATOM   2153  C  C   . ILE B  2 158 ? 1.155   -11.376 15.437  1.00 30.73 ? 363  ILE B C   1 
ATOM   2154  O  O   . ILE B  2 158 ? 1.247   -11.415 16.659  1.00 31.72 ? 363  ILE B O   1 
ATOM   2155  C  CB  . ILE B  2 158 ? -0.724  -13.050 15.239  1.00 31.19 ? 363  ILE B CB  1 
ATOM   2156  C  CG1 . ILE B  2 158 ? -1.244  -14.255 14.432  1.00 31.52 ? 363  ILE B CG1 1 
ATOM   2157  C  CG2 . ILE B  2 158 ? -1.758  -11.928 15.237  1.00 29.91 ? 363  ILE B CG2 1 
ATOM   2158  C  CD1 . ILE B  2 158 ? -2.271  -15.104 15.148  1.00 32.58 ? 363  ILE B CD1 1 
ATOM   2159  N  N   . TYR B  2 159 ? 1.509   -10.324 14.725  1.00 29.50 ? 364  TYR B N   1 
ATOM   2160  C  CA  . TYR B  2 159 ? 2.075   -9.159  15.347  1.00 29.63 ? 364  TYR B CA  1 
ATOM   2161  C  C   . TYR B  2 159 ? 1.113   -8.460  16.299  1.00 29.82 ? 364  TYR B C   1 
ATOM   2162  O  O   . TYR B  2 159 ? -0.069  -8.239  15.991  1.00 28.83 ? 364  TYR B O   1 
ATOM   2163  C  CB  . TYR B  2 159 ? 2.521   -8.164  14.288  1.00 28.46 ? 364  TYR B CB  1 
ATOM   2164  C  CG  . TYR B  2 159 ? 3.062   -6.888  14.870  1.00 28.39 ? 364  TYR B CG  1 
ATOM   2165  C  CD1 . TYR B  2 159 ? 4.269   -6.883  15.572  1.00 29.48 ? 364  TYR B CD1 1 
ATOM   2166  C  CD2 . TYR B  2 159 ? 2.368   -5.691  14.736  1.00 27.22 ? 364  TYR B CD2 1 
ATOM   2167  C  CE1 . TYR B  2 159 ? 4.772   -5.720  16.124  1.00 29.62 ? 364  TYR B CE1 1 
ATOM   2168  C  CE2 . TYR B  2 159 ? 2.869   -4.519  15.271  1.00 27.52 ? 364  TYR B CE2 1 
ATOM   2169  C  CZ  . TYR B  2 159 ? 4.071   -4.538  15.966  1.00 28.80 ? 364  TYR B CZ  1 
ATOM   2170  O  OH  . TYR B  2 159 ? 4.573   -3.375  16.497  1.00 29.55 ? 364  TYR B OH  1 
ATOM   2171  N  N   . HIS B  2 160 ? 1.666   -8.103  17.451  1.00 31.19 ? 365  HIS B N   1 
ATOM   2172  C  CA  . HIS B  2 160 ? 0.998   -7.311  18.452  1.00 31.77 ? 365  HIS B CA  1 
ATOM   2173  C  C   . HIS B  2 160 ? 2.076   -6.429  19.052  1.00 32.88 ? 365  HIS B C   1 
ATOM   2174  O  O   . HIS B  2 160 ? 3.121   -6.940  19.444  1.00 34.12 ? 365  HIS B O   1 
ATOM   2175  C  CB  . HIS B  2 160 ? 0.400   -8.232  19.519  1.00 33.07 ? 365  HIS B CB  1 
ATOM   2176  C  CG  . HIS B  2 160 ? 0.009   -7.526  20.777  1.00 33.83 ? 365  HIS B CG  1 
ATOM   2177  N  ND1 . HIS B  2 160 ? -0.900  -6.486  20.795  1.00 33.07 ? 365  HIS B ND1 1 
ATOM   2178  C  CD2 . HIS B  2 160 ? 0.398   -7.711  22.062  1.00 35.35 ? 365  HIS B CD2 1 
ATOM   2179  C  CE1 . HIS B  2 160 ? -1.048  -6.057  22.038  1.00 34.07 ? 365  HIS B CE1 1 
ATOM   2180  N  NE2 . HIS B  2 160 ? -0.271  -6.784  22.826  1.00 35.38 ? 365  HIS B NE2 1 
ATOM   2181  N  N   . HIS B  2 161 ? 1.844   -5.117  19.111  1.00 32.75 ? 366  HIS B N   1 
ATOM   2182  C  CA  . HIS B  2 161 ? 2.804   -4.202  19.740  1.00 34.02 ? 366  HIS B CA  1 
ATOM   2183  C  C   . HIS B  2 161 ? 2.663   -4.198  21.257  1.00 36.05 ? 366  HIS B C   1 
ATOM   2184  O  O   . HIS B  2 161 ? 1.547   -4.141  21.770  1.00 36.32 ? 366  HIS B O   1 
ATOM   2185  C  CB  . HIS B  2 161 ? 2.627   -2.782  19.227  1.00 32.94 ? 366  HIS B CB  1 
ATOM   2186  C  CG  . HIS B  2 161 ? 3.487   -1.779  19.929  1.00 33.68 ? 366  HIS B CG  1 
ATOM   2187  N  ND1 . HIS B  2 161 ? 4.864   -1.816  19.879  1.00 34.44 ? 366  HIS B ND1 1 
ATOM   2188  C  CD2 . HIS B  2 161 ? 3.166   -0.711  20.697  1.00 34.01 ? 366  HIS B CD2 1 
ATOM   2189  C  CE1 . HIS B  2 161 ? 5.353   -0.812  20.584  1.00 35.16 ? 366  HIS B CE1 1 
ATOM   2190  N  NE2 . HIS B  2 161 ? 4.344   -0.124  21.088  1.00 34.81 ? 366  HIS B NE2 1 
ATOM   2191  N  N   . THR B  2 162 ? 3.801   -4.237  21.956  1.00 38.42 ? 367  THR B N   1 
ATOM   2192  C  CA  . THR B  2 162 ? 3.847   -4.256  23.425  1.00 41.03 ? 367  THR B CA  1 
ATOM   2193  C  C   . THR B  2 162 ? 4.588   -3.022  23.951  1.00 42.17 ? 367  THR B C   1 
ATOM   2194  O  O   . THR B  2 162 ? 5.761   -2.803  23.620  1.00 43.11 ? 367  THR B O   1 
ATOM   2195  C  CB  . THR B  2 162 ? 4.565   -5.521  23.944  1.00 43.13 ? 367  THR B CB  1 
ATOM   2196  O  OG1 . THR B  2 162 ? 4.148   -6.662  23.180  1.00 42.77 ? 367  THR B OG1 1 
ATOM   2197  C  CG2 . THR B  2 162 ? 4.256   -5.752  25.426  1.00 44.87 ? 367  THR B CG2 1 
ATOM   2198  N  N   . PRO C  3 2   ? -15.209 16.921  21.239  1.00 44.47 ? 372  PRO C N   1 
ATOM   2199  C  CA  . PRO C  3 2   ? -16.050 16.423  20.132  1.00 42.78 ? 372  PRO C CA  1 
ATOM   2200  C  C   . PRO C  3 2   ? -15.287 15.429  19.232  1.00 39.80 ? 372  PRO C C   1 
ATOM   2201  O  O   . PRO C  3 2   ? -14.296 14.846  19.685  1.00 39.08 ? 372  PRO C O   1 
ATOM   2202  C  CB  . PRO C  3 2   ? -16.431 17.704  19.372  1.00 43.71 ? 372  PRO C CB  1 
ATOM   2203  C  CG  . PRO C  3 2   ? -16.196 18.842  20.337  1.00 46.29 ? 372  PRO C CG  1 
ATOM   2204  C  CD  . PRO C  3 2   ? -15.478 18.334  21.561  1.00 46.12 ? 372  PRO C CD  1 
ATOM   2205  N  N   . PHE C  3 3   ? -15.731 15.250  17.982  1.00 37.79 ? 373  PHE C N   1 
ATOM   2206  C  CA  . PHE C  3 3   ? -15.144 14.258  17.056  1.00 34.42 ? 373  PHE C CA  1 
ATOM   2207  C  C   . PHE C  3 3   ? -13.742 14.658  16.606  1.00 33.30 ? 373  PHE C C   1 
ATOM   2208  O  O   . PHE C  3 3   ? -13.501 15.793  16.203  1.00 33.44 ? 373  PHE C O   1 
ATOM   2209  C  CB  . PHE C  3 3   ? -16.066 14.075  15.841  1.00 33.74 ? 373  PHE C CB  1 
ATOM   2210  C  CG  . PHE C  3 3   ? -15.770 12.853  14.990  1.00 31.84 ? 373  PHE C CG  1 
ATOM   2211  C  CD1 . PHE C  3 3   ? -15.529 11.611  15.558  1.00 31.43 ? 373  PHE C CD1 1 
ATOM   2212  C  CD2 . PHE C  3 3   ? -15.783 12.948  13.605  1.00 30.67 ? 373  PHE C CD2 1 
ATOM   2213  C  CE1 . PHE C  3 3   ? -15.276 10.503  14.761  1.00 29.93 ? 373  PHE C CE1 1 
ATOM   2214  C  CE2 . PHE C  3 3   ? -15.537 11.850  12.808  1.00 29.22 ? 373  PHE C CE2 1 
ATOM   2215  C  CZ  . PHE C  3 3   ? -15.288 10.624  13.382  1.00 28.76 ? 373  PHE C CZ  1 
ATOM   2216  N  N   . ASN C  3 4   ? -12.810 13.716  16.716  1.00 31.63 ? 374  ASN C N   1 
ATOM   2217  C  CA  . ASN C  3 4   ? -11.438 13.871  16.225  1.00 29.85 ? 374  ASN C CA  1 
ATOM   2218  C  C   . ASN C  3 4   ? -10.950 12.500  15.851  1.00 27.58 ? 374  ASN C C   1 
ATOM   2219  O  O   . ASN C  3 4   ? -10.511 11.754  16.704  1.00 27.93 ? 374  ASN C O   1 
ATOM   2220  C  CB  . ASN C  3 4   ? -10.506 14.470  17.284  1.00 31.29 ? 374  ASN C CB  1 
ATOM   2221  C  CG  . ASN C  3 4   ? -9.045  14.582  16.802  1.00 31.23 ? 374  ASN C CG  1 
ATOM   2222  O  OD1 . ASN C  3 4   ? -8.663  14.065  15.740  1.00 30.48 ? 374  ASN C OD1 1 
ATOM   2223  N  ND2 . ASN C  3 4   ? -8.225  15.262  17.588  1.00 32.48 ? 374  ASN C ND2 1 
ATOM   2224  N  N   . PRO C  3 5   ? -11.041 12.146  14.575  1.00 25.58 ? 375  PRO C N   1 
ATOM   2225  C  CA  . PRO C  3 5   ? -10.670 10.796  14.178  1.00 24.09 ? 375  PRO C CA  1 
ATOM   2226  C  C   . PRO C  3 5   ? -9.168  10.482  14.091  1.00 23.62 ? 375  PRO C C   1 
ATOM   2227  O  O   . PRO C  3 5   ? -8.810  9.332   13.835  1.00 22.98 ? 375  PRO C O   1 
ATOM   2228  C  CB  . PRO C  3 5   ? -11.288 10.678  12.776  1.00 23.04 ? 375  PRO C CB  1 
ATOM   2229  C  CG  . PRO C  3 5   ? -11.394 12.076  12.276  1.00 23.81 ? 375  PRO C CG  1 
ATOM   2230  C  CD  . PRO C  3 5   ? -11.702 12.889  13.490  1.00 25.39 ? 375  PRO C CD  1 
ATOM   2231  N  N   . PHE C  3 6   ? -8.292  11.464  14.256  1.00 23.91 ? 376  PHE C N   1 
ATOM   2232  C  CA  . PHE C  3 6   ? -6.883  11.229  14.020  1.00 23.35 ? 376  PHE C CA  1 
ATOM   2233  C  C   . PHE C  3 6   ? -6.334  10.021  14.790  1.00 23.13 ? 376  PHE C C   1 
ATOM   2234  O  O   . PHE C  3 6   ? -6.566  9.877   15.983  1.00 23.71 ? 376  PHE C O   1 
ATOM   2235  C  CB  . PHE C  3 6   ? -6.076  12.474  14.386  1.00 24.45 ? 376  PHE C CB  1 
ATOM   2236  C  CG  . PHE C  3 6   ? -4.605  12.294  14.221  1.00 24.40 ? 376  PHE C CG  1 
ATOM   2237  C  CD1 . PHE C  3 6   ? -4.017  12.404  12.961  1.00 23.83 ? 376  PHE C CD1 1 
ATOM   2238  C  CD2 . PHE C  3 6   ? -3.805  11.983  15.310  1.00 25.10 ? 376  PHE C CD2 1 
ATOM   2239  C  CE1 . PHE C  3 6   ? -2.654  12.227  12.803  1.00 23.85 ? 376  PHE C CE1 1 
ATOM   2240  C  CE2 . PHE C  3 6   ? -2.441  11.799  15.153  1.00 25.70 ? 376  PHE C CE2 1 
ATOM   2241  C  CZ  . PHE C  3 6   ? -1.862  11.923  13.899  1.00 24.66 ? 376  PHE C CZ  1 
ATOM   2242  N  N   . GLU C  3 7   ? -5.616  9.151   14.094  1.00 22.30 ? 377  GLU C N   1 
ATOM   2243  C  CA  . GLU C  3 7   ? -4.782  8.143   14.733  1.00 22.27 ? 377  GLU C CA  1 
ATOM   2244  C  C   . GLU C  3 7   ? -3.453  8.131   14.029  1.00 21.85 ? 377  GLU C C   1 
ATOM   2245  O  O   . GLU C  3 7   ? -3.407  8.103   12.799  1.00 21.12 ? 377  GLU C O   1 
ATOM   2246  C  CB  . GLU C  3 7   ? -5.408  6.770   14.636  1.00 22.06 ? 377  GLU C CB  1 
ATOM   2247  C  CG  . GLU C  3 7   ? -6.730  6.684   15.369  1.00 22.74 ? 377  GLU C CG  1 
ATOM   2248  C  CD  . GLU C  3 7   ? -7.216  5.257   15.549  1.00 22.75 ? 377  GLU C CD  1 
ATOM   2249  O  OE1 . GLU C  3 7   ? -6.360  4.332   15.626  1.00 23.34 ? 377  GLU C OE1 1 
ATOM   2250  O  OE2 . GLU C  3 7   ? -8.451  5.066   15.624  1.00 23.01 ? 377  GLU C OE2 1 
ATOM   2251  N  N   . LEU C  3 8   ? -2.376  8.145   14.800  1.00 22.32 ? 378  LEU C N   1 
ATOM   2252  C  CA  . LEU C  3 8   ? -1.035  8.216   14.232  1.00 22.44 ? 378  LEU C CA  1 
ATOM   2253  C  C   . LEU C  3 8   ? -0.732  6.955   13.390  1.00 21.63 ? 378  LEU C C   1 
ATOM   2254  O  O   . LEU C  3 8   ? -0.894  5.838   13.859  1.00 21.75 ? 378  LEU C O   1 
ATOM   2255  C  CB  . LEU C  3 8   ? -0.001  8.425   15.363  1.00 23.50 ? 378  LEU C CB  1 
ATOM   2256  C  CG  . LEU C  3 8   ? 1.461   8.742   15.013  1.00 24.11 ? 378  LEU C CG  1 
ATOM   2257  C  CD1 . LEU C  3 8   ? 1.608   10.028  14.208  1.00 24.20 ? 378  LEU C CD1 1 
ATOM   2258  C  CD2 . LEU C  3 8   ? 2.322   8.817   16.273  1.00 25.35 ? 378  LEU C CD2 1 
ATOM   2259  N  N   . THR C  3 9   ? -0.358  7.159   12.134  1.00 21.17 ? 379  THR C N   1 
ATOM   2260  C  CA  . THR C  3 9   ? 0.203   6.099   11.281  1.00 20.82 ? 379  THR C CA  1 
ATOM   2261  C  C   . THR C  3 9   ? 1.457   6.595   10.549  1.00 21.19 ? 379  THR C C   1 
ATOM   2262  O  O   . THR C  3 9   ? 1.634   7.792   10.363  1.00 22.03 ? 379  THR C O   1 
ATOM   2263  C  CB  . THR C  3 9   ? -0.778  5.639   10.197  1.00 19.80 ? 379  THR C CB  1 
ATOM   2264  O  OG1 . THR C  3 9   ? -0.925  6.675   9.215   1.00 19.86 ? 379  THR C OG1 1 
ATOM   2265  C  CG2 . THR C  3 9   ? -2.114  5.311   10.793  1.00 19.49 ? 379  THR C CG2 1 
ATOM   2266  N  N   . ASN C  3 10  ? 2.314   5.670   10.138  1.00 21.15 ? 380  ASN C N   1 
ATOM   2267  C  CA  . ASN C  3 10  ? 3.511   6.037   9.360   1.00 21.79 ? 380  ASN C CA  1 
ATOM   2268  C  C   . ASN C  3 10  ? 3.786   5.137   8.146   1.00 21.35 ? 380  ASN C C   1 
ATOM   2269  O  O   . ASN C  3 10  ? 4.696   5.405   7.381   1.00 22.41 ? 380  ASN C O   1 
ATOM   2270  C  CB  . ASN C  3 10  ? 4.757   6.134   10.277  1.00 22.93 ? 380  ASN C CB  1 
ATOM   2271  C  CG  . ASN C  3 10  ? 5.104   4.813   10.948  1.00 23.33 ? 380  ASN C CG  1 
ATOM   2272  O  OD1 . ASN C  3 10  ? 4.688   3.743   10.488  1.00 23.03 ? 380  ASN C OD1 1 
ATOM   2273  N  ND2 . ASN C  3 10  ? 5.846   4.871   12.048  1.00 24.27 ? 380  ASN C ND2 1 
ATOM   2274  N  N   . HIS C  3 11  ? 2.994   4.092   7.949   1.00 20.42 ? 381  HIS C N   1 
ATOM   2275  C  CA  . HIS C  3 11  ? 3.275   3.124   6.891   1.00 20.20 ? 381  HIS C CA  1 
ATOM   2276  C  C   . HIS C  3 11  ? 1.980   2.614   6.248   1.00 18.82 ? 381  HIS C C   1 
ATOM   2277  O  O   . HIS C  3 11  ? 1.014   2.323   6.933   1.00 18.23 ? 381  HIS C O   1 
ATOM   2278  C  CB  . HIS C  3 11  ? 4.099   1.971   7.479   1.00 21.10 ? 381  HIS C CB  1 
ATOM   2279  C  CG  . HIS C  3 11  ? 4.684   1.046   6.462   1.00 21.45 ? 381  HIS C CG  1 
ATOM   2280  N  ND1 . HIS C  3 11  ? 5.160   1.477   5.246   1.00 21.75 ? 381  HIS C ND1 1 
ATOM   2281  C  CD2 . HIS C  3 11  ? 4.902   -0.289  6.497   1.00 21.86 ? 381  HIS C CD2 1 
ATOM   2282  C  CE1 . HIS C  3 11  ? 5.627   0.446   4.566   1.00 22.29 ? 381  HIS C CE1 1 
ATOM   2283  N  NE2 . HIS C  3 11  ? 5.484   -0.638  5.303   1.00 22.21 ? 381  HIS C NE2 1 
ATOM   2284  N  N   . ALA C  3 12  ? 1.976   2.533   4.920   1.00 18.32 ? 382  ALA C N   1 
ATOM   2285  C  CA  . ALA C  3 12  ? 0.816   2.100   4.157   1.00 17.24 ? 382  ALA C CA  1 
ATOM   2286  C  C   . ALA C  3 12  ? 1.072   0.729   3.574   1.00 17.15 ? 382  ALA C C   1 
ATOM   2287  O  O   . ALA C  3 12  ? 2.130   0.472   3.020   1.00 17.91 ? 382  ALA C O   1 
ATOM   2288  C  CB  . ALA C  3 12  ? 0.532   3.089   3.047   1.00 17.08 ? 382  ALA C CB  1 
ATOM   2289  N  N   . VAL C  3 13  ? 0.085   -0.144  3.682   1.00 16.50 ? 383  VAL C N   1 
ATOM   2290  C  CA  . VAL C  3 13  ? 0.225   -1.526  3.254   1.00 16.63 ? 383  VAL C CA  1 
ATOM   2291  C  C   . VAL C  3 13  ? -1.081  -1.990  2.648   1.00 15.92 ? 383  VAL C C   1 
ATOM   2292  O  O   . VAL C  3 13  ? -2.068  -1.251  2.659   1.00 15.27 ? 383  VAL C O   1 
ATOM   2293  C  CB  . VAL C  3 13  ? 0.635   -2.455  4.427   1.00 17.12 ? 383  VAL C CB  1 
ATOM   2294  C  CG1 . VAL C  3 13  ? 2.075   -2.175  4.851   1.00 18.01 ? 383  VAL C CG1 1 
ATOM   2295  C  CG2 . VAL C  3 13  ? -0.308  -2.278  5.606   1.00 16.78 ? 383  VAL C CG2 1 
ATOM   2296  N  N   . LEU C  3 14  ? -1.073  -3.205  2.106   1.00 16.10 ? 384  LEU C N   1 
ATOM   2297  C  CA  . LEU C  3 14  ? -2.241  -3.748  1.431   1.00 15.67 ? 384  LEU C CA  1 
ATOM   2298  C  C   . LEU C  3 14  ? -2.837  -4.911  2.203   1.00 15.79 ? 384  LEU C C   1 
ATOM   2299  O  O   . LEU C  3 14  ? -2.181  -5.918  2.451   1.00 16.48 ? 384  LEU C O   1 
ATOM   2300  C  CB  . LEU C  3 14  ? -1.882  -4.185  0.015   1.00 15.95 ? 384  LEU C CB  1 
ATOM   2301  C  CG  . LEU C  3 14  ? -3.062  -4.715  -0.788  1.00 15.66 ? 384  LEU C CG  1 
ATOM   2302  C  CD1 . LEU C  3 14  ? -3.951  -3.573  -1.263  1.00 15.12 ? 384  LEU C CD1 1 
ATOM   2303  C  CD2 . LEU C  3 14  ? -2.562  -5.510  -1.962  1.00 16.33 ? 384  LEU C CD2 1 
ATOM   2304  N  N   . LEU C  3 15  ? -4.096  -4.747  2.585   1.00 15.42 ? 385  LEU C N   1 
ATOM   2305  C  CA  . LEU C  3 15  ? -4.831  -5.781  3.286   1.00 15.66 ? 385  LEU C CA  1 
ATOM   2306  C  C   . LEU C  3 15  ? -5.355  -6.755  2.255   1.00 15.93 ? 385  LEU C C   1 
ATOM   2307  O  O   . LEU C  3 15  ? -6.067  -6.348  1.337   1.00 15.60 ? 385  LEU C O   1 
ATOM   2308  C  CB  . LEU C  3 15  ? -5.984  -5.146  4.040   1.00 15.30 ? 385  LEU C CB  1 
ATOM   2309  C  CG  . LEU C  3 15  ? -6.827  -6.071  4.909   1.00 15.67 ? 385  LEU C CG  1 
ATOM   2310  C  CD1 . LEU C  3 15  ? -5.976  -6.736  5.971   1.00 16.30 ? 385  LEU C CD1 1 
ATOM   2311  C  CD2 . LEU C  3 15  ? -7.974  -5.300  5.539   1.00 15.42 ? 385  LEU C CD2 1 
ATOM   2312  N  N   . VAL C  3 16  ? -4.980  -8.029  2.377   1.00 16.72 ? 386  VAL C N   1 
ATOM   2313  C  CA  . VAL C  3 16  ? -5.441  -9.039  1.435   1.00 17.19 ? 386  VAL C CA  1 
ATOM   2314  C  C   . VAL C  3 16  ? -6.276  -10.167 2.056   1.00 17.72 ? 386  VAL C C   1 
ATOM   2315  O  O   . VAL C  3 16  ? -6.845  -10.969 1.331   1.00 18.21 ? 386  VAL C O   1 
ATOM   2316  C  CB  . VAL C  3 16  ? -4.274  -9.625  0.596   1.00 17.95 ? 386  VAL C CB  1 
ATOM   2317  C  CG1 . VAL C  3 16  ? -3.520  -8.504  -0.106  1.00 17.66 ? 386  VAL C CG1 1 
ATOM   2318  C  CG2 . VAL C  3 16  ? -3.310  -10.446 1.441   1.00 18.77 ? 386  VAL C CG2 1 
ATOM   2319  N  N   . GLY C  3 17  ? -6.380  -10.243 3.371   1.00 17.89 ? 387  GLY C N   1 
ATOM   2320  C  CA  . GLY C  3 17  ? -7.147  -11.334 3.962   1.00 18.68 ? 387  GLY C CA  1 
ATOM   2321  C  C   . GLY C  3 17  ? -7.292  -11.301 5.465   1.00 18.97 ? 387  GLY C C   1 
ATOM   2322  O  O   . GLY C  3 17  ? -6.809  -10.387 6.119   1.00 18.57 ? 387  GLY C O   1 
ATOM   2323  N  N   . TYR C  3 18  ? -7.963  -12.319 5.999   1.00 19.89 ? 388  TYR C N   1 
ATOM   2324  C  CA  . TYR C  3 18  ? -8.154  -12.463 7.428   1.00 20.46 ? 388  TYR C CA  1 
ATOM   2325  C  C   . TYR C  3 18  ? -8.367  -13.917 7.845   1.00 21.84 ? 388  TYR C C   1 
ATOM   2326  O  O   . TYR C  3 18  ? -8.595  -14.796 7.031   1.00 22.26 ? 388  TYR C O   1 
ATOM   2327  C  CB  . TYR C  3 18  ? -9.321  -11.585 7.902   1.00 20.02 ? 388  TYR C CB  1 
ATOM   2328  C  CG  . TYR C  3 18  ? -10.699 -11.932 7.351   1.00 20.18 ? 388  TYR C CG  1 
ATOM   2329  C  CD1 . TYR C  3 18  ? -11.482 -12.927 7.937   1.00 21.19 ? 388  TYR C CD1 1 
ATOM   2330  C  CD2 . TYR C  3 18  ? -11.237 -11.221 6.280   1.00 19.49 ? 388  TYR C CD2 1 
ATOM   2331  C  CE1 . TYR C  3 18  ? -12.746 -13.221 7.451   1.00 21.61 ? 388  TYR C CE1 1 
ATOM   2332  C  CE2 . TYR C  3 18  ? -12.501 -11.495 5.794   1.00 19.81 ? 388  TYR C CE2 1 
ATOM   2333  C  CZ  . TYR C  3 18  ? -13.253 -12.493 6.373   1.00 20.93 ? 388  TYR C CZ  1 
ATOM   2334  O  OH  . TYR C  3 18  ? -14.497 -12.770 5.854   1.00 21.51 ? 388  TYR C OH  1 
ATOM   2335  N  N   . GLY C  3 19  ? -8.280  -14.159 9.138   1.00 22.82 ? 389  GLY C N   1 
ATOM   2336  C  CA  . GLY C  3 19  ? -8.374  -15.499 9.655   1.00 24.52 ? 389  GLY C CA  1 
ATOM   2337  C  C   . GLY C  3 19  ? -8.179  -15.502 11.151  1.00 25.74 ? 389  GLY C C   1 
ATOM   2338  O  O   . GLY C  3 19  ? -8.011  -14.442 11.767  1.00 25.08 ? 389  GLY C O   1 
ATOM   2339  N  N   . THR C  3 20  ? -8.212  -16.707 11.721  1.00 27.93 ? 390  THR C N   1 
ATOM   2340  C  CA  . THR C  3 20  ? -8.151  -16.922 13.165  1.00 29.58 ? 390  THR C CA  1 
ATOM   2341  C  C   . THR C  3 20  ? -7.193  -18.067 13.457  1.00 31.51 ? 390  THR C C   1 
ATOM   2342  O  O   . THR C  3 20  ? -7.300  -19.126 12.858  1.00 32.54 ? 390  THR C O   1 
ATOM   2343  C  CB  . THR C  3 20  ? -9.540  -17.260 13.725  1.00 30.36 ? 390  THR C CB  1 
ATOM   2344  O  OG1 . THR C  3 20  ? -10.456 -16.252 13.305  1.00 29.25 ? 390  THR C OG1 1 
ATOM   2345  C  CG2 . THR C  3 20  ? -9.537  -17.309 15.251  1.00 31.63 ? 390  THR C CG2 1 
ATOM   2346  N  N   . ASP C  3 21  ? -6.243  -17.846 14.357  1.00 32.76 ? 391  ASP C N   1 
ATOM   2347  C  CA  . ASP C  3 21  ? -5.289  -18.887 14.700  1.00 35.26 ? 391  ASP C CA  1 
ATOM   2348  C  C   . ASP C  3 21  ? -6.029  -19.996 15.438  1.00 37.30 ? 391  ASP C C   1 
ATOM   2349  O  O   . ASP C  3 21  ? -6.642  -19.765 16.476  1.00 37.84 ? 391  ASP C O   1 
ATOM   2350  C  CB  . ASP C  3 21  ? -4.155  -18.343 15.565  1.00 35.80 ? 391  ASP C CB  1 
ATOM   2351  C  CG  . ASP C  3 21  ? -3.068  -19.376 15.816  1.00 38.04 ? 391  ASP C CG  1 
ATOM   2352  O  OD1 . ASP C  3 21  ? -2.455  -19.849 14.838  1.00 38.30 ? 391  ASP C OD1 1 
ATOM   2353  O  OD2 . ASP C  3 21  ? -2.828  -19.721 16.993  1.00 40.08 ? 391  ASP C OD2 1 
ATOM   2354  N  N   . SER C  3 22  ? -5.973  -21.202 14.894  1.00 38.92 ? 392  SER C N   1 
ATOM   2355  C  CA  . SER C  3 22  ? -6.734  -22.306 15.457  1.00 40.99 ? 392  SER C CA  1 
ATOM   2356  C  C   . SER C  3 22  ? -6.266  -22.674 16.870  1.00 42.86 ? 392  SER C C   1 
ATOM   2357  O  O   . SER C  3 22  ? -7.066  -23.136 17.680  1.00 44.16 ? 392  SER C O   1 
ATOM   2358  C  CB  . SER C  3 22  ? -6.664  -23.519 14.539  1.00 41.98 ? 392  SER C CB  1 
ATOM   2359  O  OG  . SER C  3 22  ? -7.904  -24.178 14.566  1.00 43.10 ? 392  SER C OG  1 
ATOM   2360  N  N   . ALA C  3 23  ? -4.982  -22.448 17.156  1.00 43.40 ? 393  ALA C N   1 
ATOM   2361  C  CA  . ALA C  3 23  ? -4.411  -22.689 18.493  1.00 45.50 ? 393  ALA C CA  1 
ATOM   2362  C  C   . ALA C  3 23  ? -4.948  -21.715 19.550  1.00 44.96 ? 393  ALA C C   1 
ATOM   2363  O  O   . ALA C  3 23  ? -5.644  -22.124 20.469  1.00 46.36 ? 393  ALA C O   1 
ATOM   2364  C  CB  . ALA C  3 23  ? -2.882  -22.624 18.444  1.00 45.96 ? 393  ALA C CB  1 
ATOM   2365  N  N   . SER C  3 24  ? -4.636  -20.430 19.401  1.00 43.35 ? 394  SER C N   1 
ATOM   2366  C  CA  . SER C  3 24  ? -4.999  -19.416 20.400  1.00 42.88 ? 394  SER C CA  1 
ATOM   2367  C  C   . SER C  3 24  ? -6.406  -18.815 20.230  1.00 41.34 ? 394  SER C C   1 
ATOM   2368  O  O   . SER C  3 24  ? -6.888  -18.101 21.112  1.00 41.62 ? 394  SER C O   1 
ATOM   2369  C  CB  . SER C  3 24  ? -3.979  -18.276 20.356  1.00 41.97 ? 394  SER C CB  1 
ATOM   2370  O  OG  . SER C  3 24  ? -4.026  -17.610 19.106  1.00 39.95 ? 394  SER C OG  1 
ATOM   2371  N  N   . GLY C  3 25  ? -7.051  -19.080 19.098  1.00 40.02 ? 395  GLY C N   1 
ATOM   2372  C  CA  . GLY C  3 25  ? -8.269  -18.360 18.724  1.00 38.28 ? 395  GLY C CA  1 
ATOM   2373  C  C   . GLY C  3 25  ? -8.065  -16.898 18.318  1.00 35.87 ? 395  GLY C C   1 
ATOM   2374  O  O   . GLY C  3 25  ? -9.042  -16.174 18.139  1.00 34.75 ? 395  GLY C O   1 
ATOM   2375  N  N   . MET C  3 26  ? -6.816  -16.462 18.146  1.00 35.31 ? 396  MET C N   1 
ATOM   2376  C  CA  . MET C  3 26  ? -6.511  -15.046 17.867  1.00 33.47 ? 396  MET C CA  1 
ATOM   2377  C  C   . MET C  3 26  ? -6.886  -14.669 16.438  1.00 30.87 ? 396  MET C C   1 
ATOM   2378  O  O   . MET C  3 26  ? -6.393  -15.270 15.483  1.00 29.98 ? 396  MET C O   1 
ATOM   2379  C  CB  . MET C  3 26  ? -5.016  -14.770 18.105  1.00 34.40 ? 396  MET C CB  1 
ATOM   2380  C  CG  . MET C  3 26  ? -4.561  -13.321 17.950  1.00 33.72 ? 396  MET C CG  1 
ATOM   2381  S  SD  . MET C  3 26  ? -5.125  -12.236 19.285  1.00 35.01 ? 396  MET C SD  1 
ATOM   2382  C  CE  . MET C  3 26  ? -6.674  -11.603 18.639  1.00 33.12 ? 396  MET C CE  1 
ATOM   2383  N  N   . ASP C  3 27  ? -7.770  -13.681 16.304  1.00 28.99 ? 397  ASP C N   1 
ATOM   2384  C  CA  . ASP C  3 27  ? -8.111  -13.113 15.002  1.00 26.92 ? 397  ASP C CA  1 
ATOM   2385  C  C   . ASP C  3 27  ? -6.958  -12.278 14.429  1.00 25.37 ? 397  ASP C C   1 
ATOM   2386  O  O   . ASP C  3 27  ? -6.327  -11.504 15.139  1.00 25.12 ? 397  ASP C O   1 
ATOM   2387  C  CB  . ASP C  3 27  ? -9.343  -12.213 15.116  1.00 26.65 ? 397  ASP C CB  1 
ATOM   2388  C  CG  . ASP C  3 27  ? -10.640 -12.984 15.377  1.00 27.80 ? 397  ASP C CG  1 
ATOM   2389  O  OD1 . ASP C  3 27  ? -10.726 -14.197 15.069  1.00 28.56 ? 397  ASP C OD1 1 
ATOM   2390  O  OD2 . ASP C  3 27  ? -11.592 -12.349 15.881  1.00 28.30 ? 397  ASP C OD2 1 
ATOM   2391  N  N   . TYR C  3 28  ? -6.712  -12.432 13.132  1.00 24.02 ? 398  TYR C N   1 
ATOM   2392  C  CA  . TYR C  3 28  ? -5.685  -11.665 12.446  1.00 22.81 ? 398  TYR C CA  1 
ATOM   2393  C  C   . TYR C  3 28  ? -6.113  -11.179 11.055  1.00 21.39 ? 398  TYR C C   1 
ATOM   2394  O  O   . TYR C  3 28  ? -7.075  -11.668 10.458  1.00 21.09 ? 398  TYR C O   1 
ATOM   2395  C  CB  . TYR C  3 28  ? -4.382  -12.479 12.333  1.00 23.59 ? 398  TYR C CB  1 
ATOM   2396  C  CG  . TYR C  3 28  ? -4.514  -13.767 11.549  1.00 24.13 ? 398  TYR C CG  1 
ATOM   2397  C  CD1 . TYR C  3 28  ? -4.492  -13.767 10.147  1.00 23.44 ? 398  TYR C CD1 1 
ATOM   2398  C  CD2 . TYR C  3 28  ? -4.666  -14.986 12.202  1.00 25.40 ? 398  TYR C CD2 1 
ATOM   2399  C  CE1 . TYR C  3 28  ? -4.622  -14.946 9.429   1.00 24.09 ? 398  TYR C CE1 1 
ATOM   2400  C  CE2 . TYR C  3 28  ? -4.800  -16.172 11.491  1.00 26.08 ? 398  TYR C CE2 1 
ATOM   2401  C  CZ  . TYR C  3 28  ? -4.775  -16.148 10.110  1.00 25.42 ? 398  TYR C CZ  1 
ATOM   2402  O  OH  . TYR C  3 28  ? -4.915  -17.321 9.415   1.00 26.20 ? 398  TYR C OH  1 
ATOM   2403  N  N   . TRP C  3 29  ? -5.383  -10.176 10.582  1.00 20.41 ? 399  TRP C N   1 
ATOM   2404  C  CA  . TRP C  3 29  ? -5.419  -9.732  9.205   1.00 19.40 ? 399  TRP C CA  1 
ATOM   2405  C  C   . TRP C  3 29  ? -4.204  -10.318 8.526   1.00 19.85 ? 399  TRP C C   1 
ATOM   2406  O  O   . TRP C  3 29  ? -3.172  -10.536 9.180   1.00 20.67 ? 399  TRP C O   1 
ATOM   2407  C  CB  . TRP C  3 29  ? -5.272  -8.208  9.127   1.00 18.48 ? 399  TRP C CB  1 
ATOM   2408  C  CG  . TRP C  3 29  ? -6.375  -7.377  9.756   1.00 17.96 ? 399  TRP C CG  1 
ATOM   2409  C  CD1 . TRP C  3 29  ? -6.261  -6.576  10.849  1.00 17.97 ? 399  TRP C CD1 1 
ATOM   2410  C  CD2 . TRP C  3 29  ? -7.720  -7.247  9.303   1.00 17.45 ? 399  TRP C CD2 1 
ATOM   2411  N  NE1 . TRP C  3 29  ? -7.445  -5.956  11.110  1.00 17.70 ? 399  TRP C NE1 1 
ATOM   2412  C  CE2 . TRP C  3 29  ? -8.366  -6.350  10.175  1.00 17.46 ? 399  TRP C CE2 1 
ATOM   2413  C  CE3 . TRP C  3 29  ? -8.450  -7.808  8.251   1.00 17.27 ? 399  TRP C CE3 1 
ATOM   2414  C  CZ2 . TRP C  3 29  ? -9.719  -6.004  10.033  1.00 17.20 ? 399  TRP C CZ2 1 
ATOM   2415  C  CZ3 . TRP C  3 29  ? -9.800  -7.460  8.107   1.00 17.00 ? 399  TRP C CZ3 1 
ATOM   2416  C  CH2 . TRP C  3 29  ? -10.407 -6.558  8.988   1.00 17.01 ? 399  TRP C CH2 1 
ATOM   2417  N  N   . ILE C  3 30  ? -4.310  -10.530 7.214   1.00 19.47 ? 400  ILE C N   1 
ATOM   2418  C  CA  . ILE C  3 30  ? -3.169  -10.877 6.374   1.00 19.75 ? 400  ILE C CA  1 
ATOM   2419  C  C   . ILE C  3 30  ? -2.847  -9.657  5.524   1.00 18.96 ? 400  ILE C C   1 
ATOM   2420  O  O   . ILE C  3 30  ? -3.692  -9.161  4.799   1.00 18.24 ? 400  ILE C O   1 
ATOM   2421  C  CB  . ILE C  3 30  ? -3.452  -12.081 5.463   1.00 20.23 ? 400  ILE C CB  1 
ATOM   2422  C  CG1 . ILE C  3 30  ? -4.100  -13.212 6.259   1.00 21.01 ? 400  ILE C CG1 1 
ATOM   2423  C  CG2 . ILE C  3 30  ? -2.150  -12.578 4.838   1.00 21.06 ? 400  ILE C CG2 1 
ATOM   2424  C  CD1 . ILE C  3 30  ? -4.649  -14.333 5.412   1.00 21.54 ? 400  ILE C CD1 1 
ATOM   2425  N  N   . VAL C  3 31  ? -1.610  -9.184  5.613   1.00 19.35 ? 401  VAL C N   1 
ATOM   2426  C  CA  . VAL C  3 31  ? -1.230  -7.903  5.044   1.00 18.79 ? 401  VAL C CA  1 
ATOM   2427  C  C   . VAL C  3 31  ? 0.032   -8.045  4.218   1.00 19.64 ? 401  VAL C C   1 
ATOM   2428  O  O   . VAL C  3 31  ? 0.982   -8.675  4.654   1.00 20.95 ? 401  VAL C O   1 
ATOM   2429  C  CB  . VAL C  3 31  ? -0.969  -6.868  6.154   1.00 18.55 ? 401  VAL C CB  1 
ATOM   2430  C  CG1 . VAL C  3 31  ? -0.834  -5.472  5.562   1.00 17.85 ? 401  VAL C CG1 1 
ATOM   2431  C  CG2 . VAL C  3 31  ? -2.088  -6.898  7.181   1.00 18.26 ? 401  VAL C CG2 1 
ATOM   2432  N  N   . LYS C  3 32  ? 0.027   -7.441  3.031   1.00 19.41 ? 402  LYS C N   1 
ATOM   2433  C  CA  . LYS C  3 32  ? 1.172   -7.427  2.126   1.00 20.25 ? 402  LYS C CA  1 
ATOM   2434  C  C   . LYS C  3 32  ? 1.997   -6.176  2.352   1.00 20.29 ? 402  LYS C C   1 
ATOM   2435  O  O   . LYS C  3 32  ? 1.513   -5.061  2.168   1.00 19.67 ? 402  LYS C O   1 
ATOM   2436  C  CB  . LYS C  3 32  ? 0.669   -7.418  0.682   1.00 20.14 ? 402  LYS C CB  1 
ATOM   2437  C  CG  . LYS C  3 32  ? 1.732   -7.434  -0.413  1.00 21.04 ? 402  LYS C CG  1 
ATOM   2438  C  CD  . LYS C  3 32  ? 1.029   -7.348  -1.760  1.00 20.90 ? 402  LYS C CD  1 
ATOM   2439  C  CE  . LYS C  3 32  ? 1.959   -7.033  -2.913  1.00 21.79 ? 402  LYS C CE  1 
ATOM   2440  N  NZ  . LYS C  3 32  ? 1.171   -6.686  -4.129  1.00 21.42 ? 402  LYS C NZ  1 
ATOM   2441  N  N   . ASN C  3 33  ? 3.257   -6.364  2.716   1.00 21.33 ? 403  ASN C N   1 
ATOM   2442  C  CA  . ASN C  3 33  ? 4.176   -5.254  2.876   1.00 21.63 ? 403  ASN C CA  1 
ATOM   2443  C  C   . ASN C  3 33  ? 4.960   -5.014  1.574   1.00 22.16 ? 403  ASN C C   1 
ATOM   2444  O  O   . ASN C  3 33  ? 4.819   -5.769  0.599   1.00 22.29 ? 403  ASN C O   1 
ATOM   2445  C  CB  . ASN C  3 33  ? 5.102   -5.545  4.050   1.00 22.73 ? 403  ASN C CB  1 
ATOM   2446  C  CG  . ASN C  3 33  ? 5.640   -4.291  4.706   1.00 22.85 ? 403  ASN C CG  1 
ATOM   2447  O  OD1 . ASN C  3 33  ? 5.477   -3.172  4.202   1.00 22.37 ? 403  ASN C OD1 1 
ATOM   2448  N  ND2 . ASN C  3 33  ? 6.288   -4.472  5.840   1.00 23.61 ? 403  ASN C ND2 1 
ATOM   2449  N  N   . SER C  3 34  ? 5.758   -3.950  1.553   1.00 22.46 ? 404  SER C N   1 
ATOM   2450  C  CA  . SER C  3 34  ? 6.538   -3.584  0.378   1.00 23.15 ? 404  SER C CA  1 
ATOM   2451  C  C   . SER C  3 34  ? 8.025   -3.523  0.710   1.00 24.64 ? 404  SER C C   1 
ATOM   2452  O  O   . SER C  3 34  ? 8.728   -2.617  0.268   1.00 25.35 ? 404  SER C O   1 
ATOM   2453  C  CB  . SER C  3 34  ? 6.055   -2.248  -0.167  1.00 22.43 ? 404  SER C CB  1 
ATOM   2454  O  OG  . SER C  3 34  ? 6.082   -1.250  0.834   1.00 22.28 ? 404  SER C OG  1 
ATOM   2455  N  N   . TRP C  3 35  ? 8.498   -4.497  1.489   1.00 25.34 ? 405  TRP C N   1 
ATOM   2456  C  CA  . TRP C  3 35  ? 9.899   -4.562  1.898   1.00 26.95 ? 405  TRP C CA  1 
ATOM   2457  C  C   . TRP C  3 35  ? 10.604  -5.814  1.329   1.00 28.52 ? 405  TRP C C   1 
ATOM   2458  O  O   . TRP C  3 35  ? 11.501  -6.380  1.963   1.00 29.90 ? 405  TRP C O   1 
ATOM   2459  C  CB  . TRP C  3 35  ? 10.006  -4.544  3.430   1.00 26.99 ? 405  TRP C CB  1 
ATOM   2460  C  CG  . TRP C  3 35  ? 9.570   -3.266  4.092   1.00 26.02 ? 405  TRP C CG  1 
ATOM   2461  C  CD1 . TRP C  3 35  ? 9.384   -2.051  3.502   1.00 25.43 ? 405  TRP C CD1 1 
ATOM   2462  C  CD2 . TRP C  3 35  ? 9.325   -3.071  5.489   1.00 25.78 ? 405  TRP C CD2 1 
ATOM   2463  N  NE1 . TRP C  3 35  ? 9.021   -1.123  4.438   1.00 24.86 ? 405  TRP C NE1 1 
ATOM   2464  C  CE2 . TRP C  3 35  ? 8.977   -1.721  5.667   1.00 25.06 ? 405  TRP C CE2 1 
ATOM   2465  C  CE3 . TRP C  3 35  ? 9.361   -3.911  6.606   1.00 26.32 ? 405  TRP C CE3 1 
ATOM   2466  C  CZ2 . TRP C  3 35  ? 8.655   -1.188  6.913   1.00 24.85 ? 405  TRP C CZ2 1 
ATOM   2467  C  CZ3 . TRP C  3 35  ? 9.043   -3.389  7.840   1.00 26.06 ? 405  TRP C CZ3 1 
ATOM   2468  C  CH2 . TRP C  3 35  ? 8.686   -2.037  7.985   1.00 25.36 ? 405  TRP C CH2 1 
ATOM   2469  N  N   . GLY C  3 36  ? 10.197  -6.246  0.138   1.00 28.46 ? 406  GLY C N   1 
ATOM   2470  C  CA  . GLY C  3 36  ? 10.791  -7.424  -0.499  1.00 30.05 ? 406  GLY C CA  1 
ATOM   2471  C  C   . GLY C  3 36  ? 10.283  -8.741  0.063   1.00 30.27 ? 406  GLY C C   1 
ATOM   2472  O  O   . GLY C  3 36  ? 9.737   -8.785  1.162   1.00 29.94 ? 406  GLY C O   1 
ATOM   2473  N  N   . THR C  3 37  ? 10.466  -9.819  -0.688  1.00 31.37 ? 407  THR C N   1 
ATOM   2474  C  CA  . THR C  3 37  ? 9.933   -11.122 -0.295  1.00 31.65 ? 407  THR C CA  1 
ATOM   2475  C  C   . THR C  3 37  ? 10.781  -11.815 0.760   1.00 33.21 ? 407  THR C C   1 
ATOM   2476  O  O   . THR C  3 37  ? 10.380  -12.848 1.286   1.00 33.59 ? 407  THR C O   1 
ATOM   2477  C  CB  . THR C  3 37  ? 9.759   -12.061 -1.502  1.00 32.37 ? 407  THR C CB  1 
ATOM   2478  O  OG1 . THR C  3 37  ? 10.976  -12.133 -2.247  1.00 34.10 ? 407  THR C OG1 1 
ATOM   2479  C  CG2 . THR C  3 37  ? 8.651   -11.556 -2.405  1.00 30.95 ? 407  THR C CG2 1 
ATOM   2480  N  N   . GLY C  3 38  ? 11.947  -11.248 1.067   1.00 34.30 ? 408  GLY C N   1 
ATOM   2481  C  CA  . GLY C  3 38  ? 12.769  -11.718 2.172   1.00 35.75 ? 408  GLY C CA  1 
ATOM   2482  C  C   . GLY C  3 38  ? 12.214  -11.382 3.546   1.00 34.77 ? 408  GLY C C   1 
ATOM   2483  O  O   . GLY C  3 38  ? 12.442  -12.116 4.507   1.00 35.74 ? 408  GLY C O   1 
ATOM   2484  N  N   . TRP C  3 39  ? 11.482  -10.277 3.654   1.00 33.06 ? 409  TRP C N   1 
ATOM   2485  C  CA  . TRP C  3 39  ? 10.963  -9.845  4.956   1.00 32.28 ? 409  TRP C CA  1 
ATOM   2486  C  C   . TRP C  3 39  ? 9.689   -10.609 5.360   1.00 31.43 ? 409  TRP C C   1 
ATOM   2487  O  O   . TRP C  3 39  ? 8.889   -10.995 4.513   1.00 30.69 ? 409  TRP C O   1 
ATOM   2488  C  CB  . TRP C  3 39  ? 10.725  -8.329  4.966   1.00 31.00 ? 409  TRP C CB  1 
ATOM   2489  C  CG  . TRP C  3 39  ? 10.227  -7.814  6.292   1.00 30.31 ? 409  TRP C CG  1 
ATOM   2490  C  CD1 . TRP C  3 39  ? 10.978  -7.408  7.353   1.00 31.18 ? 409  TRP C CD1 1 
ATOM   2491  C  CD2 . TRP C  3 39  ? 8.863   -7.683  6.690   1.00 28.70 ? 409  TRP C CD2 1 
ATOM   2492  N  NE1 . TRP C  3 39  ? 10.163  -7.015  8.388   1.00 30.28 ? 409  TRP C NE1 1 
ATOM   2493  C  CE2 . TRP C  3 39  ? 8.858   -7.176  8.007   1.00 28.75 ? 409  TRP C CE2 1 
ATOM   2494  C  CE3 . TRP C  3 39  ? 7.642   -7.945  6.060   1.00 27.41 ? 409  TRP C CE3 1 
ATOM   2495  C  CZ2 . TRP C  3 39  ? 7.671   -6.928  8.712   1.00 27.65 ? 409  TRP C CZ2 1 
ATOM   2496  C  CZ3 . TRP C  3 39  ? 6.459   -7.701  6.760   1.00 26.24 ? 409  TRP C CZ3 1 
ATOM   2497  C  CH2 . TRP C  3 39  ? 6.484   -7.200  8.071   1.00 26.46 ? 409  TRP C CH2 1 
ATOM   2498  N  N   . GLY C  3 40  ? 9.541   -10.846 6.662   1.00 31.89 ? 410  GLY C N   1 
ATOM   2499  C  CA  . GLY C  3 40  ? 8.356   -11.472 7.238   1.00 31.35 ? 410  GLY C CA  1 
ATOM   2500  C  C   . GLY C  3 40  ? 8.009   -12.805 6.614   1.00 32.09 ? 410  GLY C C   1 
ATOM   2501  O  O   . GLY C  3 40  ? 8.879   -13.587 6.313   1.00 33.89 ? 410  GLY C O   1 
ATOM   2502  N  N   . GLU C  3 41  ? 6.724   -13.050 6.404   1.00 31.16 ? 411  GLU C N   1 
ATOM   2503  C  CA  . GLU C  3 41  ? 6.241   -14.304 5.838   1.00 31.74 ? 411  GLU C CA  1 
ATOM   2504  C  C   . GLU C  3 41  ? 6.109   -14.126 4.324   1.00 31.34 ? 411  GLU C C   1 
ATOM   2505  O  O   . GLU C  3 41  ? 5.032   -13.816 3.821   1.00 30.46 ? 411  GLU C O   1 
ATOM   2506  C  CB  . GLU C  3 41  ? 4.902   -14.669 6.504   1.00 30.98 ? 411  GLU C CB  1 
ATOM   2507  C  CG  . GLU C  3 41  ? 5.005   -14.754 8.033   1.00 31.53 ? 411  GLU C CG  1 
ATOM   2508  C  CD  . GLU C  3 41  ? 3.696   -15.074 8.747   1.00 30.96 ? 411  GLU C CD  1 
ATOM   2509  O  OE1 . GLU C  3 41  ? 2.610   -14.678 8.279   1.00 29.73 ? 411  GLU C OE1 1 
ATOM   2510  O  OE2 . GLU C  3 41  ? 3.753   -15.700 9.819   1.00 32.10 ? 411  GLU C OE2 1 
ATOM   2511  N  N   . ASN C  3 42  ? 7.229   -14.292 3.619   1.00 32.63 ? 412  ASN C N   1 
ATOM   2512  C  CA  . ASN C  3 42  ? 7.337   -14.086 2.158   1.00 32.57 ? 412  ASN C CA  1 
ATOM   2513  C  C   . ASN C  3 42  ? 6.877   -12.709 1.665   1.00 30.83 ? 412  ASN C C   1 
ATOM   2514  O  O   . ASN C  3 42  ? 6.357   -12.561 0.548   1.00 30.21 ? 412  ASN C O   1 
ATOM   2515  C  CB  . ASN C  3 42  ? 6.629   -15.201 1.390   1.00 33.09 ? 412  ASN C CB  1 
ATOM   2516  C  CG  . ASN C  3 42  ? 7.319   -16.539 1.557   1.00 35.42 ? 412  ASN C CG  1 
ATOM   2517  O  OD1 . ASN C  3 42  ? 7.200   -17.186 2.599   1.00 36.57 ? 412  ASN C OD1 1 
ATOM   2518  N  ND2 . ASN C  3 42  ? 8.049   -16.961 0.535   1.00 36.82 ? 412  ASN C ND2 1 
ATOM   2519  N  N   . GLY C  3 43  ? 7.087   -11.702 2.509   1.00 30.10 ? 413  GLY C N   1 
ATOM   2520  C  CA  . GLY C  3 43  ? 6.745   -10.330 2.175   1.00 28.60 ? 413  GLY C CA  1 
ATOM   2521  C  C   . GLY C  3 43  ? 5.485   -9.894  2.872   1.00 26.89 ? 413  GLY C C   1 
ATOM   2522  O  O   . GLY C  3 43  ? 5.222   -8.694  2.966   1.00 26.10 ? 413  GLY C O   1 
ATOM   2523  N  N   . TYR C  3 44  ? 4.711   -10.873 3.352   1.00 26.53 ? 414  TYR C N   1 
ATOM   2524  C  CA  . TYR C  3 44  ? 3.475   -10.631 4.100   1.00 25.11 ? 414  TYR C CA  1 
ATOM   2525  C  C   . TYR C  3 44  ? 3.698   -10.671 5.605   1.00 25.40 ? 414  TYR C C   1 
ATOM   2526  O  O   . TYR C  3 44  ? 4.733   -11.156 6.106   1.00 26.85 ? 414  TYR C O   1 
ATOM   2527  C  CB  . TYR C  3 44  ? 2.420   -11.678 3.729   1.00 24.95 ? 414  TYR C CB  1 
ATOM   2528  C  CG  . TYR C  3 44  ? 1.983   -11.578 2.290   1.00 24.52 ? 414  TYR C CG  1 
ATOM   2529  C  CD1 . TYR C  3 44  ? 2.778   -12.081 1.253   1.00 25.50 ? 414  TYR C CD1 1 
ATOM   2530  C  CD2 . TYR C  3 44  ? 0.789   -10.965 1.957   1.00 23.27 ? 414  TYR C CD2 1 
ATOM   2531  C  CE1 . TYR C  3 44  ? 2.377   -11.982 -0.071  1.00 25.19 ? 414  TYR C CE1 1 
ATOM   2532  C  CE2 . TYR C  3 44  ? 0.384   -10.854 0.638   1.00 22.98 ? 414  TYR C CE2 1 
ATOM   2533  C  CZ  . TYR C  3 44  ? 1.181   -11.359 -0.369  1.00 24.11 ? 414  TYR C CZ  1 
ATOM   2534  O  OH  . TYR C  3 44  ? 0.746   -11.240 -1.665  1.00 24.38 ? 414  TYR C OH  1 
ATOM   2535  N  N   . PHE C  3 45  ? 2.723   -10.152 6.334   1.00 24.15 ? 415  PHE C N   1 
ATOM   2536  C  CA  . PHE C  3 45  ? 2.673   -10.380 7.763   1.00 24.51 ? 415  PHE C CA  1 
ATOM   2537  C  C   . PHE C  3 45  ? 1.236   -10.570 8.224   1.00 23.65 ? 415  PHE C C   1 
ATOM   2538  O  O   . PHE C  3 45  ? 0.300   -10.347 7.456   1.00 22.64 ? 415  PHE C O   1 
ATOM   2539  C  CB  . PHE C  3 45  ? 3.370   -9.252  8.529   1.00 24.54 ? 415  PHE C CB  1 
ATOM   2540  C  CG  . PHE C  3 45  ? 2.708   -7.912  8.414   1.00 22.99 ? 415  PHE C CG  1 
ATOM   2541  C  CD1 . PHE C  3 45  ? 2.945   -7.100  7.320   1.00 22.37 ? 415  PHE C CD1 1 
ATOM   2542  C  CD2 . PHE C  3 45  ? 1.897   -7.438  9.434   1.00 22.39 ? 415  PHE C CD2 1 
ATOM   2543  C  CE1 . PHE C  3 45  ? 2.352   -5.854  7.224   1.00 21.26 ? 415  PHE C CE1 1 
ATOM   2544  C  CE2 . PHE C  3 45  ? 1.308   -6.190  9.351   1.00 21.26 ? 415  PHE C CE2 1 
ATOM   2545  C  CZ  . PHE C  3 45  ? 1.528   -5.402  8.245   1.00 20.74 ? 415  PHE C CZ  1 
ATOM   2546  N  N   . ARG C  3 46  ? 1.088   -11.025 9.463   1.00 24.17 ? 416  ARG C N   1 
ATOM   2547  C  CA  . ARG C  3 46  ? -0.201  -11.123 10.102  1.00 23.73 ? 416  ARG C CA  1 
ATOM   2548  C  C   . ARG C  3 46  ? -0.177  -10.282 11.364  1.00 23.72 ? 416  ARG C C   1 
ATOM   2549  O  O   . ARG C  3 46  ? 0.833   -10.197 12.047  1.00 24.57 ? 416  ARG C O   1 
ATOM   2550  C  CB  . ARG C  3 46  ? -0.570  -12.575 10.402  1.00 24.81 ? 416  ARG C CB  1 
ATOM   2551  C  CG  . ARG C  3 46  ? -0.847  -13.380 9.143   1.00 24.91 ? 416  ARG C CG  1 
ATOM   2552  C  CD  . ARG C  3 46  ? -1.077  -14.855 9.446   1.00 26.33 ? 416  ARG C CD  1 
ATOM   2553  N  NE  . ARG C  3 46  ? 0.093   -15.446 10.078  1.00 27.90 ? 416  ARG C NE  1 
ATOM   2554  C  CZ  . ARG C  3 46  ? 0.074   -16.414 10.990  1.00 29.34 ? 416  ARG C CZ  1 
ATOM   2555  N  NH1 . ARG C  3 46  ? -1.071  -16.953 11.406  1.00 29.34 ? 416  ARG C NH1 1 
ATOM   2556  N  NH2 . ARG C  3 46  ? 1.227   -16.830 11.510  1.00 30.88 ? 416  ARG C NH2 1 
ATOM   2557  N  N   . ILE C  3 47  ? -1.308  -9.641  11.637  1.00 22.84 ? 417  ILE C N   1 
ATOM   2558  C  CA  . ILE C  3 47  ? -1.414  -8.673  12.703  1.00 22.74 ? 417  ILE C CA  1 
ATOM   2559  C  C   . ILE C  3 47  ? -2.778  -8.843  13.366  1.00 22.75 ? 417  ILE C C   1 
ATOM   2560  O  O   . ILE C  3 47  ? -3.731  -9.277  12.727  1.00 22.32 ? 417  ILE C O   1 
ATOM   2561  C  CB  . ILE C  3 47  ? -1.187  -7.260  12.130  1.00 21.81 ? 417  ILE C CB  1 
ATOM   2562  C  CG1 . ILE C  3 47  ? -1.206  -6.206  13.233  1.00 21.90 ? 417  ILE C CG1 1 
ATOM   2563  C  CG2 . ILE C  3 47  ? -2.195  -6.922  11.030  1.00 20.62 ? 417  ILE C CG2 1 
ATOM   2564  C  CD1 . ILE C  3 47  ? -0.743  -4.854  12.750  1.00 21.38 ? 417  ILE C CD1 1 
ATOM   2565  N  N   . ARG C  3 48  ? -2.868  -8.535  14.655  1.00 23.60 ? 418  ARG C N   1 
ATOM   2566  C  CA  . ARG C  3 48  ? -4.110  -8.721  15.390  1.00 23.85 ? 418  ARG C CA  1 
ATOM   2567  C  C   . ARG C  3 48  ? -5.256  -7.889  14.810  1.00 22.65 ? 418  ARG C C   1 
ATOM   2568  O  O   . ARG C  3 48  ? -5.096  -6.712  14.456  1.00 21.83 ? 418  ARG C O   1 
ATOM   2569  C  CB  . ARG C  3 48  ? -3.944  -8.396  16.863  1.00 25.12 ? 418  ARG C CB  1 
ATOM   2570  C  CG  . ARG C  3 48  ? -3.051  -9.388  17.573  1.00 27.07 ? 418  ARG C CG  1 
ATOM   2571  C  CD  . ARG C  3 48  ? -3.209  -9.285  19.078  1.00 28.79 ? 418  ARG C CD  1 
ATOM   2572  N  NE  . ARG C  3 48  ? -2.278  -10.156 19.791  1.00 30.35 ? 418  ARG C NE  1 
ATOM   2573  C  CZ  . ARG C  3 48  ? -2.116  -10.137 21.108  1.00 31.70 ? 418  ARG C CZ  1 
ATOM   2574  N  NH1 . ARG C  3 48  ? -2.828  -9.290  21.853  1.00 31.61 ? 418  ARG C NH1 1 
ATOM   2575  N  NH2 . ARG C  3 48  ? -1.245  -10.961 21.681  1.00 33.13 ? 418  ARG C NH2 1 
ATOM   2576  N  N   . ARG C  3 49  ? -6.403  -8.545  14.722  1.00 22.47 ? 419  ARG C N   1 
ATOM   2577  C  CA  . ARG C  3 49  ? -7.588  -7.980  14.146  1.00 21.69 ? 419  ARG C CA  1 
ATOM   2578  C  C   . ARG C  3 49  ? -8.619  -7.870  15.245  1.00 22.39 ? 419  ARG C C   1 
ATOM   2579  O  O   . ARG C  3 49  ? -8.783  -8.798  16.031  1.00 23.53 ? 419  ARG C O   1 
ATOM   2580  C  CB  . ARG C  3 49  ? -8.116  -8.897  13.038  1.00 21.20 ? 419  ARG C CB  1 
ATOM   2581  C  CG  . ARG C  3 49  ? -9.520  -8.564  12.587  1.00 20.60 ? 419  ARG C CG  1 
ATOM   2582  C  CD  . ARG C  3 49  ? -9.849  -9.217  11.260  1.00 20.12 ? 419  ARG C CD  1 
ATOM   2583  N  NE  . ARG C  3 49  ? -9.762  -10.677 11.280  1.00 20.95 ? 419  ARG C NE  1 
ATOM   2584  C  CZ  . ARG C  3 49  ? -10.735 -11.493 11.662  1.00 21.72 ? 419  ARG C CZ  1 
ATOM   2585  N  NH1 . ARG C  3 49  ? -11.881 -11.014 12.110  1.00 21.73 ? 419  ARG C NH1 1 
ATOM   2586  N  NH2 . ARG C  3 49  ? -10.545 -12.798 11.612  1.00 22.56 ? 419  ARG C NH2 1 
ATOM   2587  N  N   . GLY C  3 50  ? -9.321  -6.743  15.279  1.00 22.09 ? 420  GLY C N   1 
ATOM   2588  C  CA  . GLY C  3 50  ? -10.458 -6.574  16.178  1.00 22.82 ? 420  GLY C CA  1 
ATOM   2589  C  C   . GLY C  3 50  ? -10.251 -5.472  17.193  1.00 23.28 ? 420  GLY C C   1 
ATOM   2590  O  O   . GLY C  3 50  ? -11.223 -5.010  17.775  1.00 23.83 ? 420  GLY C O   1 
ATOM   2591  N  N   . THR C  3 51  ? -8.995  -5.052  17.398  1.00 23.23 ? 421  THR C N   1 
ATOM   2592  C  CA  . THR C  3 51  ? -8.638  -4.076  18.441  1.00 23.78 ? 421  THR C CA  1 
ATOM   2593  C  C   . THR C  3 51  ? -7.919  -2.834  17.904  1.00 22.90 ? 421  THR C C   1 
ATOM   2594  O  O   . THR C  3 51  ? -7.191  -2.176  18.622  1.00 23.36 ? 421  THR C O   1 
ATOM   2595  C  CB  . THR C  3 51  ? -7.719  -4.727  19.489  1.00 24.94 ? 421  THR C CB  1 
ATOM   2596  O  OG1 . THR C  3 51  ? -6.610  -5.340  18.818  1.00 24.83 ? 421  THR C OG1 1 
ATOM   2597  C  CG2 . THR C  3 51  ? -8.477  -5.793  20.296  1.00 26.11 ? 421  THR C CG2 1 
ATOM   2598  N  N   . ASP C  3 52  ? -8.120  -2.513  16.640  1.00 21.84 ? 422  ASP C N   1 
ATOM   2599  C  CA  . ASP C  3 52  ? -7.430  -1.387  16.025  1.00 21.28 ? 422  ASP C CA  1 
ATOM   2600  C  C   . ASP C  3 52  ? -5.905  -1.412  16.292  1.00 21.52 ? 422  ASP C C   1 
ATOM   2601  O  O   . ASP C  3 52  ? -5.314  -0.410  16.662  1.00 21.60 ? 422  ASP C O   1 
ATOM   2602  C  CB  . ASP C  3 52  ? -8.057  -0.074  16.505  1.00 21.51 ? 422  ASP C CB  1 
ATOM   2603  C  CG  . ASP C  3 52  ? -7.678  1.110   15.628  1.00 21.05 ? 422  ASP C CG  1 
ATOM   2604  O  OD1 . ASP C  3 52  ? -7.392  0.920   14.417  1.00 20.17 ? 422  ASP C OD1 1 
ATOM   2605  O  OD2 . ASP C  3 52  ? -7.664  2.240   16.156  1.00 21.81 ? 422  ASP C OD2 1 
ATOM   2606  N  N   . GLU C  3 53  ? -5.294  -2.576  16.090  1.00 21.71 ? 423  GLU C N   1 
ATOM   2607  C  CA  . GLU C  3 53  ? -3.870  -2.783  16.368  1.00 22.36 ? 423  GLU C CA  1 
ATOM   2608  C  C   . GLU C  3 53  ? -2.975  -1.808  15.587  1.00 21.61 ? 423  GLU C C   1 
ATOM   2609  O  O   . GLU C  3 53  ? -2.968  -1.810  14.350  1.00 20.53 ? 423  GLU C O   1 
ATOM   2610  C  CB  . GLU C  3 53  ? -3.484  -4.228  16.040  1.00 22.90 ? 423  GLU C CB  1 
ATOM   2611  C  CG  . GLU C  3 53  ? -2.046  -4.616  16.361  1.00 24.03 ? 423  GLU C CG  1 
ATOM   2612  C  CD  . GLU C  3 53  ? -1.750  -4.686  17.845  1.00 25.58 ? 423  GLU C CD  1 
ATOM   2613  O  OE1 . GLU C  3 53  ? -2.616  -5.157  18.621  1.00 26.23 ? 423  GLU C OE1 1 
ATOM   2614  O  OE2 . GLU C  3 53  ? -0.638  -4.275  18.241  1.00 26.74 ? 423  GLU C OE2 1 
ATOM   2615  N  N   . CYS C  3 54  ? -2.228  -0.988  16.335  1.00 22.10 ? 424  CYS C N   1 
ATOM   2616  C  CA  . CYS C  3 54  ? -1.369  0.038   15.772  1.00 21.88 ? 424  CYS C CA  1 
ATOM   2617  C  C   . CYS C  3 54  ? -2.106  0.941   14.774  1.00 20.71 ? 424  CYS C C   1 
ATOM   2618  O  O   . CYS C  3 54  ? -1.523  1.418   13.798  1.00 20.19 ? 424  CYS C O   1 
ATOM   2619  C  CB  . CYS C  3 54  ? -0.141  -0.605  15.125  1.00 22.23 ? 424  CYS C CB  1 
ATOM   2620  S  SG  . CYS C  3 54  ? 0.946   -1.373  16.344  1.00 24.17 ? 424  CYS C SG  1 
ATOM   2621  N  N   . ALA C  3 55  ? -3.387  1.173   15.043  1.00 20.27 ? 425  ALA C N   1 
ATOM   2622  C  CA  . ALA C  3 55  ? -4.219  1.994   14.189  1.00 19.47 ? 425  ALA C CA  1 
ATOM   2623  C  C   . ALA C  3 55  ? -4.508  1.391   12.806  1.00 18.49 ? 425  ALA C C   1 
ATOM   2624  O  O   . ALA C  3 55  ? -4.852  2.142   11.891  1.00 17.89 ? 425  ALA C O   1 
ATOM   2625  C  CB  . ALA C  3 55  ? -3.601  3.384   14.038  1.00 19.68 ? 425  ALA C CB  1 
ATOM   2626  N  N   . ILE C  3 56  ? -4.399  0.066   12.649  1.00 18.34 ? 426  ILE C N   1 
ATOM   2627  C  CA  . ILE C  3 56  ? -4.582  -0.551  11.326  1.00 17.67 ? 426  ILE C CA  1 
ATOM   2628  C  C   . ILE C  3 56  ? -6.044  -0.613  10.858  1.00 17.25 ? 426  ILE C C   1 
ATOM   2629  O  O   . ILE C  3 56  ? -6.313  -0.903  9.681   1.00 16.82 ? 426  ILE C O   1 
ATOM   2630  C  CB  . ILE C  3 56  ? -3.933  -1.952  11.212  1.00 17.93 ? 426  ILE C CB  1 
ATOM   2631  C  CG1 . ILE C  3 56  ? -3.723  -2.305  9.739   1.00 17.45 ? 426  ILE C CG1 1 
ATOM   2632  C  CG2 . ILE C  3 56  ? -4.765  -3.020  11.916  1.00 18.23 ? 426  ILE C CG2 1 
ATOM   2633  C  CD1 . ILE C  3 56  ? -2.770  -3.442  9.497   1.00 17.99 ? 426  ILE C CD1 1 
ATOM   2634  N  N   . GLU C  3 57  ? -6.972  -0.342  11.774  1.00 17.54 ? 427  GLU C N   1 
ATOM   2635  C  CA  . GLU C  3 57  ? -8.376  -0.275  11.453  1.00 17.35 ? 427  GLU C CA  1 
ATOM   2636  C  C   . GLU C  3 57  ? -8.892  1.174   11.475  1.00 17.40 ? 427  GLU C C   1 
ATOM   2637  O  O   . GLU C  3 57  ? -10.096 1.407   11.646  1.00 17.57 ? 427  GLU C O   1 
ATOM   2638  C  CB  . GLU C  3 57  ? -9.170  -1.175  12.410  1.00 18.00 ? 427  GLU C CB  1 
ATOM   2639  C  CG  . GLU C  3 57  ? -8.989  -2.662  12.111  1.00 18.15 ? 427  GLU C CG  1 
ATOM   2640  C  CD  . GLU C  3 57  ? -9.133  -3.560  13.329  1.00 19.22 ? 427  GLU C CD  1 
ATOM   2641  O  OE1 . GLU C  3 57  ? -9.696  -3.113  14.344  1.00 19.79 ? 427  GLU C OE1 1 
ATOM   2642  O  OE2 . GLU C  3 57  ? -8.675  -4.723  13.282  1.00 19.71 ? 427  GLU C OE2 1 
ATOM   2643  N  N   . SER C  3 58  ? -8.000  2.138   11.245  1.00 17.26 ? 428  SER C N   1 
ATOM   2644  C  CA  . SER C  3 58  ? -8.343  3.563   11.324  1.00 17.49 ? 428  SER C CA  1 
ATOM   2645  C  C   . SER C  3 58  ? -8.481  4.298   9.972   1.00 17.04 ? 428  SER C C   1 
ATOM   2646  O  O   . SER C  3 58  ? -9.098  5.363   9.921   1.00 17.26 ? 428  SER C O   1 
ATOM   2647  C  CB  . SER C  3 58  ? -7.294  4.295   12.166  1.00 18.14 ? 428  SER C CB  1 
ATOM   2648  O  OG  . SER C  3 58  ? -6.040  4.405   11.487  1.00 17.89 ? 428  SER C OG  1 
ATOM   2649  N  N   . ILE C  3 59  ? -7.906  3.766   8.889   1.00 16.49 ? 429  ILE C N   1 
ATOM   2650  C  CA  . ILE C  3 59  ? -7.837  4.545   7.640   1.00 16.28 ? 429  ILE C CA  1 
ATOM   2651  C  C   . ILE C  3 59  ? -7.777  3.661   6.387   1.00 15.72 ? 429  ILE C C   1 
ATOM   2652  O  O   . ILE C  3 59  ? -6.904  3.808   5.532   1.00 16.08 ? 429  ILE C O   1 
ATOM   2653  C  CB  . ILE C  3 59  ? -6.642  5.540   7.712   1.00 16.66 ? 429  ILE C CB  1 
ATOM   2654  C  CG1 . ILE C  3 59  ? -6.628  6.520   6.539   1.00 16.70 ? 429  ILE C CG1 1 
ATOM   2655  C  CG2 . ILE C  3 59  ? -5.322  4.816   7.794   1.00 16.78 ? 429  ILE C CG2 1 
ATOM   2656  C  CD1 . ILE C  3 59  ? -5.679  7.700   6.747   1.00 17.27 ? 429  ILE C CD1 1 
ATOM   2657  N  N   . ALA C  3 60  ? -8.713  2.731   6.284   1.00 15.26 ? 430  ALA C N   1 
ATOM   2658  C  CA  . ALA C  3 60  ? -8.796  1.889   5.100   1.00 14.75 ? 430  ALA C CA  1 
ATOM   2659  C  C   . ALA C  3 60  ? -9.377  2.685   3.919   1.00 14.50 ? 430  ALA C C   1 
ATOM   2660  O  O   . ALA C  3 60  ? -10.329 3.420   4.074   1.00 14.74 ? 430  ALA C O   1 
ATOM   2661  C  CB  . ALA C  3 60  ? -9.642  0.656   5.392   1.00 14.75 ? 430  ALA C CB  1 
ATOM   2662  N  N   . VAL C  3 61  ? -8.760  2.553   2.759   1.00 14.15 ? 431  VAL C N   1 
ATOM   2663  C  CA  . VAL C  3 61  ? -9.173  3.240   1.537   1.00 14.11 ? 431  VAL C CA  1 
ATOM   2664  C  C   . VAL C  3 61  ? -9.502  2.229   0.469   1.00 13.90 ? 431  VAL C C   1 
ATOM   2665  O  O   . VAL C  3 61  ? -8.718  1.335   0.222   1.00 13.82 ? 431  VAL C O   1 
ATOM   2666  C  CB  . VAL C  3 61  ? -8.034  4.094   0.968   1.00 14.29 ? 431  VAL C CB  1 
ATOM   2667  C  CG1 . VAL C  3 61  ? -8.342  4.524   -0.465  1.00 14.47 ? 431  VAL C CG1 1 
ATOM   2668  C  CG2 . VAL C  3 61  ? -7.806  5.309   1.847   1.00 14.65 ? 431  VAL C CG2 1 
ATOM   2669  N  N   . ALA C  3 62  ? -10.652 2.386   -0.167  1.00 14.00 ? 432  ALA C N   1 
ATOM   2670  C  CA  . ALA C  3 62  ? -11.048 1.552   -1.294  1.00 14.04 ? 432  ALA C CA  1 
ATOM   2671  C  C   . ALA C  3 62  ? -11.183 2.386   -2.582  1.00 14.28 ? 432  ALA C C   1 
ATOM   2672  O  O   . ALA C  3 62  ? -11.641 3.533   -2.563  1.00 14.51 ? 432  ALA C O   1 
ATOM   2673  C  CB  . ALA C  3 62  ? -12.362 0.856   -0.968  1.00 14.29 ? 432  ALA C CB  1 
ATOM   2674  N  N   . ALA C  3 63  ? -10.761 1.808   -3.700  1.00 14.31 ? 433  ALA C N   1 
ATOM   2675  C  CA  . ALA C  3 63  ? -10.918 2.456   -5.002  1.00 14.69 ? 433  ALA C CA  1 
ATOM   2676  C  C   . ALA C  3 63  ? -11.157 1.394   -6.059  1.00 14.93 ? 433  ALA C C   1 
ATOM   2677  O  O   . ALA C  3 63  ? -10.762 0.239   -5.904  1.00 14.73 ? 433  ALA C O   1 
ATOM   2678  C  CB  . ALA C  3 63  ? -9.707  3.316   -5.335  1.00 14.76 ? 433  ALA C CB  1 
ATOM   2679  N  N   . THR C  3 64  ? -11.834 1.794   -7.120  1.00 15.55 ? 434  THR C N   1 
ATOM   2680  C  CA  . THR C  3 64  ? -12.279 0.893   -8.173  1.00 16.09 ? 434  THR C CA  1 
ATOM   2681  C  C   . THR C  3 64  ? -11.592 1.216   -9.500  1.00 16.73 ? 434  THR C C   1 
ATOM   2682  O  O   . THR C  3 64  ? -11.861 2.245   -10.100 1.00 17.33 ? 434  THR C O   1 
ATOM   2683  C  CB  . THR C  3 64  ? -13.806 1.003   -8.326  1.00 16.56 ? 434  THR C CB  1 
ATOM   2684  O  OG1 . THR C  3 64  ? -14.398 0.655   -7.079  1.00 16.19 ? 434  THR C OG1 1 
ATOM   2685  C  CG2 . THR C  3 64  ? -14.337 0.064   -9.420  1.00 17.19 ? 434  THR C CG2 1 
ATOM   2686  N  N   . PRO C  3 65  ? -10.694 0.340   -9.960  1.00 16.92 ? 435  PRO C N   1 
ATOM   2687  C  CA  . PRO C  3 65  ? -10.004 0.629   -11.218 1.00 17.74 ? 435  PRO C CA  1 
ATOM   2688  C  C   . PRO C  3 65  ? -10.878 0.253   -12.392 1.00 18.71 ? 435  PRO C C   1 
ATOM   2689  O  O   . PRO C  3 65  ? -11.688 -0.650  -12.281 1.00 18.87 ? 435  PRO C O   1 
ATOM   2690  C  CB  . PRO C  3 65  ? -8.789  -0.303  -11.167 1.00 17.60 ? 435  PRO C CB  1 
ATOM   2691  C  CG  . PRO C  3 65  ? -9.296  -1.494  -10.423 1.00 17.18 ? 435  PRO C CG  1 
ATOM   2692  C  CD  . PRO C  3 65  ? -10.289 -0.963  -9.408  1.00 16.59 ? 435  PRO C CD  1 
ATOM   2693  N  N   . ILE C  3 66  ? -10.702 0.938   -13.506 1.00 19.82 ? 436  ILE C N   1 
ATOM   2694  C  CA  . ILE C  3 66  ? -11.341 0.573   -14.758 1.00 21.10 ? 436  ILE C CA  1 
ATOM   2695  C  C   . ILE C  3 66  ? -10.305 -0.152  -15.612 1.00 22.03 ? 436  ILE C C   1 
ATOM   2696  O  O   . ILE C  3 66  ? -9.312  0.451   -16.043 1.00 22.42 ? 436  ILE C O   1 
ATOM   2697  C  CB  . ILE C  3 66  ? -11.813 1.818   -15.522 1.00 21.88 ? 436  ILE C CB  1 
ATOM   2698  C  CG1 . ILE C  3 66  ? -12.714 2.682   -14.635 1.00 21.41 ? 436  ILE C CG1 1 
ATOM   2699  C  CG2 . ILE C  3 66  ? -12.515 1.413   -16.818 1.00 23.06 ? 436  ILE C CG2 1 
ATOM   2700  C  CD1 . ILE C  3 66  ? -12.993 4.047   -15.219 1.00 22.26 ? 436  ILE C CD1 1 
ATOM   2701  N  N   . PRO C  3 67  ? -10.521 -1.456  -15.857 1.00 22.62 ? 437  PRO C N   1 
ATOM   2702  C  CA  . PRO C  3 67  ? -9.590  -2.187  -16.702 1.00 23.69 ? 437  PRO C CA  1 
ATOM   2703  C  C   . PRO C  3 67  ? -9.740  -1.817  -18.166 1.00 25.51 ? 437  PRO C C   1 
ATOM   2704  O  O   . PRO C  3 67  ? -10.680 -1.129  -18.534 1.00 25.75 ? 437  PRO C O   1 
ATOM   2705  C  CB  . PRO C  3 67  ? -9.975  -3.656  -16.492 1.00 23.62 ? 437  PRO C CB  1 
ATOM   2706  C  CG  . PRO C  3 67  ? -11.166 -3.684  -15.608 1.00 22.89 ? 437  PRO C CG  1 
ATOM   2707  C  CD  . PRO C  3 67  ? -11.664 -2.283  -15.437 1.00 22.49 ? 437  PRO C CD  1 
ATOM   2708  N  N   . LYS C  3 68  ? -8.818  -2.286  -18.995 1.00 27.23 ? 438  LYS C N   1 
ATOM   2709  C  CA  . LYS C  3 68  ? -9.006  -2.238  -20.448 1.00 29.50 ? 438  LYS C CA  1 
ATOM   2710  C  C   . LYS C  3 68  ? -10.230 -3.056  -20.866 1.00 30.82 ? 438  LYS C C   1 
ATOM   2711  O  O   . LYS C  3 68  ? -10.661 -3.958  -20.155 1.00 30.19 ? 438  LYS C O   1 
ATOM   2712  C  CB  . LYS C  3 68  ? -7.793  -2.827  -21.167 1.00 30.31 ? 438  LYS C CB  1 
ATOM   2713  C  CG  . LYS C  3 68  ? -6.534  -1.987  -21.075 1.00 30.30 ? 438  LYS C CG  1 
ATOM   2714  C  CD  . LYS C  3 68  ? -5.352  -2.738  -21.670 1.00 31.35 ? 438  LYS C CD  1 
ATOM   2715  C  CE  . LYS C  3 68  ? -4.152  -1.834  -21.868 1.00 31.90 ? 438  LYS C CE  1 
ATOM   2716  N  NZ  . LYS C  3 68  ? -3.116  -2.518  -22.691 1.00 33.52 ? 438  LYS C NZ  1 
ATOM   2717  N  N   . LEU C  3 69  ? -10.774 -2.743  -22.033 1.00 33.47 ? 439  LEU C N   1 
ATOM   2718  C  CA  . LEU C  3 69  ? -11.726 -3.641  -22.692 1.00 35.06 ? 439  LEU C CA  1 
ATOM   2719  C  C   . LEU C  3 69  ? -11.049 -4.979  -23.048 1.00 36.40 ? 439  LEU C C   1 
ATOM   2720  O  O   . LEU C  3 69  ? -9.811  -5.045  -23.226 1.00 36.62 ? 439  LEU C O   1 
ATOM   2721  C  CB  . LEU C  3 69  ? -12.295 -3.006  -23.970 1.00 36.50 ? 439  LEU C CB  1 
ATOM   2722  C  CG  . LEU C  3 69  ? -13.360 -1.921  -23.793 1.00 36.17 ? 439  LEU C CG  1 
ATOM   2723  C  CD1 . LEU C  3 69  ? -13.598 -1.210  -25.114 1.00 38.03 ? 439  LEU C CD1 1 
ATOM   2724  C  CD2 . LEU C  3 69  ? -14.654 -2.524  -23.265 1.00 35.53 ? 439  LEU C CD2 1 
ATOM   2725  O  OXT . LEU C  3 69  ? -11.734 -6.014  -23.182 1.00 38.03 ? 439  LEU C OXT 1 
ATOM   2726  N  N   . ASP D  1 1   ? -33.088 12.229  -37.135 1.00 30.29 ? 1    ASP D N   1 
ATOM   2727  C  CA  . ASP D  1 1   ? -33.266 10.752  -37.190 1.00 29.46 ? 1    ASP D CA  1 
ATOM   2728  C  C   . ASP D  1 1   ? -32.519 10.192  -38.400 1.00 30.50 ? 1    ASP D C   1 
ATOM   2729  O  O   . ASP D  1 1   ? -32.361 10.878  -39.410 1.00 32.50 ? 1    ASP D O   1 
ATOM   2730  C  CB  . ASP D  1 1   ? -34.761 10.355  -37.266 1.00 30.06 ? 1    ASP D CB  1 
ATOM   2731  C  CG  . ASP D  1 1   ? -35.678 11.239  -36.394 1.00 30.03 ? 1    ASP D CG  1 
ATOM   2732  O  OD1 . ASP D  1 1   ? -35.253 12.354  -35.993 1.00 30.42 ? 1    ASP D OD1 1 
ATOM   2733  O  OD2 . ASP D  1 1   ? -36.835 10.824  -36.124 1.00 29.58 ? 1    ASP D OD2 1 
ATOM   2734  N  N   . THR D  1 2   ? -32.034 8.961   -38.271 1.00 29.57 ? 2    THR D N   1 
ATOM   2735  C  CA  . THR D  1 2   ? -31.577 8.182   -39.414 1.00 31.31 ? 2    THR D CA  1 
ATOM   2736  C  C   . THR D  1 2   ? -32.797 7.509   -40.018 1.00 32.62 ? 2    THR D C   1 
ATOM   2737  O  O   . THR D  1 2   ? -33.875 7.529   -39.419 1.00 31.70 ? 2    THR D O   1 
ATOM   2738  C  CB  . THR D  1 2   ? -30.602 7.067   -39.011 1.00 30.03 ? 2    THR D CB  1 
ATOM   2739  O  OG1 . THR D  1 2   ? -31.321 6.049   -38.304 1.00 28.74 ? 2    THR D OG1 1 
ATOM   2740  C  CG2 . THR D  1 2   ? -29.472 7.610   -38.146 1.00 28.71 ? 2    THR D CG2 1 
ATOM   2741  N  N   . PRO D  1 3   ? -32.635 6.893   -41.202 1.00 34.93 ? 3    PRO D N   1 
ATOM   2742  C  CA  . PRO D  1 3   ? -33.742 6.138   -41.794 1.00 36.23 ? 3    PRO D CA  1 
ATOM   2743  C  C   . PRO D  1 3   ? -34.151 4.861   -41.039 1.00 34.88 ? 3    PRO D C   1 
ATOM   2744  O  O   . PRO D  1 3   ? -35.161 4.265   -41.384 1.00 36.01 ? 3    PRO D O   1 
ATOM   2745  C  CB  . PRO D  1 3   ? -33.209 5.770   -43.186 1.00 38.71 ? 3    PRO D CB  1 
ATOM   2746  C  CG  . PRO D  1 3   ? -32.082 6.704   -43.446 1.00 39.24 ? 3    PRO D CG  1 
ATOM   2747  C  CD  . PRO D  1 3   ? -31.477 6.959   -42.112 1.00 36.46 ? 3    PRO D CD  1 
ATOM   2748  N  N   . ALA D  1 4   ? -33.386 4.446   -40.032 1.00 33.33 ? 4    ALA D N   1 
ATOM   2749  C  CA  . ALA D  1 4   ? -33.662 3.192   -39.316 1.00 32.56 ? 4    ALA D CA  1 
ATOM   2750  C  C   . ALA D  1 4   ? -34.937 3.247   -38.475 1.00 32.25 ? 4    ALA D C   1 
ATOM   2751  O  O   . ALA D  1 4   ? -35.257 4.275   -37.871 1.00 31.87 ? 4    ALA D O   1 
ATOM   2752  C  CB  . ALA D  1 4   ? -32.483 2.819   -38.437 1.00 30.68 ? 4    ALA D CB  1 
ATOM   2753  N  N   . ASN D  1 5   ? -35.655 2.127   -38.452 1.00 33.28 ? 5    ASN D N   1 
ATOM   2754  C  CA  . ASN D  1 5   ? -36.815 1.950   -37.594 1.00 33.85 ? 5    ASN D CA  1 
ATOM   2755  C  C   . ASN D  1 5   ? -36.771 0.550   -36.982 1.00 32.44 ? 5    ASN D C   1 
ATOM   2756  O  O   . ASN D  1 5   ? -37.573 -0.322  -37.303 1.00 33.00 ? 5    ASN D O   1 
ATOM   2757  C  CB  . ASN D  1 5   ? -38.104 2.181   -38.374 1.00 38.89 ? 5    ASN D CB  1 
ATOM   2758  C  CG  . ASN D  1 5   ? -39.341 2.183   -37.488 1.00 42.12 ? 5    ASN D CG  1 
ATOM   2759  O  OD1 . ASN D  1 5   ? -39.265 2.282   -36.251 1.00 39.19 ? 5    ASN D OD1 1 
ATOM   2760  N  ND2 . ASN D  1 5   ? -40.505 2.079   -38.131 1.00 49.83 ? 5    ASN D ND2 1 
ATOM   2761  N  N   . CYS D  1 6   ? -35.812 0.376   -36.077 1.00 30.14 ? 6    CYS D N   1 
ATOM   2762  C  CA  . CYS D  1 6   ? -35.542 -0.904  -35.436 1.00 28.81 ? 6    CYS D CA  1 
ATOM   2763  C  C   . CYS D  1 6   ? -36.256 -0.991  -34.105 1.00 26.59 ? 6    CYS D C   1 
ATOM   2764  O  O   . CYS D  1 6   ? -36.426 0.018   -33.417 1.00 25.15 ? 6    CYS D O   1 
ATOM   2765  C  CB  . CYS D  1 6   ? -34.038 -1.079  -35.246 1.00 28.36 ? 6    CYS D CB  1 
ATOM   2766  S  SG  . CYS D  1 6   ? -33.169 -1.138  -36.833 1.00 31.33 ? 6    CYS D SG  1 
ATOM   2767  N  N   . THR D  1 7   ? -36.686 -2.204  -33.759 1.00 25.90 ? 7    THR D N   1 
ATOM   2768  C  CA  . THR D  1 7   ? -37.514 -2.416  -32.578 1.00 24.75 ? 7    THR D CA  1 
ATOM   2769  C  C   . THR D  1 7   ? -36.650 -2.834  -31.385 1.00 22.97 ? 7    THR D C   1 
ATOM   2770  O  O   . THR D  1 7   ? -35.491 -3.244  -31.537 1.00 22.35 ? 7    THR D O   1 
ATOM   2771  C  CB  . THR D  1 7   ? -38.624 -3.473  -32.831 1.00 26.25 ? 7    THR D CB  1 
ATOM   2772  O  OG1 . THR D  1 7   ? -38.080 -4.791  -32.730 1.00 26.28 ? 7    THR D OG1 1 
ATOM   2773  C  CG2 . THR D  1 7   ? -39.279 -3.295  -34.212 1.00 27.80 ? 7    THR D CG2 1 
ATOM   2774  N  N   . TYR D  1 8   ? -37.235 -2.709  -30.201 1.00 22.10 ? 8    TYR D N   1 
ATOM   2775  C  CA  . TYR D  1 8   ? -36.642 -3.199  -28.966 1.00 21.27 ? 8    TYR D CA  1 
ATOM   2776  C  C   . TYR D  1 8   ? -36.389 -4.718  -29.020 1.00 22.13 ? 8    TYR D C   1 
ATOM   2777  O  O   . TYR D  1 8   ? -35.390 -5.195  -28.480 1.00 21.53 ? 8    TYR D O   1 
ATOM   2778  C  CB  . TYR D  1 8   ? -37.563 -2.827  -27.793 1.00 21.44 ? 8    TYR D CB  1 
ATOM   2779  C  CG  . TYR D  1 8   ? -37.136 -3.305  -26.430 1.00 21.10 ? 8    TYR D CG  1 
ATOM   2780  C  CD1 . TYR D  1 8   ? -36.316 -2.521  -25.615 1.00 19.93 ? 8    TYR D CD1 1 
ATOM   2781  C  CD2 . TYR D  1 8   ? -37.597 -4.512  -25.933 1.00 22.23 ? 8    TYR D CD2 1 
ATOM   2782  C  CE1 . TYR D  1 8   ? -35.942 -2.943  -24.356 1.00 19.78 ? 8    TYR D CE1 1 
ATOM   2783  C  CE2 . TYR D  1 8   ? -37.217 -4.953  -24.680 1.00 22.45 ? 8    TYR D CE2 1 
ATOM   2784  C  CZ  . TYR D  1 8   ? -36.389 -4.159  -23.899 1.00 21.17 ? 8    TYR D CZ  1 
ATOM   2785  O  OH  . TYR D  1 8   ? -36.026 -4.621  -22.662 1.00 20.84 ? 8    TYR D OH  1 
ATOM   2786  N  N   . LEU D  1 9   ? -37.268 -5.478  -29.673 1.00 23.66 ? 9    LEU D N   1 
ATOM   2787  C  CA  . LEU D  1 9   ? -37.042 -6.925  -29.787 1.00 24.87 ? 9    LEU D CA  1 
ATOM   2788  C  C   . LEU D  1 9   ? -35.810 -7.229  -30.650 1.00 24.85 ? 9    LEU D C   1 
ATOM   2789  O  O   . LEU D  1 9   ? -35.082 -8.188  -30.359 1.00 25.49 ? 9    LEU D O   1 
ATOM   2790  C  CB  . LEU D  1 9   ? -38.264 -7.686  -30.310 1.00 26.64 ? 9    LEU D CB  1 
ATOM   2791  C  CG  . LEU D  1 9   ? -38.078 -9.228  -30.273 1.00 28.23 ? 9    LEU D CG  1 
ATOM   2792  C  CD1 . LEU D  1 9   ? -37.776 -9.747  -28.863 1.00 28.00 ? 9    LEU D CD1 1 
ATOM   2793  C  CD2 . LEU D  1 9   ? -39.281 -9.971  -30.846 1.00 30.19 ? 9    LEU D CD2 1 
ATOM   2794  N  N   . ASP D  1 10  ? -35.563 -6.424  -31.686 1.00 24.54 ? 10   ASP D N   1 
ATOM   2795  C  CA  . ASP D  1 10  ? -34.355 -6.597  -32.499 1.00 24.74 ? 10   ASP D CA  1 
ATOM   2796  C  C   . ASP D  1 10  ? -33.097 -6.451  -31.632 1.00 23.21 ? 10   ASP D C   1 
ATOM   2797  O  O   . ASP D  1 10  ? -32.118 -7.161  -31.831 1.00 23.51 ? 10   ASP D O   1 
ATOM   2798  C  CB  . ASP D  1 10  ? -34.304 -5.570  -33.643 1.00 25.21 ? 10   ASP D CB  1 
ATOM   2799  C  CG  . ASP D  1 10  ? -35.375 -5.802  -34.695 1.00 27.04 ? 10   ASP D CG  1 
ATOM   2800  O  OD1 . ASP D  1 10  ? -35.727 -6.978  -34.931 1.00 28.67 ? 10   ASP D OD1 1 
ATOM   2801  O  OD2 . ASP D  1 10  ? -35.866 -4.808  -35.288 1.00 27.54 ? 10   ASP D OD2 1 
ATOM   2802  N  N   . LEU D  1 11  ? -33.148 -5.543  -30.660 1.00 21.50 ? 11   LEU D N   1 
ATOM   2803  C  CA  . LEU D  1 11  ? -32.016 -5.266  -29.780 1.00 20.15 ? 11   LEU D CA  1 
ATOM   2804  C  C   . LEU D  1 11  ? -31.715 -6.370  -28.747 1.00 20.18 ? 11   LEU D C   1 
ATOM   2805  O  O   . LEU D  1 11  ? -30.553 -6.620  -28.445 1.00 19.68 ? 11   LEU D O   1 
ATOM   2806  C  CB  . LEU D  1 11  ? -32.242 -3.926  -29.082 1.00 18.99 ? 11   LEU D CB  1 
ATOM   2807  C  CG  . LEU D  1 11  ? -31.122 -3.375  -28.211 1.00 17.90 ? 11   LEU D CG  1 
ATOM   2808  C  CD1 . LEU D  1 11  ? -29.854 -3.147  -29.016 1.00 17.93 ? 11   LEU D CD1 1 
ATOM   2809  C  CD2 . LEU D  1 11  ? -31.604 -2.088  -27.577 1.00 17.21 ? 11   LEU D CD2 1 
ATOM   2810  N  N   . LEU D  1 12  ? -32.749 -7.028  -28.214 1.00 20.84 ? 12   LEU D N   1 
ATOM   2811  C  CA  . LEU D  1 12  ? -32.557 -8.147  -27.274 1.00 21.42 ? 12   LEU D CA  1 
ATOM   2812  C  C   . LEU D  1 12  ? -31.820 -9.327  -27.902 1.00 22.59 ? 12   LEU D C   1 
ATOM   2813  O  O   . LEU D  1 12  ? -32.063 -9.671  -29.052 1.00 23.53 ? 12   LEU D O   1 
ATOM   2814  C  CB  . LEU D  1 12  ? -33.893 -8.650  -26.742 1.00 22.34 ? 12   LEU D CB  1 
ATOM   2815  C  CG  . LEU D  1 12  ? -34.638 -7.696  -25.814 1.00 21.81 ? 12   LEU D CG  1 
ATOM   2816  C  CD1 . LEU D  1 12  ? -35.973 -8.342  -25.442 1.00 23.23 ? 12   LEU D CD1 1 
ATOM   2817  C  CD2 . LEU D  1 12  ? -33.816 -7.353  -24.570 1.00 20.99 ? 12   LEU D CD2 1 
ATOM   2818  N  N   . GLY D  1 13  ? -30.955 -9.965  -27.116 1.00 22.79 ? 13   GLY D N   1 
ATOM   2819  C  CA  . GLY D  1 13  ? -30.169 -11.101 -27.577 1.00 23.98 ? 13   GLY D CA  1 
ATOM   2820  C  C   . GLY D  1 13  ? -28.689 -10.881 -27.355 1.00 23.26 ? 13   GLY D C   1 
ATOM   2821  O  O   . GLY D  1 13  ? -28.297 -10.058 -26.547 1.00 21.96 ? 13   GLY D O   1 
ATOM   2822  N  N   . THR D  1 14  ? -27.874 -11.629 -28.089 1.00 24.35 ? 14   THR D N   1 
ATOM   2823  C  CA  . THR D  1 14  ? -26.425 -11.613 -27.945 1.00 24.31 ? 14   THR D CA  1 
ATOM   2824  C  C   . THR D  1 14  ? -25.841 -10.749 -29.054 1.00 23.87 ? 14   THR D C   1 
ATOM   2825  O  O   . THR D  1 14  ? -26.231 -10.877 -30.218 1.00 24.71 ? 14   THR D O   1 
ATOM   2826  C  CB  . THR D  1 14  ? -25.868 -13.040 -28.051 1.00 26.45 ? 14   THR D CB  1 
ATOM   2827  O  OG1 . THR D  1 14  ? -26.519 -13.865 -27.084 1.00 27.24 ? 14   THR D OG1 1 
ATOM   2828  C  CG2 . THR D  1 14  ? -24.366 -13.081 -27.814 1.00 26.74 ? 14   THR D CG2 1 
ATOM   2829  N  N   . TRP D  1 15  ? -24.945 -9.840  -28.680 1.00 22.77 ? 15   TRP D N   1 
ATOM   2830  C  CA  . TRP D  1 15  ? -24.256 -8.981  -29.628 1.00 22.58 ? 15   TRP D CA  1 
ATOM   2831  C  C   . TRP D  1 15  ? -22.760 -9.199  -29.507 1.00 23.41 ? 15   TRP D C   1 
ATOM   2832  O  O   . TRP D  1 15  ? -22.236 -9.288  -28.400 1.00 23.19 ? 15   TRP D O   1 
ATOM   2833  C  CB  . TRP D  1 15  ? -24.553 -7.513  -29.343 1.00 20.77 ? 15   TRP D CB  1 
ATOM   2834  C  CG  . TRP D  1 15  ? -25.911 -7.041  -29.770 1.00 20.33 ? 15   TRP D CG  1 
ATOM   2835  C  CD1 . TRP D  1 15  ? -27.064 -7.102  -29.045 1.00 19.81 ? 15   TRP D CD1 1 
ATOM   2836  C  CD2 . TRP D  1 15  ? -26.251 -6.393  -31.005 1.00 20.55 ? 15   TRP D CD2 1 
ATOM   2837  N  NE1 . TRP D  1 15  ? -28.101 -6.537  -29.751 1.00 19.69 ? 15   TRP D NE1 1 
ATOM   2838  C  CE2 . TRP D  1 15  ? -27.629 -6.097  -30.957 1.00 20.12 ? 15   TRP D CE2 1 
ATOM   2839  C  CE3 . TRP D  1 15  ? -25.524 -6.030  -32.141 1.00 21.39 ? 15   TRP D CE3 1 
ATOM   2840  C  CZ2 . TRP D  1 15  ? -28.297 -5.479  -32.009 1.00 20.48 ? 15   TRP D CZ2 1 
ATOM   2841  C  CZ3 . TRP D  1 15  ? -26.191 -5.409  -33.189 1.00 21.78 ? 15   TRP D CZ3 1 
ATOM   2842  C  CH2 . TRP D  1 15  ? -27.564 -5.145  -33.117 1.00 21.31 ? 15   TRP D CH2 1 
ATOM   2843  N  N   . VAL D  1 16  ? -22.082 -9.288  -30.647 1.00 24.80 ? 16   VAL D N   1 
ATOM   2844  C  CA  . VAL D  1 16  ? -20.633 -9.324  -30.689 1.00 25.87 ? 16   VAL D CA  1 
ATOM   2845  C  C   . VAL D  1 16  ? -20.157 -7.938  -31.109 1.00 25.35 ? 16   VAL D C   1 
ATOM   2846  O  O   . VAL D  1 16  ? -20.602 -7.416  -32.120 1.00 25.63 ? 16   VAL D O   1 
ATOM   2847  C  CB  . VAL D  1 16  ? -20.122 -10.398 -31.665 1.00 28.36 ? 16   VAL D CB  1 
ATOM   2848  C  CG1 . VAL D  1 16  ? -18.609 -10.315 -31.815 1.00 29.63 ? 16   VAL D CG1 1 
ATOM   2849  C  CG2 . VAL D  1 16  ? -20.537 -11.784 -31.188 1.00 29.36 ? 16   VAL D CG2 1 
ATOM   2850  N  N   . PHE D  1 17  ? -19.280 -7.337  -30.305 1.00 25.10 ? 17   PHE D N   1 
ATOM   2851  C  CA  . PHE D  1 17  ? -18.743 -6.015  -30.566 1.00 24.83 ? 17   PHE D CA  1 
ATOM   2852  C  C   . PHE D  1 17  ? -17.281 -6.150  -30.931 1.00 27.17 ? 17   PHE D C   1 
ATOM   2853  O  O   . PHE D  1 17  ? -16.506 -6.764  -30.197 1.00 27.64 ? 17   PHE D O   1 
ATOM   2854  C  CB  . PHE D  1 17  ? -18.886 -5.096  -29.343 1.00 22.88 ? 17   PHE D CB  1 
ATOM   2855  C  CG  . PHE D  1 17  ? -20.299 -4.669  -29.046 1.00 21.41 ? 17   PHE D CG  1 
ATOM   2856  C  CD1 . PHE D  1 17  ? -21.267 -4.604  -30.044 1.00 21.54 ? 17   PHE D CD1 1 
ATOM   2857  C  CD2 . PHE D  1 17  ? -20.654 -4.286  -27.759 1.00 20.25 ? 17   PHE D CD2 1 
ATOM   2858  C  CE1 . PHE D  1 17  ? -22.563 -4.212  -29.760 1.00 20.46 ? 17   PHE D CE1 1 
ATOM   2859  C  CE2 . PHE D  1 17  ? -21.948 -3.876  -27.468 1.00 19.12 ? 17   PHE D CE2 1 
ATOM   2860  C  CZ  . PHE D  1 17  ? -22.903 -3.841  -28.470 1.00 19.25 ? 17   PHE D CZ  1 
ATOM   2861  N  N   . GLN D  1 18  ? -16.927 -5.585  -32.083 1.00 29.34 ? 18   GLN D N   1 
ATOM   2862  C  CA  . GLN D  1 18  ? -15.548 -5.536  -32.551 1.00 32.20 ? 18   GLN D CA  1 
ATOM   2863  C  C   . GLN D  1 18  ? -14.962 -4.169  -32.236 1.00 31.67 ? 18   GLN D C   1 
ATOM   2864  O  O   . GLN D  1 18  ? -15.455 -3.162  -32.714 1.00 30.47 ? 18   GLN D O   1 
ATOM   2865  C  CB  . GLN D  1 18  ? -15.488 -5.797  -34.060 1.00 34.87 ? 18   GLN D CB  1 
ATOM   2866  C  CG  . GLN D  1 18  ? -15.828 -7.223  -34.460 1.00 36.68 ? 18   GLN D CG  1 
ATOM   2867  C  CD  . GLN D  1 18  ? -14.822 -8.240  -33.946 1.00 38.30 ? 18   GLN D CD  1 
ATOM   2868  O  OE1 . GLN D  1 18  ? -13.706 -7.890  -33.545 1.00 39.24 ? 18   GLN D OE1 1 
ATOM   2869  N  NE2 . GLN D  1 18  ? -15.211 -9.512  -33.961 1.00 39.50 ? 18   GLN D NE2 1 
ATOM   2870  N  N   . VAL D  1 19  ? -13.908 -4.141  -31.432 1.00 32.94 ? 19   VAL D N   1 
ATOM   2871  C  CA  . VAL D  1 19  ? -13.338 -2.891  -30.947 1.00 33.30 ? 19   VAL D CA  1 
ATOM   2872  C  C   . VAL D  1 19  ? -12.040 -2.620  -31.679 1.00 36.67 ? 19   VAL D C   1 
ATOM   2873  O  O   . VAL D  1 19  ? -11.200 -3.511  -31.790 1.00 39.13 ? 19   VAL D O   1 
ATOM   2874  C  CB  . VAL D  1 19  ? -13.040 -2.964  -29.430 1.00 32.06 ? 19   VAL D CB  1 
ATOM   2875  C  CG1 . VAL D  1 19  ? -12.665 -1.593  -28.888 1.00 31.30 ? 19   VAL D CG1 1 
ATOM   2876  C  CG2 . VAL D  1 19  ? -14.233 -3.535  -28.679 1.00 30.47 ? 19   VAL D CG2 1 
ATOM   2877  N  N   . GLY D  1 20  ? -11.877 -1.398  -32.176 1.00 38.43 ? 20   GLY D N   1 
ATOM   2878  C  CA  . GLY D  1 20  ? -10.608 -0.971  -32.770 1.00 42.54 ? 20   GLY D CA  1 
ATOM   2879  C  C   . GLY D  1 20  ? -10.153 0.348   -32.186 1.00 43.85 ? 20   GLY D C   1 
ATOM   2880  O  O   . GLY D  1 20  ? -10.818 0.903   -31.328 1.00 42.53 ? 20   GLY D O   1 
ATOM   2881  N  N   . SER D  1 21  ? -9.015  0.856   -32.647 1.00 48.57 ? 21   SER D N   1 
ATOM   2882  C  CA  . SER D  1 21  ? -8.556  2.194   -32.252 1.00 49.38 ? 21   SER D CA  1 
ATOM   2883  C  C   . SER D  1 21  ? -8.517  2.327   -30.727 1.00 46.54 ? 21   SER D C   1 
ATOM   2884  O  O   . SER D  1 21  ? -8.876  3.360   -30.163 1.00 43.87 ? 21   SER D O   1 
ATOM   2885  C  CB  . SER D  1 21  ? -9.478  3.263   -32.863 1.00 49.42 ? 21   SER D CB  1 
ATOM   2886  O  OG  . SER D  1 21  ? -9.657  3.045   -34.259 1.00 51.93 ? 21   SER D OG  1 
ATOM   2887  N  N   . SER D  1 22  ? -8.074  1.260   -30.073 1.00 47.21 ? 22   SER D N   1 
ATOM   2888  C  CA  . SER D  1 22  ? -8.107  1.182   -28.623 1.00 46.25 ? 22   SER D CA  1 
ATOM   2889  C  C   . SER D  1 22  ? -7.101  2.152   -28.034 1.00 46.78 ? 22   SER D C   1 
ATOM   2890  O  O   . SER D  1 22  ? -6.147  2.544   -28.694 1.00 49.43 ? 22   SER D O   1 
ATOM   2891  C  CB  . SER D  1 22  ? -7.826  -0.253  -28.144 1.00 47.52 ? 22   SER D CB  1 
ATOM   2892  O  OG  . SER D  1 22  ? -6.597  -0.738  -28.669 1.00 50.20 ? 22   SER D OG  1 
ATOM   2893  N  N   . GLY D  1 23  ? -7.345  2.557   -26.796 1.00 45.36 ? 23   GLY D N   1 
ATOM   2894  C  CA  . GLY D  1 23  ? -6.442  3.455   -26.092 1.00 46.53 ? 23   GLY D CA  1 
ATOM   2895  C  C   . GLY D  1 23  ? -6.429  4.870   -26.645 1.00 47.03 ? 23   GLY D C   1 
ATOM   2896  O  O   . GLY D  1 23  ? -5.567  5.676   -26.277 1.00 49.98 ? 23   GLY D O   1 
ATOM   2897  N  N   . SER D  1 24  ? -7.381  5.183   -27.520 1.00 44.75 ? 24   SER D N   1 
ATOM   2898  C  CA  . SER D  1 24  ? -7.483  6.518   -28.082 1.00 44.17 ? 24   SER D CA  1 
ATOM   2899  C  C   . SER D  1 24  ? -8.149  7.465   -27.072 1.00 41.72 ? 24   SER D C   1 
ATOM   2900  O  O   . SER D  1 24  ? -8.504  7.050   -25.961 1.00 38.67 ? 24   SER D O   1 
ATOM   2901  C  CB  . SER D  1 24  ? -8.261  6.471   -29.402 1.00 44.23 ? 24   SER D CB  1 
ATOM   2902  O  OG  . SER D  1 24  ? -7.607  5.626   -30.338 1.00 46.82 ? 24   SER D OG  1 
ATOM   2903  N  N   . GLN D  1 25  ? -8.303  8.729   -27.474 1.00 41.59 ? 25   GLN D N   1 
ATOM   2904  C  CA  . GLN D  1 25  ? -8.886  9.785   -26.643 1.00 39.97 ? 25   GLN D CA  1 
ATOM   2905  C  C   . GLN D  1 25  ? -10.183 10.356  -27.239 1.00 37.64 ? 25   GLN D C   1 
ATOM   2906  O  O   . GLN D  1 25  ? -10.634 9.928   -28.297 1.00 37.92 ? 25   GLN D O   1 
ATOM   2907  C  CB  . GLN D  1 25  ? -7.856  10.897  -26.411 1.00 42.49 ? 25   GLN D CB  1 
ATOM   2908  C  CG  . GLN D  1 25  ? -7.182  10.843  -25.047 1.00 44.00 ? 25   GLN D CG  1 
ATOM   2909  C  CD  . GLN D  1 25  ? -6.036  9.834   -24.959 1.00 46.45 ? 25   GLN D CD  1 
ATOM   2910  O  OE1 . GLN D  1 25  ? -6.224  8.692   -24.527 1.00 47.69 ? 25   GLN D OE1 1 
ATOM   2911  N  NE2 . GLN D  1 25  ? -4.841  10.260  -25.353 1.00 48.87 ? 25   GLN D NE2 1 
ATOM   2912  N  N   . ARG D  1 26  ? -10.787 11.311  -26.540 1.00 36.25 ? 26   ARG D N   1 
ATOM   2913  C  CA  . ARG D  1 26  ? -12.086 11.875  -26.915 1.00 34.90 ? 26   ARG D CA  1 
ATOM   2914  C  C   . ARG D  1 26  ? -12.138 12.352  -28.378 1.00 38.14 ? 26   ARG D C   1 
ATOM   2915  O  O   . ARG D  1 26  ? -13.178 12.260  -29.044 1.00 39.27 ? 26   ARG D O   1 
ATOM   2916  C  CB  . ARG D  1 26  ? -12.410 13.035  -25.975 1.00 33.69 ? 26   ARG D CB  1 
ATOM   2917  C  CG  . ARG D  1 26  ? -13.833 13.571  -26.048 1.00 31.97 ? 26   ARG D CG  1 
ATOM   2918  C  CD  . ARG D  1 26  ? -13.847 15.100  -26.031 1.00 32.33 ? 26   ARG D CD  1 
ATOM   2919  N  NE  . ARG D  1 26  ? -13.073 15.663  -24.912 1.00 33.29 ? 26   ARG D NE  1 
ATOM   2920  C  CZ  . ARG D  1 26  ? -13.551 16.478  -23.967 1.00 32.86 ? 26   ARG D CZ  1 
ATOM   2921  N  NH1 . ARG D  1 26  ? -14.814 16.878  -23.977 1.00 31.61 ? 26   ARG D NH1 1 
ATOM   2922  N  NH2 . ARG D  1 26  ? -12.739 16.925  -23.011 1.00 34.03 ? 26   ARG D NH2 1 
ATOM   2923  N  N   . ASP D  1 27  ? -11.006 12.839  -28.873 1.00 41.86 ? 27   ASP D N   1 
ATOM   2924  C  CA  . ASP D  1 27  ? -10.900 13.365  -30.234 1.00 45.01 ? 27   ASP D CA  1 
ATOM   2925  C  C   . ASP D  1 27  ? -10.658 12.260  -31.273 1.00 46.21 ? 27   ASP D C   1 
ATOM   2926  O  O   . ASP D  1 27  ? -9.983  12.496  -32.286 1.00 49.00 ? 27   ASP D O   1 
ATOM   2927  C  CB  . ASP D  1 27  ? -9.729  14.352  -30.291 1.00 47.24 ? 27   ASP D CB  1 
ATOM   2928  C  CG  . ASP D  1 27  ? -8.385  13.654  -30.165 1.00 49.10 ? 27   ASP D CG  1 
ATOM   2929  O  OD1 . ASP D  1 27  ? -8.344  12.558  -29.553 1.00 48.02 ? 27   ASP D OD1 1 
ATOM   2930  O  OD2 . ASP D  1 27  ? -7.376  14.181  -30.686 1.00 52.76 ? 27   ASP D OD2 1 
ATOM   2931  N  N   . VAL D  1 28  ? -11.181 11.063  -31.022 1.00 43.78 ? 28   VAL D N   1 
ATOM   2932  C  CA  . VAL D  1 28  ? -10.943 9.919   -31.900 1.00 44.49 ? 28   VAL D CA  1 
ATOM   2933  C  C   . VAL D  1 28  ? -11.926 9.979   -33.056 1.00 44.48 ? 28   VAL D C   1 
ATOM   2934  O  O   . VAL D  1 28  ? -13.050 10.443  -32.880 1.00 43.10 ? 28   VAL D O   1 
ATOM   2935  C  CB  . VAL D  1 28  ? -11.094 8.577   -31.139 1.00 43.08 ? 28   VAL D CB  1 
ATOM   2936  C  CG1 . VAL D  1 28  ? -12.563 8.258   -30.849 1.00 40.78 ? 28   VAL D CG1 1 
ATOM   2937  C  CG2 . VAL D  1 28  ? -10.438 7.442   -31.908 1.00 44.93 ? 28   VAL D CG2 1 
ATOM   2938  N  N   . ASN D  1 29  ? -11.508 9.506   -34.230 1.00 46.33 ? 29   ASN D N   1 
ATOM   2939  C  CA  . ASN D  1 29  ? -12.342 9.592   -35.431 1.00 46.25 ? 29   ASN D CA  1 
ATOM   2940  C  C   . ASN D  1 29  ? -13.060 8.271   -35.735 1.00 45.21 ? 29   ASN D C   1 
ATOM   2941  O  O   . ASN D  1 29  ? -12.465 7.337   -36.285 1.00 45.83 ? 29   ASN D O   1 
ATOM   2942  C  CB  . ASN D  1 29  ? -11.507 10.056  -36.632 1.00 48.95 ? 29   ASN D CB  1 
ATOM   2943  C  CG  . ASN D  1 29  ? -12.352 10.703  -37.713 1.00 49.98 ? 29   ASN D CG  1 
ATOM   2944  O  OD1 . ASN D  1 29  ? -13.577 10.561  -37.721 1.00 48.77 ? 29   ASN D OD1 1 
ATOM   2945  N  ND2 . ASN D  1 29  ? -11.706 11.418  -38.631 1.00 52.36 ? 29   ASN D ND2 1 
ATOM   2946  N  N   . CYS D  1 30  ? -14.338 8.202   -35.361 1.00 42.96 ? 30   CYS D N   1 
ATOM   2947  C  CA  . CYS D  1 30  ? -15.157 7.019   -35.615 1.00 42.75 ? 30   CYS D CA  1 
ATOM   2948  C  C   . CYS D  1 30  ? -16.134 7.263   -36.766 1.00 47.03 ? 30   CYS D C   1 
ATOM   2949  O  O   . CYS D  1 30  ? -17.350 7.383   -36.574 1.00 46.19 ? 30   CYS D O   1 
ATOM   2950  C  CB  . CYS D  1 30  ? -15.909 6.575   -34.350 1.00 37.66 ? 30   CYS D CB  1 
ATOM   2951  S  SG  . CYS D  1 30  ? -14.873 6.090   -32.936 1.00 35.11 ? 30   CYS D SG  1 
ATOM   2952  N  N   . SER D  1 31  ? -15.571 7.368   -37.959 1.00 53.98 ? 31   SER D N   1 
ATOM   2953  C  CA  . SER D  1 31  ? -16.325 7.238   -39.203 1.00 58.92 ? 31   SER D CA  1 
ATOM   2954  C  C   . SER D  1 31  ? -15.878 5.922   -39.833 1.00 62.84 ? 31   SER D C   1 
ATOM   2955  O  O   . SER D  1 31  ? -16.700 5.046   -40.111 1.00 64.17 ? 31   SER D O   1 
ATOM   2956  C  CB  . SER D  1 31  ? -16.037 8.409   -40.151 1.00 61.24 ? 31   SER D CB  1 
ATOM   2957  O  OG  . SER D  1 31  ? -14.664 8.451   -40.508 1.00 63.33 ? 31   SER D OG  1 
ATOM   2958  N  N   . VAL D  1 32  ? -14.566 5.799   -40.040 1.00 64.90 ? 32   VAL D N   1 
ATOM   2959  C  CA  . VAL D  1 32  ? -13.950 4.548   -40.477 1.00 67.41 ? 32   VAL D CA  1 
ATOM   2960  C  C   . VAL D  1 32  ? -13.542 3.673   -39.285 1.00 65.37 ? 32   VAL D C   1 
ATOM   2961  O  O   . VAL D  1 32  ? -12.782 4.102   -38.411 1.00 66.04 ? 32   VAL D O   1 
ATOM   2962  C  CB  . VAL D  1 32  ? -12.713 4.789   -41.379 1.00 71.54 ? 32   VAL D CB  1 
ATOM   2963  C  CG1 . VAL D  1 32  ? -13.112 5.565   -42.628 1.00 73.72 ? 32   VAL D CG1 1 
ATOM   2964  C  CG2 . VAL D  1 32  ? -11.584 5.497   -40.624 1.00 71.38 ? 32   VAL D CG2 1 
ATOM   2965  N  N   . MET D  1 33  ? -14.068 2.450   -39.251 1.00 62.88 ? 33   MET D N   1 
ATOM   2966  C  CA  . MET D  1 33  ? -13.540 1.399   -38.382 1.00 58.87 ? 33   MET D CA  1 
ATOM   2967  C  C   . MET D  1 33  ? -12.162 0.987   -38.913 1.00 62.54 ? 33   MET D C   1 
ATOM   2968  O  O   . MET D  1 33  ? -12.050 0.533   -40.056 1.00 64.48 ? 33   MET D O   1 
ATOM   2969  C  CB  . MET D  1 33  ? -14.499 0.193   -38.382 1.00 55.68 ? 33   MET D CB  1 
ATOM   2970  C  CG  . MET D  1 33  ? -14.077 -1.027  -37.552 1.00 54.99 ? 33   MET D CG  1 
ATOM   2971  S  SD  . MET D  1 33  ? -13.695 -0.774  -35.792 1.00 50.36 ? 33   MET D SD  1 
ATOM   2972  C  CE  . MET D  1 33  ? -14.878 0.486   -35.367 1.00 42.41 ? 33   MET D CE  1 
ATOM   2973  N  N   . GLY D  1 34  ? -11.118 1.178   -38.100 1.00 61.79 ? 34   GLY D N   1 
ATOM   2974  C  CA  . GLY D  1 34  ? -9.782  0.649   -38.400 1.00 61.75 ? 34   GLY D CA  1 
ATOM   2975  C  C   . GLY D  1 34  ? -9.793  -0.847  -38.146 1.00 61.09 ? 34   GLY D C   1 
ATOM   2976  O  O   . GLY D  1 34  ? -10.861 -1.447  -38.035 1.00 60.13 ? 34   GLY D O   1 
ATOM   2977  N  N   . PRO D  1 35  ? -8.615  -1.473  -38.038 1.00 61.65 ? 35   PRO D N   1 
ATOM   2978  C  CA  . PRO D  1 35  ? -8.625  -2.920  -37.770 1.00 61.92 ? 35   PRO D CA  1 
ATOM   2979  C  C   . PRO D  1 35  ? -9.272  -3.323  -36.424 1.00 57.73 ? 35   PRO D C   1 
ATOM   2980  O  O   . PRO D  1 35  ? -9.378  -2.501  -35.512 1.00 55.32 ? 35   PRO D O   1 
ATOM   2981  C  CB  . PRO D  1 35  ? -7.137  -3.305  -37.816 1.00 65.12 ? 35   PRO D CB  1 
ATOM   2982  C  CG  . PRO D  1 35  ? -6.381  -2.020  -37.729 1.00 65.95 ? 35   PRO D CG  1 
ATOM   2983  C  CD  . PRO D  1 35  ? -7.264  -0.960  -38.307 1.00 64.79 ? 35   PRO D CD  1 
ATOM   2984  N  N   . GLN D  1 36  ? -9.696  -4.585  -36.327 1.00 56.49 ? 36   GLN D N   1 
ATOM   2985  C  CA  . GLN D  1 36  ? -10.342 -5.124  -35.123 1.00 52.80 ? 36   GLN D CA  1 
ATOM   2986  C  C   . GLN D  1 36  ? -9.251  -5.572  -34.145 1.00 53.74 ? 36   GLN D C   1 
ATOM   2987  O  O   . GLN D  1 36  ? -8.379  -6.357  -34.516 1.00 56.49 ? 36   GLN D O   1 
ATOM   2988  C  CB  . GLN D  1 36  ? -11.240 -6.337  -35.434 1.00 52.38 ? 36   GLN D CB  1 
ATOM   2989  C  CG  . GLN D  1 36  ? -11.850 -6.439  -36.835 1.00 53.79 ? 36   GLN D CG  1 
ATOM   2990  C  CD  . GLN D  1 36  ? -13.262 -5.878  -36.941 1.00 50.60 ? 36   GLN D CD  1 
ATOM   2991  O  OE1 . GLN D  1 36  ? -13.529 -4.743  -36.532 1.00 49.06 ? 36   GLN D OE1 1 
ATOM   2992  N  NE2 . GLN D  1 36  ? -14.170 -6.664  -37.514 1.00 49.92 ? 36   GLN D NE2 1 
ATOM   2993  N  N   . GLU D  1 37  ? -9.304  -5.090  -32.906 1.00 51.57 ? 37   GLU D N   1 
ATOM   2994  C  CA  . GLU D  1 37  ? -8.299  -5.430  -31.887 1.00 52.77 ? 37   GLU D CA  1 
ATOM   2995  C  C   . GLU D  1 37  ? -8.808  -6.441  -30.853 1.00 49.93 ? 37   GLU D C   1 
ATOM   2996  O  O   . GLU D  1 37  ? -8.081  -7.349  -30.451 1.00 50.91 ? 37   GLU D O   1 
ATOM   2997  C  CB  . GLU D  1 37  ? -7.833  -4.164  -31.154 1.00 53.53 ? 37   GLU D CB  1 
ATOM   2998  C  CG  . GLU D  1 37  ? -7.211  -3.094  -32.043 1.00 56.13 ? 37   GLU D CG  1 
ATOM   2999  C  CD  . GLU D  1 37  ? -5.876  -3.514  -32.620 1.00 60.69 ? 37   GLU D CD  1 
ATOM   3000  O  OE1 . GLU D  1 37  ? -4.958  -3.806  -31.824 1.00 64.72 ? 37   GLU D OE1 1 
ATOM   3001  O  OE2 . GLU D  1 37  ? -5.740  -3.542  -33.865 1.00 64.16 ? 37   GLU D OE2 1 
ATOM   3002  N  N   . LYS D  1 38  ? -10.049 -6.258  -30.415 1.00 46.18 ? 38   LYS D N   1 
ATOM   3003  C  CA  . LYS D  1 38  ? -10.627 -7.036  -29.326 1.00 43.18 ? 38   LYS D CA  1 
ATOM   3004  C  C   . LYS D  1 38  ? -12.042 -7.443  -29.707 1.00 40.37 ? 38   LYS D C   1 
ATOM   3005  O  O   . LYS D  1 38  ? -12.738 -6.717  -30.411 1.00 38.18 ? 38   LYS D O   1 
ATOM   3006  C  CB  . LYS D  1 38  ? -10.642 -6.195  -28.037 1.00 41.39 ? 38   LYS D CB  1 
ATOM   3007  C  CG  . LYS D  1 38  ? -11.355 -6.811  -26.820 1.00 40.44 ? 38   LYS D CG  1 
ATOM   3008  C  CD  . LYS D  1 38  ? -10.401 -7.418  -25.792 1.00 42.02 ? 38   LYS D CD  1 
ATOM   3009  C  CE  . LYS D  1 38  ? -9.668  -8.646  -26.314 1.00 45.14 ? 38   LYS D CE  1 
ATOM   3010  N  NZ  . LYS D  1 38  ? -8.490  -8.980  -25.462 1.00 47.01 ? 38   LYS D NZ  1 
ATOM   3011  N  N   . LYS D  1 39  ? -12.445 -8.615  -29.238 1.00 39.73 ? 39   LYS D N   1 
ATOM   3012  C  CA  . LYS D  1 39  ? -13.810 -9.079  -29.349 1.00 38.11 ? 39   LYS D CA  1 
ATOM   3013  C  C   . LYS D  1 39  ? -14.442 -9.064  -27.953 1.00 35.53 ? 39   LYS D C   1 
ATOM   3014  O  O   . LYS D  1 39  ? -13.872 -9.609  -27.001 1.00 36.22 ? 39   LYS D O   1 
ATOM   3015  C  CB  . LYS D  1 39  ? -13.816 -10.479 -29.943 1.00 41.01 ? 39   LYS D CB  1 
ATOM   3016  C  CG  . LYS D  1 39  ? -15.188 -11.094 -30.111 1.00 41.09 ? 39   LYS D CG  1 
ATOM   3017  C  CD  . LYS D  1 39  ? -15.156 -12.242 -31.109 1.00 43.82 ? 39   LYS D CD  1 
ATOM   3018  C  CE  . LYS D  1 39  ? -16.397 -13.125 -30.996 1.00 44.15 ? 39   LYS D CE  1 
ATOM   3019  N  NZ  . LYS D  1 39  ? -16.221 -14.254 -30.037 1.00 45.55 ? 39   LYS D NZ  1 
ATOM   3020  N  N   . VAL D  1 40  ? -15.593 -8.401  -27.838 1.00 32.30 ? 40   VAL D N   1 
ATOM   3021  C  CA  . VAL D  1 40  ? -16.368 -8.338  -26.589 1.00 29.95 ? 40   VAL D CA  1 
ATOM   3022  C  C   . VAL D  1 40  ? -17.815 -8.766  -26.875 1.00 28.80 ? 40   VAL D C   1 
ATOM   3023  O  O   . VAL D  1 40  ? -18.480 -8.214  -27.773 1.00 27.82 ? 40   VAL D O   1 
ATOM   3024  C  CB  . VAL D  1 40  ? -16.350 -6.916  -25.972 1.00 28.17 ? 40   VAL D CB  1 
ATOM   3025  C  CG1 . VAL D  1 40  ? -17.194 -6.858  -24.711 1.00 27.16 ? 40   VAL D CG1 1 
ATOM   3026  C  CG2 . VAL D  1 40  ? -14.924 -6.474  -25.666 1.00 28.91 ? 40   VAL D CG2 1 
ATOM   3027  N  N   . VAL D  1 41  ? -18.282 -9.763  -26.126 1.00 28.35 ? 41   VAL D N   1 
ATOM   3028  C  CA  . VAL D  1 41  ? -19.645 -10.263 -26.237 1.00 27.55 ? 41   VAL D CA  1 
ATOM   3029  C  C   . VAL D  1 41  ? -20.520 -9.677  -25.124 1.00 25.49 ? 41   VAL D C   1 
ATOM   3030  O  O   . VAL D  1 41  ? -20.122 -9.639  -23.954 1.00 25.40 ? 41   VAL D O   1 
ATOM   3031  C  CB  . VAL D  1 41  ? -19.664 -11.797 -26.154 1.00 29.75 ? 41   VAL D CB  1 
ATOM   3032  C  CG1 . VAL D  1 41  ? -21.076 -12.347 -26.377 1.00 29.82 ? 41   VAL D CG1 1 
ATOM   3033  C  CG2 . VAL D  1 41  ? -18.693 -12.386 -27.167 1.00 31.70 ? 41   VAL D CG2 1 
ATOM   3034  N  N   . VAL D  1 42  ? -21.713 -9.222  -25.496 1.00 24.02 ? 42   VAL D N   1 
ATOM   3035  C  CA  . VAL D  1 42  ? -22.653 -8.633  -24.554 1.00 22.44 ? 42   VAL D CA  1 
ATOM   3036  C  C   . VAL D  1 42  ? -24.053 -9.178  -24.798 1.00 22.25 ? 42   VAL D C   1 
ATOM   3037  O  O   . VAL D  1 42  ? -24.495 -9.313  -25.936 1.00 22.43 ? 42   VAL D O   1 
ATOM   3038  C  CB  . VAL D  1 42  ? -22.657 -7.095  -24.643 1.00 21.09 ? 42   VAL D CB  1 
ATOM   3039  C  CG1 . VAL D  1 42  ? -23.715 -6.504  -23.712 1.00 20.18 ? 42   VAL D CG1 1 
ATOM   3040  C  CG2 . VAL D  1 42  ? -21.285 -6.533  -24.285 1.00 21.23 ? 42   VAL D CG2 1 
ATOM   3041  N  N   . TYR D  1 43  ? -24.740 -9.506  -23.714 1.00 22.01 ? 43   TYR D N   1 
ATOM   3042  C  CA  . TYR D  1 43  ? -26.075 -10.054 -23.791 1.00 22.27 ? 43   TYR D CA  1 
ATOM   3043  C  C   . TYR D  1 43  ? -27.038 -8.995  -23.275 1.00 20.68 ? 43   TYR D C   1 
ATOM   3044  O  O   . TYR D  1 43  ? -26.824 -8.434  -22.208 1.00 20.04 ? 43   TYR D O   1 
ATOM   3045  C  CB  . TYR D  1 43  ? -26.180 -11.329 -22.950 1.00 24.09 ? 43   TYR D CB  1 
ATOM   3046  C  CG  . TYR D  1 43  ? -25.123 -12.380 -23.237 1.00 25.54 ? 43   TYR D CG  1 
ATOM   3047  C  CD1 . TYR D  1 43  ? -23.898 -12.345 -22.590 1.00 25.89 ? 43   TYR D CD1 1 
ATOM   3048  C  CD2 . TYR D  1 43  ? -25.352 -13.408 -24.138 1.00 26.92 ? 43   TYR D CD2 1 
ATOM   3049  C  CE1 . TYR D  1 43  ? -22.929 -13.301 -22.831 1.00 27.54 ? 43   TYR D CE1 1 
ATOM   3050  C  CE2 . TYR D  1 43  ? -24.386 -14.362 -24.400 1.00 28.62 ? 43   TYR D CE2 1 
ATOM   3051  C  CZ  . TYR D  1 43  ? -23.176 -14.303 -23.737 1.00 28.98 ? 43   TYR D CZ  1 
ATOM   3052  O  OH  . TYR D  1 43  ? -22.195 -15.242 -23.963 1.00 31.27 ? 43   TYR D OH  1 
ATOM   3053  N  N   . LEU D  1 44  ? -28.084 -8.706  -24.039 1.00 20.06 ? 44   LEU D N   1 
ATOM   3054  C  CA  . LEU D  1 44  ? -29.113 -7.771  -23.593 1.00 19.14 ? 44   LEU D CA  1 
ATOM   3055  C  C   . LEU D  1 44  ? -30.430 -8.502  -23.347 1.00 20.11 ? 44   LEU D C   1 
ATOM   3056  O  O   . LEU D  1 44  ? -30.951 -9.172  -24.241 1.00 20.88 ? 44   LEU D O   1 
ATOM   3057  C  CB  . LEU D  1 44  ? -29.289 -6.652  -24.610 1.00 18.08 ? 44   LEU D CB  1 
ATOM   3058  C  CG  . LEU D  1 44  ? -27.989 -5.992  -25.099 1.00 17.41 ? 44   LEU D CG  1 
ATOM   3059  C  CD1 . LEU D  1 44  ? -28.329 -4.950  -26.149 1.00 16.85 ? 44   LEU D CD1 1 
ATOM   3060  C  CD2 . LEU D  1 44  ? -27.205 -5.351  -23.960 1.00 16.88 ? 44   LEU D CD2 1 
ATOM   3061  N  N   . GLN D  1 45  ? -30.937 -8.380  -22.118 1.00 20.33 ? 45   GLN D N   1 
ATOM   3062  C  CA  . GLN D  1 45  ? -32.181 -9.023  -21.672 1.00 21.58 ? 45   GLN D CA  1 
ATOM   3063  C  C   . GLN D  1 45  ? -33.134 -7.968  -21.147 1.00 20.88 ? 45   GLN D C   1 
ATOM   3064  O  O   . GLN D  1 45  ? -32.716 -7.002  -20.515 1.00 19.73 ? 45   GLN D O   1 
ATOM   3065  C  CB  . GLN D  1 45  ? -31.926 -10.028 -20.537 1.00 23.25 ? 45   GLN D CB  1 
ATOM   3066  C  CG  . GLN D  1 45  ? -30.960 -11.165 -20.873 1.00 24.22 ? 45   GLN D CG  1 
ATOM   3067  C  CD  . GLN D  1 45  ? -30.644 -12.074 -19.684 1.00 26.15 ? 45   GLN D CD  1 
ATOM   3068  O  OE1 . GLN D  1 45  ? -31.026 -11.808 -18.536 1.00 26.52 ? 45   GLN D OE1 1 
ATOM   3069  N  NE2 . GLN D  1 45  ? -29.941 -13.165 -19.960 1.00 27.62 ? 45   GLN D NE2 1 
ATOM   3070  N  N   . LYS D  1 46  ? -34.421 -8.184  -21.392 1.00 21.58 ? 46   LYS D N   1 
ATOM   3071  C  CA  . LYS D  1 46  ? -35.458 -7.295  -20.924 1.00 21.51 ? 46   LYS D CA  1 
ATOM   3072  C  C   . LYS D  1 46  ? -35.535 -7.335  -19.400 1.00 22.45 ? 46   LYS D C   1 
ATOM   3073  O  O   . LYS D  1 46  ? -35.199 -8.350  -18.805 1.00 23.59 ? 46   LYS D O   1 
ATOM   3074  C  CB  . LYS D  1 46  ? -36.805 -7.661  -21.574 1.00 22.60 ? 46   LYS D CB  1 
ATOM   3075  C  CG  . LYS D  1 46  ? -37.356 -9.057  -21.291 1.00 24.65 ? 46   LYS D CG  1 
ATOM   3076  C  CD  . LYS D  1 46  ? -38.125 -9.150  -19.967 1.00 26.20 ? 46   LYS D CD  1 
ATOM   3077  C  CE  . LYS D  1 46  ? -38.863 -10.470 -19.827 1.00 28.44 ? 46   LYS D CE  1 
ATOM   3078  N  NZ  . LYS D  1 46  ? -39.501 -10.579 -18.477 1.00 30.29 ? 46   LYS D NZ  1 
ATOM   3079  N  N   . LEU D  1 47  ? -35.938 -6.247  -18.748 1.00 22.23 ? 47   LEU D N   1 
ATOM   3080  C  CA  . LEU D  1 47  ? -36.331 -4.988  -19.379 1.00 21.09 ? 47   LEU D CA  1 
ATOM   3081  C  C   . LEU D  1 47  ? -35.159 -4.059  -19.668 1.00 19.47 ? 47   LEU D C   1 
ATOM   3082  O  O   . LEU D  1 47  ? -35.232 -3.260  -20.601 1.00 18.40 ? 47   LEU D O   1 
ATOM   3083  C  CB  . LEU D  1 47  ? -37.310 -4.239  -18.479 1.00 22.06 ? 47   LEU D CB  1 
ATOM   3084  C  CG  . LEU D  1 47  ? -38.695 -4.833  -18.355 1.00 23.90 ? 47   LEU D CG  1 
ATOM   3085  C  CD1 . LEU D  1 47  ? -39.419 -4.146  -17.221 1.00 25.30 ? 47   LEU D CD1 1 
ATOM   3086  C  CD2 . LEU D  1 47  ? -39.477 -4.676  -19.644 1.00 23.58 ? 47   LEU D CD2 1 
ATOM   3087  N  N   . ASP D  1 48  ? -34.095 -4.118  -18.864 1.00 19.39 ? 48   ASP D N   1 
ATOM   3088  C  CA  . ASP D  1 48  ? -32.955 -3.225  -19.094 1.00 18.07 ? 48   ASP D CA  1 
ATOM   3089  C  C   . ASP D  1 48  ? -31.608 -3.770  -18.638 1.00 17.95 ? 48   ASP D C   1 
ATOM   3090  O  O   . ASP D  1 48  ? -30.722 -3.013  -18.307 1.00 17.23 ? 48   ASP D O   1 
ATOM   3091  C  CB  . ASP D  1 48  ? -33.225 -1.837  -18.465 1.00 18.09 ? 48   ASP D CB  1 
ATOM   3092  C  CG  . ASP D  1 48  ? -33.018 -1.810  -16.948 1.00 19.46 ? 48   ASP D CG  1 
ATOM   3093  O  OD1 . ASP D  1 48  ? -33.243 -2.844  -16.269 1.00 21.06 ? 48   ASP D OD1 1 
ATOM   3094  O  OD2 . ASP D  1 48  ? -32.609 -0.741  -16.418 1.00 20.03 ? 48   ASP D OD2 1 
ATOM   3095  N  N   . THR D  1 49  ? -31.434 -5.075  -18.657 1.00 18.78 ? 49   THR D N   1 
ATOM   3096  C  CA  . THR D  1 49  ? -30.223 -5.668  -18.120 1.00 19.21 ? 49   THR D CA  1 
ATOM   3097  C  C   . THR D  1 49  ? -29.231 -6.002  -19.237 1.00 18.59 ? 49   THR D C   1 
ATOM   3098  O  O   . THR D  1 49  ? -29.596 -6.586  -20.245 1.00 18.45 ? 49   THR D O   1 
ATOM   3099  C  CB  . THR D  1 49  ? -30.555 -6.934  -17.311 1.00 21.05 ? 49   THR D CB  1 
ATOM   3100  O  OG1 . THR D  1 49  ? -31.445 -6.595  -16.249 1.00 22.16 ? 49   THR D OG1 1 
ATOM   3101  C  CG2 . THR D  1 49  ? -29.305 -7.570  -16.725 1.00 21.69 ? 49   THR D CG2 1 
ATOM   3102  N  N   . ALA D  1 50  ? -27.972 -5.612  -19.040 1.00 18.46 ? 50   ALA D N   1 
ATOM   3103  C  CA  . ALA D  1 50  ? -26.890 -5.991  -19.929 1.00 18.49 ? 50   ALA D CA  1 
ATOM   3104  C  C   . ALA D  1 50  ? -25.917 -6.803  -19.119 1.00 20.05 ? 50   ALA D C   1 
ATOM   3105  O  O   . ALA D  1 50  ? -25.614 -6.438  -18.001 1.00 20.56 ? 50   ALA D O   1 
ATOM   3106  C  CB  . ALA D  1 50  ? -26.203 -4.755  -20.506 1.00 17.14 ? 50   ALA D CB  1 
ATOM   3107  N  N   . TYR D  1 51  ? -25.432 -7.912  -19.657 1.00 21.70 ? 51   TYR D N   1 
ATOM   3108  C  CA  . TYR D  1 51  ? -24.329 -8.616  -18.992 1.00 23.79 ? 51   TYR D CA  1 
ATOM   3109  C  C   . TYR D  1 51  ? -23.301 -9.170  -19.975 1.00 24.78 ? 51   TYR D C   1 
ATOM   3110  O  O   . TYR D  1 51  ? -23.515 -9.152  -21.186 1.00 23.84 ? 51   TYR D O   1 
ATOM   3111  C  CB  . TYR D  1 51  ? -24.843 -9.679  -17.999 1.00 25.72 ? 51   TYR D CB  1 
ATOM   3112  C  CG  . TYR D  1 51  ? -25.331 -11.001 -18.573 1.00 27.17 ? 51   TYR D CG  1 
ATOM   3113  C  CD1 . TYR D  1 51  ? -26.514 -11.082 -19.296 1.00 26.86 ? 51   TYR D CD1 1 
ATOM   3114  C  CD2 . TYR D  1 51  ? -24.614 -12.188 -18.354 1.00 29.24 ? 51   TYR D CD2 1 
ATOM   3115  C  CE1 . TYR D  1 51  ? -26.963 -12.305 -19.804 1.00 28.17 ? 51   TYR D CE1 1 
ATOM   3116  C  CE2 . TYR D  1 51  ? -25.050 -13.409 -18.859 1.00 30.65 ? 51   TYR D CE2 1 
ATOM   3117  C  CZ  . TYR D  1 51  ? -26.226 -13.472 -19.583 1.00 30.40 ? 51   TYR D CZ  1 
ATOM   3118  O  OH  . TYR D  1 51  ? -26.664 -14.699 -20.082 1.00 32.31 ? 51   TYR D OH  1 
ATOM   3119  N  N   . ASP D  1 52  ? -22.162 -9.597  -19.432 1.00 27.31 ? 52   ASP D N   1 
ATOM   3120  C  CA  . ASP D  1 52  ? -21.063 -10.150 -20.231 1.00 28.92 ? 52   ASP D CA  1 
ATOM   3121  C  C   . ASP D  1 52  ? -20.688 -11.551 -19.753 1.00 31.91 ? 52   ASP D C   1 
ATOM   3122  O  O   . ASP D  1 52  ? -21.300 -12.080 -18.814 1.00 33.62 ? 52   ASP D O   1 
ATOM   3123  C  CB  . ASP D  1 52  ? -19.852 -9.200  -20.234 1.00 28.71 ? 52   ASP D CB  1 
ATOM   3124  C  CG  . ASP D  1 52  ? -19.088 -9.191  -18.912 1.00 30.21 ? 52   ASP D CG  1 
ATOM   3125  O  OD1 . ASP D  1 52  ? -19.360 -10.062 -18.033 1.00 32.40 ? 52   ASP D OD1 1 
ATOM   3126  O  OD2 . ASP D  1 52  ? -18.203 -8.308  -18.760 1.00 29.59 ? 52   ASP D OD2 1 
ATOM   3127  N  N   . ASP D  1 53  ? -19.694 -12.154 -20.401 1.00 33.70 ? 53   ASP D N   1 
ATOM   3128  C  CA  . ASP D  1 53  ? -19.306 -13.547 -20.111 1.00 36.19 ? 53   ASP D CA  1 
ATOM   3129  C  C   . ASP D  1 53  ? -18.726 -13.754 -18.713 1.00 37.47 ? 53   ASP D C   1 
ATOM   3130  O  O   . ASP D  1 53  ? -18.589 -14.890 -18.274 1.00 40.28 ? 53   ASP D O   1 
ATOM   3131  C  CB  . ASP D  1 53  ? -18.285 -14.042 -21.143 1.00 37.53 ? 53   ASP D CB  1 
ATOM   3132  C  CG  . ASP D  1 53  ? -18.869 -14.157 -22.537 1.00 37.25 ? 53   ASP D CG  1 
ATOM   3133  O  OD1 . ASP D  1 53  ? -19.912 -14.830 -22.693 1.00 37.56 ? 53   ASP D OD1 1 
ATOM   3134  O  OD2 . ASP D  1 53  ? -18.277 -13.585 -23.478 1.00 36.85 ? 53   ASP D OD2 1 
ATOM   3135  N  N   . LEU D  1 54  ? -18.374 -12.674 -18.015 1.00 36.35 ? 54   LEU D N   1 
ATOM   3136  C  CA  . LEU D  1 54  ? -17.807 -12.791 -16.670 1.00 37.38 ? 54   LEU D CA  1 
ATOM   3137  C  C   . LEU D  1 54  ? -18.835 -12.794 -15.541 1.00 37.72 ? 54   LEU D C   1 
ATOM   3138  O  O   . LEU D  1 54  ? -18.498 -13.142 -14.408 1.00 39.52 ? 54   LEU D O   1 
ATOM   3139  C  CB  . LEU D  1 54  ? -16.790 -11.685 -16.423 1.00 36.45 ? 54   LEU D CB  1 
ATOM   3140  C  CG  . LEU D  1 54  ? -15.351 -12.051 -16.761 1.00 37.83 ? 54   LEU D CG  1 
ATOM   3141  C  CD1 . LEU D  1 54  ? -14.491 -10.799 -16.666 1.00 36.58 ? 54   LEU D CD1 1 
ATOM   3142  C  CD2 . LEU D  1 54  ? -14.834 -13.155 -15.836 1.00 40.56 ? 54   LEU D CD2 1 
ATOM   3143  N  N   . GLY D  1 55  ? -20.079 -12.432 -15.840 1.00 36.11 ? 55   GLY D N   1 
ATOM   3144  C  CA  . GLY D  1 55  ? -21.118 -12.330 -14.813 1.00 36.16 ? 55   GLY D CA  1 
ATOM   3145  C  C   . GLY D  1 55  ? -21.190 -10.921 -14.255 1.00 34.43 ? 55   GLY D C   1 
ATOM   3146  O  O   . GLY D  1 55  ? -21.650 -10.721 -13.129 1.00 35.67 ? 55   GLY D O   1 
ATOM   3147  N  N   . ASN D  1 56  ? -20.692 -9.957  -15.029 1.00 31.90 ? 56   ASN D N   1 
ATOM   3148  C  CA  . ASN D  1 56  ? -20.897 -8.533  -14.757 1.00 29.83 ? 56   ASN D CA  1 
ATOM   3149  C  C   . ASN D  1 56  ? -22.229 -8.047  -15.316 1.00 27.49 ? 56   ASN D C   1 
ATOM   3150  O  O   . ASN D  1 56  ? -22.553 -8.312  -16.483 1.00 26.00 ? 56   ASN D O   1 
ATOM   3151  C  CB  . ASN D  1 56  ? -19.803 -7.693  -15.398 1.00 28.50 ? 56   ASN D CB  1 
ATOM   3152  C  CG  . ASN D  1 56  ? -18.446 -8.028  -14.862 1.00 30.34 ? 56   ASN D CG  1 
ATOM   3153  O  OD1 . ASN D  1 56  ? -18.278 -8.264  -13.648 1.00 31.74 ? 56   ASN D OD1 1 
ATOM   3154  N  ND2 . ASN D  1 56  ? -17.449 -8.051  -15.755 1.00 30.02 ? 56   ASN D ND2 1 
ATOM   3155  N  N   . SER D  1 57  ? -22.959 -7.320  -14.470 1.00 26.40 ? 57   SER D N   1 
ATOM   3156  C  CA  . SER D  1 57  ? -24.243 -6.736  -14.804 1.00 24.76 ? 57   SER D CA  1 
ATOM   3157  C  C   . SER D  1 57  ? -24.142 -5.237  -15.087 1.00 22.13 ? 57   SER D C   1 
ATOM   3158  O  O   . SER D  1 57  ? -23.360 -4.520  -14.471 1.00 21.95 ? 57   SER D O   1 
ATOM   3159  C  CB  . SER D  1 57  ? -25.230 -6.967  -13.658 1.00 26.60 ? 57   SER D CB  1 
ATOM   3160  O  OG  . SER D  1 57  ? -25.857 -8.228  -13.804 1.00 28.45 ? 57   SER D OG  1 
ATOM   3161  N  N   . GLY D  1 58  ? -24.970 -4.784  -16.017 1.00 20.08 ? 58   GLY D N   1 
ATOM   3162  C  CA  . GLY D  1 58  ? -25.114 -3.369  -16.333 1.00 18.22 ? 58   GLY D CA  1 
ATOM   3163  C  C   . GLY D  1 58  ? -26.496 -3.069  -16.896 1.00 17.22 ? 58   GLY D C   1 
ATOM   3164  O  O   . GLY D  1 58  ? -27.449 -3.830  -16.706 1.00 17.89 ? 58   GLY D O   1 
ATOM   3165  N  N   . HIS D  1 59  ? -26.611 -1.959  -17.602 1.00 15.61 ? 59   HIS D N   1 
ATOM   3166  C  CA  . HIS D  1 59  ? -27.897 -1.511  -18.065 1.00 15.06 ? 59   HIS D CA  1 
ATOM   3167  C  C   . HIS D  1 59  ? -27.827 -1.065  -19.523 1.00 13.66 ? 59   HIS D C   1 
ATOM   3168  O  O   . HIS D  1 59  ? -26.772 -0.699  -20.021 1.00 13.07 ? 59   HIS D O   1 
ATOM   3169  C  CB  . HIS D  1 59  ? -28.407 -0.399  -17.147 1.00 15.44 ? 59   HIS D CB  1 
ATOM   3170  C  CG  . HIS D  1 59  ? -28.678 -0.852  -15.745 1.00 17.01 ? 59   HIS D CG  1 
ATOM   3171  N  ND1 . HIS D  1 59  ? -29.902 -1.361  -15.349 1.00 18.16 ? 59   HIS D ND1 1 
ATOM   3172  C  CD2 . HIS D  1 59  ? -27.890 -0.876  -14.641 1.00 17.88 ? 59   HIS D CD2 1 
ATOM   3173  C  CE1 . HIS D  1 59  ? -29.853 -1.683  -14.067 1.00 19.64 ? 59   HIS D CE1 1 
ATOM   3174  N  NE2 . HIS D  1 59  ? -28.642 -1.401  -13.616 1.00 19.52 ? 59   HIS D NE2 1 
ATOM   3175  N  N   . PHE D  1 60  ? -28.947 -1.143  -20.221 1.00 13.31 ? 60   PHE D N   1 
ATOM   3176  C  CA  . PHE D  1 60  ? -29.012 -0.649  -21.574 1.00 12.44 ? 60   PHE D CA  1 
ATOM   3177  C  C   . PHE D  1 60  ? -30.338 0.025   -21.784 1.00 12.46 ? 60   PHE D C   1 
ATOM   3178  O  O   . PHE D  1 60  ? -31.292 -0.218  -21.056 1.00 13.17 ? 60   PHE D O   1 
ATOM   3179  C  CB  . PHE D  1 60  ? -28.812 -1.773  -22.601 1.00 12.58 ? 60   PHE D CB  1 
ATOM   3180  C  CG  . PHE D  1 60  ? -30.024 -2.646  -22.802 1.00 13.26 ? 60   PHE D CG  1 
ATOM   3181  C  CD1 . PHE D  1 60  ? -30.219 -3.764  -22.025 1.00 14.17 ? 60   PHE D CD1 1 
ATOM   3182  C  CD2 . PHE D  1 60  ? -30.963 -2.345  -23.773 1.00 13.24 ? 60   PHE D CD2 1 
ATOM   3183  C  CE1 . PHE D  1 60  ? -31.330 -4.565  -22.191 1.00 15.11 ? 60   PHE D CE1 1 
ATOM   3184  C  CE2 . PHE D  1 60  ? -32.084 -3.140  -23.944 1.00 14.10 ? 60   PHE D CE2 1 
ATOM   3185  C  CZ  . PHE D  1 60  ? -32.263 -4.259  -23.157 1.00 15.00 ? 60   PHE D CZ  1 
ATOM   3186  N  N   . THR D  1 61  ? -30.376 0.911   -22.762 1.00 11.93 ? 61   THR D N   1 
ATOM   3187  C  CA  . THR D  1 61  ? -31.642 1.400   -23.292 1.00 12.19 ? 61   THR D CA  1 
ATOM   3188  C  C   . THR D  1 61  ? -31.565 1.492   -24.802 1.00 12.07 ? 61   THR D C   1 
ATOM   3189  O  O   . THR D  1 61  ? -30.493 1.679   -25.373 1.00 11.74 ? 61   THR D O   1 
ATOM   3190  C  CB  . THR D  1 61  ? -32.040 2.751   -22.679 1.00 12.27 ? 61   THR D CB  1 
ATOM   3191  O  OG1 . THR D  1 61  ? -33.290 3.164   -23.230 1.00 12.74 ? 61   THR D OG1 1 
ATOM   3192  C  CG2 . THR D  1 61  ? -30.961 3.828   -22.913 1.00 11.75 ? 61   THR D CG2 1 
ATOM   3193  N  N   . ILE D  1 62  ? -32.703 1.308   -25.455 1.00 12.71 ? 62   ILE D N   1 
ATOM   3194  C  CA  . ILE D  1 62  ? -32.802 1.614   -26.863 1.00 12.93 ? 62   ILE D CA  1 
ATOM   3195  C  C   . ILE D  1 62  ? -33.037 3.109   -26.918 1.00 13.00 ? 62   ILE D C   1 
ATOM   3196  O  O   . ILE D  1 62  ? -33.634 3.692   -26.009 1.00 13.13 ? 62   ILE D O   1 
ATOM   3197  C  CB  . ILE D  1 62  ? -33.912 0.815   -27.571 1.00 13.79 ? 62   ILE D CB  1 
ATOM   3198  C  CG1 . ILE D  1 62  ? -33.707 0.862   -29.090 1.00 14.31 ? 62   ILE D CG1 1 
ATOM   3199  C  CG2 . ILE D  1 62  ? -35.299 1.344   -27.232 1.00 14.42 ? 62   ILE D CG2 1 
ATOM   3200  C  CD1 . ILE D  1 62  ? -34.625 -0.047  -29.875 1.00 15.39 ? 62   ILE D CD1 1 
ATOM   3201  N  N   . ILE D  1 63  ? -32.544 3.741   -27.965 1.00 13.23 ? 63   ILE D N   1 
ATOM   3202  C  CA  . ILE D  1 63  ? -32.811 5.145   -28.159 1.00 13.74 ? 63   ILE D CA  1 
ATOM   3203  C  C   . ILE D  1 63  ? -33.830 5.283   -29.281 1.00 14.92 ? 63   ILE D C   1 
ATOM   3204  O  O   . ILE D  1 63  ? -33.486 5.216   -30.472 1.00 15.50 ? 63   ILE D O   1 
ATOM   3205  C  CB  . ILE D  1 63  ? -31.504 5.930   -28.410 1.00 13.49 ? 63   ILE D CB  1 
ATOM   3206  C  CG1 . ILE D  1 63  ? -30.613 5.825   -27.160 1.00 12.70 ? 63   ILE D CG1 1 
ATOM   3207  C  CG2 . ILE D  1 63  ? -31.819 7.387   -28.745 1.00 14.18 ? 63   ILE D CG2 1 
ATOM   3208  C  CD1 . ILE D  1 63  ? -29.135 5.732   -27.456 1.00 12.47 ? 63   ILE D CD1 1 
ATOM   3209  N  N   . TYR D  1 64  ? -35.086 5.441   -28.872 1.00 15.68 ? 64   TYR D N   1 
ATOM   3210  C  CA  . TYR D  1 64  ? -36.225 5.457   -29.791 1.00 17.19 ? 64   TYR D CA  1 
ATOM   3211  C  C   . TYR D  1 64  ? -36.158 4.236   -30.717 1.00 17.61 ? 64   TYR D C   1 
ATOM   3212  O  O   . TYR D  1 64  ? -36.355 3.122   -30.266 1.00 17.79 ? 64   TYR D O   1 
ATOM   3213  C  CB  . TYR D  1 64  ? -36.289 6.805   -30.544 1.00 18.21 ? 64   TYR D CB  1 
ATOM   3214  C  CG  . TYR D  1 64  ? -37.565 7.082   -31.357 1.00 19.77 ? 64   TYR D CG  1 
ATOM   3215  C  CD1 . TYR D  1 64  ? -38.815 7.126   -30.748 1.00 20.37 ? 64   TYR D CD1 1 
ATOM   3216  C  CD2 . TYR D  1 64  ? -37.499 7.338   -32.718 1.00 20.90 ? 64   TYR D CD2 1 
ATOM   3217  C  CE1 . TYR D  1 64  ? -39.957 7.394   -31.473 1.00 21.98 ? 64   TYR D CE1 1 
ATOM   3218  C  CE2 . TYR D  1 64  ? -38.633 7.610   -33.453 1.00 22.45 ? 64   TYR D CE2 1 
ATOM   3219  C  CZ  . TYR D  1 64  ? -39.864 7.641   -32.828 1.00 23.05 ? 64   TYR D CZ  1 
ATOM   3220  O  OH  . TYR D  1 64  ? -41.001 7.901   -33.569 1.00 24.82 ? 64   TYR D OH  1 
ATOM   3221  N  N   . ASN D  1 65  ? -35.850 4.435   -31.988 1.00 18.58 ? 65   ASN D N   1 
ATOM   3222  C  CA  . ASN D  1 65  ? -35.732 3.344   -32.958 1.00 19.31 ? 65   ASN D CA  1 
ATOM   3223  C  C   . ASN D  1 65  ? -34.408 3.415   -33.715 1.00 19.35 ? 65   ASN D C   1 
ATOM   3224  O  O   . ASN D  1 65  ? -34.216 2.743   -34.738 1.00 20.44 ? 65   ASN D O   1 
ATOM   3225  C  CB  . ASN D  1 65  ? -36.893 3.423   -33.939 1.00 20.93 ? 65   ASN D CB  1 
ATOM   3226  C  CG  . ASN D  1 65  ? -36.870 4.696   -34.794 1.00 21.98 ? 65   ASN D CG  1 
ATOM   3227  O  OD1 . ASN D  1 65  ? -35.921 5.487   -34.770 1.00 21.29 ? 65   ASN D OD1 1 
ATOM   3228  N  ND2 . ASN D  1 65  ? -37.935 4.894   -35.550 1.00 23.39 ? 65   ASN D ND2 1 
ATOM   3229  N  N   . GLN D  1 66  ? -33.500 4.223   -33.179 1.00 18.55 ? 66   GLN D N   1 
ATOM   3230  C  CA  . GLN D  1 66  ? -32.290 4.666   -33.854 1.00 18.88 ? 66   GLN D CA  1 
ATOM   3231  C  C   . GLN D  1 66  ? -31.060 3.846   -33.522 1.00 18.03 ? 66   GLN D C   1 
ATOM   3232  O  O   . GLN D  1 66  ? -30.229 3.607   -34.377 1.00 19.17 ? 66   GLN D O   1 
ATOM   3233  C  CB  . GLN D  1 66  ? -32.004 6.094   -33.414 1.00 18.79 ? 66   GLN D CB  1 
ATOM   3234  C  CG  . GLN D  1 66  ? -33.072 7.084   -33.813 1.00 20.00 ? 66   GLN D CG  1 
ATOM   3235  C  CD  . GLN D  1 66  ? -32.923 7.493   -35.264 1.00 21.95 ? 66   GLN D CD  1 
ATOM   3236  O  OE1 . GLN D  1 66  ? -31.967 8.183   -35.611 1.00 22.72 ? 66   GLN D OE1 1 
ATOM   3237  N  NE2 . GLN D  1 66  ? -33.850 7.062   -36.117 1.00 23.24 ? 66   GLN D NE2 1 
ATOM   3238  N  N   . GLY D  1 67  ? -30.931 3.458   -32.261 1.00 16.52 ? 67   GLY D N   1 
ATOM   3239  C  CA  . GLY D  1 67  ? -29.728 2.808   -31.749 1.00 15.70 ? 67   GLY D CA  1 
ATOM   3240  C  C   . GLY D  1 67  ? -29.864 2.517   -30.264 1.00 14.30 ? 67   GLY D C   1 
ATOM   3241  O  O   . GLY D  1 67  ? -30.971 2.460   -29.747 1.00 14.05 ? 67   GLY D O   1 
ATOM   3242  N  N   . PHE D  1 68  ? -28.739 2.336   -29.579 1.00 13.61 ? 68   PHE D N   1 
ATOM   3243  C  CA  . PHE D  1 68  ? -28.742 1.898   -28.173 1.00 12.87 ? 68   PHE D CA  1 
ATOM   3244  C  C   . PHE D  1 68  ? -27.547 2.460   -27.410 1.00 12.37 ? 68   PHE D C   1 
ATOM   3245  O  O   . PHE D  1 68  ? -26.491 2.722   -28.003 1.00 12.53 ? 68   PHE D O   1 
ATOM   3246  C  CB  . PHE D  1 68  ? -28.692 0.367   -28.086 1.00 13.11 ? 68   PHE D CB  1 
ATOM   3247  C  CG  . PHE D  1 68  ? -27.461 -0.219  -28.706 1.00 13.57 ? 68   PHE D CG  1 
ATOM   3248  C  CD1 . PHE D  1 68  ? -26.244 -0.189  -28.028 1.00 13.33 ? 68   PHE D CD1 1 
ATOM   3249  C  CD2 . PHE D  1 68  ? -27.501 -0.750  -29.974 1.00 14.56 ? 68   PHE D CD2 1 
ATOM   3250  C  CE1 . PHE D  1 68  ? -25.095 -0.688  -28.616 1.00 14.04 ? 68   PHE D CE1 1 
ATOM   3251  C  CE2 . PHE D  1 68  ? -26.369 -1.260  -30.574 1.00 15.34 ? 68   PHE D CE2 1 
ATOM   3252  C  CZ  . PHE D  1 68  ? -25.164 -1.236  -29.897 1.00 15.08 ? 68   PHE D CZ  1 
ATOM   3253  N  N   . GLU D  1 69  ? -27.718 2.621   -26.092 1.00 11.95 ? 69   GLU D N   1 
ATOM   3254  C  CA  . GLU D  1 69  ? -26.600 2.879   -25.193 1.00 11.69 ? 69   GLU D CA  1 
ATOM   3255  C  C   . GLU D  1 69  ? -26.542 1.778   -24.161 1.00 11.65 ? 69   GLU D C   1 
ATOM   3256  O  O   . GLU D  1 69  ? -27.571 1.396   -23.615 1.00 11.74 ? 69   GLU D O   1 
ATOM   3257  C  CB  . GLU D  1 69  ? -26.694 4.238   -24.503 1.00 11.81 ? 69   GLU D CB  1 
ATOM   3258  C  CG  . GLU D  1 69  ? -25.387 4.589   -23.782 1.00 11.99 ? 69   GLU D CG  1 
ATOM   3259  C  CD  . GLU D  1 69  ? -25.388 5.932   -23.058 1.00 12.37 ? 69   GLU D CD  1 
ATOM   3260  O  OE1 . GLU D  1 69  ? -26.191 6.143   -22.115 1.00 12.79 ? 69   GLU D OE1 1 
ATOM   3261  O  OE2 . GLU D  1 69  ? -24.529 6.765   -23.409 1.00 12.75 ? 69   GLU D OE2 1 
ATOM   3262  N  N   . ILE D  1 70  ? -25.339 1.262   -23.916 1.00 11.67 ? 70   ILE D N   1 
ATOM   3263  C  CA  . ILE D  1 70  ? -25.108 0.242   -22.919 1.00 11.95 ? 70   ILE D CA  1 
ATOM   3264  C  C   . ILE D  1 70  ? -24.109 0.805   -21.919 1.00 12.13 ? 70   ILE D C   1 
ATOM   3265  O  O   . ILE D  1 70  ? -23.132 1.428   -22.317 1.00 12.13 ? 70   ILE D O   1 
ATOM   3266  C  CB  . ILE D  1 70  ? -24.503 -1.031  -23.540 1.00 12.38 ? 70   ILE D CB  1 
ATOM   3267  C  CG1 . ILE D  1 70  ? -25.466 -1.651  -24.555 1.00 12.55 ? 70   ILE D CG1 1 
ATOM   3268  C  CG2 . ILE D  1 70  ? -24.152 -2.049  -22.453 1.00 12.97 ? 70   ILE D CG2 1 
ATOM   3269  C  CD1 . ILE D  1 70  ? -24.798 -2.603  -25.526 1.00 13.22 ? 70   ILE D CD1 1 
ATOM   3270  N  N   . VAL D  1 71  ? -24.355 0.594   -20.628 1.00 12.58 ? 71   VAL D N   1 
ATOM   3271  C  CA  . VAL D  1 71  ? -23.381 0.945   -19.598 1.00 13.14 ? 71   VAL D CA  1 
ATOM   3272  C  C   . VAL D  1 71  ? -23.015 -0.321  -18.848 1.00 14.11 ? 71   VAL D C   1 
ATOM   3273  O  O   . VAL D  1 71  ? -23.858 -0.909  -18.206 1.00 14.65 ? 71   VAL D O   1 
ATOM   3274  C  CB  . VAL D  1 71  ? -23.932 2.000   -18.621 1.00 13.31 ? 71   VAL D CB  1 
ATOM   3275  C  CG1 . VAL D  1 71  ? -22.890 2.319   -17.560 1.00 14.00 ? 71   VAL D CG1 1 
ATOM   3276  C  CG2 . VAL D  1 71  ? -24.339 3.260   -19.380 1.00 12.72 ? 71   VAL D CG2 1 
ATOM   3277  N  N   . LEU D  1 72  ? -21.756 -0.739  -18.930 1.00 14.76 ? 72   LEU D N   1 
ATOM   3278  C  CA  . LEU D  1 72  ? -21.357 -2.053  -18.433 1.00 16.07 ? 72   LEU D CA  1 
ATOM   3279  C  C   . LEU D  1 72  ? -19.847 -2.129  -18.186 1.00 17.16 ? 72   LEU D C   1 
ATOM   3280  O  O   . LEU D  1 72  ? -19.063 -1.867  -19.088 1.00 17.32 ? 72   LEU D O   1 
ATOM   3281  C  CB  . LEU D  1 72  ? -21.795 -3.112  -19.467 1.00 16.01 ? 72   LEU D CB  1 
ATOM   3282  C  CG  . LEU D  1 72  ? -21.309 -4.551  -19.317 1.00 17.26 ? 72   LEU D CG  1 
ATOM   3283  C  CD1 . LEU D  1 72  ? -21.910 -5.186  -18.076 1.00 18.18 ? 72   LEU D CD1 1 
ATOM   3284  C  CD2 . LEU D  1 72  ? -21.631 -5.362  -20.573 1.00 17.41 ? 72   LEU D CD2 1 
ATOM   3285  N  N   . ASN D  1 73  ? -19.439 -2.509  -16.974 1.00 18.71 ? 73   ASN D N   1 
ATOM   3286  C  CA  . ASN D  1 73  ? -18.010 -2.615  -16.636 1.00 19.86 ? 73   ASN D CA  1 
ATOM   3287  C  C   . ASN D  1 73  ? -17.312 -1.257  -16.646 1.00 19.28 ? 73   ASN D C   1 
ATOM   3288  O  O   . ASN D  1 73  ? -16.153 -1.150  -17.050 1.00 19.61 ? 73   ASN D O   1 
ATOM   3289  C  CB  . ASN D  1 73  ? -17.312 -3.541  -17.632 1.00 20.50 ? 73   ASN D CB  1 
ATOM   3290  C  CG  . ASN D  1 73  ? -16.892 -4.832  -17.018 1.00 22.70 ? 73   ASN D CG  1 
ATOM   3291  O  OD1 . ASN D  1 73  ? -17.731 -5.664  -16.610 1.00 24.14 ? 73   ASN D OD1 1 
ATOM   3292  N  ND2 . ASN D  1 73  ? -15.565 -5.028  -16.935 1.00 24.00 ? 73   ASN D ND2 1 
ATOM   3293  N  N   . ASP D  1 74  ? -18.026 -0.220  -16.218 1.00 18.75 ? 74   ASP D N   1 
ATOM   3294  C  CA  . ASP D  1 74  ? -17.523 1.157   -16.268 1.00 18.33 ? 74   ASP D CA  1 
ATOM   3295  C  C   . ASP D  1 74  ? -17.189 1.641   -17.694 1.00 17.20 ? 74   ASP D C   1 
ATOM   3296  O  O   . ASP D  1 74  ? -16.399 2.568   -17.865 1.00 17.25 ? 74   ASP D O   1 
ATOM   3297  C  CB  . ASP D  1 74  ? -16.321 1.322   -15.322 1.00 19.76 ? 74   ASP D CB  1 
ATOM   3298  C  CG  . ASP D  1 74  ? -16.738 1.602   -13.875 1.00 20.99 ? 74   ASP D CG  1 
ATOM   3299  O  OD1 . ASP D  1 74  ? -17.864 2.124   -13.643 1.00 21.30 ? 74   ASP D OD1 1 
ATOM   3300  O  OD2 . ASP D  1 74  ? -15.926 1.332   -12.957 1.00 22.35 ? 74   ASP D OD2 1 
ATOM   3301  N  N   . TYR D  1 75  ? -17.796 1.024   -18.709 1.00 16.26 ? 75   TYR D N   1 
ATOM   3302  C  CA  . TYR D  1 75  ? -17.713 1.541   -20.085 1.00 15.53 ? 75   TYR D CA  1 
ATOM   3303  C  C   . TYR D  1 75  ? -19.103 1.831   -20.602 1.00 14.34 ? 75   TYR D C   1 
ATOM   3304  O  O   . TYR D  1 75  ? -20.051 1.149   -20.231 1.00 13.97 ? 75   TYR D O   1 
ATOM   3305  C  CB  . TYR D  1 75  ? -16.983 0.565   -21.022 1.00 16.13 ? 75   TYR D CB  1 
ATOM   3306  C  CG  . TYR D  1 75  ? -15.481 0.610   -20.882 1.00 17.21 ? 75   TYR D CG  1 
ATOM   3307  C  CD1 . TYR D  1 75  ? -14.718 1.503   -21.625 1.00 17.57 ? 75   TYR D CD1 1 
ATOM   3308  C  CD2 . TYR D  1 75  ? -14.825 -0.213  -19.985 1.00 18.15 ? 75   TYR D CD2 1 
ATOM   3309  C  CE1 . TYR D  1 75  ? -13.337 1.564   -21.484 1.00 18.74 ? 75   TYR D CE1 1 
ATOM   3310  C  CE2 . TYR D  1 75  ? -13.457 -0.164  -19.837 1.00 19.41 ? 75   TYR D CE2 1 
ATOM   3311  C  CZ  . TYR D  1 75  ? -12.718 0.732   -20.593 1.00 19.64 ? 75   TYR D CZ  1 
ATOM   3312  O  OH  . TYR D  1 75  ? -11.362 0.773   -20.463 1.00 21.23 ? 75   TYR D OH  1 
ATOM   3313  N  N   . LYS D  1 76  ? -19.210 2.861   -21.441 1.00 13.84 ? 76   LYS D N   1 
ATOM   3314  C  CA  . LYS D  1 76  ? -20.453 3.204   -22.133 1.00 13.06 ? 76   LYS D CA  1 
ATOM   3315  C  C   . LYS D  1 76  ? -20.290 2.975   -23.622 1.00 13.18 ? 76   LYS D C   1 
ATOM   3316  O  O   . LYS D  1 76  ? -19.358 3.518   -24.246 1.00 13.76 ? 76   LYS D O   1 
ATOM   3317  C  CB  . LYS D  1 76  ? -20.826 4.675   -21.951 1.00 12.88 ? 76   LYS D CB  1 
ATOM   3318  C  CG  . LYS D  1 76  ? -21.008 5.097   -20.528 1.00 13.14 ? 76   LYS D CG  1 
ATOM   3319  C  CD  . LYS D  1 76  ? -21.810 6.387   -20.408 1.00 13.14 ? 76   LYS D CD  1 
ATOM   3320  C  CE  . LYS D  1 76  ? -21.846 6.824   -18.966 1.00 13.73 ? 76   LYS D CE  1 
ATOM   3321  N  NZ  . LYS D  1 76  ? -23.027 7.679   -18.676 1.00 13.98 ? 76   LYS D NZ  1 
ATOM   3322  N  N   . TRP D  1 77  ? -21.221 2.212   -24.186 1.00 12.88 ? 77   TRP D N   1 
ATOM   3323  C  CA  . TRP D  1 77  ? -21.230 1.892   -25.596 1.00 13.26 ? 77   TRP D CA  1 
ATOM   3324  C  C   . TRP D  1 77  ? -22.412 2.579   -26.243 1.00 12.87 ? 77   TRP D C   1 
ATOM   3325  O  O   . TRP D  1 77  ? -23.486 2.626   -25.675 1.00 12.31 ? 77   TRP D O   1 
ATOM   3326  C  CB  . TRP D  1 77  ? -21.421 0.399   -25.818 1.00 13.70 ? 77   TRP D CB  1 
ATOM   3327  C  CG  . TRP D  1 77  ? -20.431 -0.495  -25.149 1.00 14.39 ? 77   TRP D CG  1 
ATOM   3328  C  CD1 . TRP D  1 77  ? -20.398 -0.854  -23.826 1.00 14.32 ? 77   TRP D CD1 1 
ATOM   3329  C  CD2 . TRP D  1 77  ? -19.365 -1.188  -25.781 1.00 15.53 ? 77   TRP D CD2 1 
ATOM   3330  N  NE1 . TRP D  1 77  ? -19.359 -1.712  -23.607 1.00 15.28 ? 77   TRP D NE1 1 
ATOM   3331  C  CE2 . TRP D  1 77  ? -18.716 -1.942  -24.794 1.00 15.99 ? 77   TRP D CE2 1 
ATOM   3332  C  CE3 . TRP D  1 77  ? -18.896 -1.244  -27.099 1.00 16.47 ? 77   TRP D CE3 1 
ATOM   3333  C  CZ2 . TRP D  1 77  ? -17.619 -2.735  -25.071 1.00 17.32 ? 77   TRP D CZ2 1 
ATOM   3334  C  CZ3 . TRP D  1 77  ? -17.813 -2.030  -27.377 1.00 17.76 ? 77   TRP D CZ3 1 
ATOM   3335  C  CH2 . TRP D  1 77  ? -17.178 -2.769  -26.365 1.00 18.17 ? 77   TRP D CH2 1 
ATOM   3336  N  N   . PHE D  1 78  ? -22.218 3.100   -27.443 1.00 13.35 ? 78   PHE D N   1 
ATOM   3337  C  CA  . PHE D  1 78  ? -23.305 3.718   -28.158 1.00 13.33 ? 78   PHE D CA  1 
ATOM   3338  C  C   . PHE D  1 78  ? -23.086 3.586   -29.642 1.00 14.37 ? 78   PHE D C   1 
ATOM   3339  O  O   . PHE D  1 78  ? -22.000 3.883   -30.136 1.00 15.11 ? 78   PHE D O   1 
ATOM   3340  C  CB  . PHE D  1 78  ? -23.439 5.198   -27.826 1.00 13.19 ? 78   PHE D CB  1 
ATOM   3341  C  CG  . PHE D  1 78  ? -24.225 5.951   -28.853 1.00 13.70 ? 78   PHE D CG  1 
ATOM   3342  C  CD1 . PHE D  1 78  ? -25.541 5.613   -29.107 1.00 13.56 ? 78   PHE D CD1 1 
ATOM   3343  C  CD2 . PHE D  1 78  ? -23.643 6.961   -29.596 1.00 14.65 ? 78   PHE D CD2 1 
ATOM   3344  C  CE1 . PHE D  1 78  ? -26.277 6.276   -30.075 1.00 14.29 ? 78   PHE D CE1 1 
ATOM   3345  C  CE2 . PHE D  1 78  ? -24.366 7.636   -30.566 1.00 15.46 ? 78   PHE D CE2 1 
ATOM   3346  C  CZ  . PHE D  1 78  ? -25.684 7.289   -30.816 1.00 15.28 ? 78   PHE D CZ  1 
ATOM   3347  N  N   . ALA D  1 79  ? -24.130 3.168   -30.349 1.00 14.65 ? 79   ALA D N   1 
ATOM   3348  C  CA  . ALA D  1 79  ? -24.082 3.152   -31.804 1.00 16.12 ? 79   ALA D CA  1 
ATOM   3349  C  C   . ALA D  1 79  ? -25.476 3.270   -32.395 1.00 16.43 ? 79   ALA D C   1 
ATOM   3350  O  O   . ALA D  1 79  ? -26.451 2.899   -31.768 1.00 15.66 ? 79   ALA D O   1 
ATOM   3351  C  CB  . ALA D  1 79  ? -23.396 1.886   -32.294 1.00 16.93 ? 79   ALA D CB  1 
ATOM   3352  N  N   . PHE D  1 80  ? -25.554 3.809   -33.599 1.00 17.94 ? 80   PHE D N   1 
ATOM   3353  C  CA  . PHE D  1 80  ? -26.798 3.799   -34.361 1.00 18.78 ? 80   PHE D CA  1 
ATOM   3354  C  C   . PHE D  1 80  ? -26.922 2.456   -35.048 1.00 19.83 ? 80   PHE D C   1 
ATOM   3355  O  O   . PHE D  1 80  ? -25.915 1.872   -35.415 1.00 20.59 ? 80   PHE D O   1 
ATOM   3356  C  CB  . PHE D  1 80  ? -26.775 4.893   -35.414 1.00 20.20 ? 80   PHE D CB  1 
ATOM   3357  C  CG  . PHE D  1 80  ? -26.838 6.276   -34.848 1.00 19.78 ? 80   PHE D CG  1 
ATOM   3358  C  CD1 . PHE D  1 80  ? -28.017 6.757   -34.303 1.00 19.18 ? 80   PHE D CD1 1 
ATOM   3359  C  CD2 . PHE D  1 80  ? -25.735 7.102   -34.879 1.00 20.38 ? 80   PHE D CD2 1 
ATOM   3360  C  CE1 . PHE D  1 80  ? -28.087 8.038   -33.781 1.00 19.09 ? 80   PHE D CE1 1 
ATOM   3361  C  CE2 . PHE D  1 80  ? -25.796 8.383   -34.363 1.00 20.22 ? 80   PHE D CE2 1 
ATOM   3362  C  CZ  . PHE D  1 80  ? -26.974 8.850   -33.810 1.00 19.58 ? 80   PHE D CZ  1 
ATOM   3363  N  N   . PHE D  1 81  ? -28.142 1.968   -35.244 1.00 20.29 ? 81   PHE D N   1 
ATOM   3364  C  CA  . PHE D  1 81  ? -28.333 0.783   -36.102 1.00 21.83 ? 81   PHE D CA  1 
ATOM   3365  C  C   . PHE D  1 81  ? -27.914 1.102   -37.529 1.00 24.12 ? 81   PHE D C   1 
ATOM   3366  O  O   . PHE D  1 81  ? -28.078 2.226   -37.994 1.00 24.77 ? 81   PHE D O   1 
ATOM   3367  C  CB  . PHE D  1 81  ? -29.784 0.293   -36.105 1.00 21.87 ? 81   PHE D CB  1 
ATOM   3368  C  CG  . PHE D  1 81  ? -30.288 -0.085  -34.756 1.00 20.35 ? 81   PHE D CG  1 
ATOM   3369  C  CD1 . PHE D  1 81  ? -29.769 -1.180  -34.096 1.00 20.05 ? 81   PHE D CD1 1 
ATOM   3370  C  CD2 . PHE D  1 81  ? -31.268 0.666   -34.135 1.00 19.71 ? 81   PHE D CD2 1 
ATOM   3371  C  CE1 . PHE D  1 81  ? -30.223 -1.523  -32.832 1.00 19.07 ? 81   PHE D CE1 1 
ATOM   3372  C  CE2 . PHE D  1 81  ? -31.734 0.330   -32.885 1.00 18.69 ? 81   PHE D CE2 1 
ATOM   3373  C  CZ  . PHE D  1 81  ? -31.217 -0.768  -32.230 1.00 18.36 ? 81   PHE D CZ  1 
ATOM   3374  N  N   . LYS D  1 82  ? -27.401 0.079   -38.208 1.00 26.08 ? 82   LYS D N   1 
ATOM   3375  C  CA  . LYS D  1 82  ? -26.847 0.189   -39.552 1.00 29.01 ? 82   LYS D CA  1 
ATOM   3376  C  C   . LYS D  1 82  ? -27.899 0.464   -40.631 1.00 31.03 ? 82   LYS D C   1 
ATOM   3377  O  O   . LYS D  1 82  ? -29.000 -0.078  -40.591 1.00 31.03 ? 82   LYS D O   1 
ATOM   3378  C  CB  . LYS D  1 82  ? -26.096 -1.099  -39.897 1.00 30.60 ? 82   LYS D CB  1 
ATOM   3379  C  CG  . LYS D  1 82  ? -25.239 -1.033  -41.158 1.00 33.79 ? 82   LYS D CG  1 
ATOM   3380  C  CD  . LYS D  1 82  ? -24.542 -2.369  -41.383 1.00 35.46 ? 82   LYS D CD  1 
ATOM   3381  C  CE  . LYS D  1 82  ? -23.094 -2.242  -41.841 1.00 37.23 ? 82   LYS D CE  1 
ATOM   3382  N  NZ  . LYS D  1 82  ? -23.023 -1.919  -43.274 1.00 40.44 ? 82   LYS D NZ  1 
ATOM   3383  N  N   . TYR D  1 83  ? -27.529 1.305   -41.594 1.00 33.42 ? 83   TYR D N   1 
ATOM   3384  C  CA  . TYR D  1 83  ? -28.323 1.553   -42.792 1.00 36.12 ? 83   TYR D CA  1 
ATOM   3385  C  C   . TYR D  1 83  ? -27.391 1.949   -43.940 1.00 39.28 ? 83   TYR D C   1 
ATOM   3386  O  O   . TYR D  1 83  ? -26.242 2.340   -43.700 1.00 39.17 ? 83   TYR D O   1 
ATOM   3387  C  CB  . TYR D  1 83  ? -29.354 2.660   -42.550 1.00 35.41 ? 83   TYR D CB  1 
ATOM   3388  C  CG  . TYR D  1 83  ? -28.724 3.972   -42.148 1.00 34.84 ? 83   TYR D CG  1 
ATOM   3389  C  CD1 . TYR D  1 83  ? -28.326 4.183   -40.839 1.00 32.32 ? 83   TYR D CD1 1 
ATOM   3390  C  CD2 . TYR D  1 83  ? -28.511 4.996   -43.077 1.00 37.17 ? 83   TYR D CD2 1 
ATOM   3391  C  CE1 . TYR D  1 83  ? -27.737 5.366   -40.450 1.00 32.19 ? 83   TYR D CE1 1 
ATOM   3392  C  CE2 . TYR D  1 83  ? -27.914 6.195   -42.696 1.00 36.85 ? 83   TYR D CE2 1 
ATOM   3393  C  CZ  . TYR D  1 83  ? -27.529 6.365   -41.379 1.00 34.50 ? 83   TYR D CZ  1 
ATOM   3394  O  OH  . TYR D  1 83  ? -26.945 7.532   -40.942 1.00 34.99 ? 83   TYR D OH  1 
ATOM   3395  N  N   . LYS D  1 84  ? -27.902 1.834   -45.167 1.00 42.58 ? 84   LYS D N   1 
ATOM   3396  C  CA  . LYS D  1 84  ? -27.182 2.202   -46.391 1.00 46.35 ? 84   LYS D CA  1 
ATOM   3397  C  C   . LYS D  1 84  ? -28.099 2.948   -47.357 1.00 48.38 ? 84   LYS D C   1 
ATOM   3398  O  O   . LYS D  1 84  ? -29.243 2.544   -47.560 1.00 48.45 ? 84   LYS D O   1 
ATOM   3399  C  CB  . LYS D  1 84  ? -26.644 0.951   -47.092 1.00 49.12 ? 84   LYS D CB  1 
ATOM   3400  C  CG  . LYS D  1 84  ? -25.504 0.265   -46.346 1.00 48.42 ? 84   LYS D CG  1 
ATOM   3401  C  CD  . LYS D  1 84  ? -24.895 -0.865  -47.177 1.00 51.90 ? 84   LYS D CD  1 
ATOM   3402  C  CE  . LYS D  1 84  ? -23.659 -1.447  -46.492 1.00 51.35 ? 84   LYS D CE  1 
ATOM   3403  N  NZ  . LYS D  1 84  ? -23.212 -2.724  -47.130 1.00 54.31 ? 84   LYS D NZ  1 
ATOM   3404  N  N   . LYS D  1 89  ? -32.609 4.477   -52.712 1.00 65.13 ? 89   LYS D N   1 
ATOM   3405  C  CA  . LYS D  1 89  ? -33.155 3.362   -51.944 1.00 62.70 ? 89   LYS D CA  1 
ATOM   3406  C  C   . LYS D  1 89  ? -32.407 3.182   -50.618 1.00 58.51 ? 89   LYS D C   1 
ATOM   3407  O  O   . LYS D  1 89  ? -31.175 3.169   -50.589 1.00 58.50 ? 89   LYS D O   1 
ATOM   3408  C  CB  . LYS D  1 89  ? -33.067 2.085   -52.777 1.00 65.61 ? 89   LYS D CB  1 
ATOM   3409  C  CG  . LYS D  1 89  ? -33.416 0.792   -52.040 1.00 63.77 ? 89   LYS D CG  1 
ATOM   3410  C  CD  . LYS D  1 89  ? -33.091 -0.406  -52.919 1.00 66.93 ? 89   LYS D CD  1 
ATOM   3411  C  CE  . LYS D  1 89  ? -33.157 -1.726  -52.168 1.00 65.13 ? 89   LYS D CE  1 
ATOM   3412  N  NZ  . LYS D  1 89  ? -33.029 -2.861  -53.136 1.00 68.78 ? 89   LYS D NZ  1 
ATOM   3413  N  N   . VAL D  1 90  ? -33.148 3.030   -49.524 1.00 54.98 ? 90   VAL D N   1 
ATOM   3414  C  CA  . VAL D  1 90  ? -32.533 2.816   -48.210 1.00 51.15 ? 90   VAL D CA  1 
ATOM   3415  C  C   . VAL D  1 90  ? -32.801 1.407   -47.703 1.00 49.44 ? 90   VAL D C   1 
ATOM   3416  O  O   . VAL D  1 90  ? -33.909 0.904   -47.847 1.00 49.94 ? 90   VAL D O   1 
ATOM   3417  C  CB  . VAL D  1 90  ? -33.065 3.807   -47.147 1.00 48.61 ? 90   VAL D CB  1 
ATOM   3418  C  CG1 . VAL D  1 90  ? -32.123 3.849   -45.951 1.00 45.38 ? 90   VAL D CG1 1 
ATOM   3419  C  CG2 . VAL D  1 90  ? -33.246 5.201   -47.743 1.00 50.56 ? 90   VAL D CG2 1 
ATOM   3420  N  N   . THR D  1 91  ? -31.789 0.788   -47.096 1.00 47.64 ? 91   THR D N   1 
ATOM   3421  C  CA  . THR D  1 91  ? -31.939 -0.523  -46.467 1.00 46.08 ? 91   THR D CA  1 
ATOM   3422  C  C   . THR D  1 91  ? -31.454 -0.472  -45.012 1.00 42.65 ? 91   THR D C   1 
ATOM   3423  O  O   . THR D  1 91  ? -30.429 0.139   -44.714 1.00 41.51 ? 91   THR D O   1 
ATOM   3424  C  CB  . THR D  1 91  ? -31.161 -1.607  -47.241 1.00 48.39 ? 91   THR D CB  1 
ATOM   3425  O  OG1 . THR D  1 91  ? -31.572 -1.620  -48.623 1.00 52.05 ? 91   THR D OG1 1 
ATOM   3426  C  CG2 . THR D  1 91  ? -31.408 -2.982  -46.635 1.00 47.36 ? 91   THR D CG2 1 
ATOM   3427  N  N   . THR D  1 92  ? -32.194 -1.129  -44.121 1.00 40.83 ? 92   THR D N   1 
ATOM   3428  C  CA  . THR D  1 92  ? -31.913 -1.104  -42.698 1.00 38.00 ? 92   THR D CA  1 
ATOM   3429  C  C   . THR D  1 92  ? -31.544 -2.498  -42.194 1.00 37.70 ? 92   THR D C   1 
ATOM   3430  O  O   . THR D  1 92  ? -32.227 -3.469  -42.479 1.00 38.50 ? 92   THR D O   1 
ATOM   3431  C  CB  . THR D  1 92  ? -33.120 -0.562  -41.909 1.00 36.55 ? 92   THR D CB  1 
ATOM   3432  O  OG1 . THR D  1 92  ? -33.260 0.836   -42.173 1.00 36.89 ? 92   THR D OG1 1 
ATOM   3433  C  CG2 . THR D  1 92  ? -32.926 -0.737  -40.402 1.00 34.11 ? 92   THR D CG2 1 
ATOM   3434  N  N   . TYR D  1 93  ? -30.463 -2.574  -41.424 1.00 36.29 ? 93   TYR D N   1 
ATOM   3435  C  CA  . TYR D  1 93  ? -30.001 -3.828  -40.859 1.00 36.05 ? 93   TYR D CA  1 
ATOM   3436  C  C   . TYR D  1 93  ? -30.039 -3.709  -39.344 1.00 33.64 ? 93   TYR D C   1 
ATOM   3437  O  O   . TYR D  1 93  ? -29.092 -3.241  -38.707 1.00 32.72 ? 93   TYR D O   1 
ATOM   3438  C  CB  . TYR D  1 93  ? -28.591 -4.156  -41.354 1.00 37.22 ? 93   TYR D CB  1 
ATOM   3439  C  CG  . TYR D  1 93  ? -28.475 -4.200  -42.857 1.00 40.32 ? 93   TYR D CG  1 
ATOM   3440  C  CD1 . TYR D  1 93  ? -29.027 -5.250  -43.589 1.00 42.82 ? 93   TYR D CD1 1 
ATOM   3441  C  CD2 . TYR D  1 93  ? -27.819 -3.193  -43.551 1.00 41.49 ? 93   TYR D CD2 1 
ATOM   3442  C  CE1 . TYR D  1 93  ? -28.918 -5.296  -44.972 1.00 45.94 ? 93   TYR D CE1 1 
ATOM   3443  C  CE2 . TYR D  1 93  ? -27.708 -3.223  -44.930 1.00 44.86 ? 93   TYR D CE2 1 
ATOM   3444  C  CZ  . TYR D  1 93  ? -28.257 -4.273  -45.636 1.00 47.13 ? 93   TYR D CZ  1 
ATOM   3445  O  OH  . TYR D  1 93  ? -28.152 -4.293  -47.009 1.00 51.22 ? 93   TYR D OH  1 
ATOM   3446  N  N   . CYS D  1 94  ? -31.153 -4.123  -38.763 1.00 33.33 ? 94   CYS D N   1 
ATOM   3447  C  CA  . CYS D  1 94  ? -31.329 -4.054  -37.321 1.00 31.40 ? 94   CYS D CA  1 
ATOM   3448  C  C   . CYS D  1 94  ? -30.452 -5.059  -36.542 1.00 30.16 ? 94   CYS D C   1 
ATOM   3449  O  O   . CYS D  1 94  ? -30.346 -4.964  -35.324 1.00 28.71 ? 94   CYS D O   1 
ATOM   3450  C  CB  . CYS D  1 94  ? -32.814 -4.210  -36.988 1.00 32.03 ? 94   CYS D CB  1 
ATOM   3451  S  SG  . CYS D  1 94  ? -33.836 -2.888  -37.724 1.00 34.08 ? 94   CYS D SG  1 
ATOM   3452  N  N   . ASN D  1 95  ? -29.820 -5.999  -37.251 1.00 30.98 ? 95   ASN D N   1 
ATOM   3453  C  CA  . ASN D  1 95  ? -28.860 -6.939  -36.663 1.00 30.39 ? 95   ASN D CA  1 
ATOM   3454  C  C   . ASN D  1 95  ? -27.401 -6.431  -36.679 1.00 29.47 ? 95   ASN D C   1 
ATOM   3455  O  O   . ASN D  1 95  ? -26.481 -7.177  -36.363 1.00 29.47 ? 95   ASN D O   1 
ATOM   3456  C  CB  . ASN D  1 95  ? -28.934 -8.282  -37.415 1.00 32.83 ? 95   ASN D CB  1 
ATOM   3457  C  CG  . ASN D  1 95  ? -28.608 -8.139  -38.890 1.00 35.14 ? 95   ASN D CG  1 
ATOM   3458  O  OD1 . ASN D  1 95  ? -28.744 -7.054  -39.440 1.00 35.31 ? 95   ASN D OD1 1 
ATOM   3459  N  ND2 . ASN D  1 95  ? -28.188 -9.223  -39.538 1.00 37.68 ? 95   ASN D ND2 1 
ATOM   3460  N  N   . GLU D  1 96  ? -27.187 -5.179  -37.071 1.00 28.70 ? 96   GLU D N   1 
ATOM   3461  C  CA  . GLU D  1 96  ? -25.836 -4.623  -37.186 1.00 28.41 ? 96   GLU D CA  1 
ATOM   3462  C  C   . GLU D  1 96  ? -25.845 -3.158  -36.796 1.00 26.34 ? 96   GLU D C   1 
ATOM   3463  O  O   . GLU D  1 96  ? -26.899 -2.541  -36.742 1.00 25.60 ? 96   GLU D O   1 
ATOM   3464  C  CB  . GLU D  1 96  ? -25.312 -4.756  -38.624 1.00 31.29 ? 96   GLU D CB  1 
ATOM   3465  C  CG  . GLU D  1 96  ? -25.166 -6.191  -39.148 1.00 33.48 ? 96   GLU D CG  1 
ATOM   3466  C  CD  . GLU D  1 96  ? -24.442 -6.273  -40.489 1.00 36.46 ? 96   GLU D CD  1 
ATOM   3467  O  OE1 . GLU D  1 96  ? -23.471 -5.513  -40.707 1.00 36.90 ? 96   GLU D OE1 1 
ATOM   3468  O  OE2 . GLU D  1 96  ? -24.831 -7.107  -41.335 1.00 38.82 ? 96   GLU D OE2 1 
ATOM   3469  N  N   . THR D  1 97  ? -24.666 -2.603  -36.538 1.00 25.46 ? 97   THR D N   1 
ATOM   3470  C  CA  . THR D  1 97  ? -24.539 -1.185  -36.179 1.00 24.11 ? 97   THR D CA  1 
ATOM   3471  C  C   . THR D  1 97  ? -23.620 -0.454  -37.134 1.00 25.71 ? 97   THR D C   1 
ATOM   3472  O  O   . THR D  1 97  ? -22.736 -1.052  -37.736 1.00 27.17 ? 97   THR D O   1 
ATOM   3473  C  CB  . THR D  1 97  ? -23.972 -0.982  -34.752 1.00 22.00 ? 97   THR D CB  1 
ATOM   3474  O  OG1 . THR D  1 97  ? -22.576 -1.290  -34.719 1.00 22.42 ? 97   THR D OG1 1 
ATOM   3475  C  CG2 . THR D  1 97  ? -24.706 -1.855  -33.749 1.00 20.83 ? 97   THR D CG2 1 
ATOM   3476  N  N   . MET D  1 98  ? -23.837 0.849   -37.265 1.00 25.54 ? 98   MET D N   1 
ATOM   3477  C  CA  . MET D  1 98  ? -22.840 1.725   -37.863 1.00 27.07 ? 98   MET D CA  1 
ATOM   3478  C  C   . MET D  1 98  ? -21.647 1.677   -36.924 1.00 26.49 ? 98   MET D C   1 
ATOM   3479  O  O   . MET D  1 98  ? -21.745 1.123   -35.824 1.00 24.99 ? 98   MET D O   1 
ATOM   3480  C  CB  . MET D  1 98  ? -23.348 3.174   -37.965 1.00 26.83 ? 98   MET D CB  1 
ATOM   3481  C  CG  . MET D  1 98  ? -24.624 3.342   -38.774 1.00 27.57 ? 98   MET D CG  1 
ATOM   3482  S  SD  . MET D  1 98  ? -24.446 2.806   -40.489 1.00 30.56 ? 98   MET D SD  1 
ATOM   3483  C  CE  . MET D  1 98  ? -23.854 4.321   -41.252 1.00 32.43 ? 98   MET D CE  1 
ATOM   3484  N  N   . THR D  1 99  ? -20.532 2.257   -37.334 1.00 28.09 ? 99   THR D N   1 
ATOM   3485  C  CA  . THR D  1 99  ? -19.397 2.360   -36.443 1.00 27.94 ? 99   THR D CA  1 
ATOM   3486  C  C   . THR D  1 99  ? -19.814 3.165   -35.228 1.00 25.78 ? 99   THR D C   1 
ATOM   3487  O  O   . THR D  1 99  ? -20.464 4.201   -35.361 1.00 25.87 ? 99   THR D O   1 
ATOM   3488  C  CB  . THR D  1 99  ? -18.199 3.029   -37.106 1.00 30.38 ? 99   THR D CB  1 
ATOM   3489  O  OG1 . THR D  1 99  ? -17.881 2.330   -38.316 1.00 32.69 ? 99   THR D OG1 1 
ATOM   3490  C  CG2 . THR D  1 99  ? -17.003 2.998   -36.149 1.00 30.59 ? 99   THR D CG2 1 
ATOM   3491  N  N   . GLY D  1 100 ? -19.475 2.665   -34.046 1.00 24.10 ? 100  GLY D N   1 
ATOM   3492  C  CA  . GLY D  1 100 ? -19.953 3.247   -32.799 1.00 22.02 ? 100  GLY D CA  1 
ATOM   3493  C  C   . GLY D  1 100 ? -18.811 3.745   -31.942 1.00 21.67 ? 100  GLY D C   1 
ATOM   3494  O  O   . GLY D  1 100 ? -17.652 3.645   -32.326 1.00 23.02 ? 100  GLY D O   1 
ATOM   3495  N  N   . TRP D  1 101 ? -19.161 4.267   -30.769 1.00 20.12 ? 101  TRP D N   1 
ATOM   3496  C  CA  . TRP D  1 101 ? -18.195 4.825   -29.824 1.00 19.77 ? 101  TRP D CA  1 
ATOM   3497  C  C   . TRP D  1 101 ? -18.290 4.112   -28.493 1.00 18.18 ? 101  TRP D C   1 
ATOM   3498  O  O   . TRP D  1 101 ? -19.385 3.975   -27.932 1.00 16.87 ? 101  TRP D O   1 
ATOM   3499  C  CB  . TRP D  1 101 ? -18.507 6.293   -29.574 1.00 19.82 ? 101  TRP D CB  1 
ATOM   3500  C  CG  . TRP D  1 101 ? -18.391 7.179   -30.774 1.00 21.44 ? 101  TRP D CG  1 
ATOM   3501  C  CD1 . TRP D  1 101 ? -17.309 7.903   -31.141 1.00 23.23 ? 101  TRP D CD1 1 
ATOM   3502  C  CD2 . TRP D  1 101 ? -19.410 7.463   -31.733 1.00 21.88 ? 101  TRP D CD2 1 
ATOM   3503  N  NE1 . TRP D  1 101 ? -17.580 8.619   -32.271 1.00 24.83 ? 101  TRP D NE1 1 
ATOM   3504  C  CE2 . TRP D  1 101 ? -18.866 8.365   -32.662 1.00 23.82 ? 101  TRP D CE2 1 
ATOM   3505  C  CE3 . TRP D  1 101 ? -20.732 7.050   -31.893 1.00 21.03 ? 101  TRP D CE3 1 
ATOM   3506  C  CZ2 . TRP D  1 101 ? -19.592 8.861   -33.739 1.00 24.70 ? 101  TRP D CZ2 1 
ATOM   3507  C  CZ3 . TRP D  1 101 ? -21.453 7.536   -32.979 1.00 22.01 ? 101  TRP D CZ3 1 
ATOM   3508  C  CH2 . TRP D  1 101 ? -20.881 8.432   -33.879 1.00 23.81 ? 101  TRP D CH2 1 
ATOM   3509  N  N   . VAL D  1 102 ? -17.146 3.696   -27.968 1.00 18.23 ? 102  VAL D N   1 
ATOM   3510  C  CA  . VAL D  1 102 ? -17.086 3.161   -26.612 1.00 17.27 ? 102  VAL D CA  1 
ATOM   3511  C  C   . VAL D  1 102 ? -16.031 3.911   -25.812 1.00 17.64 ? 102  VAL D C   1 
ATOM   3512  O  O   . VAL D  1 102 ? -14.917 4.139   -26.286 1.00 18.87 ? 102  VAL D O   1 
ATOM   3513  C  CB  . VAL D  1 102 ? -16.814 1.636   -26.577 1.00 17.62 ? 102  VAL D CB  1 
ATOM   3514  C  CG1 . VAL D  1 102 ? -15.506 1.270   -27.274 1.00 19.26 ? 102  VAL D CG1 1 
ATOM   3515  C  CG2 . VAL D  1 102 ? -16.811 1.114   -25.144 1.00 17.10 ? 102  VAL D CG2 1 
ATOM   3516  N  N   . HIS D  1 103 ? -16.393 4.292   -24.592 1.00 16.83 ? 103  HIS D N   1 
ATOM   3517  C  CA  . HIS D  1 103 ? -15.452 4.909   -23.689 1.00 17.43 ? 103  HIS D CA  1 
ATOM   3518  C  C   . HIS D  1 103 ? -15.790 4.607   -22.242 1.00 16.74 ? 103  HIS D C   1 
ATOM   3519  O  O   . HIS D  1 103 ? -16.920 4.257   -21.931 1.00 15.78 ? 103  HIS D O   1 
ATOM   3520  C  CB  . HIS D  1 103 ? -15.409 6.422   -23.936 1.00 17.76 ? 103  HIS D CB  1 
ATOM   3521  C  CG  . HIS D  1 103 ? -16.710 7.109   -23.701 1.00 16.92 ? 103  HIS D CG  1 
ATOM   3522  N  ND1 . HIS D  1 103 ? -17.219 7.320   -22.439 1.00 16.54 ? 103  HIS D ND1 1 
ATOM   3523  C  CD2 . HIS D  1 103 ? -17.604 7.646   -24.561 1.00 16.89 ? 103  HIS D CD2 1 
ATOM   3524  C  CE1 . HIS D  1 103 ? -18.372 7.955   -22.531 1.00 16.20 ? 103  HIS D CE1 1 
ATOM   3525  N  NE2 . HIS D  1 103 ? -18.632 8.161   -23.808 1.00 16.22 ? 103  HIS D NE2 1 
ATOM   3526  N  N   . ASP D  1 104 ? -14.807 4.749   -21.356 1.00 17.47 ? 104  ASP D N   1 
ATOM   3527  C  CA  . ASP D  1 104 ? -15.045 4.560   -19.934 1.00 17.38 ? 104  ASP D CA  1 
ATOM   3528  C  C   . ASP D  1 104 ? -15.996 5.627   -19.411 1.00 16.92 ? 104  ASP D C   1 
ATOM   3529  O  O   . ASP D  1 104 ? -16.177 6.664   -20.060 1.00 16.76 ? 104  ASP D O   1 
ATOM   3530  C  CB  . ASP D  1 104 ? -13.743 4.513   -19.138 1.00 18.67 ? 104  ASP D CB  1 
ATOM   3531  C  CG  . ASP D  1 104 ? -12.903 5.768   -19.272 1.00 19.60 ? 104  ASP D CG  1 
ATOM   3532  O  OD1 . ASP D  1 104 ? -13.362 6.854   -18.858 1.00 19.28 ? 104  ASP D OD1 1 
ATOM   3533  O  OD2 . ASP D  1 104 ? -11.747 5.645   -19.743 1.00 20.75 ? 104  ASP D OD2 1 
ATOM   3534  N  N   . VAL D  1 105 ? -16.629 5.364   -18.264 1.00 16.80 ? 105  VAL D N   1 
ATOM   3535  C  CA  . VAL D  1 105 ? -17.604 6.308   -17.704 1.00 16.72 ? 105  VAL D CA  1 
ATOM   3536  C  C   . VAL D  1 105 ? -17.023 7.702   -17.421 1.00 17.76 ? 105  VAL D C   1 
ATOM   3537  O  O   . VAL D  1 105 ? -17.772 8.666   -17.295 1.00 17.96 ? 105  VAL D O   1 
ATOM   3538  C  CB  . VAL D  1 105 ? -18.296 5.786   -16.416 1.00 16.95 ? 105  VAL D CB  1 
ATOM   3539  C  CG1 . VAL D  1 105 ? -19.206 4.612   -16.747 1.00 16.25 ? 105  VAL D CG1 1 
ATOM   3540  C  CG2 . VAL D  1 105 ? -17.291 5.414   -15.331 1.00 18.13 ? 105  VAL D CG2 1 
ATOM   3541  N  N   . LEU D  1 106 ? -15.705 7.809   -17.293 1.00 18.68 ? 106  LEU D N   1 
ATOM   3542  C  CA  . LEU D  1 106 ? -15.084 9.112   -17.097 1.00 19.83 ? 106  LEU D CA  1 
ATOM   3543  C  C   . LEU D  1 106 ? -14.856 9.848   -18.417 1.00 19.90 ? 106  LEU D C   1 
ATOM   3544  O  O   . LEU D  1 106 ? -14.671 11.056  -18.417 1.00 20.75 ? 106  LEU D O   1 
ATOM   3545  C  CB  . LEU D  1 106 ? -13.766 8.973   -16.354 1.00 21.08 ? 106  LEU D CB  1 
ATOM   3546  C  CG  . LEU D  1 106 ? -13.883 8.259   -15.015 1.00 21.54 ? 106  LEU D CG  1 
ATOM   3547  C  CD1 . LEU D  1 106 ? -12.501 7.807   -14.558 1.00 22.89 ? 106  LEU D CD1 1 
ATOM   3548  C  CD2 . LEU D  1 106 ? -14.533 9.180   -13.997 1.00 22.24 ? 106  LEU D CD2 1 
ATOM   3549  N  N   . GLY D  1 107 ? -14.882 9.115   -19.526 1.00 19.34 ? 107  GLY D N   1 
ATOM   3550  C  CA  . GLY D  1 107 ? -14.659 9.684   -20.846 1.00 19.75 ? 107  GLY D CA  1 
ATOM   3551  C  C   . GLY D  1 107 ? -13.189 9.864   -21.143 1.00 21.20 ? 107  GLY D C   1 
ATOM   3552  O  O   . GLY D  1 107 ? -12.826 10.730  -21.912 1.00 22.00 ? 107  GLY D O   1 
ATOM   3553  N  N   . ARG D  1 108 ? -12.345 9.050   -20.523 1.00 21.83 ? 108  ARG D N   1 
ATOM   3554  C  CA  . ARG D  1 108 ? -10.902 9.173   -20.667 1.00 23.70 ? 108  ARG D CA  1 
ATOM   3555  C  C   . ARG D  1 108 ? -10.376 8.398   -21.874 1.00 24.59 ? 108  ARG D C   1 
ATOM   3556  O  O   . ARG D  1 108 ? -9.812  8.991   -22.788 1.00 25.63 ? 108  ARG D O   1 
ATOM   3557  C  CB  . ARG D  1 108 ? -10.195 8.675   -19.404 1.00 24.36 ? 108  ARG D CB  1 
ATOM   3558  C  CG  . ARG D  1 108 ? -10.583 9.408   -18.141 1.00 24.32 ? 108  ARG D CG  1 
ATOM   3559  C  CD  . ARG D  1 108 ? -9.803  10.688  -17.945 1.00 25.80 ? 108  ARG D CD  1 
ATOM   3560  N  NE  . ARG D  1 108 ? -10.086 11.153  -16.597 1.00 26.18 ? 108  ARG D NE  1 
ATOM   3561  C  CZ  . ARG D  1 108 ? -11.043 12.010  -16.274 1.00 25.81 ? 108  ARG D CZ  1 
ATOM   3562  N  NH1 . ARG D  1 108 ? -11.794 12.579  -17.202 1.00 25.05 ? 108  ARG D NH1 1 
ATOM   3563  N  NH2 . ARG D  1 108 ? -11.226 12.316  -15.008 1.00 26.58 ? 108  ARG D NH2 1 
ATOM   3564  N  N   . ASN D  1 109 ? -10.557 7.077   -21.846 1.00 24.77 ? 109  ASN D N   1 
ATOM   3565  C  CA  . ASN D  1 109 ? -10.107 6.179   -22.900 1.00 26.09 ? 109  ASN D CA  1 
ATOM   3566  C  C   . ASN D  1 109 ? -11.262 5.839   -23.837 1.00 25.19 ? 109  ASN D C   1 
ATOM   3567  O  O   . ASN D  1 109 ? -12.351 5.478   -23.394 1.00 23.09 ? 109  ASN D O   1 
ATOM   3568  C  CB  . ASN D  1 109 ? -9.542  4.896   -22.305 1.00 27.64 ? 109  ASN D CB  1 
ATOM   3569  C  CG  . ASN D  1 109 ? -8.281  5.126   -21.499 1.00 29.19 ? 109  ASN D CG  1 
ATOM   3570  O  OD1 . ASN D  1 109 ? -7.488  6.011   -21.816 1.00 30.85 ? 109  ASN D OD1 1 
ATOM   3571  N  ND2 . ASN D  1 109 ? -8.072  4.310   -20.461 1.00 29.62 ? 109  ASN D ND2 1 
ATOM   3572  N  N   . TRP D  1 110 ? -11.009 5.982   -25.135 1.00 26.11 ? 110  TRP D N   1 
ATOM   3573  C  CA  . TRP D  1 110 ? -12.040 5.923   -26.164 1.00 25.22 ? 110  TRP D CA  1 
ATOM   3574  C  C   . TRP D  1 110 ? -11.646 4.933   -27.243 1.00 26.88 ? 110  TRP D C   1 
ATOM   3575  O  O   . TRP D  1 110 ? -10.464 4.654   -27.441 1.00 28.88 ? 110  TRP D O   1 
ATOM   3576  C  CB  . TRP D  1 110 ? -12.204 7.287   -26.822 1.00 25.33 ? 110  TRP D CB  1 
ATOM   3577  C  CG  . TRP D  1 110 ? -13.024 8.281   -26.063 1.00 23.89 ? 110  TRP D CG  1 
ATOM   3578  C  CD1 . TRP D  1 110 ? -12.692 8.915   -24.896 1.00 23.62 ? 110  TRP D CD1 1 
ATOM   3579  C  CD2 . TRP D  1 110 ? -14.303 8.794   -26.448 1.00 22.63 ? 110  TRP D CD2 1 
ATOM   3580  N  NE1 . TRP D  1 110 ? -13.708 9.773   -24.522 1.00 22.58 ? 110  TRP D NE1 1 
ATOM   3581  C  CE2 . TRP D  1 110 ? -14.699 9.720   -25.461 1.00 22.06 ? 110  TRP D CE2 1 
ATOM   3582  C  CE3 . TRP D  1 110 ? -15.160 8.548   -27.529 1.00 22.28 ? 110  TRP D CE3 1 
ATOM   3583  C  CZ2 . TRP D  1 110 ? -15.898 10.404  -25.526 1.00 21.21 ? 110  TRP D CZ2 1 
ATOM   3584  C  CZ3 . TRP D  1 110 ? -16.347 9.230   -27.598 1.00 21.39 ? 110  TRP D CZ3 1 
ATOM   3585  C  CH2 . TRP D  1 110 ? -16.712 10.147  -26.595 1.00 20.93 ? 110  TRP D CH2 1 
ATOM   3586  N  N   . ALA D  1 111 ? -12.654 4.412   -27.935 1.00 26.39 ? 111  ALA D N   1 
ATOM   3587  C  CA  . ALA D  1 111 ? -12.448 3.546   -29.081 1.00 27.82 ? 111  ALA D CA  1 
ATOM   3588  C  C   . ALA D  1 111 ? -13.682 3.548   -29.956 1.00 27.38 ? 111  ALA D C   1 
ATOM   3589  O  O   . ALA D  1 111 ? -14.764 3.947   -29.529 1.00 25.49 ? 111  ALA D O   1 
ATOM   3590  C  CB  . ALA D  1 111 ? -12.137 2.133   -28.626 1.00 28.14 ? 111  ALA D CB  1 
ATOM   3591  N  N   . CYS D  1 112 ? -13.504 3.092   -31.187 1.00 29.33 ? 112  CYS D N   1 
ATOM   3592  C  CA  . CYS D  1 112 ? -14.613 2.830   -32.079 1.00 29.14 ? 112  CYS D CA  1 
ATOM   3593  C  C   . CYS D  1 112 ? -14.950 1.357   -31.995 1.00 28.39 ? 112  CYS D C   1 
ATOM   3594  O  O   . CYS D  1 112 ? -14.094 0.541   -31.638 1.00 29.00 ? 112  CYS D O   1 
ATOM   3595  C  CB  . CYS D  1 112 ? -14.225 3.164   -33.512 1.00 32.78 ? 112  CYS D CB  1 
ATOM   3596  S  SG  . CYS D  1 112 ? -13.483 4.790   -33.690 1.00 35.52 ? 112  CYS D SG  1 
ATOM   3597  N  N   . PHE D  1 113 ? -16.186 1.013   -32.342 1.00 26.61 ? 113  PHE D N   1 
ATOM   3598  C  CA  . PHE D  1 113 ? -16.566 -0.385  -32.493 1.00 26.40 ? 113  PHE D CA  1 
ATOM   3599  C  C   . PHE D  1 113 ? -17.655 -0.560  -33.545 1.00 26.21 ? 113  PHE D C   1 
ATOM   3600  O  O   . PHE D  1 113 ? -18.262 0.412   -33.979 1.00 26.01 ? 113  PHE D O   1 
ATOM   3601  C  CB  . PHE D  1 113 ? -17.026 -0.970  -31.151 1.00 24.40 ? 113  PHE D CB  1 
ATOM   3602  C  CG  . PHE D  1 113 ? -18.400 -0.548  -30.741 1.00 22.21 ? 113  PHE D CG  1 
ATOM   3603  C  CD1 . PHE D  1 113 ? -18.615 0.703   -30.175 1.00 20.89 ? 113  PHE D CD1 1 
ATOM   3604  C  CD2 . PHE D  1 113 ? -19.477 -1.400  -30.909 1.00 21.78 ? 113  PHE D CD2 1 
ATOM   3605  C  CE1 . PHE D  1 113 ? -19.892 1.094   -29.791 1.00 19.57 ? 113  PHE D CE1 1 
ATOM   3606  C  CE2 . PHE D  1 113 ? -20.755 -1.021  -30.515 1.00 20.37 ? 113  PHE D CE2 1 
ATOM   3607  C  CZ  . PHE D  1 113 ? -20.967 0.224   -29.951 1.00 19.24 ? 113  PHE D CZ  1 
ATOM   3608  N  N   . THR D  1 114 ? -17.861 -1.802  -33.976 1.00 26.64 ? 114  THR D N   1 
ATOM   3609  C  CA  . THR D  1 114 ? -19.047 -2.183  -34.747 1.00 26.67 ? 114  THR D CA  1 
ATOM   3610  C  C   . THR D  1 114 ? -19.668 -3.417  -34.100 1.00 25.77 ? 114  THR D C   1 
ATOM   3611  O  O   . THR D  1 114 ? -18.965 -4.266  -33.543 1.00 25.85 ? 114  THR D O   1 
ATOM   3612  C  CB  . THR D  1 114 ? -18.738 -2.498  -36.232 1.00 29.34 ? 114  THR D CB  1 
ATOM   3613  O  OG1 . THR D  1 114 ? -17.624 -3.389  -36.318 1.00 30.87 ? 114  THR D OG1 1 
ATOM   3614  C  CG2 . THR D  1 114 ? -18.424 -1.247  -37.001 1.00 30.44 ? 114  THR D CG2 1 
ATOM   3615  N  N   . GLY D  1 115 ? -20.987 -3.513  -34.188 1.00 24.96 ? 115  GLY D N   1 
ATOM   3616  C  CA  . GLY D  1 115 ? -21.708 -4.603  -33.578 1.00 24.53 ? 115  GLY D CA  1 
ATOM   3617  C  C   . GLY D  1 115 ? -22.493 -5.437  -34.553 1.00 25.90 ? 115  GLY D C   1 
ATOM   3618  O  O   . GLY D  1 115 ? -23.025 -4.925  -35.527 1.00 26.40 ? 115  GLY D O   1 
ATOM   3619  N  N   . LYS D  1 116 ? -22.548 -6.734  -34.268 1.00 26.92 ? 116  LYS D N   1 
ATOM   3620  C  CA  . LYS D  1 116 ? -23.379 -7.681  -35.004 1.00 28.54 ? 116  LYS D CA  1 
ATOM   3621  C  C   . LYS D  1 116 ? -24.108 -8.563  -34.013 1.00 27.91 ? 116  LYS D C   1 
ATOM   3622  O  O   . LYS D  1 116 ? -23.498 -9.129  -33.102 1.00 27.62 ? 116  LYS D O   1 
ATOM   3623  C  CB  . LYS D  1 116 ? -22.541 -8.576  -35.912 1.00 31.21 ? 116  LYS D CB  1 
ATOM   3624  C  CG  . LYS D  1 116 ? -21.956 -7.865  -37.115 1.00 32.86 ? 116  LYS D CG  1 
ATOM   3625  C  CD  . LYS D  1 116 ? -20.942 -8.750  -37.831 1.00 35.74 ? 116  LYS D CD  1 
ATOM   3626  C  CE  . LYS D  1 116 ? -20.227 -7.980  -38.923 1.00 37.55 ? 116  LYS D CE  1 
ATOM   3627  N  NZ  . LYS D  1 116 ? -19.103 -8.783  -39.479 1.00 40.58 ? 116  LYS D NZ  1 
ATOM   3628  N  N   . LYS D  1 117 ? -25.412 -8.688  -34.204 1.00 27.82 ? 117  LYS D N   1 
ATOM   3629  C  CA  . LYS D  1 117 ? -26.200 -9.593  -33.404 1.00 27.84 ? 117  LYS D CA  1 
ATOM   3630  C  C   . LYS D  1 117 ? -25.962 -11.004 -33.866 1.00 30.24 ? 117  LYS D C   1 
ATOM   3631  O  O   . LYS D  1 117 ? -25.909 -11.253 -35.055 1.00 32.06 ? 117  LYS D O   1 
ATOM   3632  C  CB  . LYS D  1 117 ? -27.668 -9.278  -33.558 1.00 27.45 ? 117  LYS D CB  1 
ATOM   3633  C  CG  . LYS D  1 117 ? -28.473 -9.767  -32.381 1.00 26.86 ? 117  LYS D CG  1 
ATOM   3634  C  CD  . LYS D  1 117 ? -29.938 -9.643  -32.692 1.00 26.93 ? 117  LYS D CD  1 
ATOM   3635  C  CE  . LYS D  1 117 ? -30.752 -9.853  -31.450 1.00 26.04 ? 117  LYS D CE  1 
ATOM   3636  N  NZ  . LYS D  1 117 ? -32.178 -9.597  -31.778 1.00 26.35 ? 117  LYS D NZ  1 
ATOM   3637  N  N   . VAL D  1 118 ? -25.830 -11.931 -32.931 1.00 30.99 ? 118  VAL D N   1 
ATOM   3638  C  CA  . VAL D  1 118 ? -25.570 -13.320 -33.281 1.00 33.67 ? 118  VAL D CA  1 
ATOM   3639  C  C   . VAL D  1 118 ? -26.646 -14.223 -32.709 1.00 34.45 ? 118  VAL D C   1 
ATOM   3640  O  O   . VAL D  1 118 ? -26.341 -15.316 -32.229 1.00 36.34 ? 118  VAL D O   1 
ATOM   3641  C  CB  . VAL D  1 118 ? -24.162 -13.770 -32.814 1.00 34.55 ? 118  VAL D CB  1 
ATOM   3642  C  CG1 . VAL D  1 118 ? -23.079 -13.074 -33.646 1.00 35.01 ? 118  VAL D CG1 1 
ATOM   3643  C  CG2 . VAL D  1 118 ? -23.952 -13.510 -31.323 1.00 32.65 ? 118  VAL D CG2 1 
ATOM   3644  N  N   . HIS E  2 1   ? -45.453 15.996  -0.933  1.00 45.83 ? 206  HIS E N   1 
ATOM   3645  C  CA  . HIS E  2 1   ? -46.284 15.540  -2.081  1.00 43.45 ? 206  HIS E CA  1 
ATOM   3646  C  C   . HIS E  2 1   ? -46.407 16.659  -3.110  1.00 41.03 ? 206  HIS E C   1 
ATOM   3647  O  O   . HIS E  2 1   ? -46.345 17.836  -2.755  1.00 41.25 ? 206  HIS E O   1 
ATOM   3648  C  CB  . HIS E  2 1   ? -47.665 15.050  -1.609  1.00 45.60 ? 206  HIS E CB  1 
ATOM   3649  C  CG  . HIS E  2 1   ? -48.482 16.078  -0.875  1.00 48.26 ? 206  HIS E CG  1 
ATOM   3650  N  ND1 . HIS E  2 1   ? -48.905 17.260  -1.453  1.00 48.53 ? 206  HIS E ND1 1 
ATOM   3651  C  CD2 . HIS E  2 1   ? -49.003 16.070  0.378   1.00 51.03 ? 206  HIS E CD2 1 
ATOM   3652  C  CE1 . HIS E  2 1   ? -49.622 17.947  -0.579  1.00 50.66 ? 206  HIS E CE1 1 
ATOM   3653  N  NE2 . HIS E  2 1   ? -49.698 17.246  0.539   1.00 52.09 ? 206  HIS E NE2 1 
ATOM   3654  N  N   . LEU E  2 2   ? -46.599 16.294  -4.377  1.00 37.22 ? 207  LEU E N   1 
ATOM   3655  C  CA  . LEU E  2 2   ? -46.550 17.274  -5.464  1.00 35.11 ? 207  LEU E CA  1 
ATOM   3656  C  C   . LEU E  2 2   ? -47.687 18.277  -5.392  1.00 35.30 ? 207  LEU E C   1 
ATOM   3657  O  O   . LEU E  2 2   ? -48.814 17.914  -5.075  1.00 36.63 ? 207  LEU E O   1 
ATOM   3658  C  CB  . LEU E  2 2   ? -46.568 16.582  -6.826  1.00 33.38 ? 207  LEU E CB  1 
ATOM   3659  C  CG  . LEU E  2 2   ? -45.232 16.128  -7.413  1.00 31.67 ? 207  LEU E CG  1 
ATOM   3660  C  CD1 . LEU E  2 2   ? -44.201 15.820  -6.344  1.00 32.05 ? 207  LEU E CD1 1 
ATOM   3661  C  CD2 . LEU E  2 2   ? -45.443 14.901  -8.292  1.00 30.55 ? 207  LEU E CD2 1 
ATOM   3662  N  N   . PRO E  2 3   ? -47.396 19.550  -5.691  1.00 34.12 ? 208  PRO E N   1 
ATOM   3663  C  CA  . PRO E  2 3   ? -48.464 20.542  -5.668  1.00 34.62 ? 208  PRO E CA  1 
ATOM   3664  C  C   . PRO E  2 3   ? -49.451 20.348  -6.808  1.00 34.16 ? 208  PRO E C   1 
ATOM   3665  O  O   . PRO E  2 3   ? -49.151 19.688  -7.804  1.00 32.45 ? 208  PRO E O   1 
ATOM   3666  C  CB  . PRO E  2 3   ? -47.721 21.869  -5.826  1.00 34.20 ? 208  PRO E CB  1 
ATOM   3667  C  CG  . PRO E  2 3   ? -46.454 21.520  -6.515  1.00 32.60 ? 208  PRO E CG  1 
ATOM   3668  C  CD  . PRO E  2 3   ? -46.096 20.135  -6.069  1.00 32.77 ? 208  PRO E CD  1 
ATOM   3669  N  N   . THR E  2 4   ? -50.623 20.937  -6.640  1.00 35.17 ? 209  THR E N   1 
ATOM   3670  C  CA  . THR E  2 4   ? -51.705 20.841  -7.610  1.00 35.18 ? 209  THR E CA  1 
ATOM   3671  C  C   . THR E  2 4   ? -51.336 21.361  -8.999  1.00 33.46 ? 209  THR E C   1 
ATOM   3672  O  O   . THR E  2 4   ? -51.769 20.804  -10.011 1.00 32.61 ? 209  THR E O   1 
ATOM   3673  C  CB  . THR E  2 4   ? -52.954 21.556  -7.054  1.00 37.37 ? 209  THR E CB  1 
ATOM   3674  O  OG1 . THR E  2 4   ? -53.715 20.595  -6.313  1.00 40.00 ? 209  THR E OG1 1 
ATOM   3675  C  CG2 . THR E  2 4   ? -53.834 22.177  -8.164  1.00 37.56 ? 209  THR E CG2 1 
ATOM   3676  N  N   . SER E  2 5   ? -50.553 22.435  -9.044  1.00 32.43 ? 210  SER E N   1 
ATOM   3677  C  CA  . SER E  2 5   ? -50.052 22.959  -10.309 1.00 31.07 ? 210  SER E CA  1 
ATOM   3678  C  C   . SER E  2 5   ? -48.617 23.462  -10.148 1.00 29.61 ? 210  SER E C   1 
ATOM   3679  O  O   . SER E  2 5   ? -48.135 23.643  -9.036  1.00 30.14 ? 210  SER E O   1 
ATOM   3680  C  CB  . SER E  2 5   ? -50.961 24.087  -10.804 1.00 32.22 ? 210  SER E CB  1 
ATOM   3681  O  OG  . SER E  2 5   ? -50.654 25.310  -10.153 1.00 32.95 ? 210  SER E OG  1 
ATOM   3682  N  N   . TRP E  2 6   ? -47.933 23.679  -11.260 1.00 28.04 ? 211  TRP E N   1 
ATOM   3683  C  CA  . TRP E  2 6   ? -46.554 24.149  -11.213 1.00 27.06 ? 211  TRP E CA  1 
ATOM   3684  C  C   . TRP E  2 6   ? -46.188 24.780  -12.545 1.00 26.36 ? 211  TRP E C   1 
ATOM   3685  O  O   . TRP E  2 6   ? -46.629 24.310  -13.595 1.00 25.67 ? 211  TRP E O   1 
ATOM   3686  C  CB  . TRP E  2 6   ? -45.620 22.978  -10.913 1.00 26.23 ? 211  TRP E CB  1 
ATOM   3687  C  CG  . TRP E  2 6   ? -44.226 23.389  -10.637 1.00 25.55 ? 211  TRP E CG  1 
ATOM   3688  C  CD1 . TRP E  2 6   ? -43.232 23.538  -11.545 1.00 24.60 ? 211  TRP E CD1 1 
ATOM   3689  C  CD2 . TRP E  2 6   ? -43.663 23.717  -9.361  1.00 26.09 ? 211  TRP E CD2 1 
ATOM   3690  N  NE1 . TRP E  2 6   ? -42.083 23.936  -10.922 1.00 24.47 ? 211  TRP E NE1 1 
ATOM   3691  C  CE2 . TRP E  2 6   ? -42.320 24.060  -9.580  1.00 25.36 ? 211  TRP E CE2 1 
ATOM   3692  C  CE3 . TRP E  2 6   ? -44.169 23.757  -8.056  1.00 27.24 ? 211  TRP E CE3 1 
ATOM   3693  C  CZ2 . TRP E  2 6   ? -41.472 24.434  -8.550  1.00 25.85 ? 211  TRP E CZ2 1 
ATOM   3694  C  CZ3 . TRP E  2 6   ? -43.328 24.114  -7.033  1.00 27.62 ? 211  TRP E CZ3 1 
ATOM   3695  C  CH2 . TRP E  2 6   ? -41.990 24.448  -7.281  1.00 27.10 ? 211  TRP E CH2 1 
ATOM   3696  N  N   . ASP E  2 7   ? -45.384 25.840  -12.499 1.00 26.22 ? 212  ASP E N   1 
ATOM   3697  C  CA  . ASP E  2 7   ? -44.960 26.548  -13.711 1.00 25.78 ? 212  ASP E CA  1 
ATOM   3698  C  C   . ASP E  2 7   ? -43.591 27.183  -13.472 1.00 25.51 ? 212  ASP E C   1 
ATOM   3699  O  O   . ASP E  2 7   ? -43.479 28.141  -12.705 1.00 26.44 ? 212  ASP E O   1 
ATOM   3700  C  CB  . ASP E  2 7   ? -45.992 27.623  -14.078 1.00 26.89 ? 212  ASP E CB  1 
ATOM   3701  C  CG  . ASP E  2 7   ? -45.789 28.193  -15.477 1.00 26.96 ? 212  ASP E CG  1 
ATOM   3702  O  OD1 . ASP E  2 7   ? -44.649 28.178  -15.985 1.00 26.21 ? 212  ASP E OD1 1 
ATOM   3703  O  OD2 . ASP E  2 7   ? -46.785 28.672  -16.076 1.00 27.99 ? 212  ASP E OD2 1 
ATOM   3704  N  N   . TRP E  2 8   ? -42.554 26.651  -14.118 1.00 24.14 ? 213  TRP E N   1 
ATOM   3705  C  CA  . TRP E  2 8   ? -41.187 27.141  -13.894 1.00 24.05 ? 213  TRP E CA  1 
ATOM   3706  C  C   . TRP E  2 8   ? -40.964 28.585  -14.346 1.00 25.40 ? 213  TRP E C   1 
ATOM   3707  O  O   . TRP E  2 8   ? -39.927 29.164  -14.036 1.00 25.20 ? 213  TRP E O   1 
ATOM   3708  C  CB  . TRP E  2 8   ? -40.131 26.215  -14.524 1.00 22.69 ? 213  TRP E CB  1 
ATOM   3709  C  CG  . TRP E  2 8   ? -39.777 25.020  -13.647 1.00 21.87 ? 213  TRP E CG  1 
ATOM   3710  C  CD1 . TRP E  2 8   ? -40.091 23.716  -13.876 1.00 20.98 ? 213  TRP E CD1 1 
ATOM   3711  C  CD2 . TRP E  2 8   ? -39.049 25.046  -12.416 1.00 21.87 ? 213  TRP E CD2 1 
ATOM   3712  N  NE1 . TRP E  2 8   ? -39.601 22.933  -12.874 1.00 20.78 ? 213  TRP E NE1 1 
ATOM   3713  C  CE2 . TRP E  2 8   ? -38.957 23.723  -11.961 1.00 21.25 ? 213  TRP E CE2 1 
ATOM   3714  C  CE3 . TRP E  2 8   ? -38.471 26.058  -11.656 1.00 22.52 ? 213  TRP E CE3 1 
ATOM   3715  C  CZ2 . TRP E  2 8   ? -38.319 23.381  -10.773 1.00 21.46 ? 213  TRP E CZ2 1 
ATOM   3716  C  CZ3 . TRP E  2 8   ? -37.832 25.716  -10.467 1.00 22.67 ? 213  TRP E CZ3 1 
ATOM   3717  C  CH2 . TRP E  2 8   ? -37.764 24.392  -10.040 1.00 22.15 ? 213  TRP E CH2 1 
ATOM   3718  N  N   . ARG E  2 9   ? -41.931 29.156  -15.072 1.00 26.65 ? 214  ARG E N   1 
ATOM   3719  C  CA  . ARG E  2 9   ? -41.924 30.581  -15.407 1.00 28.02 ? 214  ARG E CA  1 
ATOM   3720  C  C   . ARG E  2 9   ? -42.382 31.447  -14.253 1.00 29.73 ? 214  ARG E C   1 
ATOM   3721  O  O   . ARG E  2 9   ? -42.272 32.659  -14.323 1.00 31.07 ? 214  ARG E O   1 
ATOM   3722  C  CB  . ARG E  2 9   ? -42.834 30.864  -16.601 1.00 28.51 ? 214  ARG E CB  1 
ATOM   3723  C  CG  . ARG E  2 9   ? -42.434 30.129  -17.865 1.00 27.73 ? 214  ARG E CG  1 
ATOM   3724  C  CD  . ARG E  2 9   ? -43.490 30.287  -18.936 1.00 28.37 ? 214  ARG E CD  1 
ATOM   3725  N  NE  . ARG E  2 9   ? -44.775 29.709  -18.556 1.00 28.48 ? 214  ARG E NE  1 
ATOM   3726  C  CZ  . ARG E  2 9   ? -45.896 29.882  -19.251 1.00 29.44 ? 214  ARG E CZ  1 
ATOM   3727  N  NH1 . ARG E  2 9   ? -45.893 30.608  -20.362 1.00 30.05 ? 214  ARG E NH1 1 
ATOM   3728  N  NH2 . ARG E  2 9   ? -47.030 29.329  -18.839 1.00 29.80 ? 214  ARG E NH2 1 
ATOM   3729  N  N   . ASN E  2 10  ? -42.909 30.835  -13.201 1.00 30.36 ? 215  ASN E N   1 
ATOM   3730  C  CA  . ASN E  2 10  ? -43.463 31.580  -12.087 1.00 33.01 ? 215  ASN E CA  1 
ATOM   3731  C  C   . ASN E  2 10  ? -43.494 30.740  -10.821 1.00 33.52 ? 215  ASN E C   1 
ATOM   3732  O  O   . ASN E  2 10  ? -44.518 30.196  -10.436 1.00 34.37 ? 215  ASN E O   1 
ATOM   3733  C  CB  . ASN E  2 10  ? -44.866 32.094  -12.430 1.00 34.16 ? 215  ASN E CB  1 
ATOM   3734  C  CG  . ASN E  2 10  ? -45.446 32.971  -11.335 1.00 36.51 ? 215  ASN E CG  1 
ATOM   3735  O  OD1 . ASN E  2 10  ? -44.708 33.535  -10.509 1.00 37.40 ? 215  ASN E OD1 1 
ATOM   3736  N  ND2 . ASN E  2 10  ? -46.771 33.095  -11.316 1.00 37.39 ? 215  ASN E ND2 1 
ATOM   3737  N  N   . VAL E  2 11  ? -42.338 30.632  -10.194 1.00 34.91 ? 216  VAL E N   1 
ATOM   3738  C  CA  . VAL E  2 11  ? -42.200 30.009  -8.889  1.00 36.39 ? 216  VAL E CA  1 
ATOM   3739  C  C   . VAL E  2 11  ? -41.996 31.170  -7.916  1.00 39.08 ? 216  VAL E C   1 
ATOM   3740  O  O   . VAL E  2 11  ? -40.948 31.802  -7.920  1.00 39.57 ? 216  VAL E O   1 
ATOM   3741  C  CB  . VAL E  2 11  ? -41.004 29.027  -8.869  1.00 34.77 ? 216  VAL E CB  1 
ATOM   3742  C  CG1 . VAL E  2 11  ? -40.889 28.332  -7.521  1.00 35.18 ? 216  VAL E CG1 1 
ATOM   3743  C  CG2 . VAL E  2 11  ? -41.156 28.003  -9.988  1.00 33.75 ? 216  VAL E CG2 1 
ATOM   3744  N  N   . HIS E  2 12  ? -43.021 31.463  -7.122  1.00 42.46 ? 217  HIS E N   1 
ATOM   3745  C  CA  . HIS E  2 12  ? -43.036 32.632  -6.239  1.00 45.94 ? 217  HIS E CA  1 
ATOM   3746  C  C   . HIS E  2 12  ? -42.670 33.937  -6.967  1.00 44.23 ? 217  HIS E C   1 
ATOM   3747  O  O   . HIS E  2 12  ? -41.933 34.764  -6.433  1.00 45.23 ? 217  HIS E O   1 
ATOM   3748  C  CB  . HIS E  2 12  ? -42.108 32.404  -5.036  1.00 49.03 ? 217  HIS E CB  1 
ATOM   3749  C  CG  . HIS E  2 12  ? -42.564 31.306  -4.123  1.00 53.94 ? 217  HIS E CG  1 
ATOM   3750  N  ND1 . HIS E  2 12  ? -43.552 31.489  -3.175  1.00 57.33 ? 217  HIS E ND1 1 
ATOM   3751  C  CD2 . HIS E  2 12  ? -42.170 30.014  -4.012  1.00 56.54 ? 217  HIS E CD2 1 
ATOM   3752  C  CE1 . HIS E  2 12  ? -43.744 30.359  -2.519  1.00 59.92 ? 217  HIS E CE1 1 
ATOM   3753  N  NE2 . HIS E  2 12  ? -42.920 29.447  -3.008  1.00 59.84 ? 217  HIS E NE2 1 
ATOM   3754  N  N   . GLY E  2 13  ? -43.188 34.116  -8.182  1.00 42.13 ? 218  GLY E N   1 
ATOM   3755  C  CA  . GLY E  2 13  ? -42.913 35.323  -8.975  1.00 41.23 ? 218  GLY E CA  1 
ATOM   3756  C  C   . GLY E  2 13  ? -41.601 35.344  -9.747  1.00 39.15 ? 218  GLY E C   1 
ATOM   3757  O  O   . GLY E  2 13  ? -41.259 36.363  -10.338 1.00 39.50 ? 218  GLY E O   1 
ATOM   3758  N  N   . ILE E  2 14  ? -40.861 34.233  -9.754  1.00 36.97 ? 219  ILE E N   1 
ATOM   3759  C  CA  . ILE E  2 14  ? -39.557 34.177  -10.424 1.00 34.90 ? 219  ILE E CA  1 
ATOM   3760  C  C   . ILE E  2 14  ? -39.609 33.261  -11.650 1.00 32.67 ? 219  ILE E C   1 
ATOM   3761  O  O   . ILE E  2 14  ? -40.260 32.217  -11.636 1.00 32.11 ? 219  ILE E O   1 
ATOM   3762  C  CB  . ILE E  2 14  ? -38.441 33.697  -9.463  1.00 34.48 ? 219  ILE E CB  1 
ATOM   3763  C  CG1 . ILE E  2 14  ? -38.446 34.518  -8.161  1.00 36.18 ? 219  ILE E CG1 1 
ATOM   3764  C  CG2 . ILE E  2 14  ? -37.072 33.761  -10.133 1.00 33.53 ? 219  ILE E CG2 1 
ATOM   3765  C  CD1 . ILE E  2 14  ? -38.249 36.007  -8.350  1.00 37.48 ? 219  ILE E CD1 1 
ATOM   3766  N  N   . ASN E  2 15  ? -38.904 33.668  -12.701 1.00 31.41 ? 220  ASN E N   1 
ATOM   3767  C  CA  . ASN E  2 15  ? -38.816 32.918  -13.942 1.00 29.44 ? 220  ASN E CA  1 
ATOM   3768  C  C   . ASN E  2 15  ? -37.480 32.200  -14.018 1.00 27.92 ? 220  ASN E C   1 
ATOM   3769  O  O   . ASN E  2 15  ? -36.437 32.779  -13.701 1.00 28.01 ? 220  ASN E O   1 
ATOM   3770  C  CB  . ASN E  2 15  ? -38.950 33.864  -15.137 1.00 29.93 ? 220  ASN E CB  1 
ATOM   3771  C  CG  . ASN E  2 15  ? -38.786 33.148  -16.461 1.00 29.00 ? 220  ASN E CG  1 
ATOM   3772  O  OD1 . ASN E  2 15  ? -39.498 32.194  -16.749 1.00 28.06 ? 220  ASN E OD1 1 
ATOM   3773  N  ND2 . ASN E  2 15  ? -37.831 33.590  -17.262 1.00 29.22 ? 220  ASN E ND2 1 
ATOM   3774  N  N   . PHE E  2 16  ? -37.514 30.935  -14.438 1.00 26.30 ? 221  PHE E N   1 
ATOM   3775  C  CA  . PHE E  2 16  ? -36.301 30.119  -14.544 1.00 25.07 ? 221  PHE E CA  1 
ATOM   3776  C  C   . PHE E  2 16  ? -36.071 29.553  -15.945 1.00 24.35 ? 221  PHE E C   1 
ATOM   3777  O  O   . PHE E  2 16  ? -35.114 28.803  -16.154 1.00 23.16 ? 221  PHE E O   1 
ATOM   3778  C  CB  . PHE E  2 16  ? -36.355 28.979  -13.530 1.00 24.35 ? 221  PHE E CB  1 
ATOM   3779  C  CG  . PHE E  2 16  ? -36.195 29.422  -12.096 1.00 25.02 ? 221  PHE E CG  1 
ATOM   3780  C  CD1 . PHE E  2 16  ? -34.944 29.702  -11.583 1.00 25.23 ? 221  PHE E CD1 1 
ATOM   3781  C  CD2 . PHE E  2 16  ? -37.289 29.524  -11.256 1.00 25.61 ? 221  PHE E CD2 1 
ATOM   3782  C  CE1 . PHE E  2 16  ? -34.778 30.077  -10.261 1.00 25.98 ? 221  PHE E CE1 1 
ATOM   3783  C  CE2 . PHE E  2 16  ? -37.134 29.901  -9.931  1.00 26.58 ? 221  PHE E CE2 1 
ATOM   3784  C  CZ  . PHE E  2 16  ? -35.873 30.178  -9.433  1.00 26.69 ? 221  PHE E CZ  1 
ATOM   3785  N  N   . VAL E  2 17  ? -36.930 29.932  -16.898 1.00 24.98 ? 222  VAL E N   1 
ATOM   3786  C  CA  . VAL E  2 17  ? -36.904 29.396  -18.254 1.00 24.71 ? 222  VAL E CA  1 
ATOM   3787  C  C   . VAL E  2 17  ? -36.357 30.445  -19.202 1.00 25.75 ? 222  VAL E C   1 
ATOM   3788  O  O   . VAL E  2 17  ? -36.711 31.608  -19.104 1.00 26.89 ? 222  VAL E O   1 
ATOM   3789  C  CB  . VAL E  2 17  ? -38.323 29.022  -18.734 1.00 24.80 ? 222  VAL E CB  1 
ATOM   3790  C  CG1 . VAL E  2 17  ? -38.253 28.262  -20.048 1.00 24.23 ? 222  VAL E CG1 1 
ATOM   3791  C  CG2 . VAL E  2 17  ? -39.057 28.228  -17.659 1.00 24.38 ? 222  VAL E CG2 1 
ATOM   3792  N  N   . SER E  2 18  ? -35.526 30.021  -20.143 1.00 25.72 ? 223  SER E N   1 
ATOM   3793  C  CA  . SER E  2 18  ? -34.943 30.936  -21.112 1.00 27.14 ? 223  SER E CA  1 
ATOM   3794  C  C   . SER E  2 18  ? -35.976 31.428  -22.135 1.00 28.07 ? 223  SER E C   1 
ATOM   3795  O  O   . SER E  2 18  ? -37.070 30.868  -22.241 1.00 27.71 ? 223  SER E O   1 
ATOM   3796  C  CB  . SER E  2 18  ? -33.762 30.266  -21.816 1.00 26.94 ? 223  SER E CB  1 
ATOM   3797  O  OG  . SER E  2 18  ? -34.113 28.974  -22.262 1.00 26.19 ? 223  SER E OG  1 
ATOM   3798  N  N   . PRO E  2 19  ? -35.646 32.507  -22.873 1.00 29.61 ? 224  PRO E N   1 
ATOM   3799  C  CA  . PRO E  2 19  ? -36.585 33.018  -23.883 1.00 30.45 ? 224  PRO E CA  1 
ATOM   3800  C  C   . PRO E  2 19  ? -36.956 31.986  -24.942 1.00 30.17 ? 224  PRO E C   1 
ATOM   3801  O  O   . PRO E  2 19  ? -36.155 31.092  -25.256 1.00 29.81 ? 224  PRO E O   1 
ATOM   3802  C  CB  . PRO E  2 19  ? -35.816 34.172  -24.521 1.00 31.70 ? 224  PRO E CB  1 
ATOM   3803  C  CG  . PRO E  2 19  ? -34.940 34.673  -23.428 1.00 32.03 ? 224  PRO E CG  1 
ATOM   3804  C  CD  . PRO E  2 19  ? -34.538 33.452  -22.633 1.00 30.37 ? 224  PRO E CD  1 
ATOM   3805  N  N   . VAL E  2 20  ? -38.177 32.093  -25.463 1.00 30.55 ? 225  VAL E N   1 
ATOM   3806  C  CA  . VAL E  2 20  ? -38.601 31.261  -26.581 1.00 30.18 ? 225  VAL E CA  1 
ATOM   3807  C  C   . VAL E  2 20  ? -37.774 31.668  -27.798 1.00 31.02 ? 225  VAL E C   1 
ATOM   3808  O  O   . VAL E  2 20  ? -37.568 32.849  -28.054 1.00 32.31 ? 225  VAL E O   1 
ATOM   3809  C  CB  . VAL E  2 20  ? -40.111 31.411  -26.872 1.00 30.61 ? 225  VAL E CB  1 
ATOM   3810  C  CG1 . VAL E  2 20  ? -40.481 30.814  -28.232 1.00 30.77 ? 225  VAL E CG1 1 
ATOM   3811  C  CG2 . VAL E  2 20  ? -40.927 30.772  -25.758 1.00 29.67 ? 225  VAL E CG2 1 
ATOM   3812  N  N   . ARG E  2 21  ? -37.292 30.675  -28.531 1.00 30.63 ? 226  ARG E N   1 
ATOM   3813  C  CA  . ARG E  2 21  ? -36.492 30.903  -29.722 1.00 31.43 ? 226  ARG E CA  1 
ATOM   3814  C  C   . ARG E  2 21  ? -37.196 30.293  -30.936 1.00 31.65 ? 226  ARG E C   1 
ATOM   3815  O  O   . ARG E  2 21  ? -38.286 29.719  -30.821 1.00 30.67 ? 226  ARG E O   1 
ATOM   3816  C  CB  . ARG E  2 21  ? -35.116 30.276  -29.543 1.00 31.28 ? 226  ARG E CB  1 
ATOM   3817  C  CG  . ARG E  2 21  ? -34.316 30.856  -28.383 1.00 31.47 ? 226  ARG E CG  1 
ATOM   3818  C  CD  . ARG E  2 21  ? -32.846 30.489  -28.498 1.00 31.77 ? 226  ARG E CD  1 
ATOM   3819  N  NE  . ARG E  2 21  ? -32.226 31.077  -29.692 1.00 33.01 ? 226  ARG E NE  1 
ATOM   3820  C  CZ  . ARG E  2 21  ? -31.032 30.732  -30.176 1.00 33.23 ? 226  ARG E CZ  1 
ATOM   3821  N  NH1 . ARG E  2 21  ? -30.301 29.799  -29.578 1.00 32.39 ? 226  ARG E NH1 1 
ATOM   3822  N  NH2 . ARG E  2 21  ? -30.562 31.334  -31.262 1.00 34.80 ? 226  ARG E NH2 1 
ATOM   3823  N  N   . ASN E  2 22  ? -36.568 30.432  -32.100 1.00 32.63 ? 227  ASN E N   1 
ATOM   3824  C  CA  . ASN E  2 22  ? -37.173 30.036  -33.357 1.00 32.70 ? 227  ASN E CA  1 
ATOM   3825  C  C   . ASN E  2 22  ? -36.237 29.192  -34.214 1.00 32.43 ? 227  ASN E C   1 
ATOM   3826  O  O   . ASN E  2 22  ? -35.225 29.675  -34.707 1.00 33.28 ? 227  ASN E O   1 
ATOM   3827  C  CB  . ASN E  2 22  ? -37.617 31.274  -34.127 1.00 34.26 ? 227  ASN E CB  1 
ATOM   3828  C  CG  . ASN E  2 22  ? -38.719 30.968  -35.118 1.00 34.94 ? 227  ASN E CG  1 
ATOM   3829  O  OD1 . ASN E  2 22  ? -38.773 29.883  -35.693 1.00 34.30 ? 227  ASN E OD1 1 
ATOM   3830  N  ND2 . ASN E  2 22  ? -39.617 31.921  -35.309 1.00 36.26 ? 227  ASN E ND2 1 
ATOM   3831  N  N   . GLN E  2 23  ? -36.607 27.929  -34.400 1.00 31.60 ? 228  GLN E N   1 
ATOM   3832  C  CA  . GLN E  2 23  ? -35.802 26.989  -35.153 1.00 31.41 ? 228  GLN E CA  1 
ATOM   3833  C  C   . GLN E  2 23  ? -35.888 27.276  -36.648 1.00 32.97 ? 228  GLN E C   1 
ATOM   3834  O  O   . GLN E  2 23  ? -34.979 26.937  -37.394 1.00 33.32 ? 228  GLN E O   1 
ATOM   3835  C  CB  . GLN E  2 23  ? -36.231 25.549  -34.840 1.00 30.09 ? 228  GLN E CB  1 
ATOM   3836  C  CG  . GLN E  2 23  ? -37.596 25.138  -35.391 1.00 30.48 ? 228  GLN E CG  1 
ATOM   3837  C  CD  . GLN E  2 23  ? -38.020 23.762  -34.909 1.00 29.13 ? 228  GLN E CD  1 
ATOM   3838  O  OE1 . GLN E  2 23  ? -38.483 23.601  -33.782 1.00 27.55 ? 228  GLN E OE1 1 
ATOM   3839  N  NE2 . GLN E  2 23  ? -37.852 22.762  -35.761 1.00 29.48 ? 228  GLN E NE2 1 
ATOM   3840  N  N   . ALA E  2 24  ? -36.994 27.892  -37.062 1.00 34.11 ? 229  ALA E N   1 
ATOM   3841  C  CA  . ALA E  2 24  ? -37.241 28.245  -38.460 1.00 36.09 ? 229  ALA E CA  1 
ATOM   3842  C  C   . ALA E  2 24  ? -37.530 26.975  -39.269 1.00 36.24 ? 229  ALA E C   1 
ATOM   3843  O  O   . ALA E  2 24  ? -38.157 26.050  -38.738 1.00 35.25 ? 229  ALA E O   1 
ATOM   3844  C  CB  . ALA E  2 24  ? -36.068 29.046  -39.034 1.00 37.40 ? 229  ALA E CB  1 
ATOM   3845  N  N   . SER E  2 25  ? -37.107 26.945  -40.537 1.00 37.90 ? 230  SER E N   1 
ATOM   3846  C  CA  . SER E  2 25  ? -37.265 25.781  -41.410 1.00 38.23 ? 230  SER E CA  1 
ATOM   3847  C  C   . SER E  2 25  ? -35.995 24.912  -41.384 1.00 37.65 ? 230  SER E C   1 
ATOM   3848  O  O   . SER E  2 25  ? -35.281 24.773  -42.376 1.00 39.33 ? 230  SER E O   1 
ATOM   3849  C  CB  . SER E  2 25  ? -37.553 26.233  -42.844 1.00 40.69 ? 230  SER E CB  1 
ATOM   3850  O  OG  . SER E  2 25  ? -38.803 26.898  -42.951 1.00 41.69 ? 230  SER E OG  1 
ATOM   3851  N  N   . CYS E  2 26  ? -35.711 24.345  -40.226 1.00 35.69 ? 231  CYS E N   1 
ATOM   3852  C  CA  . CYS E  2 26  ? -34.608 23.394  -40.060 1.00 34.69 ? 231  CYS E CA  1 
ATOM   3853  C  C   . CYS E  2 26  ? -35.124 22.432  -39.021 1.00 32.17 ? 231  CYS E C   1 
ATOM   3854  O  O   . CYS E  2 26  ? -35.804 22.850  -38.096 1.00 31.27 ? 231  CYS E O   1 
ATOM   3855  C  CB  . CYS E  2 26  ? -33.323 24.128  -39.626 1.00 34.73 ? 231  CYS E CB  1 
ATOM   3856  S  SG  . CYS E  2 26  ? -32.005 23.172  -38.833 1.00 33.72 ? 231  CYS E SG  1 
ATOM   3857  N  N   . GLY E  2 27  ? -34.868 21.142  -39.191 1.00 31.55 ? 232  GLY E N   1 
ATOM   3858  C  CA  . GLY E  2 27  ? -35.388 20.150  -38.252 1.00 29.69 ? 232  GLY E CA  1 
ATOM   3859  C  C   . GLY E  2 27  ? -34.532 20.046  -37.007 1.00 28.13 ? 232  GLY E C   1 
ATOM   3860  O  O   . GLY E  2 27  ? -34.019 18.982  -36.699 1.00 27.20 ? 232  GLY E O   1 
ATOM   3861  N  N   . SER E  2 28  ? -34.386 21.150  -36.288 1.00 27.74 ? 233  SER E N   1 
ATOM   3862  C  CA  . SER E  2 28  ? -33.460 21.212  -35.160 1.00 26.90 ? 233  SER E CA  1 
ATOM   3863  C  C   . SER E  2 28  ? -34.150 21.252  -33.791 1.00 25.39 ? 233  SER E C   1 
ATOM   3864  O  O   . SER E  2 28  ? -33.514 21.573  -32.794 1.00 24.54 ? 233  SER E O   1 
ATOM   3865  C  CB  . SER E  2 28  ? -32.544 22.430  -35.313 1.00 27.78 ? 233  SER E CB  1 
ATOM   3866  O  OG  . SER E  2 28  ? -33.291 23.620  -35.402 1.00 28.18 ? 233  SER E OG  1 
ATOM   3867  N  N   . CYS E  2 29  ? -35.433 20.900  -33.747 1.00 25.25 ? 234  CYS E N   1 
ATOM   3868  C  CA  . CYS E  2 29  ? -36.205 20.925  -32.499 1.00 24.34 ? 234  CYS E CA  1 
ATOM   3869  C  C   . CYS E  2 29  ? -35.494 20.242  -31.323 1.00 22.70 ? 234  CYS E C   1 
ATOM   3870  O  O   . CYS E  2 29  ? -35.505 20.759  -30.204 1.00 22.27 ? 234  CYS E O   1 
ATOM   3871  C  CB  . CYS E  2 29  ? -37.587 20.285  -32.696 1.00 24.41 ? 234  CYS E CB  1 
ATOM   3872  S  SG  . CYS E  2 29  ? -37.555 18.587  -33.304 1.00 25.44 ? 234  CYS E SG  1 
ATOM   3873  N  N   . TYR E  2 30  ? -34.897 19.087  -31.594 1.00 21.84 ? 235  TYR E N   1 
ATOM   3874  C  CA  . TYR E  2 30  ? -34.212 18.292  -30.586 1.00 20.63 ? 235  TYR E CA  1 
ATOM   3875  C  C   . TYR E  2 30  ? -33.086 19.087  -29.945 1.00 20.71 ? 235  TYR E C   1 
ATOM   3876  O  O   . TYR E  2 30  ? -32.823 18.972  -28.737 1.00 19.77 ? 235  TYR E O   1 
ATOM   3877  C  CB  . TYR E  2 30  ? -33.654 17.011  -31.209 1.00 20.43 ? 235  TYR E CB  1 
ATOM   3878  C  CG  . TYR E  2 30  ? -32.522 17.250  -32.180 1.00 21.25 ? 235  TYR E CG  1 
ATOM   3879  C  CD1 . TYR E  2 30  ? -32.766 17.595  -33.501 1.00 22.17 ? 235  TYR E CD1 1 
ATOM   3880  C  CD2 . TYR E  2 30  ? -31.208 17.148  -31.766 1.00 21.04 ? 235  TYR E CD2 1 
ATOM   3881  C  CE1 . TYR E  2 30  ? -31.723 17.816  -34.383 1.00 23.02 ? 235  TYR E CE1 1 
ATOM   3882  C  CE2 . TYR E  2 30  ? -30.161 17.370  -32.633 1.00 21.94 ? 235  TYR E CE2 1 
ATOM   3883  C  CZ  . TYR E  2 30  ? -30.417 17.705  -33.950 1.00 22.91 ? 235  TYR E CZ  1 
ATOM   3884  O  OH  . TYR E  2 30  ? -29.346 17.931  -34.809 1.00 23.69 ? 235  TYR E OH  1 
ATOM   3885  N  N   . SER E  2 31  ? -32.426 19.900  -30.766 1.00 21.71 ? 236  SER E N   1 
ATOM   3886  C  CA  . SER E  2 31  ? -31.328 20.733  -30.291 1.00 21.93 ? 236  SER E CA  1 
ATOM   3887  C  C   . SER E  2 31  ? -31.839 21.805  -29.335 1.00 21.60 ? 236  SER E C   1 
ATOM   3888  O  O   . SER E  2 31  ? -31.257 22.008  -28.285 1.00 21.17 ? 236  SER E O   1 
ATOM   3889  C  CB  . SER E  2 31  ? -30.608 21.386  -31.460 1.00 23.32 ? 236  SER E CB  1 
ATOM   3890  O  OG  . SER E  2 31  ? -29.275 21.639  -31.094 1.00 23.75 ? 236  SER E OG  1 
ATOM   3891  N  N   . PHE E  2 32  ? -32.939 22.455  -29.703 1.00 21.85 ? 237  PHE E N   1 
ATOM   3892  C  CA  . PHE E  2 32  ? -33.568 23.501  -28.890 1.00 21.87 ? 237  PHE E CA  1 
ATOM   3893  C  C   . PHE E  2 32  ? -34.188 23.002  -27.591 1.00 20.75 ? 237  PHE E C   1 
ATOM   3894  O  O   . PHE E  2 32  ? -34.150 23.685  -26.565 1.00 21.20 ? 237  PHE E O   1 
ATOM   3895  C  CB  . PHE E  2 32  ? -34.655 24.226  -29.707 1.00 22.75 ? 237  PHE E CB  1 
ATOM   3896  C  CG  . PHE E  2 32  ? -34.111 25.203  -30.707 1.00 24.14 ? 237  PHE E CG  1 
ATOM   3897  C  CD1 . PHE E  2 32  ? -33.577 24.765  -31.906 1.00 24.86 ? 237  PHE E CD1 1 
ATOM   3898  C  CD2 . PHE E  2 32  ? -34.120 26.567  -30.444 1.00 25.05 ? 237  PHE E CD2 1 
ATOM   3899  C  CE1 . PHE E  2 32  ? -33.070 25.671  -32.835 1.00 26.34 ? 237  PHE E CE1 1 
ATOM   3900  C  CE2 . PHE E  2 32  ? -33.614 27.478  -31.363 1.00 26.45 ? 237  PHE E CE2 1 
ATOM   3901  C  CZ  . PHE E  2 32  ? -33.088 27.028  -32.564 1.00 27.10 ? 237  PHE E CZ  1 
ATOM   3902  N  N   . ALA E  2 33  ? -34.806 21.832  -27.630 1.00 19.99 ? 238  ALA E N   1 
ATOM   3903  C  CA  . ALA E  2 33  ? -35.412 21.296  -26.428 1.00 19.06 ? 238  ALA E CA  1 
ATOM   3904  C  C   . ALA E  2 33  ? -34.291 20.926  -25.445 1.00 18.30 ? 238  ALA E C   1 
ATOM   3905  O  O   . ALA E  2 33  ? -34.378 21.251  -24.259 1.00 17.84 ? 238  ALA E O   1 
ATOM   3906  C  CB  . ALA E  2 33  ? -36.293 20.099  -26.762 1.00 18.83 ? 238  ALA E CB  1 
ATOM   3907  N  N   . SER E  2 34  ? -33.243 20.269  -25.961 1.00 18.01 ? 239  SER E N   1 
ATOM   3908  C  CA  . SER E  2 34  ? -32.024 19.950  -25.197 1.00 17.59 ? 239  SER E CA  1 
ATOM   3909  C  C   . SER E  2 34  ? -31.387 21.189  -24.563 1.00 18.07 ? 239  SER E C   1 
ATOM   3910  O  O   . SER E  2 34  ? -31.071 21.193  -23.367 1.00 17.61 ? 239  SER E O   1 
ATOM   3911  C  CB  . SER E  2 34  ? -30.975 19.292  -26.099 1.00 17.69 ? 239  SER E CB  1 
ATOM   3912  O  OG  . SER E  2 34  ? -31.256 17.929  -26.332 1.00 17.01 ? 239  SER E OG  1 
ATOM   3913  N  N   . MET E  2 35  ? -31.175 22.229  -25.372 1.00 19.04 ? 240  MET E N   1 
ATOM   3914  C  CA  . MET E  2 35  ? -30.529 23.450  -24.880 1.00 19.63 ? 240  MET E CA  1 
ATOM   3915  C  C   . MET E  2 35  ? -31.382 24.092  -23.804 1.00 19.23 ? 240  MET E C   1 
ATOM   3916  O  O   . MET E  2 35  ? -30.866 24.502  -22.775 1.00 19.35 ? 240  MET E O   1 
ATOM   3917  C  CB  . MET E  2 35  ? -30.304 24.470  -25.997 1.00 20.90 ? 240  MET E CB  1 
ATOM   3918  C  CG  . MET E  2 35  ? -29.241 24.139  -27.039 1.00 21.71 ? 240  MET E CG  1 
ATOM   3919  S  SD  . MET E  2 35  ? -27.748 23.347  -26.421 1.00 21.96 ? 240  MET E SD  1 
ATOM   3920  C  CE  . MET E  2 35  ? -28.142 21.610  -26.624 1.00 21.09 ? 240  MET E CE  1 
ATOM   3921  N  N   . GLY E  2 36  ? -32.686 24.176  -24.049 1.00 19.02 ? 241  GLY E N   1 
ATOM   3922  C  CA  . GLY E  2 36  ? -33.632 24.781  -23.107 1.00 18.94 ? 241  GLY E CA  1 
ATOM   3923  C  C   . GLY E  2 36  ? -33.732 24.083  -21.762 1.00 18.10 ? 241  GLY E C   1 
ATOM   3924  O  O   . GLY E  2 36  ? -33.911 24.737  -20.742 1.00 18.48 ? 241  GLY E O   1 
ATOM   3925  N  N   . MET E  2 37  ? -33.631 22.755  -21.752 1.00 17.18 ? 242  MET E N   1 
ATOM   3926  C  CA  . MET E  2 37  ? -33.633 22.009  -20.485 1.00 16.46 ? 242  MET E CA  1 
ATOM   3927  C  C   . MET E  2 37  ? -32.409 22.378  -19.670 1.00 16.54 ? 242  MET E C   1 
ATOM   3928  O  O   . MET E  2 37  ? -32.498 22.594  -18.456 1.00 16.44 ? 242  MET E O   1 
ATOM   3929  C  CB  . MET E  2 37  ? -33.635 20.484  -20.707 1.00 15.78 ? 242  MET E CB  1 
ATOM   3930  C  CG  . MET E  2 37  ? -33.282 19.675  -19.453 1.00 15.33 ? 242  MET E CG  1 
ATOM   3931  S  SD  . MET E  2 37  ? -33.570 17.891  -19.588 1.00 14.87 ? 242  MET E SD  1 
ATOM   3932  C  CE  . MET E  2 37  ? -32.673 17.544  -21.093 1.00 14.74 ? 242  MET E CE  1 
ATOM   3933  N  N   . LEU E  2 38  ? -31.260 22.405  -20.337 1.00 16.61 ? 243  LEU E N   1 
ATOM   3934  C  CA  . LEU E  2 38  ? -30.008 22.682  -19.664 1.00 16.88 ? 243  LEU E CA  1 
ATOM   3935  C  C   . LEU E  2 38  ? -29.897 24.145  -19.258 1.00 17.84 ? 243  LEU E C   1 
ATOM   3936  O  O   . LEU E  2 38  ? -29.400 24.423  -18.175 1.00 18.04 ? 243  LEU E O   1 
ATOM   3937  C  CB  . LEU E  2 38  ? -28.822 22.273  -20.526 1.00 16.90 ? 243  LEU E CB  1 
ATOM   3938  C  CG  . LEU E  2 38  ? -28.806 20.792  -20.911 1.00 16.27 ? 243  LEU E CG  1 
ATOM   3939  C  CD1 . LEU E  2 38  ? -27.640 20.510  -21.843 1.00 16.63 ? 243  LEU E CD1 1 
ATOM   3940  C  CD2 . LEU E  2 38  ? -28.769 19.873  -19.702 1.00 15.75 ? 243  LEU E CD2 1 
ATOM   3941  N  N   . GLU E  2 39  ? -30.362 25.060  -20.113 1.00 18.71 ? 244  GLU E N   1 
ATOM   3942  C  CA  . GLU E  2 39  ? -30.381 26.495  -19.803 1.00 19.77 ? 244  GLU E CA  1 
ATOM   3943  C  C   . GLU E  2 39  ? -31.206 26.721  -18.550 1.00 19.55 ? 244  GLU E C   1 
ATOM   3944  O  O   . GLU E  2 39  ? -30.756 27.411  -17.627 1.00 20.20 ? 244  GLU E O   1 
ATOM   3945  C  CB  . GLU E  2 39  ? -30.968 27.335  -20.964 1.00 21.00 ? 244  GLU E CB  1 
ATOM   3946  C  CG  . GLU E  2 39  ? -30.073 27.458  -22.197 1.00 21.98 ? 244  GLU E CG  1 
ATOM   3947  C  CD  . GLU E  2 39  ? -30.780 27.966  -23.464 1.00 23.64 ? 244  GLU E CD  1 
ATOM   3948  O  OE1 . GLU E  2 39  ? -31.986 28.345  -23.407 1.00 24.30 ? 244  GLU E OE1 1 
ATOM   3949  O  OE2 . GLU E  2 39  ? -30.119 27.990  -24.549 1.00 25.05 ? 244  GLU E OE2 1 
ATOM   3950  N  N   . ALA E  2 40  ? -32.400 26.123  -18.506 1.00 18.76 ? 245  ALA E N   1 
ATOM   3951  C  CA  . ALA E  2 40  ? -33.316 26.320  -17.383 1.00 18.78 ? 245  ALA E CA  1 
ATOM   3952  C  C   . ALA E  2 40  ? -32.793 25.704  -16.093 1.00 18.38 ? 245  ALA E C   1 
ATOM   3953  O  O   . ALA E  2 40  ? -32.986 26.249  -15.014 1.00 18.77 ? 245  ALA E O   1 
ATOM   3954  C  CB  . ALA E  2 40  ? -34.692 25.759  -17.699 1.00 18.46 ? 245  ALA E CB  1 
ATOM   3955  N  N   . ARG E  2 41  ? -32.160 24.545  -16.212 1.00 17.61 ? 246  ARG E N   1 
ATOM   3956  C  CA  . ARG E  2 41  ? -31.632 23.831  -15.053 1.00 17.32 ? 246  ARG E CA  1 
ATOM   3957  C  C   . ARG E  2 41  ? -30.397 24.502  -14.475 1.00 17.93 ? 246  ARG E C   1 
ATOM   3958  O  O   . ARG E  2 41  ? -30.215 24.499  -13.278 1.00 18.32 ? 246  ARG E O   1 
ATOM   3959  C  CB  . ARG E  2 41  ? -31.358 22.366  -15.394 1.00 16.45 ? 246  ARG E CB  1 
ATOM   3960  C  CG  . ARG E  2 41  ? -32.636 21.564  -15.402 1.00 16.01 ? 246  ARG E CG  1 
ATOM   3961  C  CD  . ARG E  2 41  ? -32.464 20.114  -15.814 1.00 15.32 ? 246  ARG E CD  1 
ATOM   3962  N  NE  . ARG E  2 41  ? -33.758 19.439  -15.718 1.00 15.03 ? 246  ARG E NE  1 
ATOM   3963  C  CZ  . ARG E  2 41  ? -33.944 18.181  -15.323 1.00 14.70 ? 246  ARG E CZ  1 
ATOM   3964  N  NH1 . ARG E  2 41  ? -32.926 17.410  -14.980 1.00 14.53 ? 246  ARG E NH1 1 
ATOM   3965  N  NH2 . ARG E  2 41  ? -35.173 17.704  -15.234 1.00 14.69 ? 246  ARG E NH2 1 
ATOM   3966  N  N   . ILE E  2 42  ? -29.571 25.100  -15.326 1.00 18.34 ? 247  ILE E N   1 
ATOM   3967  C  CA  . ILE E  2 42  ? -28.472 25.961  -14.859 1.00 19.16 ? 247  ILE E CA  1 
ATOM   3968  C  C   . ILE E  2 42  ? -29.051 27.119  -14.024 1.00 20.09 ? 247  ILE E C   1 
ATOM   3969  O  O   . ILE E  2 42  ? -28.534 27.440  -12.948 1.00 20.91 ? 247  ILE E O   1 
ATOM   3970  C  CB  . ILE E  2 42  ? -27.612 26.487  -16.043 1.00 19.40 ? 247  ILE E CB  1 
ATOM   3971  C  CG1 . ILE E  2 42  ? -26.796 25.344  -16.661 1.00 18.84 ? 247  ILE E CG1 1 
ATOM   3972  C  CG2 . ILE E  2 42  ? -26.676 27.611  -15.594 1.00 20.43 ? 247  ILE E CG2 1 
ATOM   3973  C  CD1 . ILE E  2 42  ? -26.228 25.658  -18.035 1.00 19.16 ? 247  ILE E CD1 1 
ATOM   3974  N  N   . ARG E  2 43  ? -30.145 27.708  -14.494 1.00 20.44 ? 248  ARG E N   1 
ATOM   3975  C  CA  . ARG E  2 43  ? -30.797 28.799  -13.761 1.00 21.57 ? 248  ARG E CA  1 
ATOM   3976  C  C   . ARG E  2 43  ? -31.347 28.365  -12.395 1.00 21.54 ? 248  ARG E C   1 
ATOM   3977  O  O   . ARG E  2 43  ? -31.219 29.084  -11.403 1.00 22.35 ? 248  ARG E O   1 
ATOM   3978  C  CB  . ARG E  2 43  ? -31.925 29.415  -14.589 1.00 22.01 ? 248  ARG E CB  1 
ATOM   3979  C  CG  . ARG E  2 43  ? -31.464 30.301  -15.719 1.00 22.91 ? 248  ARG E CG  1 
ATOM   3980  C  CD  . ARG E  2 43  ? -32.604 30.414  -16.689 1.00 23.29 ? 248  ARG E CD  1 
ATOM   3981  N  NE  . ARG E  2 43  ? -32.376 31.280  -17.835 1.00 24.21 ? 248  ARG E NE  1 
ATOM   3982  C  CZ  . ARG E  2 43  ? -32.898 32.497  -17.973 1.00 25.24 ? 248  ARG E CZ  1 
ATOM   3983  N  NH1 . ARG E  2 43  ? -33.655 33.033  -17.010 1.00 25.72 ? 248  ARG E NH1 1 
ATOM   3984  N  NH2 . ARG E  2 43  ? -32.650 33.181  -19.084 1.00 25.92 ? 248  ARG E NH2 1 
ATOM   3985  N  N   . ILE E  2 44  ? -31.967 27.196  -12.356 1.00 20.76 ? 249  ILE E N   1 
ATOM   3986  C  CA  . ILE E  2 44  ? -32.517 26.659  -11.117 1.00 20.96 ? 249  ILE E CA  1 
ATOM   3987  C  C   . ILE E  2 44  ? -31.378 26.375  -10.145 1.00 21.51 ? 249  ILE E C   1 
ATOM   3988  O  O   . ILE E  2 44  ? -31.382 26.859  -9.002  1.00 22.76 ? 249  ILE E O   1 
ATOM   3989  C  CB  . ILE E  2 44  ? -33.350 25.386  -11.401 1.00 20.07 ? 249  ILE E CB  1 
ATOM   3990  C  CG1 . ILE E  2 44  ? -34.583 25.767  -12.239 1.00 19.98 ? 249  ILE E CG1 1 
ATOM   3991  C  CG2 . ILE E  2 44  ? -33.758 24.680  -10.111 1.00 20.10 ? 249  ILE E CG2 1 
ATOM   3992  C  CD1 . ILE E  2 44  ? -35.203 24.605  -12.969 1.00 19.19 ? 249  ILE E CD1 1 
ATOM   3993  N  N   . LEU E  2 45  ? -30.385 25.622  -10.622 1.00 21.07 ? 250  LEU E N   1 
ATOM   3994  C  CA  . LEU E  2 45  ? -29.225 25.262  -9.805  1.00 21.49 ? 250  LEU E CA  1 
ATOM   3995  C  C   . LEU E  2 45  ? -28.446 26.454  -9.245  1.00 22.91 ? 250  LEU E C   1 
ATOM   3996  O  O   . LEU E  2 45  ? -27.835 26.331  -8.195  1.00 24.21 ? 250  LEU E O   1 
ATOM   3997  C  CB  . LEU E  2 45  ? -28.282 24.353  -10.595 1.00 20.77 ? 250  LEU E CB  1 
ATOM   3998  C  CG  . LEU E  2 45  ? -28.833 22.951  -10.928 1.00 19.67 ? 250  LEU E CG  1 
ATOM   3999  C  CD1 . LEU E  2 45  ? -28.011 22.350  -12.041 1.00 19.10 ? 250  LEU E CD1 1 
ATOM   4000  C  CD2 . LEU E  2 45  ? -28.825 22.041  -9.709  1.00 19.84 ? 250  LEU E CD2 1 
ATOM   4001  N  N   . THR E  2 46  ? -28.482 27.603  -9.920  1.00 23.31 ? 251  THR E N   1 
ATOM   4002  C  CA  . THR E  2 46  ? -27.710 28.774  -9.502  1.00 24.41 ? 251  THR E CA  1 
ATOM   4003  C  C   . THR E  2 46  ? -28.570 29.949  -9.019  1.00 25.41 ? 251  THR E C   1 
ATOM   4004  O  O   . THR E  2 46  ? -28.066 31.058  -8.849  1.00 26.40 ? 251  THR E O   1 
ATOM   4005  C  CB  . THR E  2 46  ? -26.827 29.266  -10.655 1.00 24.36 ? 251  THR E CB  1 
ATOM   4006  O  OG1 . THR E  2 46  ? -27.649 29.662  -11.759 1.00 23.88 ? 251  THR E OG1 1 
ATOM   4007  C  CG2 . THR E  2 46  ? -25.875 28.170  -11.093 1.00 23.65 ? 251  THR E CG2 1 
ATOM   4008  N  N   . ASN E  2 47  ? -29.861 29.710  -8.786  1.00 25.26 ? 252  ASN E N   1 
ATOM   4009  C  CA  . ASN E  2 47  ? -30.812 30.782  -8.424  1.00 26.07 ? 252  ASN E CA  1 
ATOM   4010  C  C   . ASN E  2 47  ? -30.648 32.020  -9.315  1.00 26.65 ? 252  ASN E C   1 
ATOM   4011  O  O   . ASN E  2 47  ? -30.525 33.141  -8.826  1.00 27.68 ? 252  ASN E O   1 
ATOM   4012  C  CB  . ASN E  2 47  ? -30.707 31.171  -6.931  1.00 27.01 ? 252  ASN E CB  1 
ATOM   4013  C  CG  . ASN E  2 47  ? -31.960 31.891  -6.423  1.00 27.81 ? 252  ASN E CG  1 
ATOM   4014  O  OD1 . ASN E  2 47  ? -33.066 31.559  -6.821  1.00 27.23 ? 252  ASN E OD1 1 
ATOM   4015  N  ND2 . ASN E  2 47  ? -31.786 32.879  -5.549  1.00 29.23 ? 252  ASN E ND2 1 
ATOM   4016  N  N   . ASN E  2 48  ? -30.626 31.784  -10.624 1.00 25.92 ? 253  ASN E N   1 
ATOM   4017  C  CA  . ASN E  2 48  ? -30.557 32.840  -11.640 1.00 26.67 ? 253  ASN E CA  1 
ATOM   4018  C  C   . ASN E  2 48  ? -29.304 33.720  -11.623 1.00 27.80 ? 253  ASN E C   1 
ATOM   4019  O  O   . ASN E  2 48  ? -29.319 34.809  -12.205 1.00 28.72 ? 253  ASN E O   1 
ATOM   4020  C  CB  . ASN E  2 48  ? -31.826 33.729  -11.606 1.00 27.24 ? 253  ASN E CB  1 
ATOM   4021  C  CG  . ASN E  2 48  ? -32.977 33.128  -12.380 1.00 26.37 ? 253  ASN E CG  1 
ATOM   4022  O  OD1 . ASN E  2 48  ? -32.781 32.550  -13.440 1.00 25.52 ? 253  ASN E OD1 1 
ATOM   4023  N  ND2 . ASN E  2 48  ? -34.192 33.277  -11.860 1.00 26.78 ? 253  ASN E ND2 1 
ATOM   4024  N  N   . SER E  2 49  ? -28.228 33.276  -10.979 1.00 28.03 ? 254  SER E N   1 
ATOM   4025  C  CA  . SER E  2 49  ? -26.970 34.028  -11.055 1.00 29.10 ? 254  SER E CA  1 
ATOM   4026  C  C   . SER E  2 49  ? -26.208 33.673  -12.346 1.00 28.78 ? 254  SER E C   1 
ATOM   4027  O  O   . SER E  2 49  ? -25.301 34.391  -12.740 1.00 29.88 ? 254  SER E O   1 
ATOM   4028  C  CB  . SER E  2 49  ? -26.112 33.797  -9.816  1.00 29.53 ? 254  SER E CB  1 
ATOM   4029  O  OG  . SER E  2 49  ? -25.672 32.460  -9.742  1.00 28.78 ? 254  SER E OG  1 
ATOM   4030  N  N   . GLN E  2 50  ? -26.578 32.562  -12.988 1.00 27.69 ? 255  GLN E N   1 
ATOM   4031  C  CA  . GLN E  2 50  ? -26.087 32.205  -14.320 1.00 27.35 ? 255  GLN E CA  1 
ATOM   4032  C  C   . GLN E  2 50  ? -27.250 31.948  -15.267 1.00 26.64 ? 255  GLN E C   1 
ATOM   4033  O  O   . GLN E  2 50  ? -28.095 31.113  -15.003 1.00 25.83 ? 255  GLN E O   1 
ATOM   4034  C  CB  . GLN E  2 50  ? -25.229 30.952  -14.259 1.00 26.89 ? 255  GLN E CB  1 
ATOM   4035  C  CG  . GLN E  2 50  ? -23.875 31.173  -13.634 1.00 27.68 ? 255  GLN E CG  1 
ATOM   4036  C  CD  . GLN E  2 50  ? -23.145 29.879  -13.406 1.00 26.88 ? 255  GLN E CD  1 
ATOM   4037  O  OE1 . GLN E  2 50  ? -22.894 29.123  -14.334 1.00 26.06 ? 255  GLN E OE1 1 
ATOM   4038  N  NE2 . GLN E  2 50  ? -22.804 29.615  -12.162 1.00 27.38 ? 255  GLN E NE2 1 
ATOM   4039  N  N   . THR E  2 51  ? -27.275 32.672  -16.377 1.00 27.29 ? 256  THR E N   1 
ATOM   4040  C  CA  . THR E  2 51  ? -28.379 32.632  -17.331 1.00 26.96 ? 256  THR E CA  1 
ATOM   4041  C  C   . THR E  2 51  ? -27.813 32.469  -18.739 1.00 26.96 ? 256  THR E C   1 
ATOM   4042  O  O   . THR E  2 51  ? -28.178 33.203  -19.641 1.00 27.69 ? 256  THR E O   1 
ATOM   4043  C  CB  . THR E  2 51  ? -29.222 33.934  -17.270 1.00 27.89 ? 256  THR E CB  1 
ATOM   4044  O  OG1 . THR E  2 51  ? -28.357 35.065  -17.426 1.00 29.12 ? 256  THR E OG1 1 
ATOM   4045  C  CG2 . THR E  2 51  ? -29.964 34.069  -15.937 1.00 27.94 ? 256  THR E CG2 1 
ATOM   4046  N  N   . PRO E  2 52  ? -26.918 31.493  -18.936 1.00 26.42 ? 257  PRO E N   1 
ATOM   4047  C  CA  . PRO E  2 52  ? -26.355 31.318  -20.270 1.00 26.72 ? 257  PRO E CA  1 
ATOM   4048  C  C   . PRO E  2 52  ? -27.396 30.859  -21.293 1.00 26.40 ? 257  PRO E C   1 
ATOM   4049  O  O   . PRO E  2 52  ? -28.373 30.190  -20.936 1.00 25.51 ? 257  PRO E O   1 
ATOM   4050  C  CB  . PRO E  2 52  ? -25.308 30.224  -20.062 1.00 26.14 ? 257  PRO E CB  1 
ATOM   4051  C  CG  . PRO E  2 52  ? -25.855 29.415  -18.937 1.00 25.07 ? 257  PRO E CG  1 
ATOM   4052  C  CD  . PRO E  2 52  ? -26.485 30.427  -18.021 1.00 25.59 ? 257  PRO E CD  1 
ATOM   4053  N  N   . ILE E  2 53  ? -27.183 31.265  -22.542 1.00 27.19 ? 258  ILE E N   1 
ATOM   4054  C  CA  . ILE E  2 53  ? -27.910 30.759  -23.691 1.00 26.94 ? 258  ILE E CA  1 
ATOM   4055  C  C   . ILE E  2 53  ? -26.920 29.900  -24.463 1.00 26.88 ? 258  ILE E C   1 
ATOM   4056  O  O   . ILE E  2 53  ? -25.853 30.375  -24.838 1.00 27.64 ? 258  ILE E O   1 
ATOM   4057  C  CB  . ILE E  2 53  ? -28.426 31.911  -24.580 1.00 28.18 ? 258  ILE E CB  1 
ATOM   4058  C  CG1 . ILE E  2 53  ? -29.383 32.826  -23.800 1.00 28.37 ? 258  ILE E CG1 1 
ATOM   4059  C  CG2 . ILE E  2 53  ? -29.120 31.371  -25.822 1.00 28.13 ? 258  ILE E CG2 1 
ATOM   4060  C  CD1 . ILE E  2 53  ? -30.568 32.115  -23.173 1.00 27.17 ? 258  ILE E CD1 1 
ATOM   4061  N  N   . LEU E  2 54  ? -27.276 28.635  -24.682 1.00 26.08 ? 259  LEU E N   1 
ATOM   4062  C  CA  . LEU E  2 54  ? -26.390 27.664  -25.327 1.00 26.01 ? 259  LEU E CA  1 
ATOM   4063  C  C   . LEU E  2 54  ? -26.724 27.526  -26.787 1.00 26.89 ? 259  LEU E C   1 
ATOM   4064  O  O   . LEU E  2 54  ? -27.866 27.697  -27.182 1.00 27.71 ? 259  LEU E O   1 
ATOM   4065  C  CB  . LEU E  2 54  ? -26.516 26.297  -24.665 1.00 24.71 ? 259  LEU E CB  1 
ATOM   4066  C  CG  . LEU E  2 54  ? -26.232 26.279  -23.164 1.00 24.17 ? 259  LEU E CG  1 
ATOM   4067  C  CD1 . LEU E  2 54  ? -26.625 24.931  -22.587 1.00 23.07 ? 259  LEU E CD1 1 
ATOM   4068  C  CD2 . LEU E  2 54  ? -24.772 26.593  -22.884 1.00 24.77 ? 259  LEU E CD2 1 
ATOM   4069  N  N   . SER E  2 55  ? -25.716 27.189  -27.580 1.00 27.82 ? 260  SER E N   1 
ATOM   4070  C  CA  . SER E  2 55  ? -25.821 27.178  -29.033 1.00 28.90 ? 260  SER E CA  1 
ATOM   4071  C  C   . SER E  2 55  ? -26.440 25.887  -29.569 1.00 28.07 ? 260  SER E C   1 
ATOM   4072  O  O   . SER E  2 55  ? -25.804 24.832  -29.505 1.00 27.72 ? 260  SER E O   1 
ATOM   4073  C  CB  . SER E  2 55  ? -24.425 27.348  -29.644 1.00 30.31 ? 260  SER E CB  1 
ATOM   4074  O  OG  . SER E  2 55  ? -24.456 27.190  -31.057 1.00 32.17 ? 260  SER E OG  1 
ATOM   4075  N  N   . PRO E  2 56  ? -27.667 25.966  -30.118 1.00 28.10 ? 261  PRO E N   1 
ATOM   4076  C  CA  . PRO E  2 56  ? -28.207 24.826  -30.859 1.00 27.71 ? 261  PRO E CA  1 
ATOM   4077  C  C   . PRO E  2 56  ? -27.449 24.551  -32.169 1.00 28.70 ? 261  PRO E C   1 
ATOM   4078  O  O   . PRO E  2 56  ? -27.448 23.412  -32.637 1.00 28.24 ? 261  PRO E O   1 
ATOM   4079  C  CB  . PRO E  2 56  ? -29.645 25.248  -31.177 1.00 27.84 ? 261  PRO E CB  1 
ATOM   4080  C  CG  . PRO E  2 56  ? -29.938 26.410  -30.298 1.00 28.16 ? 261  PRO E CG  1 
ATOM   4081  C  CD  . PRO E  2 56  ? -28.630 27.076  -30.053 1.00 29.02 ? 261  PRO E CD  1 
ATOM   4082  N  N   . GLN E  2 57  ? -26.815 25.578  -32.741 1.00 29.80 ? 262  GLN E N   1 
ATOM   4083  C  CA  . GLN E  2 57  ? -26.108 25.447  -34.024 1.00 31.31 ? 262  GLN E CA  1 
ATOM   4084  C  C   . GLN E  2 57  ? -24.837 24.618  -33.949 1.00 30.81 ? 262  GLN E C   1 
ATOM   4085  O  O   . GLN E  2 57  ? -24.488 23.937  -34.904 1.00 31.37 ? 262  GLN E O   1 
ATOM   4086  C  CB  . GLN E  2 57  ? -25.767 26.828  -34.608 1.00 33.45 ? 262  GLN E CB  1 
ATOM   4087  C  CG  . GLN E  2 57  ? -25.232 26.804  -36.042 1.00 35.04 ? 262  GLN E CG  1 
ATOM   4088  C  CD  . GLN E  2 57  ? -26.225 26.232  -37.038 1.00 35.10 ? 262  GLN E CD  1 
ATOM   4089  O  OE1 . GLN E  2 57  ? -27.382 26.637  -37.063 1.00 35.26 ? 262  GLN E OE1 1 
ATOM   4090  N  NE2 . GLN E  2 57  ? -25.775 25.293  -37.871 1.00 35.47 ? 262  GLN E NE2 1 
ATOM   4091  N  N   . GLU E  2 58  ? -24.128 24.689  -32.830 1.00 30.05 ? 263  GLU E N   1 
ATOM   4092  C  CA  . GLU E  2 58  ? -22.958 23.845  -32.636 1.00 29.87 ? 263  GLU E CA  1 
ATOM   4093  C  C   . GLU E  2 58  ? -23.359 22.373  -32.615 1.00 28.44 ? 263  GLU E C   1 
ATOM   4094  O  O   . GLU E  2 58  ? -22.604 21.513  -33.055 1.00 28.89 ? 263  GLU E O   1 
ATOM   4095  C  CB  . GLU E  2 58  ? -22.238 24.224  -31.349 1.00 29.66 ? 263  GLU E CB  1 
ATOM   4096  C  CG  . GLU E  2 58  ? -20.888 23.548  -31.171 1.00 29.91 ? 263  GLU E CG  1 
ATOM   4097  C  CD  . GLU E  2 58  ? -20.980 22.266  -30.389 1.00 28.57 ? 263  GLU E CD  1 
ATOM   4098  O  OE1 . GLU E  2 58  ? -21.850 22.188  -29.489 1.00 27.85 ? 263  GLU E OE1 1 
ATOM   4099  O  OE2 . GLU E  2 58  ? -20.185 21.338  -30.664 1.00 28.61 ? 263  GLU E OE2 1 
ATOM   4100  N  N   . VAL E  2 59  ? -24.556 22.089  -32.117 1.00 26.89 ? 264  VAL E N   1 
ATOM   4101  C  CA  . VAL E  2 59  ? -25.065 20.724  -32.122 1.00 25.82 ? 264  VAL E CA  1 
ATOM   4102  C  C   . VAL E  2 59  ? -25.439 20.370  -33.553 1.00 26.52 ? 264  VAL E C   1 
ATOM   4103  O  O   . VAL E  2 59  ? -24.979 19.374  -34.087 1.00 26.42 ? 264  VAL E O   1 
ATOM   4104  C  CB  . VAL E  2 59  ? -26.258 20.540  -31.148 1.00 24.17 ? 264  VAL E CB  1 
ATOM   4105  C  CG1 . VAL E  2 59  ? -26.926 19.183  -31.336 1.00 23.18 ? 264  VAL E CG1 1 
ATOM   4106  C  CG2 . VAL E  2 59  ? -25.795 20.708  -29.711 1.00 23.41 ? 264  VAL E CG2 1 
ATOM   4107  N  N   . VAL E  2 60  ? -26.248 21.211  -34.178 1.00 27.23 ? 265  VAL E N   1 
ATOM   4108  C  CA  . VAL E  2 60  ? -26.623 20.994  -35.575 1.00 28.47 ? 265  VAL E CA  1 
ATOM   4109  C  C   . VAL E  2 60  ? -25.408 20.766  -36.487 1.00 29.98 ? 265  VAL E C   1 
ATOM   4110  O  O   . VAL E  2 60  ? -25.409 19.836  -37.295 1.00 30.38 ? 265  VAL E O   1 
ATOM   4111  C  CB  . VAL E  2 60  ? -27.489 22.152  -36.122 1.00 29.19 ? 265  VAL E CB  1 
ATOM   4112  C  CG1 . VAL E  2 60  ? -27.514 22.142  -37.650 1.00 30.90 ? 265  VAL E CG1 1 
ATOM   4113  C  CG2 . VAL E  2 60  ? -28.902 22.059  -35.562 1.00 27.86 ? 265  VAL E CG2 1 
ATOM   4114  N  N   . SER E  2 61  ? -24.375 21.591  -36.337 1.00 30.94 ? 266  SER E N   1 
ATOM   4115  C  CA  . SER E  2 61  ? -23.233 21.564  -37.250 1.00 32.76 ? 266  SER E CA  1 
ATOM   4116  C  C   . SER E  2 61  ? -22.172 20.537  -36.889 1.00 33.03 ? 266  SER E C   1 
ATOM   4117  O  O   . SER E  2 61  ? -21.555 19.971  -37.779 1.00 34.08 ? 266  SER E O   1 
ATOM   4118  C  CB  . SER E  2 61  ? -22.587 22.958  -37.341 1.00 33.94 ? 266  SER E CB  1 
ATOM   4119  O  OG  . SER E  2 61  ? -23.466 23.880  -37.972 1.00 34.46 ? 266  SER E OG  1 
ATOM   4120  N  N   . CYS E  2 62  ? -21.950 20.303  -35.595 1.00 32.67 ? 267  CYS E N   1 
ATOM   4121  C  CA  . CYS E  2 62  ? -20.803 19.509  -35.142 1.00 33.26 ? 267  CYS E CA  1 
ATOM   4122  C  C   . CYS E  2 62  ? -21.118 18.122  -34.597 1.00 31.16 ? 267  CYS E C   1 
ATOM   4123  O  O   . CYS E  2 62  ? -20.235 17.272  -34.571 1.00 31.08 ? 267  CYS E O   1 
ATOM   4124  C  CB  . CYS E  2 62  ? -20.017 20.269  -34.056 1.00 34.56 ? 267  CYS E CB  1 
ATOM   4125  S  SG  . CYS E  2 62  ? -19.525 21.955  -34.495 1.00 38.20 ? 267  CYS E SG  1 
ATOM   4126  N  N   . SER E  2 63  ? -22.337 17.886  -34.119 1.00 29.46 ? 268  SER E N   1 
ATOM   4127  C  CA  . SER E  2 63  ? -22.606 16.622  -33.411 1.00 27.82 ? 268  SER E CA  1 
ATOM   4128  C  C   . SER E  2 63  ? -22.791 15.423  -34.336 1.00 27.83 ? 268  SER E C   1 
ATOM   4129  O  O   . SER E  2 63  ? -23.699 15.394  -35.172 1.00 27.52 ? 268  SER E O   1 
ATOM   4130  C  CB  . SER E  2 63  ? -23.814 16.715  -32.485 1.00 26.33 ? 268  SER E CB  1 
ATOM   4131  O  OG  . SER E  2 63  ? -23.890 15.538  -31.696 1.00 25.17 ? 268  SER E OG  1 
ATOM   4132  N  N   . GLN E  2 64  ? -21.926 14.433  -34.129 1.00 27.92 ? 269  GLN E N   1 
ATOM   4133  C  CA  . GLN E  2 64  ? -22.060 13.106  -34.720 1.00 28.21 ? 269  GLN E CA  1 
ATOM   4134  C  C   . GLN E  2 64  ? -23.117 12.236  -34.023 1.00 25.77 ? 269  GLN E C   1 
ATOM   4135  O  O   . GLN E  2 64  ? -23.409 11.131  -34.493 1.00 26.36 ? 269  GLN E O   1 
ATOM   4136  C  CB  . GLN E  2 64  ? -20.709 12.372  -34.676 1.00 29.69 ? 269  GLN E CB  1 
ATOM   4137  C  CG  . GLN E  2 64  ? -19.613 13.022  -35.505 1.00 31.82 ? 269  GLN E CG  1 
ATOM   4138  C  CD  . GLN E  2 64  ? -19.939 13.004  -36.983 1.00 33.77 ? 269  GLN E CD  1 
ATOM   4139  O  OE1 . GLN E  2 64  ? -19.752 11.987  -37.658 1.00 35.98 ? 269  GLN E OE1 1 
ATOM   4140  N  NE2 . GLN E  2 64  ? -20.436 14.133  -37.501 1.00 34.56 ? 269  GLN E NE2 1 
ATOM   4141  N  N   . TYR E  2 65  ? -23.687 12.715  -32.919 1.00 23.52 ? 270  TYR E N   1 
ATOM   4142  C  CA  . TYR E  2 65  ? -24.749 11.991  -32.245 1.00 21.85 ? 270  TYR E CA  1 
ATOM   4143  C  C   . TYR E  2 65  ? -26.140 12.402  -32.744 1.00 21.50 ? 270  TYR E C   1 
ATOM   4144  O  O   . TYR E  2 65  ? -27.159 11.982  -32.165 1.00 20.64 ? 270  TYR E O   1 
ATOM   4145  C  CB  . TYR E  2 65  ? -24.656 12.185  -30.726 1.00 20.52 ? 270  TYR E CB  1 
ATOM   4146  C  CG  . TYR E  2 65  ? -23.391 11.670  -30.057 1.00 20.37 ? 270  TYR E CG  1 
ATOM   4147  C  CD1 . TYR E  2 65  ? -22.488 10.818  -30.711 1.00 21.25 ? 270  TYR E CD1 1 
ATOM   4148  C  CD2 . TYR E  2 65  ? -23.110 12.017  -28.745 1.00 19.50 ? 270  TYR E CD2 1 
ATOM   4149  C  CE1 . TYR E  2 65  ? -21.333 10.361  -30.068 1.00 21.20 ? 270  TYR E CE1 1 
ATOM   4150  C  CE2 . TYR E  2 65  ? -21.973 11.561  -28.101 1.00 19.54 ? 270  TYR E CE2 1 
ATOM   4151  C  CZ  . TYR E  2 65  ? -21.091 10.737  -28.753 1.00 20.36 ? 270  TYR E CZ  1 
ATOM   4152  O  OH  . TYR E  2 65  ? -19.986 10.309  -28.067 1.00 20.44 ? 270  TYR E OH  1 
ATOM   4153  N  N   . ALA E  2 66  ? -26.185 13.221  -33.796 1.00 22.31 ? 271  ALA E N   1 
ATOM   4154  C  CA  . ALA E  2 66  ? -27.446 13.597  -34.444 1.00 22.28 ? 271  ALA E CA  1 
ATOM   4155  C  C   . ALA E  2 66  ? -27.266 13.856  -35.954 1.00 23.72 ? 271  ALA E C   1 
ATOM   4156  O  O   . ALA E  2 66  ? -26.173 13.697  -36.489 1.00 24.44 ? 271  ALA E O   1 
ATOM   4157  C  CB  . ALA E  2 66  ? -28.056 14.808  -33.749 1.00 21.61 ? 271  ALA E CB  1 
ATOM   4158  N  N   . GLN E  2 67  ? -28.348 14.237  -36.630 1.00 24.22 ? 272  GLN E N   1 
ATOM   4159  C  CA  . GLN E  2 67  ? -28.351 14.376  -38.102 1.00 25.99 ? 272  GLN E CA  1 
ATOM   4160  C  C   . GLN E  2 67  ? -28.702 15.794  -38.549 1.00 27.01 ? 272  GLN E C   1 
ATOM   4161  O  O   . GLN E  2 67  ? -29.487 15.978  -39.481 1.00 28.31 ? 272  GLN E O   1 
ATOM   4162  C  CB  . GLN E  2 67  ? -29.340 13.382  -38.746 1.00 26.08 ? 272  GLN E CB  1 
ATOM   4163  C  CG  . GLN E  2 67  ? -28.959 11.919  -38.606 1.00 25.76 ? 272  GLN E CG  1 
ATOM   4164  C  CD  . GLN E  2 67  ? -29.148 11.400  -37.196 1.00 24.17 ? 272  GLN E CD  1 
ATOM   4165  O  OE1 . GLN E  2 67  ? -30.206 11.581  -36.586 1.00 23.39 ? 272  GLN E OE1 1 
ATOM   4166  N  NE2 . GLN E  2 67  ? -28.112 10.760  -36.663 1.00 23.94 ? 272  GLN E NE2 1 
ATOM   4167  N  N   . GLY E  2 68  ? -28.130 16.777  -37.867 1.00 26.99 ? 273  GLY E N   1 
ATOM   4168  C  CA  . GLY E  2 68  ? -28.209 18.170  -38.264 1.00 28.32 ? 273  GLY E CA  1 
ATOM   4169  C  C   . GLY E  2 68  ? -29.618 18.698  -38.334 1.00 28.52 ? 273  GLY E C   1 
ATOM   4170  O  O   . GLY E  2 68  ? -30.390 18.532  -37.392 1.00 26.94 ? 273  GLY E O   1 
ATOM   4171  N  N   . CYS E  2 69  ? -29.954 19.331  -39.466 1.00 30.68 ? 274  CYS E N   1 
ATOM   4172  C  CA  . CYS E  2 69  ? -31.325 19.801  -39.715 1.00 31.16 ? 274  CYS E CA  1 
ATOM   4173  C  C   . CYS E  2 69  ? -32.242 18.644  -40.089 1.00 30.52 ? 274  CYS E C   1 
ATOM   4174  O  O   . CYS E  2 69  ? -33.447 18.837  -40.223 1.00 30.36 ? 274  CYS E O   1 
ATOM   4175  C  CB  . CYS E  2 69  ? -31.385 20.859  -40.818 1.00 33.65 ? 274  CYS E CB  1 
ATOM   4176  S  SG  . CYS E  2 69  ? -30.796 22.505  -40.365 1.00 35.11 ? 274  CYS E SG  1 
ATOM   4177  N  N   . GLU E  2 70  ? -31.681 17.447  -40.235 1.00 30.27 ? 275  GLU E N   1 
ATOM   4178  C  CA  . GLU E  2 70  ? -32.498 16.259  -40.463 1.00 30.18 ? 275  GLU E CA  1 
ATOM   4179  C  C   . GLU E  2 70  ? -32.859 15.547  -39.148 1.00 27.97 ? 275  GLU E C   1 
ATOM   4180  O  O   . GLU E  2 70  ? -33.065 14.342  -39.145 1.00 27.75 ? 275  GLU E O   1 
ATOM   4181  C  CB  . GLU E  2 70  ? -31.830 15.267  -41.451 1.00 31.49 ? 275  GLU E CB  1 
ATOM   4182  C  CG  . GLU E  2 70  ? -30.866 15.852  -42.485 1.00 33.52 ? 275  GLU E CG  1 
ATOM   4183  C  CD  . GLU E  2 70  ? -31.281 17.213  -43.010 1.00 34.86 ? 275  GLU E CD  1 
ATOM   4184  O  OE1 . GLU E  2 70  ? -32.392 17.329  -43.563 1.00 36.26 ? 275  GLU E OE1 1 
ATOM   4185  O  OE2 . GLU E  2 70  ? -30.489 18.169  -42.868 1.00 35.73 ? 275  GLU E OE2 1 
ATOM   4186  N  N   . GLY E  2 71  ? -32.938 16.286  -38.042 1.00 26.75 ? 276  GLY E N   1 
ATOM   4187  C  CA  . GLY E  2 71  ? -33.451 15.745  -36.764 1.00 24.99 ? 276  GLY E CA  1 
ATOM   4188  C  C   . GLY E  2 71  ? -32.467 15.011  -35.859 1.00 23.42 ? 276  GLY E C   1 
ATOM   4189  O  O   . GLY E  2 71  ? -31.303 14.807  -36.214 1.00 23.64 ? 276  GLY E O   1 
ATOM   4190  N  N   . GLY E  2 72  ? -32.959 14.603  -34.690 1.00 21.60 ? 277  GLY E N   1 
ATOM   4191  C  CA  . GLY E  2 72  ? -32.143 13.940  -33.676 1.00 20.50 ? 277  GLY E CA  1 
ATOM   4192  C  C   . GLY E  2 72  ? -32.864 13.740  -32.347 1.00 19.05 ? 277  GLY E C   1 
ATOM   4193  O  O   . GLY E  2 72  ? -34.070 13.960  -32.251 1.00 19.13 ? 277  GLY E O   1 
ATOM   4194  N  N   . PHE E  2 73  ? -32.135 13.322  -31.316 1.00 18.07 ? 278  PHE E N   1 
ATOM   4195  C  CA  . PHE E  2 73  ? -32.777 12.972  -30.045 1.00 16.90 ? 278  PHE E CA  1 
ATOM   4196  C  C   . PHE E  2 73  ? -32.146 13.603  -28.795 1.00 15.91 ? 278  PHE E C   1 
ATOM   4197  O  O   . PHE E  2 73  ? -30.946 13.498  -28.576 1.00 15.77 ? 278  PHE E O   1 
ATOM   4198  C  CB  . PHE E  2 73  ? -32.905 11.441  -29.936 1.00 16.83 ? 278  PHE E CB  1 
ATOM   4199  C  CG  . PHE E  2 73  ? -33.867 10.875  -30.938 1.00 17.35 ? 278  PHE E CG  1 
ATOM   4200  C  CD1 . PHE E  2 73  ? -33.464 10.653  -32.246 1.00 18.27 ? 278  PHE E CD1 1 
ATOM   4201  C  CD2 . PHE E  2 73  ? -35.189 10.654  -30.605 1.00 17.11 ? 278  PHE E CD2 1 
ATOM   4202  C  CE1 . PHE E  2 73  ? -34.352 10.195  -33.203 1.00 18.84 ? 278  PHE E CE1 1 
ATOM   4203  C  CE2 . PHE E  2 73  ? -36.093 10.178  -31.560 1.00 17.67 ? 278  PHE E CE2 1 
ATOM   4204  C  CZ  . PHE E  2 73  ? -35.672 9.952   -32.858 1.00 18.49 ? 278  PHE E CZ  1 
ATOM   4205  N  N   . PRO E  2 74  ? -32.973 14.271  -27.972 1.00 15.28 ? 279  PRO E N   1 
ATOM   4206  C  CA  . PRO E  2 74  ? -32.495 14.892  -26.744 1.00 14.69 ? 279  PRO E CA  1 
ATOM   4207  C  C   . PRO E  2 74  ? -31.609 14.001  -25.849 1.00 13.97 ? 279  PRO E C   1 
ATOM   4208  O  O   . PRO E  2 74  ? -30.631 14.491  -25.290 1.00 13.84 ? 279  PRO E O   1 
ATOM   4209  C  CB  . PRO E  2 74  ? -33.789 15.280  -26.035 1.00 14.47 ? 279  PRO E CB  1 
ATOM   4210  C  CG  . PRO E  2 74  ? -34.750 15.538  -27.136 1.00 15.02 ? 279  PRO E CG  1 
ATOM   4211  C  CD  . PRO E  2 74  ? -34.399 14.561  -28.207 1.00 15.48 ? 279  PRO E CD  1 
ATOM   4212  N  N   . TYR E  2 75  ? -31.922 12.713  -25.739 1.00 13.52 ? 280  TYR E N   1 
ATOM   4213  C  CA  . TYR E  2 75  ? -31.091 11.790  -24.952 1.00 13.12 ? 280  TYR E CA  1 
ATOM   4214  C  C   . TYR E  2 75  ? -29.622 11.859  -25.373 1.00 13.50 ? 280  TYR E C   1 
ATOM   4215  O  O   . TYR E  2 75  ? -28.731 11.821  -24.539 1.00 13.35 ? 280  TYR E O   1 
ATOM   4216  C  CB  . TYR E  2 75  ? -31.582 10.343  -25.090 1.00 12.97 ? 280  TYR E CB  1 
ATOM   4217  C  CG  . TYR E  2 75  ? -30.808 9.334   -24.260 1.00 12.76 ? 280  TYR E CG  1 
ATOM   4218  C  CD1 . TYR E  2 75  ? -29.644 8.747   -24.740 1.00 13.12 ? 280  TYR E CD1 1 
ATOM   4219  C  CD2 . TYR E  2 75  ? -31.253 8.959   -22.988 1.00 12.39 ? 280  TYR E CD2 1 
ATOM   4220  C  CE1 . TYR E  2 75  ? -28.936 7.824   -23.972 1.00 13.10 ? 280  TYR E CE1 1 
ATOM   4221  C  CE2 . TYR E  2 75  ? -30.557 8.051   -22.225 1.00 12.41 ? 280  TYR E CE2 1 
ATOM   4222  C  CZ  . TYR E  2 75  ? -29.398 7.486   -22.722 1.00 12.77 ? 280  TYR E CZ  1 
ATOM   4223  O  OH  . TYR E  2 75  ? -28.723 6.575   -21.972 1.00 12.98 ? 280  TYR E OH  1 
ATOM   4224  N  N   . LEU E  2 76  ? -29.393 11.951  -26.678 1.00 14.10 ? 281  LEU E N   1 
ATOM   4225  C  CA  . LEU E  2 76  ? -28.048 11.919  -27.250 1.00 14.70 ? 281  LEU E CA  1 
ATOM   4226  C  C   . LEU E  2 76  ? -27.354 13.282  -27.277 1.00 15.14 ? 281  LEU E C   1 
ATOM   4227  O  O   . LEU E  2 76  ? -26.146 13.326  -27.460 1.00 15.76 ? 281  LEU E O   1 
ATOM   4228  C  CB  . LEU E  2 76  ? -28.081 11.325  -28.664 1.00 15.34 ? 281  LEU E CB  1 
ATOM   4229  C  CG  . LEU E  2 76  ? -28.272 9.806   -28.724 1.00 15.27 ? 281  LEU E CG  1 
ATOM   4230  C  CD1 . LEU E  2 76  ? -28.488 9.325   -30.145 1.00 15.98 ? 281  LEU E CD1 1 
ATOM   4231  C  CD2 . LEU E  2 76  ? -27.090 9.067   -28.089 1.00 15.36 ? 281  LEU E CD2 1 
ATOM   4232  N  N   . ILE E  2 77  ? -28.097 14.370  -27.079 1.00 15.03 ? 282  ILE E N   1 
ATOM   4233  C  CA  . ILE E  2 77  ? -27.527 15.725  -27.107 1.00 15.59 ? 282  ILE E CA  1 
ATOM   4234  C  C   . ILE E  2 77  ? -27.421 16.348  -25.709 1.00 15.20 ? 282  ILE E C   1 
ATOM   4235  O  O   . ILE E  2 77  ? -26.325 16.651  -25.249 1.00 15.46 ? 282  ILE E O   1 
ATOM   4236  C  CB  . ILE E  2 77  ? -28.332 16.659  -28.025 1.00 16.14 ? 282  ILE E CB  1 
ATOM   4237  C  CG1 . ILE E  2 77  ? -28.427 16.086  -29.446 1.00 16.73 ? 282  ILE E CG1 1 
ATOM   4238  C  CG2 . ILE E  2 77  ? -27.709 18.048  -28.046 1.00 16.92 ? 282  ILE E CG2 1 
ATOM   4239  C  CD1 . ILE E  2 77  ? -27.122 15.589  -30.035 1.00 17.38 ? 282  ILE E CD1 1 
ATOM   4240  N  N   . ALA E  2 78  ? -28.559 16.544  -25.045 1.00 14.71 ? 283  ALA E N   1 
ATOM   4241  C  CA  . ALA E  2 78  ? -28.591 17.053  -23.674 1.00 14.42 ? 283  ALA E CA  1 
ATOM   4242  C  C   . ALA E  2 78  ? -27.876 16.110  -22.736 1.00 14.04 ? 283  ALA E C   1 
ATOM   4243  O  O   . ALA E  2 78  ? -27.291 16.527  -21.727 1.00 13.99 ? 283  ALA E O   1 
ATOM   4244  C  CB  . ALA E  2 78  ? -30.024 17.233  -23.206 1.00 14.17 ? 283  ALA E CB  1 
ATOM   4245  N  N   . GLY E  2 79  ? -27.965 14.828  -23.061 1.00 13.81 ? 284  GLY E N   1 
ATOM   4246  C  CA  . GLY E  2 79  ? -27.305 13.798  -22.300 1.00 13.62 ? 284  GLY E CA  1 
ATOM   4247  C  C   . GLY E  2 79  ? -25.931 13.500  -22.850 1.00 14.18 ? 284  GLY E C   1 
ATOM   4248  O  O   . GLY E  2 79  ? -24.943 14.041  -22.383 1.00 14.52 ? 284  GLY E O   1 
ATOM   4249  N  N   . LYS E  2 80  ? -25.857 12.639  -23.852 1.00 14.43 ? 285  LYS E N   1 
ATOM   4250  C  CA  . LYS E  2 80  ? -24.581 12.067  -24.210 1.00 15.07 ? 285  LYS E CA  1 
ATOM   4251  C  C   . LYS E  2 80  ? -23.614 13.075  -24.793 1.00 15.79 ? 285  LYS E C   1 
ATOM   4252  O  O   . LYS E  2 80  ? -22.441 13.076  -24.431 1.00 16.20 ? 285  LYS E O   1 
ATOM   4253  C  CB  . LYS E  2 80  ? -24.753 10.913  -25.189 1.00 15.44 ? 285  LYS E CB  1 
ATOM   4254  C  CG  . LYS E  2 80  ? -23.528 10.022  -25.219 1.00 16.17 ? 285  LYS E CG  1 
ATOM   4255  C  CD  . LYS E  2 80  ? -23.703 8.777   -26.081 1.00 16.54 ? 285  LYS E CD  1 
ATOM   4256  C  CE  . LYS E  2 80  ? -22.368 8.041   -26.118 1.00 17.36 ? 285  LYS E CE  1 
ATOM   4257  N  NZ  . LYS E  2 80  ? -22.022 7.479   -24.786 1.00 17.10 ? 285  LYS E NZ  1 
ATOM   4258  N  N   . TYR E  2 81  ? -24.086 13.915  -25.713 1.00 16.02 ? 286  TYR E N   1 
ATOM   4259  C  CA  . TYR E  2 81  ? -23.204 14.879  -26.351 1.00 16.93 ? 286  TYR E CA  1 
ATOM   4260  C  C   . TYR E  2 81  ? -22.711 15.903  -25.332 1.00 16.89 ? 286  TYR E C   1 
ATOM   4261  O  O   . TYR E  2 81  ? -21.538 16.253  -25.304 1.00 17.47 ? 286  TYR E O   1 
ATOM   4262  C  CB  . TYR E  2 81  ? -23.890 15.601  -27.511 1.00 17.38 ? 286  TYR E CB  1 
ATOM   4263  C  CG  . TYR E  2 81  ? -22.927 16.452  -28.275 1.00 18.60 ? 286  TYR E CG  1 
ATOM   4264  C  CD1 . TYR E  2 81  ? -21.911 15.869  -29.021 1.00 19.49 ? 286  TYR E CD1 1 
ATOM   4265  C  CD2 . TYR E  2 81  ? -23.007 17.843  -28.232 1.00 19.07 ? 286  TYR E CD2 1 
ATOM   4266  C  CE1 . TYR E  2 81  ? -20.996 16.651  -29.719 1.00 20.84 ? 286  TYR E CE1 1 
ATOM   4267  C  CE2 . TYR E  2 81  ? -22.097 18.634  -28.924 1.00 20.38 ? 286  TYR E CE2 1 
ATOM   4268  C  CZ  . TYR E  2 81  ? -21.102 18.027  -29.675 1.00 21.26 ? 286  TYR E CZ  1 
ATOM   4269  O  OH  . TYR E  2 81  ? -20.198 18.794  -30.365 1.00 22.95 ? 286  TYR E OH  1 
ATOM   4270  N  N   . ALA E  2 82  ? -23.625 16.367  -24.491 1.00 16.23 ? 287  ALA E N   1 
ATOM   4271  C  CA  . ALA E  2 82  ? -23.276 17.307  -23.450 1.00 16.29 ? 287  ALA E CA  1 
ATOM   4272  C  C   . ALA E  2 82  ? -22.237 16.720  -22.490 1.00 16.46 ? 287  ALA E C   1 
ATOM   4273  O  O   . ALA E  2 82  ? -21.322 17.409  -22.077 1.00 17.15 ? 287  ALA E O   1 
ATOM   4274  C  CB  . ALA E  2 82  ? -24.521 17.743  -22.710 1.00 15.60 ? 287  ALA E CB  1 
ATOM   4275  N  N   . GLN E  2 83  ? -22.350 15.444  -22.157 1.00 16.12 ? 288  GLN E N   1 
ATOM   4276  C  CA  . GLN E  2 83  ? -21.385 14.821  -21.248 1.00 16.43 ? 288  GLN E CA  1 
ATOM   4277  C  C   . GLN E  2 83  ? -19.993 14.596  -21.874 1.00 17.44 ? 288  GLN E C   1 
ATOM   4278  O  O   . GLN E  2 83  ? -18.971 14.829  -21.227 1.00 17.93 ? 288  GLN E O   1 
ATOM   4279  C  CB  . GLN E  2 83  ? -21.943 13.488  -20.733 1.00 15.85 ? 288  GLN E CB  1 
ATOM   4280  C  CG  . GLN E  2 83  ? -20.966 12.716  -19.872 1.00 16.21 ? 288  GLN E CG  1 
ATOM   4281  C  CD  . GLN E  2 83  ? -21.631 11.614  -19.081 1.00 15.78 ? 288  GLN E CD  1 
ATOM   4282  O  OE1 . GLN E  2 83  ? -21.448 10.413  -19.362 1.00 16.06 ? 288  GLN E OE1 1 
ATOM   4283  N  NE2 . GLN E  2 83  ? -22.407 12.010  -18.077 1.00 15.40 ? 288  GLN E NE2 1 
ATOM   4284  N  N   . ASP E  2 84  ? -19.976 14.117  -23.118 1.00 17.99 ? 289  ASP E N   1 
ATOM   4285  C  CA  . ASP E  2 84  ? -18.754 13.688  -23.795 1.00 19.10 ? 289  ASP E CA  1 
ATOM   4286  C  C   . ASP E  2 84  ? -17.975 14.853  -24.360 1.00 20.28 ? 289  ASP E C   1 
ATOM   4287  O  O   . ASP E  2 84  ? -16.747 14.909  -24.220 1.00 21.46 ? 289  ASP E O   1 
ATOM   4288  C  CB  . ASP E  2 84  ? -19.079 12.722  -24.936 1.00 19.20 ? 289  ASP E CB  1 
ATOM   4289  C  CG  . ASP E  2 84  ? -19.602 11.393  -24.449 1.00 18.68 ? 289  ASP E CG  1 
ATOM   4290  O  OD1 . ASP E  2 84  ? -19.533 11.146  -23.215 1.00 18.51 ? 289  ASP E OD1 1 
ATOM   4291  O  OD2 . ASP E  2 84  ? -20.084 10.590  -25.298 1.00 18.56 ? 289  ASP E OD2 1 
ATOM   4292  N  N   . PHE E  2 85  ? -18.685 15.770  -25.011 1.00 20.45 ? 290  PHE E N   1 
ATOM   4293  C  CA  . PHE E  2 85  ? -18.044 16.893  -25.718 1.00 21.69 ? 290  PHE E CA  1 
ATOM   4294  C  C   . PHE E  2 85  ? -18.349 18.272  -25.135 1.00 21.47 ? 290  PHE E C   1 
ATOM   4295  O  O   . PHE E  2 85  ? -17.530 19.173  -25.241 1.00 22.42 ? 290  PHE E O   1 
ATOM   4296  C  CB  . PHE E  2 85  ? -18.367 16.807  -27.212 1.00 22.30 ? 290  PHE E CB  1 
ATOM   4297  C  CG  . PHE E  2 85  ? -17.811 15.560  -27.852 1.00 22.90 ? 290  PHE E CG  1 
ATOM   4298  C  CD1 . PHE E  2 85  ? -16.463 15.477  -28.172 1.00 24.42 ? 290  PHE E CD1 1 
ATOM   4299  C  CD2 . PHE E  2 85  ? -18.624 14.445  -28.078 1.00 22.22 ? 290  PHE E CD2 1 
ATOM   4300  C  CE1 . PHE E  2 85  ? -15.942 14.316  -28.732 1.00 25.03 ? 290  PHE E CE1 1 
ATOM   4301  C  CE2 . PHE E  2 85  ? -18.112 13.281  -28.631 1.00 22.70 ? 290  PHE E CE2 1 
ATOM   4302  C  CZ  . PHE E  2 85  ? -16.774 13.213  -28.955 1.00 24.11 ? 290  PHE E CZ  1 
ATOM   4303  N  N   . GLY E  2 86  ? -19.507 18.431  -24.506 1.00 20.42 ? 291  GLY E N   1 
ATOM   4304  C  CA  . GLY E  2 86  ? -19.874 19.702  -23.904 1.00 20.41 ? 291  GLY E CA  1 
ATOM   4305  C  C   . GLY E  2 86  ? -20.513 20.632  -24.909 1.00 20.96 ? 291  GLY E C   1 
ATOM   4306  O  O   . GLY E  2 86  ? -20.446 20.396  -26.117 1.00 21.48 ? 291  GLY E O   1 
ATOM   4307  N  N   . LEU E  2 87  ? -21.118 21.699  -24.399 1.00 21.00 ? 292  LEU E N   1 
ATOM   4308  C  CA  . LEU E  2 87  ? -21.881 22.642  -25.200 1.00 21.52 ? 292  LEU E CA  1 
ATOM   4309  C  C   . LEU E  2 87  ? -21.320 24.049  -25.025 1.00 22.83 ? 292  LEU E C   1 
ATOM   4310  O  O   . LEU E  2 87  ? -20.885 24.419  -23.928 1.00 22.70 ? 292  LEU E O   1 
ATOM   4311  C  CB  . LEU E  2 87  ? -23.340 22.656  -24.754 1.00 20.47 ? 292  LEU E CB  1 
ATOM   4312  C  CG  . LEU E  2 87  ? -24.035 21.310  -24.613 1.00 19.47 ? 292  LEU E CG  1 
ATOM   4313  C  CD1 . LEU E  2 87  ? -25.430 21.509  -24.053 1.00 18.76 ? 292  LEU E CD1 1 
ATOM   4314  C  CD2 . LEU E  2 87  ? -24.089 20.580  -25.942 1.00 19.75 ? 292  LEU E CD2 1 
ATOM   4315  N  N   . VAL E  2 88  ? -21.371 24.839  -26.098 1.00 24.14 ? 293  VAL E N   1 
ATOM   4316  C  CA  . VAL E  2 88  ? -20.920 26.231  -26.050 1.00 25.62 ? 293  VAL E CA  1 
ATOM   4317  C  C   . VAL E  2 88  ? -22.095 27.193  -25.987 1.00 26.12 ? 293  VAL E C   1 
ATOM   4318  O  O   . VAL E  2 88  ? -23.245 26.804  -26.188 1.00 25.30 ? 293  VAL E O   1 
ATOM   4319  C  CB  . VAL E  2 88  ? -20.008 26.597  -27.242 1.00 27.04 ? 293  VAL E CB  1 
ATOM   4320  C  CG1 . VAL E  2 88  ? -18.727 25.784  -27.189 1.00 27.25 ? 293  VAL E CG1 1 
ATOM   4321  C  CG2 . VAL E  2 88  ? -20.720 26.412  -28.576 1.00 27.31 ? 293  VAL E CG2 1 
ATOM   4322  N  N   . GLU E  2 89  ? -21.786 28.451  -25.701 1.00 27.92 ? 294  GLU E N   1 
ATOM   4323  C  CA  . GLU E  2 89  ? -22.783 29.510  -25.702 1.00 28.98 ? 294  GLU E CA  1 
ATOM   4324  C  C   . GLU E  2 89  ? -23.113 30.005  -27.101 1.00 30.56 ? 294  GLU E C   1 
ATOM   4325  O  O   . GLU E  2 89  ? -22.325 29.843  -28.040 1.00 31.51 ? 294  GLU E O   1 
ATOM   4326  C  CB  . GLU E  2 89  ? -22.349 30.659  -24.804 1.00 30.00 ? 294  GLU E CB  1 
ATOM   4327  C  CG  . GLU E  2 89  ? -22.183 30.183  -23.367 1.00 29.25 ? 294  GLU E CG  1 
ATOM   4328  C  CD  . GLU E  2 89  ? -22.112 31.308  -22.356 1.00 30.69 ? 294  GLU E CD  1 
ATOM   4329  O  OE1 . GLU E  2 89  ? -22.920 32.274  -22.458 1.00 31.88 ? 294  GLU E OE1 1 
ATOM   4330  O  OE2 . GLU E  2 89  ? -21.256 31.212  -21.449 1.00 30.89 ? 294  GLU E OE2 1 
ATOM   4331  N  N   . GLU E  2 90  ? -24.311 30.581  -27.208 1.00 31.20 ? 295  GLU E N   1 
ATOM   4332  C  CA  . GLU E  2 90  ? -24.868 31.049  -28.465 1.00 33.07 ? 295  GLU E CA  1 
ATOM   4333  C  C   . GLU E  2 90  ? -23.892 31.968  -29.194 1.00 35.78 ? 295  GLU E C   1 
ATOM   4334  O  O   . GLU E  2 90  ? -23.726 31.833  -30.401 1.00 37.55 ? 295  GLU E O   1 
ATOM   4335  C  CB  . GLU E  2 90  ? -26.220 31.743  -28.211 1.00 33.03 ? 295  GLU E CB  1 
ATOM   4336  C  CG  . GLU E  2 90  ? -26.849 32.468  -29.399 1.00 34.32 ? 295  GLU E CG  1 
ATOM   4337  C  CD  . GLU E  2 90  ? -27.340 31.551  -30.512 1.00 34.58 ? 295  GLU E CD  1 
ATOM   4338  O  OE1 . GLU E  2 90  ? -27.410 30.313  -30.315 1.00 32.90 ? 295  GLU E OE1 1 
ATOM   4339  O  OE2 . GLU E  2 90  ? -27.668 32.086  -31.609 1.00 36.51 ? 295  GLU E OE2 1 
ATOM   4340  N  N   . ALA E  2 91  ? -23.231 32.870  -28.466 1.00 37.36 ? 296  ALA E N   1 
ATOM   4341  C  CA  . ALA E  2 91  ? -22.283 33.827  -29.072 1.00 40.60 ? 296  ALA E CA  1 
ATOM   4342  C  C   . ALA E  2 91  ? -21.074 33.137  -29.727 1.00 42.22 ? 296  ALA E C   1 
ATOM   4343  O  O   . ALA E  2 91  ? -20.519 33.639  -30.694 1.00 44.65 ? 296  ALA E O   1 
ATOM   4344  C  CB  . ALA E  2 91  ? -21.815 34.848  -28.042 1.00 40.88 ? 296  ALA E CB  1 
ATOM   4345  N  N   . CYS E  2 92  ? -20.677 31.984  -29.202 1.00 42.01 ? 297  CYS E N   1 
ATOM   4346  C  CA  . CYS E  2 92  ? -19.577 31.218  -29.788 1.00 43.78 ? 297  CYS E CA  1 
ATOM   4347  C  C   . CYS E  2 92  ? -19.948 30.642  -31.166 1.00 43.65 ? 297  CYS E C   1 
ATOM   4348  O  O   . CYS E  2 92  ? -19.078 30.457  -32.018 1.00 45.17 ? 297  CYS E O   1 
ATOM   4349  C  CB  . CYS E  2 92  ? -19.154 30.097  -28.833 1.00 44.22 ? 297  CYS E CB  1 
ATOM   4350  S  SG  . CYS E  2 92  ? -17.653 29.205  -29.314 1.00 51.18 ? 297  CYS E SG  1 
ATOM   4351  N  N   . PHE E  2 93  ? -21.242 30.385  -31.385 1.00 42.25 ? 298  PHE E N   1 
ATOM   4352  C  CA  . PHE E  2 93  ? -21.723 29.765  -32.617 1.00 41.05 ? 298  PHE E CA  1 
ATOM   4353  C  C   . PHE E  2 93  ? -23.196 30.117  -32.860 1.00 39.79 ? 298  PHE E C   1 
ATOM   4354  O  O   . PHE E  2 93  ? -24.080 29.332  -32.546 1.00 38.15 ? 298  PHE E O   1 
ATOM   4355  C  CB  . PHE E  2 93  ? -21.560 28.247  -32.513 1.00 40.19 ? 298  PHE E CB  1 
ATOM   4356  C  CG  . PHE E  2 93  ? -21.398 27.555  -33.838 1.00 41.44 ? 298  PHE E CG  1 
ATOM   4357  C  CD1 . PHE E  2 93  ? -22.039 28.021  -34.986 1.00 42.45 ? 298  PHE E CD1 1 
ATOM   4358  C  CD2 . PHE E  2 93  ? -20.610 26.417  -33.931 1.00 41.58 ? 298  PHE E CD2 1 
ATOM   4359  C  CE1 . PHE E  2 93  ? -21.879 27.374  -36.198 1.00 43.58 ? 298  PHE E CE1 1 
ATOM   4360  C  CE2 . PHE E  2 93  ? -20.445 25.767  -35.140 1.00 42.40 ? 298  PHE E CE2 1 
ATOM   4361  C  CZ  . PHE E  2 93  ? -21.082 26.243  -36.273 1.00 43.64 ? 298  PHE E CZ  1 
ATOM   4362  N  N   . PRO E  2 94  ? -23.466 31.302  -33.426 1.00 40.32 ? 299  PRO E N   1 
ATOM   4363  C  CA  . PRO E  2 94  ? -24.854 31.752  -33.601 1.00 39.89 ? 299  PRO E CA  1 
ATOM   4364  C  C   . PRO E  2 94  ? -25.714 30.906  -34.569 1.00 39.29 ? 299  PRO E C   1 
ATOM   4365  O  O   . PRO E  2 94  ? -25.185 30.272  -35.486 1.00 39.45 ? 299  PRO E O   1 
ATOM   4366  C  CB  . PRO E  2 94  ? -24.692 33.189  -34.133 1.00 41.84 ? 299  PRO E CB  1 
ATOM   4367  C  CG  . PRO E  2 94  ? -23.297 33.585  -33.785 1.00 42.60 ? 299  PRO E CG  1 
ATOM   4368  C  CD  . PRO E  2 94  ? -22.498 32.329  -33.856 1.00 42.07 ? 299  PRO E CD  1 
ATOM   4369  N  N   . TYR E  2 95  ? -27.035 30.941  -34.371 1.00 38.13 ? 300  TYR E N   1 
ATOM   4370  C  CA  . TYR E  2 95  ? -27.971 30.085  -35.116 1.00 37.30 ? 300  TYR E CA  1 
ATOM   4371  C  C   . TYR E  2 95  ? -28.221 30.538  -36.551 1.00 38.81 ? 300  TYR E C   1 
ATOM   4372  O  O   . TYR E  2 95  ? -28.773 31.607  -36.764 1.00 39.52 ? 300  TYR E O   1 
ATOM   4373  C  CB  . TYR E  2 95  ? -29.317 29.988  -34.384 1.00 35.74 ? 300  TYR E CB  1 
ATOM   4374  C  CG  . TYR E  2 95  ? -30.238 28.937  -34.973 1.00 35.01 ? 300  TYR E CG  1 
ATOM   4375  C  CD1 . TYR E  2 95  ? -29.898 27.588  -34.934 1.00 33.84 ? 300  TYR E CD1 1 
ATOM   4376  C  CD2 . TYR E  2 95  ? -31.445 29.287  -35.571 1.00 35.48 ? 300  TYR E CD2 1 
ATOM   4377  C  CE1 . TYR E  2 95  ? -30.727 26.621  -35.471 1.00 33.18 ? 300  TYR E CE1 1 
ATOM   4378  C  CE2 . TYR E  2 95  ? -32.282 28.322  -36.113 1.00 34.86 ? 300  TYR E CE2 1 
ATOM   4379  C  CZ  . TYR E  2 95  ? -31.914 26.992  -36.054 1.00 33.75 ? 300  TYR E CZ  1 
ATOM   4380  O  OH  . TYR E  2 95  ? -32.725 26.028  -36.590 1.00 32.99 ? 300  TYR E OH  1 
ATOM   4381  N  N   . THR E  2 96  ? -27.841 29.698  -37.519 1.00 39.39 ? 301  THR E N   1 
ATOM   4382  C  CA  . THR E  2 96  ? -28.108 29.940  -38.954 1.00 41.11 ? 301  THR E CA  1 
ATOM   4383  C  C   . THR E  2 96  ? -29.350 29.190  -39.467 1.00 40.53 ? 301  THR E C   1 
ATOM   4384  O  O   . THR E  2 96  ? -29.974 29.604  -40.431 1.00 41.29 ? 301  THR E O   1 
ATOM   4385  C  CB  . THR E  2 96  ? -26.908 29.534  -39.850 1.00 42.28 ? 301  THR E CB  1 
ATOM   4386  O  OG1 . THR E  2 96  ? -26.815 28.110  -39.931 1.00 41.29 ? 301  THR E OG1 1 
ATOM   4387  C  CG2 . THR E  2 96  ? -25.591 30.091  -39.313 1.00 42.83 ? 301  THR E CG2 1 
ATOM   4388  N  N   . GLY E  2 97  ? -29.698 28.077  -38.830 1.00 39.25 ? 302  GLY E N   1 
ATOM   4389  C  CA  . GLY E  2 97  ? -30.822 27.254  -39.297 1.00 38.82 ? 302  GLY E CA  1 
ATOM   4390  C  C   . GLY E  2 97  ? -30.544 26.507  -40.592 1.00 40.06 ? 302  GLY E C   1 
ATOM   4391  O  O   . GLY E  2 97  ? -31.446 26.313  -41.400 1.00 40.70 ? 302  GLY E O   1 
ATOM   4392  N  N   . THR E  2 98  ? -29.290 26.104  -40.790 1.00 40.81 ? 303  THR E N   1 
ATOM   4393  C  CA  . THR E  2 98  ? -28.908 25.228  -41.888 1.00 42.23 ? 303  THR E CA  1 
ATOM   4394  C  C   . THR E  2 98  ? -27.742 24.345  -41.470 1.00 42.40 ? 303  THR E C   1 
ATOM   4395  O  O   . THR E  2 98  ? -27.153 24.520  -40.394 1.00 41.09 ? 303  THR E O   1 
ATOM   4396  C  CB  . THR E  2 98  ? -28.482 26.009  -43.150 1.00 45.21 ? 303  THR E CB  1 
ATOM   4397  O  OG1 . THR E  2 98  ? -27.579 27.056  -42.775 1.00 46.06 ? 303  THR E OG1 1 
ATOM   4398  C  CG2 . THR E  2 98  ? -29.699 26.595  -43.891 1.00 45.86 ? 303  THR E CG2 1 
ATOM   4399  N  N   . ASP E  2 99  ? -27.416 23.394  -42.344 1.00 43.69 ? 304  ASP E N   1 
ATOM   4400  C  CA  . ASP E  2 99  ? -26.307 22.477  -42.137 1.00 43.50 ? 304  ASP E CA  1 
ATOM   4401  C  C   . ASP E  2 99  ? -25.014 23.187  -42.500 1.00 45.91 ? 304  ASP E C   1 
ATOM   4402  O  O   . ASP E  2 99  ? -24.414 22.928  -43.547 1.00 47.31 ? 304  ASP E O   1 
ATOM   4403  C  CB  . ASP E  2 99  ? -26.506 21.216  -42.981 1.00 43.57 ? 304  ASP E CB  1 
ATOM   4404  C  CG  . ASP E  2 99  ? -27.823 20.508  -42.672 1.00 42.16 ? 304  ASP E CG  1 
ATOM   4405  O  OD1 . ASP E  2 99  ? -28.290 20.577  -41.511 1.00 39.69 ? 304  ASP E OD1 1 
ATOM   4406  O  OD2 . ASP E  2 99  ? -28.393 19.880  -43.591 1.00 42.73 ? 304  ASP E OD2 1 
ATOM   4407  N  N   . SER E  2 100 ? -24.603 24.093  -41.615 1.00 46.17 ? 305  SER E N   1 
ATOM   4408  C  CA  . SER E  2 100 ? -23.393 24.887  -41.792 1.00 48.15 ? 305  SER E CA  1 
ATOM   4409  C  C   . SER E  2 100 ? -22.174 24.052  -41.395 1.00 48.57 ? 305  SER E C   1 
ATOM   4410  O  O   . SER E  2 100 ? -22.324 23.034  -40.708 1.00 46.93 ? 305  SER E O   1 
ATOM   4411  C  CB  . SER E  2 100 ? -23.468 26.145  -40.918 1.00 47.90 ? 305  SER E CB  1 
ATOM   4412  O  OG  . SER E  2 100 ? -24.770 26.711  -40.949 1.00 47.06 ? 305  SER E OG  1 
ATOM   4413  N  N   . PRO E  2 101 ? -20.965 24.465  -41.831 1.00 50.54 ? 306  PRO E N   1 
ATOM   4414  C  CA  . PRO E  2 101 ? -19.730 23.812  -41.371 1.00 50.61 ? 306  PRO E CA  1 
ATOM   4415  C  C   . PRO E  2 101 ? -19.430 24.058  -39.890 1.00 49.79 ? 306  PRO E C   1 
ATOM   4416  O  O   . PRO E  2 101 ? -19.921 25.033  -39.320 1.00 49.08 ? 306  PRO E O   1 
ATOM   4417  C  CB  . PRO E  2 101 ? -18.643 24.454  -42.247 1.00 53.09 ? 306  PRO E CB  1 
ATOM   4418  C  CG  . PRO E  2 101 ? -19.362 24.964  -43.449 1.00 54.32 ? 306  PRO E CG  1 
ATOM   4419  C  CD  . PRO E  2 101 ? -20.708 25.394  -42.947 1.00 52.92 ? 306  PRO E CD  1 
ATOM   4420  N  N   . CYS E  2 102 ? -18.620 23.182  -39.290 1.00 50.53 ? 307  CYS E N   1 
ATOM   4421  C  CA  . CYS E  2 102 ? -18.312 23.236  -37.850 1.00 50.47 ? 307  CYS E CA  1 
ATOM   4422  C  C   . CYS E  2 102 ? -17.066 24.073  -37.566 1.00 53.34 ? 307  CYS E C   1 
ATOM   4423  O  O   . CYS E  2 102 ? -15.998 23.541  -37.247 1.00 53.81 ? 307  CYS E O   1 
ATOM   4424  C  CB  . CYS E  2 102 ? -18.155 21.811  -37.277 1.00 48.87 ? 307  CYS E CB  1 
ATOM   4425  S  SG  . CYS E  2 102 ? -17.751 21.676  -35.501 1.00 47.29 ? 307  CYS E SG  1 
ATOM   4426  N  N   . LYS E  2 103 ? -17.208 25.388  -37.698 1.00 55.97 ? 308  LYS E N   1 
ATOM   4427  C  CA  . LYS E  2 103 ? -16.150 26.322  -37.306 1.00 57.80 ? 308  LYS E CA  1 
ATOM   4428  C  C   . LYS E  2 103 ? -16.739 27.402  -36.403 1.00 56.66 ? 308  LYS E C   1 
ATOM   4429  O  O   . LYS E  2 103 ? -17.836 27.905  -36.659 1.00 55.93 ? 308  LYS E O   1 
ATOM   4430  C  CB  . LYS E  2 103 ? -15.481 26.944  -38.536 1.00 61.99 ? 308  LYS E CB  1 
ATOM   4431  C  CG  . LYS E  2 103 ? -14.685 25.947  -39.371 1.00 63.83 ? 308  LYS E CG  1 
ATOM   4432  C  CD  . LYS E  2 103 ? -14.122 26.585  -40.633 1.00 66.61 ? 308  LYS E CD  1 
ATOM   4433  C  CE  . LYS E  2 103 ? -13.451 25.555  -41.530 1.00 67.82 ? 308  LYS E CE  1 
ATOM   4434  N  NZ  . LYS E  2 103 ? -12.736 26.189  -42.674 1.00 70.79 ? 308  LYS E NZ  1 
ATOM   4435  N  N   . MET E  2 104 ? -16.006 27.740  -35.346 1.00 56.00 ? 309  MET E N   1 
ATOM   4436  C  CA  . MET E  2 104 ? -16.480 28.686  -34.338 1.00 55.92 ? 309  MET E CA  1 
ATOM   4437  C  C   . MET E  2 104 ? -15.295 29.467  -33.757 1.00 57.25 ? 309  MET E C   1 
ATOM   4438  O  O   . MET E  2 104 ? -14.168 29.335  -34.244 1.00 58.54 ? 309  MET E O   1 
ATOM   4439  C  CB  . MET E  2 104 ? -17.264 27.933  -33.246 1.00 53.30 ? 309  MET E CB  1 
ATOM   4440  C  CG  . MET E  2 104 ? -16.413 27.115  -32.282 1.00 52.86 ? 309  MET E CG  1 
ATOM   4441  S  SD  . MET E  2 104 ? -17.352 25.813  -31.448 1.00 51.31 ? 309  MET E SD  1 
ATOM   4442  C  CE  . MET E  2 104 ? -17.494 24.638  -32.795 1.00 50.97 ? 309  MET E CE  1 
ATOM   4443  N  N   . LYS E  2 105 ? -15.544 30.277  -32.726 1.00 57.35 ? 310  LYS E N   1 
ATOM   4444  C  CA  . LYS E  2 105 ? -14.501 31.152  -32.164 1.00 58.90 ? 310  LYS E CA  1 
ATOM   4445  C  C   . LYS E  2 105 ? -13.367 30.352  -31.509 1.00 57.52 ? 310  LYS E C   1 
ATOM   4446  O  O   . LYS E  2 105 ? -13.187 30.364  -30.293 1.00 55.83 ? 310  LYS E O   1 
ATOM   4447  C  CB  . LYS E  2 105 ? -15.100 32.163  -31.171 1.00 58.93 ? 310  LYS E CB  1 
ATOM   4448  C  CG  . LYS E  2 105 ? -16.166 33.092  -31.761 1.00 59.69 ? 310  LYS E CG  1 
ATOM   4449  C  CD  . LYS E  2 105 ? -16.192 34.452  -31.061 1.00 60.40 ? 310  LYS E CD  1 
ATOM   4450  C  CE  . LYS E  2 105 ? -17.552 35.135  -31.139 1.00 59.44 ? 310  LYS E CE  1 
ATOM   4451  N  NZ  . LYS E  2 105 ? -18.129 35.151  -32.511 1.00 59.99 ? 310  LYS E NZ  1 
ATOM   4452  N  N   . PHE E  2 109 ? -15.467 28.028  -23.768 1.00 28.45 ? 314  PHE E N   1 
ATOM   4453  C  CA  . PHE E  2 109 ? -15.899 27.356  -22.553 1.00 27.17 ? 314  PHE E CA  1 
ATOM   4454  C  C   . PHE E  2 109 ? -17.019 26.359  -22.836 1.00 25.70 ? 314  PHE E C   1 
ATOM   4455  O  O   . PHE E  2 109 ? -18.034 26.715  -23.438 1.00 25.46 ? 314  PHE E O   1 
ATOM   4456  C  CB  . PHE E  2 109 ? -16.388 28.343  -21.481 1.00 27.20 ? 314  PHE E CB  1 
ATOM   4457  C  CG  . PHE E  2 109 ? -16.684 27.670  -20.168 1.00 26.28 ? 314  PHE E CG  1 
ATOM   4458  C  CD1 . PHE E  2 109 ? -15.661 27.400  -19.270 1.00 26.72 ? 314  PHE E CD1 1 
ATOM   4459  C  CD2 . PHE E  2 109 ? -17.970 27.226  -19.872 1.00 25.04 ? 314  PHE E CD2 1 
ATOM   4460  C  CE1 . PHE E  2 109 ? -15.917 26.735  -18.081 1.00 26.05 ? 314  PHE E CE1 1 
ATOM   4461  C  CE2 . PHE E  2 109 ? -18.240 26.556  -18.694 1.00 24.27 ? 314  PHE E CE2 1 
ATOM   4462  C  CZ  . PHE E  2 109 ? -17.213 26.305  -17.792 1.00 24.87 ? 314  PHE E CZ  1 
ATOM   4463  N  N   . ARG E  2 110 ? -16.849 25.120  -22.383 1.00 24.74 ? 315  ARG E N   1 
ATOM   4464  C  CA  . ARG E  2 110 ? -17.852 24.094  -22.630 1.00 23.37 ? 315  ARG E CA  1 
ATOM   4465  C  C   . ARG E  2 110 ? -18.569 23.696  -21.337 1.00 22.07 ? 315  ARG E C   1 
ATOM   4466  O  O   . ARG E  2 110 ? -17.932 23.479  -20.291 1.00 21.97 ? 315  ARG E O   1 
ATOM   4467  C  CB  . ARG E  2 110 ? -17.220 22.895  -23.343 1.00 23.59 ? 315  ARG E CB  1 
ATOM   4468  C  CG  . ARG E  2 110 ? -16.321 23.324  -24.499 1.00 25.10 ? 315  ARG E CG  1 
ATOM   4469  C  CD  . ARG E  2 110 ? -16.024 22.230  -25.505 1.00 25.34 ? 315  ARG E CD  1 
ATOM   4470  N  NE  . ARG E  2 110 ? -17.214 21.880  -26.269 1.00 24.80 ? 315  ARG E NE  1 
ATOM   4471  C  CZ  . ARG E  2 110 ? -17.399 22.049  -27.582 1.00 25.58 ? 315  ARG E CZ  1 
ATOM   4472  N  NH1 . ARG E  2 110 ? -16.476 22.579  -28.361 1.00 27.05 ? 315  ARG E NH1 1 
ATOM   4473  N  NH2 . ARG E  2 110 ? -18.553 21.662  -28.127 1.00 25.04 ? 315  ARG E NH2 1 
ATOM   4474  N  N   . TYR E  2 111 ? -19.902 23.657  -21.423 1.00 21.09 ? 316  TYR E N   1 
ATOM   4475  C  CA  . TYR E  2 111 ? -20.765 23.165  -20.352 1.00 20.05 ? 316  TYR E CA  1 
ATOM   4476  C  C   . TYR E  2 111 ? -21.049 21.673  -20.562 1.00 18.98 ? 316  TYR E C   1 
ATOM   4477  O  O   . TYR E  2 111 ? -21.436 21.268  -21.661 1.00 18.83 ? 316  TYR E O   1 
ATOM   4478  C  CB  . TYR E  2 111 ? -22.112 23.890  -20.351 1.00 19.79 ? 316  TYR E CB  1 
ATOM   4479  C  CG  . TYR E  2 111 ? -22.060 25.339  -19.985 1.00 20.70 ? 316  TYR E CG  1 
ATOM   4480  C  CD1 . TYR E  2 111 ? -21.802 26.312  -20.945 1.00 21.72 ? 316  TYR E CD1 1 
ATOM   4481  C  CD2 . TYR E  2 111 ? -22.292 25.748  -18.682 1.00 20.78 ? 316  TYR E CD2 1 
ATOM   4482  C  CE1 . TYR E  2 111 ? -21.757 27.650  -20.610 1.00 22.71 ? 316  TYR E CE1 1 
ATOM   4483  C  CE2 . TYR E  2 111 ? -22.255 27.084  -18.337 1.00 21.76 ? 316  TYR E CE2 1 
ATOM   4484  C  CZ  . TYR E  2 111 ? -21.985 28.031  -19.308 1.00 22.74 ? 316  TYR E CZ  1 
ATOM   4485  O  OH  . TYR E  2 111 ? -21.958 29.361  -18.959 1.00 24.16 ? 316  TYR E OH  1 
ATOM   4486  N  N   . TYR E  2 112 ? -20.888 20.875  -19.510 1.00 18.26 ? 317  TYR E N   1 
ATOM   4487  C  CA  . TYR E  2 112 ? -21.163 19.443  -19.575 1.00 17.40 ? 317  TYR E CA  1 
ATOM   4488  C  C   . TYR E  2 112 ? -22.363 19.018  -18.713 1.00 16.40 ? 317  TYR E C   1 
ATOM   4489  O  O   . TYR E  2 112 ? -22.847 19.778  -17.872 1.00 16.33 ? 317  TYR E O   1 
ATOM   4490  C  CB  . TYR E  2 112 ? -19.932 18.671  -19.153 1.00 17.79 ? 317  TYR E CB  1 
ATOM   4491  C  CG  . TYR E  2 112 ? -18.727 18.947  -20.021 1.00 18.81 ? 317  TYR E CG  1 
ATOM   4492  C  CD1 . TYR E  2 112 ? -17.881 20.028  -19.762 1.00 19.70 ? 317  TYR E CD1 1 
ATOM   4493  C  CD2 . TYR E  2 112 ? -18.417 18.114  -21.089 1.00 19.00 ? 317  TYR E CD2 1 
ATOM   4494  C  CE1 . TYR E  2 112 ? -16.774 20.284  -20.563 1.00 20.76 ? 317  TYR E CE1 1 
ATOM   4495  C  CE2 . TYR E  2 112 ? -17.313 18.350  -21.886 1.00 20.22 ? 317  TYR E CE2 1 
ATOM   4496  C  CZ  . TYR E  2 112 ? -16.494 19.431  -21.625 1.00 20.93 ? 317  TYR E CZ  1 
ATOM   4497  O  OH  . TYR E  2 112 ? -15.413 19.651  -22.427 1.00 22.00 ? 317  TYR E OH  1 
ATOM   4498  N  N   . SER E  2 113 ? -22.852 17.808  -18.967 1.00 15.67 ? 318  SER E N   1 
ATOM   4499  C  CA  . SER E  2 113 ? -23.893 17.180  -18.143 1.00 14.93 ? 318  SER E CA  1 
ATOM   4500  C  C   . SER E  2 113 ? -23.293 16.043  -17.320 1.00 14.82 ? 318  SER E C   1 
ATOM   4501  O  O   . SER E  2 113 ? -22.589 15.188  -17.862 1.00 14.88 ? 318  SER E O   1 
ATOM   4502  C  CB  . SER E  2 113 ? -25.016 16.618  -19.012 1.00 14.37 ? 318  SER E CB  1 
ATOM   4503  O  OG  . SER E  2 113 ? -25.650 17.636  -19.766 1.00 14.51 ? 318  SER E OG  1 
ATOM   4504  N  N   . SER E  2 114 ? -23.581 16.025  -16.023 1.00 14.72 ? 319  SER E N   1 
ATOM   4505  C  CA  . SER E  2 114 ? -23.008 15.008  -15.146 1.00 14.92 ? 319  SER E CA  1 
ATOM   4506  C  C   . SER E  2 114 ? -23.760 13.688  -15.213 1.00 14.54 ? 319  SER E C   1 
ATOM   4507  O  O   . SER E  2 114 ? -23.209 12.671  -14.846 1.00 14.85 ? 319  SER E O   1 
ATOM   4508  C  CB  . SER E  2 114 ? -22.967 15.497  -13.703 1.00 15.24 ? 319  SER E CB  1 
ATOM   4509  O  OG  . SER E  2 114 ? -24.224 15.980  -13.308 1.00 14.90 ? 319  SER E OG  1 
ATOM   4510  N  N   . GLU E  2 115 ? -25.007 13.703  -15.679 1.00 14.08 ? 320  GLU E N   1 
ATOM   4511  C  CA  . GLU E  2 115 ? -25.906 12.554  -15.552 1.00 13.87 ? 320  GLU E CA  1 
ATOM   4512  C  C   . GLU E  2 115 ? -27.059 12.761  -16.514 1.00 13.41 ? 320  GLU E C   1 
ATOM   4513  O  O   . GLU E  2 115 ? -27.496 13.888  -16.728 1.00 13.41 ? 320  GLU E O   1 
ATOM   4514  C  CB  . GLU E  2 115 ? -26.440 12.450  -14.111 1.00 14.13 ? 320  GLU E CB  1 
ATOM   4515  C  CG  . GLU E  2 115 ? -27.147 11.139  -13.737 1.00 14.18 ? 320  GLU E CG  1 
ATOM   4516  C  CD  . GLU E  2 115 ? -28.575 11.007  -14.274 1.00 13.88 ? 320  GLU E CD  1 
ATOM   4517  O  OE1 . GLU E  2 115 ? -29.249 12.060  -14.547 1.00 13.92 ? 320  GLU E OE1 1 
ATOM   4518  O  OE2 . GLU E  2 115 ? -29.045 9.836   -14.428 1.00 13.93 ? 320  GLU E OE2 1 
ATOM   4519  N  N   . TYR E  2 116 ? -27.547 11.697  -17.121 1.00 13.15 ? 321  TYR E N   1 
ATOM   4520  C  CA  . TYR E  2 116 ? -28.661 11.833  -18.035 1.00 12.80 ? 321  TYR E CA  1 
ATOM   4521  C  C   . TYR E  2 116 ? -29.390 10.513  -18.100 1.00 12.70 ? 321  TYR E C   1 
ATOM   4522  O  O   . TYR E  2 116 ? -28.781 9.454   -18.054 1.00 13.24 ? 321  TYR E O   1 
ATOM   4523  C  CB  . TYR E  2 116 ? -28.210 12.295  -19.420 1.00 12.84 ? 321  TYR E CB  1 
ATOM   4524  C  CG  . TYR E  2 116 ? -27.212 11.377  -20.069 1.00 13.10 ? 321  TYR E CG  1 
ATOM   4525  C  CD1 . TYR E  2 116 ? -25.849 11.539  -19.856 1.00 13.50 ? 321  TYR E CD1 1 
ATOM   4526  C  CD2 . TYR E  2 116 ? -27.627 10.348  -20.912 1.00 13.07 ? 321  TYR E CD2 1 
ATOM   4527  C  CE1 . TYR E  2 116 ? -24.931 10.681  -20.444 1.00 13.87 ? 321  TYR E CE1 1 
ATOM   4528  C  CE2 . TYR E  2 116 ? -26.717 9.487   -21.484 1.00 13.42 ? 321  TYR E CE2 1 
ATOM   4529  C  CZ  . TYR E  2 116 ? -25.380 9.657   -21.244 1.00 13.82 ? 321  TYR E CZ  1 
ATOM   4530  O  OH  . TYR E  2 116 ? -24.484 8.801   -21.807 1.00 14.44 ? 321  TYR E OH  1 
ATOM   4531  N  N   . HIS E  2 117 ? -30.708 10.576  -18.192 1.00 12.45 ? 322  HIS E N   1 
ATOM   4532  C  CA  . HIS E  2 117 ? -31.475 9.351   -18.316 1.00 12.42 ? 322  HIS E CA  1 
ATOM   4533  C  C   . HIS E  2 117 ? -32.858 9.595   -18.851 1.00 12.16 ? 322  HIS E C   1 
ATOM   4534  O  O   . HIS E  2 117 ? -33.384 10.714  -18.784 1.00 12.08 ? 322  HIS E O   1 
ATOM   4535  C  CB  . HIS E  2 117 ? -31.571 8.647   -16.958 1.00 12.68 ? 322  HIS E CB  1 
ATOM   4536  C  CG  . HIS E  2 117 ? -32.287 9.444   -15.920 1.00 12.81 ? 322  HIS E CG  1 
ATOM   4537  N  ND1 . HIS E  2 117 ? -31.657 10.402  -15.150 1.00 13.04 ? 322  HIS E ND1 1 
ATOM   4538  C  CD2 . HIS E  2 117 ? -33.581 9.432   -15.521 1.00 12.91 ? 322  HIS E CD2 1 
ATOM   4539  C  CE1 . HIS E  2 117 ? -32.534 10.945  -14.322 1.00 13.20 ? 322  HIS E CE1 1 
ATOM   4540  N  NE2 . HIS E  2 117 ? -33.711 10.379  -14.534 1.00 13.18 ? 322  HIS E NE2 1 
ATOM   4541  N  N   . TYR E  2 118 ? -33.437 8.532   -19.393 1.00 12.10 ? 323  TYR E N   1 
ATOM   4542  C  CA  . TYR E  2 118 ? -34.848 8.515   -19.687 1.00 12.09 ? 323  TYR E CA  1 
ATOM   4543  C  C   . TYR E  2 118 ? -35.575 8.418   -18.357 1.00 12.27 ? 323  TYR E C   1 
ATOM   4544  O  O   . TYR E  2 118 ? -35.235 7.584   -17.507 1.00 12.43 ? 323  TYR E O   1 
ATOM   4545  C  CB  . TYR E  2 118 ? -35.223 7.322   -20.574 1.00 12.27 ? 323  TYR E CB  1 
ATOM   4546  C  CG  . TYR E  2 118 ? -34.862 7.487   -22.038 1.00 12.27 ? 323  TYR E CG  1 
ATOM   4547  C  CD1 . TYR E  2 118 ? -35.400 8.518   -22.791 1.00 12.27 ? 323  TYR E CD1 1 
ATOM   4548  C  CD2 . TYR E  2 118 ? -33.999 6.609   -22.668 1.00 12.43 ? 323  TYR E CD2 1 
ATOM   4549  C  CE1 . TYR E  2 118 ? -35.081 8.678   -24.130 1.00 12.46 ? 323  TYR E CE1 1 
ATOM   4550  C  CE2 . TYR E  2 118 ? -33.681 6.754   -24.003 1.00 12.63 ? 323  TYR E CE2 1 
ATOM   4551  C  CZ  . TYR E  2 118 ? -34.229 7.789   -24.730 1.00 12.63 ? 323  TYR E CZ  1 
ATOM   4552  O  OH  . TYR E  2 118 ? -33.924 7.946   -26.056 1.00 13.02 ? 323  TYR E OH  1 
ATOM   4553  N  N   . VAL E  2 119 ? -36.572 9.281   -18.189 1.00 12.28 ? 324  VAL E N   1 
ATOM   4554  C  CA  . VAL E  2 119 ? -37.450 9.233   -17.042 1.00 12.64 ? 324  VAL E CA  1 
ATOM   4555  C  C   . VAL E  2 119 ? -38.104 7.851   -17.005 1.00 13.07 ? 324  VAL E C   1 
ATOM   4556  O  O   . VAL E  2 119 ? -38.749 7.415   -17.983 1.00 13.15 ? 324  VAL E O   1 
ATOM   4557  C  CB  . VAL E  2 119 ? -38.539 10.317  -17.108 1.00 12.73 ? 324  VAL E CB  1 
ATOM   4558  C  CG1 . VAL E  2 119 ? -39.510 10.151  -15.955 1.00 13.29 ? 324  VAL E CG1 1 
ATOM   4559  C  CG2 . VAL E  2 119 ? -37.916 11.698  -17.080 1.00 12.53 ? 324  VAL E CG2 1 
ATOM   4560  N  N   . GLY E  2 120 ? -37.914 7.168   -15.878 1.00 13.51 ? 325  GLY E N   1 
ATOM   4561  C  CA  . GLY E  2 120 ? -38.309 5.774   -15.741 1.00 14.11 ? 325  GLY E CA  1 
ATOM   4562  C  C   . GLY E  2 120 ? -37.159 4.786   -15.807 1.00 14.25 ? 325  GLY E C   1 
ATOM   4563  O  O   . GLY E  2 120 ? -37.364 3.611   -15.575 1.00 15.06 ? 325  GLY E O   1 
ATOM   4564  N  N   . GLY E  2 121 ? -35.944 5.243   -16.117 1.00 13.87 ? 326  GLY E N   1 
ATOM   4565  C  CA  . GLY E  2 121 ? -34.777 4.363   -16.189 1.00 14.01 ? 326  GLY E CA  1 
ATOM   4566  C  C   . GLY E  2 121 ? -34.329 4.031   -17.604 1.00 13.92 ? 326  GLY E C   1 
ATOM   4567  O  O   . GLY E  2 121 ? -33.133 3.752   -17.836 1.00 14.53 ? 326  GLY E O   1 
ATOM   4568  N  N   . PHE E  2 122 ? -35.260 4.064   -18.558 1.00 13.70 ? 327  PHE E N   1 
ATOM   4569  C  CA  . PHE E  2 122 ? -35.005 3.589   -19.916 1.00 13.68 ? 327  PHE E CA  1 
ATOM   4570  C  C   . PHE E  2 122 ? -36.209 3.884   -20.795 1.00 13.67 ? 327  PHE E C   1 
ATOM   4571  O  O   . PHE E  2 122 ? -37.313 4.042   -20.287 1.00 13.70 ? 327  PHE E O   1 
ATOM   4572  C  CB  . PHE E  2 122 ? -34.729 2.085   -19.923 1.00 14.21 ? 327  PHE E CB  1 
ATOM   4573  C  CG  . PHE E  2 122 ? -35.765 1.265   -19.186 1.00 14.63 ? 327  PHE E CG  1 
ATOM   4574  C  CD1 . PHE E  2 122 ? -35.642 1.027   -17.828 1.00 14.93 ? 327  PHE E CD1 1 
ATOM   4575  C  CD2 . PHE E  2 122 ? -36.856 0.745   -19.850 1.00 14.94 ? 327  PHE E CD2 1 
ATOM   4576  C  CE1 . PHE E  2 122 ? -36.600 0.278   -17.143 1.00 15.58 ? 327  PHE E CE1 1 
ATOM   4577  C  CE2 . PHE E  2 122 ? -37.823 0.006   -19.181 1.00 15.55 ? 327  PHE E CE2 1 
ATOM   4578  C  CZ  . PHE E  2 122 ? -37.698 -0.232  -17.827 1.00 15.87 ? 327  PHE E CZ  1 
ATOM   4579  N  N   . TYR E  2 123 ? -35.985 3.971   -22.106 1.00 13.71 ? 328  TYR E N   1 
ATOM   4580  C  CA  . TYR E  2 123 ? -37.070 4.162   -23.058 1.00 14.03 ? 328  TYR E CA  1 
ATOM   4581  C  C   . TYR E  2 123 ? -38.128 3.069   -22.880 1.00 14.68 ? 328  TYR E C   1 
ATOM   4582  O  O   . TYR E  2 123 ? -37.840 1.879   -23.037 1.00 15.05 ? 328  TYR E O   1 
ATOM   4583  C  CB  . TYR E  2 123 ? -36.560 4.129   -24.505 1.00 14.17 ? 328  TYR E CB  1 
ATOM   4584  C  CG  . TYR E  2 123 ? -37.644 4.453   -25.504 1.00 14.46 ? 328  TYR E CG  1 
ATOM   4585  C  CD1 . TYR E  2 123 ? -38.280 5.674   -25.468 1.00 14.30 ? 328  TYR E CD1 1 
ATOM   4586  C  CD2 . TYR E  2 123 ? -38.056 3.536   -26.458 1.00 15.04 ? 328  TYR E CD2 1 
ATOM   4587  C  CE1 . TYR E  2 123 ? -39.286 5.984   -26.354 1.00 14.72 ? 328  TYR E CE1 1 
ATOM   4588  C  CE2 . TYR E  2 123 ? -39.056 3.843   -27.364 1.00 15.43 ? 328  TYR E CE2 1 
ATOM   4589  C  CZ  . TYR E  2 123 ? -39.667 5.071   -27.307 1.00 15.27 ? 328  TYR E CZ  1 
ATOM   4590  O  OH  . TYR E  2 123 ? -40.661 5.426   -28.195 1.00 15.81 ? 328  TYR E OH  1 
ATOM   4591  N  N   . GLY E  2 124 ? -39.341 3.490   -22.541 1.00 15.05 ? 329  GLY E N   1 
ATOM   4592  C  CA  . GLY E  2 124 ? -40.402 2.563   -22.187 1.00 16.04 ? 329  GLY E CA  1 
ATOM   4593  C  C   . GLY E  2 124 ? -40.921 2.687   -20.772 1.00 16.11 ? 329  GLY E C   1 
ATOM   4594  O  O   . GLY E  2 124 ? -42.033 2.259   -20.497 1.00 16.91 ? 329  GLY E O   1 
ATOM   4595  N  N   . GLY E  2 125 ? -40.131 3.282   -19.876 1.00 15.58 ? 330  GLY E N   1 
ATOM   4596  C  CA  . GLY E  2 125 ? -40.532 3.447   -18.492 1.00 15.76 ? 330  GLY E CA  1 
ATOM   4597  C  C   . GLY E  2 125 ? -41.189 4.765   -18.128 1.00 15.60 ? 330  GLY E C   1 
ATOM   4598  O  O   . GLY E  2 125 ? -41.521 4.993   -16.961 1.00 16.02 ? 330  GLY E O   1 
ATOM   4599  N  N   . CYS E  2 126 ? -41.389 5.643   -19.095 1.00 15.33 ? 331  CYS E N   1 
ATOM   4600  C  CA  . CYS E  2 126 ? -41.929 6.968   -18.781 1.00 15.41 ? 331  CYS E CA  1 
ATOM   4601  C  C   . CYS E  2 126 ? -43.388 6.869   -18.345 1.00 16.02 ? 331  CYS E C   1 
ATOM   4602  O  O   . CYS E  2 126 ? -44.082 5.950   -18.733 1.00 16.51 ? 331  CYS E O   1 
ATOM   4603  C  CB  . CYS E  2 126 ? -41.809 7.894   -19.996 1.00 15.37 ? 331  CYS E CB  1 
ATOM   4604  S  SG  . CYS E  2 126 ? -42.045 9.646   -19.606 1.00 15.93 ? 331  CYS E SG  1 
ATOM   4605  N  N   . ASN E  2 127 ? -43.825 7.799   -17.504 1.00 16.14 ? 332  ASN E N   1 
ATOM   4606  C  CA  . ASN E  2 127 ? -45.231 7.983   -17.177 1.00 16.85 ? 332  ASN E CA  1 
ATOM   4607  C  C   . ASN E  2 127 ? -45.456 9.352   -16.545 1.00 16.94 ? 332  ASN E C   1 
ATOM   4608  O  O   . ASN E  2 127 ? -44.508 10.033  -16.166 1.00 16.48 ? 332  ASN E O   1 
ATOM   4609  C  CB  . ASN E  2 127 ? -45.785 6.868   -16.290 1.00 17.65 ? 332  ASN E CB  1 
ATOM   4610  C  CG  . ASN E  2 127 ? -45.178 6.841   -14.898 1.00 17.79 ? 332  ASN E CG  1 
ATOM   4611  O  OD1 . ASN E  2 127 ? -45.113 7.859   -14.196 1.00 17.74 ? 332  ASN E OD1 1 
ATOM   4612  N  ND2 . ASN E  2 127 ? -44.762 5.658   -14.475 1.00 18.08 ? 332  ASN E ND2 1 
ATOM   4613  N  N   . GLU E  2 128 ? -46.713 9.753   -16.459 1.00 17.68 ? 333  GLU E N   1 
ATOM   4614  C  CA  . GLU E  2 128 ? -47.070 11.088  -16.030 1.00 18.06 ? 333  GLU E CA  1 
ATOM   4615  C  C   . GLU E  2 128 ? -46.571 11.413  -14.611 1.00 18.08 ? 333  GLU E C   1 
ATOM   4616  O  O   . GLU E  2 128 ? -46.041 12.498  -14.384 1.00 17.71 ? 333  GLU E O   1 
ATOM   4617  C  CB  . GLU E  2 128 ? -48.589 11.252  -16.092 1.00 19.37 ? 333  GLU E CB  1 
ATOM   4618  C  CG  . GLU E  2 128 ? -49.094 12.639  -15.693 1.00 20.02 ? 333  GLU E CG  1 
ATOM   4619  C  CD  . GLU E  2 128 ? -50.405 12.587  -14.937 1.00 21.52 ? 333  GLU E CD  1 
ATOM   4620  O  OE1 . GLU E  2 128 ? -51.132 11.570  -15.063 1.00 22.27 ? 333  GLU E OE1 1 
ATOM   4621  O  OE2 . GLU E  2 128 ? -50.711 13.566  -14.223 1.00 22.31 ? 333  GLU E OE2 1 
ATOM   4622  N  N   . ALA E  2 129 ? -46.755 10.477  -13.676 1.00 18.45 ? 334  ALA E N   1 
ATOM   4623  C  CA  . ALA E  2 129 ? -46.300 10.638  -12.287 1.00 18.75 ? 334  ALA E CA  1 
ATOM   4624  C  C   . ALA E  2 129 ? -44.800 10.908  -12.193 1.00 17.89 ? 334  ALA E C   1 
ATOM   4625  O  O   . ALA E  2 129 ? -44.359 11.835  -11.501 1.00 17.90 ? 334  ALA E O   1 
ATOM   4626  C  CB  . ALA E  2 129 ? -46.644 9.406   -11.470 1.00 19.52 ? 334  ALA E CB  1 
ATOM   4627  N  N   . LEU E  2 130 ? -44.027 10.083  -12.890 1.00 17.18 ? 335  LEU E N   1 
ATOM   4628  C  CA  . LEU E  2 130 ? -42.579 10.231  -12.915 1.00 16.40 ? 335  LEU E CA  1 
ATOM   4629  C  C   . LEU E  2 130 ? -42.174 11.552  -13.573 1.00 16.01 ? 335  LEU E C   1 
ATOM   4630  O  O   . LEU E  2 130 ? -41.213 12.184  -13.145 1.00 15.70 ? 335  LEU E O   1 
ATOM   4631  C  CB  . LEU E  2 130 ? -41.932 9.043   -13.628 1.00 15.87 ? 335  LEU E CB  1 
ATOM   4632  C  CG  . LEU E  2 130 ? -41.997 7.725   -12.834 1.00 16.45 ? 335  LEU E CG  1 
ATOM   4633  C  CD1 . LEU E  2 130 ? -41.594 6.545   -13.704 1.00 16.12 ? 335  LEU E CD1 1 
ATOM   4634  C  CD2 . LEU E  2 130 ? -41.140 7.795   -11.578 1.00 16.68 ? 335  LEU E CD2 1 
ATOM   4635  N  N   . MET E  2 131 ? -42.926 11.978  -14.590 1.00 16.19 ? 336  MET E N   1 
ATOM   4636  C  CA  . MET E  2 131 ? -42.660 13.268  -15.226 1.00 16.07 ? 336  MET E CA  1 
ATOM   4637  C  C   . MET E  2 131 ? -42.963 14.426  -14.274 1.00 16.87 ? 336  MET E C   1 
ATOM   4638  O  O   . MET E  2 131 ? -42.213 15.376  -14.228 1.00 16.98 ? 336  MET E O   1 
ATOM   4639  C  CB  . MET E  2 131 ? -43.424 13.425  -16.541 1.00 15.99 ? 336  MET E CB  1 
ATOM   4640  C  CG  . MET E  2 131 ? -42.851 12.598  -17.670 1.00 15.45 ? 336  MET E CG  1 
ATOM   4641  S  SD  . MET E  2 131 ? -44.021 12.438  -19.026 1.00 15.78 ? 336  MET E SD  1 
ATOM   4642  C  CE  . MET E  2 131 ? -43.940 14.085  -19.715 1.00 15.79 ? 336  MET E CE  1 
ATOM   4643  N  N   . LYS E  2 132 ? -44.038 14.329  -13.498 1.00 18.21 ? 337  LYS E N   1 
ATOM   4644  C  CA  . LYS E  2 132 ? -44.370 15.380  -12.532 1.00 19.29 ? 337  LYS E CA  1 
ATOM   4645  C  C   . LYS E  2 132 ? -43.262 15.510  -11.502 1.00 19.39 ? 337  LYS E C   1 
ATOM   4646  O  O   . LYS E  2 132 ? -42.778 16.612  -11.248 1.00 19.58 ? 337  LYS E O   1 
ATOM   4647  C  CB  . LYS E  2 132 ? -45.706 15.117  -11.840 1.00 20.45 ? 337  LYS E CB  1 
ATOM   4648  C  CG  . LYS E  2 132 ? -46.898 15.479  -12.699 1.00 20.85 ? 337  LYS E CG  1 
ATOM   4649  C  CD  . LYS E  2 132 ? -48.212 15.029  -12.079 1.00 22.05 ? 337  LYS E CD  1 
ATOM   4650  C  CE  . LYS E  2 132 ? -48.586 15.901  -10.890 1.00 23.10 ? 337  LYS E CE  1 
ATOM   4651  N  NZ  . LYS E  2 132 ? -49.447 15.143  -9.944  1.00 24.35 ? 337  LYS E NZ  1 
ATOM   4652  N  N   . LEU E  2 133 ? -42.861 14.372  -10.947 1.00 19.55 ? 338  LEU E N   1 
ATOM   4653  C  CA  . LEU E  2 133 ? -41.798 14.311  -9.960  1.00 20.04 ? 338  LEU E CA  1 
ATOM   4654  C  C   . LEU E  2 133 ? -40.465 14.895  -10.463 1.00 19.11 ? 338  LEU E C   1 
ATOM   4655  O  O   . LEU E  2 133 ? -39.871 15.745  -9.798  1.00 19.40 ? 338  LEU E O   1 
ATOM   4656  C  CB  . LEU E  2 133 ? -41.625 12.859  -9.508  1.00 20.60 ? 338  LEU E CB  1 
ATOM   4657  C  CG  . LEU E  2 133 ? -40.552 12.503  -8.480  1.00 21.16 ? 338  LEU E CG  1 
ATOM   4658  C  CD1 . LEU E  2 133 ? -40.680 13.353  -7.222  1.00 22.43 ? 338  LEU E CD1 1 
ATOM   4659  C  CD2 . LEU E  2 133 ? -40.671 11.010  -8.149  1.00 21.68 ? 338  LEU E CD2 1 
ATOM   4660  N  N   . GLU E  2 134 ? -40.011 14.458  -11.635 1.00 18.21 ? 339  GLU E N   1 
ATOM   4661  C  CA  . GLU E  2 134 ? -38.771 14.973  -12.219 1.00 17.56 ? 339  GLU E CA  1 
ATOM   4662  C  C   . GLU E  2 134 ? -38.848 16.491  -12.403 1.00 17.91 ? 339  GLU E C   1 
ATOM   4663  O  O   . GLU E  2 134 ? -37.923 17.222  -12.042 1.00 17.98 ? 339  GLU E O   1 
ATOM   4664  C  CB  . GLU E  2 134 ? -38.499 14.300  -13.557 1.00 16.80 ? 339  GLU E CB  1 
ATOM   4665  C  CG  . GLU E  2 134 ? -37.283 14.823  -14.330 1.00 16.39 ? 339  GLU E CG  1 
ATOM   4666  C  CD  . GLU E  2 134 ? -35.946 14.510  -13.670 1.00 16.28 ? 339  GLU E CD  1 
ATOM   4667  O  OE1 . GLU E  2 134 ? -35.851 13.441  -13.028 1.00 16.71 ? 339  GLU E OE1 1 
ATOM   4668  O  OE2 . GLU E  2 134 ? -34.987 15.320  -13.802 1.00 15.90 ? 339  GLU E OE2 1 
ATOM   4669  N  N   . LEU E  2 135 ? -39.968 16.950  -12.947 1.00 18.19 ? 340  LEU E N   1 
ATOM   4670  C  CA  . LEU E  2 135 ? -40.164 18.348  -13.274 1.00 18.56 ? 340  LEU E CA  1 
ATOM   4671  C  C   . LEU E  2 135 ? -40.069 19.257  -12.061 1.00 19.48 ? 340  LEU E C   1 
ATOM   4672  O  O   . LEU E  2 135 ? -39.433 20.311  -12.111 1.00 19.68 ? 340  LEU E O   1 
ATOM   4673  C  CB  . LEU E  2 135 ? -41.544 18.541  -13.898 1.00 18.80 ? 340  LEU E CB  1 
ATOM   4674  C  CG  . LEU E  2 135 ? -41.903 19.953  -14.341 1.00 19.19 ? 340  LEU E CG  1 
ATOM   4675  C  CD1 . LEU E  2 135 ? -41.040 20.374  -15.523 1.00 18.63 ? 340  LEU E CD1 1 
ATOM   4676  C  CD2 . LEU E  2 135 ? -43.383 20.007  -14.702 1.00 19.87 ? 340  LEU E CD2 1 
ATOM   4677  N  N   . VAL E  2 136 ? -40.743 18.873  -10.989 1.00 20.42 ? 341  VAL E N   1 
ATOM   4678  C  CA  . VAL E  2 136 ? -40.817 19.717  -9.817  1.00 21.57 ? 341  VAL E CA  1 
ATOM   4679  C  C   . VAL E  2 136 ? -39.515 19.634  -9.026  1.00 21.82 ? 341  VAL E C   1 
ATOM   4680  O  O   . VAL E  2 136 ? -38.998 20.647  -8.534  1.00 22.16 ? 341  VAL E O   1 
ATOM   4681  C  CB  . VAL E  2 136 ? -42.014 19.343  -8.931  1.00 22.45 ? 341  VAL E CB  1 
ATOM   4682  C  CG1 . VAL E  2 136 ? -41.962 20.097  -7.605  1.00 23.62 ? 341  VAL E CG1 1 
ATOM   4683  C  CG2 . VAL E  2 136 ? -43.307 19.665  -9.660  1.00 22.63 ? 341  VAL E CG2 1 
ATOM   4684  N  N   . HIS E  2 137 ? -38.972 18.431  -8.927  1.00 21.83 ? 342  HIS E N   1 
ATOM   4685  C  CA  . HIS E  2 137 ? -37.810 18.215  -8.076  1.00 22.18 ? 342  HIS E CA  1 
ATOM   4686  C  C   . HIS E  2 137 ? -36.496 18.566  -8.764  1.00 20.79 ? 342  HIS E C   1 
ATOM   4687  O  O   . HIS E  2 137 ? -35.571 18.945  -8.080  1.00 21.19 ? 342  HIS E O   1 
ATOM   4688  C  CB  . HIS E  2 137 ? -37.810 16.789  -7.521  1.00 22.72 ? 342  HIS E CB  1 
ATOM   4689  C  CG  . HIS E  2 137 ? -38.863 16.559  -6.485  1.00 24.49 ? 342  HIS E CG  1 
ATOM   4690  N  ND1 . HIS E  2 137 ? -40.142 17.070  -6.591  1.00 25.54 ? 342  HIS E ND1 1 
ATOM   4691  C  CD2 . HIS E  2 137 ? -38.832 15.876  -5.316  1.00 26.31 ? 342  HIS E CD2 1 
ATOM   4692  C  CE1 . HIS E  2 137 ? -40.853 16.710  -5.539  1.00 26.76 ? 342  HIS E CE1 1 
ATOM   4693  N  NE2 . HIS E  2 137 ? -40.082 15.984  -4.750  1.00 27.39 ? 342  HIS E NE2 1 
ATOM   4694  N  N   . HIS E  2 138 ? -36.428 18.492  -10.095 1.00 19.46 ? 343  HIS E N   1 
ATOM   4695  C  CA  . HIS E  2 138 ? -35.183 18.784  -10.820 1.00 18.83 ? 343  HIS E CA  1 
ATOM   4696  C  C   . HIS E  2 138 ? -35.287 19.805  -11.944 1.00 18.60 ? 343  HIS E C   1 
ATOM   4697  O  O   . HIS E  2 138 ? -34.257 20.283  -12.403 1.00 18.79 ? 343  HIS E O   1 
ATOM   4698  C  CB  . HIS E  2 138 ? -34.557 17.505  -11.392 1.00 18.19 ? 343  HIS E CB  1 
ATOM   4699  C  CG  . HIS E  2 138 ? -34.358 16.427  -10.378 1.00 18.50 ? 343  HIS E CG  1 
ATOM   4700  N  ND1 . HIS E  2 138 ? -33.351 16.468  -9.437  1.00 19.03 ? 343  HIS E ND1 1 
ATOM   4701  C  CD2 . HIS E  2 138 ? -35.060 15.300  -10.129 1.00 18.54 ? 343  HIS E CD2 1 
ATOM   4702  C  CE1 . HIS E  2 138 ? -33.440 15.405  -8.657  1.00 19.31 ? 343  HIS E CE1 1 
ATOM   4703  N  NE2 . HIS E  2 138 ? -34.469 14.682  -9.056  1.00 19.01 ? 343  HIS E NE2 1 
ATOM   4704  N  N   . GLY E  2 139 ? -36.484 20.119  -12.433 1.00 18.42 ? 344  GLY E N   1 
ATOM   4705  C  CA  . GLY E  2 139 ? -36.631 21.202  -13.414 1.00 18.24 ? 344  GLY E CA  1 
ATOM   4706  C  C   . GLY E  2 139 ? -37.118 20.780  -14.788 1.00 17.54 ? 344  GLY E C   1 
ATOM   4707  O  O   . GLY E  2 139 ? -37.298 19.592  -15.044 1.00 17.06 ? 344  GLY E O   1 
ATOM   4708  N  N   . PRO E  2 140 ? -37.322 21.756  -15.691 1.00 17.54 ? 345  PRO E N   1 
ATOM   4709  C  CA  . PRO E  2 140 ? -37.809 21.464  -17.032 1.00 17.35 ? 345  PRO E CA  1 
ATOM   4710  C  C   . PRO E  2 140 ? -37.070 20.302  -17.690 1.00 16.79 ? 345  PRO E C   1 
ATOM   4711  O  O   . PRO E  2 140 ? -35.876 20.138  -17.486 1.00 16.63 ? 345  PRO E O   1 
ATOM   4712  C  CB  . PRO E  2 140 ? -37.560 22.770  -17.790 1.00 17.68 ? 345  PRO E CB  1 
ATOM   4713  C  CG  . PRO E  2 140 ? -37.718 23.807  -16.742 1.00 18.36 ? 345  PRO E CG  1 
ATOM   4714  C  CD  . PRO E  2 140 ? -37.125 23.205  -15.496 1.00 18.23 ? 345  PRO E CD  1 
ATOM   4715  N  N   . MET E  2 141 ? -37.790 19.498  -18.458 1.00 16.63 ? 346  MET E N   1 
ATOM   4716  C  CA  . MET E  2 141 ? -37.190 18.352  -19.109 1.00 16.33 ? 346  MET E CA  1 
ATOM   4717  C  C   . MET E  2 141 ? -37.655 18.309  -20.548 1.00 16.13 ? 346  MET E C   1 
ATOM   4718  O  O   . MET E  2 141 ? -38.728 18.816  -20.874 1.00 16.33 ? 346  MET E O   1 
ATOM   4719  C  CB  . MET E  2 141 ? -37.570 17.047  -18.386 1.00 16.51 ? 346  MET E CB  1 
ATOM   4720  C  CG  . MET E  2 141 ? -38.977 16.576  -18.707 1.00 17.02 ? 346  MET E CG  1 
ATOM   4721  S  SD  . MET E  2 141 ? -39.758 15.566  -17.427 1.00 18.68 ? 346  MET E SD  1 
ATOM   4722  C  CE  . MET E  2 141 ? -39.625 16.716  -16.069 1.00 17.87 ? 346  MET E CE  1 
ATOM   4723  N  N   . ALA E  2 142 ? -36.824 17.715  -21.398 1.00 15.67 ? 347  ALA E N   1 
ATOM   4724  C  CA  . ALA E  2 142 ? -37.166 17.505  -22.794 1.00 15.68 ? 347  ALA E CA  1 
ATOM   4725  C  C   . ALA E  2 142 ? -38.153 16.355  -22.917 1.00 15.48 ? 347  ALA E C   1 
ATOM   4726  O  O   . ALA E  2 142 ? -38.030 15.332  -22.233 1.00 14.98 ? 347  ALA E O   1 
ATOM   4727  C  CB  . ALA E  2 142 ? -35.920 17.208  -23.620 1.00 15.63 ? 347  ALA E CB  1 
ATOM   4728  N  N   . VAL E  2 143 ? -39.137 16.549  -23.790 1.00 15.79 ? 348  VAL E N   1 
ATOM   4729  C  CA  . VAL E  2 143 ? -40.115 15.539  -24.118 1.00 15.84 ? 348  VAL E CA  1 
ATOM   4730  C  C   . VAL E  2 143 ? -40.338 15.569  -25.624 1.00 16.47 ? 348  VAL E C   1 
ATOM   4731  O  O   . VAL E  2 143 ? -39.985 16.537  -26.291 1.00 17.08 ? 348  VAL E O   1 
ATOM   4732  C  CB  . VAL E  2 143 ? -41.438 15.768  -23.359 1.00 16.01 ? 348  VAL E CB  1 
ATOM   4733  C  CG1 . VAL E  2 143 ? -41.209 15.658  -21.863 1.00 15.65 ? 348  VAL E CG1 1 
ATOM   4734  C  CG2 . VAL E  2 143 ? -42.026 17.134  -23.668 1.00 16.66 ? 348  VAL E CG2 1 
ATOM   4735  N  N   . ALA E  2 144 ? -40.889 14.495  -26.170 1.00 16.76 ? 349  ALA E N   1 
ATOM   4736  C  CA  . ALA E  2 144 ? -41.255 14.465  -27.578 1.00 17.46 ? 349  ALA E CA  1 
ATOM   4737  C  C   . ALA E  2 144 ? -42.705 14.035  -27.729 1.00 17.80 ? 349  ALA E C   1 
ATOM   4738  O  O   . ALA E  2 144 ? -43.220 13.270  -26.911 1.00 17.65 ? 349  ALA E O   1 
ATOM   4739  C  CB  . ALA E  2 144 ? -40.344 13.513  -28.347 1.00 17.54 ? 349  ALA E CB  1 
ATOM   4740  N  N   . PHE E  2 145 ? -43.355 14.527  -28.779 1.00 18.41 ? 350  PHE E N   1 
ATOM   4741  C  CA  . PHE E  2 145 ? -44.691 14.068  -29.131 1.00 19.02 ? 350  PHE E CA  1 
ATOM   4742  C  C   . PHE E  2 145 ? -44.855 14.060  -30.641 1.00 19.90 ? 350  PHE E C   1 
ATOM   4743  O  O   . PHE E  2 145 ? -43.930 14.434  -31.377 1.00 19.88 ? 350  PHE E O   1 
ATOM   4744  C  CB  . PHE E  2 145 ? -45.769 14.915  -28.457 1.00 19.30 ? 350  PHE E CB  1 
ATOM   4745  C  CG  . PHE E  2 145 ? -45.893 16.306  -29.009 1.00 19.92 ? 350  PHE E CG  1 
ATOM   4746  C  CD1 . PHE E  2 145 ? -44.877 17.237  -28.828 1.00 19.52 ? 350  PHE E CD1 1 
ATOM   4747  C  CD2 . PHE E  2 145 ? -47.041 16.694  -29.697 1.00 20.83 ? 350  PHE E CD2 1 
ATOM   4748  C  CE1 . PHE E  2 145 ? -44.998 18.520  -29.330 1.00 20.20 ? 350  PHE E CE1 1 
ATOM   4749  C  CE2 . PHE E  2 145 ? -47.160 17.981  -30.198 1.00 21.49 ? 350  PHE E CE2 1 
ATOM   4750  C  CZ  . PHE E  2 145 ? -46.143 18.895  -30.008 1.00 21.17 ? 350  PHE E CZ  1 
ATOM   4751  N  N   . GLU E  2 146 ? -46.014 13.583  -31.092 1.00 20.66 ? 351  GLU E N   1 
ATOM   4752  C  CA  . GLU E  2 146 ? -46.303 13.503  -32.507 1.00 21.73 ? 351  GLU E CA  1 
ATOM   4753  C  C   . GLU E  2 146 ? -47.168 14.666  -32.867 1.00 22.74 ? 351  GLU E C   1 
ATOM   4754  O  O   . GLU E  2 146 ? -48.328 14.709  -32.464 1.00 23.42 ? 351  GLU E O   1 
ATOM   4755  C  CB  . GLU E  2 146 ? -47.050 12.216  -32.846 1.00 22.23 ? 351  GLU E CB  1 
ATOM   4756  C  CG  . GLU E  2 146 ? -47.356 12.024  -34.344 1.00 23.33 ? 351  GLU E CG  1 
ATOM   4757  C  CD  . GLU E  2 146 ? -46.099 11.873  -35.208 1.00 23.35 ? 351  GLU E CD  1 
ATOM   4758  O  OE1 . GLU E  2 146 ? -44.987 11.732  -34.643 1.00 22.35 ? 351  GLU E OE1 1 
ATOM   4759  O  OE2 . GLU E  2 146 ? -46.212 11.887  -36.460 1.00 24.41 ? 351  GLU E OE2 1 
ATOM   4760  N  N   . VAL E  2 147 ? -46.599 15.606  -33.618 1.00 23.27 ? 352  VAL E N   1 
ATOM   4761  C  CA  . VAL E  2 147 ? -47.348 16.709  -34.209 1.00 24.43 ? 352  VAL E CA  1 
ATOM   4762  C  C   . VAL E  2 147 ? -48.215 16.141  -35.305 1.00 25.71 ? 352  VAL E C   1 
ATOM   4763  O  O   . VAL E  2 147 ? -47.692 15.556  -36.257 1.00 26.03 ? 352  VAL E O   1 
ATOM   4764  C  CB  . VAL E  2 147 ? -46.406 17.740  -34.863 1.00 24.75 ? 352  VAL E CB  1 
ATOM   4765  C  CG1 . VAL E  2 147 ? -47.180 18.725  -35.738 1.00 26.18 ? 352  VAL E CG1 1 
ATOM   4766  C  CG2 . VAL E  2 147 ? -45.588 18.460  -33.809 1.00 23.83 ? 352  VAL E CG2 1 
ATOM   4767  N  N   . TYR E  2 148 ? -49.528 16.311  -35.171 1.00 26.70 ? 353  TYR E N   1 
ATOM   4768  C  CA  . TYR E  2 148 ? -50.475 15.958  -36.230 1.00 28.16 ? 353  TYR E CA  1 
ATOM   4769  C  C   . TYR E  2 148 ? -50.975 17.236  -36.906 1.00 29.51 ? 353  TYR E C   1 
ATOM   4770  O  O   . TYR E  2 148 ? -50.728 18.345  -36.422 1.00 29.29 ? 353  TYR E O   1 
ATOM   4771  C  CB  . TYR E  2 148 ? -51.658 15.158  -35.670 1.00 28.37 ? 353  TYR E CB  1 
ATOM   4772  C  CG  . TYR E  2 148 ? -51.321 13.754  -35.233 1.00 27.68 ? 353  TYR E CG  1 
ATOM   4773  C  CD1 . TYR E  2 148 ? -51.133 12.733  -36.167 1.00 28.26 ? 353  TYR E CD1 1 
ATOM   4774  C  CD2 . TYR E  2 148 ? -51.190 13.439  -33.880 1.00 26.70 ? 353  TYR E CD2 1 
ATOM   4775  C  CE1 . TYR E  2 148 ? -50.832 11.438  -35.766 1.00 27.63 ? 353  TYR E CE1 1 
ATOM   4776  C  CE2 . TYR E  2 148 ? -50.888 12.149  -33.470 1.00 26.09 ? 353  TYR E CE2 1 
ATOM   4777  C  CZ  . TYR E  2 148 ? -50.715 11.156  -34.414 1.00 26.66 ? 353  TYR E CZ  1 
ATOM   4778  O  OH  . TYR E  2 148 ? -50.399 9.884   -33.989 1.00 26.68 ? 353  TYR E OH  1 
ATOM   4779  N  N   . ASP E  2 149 ? -51.698 17.068  -38.010 1.00 30.93 ? 354  ASP E N   1 
ATOM   4780  C  CA  . ASP E  2 149 ? -52.139 18.196  -38.816 1.00 32.44 ? 354  ASP E CA  1 
ATOM   4781  C  C   . ASP E  2 149 ? -52.946 19.205  -38.005 1.00 32.68 ? 354  ASP E C   1 
ATOM   4782  O  O   . ASP E  2 149 ? -52.785 20.414  -38.198 1.00 33.04 ? 354  ASP E O   1 
ATOM   4783  C  CB  . ASP E  2 149 ? -52.952 17.718  -40.030 1.00 34.02 ? 354  ASP E CB  1 
ATOM   4784  C  CG  . ASP E  2 149 ? -52.135 16.847  -40.974 1.00 34.37 ? 354  ASP E CG  1 
ATOM   4785  O  OD1 . ASP E  2 149 ? -50.898 16.981  -40.945 1.00 33.38 ? 354  ASP E OD1 1 
ATOM   4786  O  OD2 . ASP E  2 149 ? -52.720 16.039  -41.748 1.00 35.17 ? 354  ASP E OD2 1 
ATOM   4787  N  N   . ASP E  2 150 ? -53.796 18.714  -37.098 1.00 32.42 ? 355  ASP E N   1 
ATOM   4788  C  CA  . ASP E  2 150 ? -54.668 19.606  -36.319 1.00 32.91 ? 355  ASP E CA  1 
ATOM   4789  C  C   . ASP E  2 150 ? -53.905 20.463  -35.325 1.00 31.94 ? 355  ASP E C   1 
ATOM   4790  O  O   . ASP E  2 150 ? -54.404 21.508  -34.904 1.00 32.60 ? 355  ASP E O   1 
ATOM   4791  C  CB  . ASP E  2 150 ? -55.836 18.866  -35.635 1.00 33.28 ? 355  ASP E CB  1 
ATOM   4792  C  CG  . ASP E  2 150 ? -55.388 17.759  -34.692 1.00 32.20 ? 355  ASP E CG  1 
ATOM   4793  O  OD1 . ASP E  2 150 ? -54.189 17.657  -34.359 1.00 31.15 ? 355  ASP E OD1 1 
ATOM   4794  O  OD2 . ASP E  2 150 ? -56.257 16.961  -34.286 1.00 32.80 ? 355  ASP E OD2 1 
ATOM   4795  N  N   . PHE E  2 151 ? -52.692 20.041  -34.972 1.00 30.55 ? 356  PHE E N   1 
ATOM   4796  C  CA  . PHE E  2 151 ? -51.809 20.857  -34.135 1.00 29.66 ? 356  PHE E CA  1 
ATOM   4797  C  C   . PHE E  2 151 ? -51.373 22.147  -34.831 1.00 30.63 ? 356  PHE E C   1 
ATOM   4798  O  O   . PHE E  2 151 ? -51.056 23.140  -34.164 1.00 30.34 ? 356  PHE E O   1 
ATOM   4799  C  CB  . PHE E  2 151 ? -50.577 20.069  -33.721 1.00 28.08 ? 356  PHE E CB  1 
ATOM   4800  C  CG  . PHE E  2 151 ? -49.791 20.720  -32.630 1.00 27.05 ? 356  PHE E CG  1 
ATOM   4801  C  CD1 . PHE E  2 151 ? -50.220 20.647  -31.317 1.00 26.53 ? 356  PHE E CD1 1 
ATOM   4802  C  CD2 . PHE E  2 151 ? -48.628 21.408  -32.911 1.00 26.84 ? 356  PHE E CD2 1 
ATOM   4803  C  CE1 . PHE E  2 151 ? -49.489 21.240  -30.299 1.00 25.76 ? 356  PHE E CE1 1 
ATOM   4804  C  CE2 . PHE E  2 151 ? -47.896 22.004  -31.903 1.00 26.02 ? 356  PHE E CE2 1 
ATOM   4805  C  CZ  . PHE E  2 151 ? -48.328 21.925  -30.597 1.00 25.52 ? 356  PHE E CZ  1 
ATOM   4806  N  N   . LEU E  2 152 ? -51.368 22.132  -36.164 1.00 31.79 ? 357  LEU E N   1 
ATOM   4807  C  CA  . LEU E  2 152 ? -51.045 23.324  -36.947 1.00 33.04 ? 357  LEU E CA  1 
ATOM   4808  C  C   . LEU E  2 152 ? -52.202 24.336  -37.003 1.00 34.60 ? 357  LEU E C   1 
ATOM   4809  O  O   . LEU E  2 152 ? -52.092 25.354  -37.669 1.00 35.62 ? 357  LEU E O   1 
ATOM   4810  C  CB  . LEU E  2 152 ? -50.605 22.917  -38.356 1.00 33.89 ? 357  LEU E CB  1 
ATOM   4811  C  CG  . LEU E  2 152 ? -49.433 21.919  -38.395 1.00 32.79 ? 357  LEU E CG  1 
ATOM   4812  C  CD1 . LEU E  2 152 ? -49.029 21.610  -39.830 1.00 33.94 ? 357  LEU E CD1 1 
ATOM   4813  C  CD2 . LEU E  2 152 ? -48.244 22.455  -37.615 1.00 31.71 ? 357  LEU E CD2 1 
ATOM   4814  N  N   . HIS E  2 153 ? -53.301 24.036  -36.305 1.00 35.08 ? 358  HIS E N   1 
ATOM   4815  C  CA  . HIS E  2 153 ? -54.428 24.959  -36.097 1.00 36.61 ? 358  HIS E CA  1 
ATOM   4816  C  C   . HIS E  2 153 ? -54.386 25.619  -34.723 1.00 35.86 ? 358  HIS E C   1 
ATOM   4817  O  O   . HIS E  2 153 ? -55.136 26.557  -34.471 1.00 37.01 ? 358  HIS E O   1 
ATOM   4818  C  CB  . HIS E  2 153 ? -55.758 24.196  -36.216 1.00 37.62 ? 358  HIS E CB  1 
ATOM   4819  C  CG  . HIS E  2 153 ? -56.969 25.079  -36.266 1.00 39.68 ? 358  HIS E CG  1 
ATOM   4820  N  ND1 . HIS E  2 153 ? -57.468 25.597  -37.445 1.00 41.74 ? 358  HIS E ND1 1 
ATOM   4821  C  CD2 . HIS E  2 153 ? -57.782 25.537  -35.283 1.00 40.19 ? 358  HIS E CD2 1 
ATOM   4822  C  CE1 . HIS E  2 153 ? -58.531 26.340  -37.186 1.00 43.05 ? 358  HIS E CE1 1 
ATOM   4823  N  NE2 . HIS E  2 153 ? -58.743 26.321  -35.882 1.00 42.20 ? 358  HIS E NE2 1 
ATOM   4824  N  N   . TYR E  2 154 ? -53.529 25.124  -33.831 1.00 34.27 ? 359  TYR E N   1 
ATOM   4825  C  CA  . TYR E  2 154 ? -53.509 25.592  -32.446 1.00 33.50 ? 359  TYR E CA  1 
ATOM   4826  C  C   . TYR E  2 154 ? -53.120 27.052  -32.374 1.00 34.42 ? 359  TYR E C   1 
ATOM   4827  O  O   . TYR E  2 154 ? -52.114 27.449  -32.949 1.00 34.42 ? 359  TYR E O   1 
ATOM   4828  C  CB  . TYR E  2 154 ? -52.513 24.787  -31.603 1.00 31.60 ? 359  TYR E CB  1 
ATOM   4829  C  CG  . TYR E  2 154 ? -52.469 25.208  -30.139 1.00 30.84 ? 359  TYR E CG  1 
ATOM   4830  C  CD1 . TYR E  2 154 ? -53.421 24.749  -29.242 1.00 30.78 ? 359  TYR E CD1 1 
ATOM   4831  C  CD2 . TYR E  2 154 ? -51.479 26.065  -29.661 1.00 30.39 ? 359  TYR E CD2 1 
ATOM   4832  C  CE1 . TYR E  2 154 ? -53.397 25.122  -27.916 1.00 30.48 ? 359  TYR E CE1 1 
ATOM   4833  C  CE2 . TYR E  2 154 ? -51.446 26.452  -28.329 1.00 29.94 ? 359  TYR E CE2 1 
ATOM   4834  C  CZ  . TYR E  2 154 ? -52.413 25.979  -27.462 1.00 29.98 ? 359  TYR E CZ  1 
ATOM   4835  O  OH  . TYR E  2 154 ? -52.406 26.342  -26.139 1.00 29.75 ? 359  TYR E OH  1 
ATOM   4836  N  N   . LYS E  2 155 ? -53.936 27.842  -31.680 1.00 35.69 ? 360  LYS E N   1 
ATOM   4837  C  CA  . LYS E  2 155 ? -53.540 29.179  -31.217 1.00 36.26 ? 360  LYS E CA  1 
ATOM   4838  C  C   . LYS E  2 155 ? -53.601 29.301  -29.693 1.00 35.60 ? 360  LYS E C   1 
ATOM   4839  O  O   . LYS E  2 155 ? -52.774 29.984  -29.097 1.00 35.16 ? 360  LYS E O   1 
ATOM   4840  C  CB  . LYS E  2 155 ? -54.410 30.264  -31.862 1.00 38.29 ? 360  LYS E CB  1 
ATOM   4841  C  CG  . LYS E  2 155 ? -53.972 30.642  -33.275 1.00 39.46 ? 360  LYS E CG  1 
ATOM   4842  C  CD  . LYS E  2 155 ? -54.281 32.098  -33.632 1.00 41.44 ? 360  LYS E CD  1 
ATOM   4843  C  CE  . LYS E  2 155 ? -55.767 32.298  -33.894 1.00 43.09 ? 360  LYS E CE  1 
ATOM   4844  N  NZ  . LYS E  2 155 ? -56.079 33.675  -34.378 1.00 45.28 ? 360  LYS E NZ  1 
ATOM   4845  N  N   . LYS E  2 156 ? -54.588 28.660  -29.074 1.00 35.71 ? 361  LYS E N   1 
ATOM   4846  C  CA  . LYS E  2 156 ? -54.759 28.718  -27.627 1.00 35.47 ? 361  LYS E CA  1 
ATOM   4847  C  C   . LYS E  2 156 ? -55.569 27.533  -27.087 1.00 34.80 ? 361  LYS E C   1 
ATOM   4848  O  O   . LYS E  2 156 ? -56.117 26.739  -27.846 1.00 34.92 ? 361  LYS E O   1 
ATOM   4849  C  CB  . LYS E  2 156 ? -55.438 30.036  -27.237 1.00 37.23 ? 361  LYS E CB  1 
ATOM   4850  C  CG  . LYS E  2 156 ? -56.845 30.214  -27.802 1.00 39.16 ? 361  LYS E CG  1 
ATOM   4851  C  CD  . LYS E  2 156 ? -57.450 31.543  -27.363 1.00 41.31 ? 361  LYS E CD  1 
ATOM   4852  C  CE  . LYS E  2 156 ? -58.962 31.586  -27.574 1.00 43.35 ? 361  LYS E CE  1 
ATOM   4853  N  NZ  . LYS E  2 156 ? -59.578 32.679  -26.768 1.00 44.90 ? 361  LYS E NZ  1 
ATOM   4854  N  N   . GLY E  2 157 ? -55.639 27.432  -25.768 1.00 34.24 ? 362  GLY E N   1 
ATOM   4855  C  CA  . GLY E  2 157 ? -56.410 26.390  -25.107 1.00 34.14 ? 362  GLY E CA  1 
ATOM   4856  C  C   . GLY E  2 157 ? -55.590 25.154  -24.795 1.00 32.84 ? 362  GLY E C   1 
ATOM   4857  O  O   . GLY E  2 157 ? -54.357 25.205  -24.723 1.00 31.57 ? 362  GLY E O   1 
ATOM   4858  N  N   . ILE E  2 158 ? -56.288 24.038  -24.606 1.00 33.04 ? 363  ILE E N   1 
ATOM   4859  C  CA  . ILE E  2 158 ? -55.659 22.786  -24.252 1.00 31.96 ? 363  ILE E CA  1 
ATOM   4860  C  C   . ILE E  2 158 ? -55.797 21.834  -25.434 1.00 31.80 ? 363  ILE E C   1 
ATOM   4861  O  O   . ILE E  2 158 ? -56.870 21.319  -25.717 1.00 32.40 ? 363  ILE E O   1 
ATOM   4862  C  CB  . ILE E  2 158 ? -56.275 22.199  -22.969 1.00 32.49 ? 363  ILE E CB  1 
ATOM   4863  C  CG1 . ILE E  2 158 ? -56.154 23.208  -21.819 1.00 33.23 ? 363  ILE E CG1 1 
ATOM   4864  C  CG2 . ILE E  2 158 ? -55.569 20.909  -22.585 1.00 31.18 ? 363  ILE E CG2 1 
ATOM   4865  C  CD1 . ILE E  2 158 ? -57.164 23.001  -20.713 1.00 34.87 ? 363  ILE E CD1 1 
ATOM   4866  N  N   . TYR E  2 159 ? -54.686 21.613  -26.123 1.00 31.03 ? 364  TYR E N   1 
ATOM   4867  C  CA  . TYR E  2 159 ? -54.682 20.791  -27.315 1.00 30.99 ? 364  TYR E CA  1 
ATOM   4868  C  C   . TYR E  2 159 ? -54.950 19.316  -27.004 1.00 30.87 ? 364  TYR E C   1 
ATOM   4869  O  O   . TYR E  2 159 ? -54.535 18.792  -25.981 1.00 29.60 ? 364  TYR E O   1 
ATOM   4870  C  CB  . TYR E  2 159 ? -53.363 20.939  -28.082 1.00 29.94 ? 364  TYR E CB  1 
ATOM   4871  C  CG  . TYR E  2 159 ? -53.245 19.939  -29.198 1.00 29.79 ? 364  TYR E CG  1 
ATOM   4872  C  CD1 . TYR E  2 159 ? -53.872 20.150  -30.414 1.00 30.90 ? 364  TYR E CD1 1 
ATOM   4873  C  CD2 . TYR E  2 159 ? -52.547 18.751  -29.017 1.00 28.68 ? 364  TYR E CD2 1 
ATOM   4874  C  CE1 . TYR E  2 159 ? -53.783 19.218  -31.438 1.00 30.95 ? 364  TYR E CE1 1 
ATOM   4875  C  CE2 . TYR E  2 159 ? -52.441 17.818  -30.026 1.00 28.74 ? 364  TYR E CE2 1 
ATOM   4876  C  CZ  . TYR E  2 159 ? -53.060 18.050  -31.240 1.00 29.96 ? 364  TYR E CZ  1 
ATOM   4877  O  OH  . TYR E  2 159 ? -52.955 17.106  -32.242 1.00 30.14 ? 364  TYR E OH  1 
ATOM   4878  N  N   . HIS E  2 160 ? -55.658 18.680  -27.934 1.00 32.37 ? 365  HIS E N   1 
ATOM   4879  C  CA  . HIS E  2 160 ? -56.074 17.296  -27.861 1.00 33.17 ? 365  HIS E CA  1 
ATOM   4880  C  C   . HIS E  2 160 ? -56.255 16.879  -29.312 1.00 34.01 ? 365  HIS E C   1 
ATOM   4881  O  O   . HIS E  2 160 ? -56.875 17.607  -30.074 1.00 35.19 ? 365  HIS E O   1 
ATOM   4882  C  CB  . HIS E  2 160 ? -57.398 17.208  -27.096 1.00 34.62 ? 365  HIS E CB  1 
ATOM   4883  C  CG  . HIS E  2 160 ? -58.163 15.937  -27.316 1.00 36.15 ? 365  HIS E CG  1 
ATOM   4884  N  ND1 . HIS E  2 160 ? -57.723 14.707  -26.862 1.00 36.07 ? 365  HIS E ND1 1 
ATOM   4885  C  CD2 . HIS E  2 160 ? -59.365 15.710  -27.902 1.00 37.79 ? 365  HIS E CD2 1 
ATOM   4886  C  CE1 . HIS E  2 160 ? -58.611 13.776  -27.176 1.00 36.93 ? 365  HIS E CE1 1 
ATOM   4887  N  NE2 . HIS E  2 160 ? -59.617 14.358  -27.806 1.00 37.99 ? 365  HIS E NE2 1 
ATOM   4888  N  N   . HIS E  2 161 ? -55.704 15.735  -29.699 1.00 33.70 ? 366  HIS E N   1 
ATOM   4889  C  CA  . HIS E  2 161 ? -55.815 15.255  -31.068 1.00 34.61 ? 366  HIS E CA  1 
ATOM   4890  C  C   . HIS E  2 161 ? -57.165 14.591  -31.303 1.00 36.77 ? 366  HIS E C   1 
ATOM   4891  O  O   . HIS E  2 161 ? -57.628 13.799  -30.478 1.00 37.16 ? 366  HIS E O   1 
ATOM   4892  C  CB  . HIS E  2 161 ? -54.684 14.277  -31.395 1.00 33.56 ? 366  HIS E CB  1 
ATOM   4893  C  CG  . HIS E  2 161 ? -54.799 13.651  -32.750 1.00 34.47 ? 366  HIS E CG  1 
ATOM   4894  N  ND1 . HIS E  2 161 ? -55.024 14.388  -33.894 1.00 35.50 ? 366  HIS E ND1 1 
ATOM   4895  C  CD2 . HIS E  2 161 ? -54.719 12.358  -33.145 1.00 34.44 ? 366  HIS E CD2 1 
ATOM   4896  C  CE1 . HIS E  2 161 ? -55.088 13.575  -34.934 1.00 36.27 ? 366  HIS E CE1 1 
ATOM   4897  N  NE2 . HIS E  2 161 ? -54.908 12.337  -34.507 1.00 35.52 ? 366  HIS E NE2 1 
ATOM   4898  N  N   . THR E  2 162 ? -57.773 14.914  -32.443 1.00 38.69 ? 367  THR E N   1 
ATOM   4899  C  CA  . THR E  2 162 ? -59.049 14.354  -32.857 1.00 40.70 ? 367  THR E CA  1 
ATOM   4900  C  C   . THR E  2 162 ? -58.877 13.621  -34.181 1.00 41.55 ? 367  THR E C   1 
ATOM   4901  O  O   . THR E  2 162 ? -58.793 12.395  -34.207 1.00 42.47 ? 367  THR E O   1 
ATOM   4902  C  CB  . THR E  2 162 ? -60.087 15.464  -33.054 1.00 42.71 ? 367  THR E CB  1 
ATOM   4903  O  OG1 . THR E  2 162 ? -59.661 16.319  -34.122 1.00 43.79 ? 367  THR E OG1 1 
ATOM   4904  C  CG2 . THR E  2 162 ? -60.246 16.300  -31.768 1.00 42.50 ? 367  THR E CG2 1 
ATOM   4905  N  N   . PRO F  3 2   ? -44.358 -9.587  -26.278 1.00 38.73 ? 372  PRO F N   1 
ATOM   4906  C  CA  . PRO F  3 2   ? -43.129 -9.049  -25.698 1.00 37.40 ? 372  PRO F CA  1 
ATOM   4907  C  C   . PRO F  3 2   ? -43.099 -7.526  -25.705 1.00 35.08 ? 372  PRO F C   1 
ATOM   4908  O  O   . PRO F  3 2   ? -43.800 -6.895  -26.492 1.00 34.55 ? 372  PRO F O   1 
ATOM   4909  C  CB  . PRO F  3 2   ? -42.026 -9.606  -26.611 1.00 39.01 ? 372  PRO F CB  1 
ATOM   4910  C  CG  . PRO F  3 2   ? -42.710 -9.995  -27.889 1.00 39.86 ? 372  PRO F CG  1 
ATOM   4911  C  CD  . PRO F  3 2   ? -44.107 -10.374 -27.501 1.00 40.13 ? 372  PRO F CD  1 
ATOM   4912  N  N   . PHE F  3 3   ? -42.266 -6.963  -24.834 1.00 33.40 ? 373  PHE F N   1 
ATOM   4913  C  CA  . PHE F  3 3   ? -42.147 -5.516  -24.613 1.00 30.73 ? 373  PHE F CA  1 
ATOM   4914  C  C   . PHE F  3 3   ? -41.721 -4.774  -25.894 1.00 29.83 ? 373  PHE F C   1 
ATOM   4915  O  O   . PHE F  3 3   ? -40.691 -5.076  -26.468 1.00 29.44 ? 373  PHE F O   1 
ATOM   4916  C  CB  . PHE F  3 3   ? -41.129 -5.323  -23.469 1.00 30.23 ? 373  PHE F CB  1 
ATOM   4917  C  CG  . PHE F  3 3   ? -40.917 -3.897  -23.032 1.00 28.79 ? 373  PHE F CG  1 
ATOM   4918  C  CD1 . PHE F  3 3   ? -41.981 -3.078  -22.705 1.00 27.98 ? 373  PHE F CD1 1 
ATOM   4919  C  CD2 . PHE F  3 3   ? -39.624 -3.395  -22.890 1.00 28.14 ? 373  PHE F CD2 1 
ATOM   4920  C  CE1 . PHE F  3 3   ? -41.764 -1.776  -22.280 1.00 26.96 ? 373  PHE F CE1 1 
ATOM   4921  C  CE2 . PHE F  3 3   ? -39.398 -2.089  -22.469 1.00 27.17 ? 373  PHE F CE2 1 
ATOM   4922  C  CZ  . PHE F  3 3   ? -40.474 -1.278  -22.162 1.00 26.37 ? 373  PHE F CZ  1 
ATOM   4923  N  N   . ASN F  3 4   ? -42.555 -3.849  -26.366 1.00 28.90 ? 374  ASN F N   1 
ATOM   4924  C  CA  . ASN F  3 4   ? -42.177 -2.890  -27.412 1.00 27.93 ? 374  ASN F CA  1 
ATOM   4925  C  C   . ASN F  3 4   ? -42.593 -1.491  -26.990 1.00 26.36 ? 374  ASN F C   1 
ATOM   4926  O  O   . ASN F  3 4   ? -43.766 -1.122  -27.101 1.00 26.54 ? 374  ASN F O   1 
ATOM   4927  C  CB  . ASN F  3 4   ? -42.817 -3.217  -28.753 1.00 29.21 ? 374  ASN F CB  1 
ATOM   4928  C  CG  . ASN F  3 4   ? -42.270 -2.349  -29.890 1.00 29.62 ? 374  ASN F CG  1 
ATOM   4929  O  OD1 . ASN F  3 4   ? -41.616 -1.320  -29.663 1.00 28.90 ? 374  ASN F OD1 1 
ATOM   4930  N  ND2 . ASN F  3 4   ? -42.526 -2.770  -31.126 1.00 30.69 ? 374  ASN F ND2 1 
ATOM   4931  N  N   . PRO F  3 5   ? -41.634 -0.700  -26.504 1.00 24.65 ? 375  PRO F N   1 
ATOM   4932  C  CA  . PRO F  3 5   ? -41.956 0.612   -25.986 1.00 23.50 ? 375  PRO F CA  1 
ATOM   4933  C  C   . PRO F  3 5   ? -42.248 1.706   -27.034 1.00 23.05 ? 375  PRO F C   1 
ATOM   4934  O  O   . PRO F  3 5   ? -42.672 2.809   -26.667 1.00 22.70 ? 375  PRO F O   1 
ATOM   4935  C  CB  . PRO F  3 5   ? -40.705 0.967   -25.170 1.00 22.76 ? 375  PRO F CB  1 
ATOM   4936  C  CG  . PRO F  3 5   ? -39.605 0.229   -25.837 1.00 23.56 ? 375  PRO F CG  1 
ATOM   4937  C  CD  . PRO F  3 5   ? -40.221 -1.054  -26.290 1.00 24.69 ? 375  PRO F CD  1 
ATOM   4938  N  N   . PHE F  3 6   ? -42.021 1.410   -28.308 1.00 23.22 ? 376  PHE F N   1 
ATOM   4939  C  CA  . PHE F  3 6   ? -42.145 2.406   -29.379 1.00 22.67 ? 376  PHE F CA  1 
ATOM   4940  C  C   . PHE F  3 6   ? -43.461 3.193   -29.419 1.00 22.17 ? 376  PHE F C   1 
ATOM   4941  O  O   . PHE F  3 6   ? -44.537 2.607   -29.554 1.00 22.49 ? 376  PHE F O   1 
ATOM   4942  C  CB  . PHE F  3 6   ? -41.979 1.725   -30.734 1.00 23.60 ? 376  PHE F CB  1 
ATOM   4943  C  CG  . PHE F  3 6   ? -42.002 2.682   -31.873 1.00 23.92 ? 376  PHE F CG  1 
ATOM   4944  C  CD1 . PHE F  3 6   ? -40.878 3.445   -32.167 1.00 23.66 ? 376  PHE F CD1 1 
ATOM   4945  C  CD2 . PHE F  3 6   ? -43.163 2.865   -32.628 1.00 24.41 ? 376  PHE F CD2 1 
ATOM   4946  C  CE1 . PHE F  3 6   ? -40.891 4.354   -33.203 1.00 23.93 ? 376  PHE F CE1 1 
ATOM   4947  C  CE2 . PHE F  3 6   ? -43.185 3.772   -33.666 1.00 24.84 ? 376  PHE F CE2 1 
ATOM   4948  C  CZ  . PHE F  3 6   ? -42.042 4.515   -33.958 1.00 24.74 ? 376  PHE F CZ  1 
ATOM   4949  N  N   . GLU F  3 7   ? -43.369 4.516   -29.331 1.00 21.13 ? 377  GLU F N   1 
ATOM   4950  C  CA  . GLU F  3 7   ? -44.488 5.400   -29.688 1.00 21.04 ? 377  GLU F CA  1 
ATOM   4951  C  C   . GLU F  3 7   ? -43.962 6.459   -30.670 1.00 20.91 ? 377  GLU F C   1 
ATOM   4952  O  O   . GLU F  3 7   ? -42.931 7.083   -30.438 1.00 20.11 ? 377  GLU F O   1 
ATOM   4953  C  CB  . GLU F  3 7   ? -45.118 6.078   -28.458 1.00 20.49 ? 377  GLU F CB  1 
ATOM   4954  C  CG  . GLU F  3 7   ? -45.549 5.134   -27.340 1.00 20.60 ? 377  GLU F CG  1 
ATOM   4955  C  CD  . GLU F  3 7   ? -46.363 5.822   -26.234 1.00 20.55 ? 377  GLU F CD  1 
ATOM   4956  O  OE1 . GLU F  3 7   ? -46.852 6.964   -26.426 1.00 20.53 ? 377  GLU F OE1 1 
ATOM   4957  O  OE2 . GLU F  3 7   ? -46.553 5.214   -25.162 1.00 20.80 ? 377  GLU F OE2 1 
ATOM   4958  N  N   . LEU F  3 8   ? -44.682 6.660   -31.760 1.00 21.42 ? 378  LEU F N   1 
ATOM   4959  C  CA  . LEU F  3 8   ? -44.246 7.545   -32.818 1.00 21.70 ? 378  LEU F CA  1 
ATOM   4960  C  C   . LEU F  3 8   ? -44.174 8.987   -32.306 1.00 21.07 ? 378  LEU F C   1 
ATOM   4961  O  O   . LEU F  3 8   ? -45.125 9.482   -31.721 1.00 20.79 ? 378  LEU F O   1 
ATOM   4962  C  CB  . LEU F  3 8   ? -45.228 7.447   -33.989 1.00 22.74 ? 378  LEU F CB  1 
ATOM   4963  C  CG  . LEU F  3 8   ? -44.973 8.264   -35.251 1.00 23.55 ? 378  LEU F CG  1 
ATOM   4964  C  CD1 . LEU F  3 8   ? -43.650 7.896   -35.898 1.00 23.86 ? 378  LEU F CD1 1 
ATOM   4965  C  CD2 . LEU F  3 8   ? -46.125 8.034   -36.224 1.00 24.80 ? 378  LEU F CD2 1 
ATOM   4966  N  N   . THR F  3 9   ? -43.038 9.639   -32.521 1.00 20.91 ? 379  THR F N   1 
ATOM   4967  C  CA  . THR F  3 9   ? -42.883 11.049  -32.225 1.00 20.75 ? 379  THR F CA  1 
ATOM   4968  C  C   . THR F  3 9   ? -42.120 11.705  -33.362 1.00 21.58 ? 379  THR F C   1 
ATOM   4969  O  O   . THR F  3 9   ? -41.417 11.041  -34.105 1.00 22.68 ? 379  THR F O   1 
ATOM   4970  C  CB  . THR F  3 9   ? -42.101 11.308  -30.925 1.00 19.69 ? 379  THR F CB  1 
ATOM   4971  O  OG1 . THR F  3 9   ? -40.830 10.663  -31.008 1.00 19.68 ? 379  THR F OG1 1 
ATOM   4972  C  CG2 . THR F  3 9   ? -42.856 10.787  -29.715 1.00 19.15 ? 379  THR F CG2 1 
ATOM   4973  N  N   . ASN F  3 10  ? -42.283 13.013  -33.485 1.00 21.70 ? 380  ASN F N   1 
ATOM   4974  C  CA  . ASN F  3 10  ? -41.631 13.780  -34.534 1.00 22.54 ? 380  ASN F CA  1 
ATOM   4975  C  C   . ASN F  3 10  ? -41.181 15.183  -34.102 1.00 22.38 ? 380  ASN F C   1 
ATOM   4976  O  O   . ASN F  3 10  ? -40.554 15.889  -34.878 1.00 23.87 ? 380  ASN F O   1 
ATOM   4977  C  CB  . ASN F  3 10  ? -42.547 13.858  -35.763 1.00 23.61 ? 380  ASN F CB  1 
ATOM   4978  C  CG  . ASN F  3 10  ? -43.819 14.636  -35.497 1.00 23.70 ? 380  ASN F CG  1 
ATOM   4979  O  OD1 . ASN F  3 10  ? -43.907 15.406  -34.545 1.00 22.83 ? 380  ASN F OD1 1 
ATOM   4980  N  ND2 . ASN F  3 10  ? -44.814 14.448  -36.350 1.00 24.70 ? 380  ASN F ND2 1 
ATOM   4981  N  N   . HIS F  3 11  ? -41.480 15.582  -32.868 1.00 21.54 ? 381  HIS F N   1 
ATOM   4982  C  CA  . HIS F  3 11  ? -41.125 16.911  -32.410 1.00 21.54 ? 381  HIS F CA  1 
ATOM   4983  C  C   . HIS F  3 11  ? -40.700 16.941  -30.940 1.00 20.40 ? 381  HIS F C   1 
ATOM   4984  O  O   . HIS F  3 11  ? -41.409 16.420  -30.077 1.00 19.92 ? 381  HIS F O   1 
ATOM   4985  C  CB  . HIS F  3 11  ? -42.303 17.842  -32.640 1.00 22.22 ? 381  HIS F CB  1 
ATOM   4986  C  CG  . HIS F  3 11  ? -41.976 19.289  -32.465 1.00 22.57 ? 381  HIS F CG  1 
ATOM   4987  N  ND1 . HIS F  3 11  ? -40.809 19.851  -32.931 1.00 22.99 ? 381  HIS F ND1 1 
ATOM   4988  C  CD2 . HIS F  3 11  ? -42.681 20.297  -31.901 1.00 22.75 ? 381  HIS F CD2 1 
ATOM   4989  C  CE1 . HIS F  3 11  ? -40.809 21.143  -32.664 1.00 23.41 ? 381  HIS F CE1 1 
ATOM   4990  N  NE2 . HIS F  3 11  ? -41.930 21.438  -32.033 1.00 23.17 ? 381  HIS F NE2 1 
ATOM   4991  N  N   . ALA F  3 12  ? -39.557 17.574  -30.663 1.00 20.03 ? 382  ALA F N   1 
ATOM   4992  C  CA  . ALA F  3 12  ? -39.016 17.660  -29.310 1.00 19.12 ? 382  ALA F CA  1 
ATOM   4993  C  C   . ALA F  3 12  ? -39.263 19.032  -28.693 1.00 19.03 ? 382  ALA F C   1 
ATOM   4994  O  O   . ALA F  3 12  ? -38.996 20.066  -29.303 1.00 19.81 ? 382  ALA F O   1 
ATOM   4995  C  CB  . ALA F  3 12  ? -37.534 17.342  -29.327 1.00 19.09 ? 382  ALA F CB  1 
ATOM   4996  N  N   . VAL F  3 13  ? -39.786 19.037  -27.474 1.00 18.44 ? 383  VAL F N   1 
ATOM   4997  C  CA  . VAL F  3 13  ? -40.182 20.284  -26.816 1.00 18.49 ? 383  VAL F CA  1 
ATOM   4998  C  C   . VAL F  3 13  ? -39.780 20.259  -25.342 1.00 17.79 ? 383  VAL F C   1 
ATOM   4999  O  O   . VAL F  3 13  ? -39.296 19.245  -24.839 1.00 17.22 ? 383  VAL F O   1 
ATOM   5000  C  CB  . VAL F  3 13  ? -41.701 20.570  -26.977 1.00 18.95 ? 383  VAL F CB  1 
ATOM   5001  C  CG1 . VAL F  3 13  ? -42.030 20.927  -28.415 1.00 19.88 ? 383  VAL F CG1 1 
ATOM   5002  C  CG2 . VAL F  3 13  ? -42.536 19.377  -26.545 1.00 18.82 ? 383  VAL F CG2 1 
ATOM   5003  N  N   . LEU F  3 14  ? -39.972 21.383  -24.660 1.00 17.94 ? 384  LEU F N   1 
ATOM   5004  C  CA  . LEU F  3 14  ? -39.573 21.512  -23.271 1.00 17.53 ? 384  LEU F CA  1 
ATOM   5005  C  C   . LEU F  3 14  ? -40.782 21.599  -22.339 1.00 17.70 ? 384  LEU F C   1 
ATOM   5006  O  O   . LEU F  3 14  ? -41.585 22.531  -22.409 1.00 18.37 ? 384  LEU F O   1 
ATOM   5007  C  CB  . LEU F  3 14  ? -38.667 22.735  -23.090 1.00 17.69 ? 384  LEU F CB  1 
ATOM   5008  C  CG  . LEU F  3 14  ? -37.956 22.775  -21.734 1.00 17.35 ? 384  LEU F CG  1 
ATOM   5009  C  CD1 . LEU F  3 14  ? -36.920 21.678  -21.630 1.00 16.76 ? 384  LEU F CD1 1 
ATOM   5010  C  CD2 . LEU F  3 14  ? -37.308 24.129  -21.517 1.00 17.84 ? 384  LEU F CD2 1 
ATOM   5011  N  N   . LEU F  3 15  ? -40.891 20.617  -21.455 1.00 17.38 ? 385  LEU F N   1 
ATOM   5012  C  CA  . LEU F  3 15  ? -41.945 20.590  -20.466 1.00 17.74 ? 385  LEU F CA  1 
ATOM   5013  C  C   . LEU F  3 15  ? -41.565 21.520  -19.341 1.00 18.00 ? 385  LEU F C   1 
ATOM   5014  O  O   . LEU F  3 15  ? -40.527 21.342  -18.726 1.00 17.74 ? 385  LEU F O   1 
ATOM   5015  C  CB  . LEU F  3 15  ? -42.108 19.174  -19.916 1.00 17.52 ? 385  LEU F CB  1 
ATOM   5016  C  CG  . LEU F  3 15  ? -43.243 19.002  -18.904 1.00 17.94 ? 385  LEU F CG  1 
ATOM   5017  C  CD1 . LEU F  3 15  ? -44.580 19.054  -19.619 1.00 18.46 ? 385  LEU F CD1 1 
ATOM   5018  C  CD2 . LEU F  3 15  ? -43.100 17.697  -18.145 1.00 17.78 ? 385  LEU F CD2 1 
ATOM   5019  N  N   . VAL F  3 16  ? -42.397 22.515  -19.071 1.00 18.80 ? 386  VAL F N   1 
ATOM   5020  C  CA  . VAL F  3 16  ? -42.076 23.475  -18.031 1.00 19.31 ? 386  VAL F CA  1 
ATOM   5021  C  C   . VAL F  3 16  ? -43.085 23.513  -16.899 1.00 20.12 ? 386  VAL F C   1 
ATOM   5022  O  O   . VAL F  3 16  ? -42.802 24.126  -15.875 1.00 20.43 ? 386  VAL F O   1 
ATOM   5023  C  CB  . VAL F  3 16  ? -41.909 24.900  -18.582 1.00 19.81 ? 386  VAL F CB  1 
ATOM   5024  C  CG1 . VAL F  3 16  ? -40.951 24.889  -19.755 1.00 19.40 ? 386  VAL F CG1 1 
ATOM   5025  C  CG2 . VAL F  3 16  ? -43.252 25.507  -18.958 1.00 20.64 ? 386  VAL F CG2 1 
ATOM   5026  N  N   . GLY F  3 17  ? -44.249 22.885  -17.071 1.00 20.50 ? 387  GLY F N   1 
ATOM   5027  C  CA  . GLY F  3 17  ? -45.242 22.911  -16.015 1.00 21.62 ? 387  GLY F CA  1 
ATOM   5028  C  C   . GLY F  3 17  ? -46.451 22.023  -16.198 1.00 22.13 ? 387  GLY F C   1 
ATOM   5029  O  O   . GLY F  3 17  ? -46.569 21.296  -17.174 1.00 21.68 ? 387  GLY F O   1 
ATOM   5030  N  N   . TYR F  3 18  ? -47.351 22.093  -15.228 1.00 23.51 ? 388  TYR F N   1 
ATOM   5031  C  CA  . TYR F  3 18  ? -48.610 21.390  -15.301 1.00 24.44 ? 388  TYR F CA  1 
ATOM   5032  C  C   . TYR F  3 18  ? -49.684 22.128  -14.524 1.00 26.25 ? 388  TYR F C   1 
ATOM   5033  O  O   . TYR F  3 18  ? -49.403 22.889  -13.608 1.00 27.20 ? 388  TYR F O   1 
ATOM   5034  C  CB  . TYR F  3 18  ? -48.470 19.948  -14.807 1.00 23.94 ? 388  TYR F CB  1 
ATOM   5035  C  CG  . TYR F  3 18  ? -48.109 19.783  -13.352 1.00 24.21 ? 388  TYR F CG  1 
ATOM   5036  C  CD1 . TYR F  3 18  ? -49.077 19.868  -12.363 1.00 25.51 ? 388  TYR F CD1 1 
ATOM   5037  C  CD2 . TYR F  3 18  ? -46.814 19.493  -12.970 1.00 23.69 ? 388  TYR F CD2 1 
ATOM   5038  C  CE1 . TYR F  3 18  ? -48.758 19.688  -11.033 1.00 26.09 ? 388  TYR F CE1 1 
ATOM   5039  C  CE2 . TYR F  3 18  ? -46.480 19.316  -11.636 1.00 24.19 ? 388  TYR F CE2 1 
ATOM   5040  C  CZ  . TYR F  3 18  ? -47.458 19.413  -10.676 1.00 25.36 ? 388  TYR F CZ  1 
ATOM   5041  O  OH  . TYR F  3 18  ? -47.141 19.241  -9.355  1.00 26.30 ? 388  TYR F OH  1 
ATOM   5042  N  N   . GLY F  3 19  ? -50.924 21.887  -14.912 1.00 27.79 ? 389  GLY F N   1 
ATOM   5043  C  CA  . GLY F  3 19  ? -52.056 22.520  -14.277 1.00 30.08 ? 389  GLY F CA  1 
ATOM   5044  C  C   . GLY F  3 19  ? -53.331 21.798  -14.648 1.00 31.37 ? 389  GLY F C   1 
ATOM   5045  O  O   . GLY F  3 19  ? -53.302 20.735  -15.257 1.00 30.35 ? 389  GLY F O   1 
ATOM   5046  N  N   . THR F  3 20  ? -54.449 22.407  -14.277 1.00 34.79 ? 390  THR F N   1 
ATOM   5047  C  CA  . THR F  3 20  ? -55.762 21.823  -14.491 1.00 36.53 ? 390  THR F CA  1 
ATOM   5048  C  C   . THR F  3 20  ? -56.772 22.949  -14.695 1.00 39.14 ? 390  THR F C   1 
ATOM   5049  O  O   . THR F  3 20  ? -56.831 23.892  -13.896 1.00 39.97 ? 390  THR F O   1 
ATOM   5050  C  CB  . THR F  3 20  ? -56.163 20.907  -13.320 1.00 37.05 ? 390  THR F CB  1 
ATOM   5051  O  OG1 . THR F  3 20  ? -57.509 20.468  -13.504 1.00 39.34 ? 390  THR F OG1 1 
ATOM   5052  C  CG2 . THR F  3 20  ? -56.054 21.615  -11.977 1.00 38.17 ? 390  THR F CG2 1 
ATOM   5053  N  N   . ASP F  3 21  ? -57.540 22.855  -15.781 1.00 41.11 ? 391  ASP F N   1 
ATOM   5054  C  CA  . ASP F  3 21  ? -58.454 23.923  -16.182 1.00 44.93 ? 391  ASP F CA  1 
ATOM   5055  C  C   . ASP F  3 21  ? -59.573 24.089  -15.149 1.00 48.53 ? 391  ASP F C   1 
ATOM   5056  O  O   . ASP F  3 21  ? -60.366 23.168  -14.920 1.00 50.25 ? 391  ASP F O   1 
ATOM   5057  C  CB  . ASP F  3 21  ? -59.038 23.639  -17.573 1.00 45.71 ? 391  ASP F CB  1 
ATOM   5058  C  CG  . ASP F  3 21  ? -59.664 24.867  -18.218 1.00 48.13 ? 391  ASP F CG  1 
ATOM   5059  O  OD1 . ASP F  3 21  ? -59.208 26.005  -17.963 1.00 48.28 ? 391  ASP F OD1 1 
ATOM   5060  O  OD2 . ASP F  3 21  ? -60.614 24.685  -19.004 1.00 51.34 ? 391  ASP F OD2 1 
ATOM   5061  N  N   . SER F  3 22  ? -59.614 25.264  -14.521 1.00 51.36 ? 392  SER F N   1 
ATOM   5062  C  CA  . SER F  3 22  ? -60.574 25.553  -13.452 1.00 54.59 ? 392  SER F CA  1 
ATOM   5063  C  C   . SER F  3 22  ? -62.005 25.234  -13.911 1.00 56.35 ? 392  SER F C   1 
ATOM   5064  O  O   . SER F  3 22  ? -62.779 24.606  -13.184 1.00 57.41 ? 392  SER F O   1 
ATOM   5065  C  CB  . SER F  3 22  ? -60.454 27.021  -13.019 1.00 56.41 ? 392  SER F CB  1 
ATOM   5066  O  OG  . SER F  3 22  ? -60.679 27.173  -11.630 1.00 58.93 ? 392  SER F OG  1 
ATOM   5067  N  N   . ALA F  3 23  ? -62.329 25.638  -15.135 1.00 56.55 ? 393  ALA F N   1 
ATOM   5068  C  CA  . ALA F  3 23  ? -63.644 25.378  -15.713 1.00 58.80 ? 393  ALA F CA  1 
ATOM   5069  C  C   . ALA F  3 23  ? -63.833 23.896  -16.085 1.00 58.53 ? 393  ALA F C   1 
ATOM   5070  O  O   . ALA F  3 23  ? -64.754 23.232  -15.601 1.00 59.40 ? 393  ALA F O   1 
ATOM   5071  C  CB  . ALA F  3 23  ? -63.862 26.266  -16.935 1.00 58.85 ? 393  ALA F CB  1 
ATOM   5072  N  N   . SER F  3 24  ? -62.951 23.385  -16.940 1.00 56.92 ? 394  SER F N   1 
ATOM   5073  C  CA  . SER F  3 24  ? -63.120 22.050  -17.540 1.00 55.41 ? 394  SER F CA  1 
ATOM   5074  C  C   . SER F  3 24  ? -62.696 20.872  -16.631 1.00 53.49 ? 394  SER F C   1 
ATOM   5075  O  O   . SER F  3 24  ? -62.981 19.716  -16.948 1.00 52.49 ? 394  SER F O   1 
ATOM   5076  C  CB  . SER F  3 24  ? -62.346 21.989  -18.868 1.00 53.60 ? 394  SER F CB  1 
ATOM   5077  O  OG  . SER F  3 24  ? -62.740 20.885  -19.659 1.00 53.33 ? 394  SER F OG  1 
ATOM   5078  N  N   . GLY F  3 25  ? -62.014 21.157  -15.519 1.00 51.82 ? 395  GLY F N   1 
ATOM   5079  C  CA  . GLY F  3 25  ? -61.434 20.106  -14.673 1.00 50.04 ? 395  GLY F CA  1 
ATOM   5080  C  C   . GLY F  3 25  ? -60.346 19.288  -15.377 1.00 47.62 ? 395  GLY F C   1 
ATOM   5081  O  O   . GLY F  3 25  ? -59.848 18.301  -14.825 1.00 45.98 ? 395  GLY F O   1 
ATOM   5082  N  N   . MET F  3 26  ? -59.961 19.734  -16.578 1.00 45.81 ? 396  MET F N   1 
ATOM   5083  C  CA  . MET F  3 26  ? -59.103 18.993  -17.502 1.00 42.47 ? 396  MET F CA  1 
ATOM   5084  C  C   . MET F  3 26  ? -57.633 19.269  -17.217 1.00 39.27 ? 396  MET F C   1 
ATOM   5085  O  O   . MET F  3 26  ? -57.176 20.413  -17.337 1.00 38.71 ? 396  MET F O   1 
ATOM   5086  C  CB  . MET F  3 26  ? -59.426 19.428  -18.940 1.00 43.24 ? 396  MET F CB  1 
ATOM   5087  C  CG  . MET F  3 26  ? -58.645 18.719  -20.036 1.00 42.18 ? 396  MET F CG  1 
ATOM   5088  S  SD  . MET F  3 26  ? -59.101 16.979  -20.225 1.00 45.75 ? 396  MET F SD  1 
ATOM   5089  C  CE  . MET F  3 26  ? -57.816 16.137  -19.277 1.00 42.02 ? 396  MET F CE  1 
ATOM   5090  N  N   . ASP F  3 27  ? -56.898 18.216  -16.859 1.00 36.20 ? 397  ASP F N   1 
ATOM   5091  C  CA  . ASP F  3 27  ? -55.477 18.320  -16.567 1.00 33.22 ? 397  ASP F CA  1 
ATOM   5092  C  C   . ASP F  3 27  ? -54.682 18.572  -17.823 1.00 30.34 ? 397  ASP F C   1 
ATOM   5093  O  O   . ASP F  3 27  ? -55.012 18.028  -18.868 1.00 29.82 ? 397  ASP F O   1 
ATOM   5094  C  CB  . ASP F  3 27  ? -54.968 17.025  -15.921 1.00 33.40 ? 397  ASP F CB  1 
ATOM   5095  C  CG  . ASP F  3 27  ? -55.483 16.831  -14.501 1.00 35.59 ? 397  ASP F CG  1 
ATOM   5096  O  OD1 . ASP F  3 27  ? -56.206 17.718  -13.983 1.00 37.34 ? 397  ASP F OD1 1 
ATOM   5097  O  OD2 . ASP F  3 27  ? -55.166 15.781  -13.897 1.00 36.91 ? 397  ASP F OD2 1 
ATOM   5098  N  N   . TYR F  3 28  ? -53.614 19.368  -17.700 1.00 28.01 ? 398  TYR F N   1 
ATOM   5099  C  CA  . TYR F  3 28  ? -52.717 19.650  -18.823 1.00 26.08 ? 398  TYR F CA  1 
ATOM   5100  C  C   . TYR F  3 28  ? -51.235 19.777  -18.472 1.00 24.28 ? 398  TYR F C   1 
ATOM   5101  O  O   . TYR F  3 28  ? -50.850 19.830  -17.305 1.00 23.91 ? 398  TYR F O   1 
ATOM   5102  C  CB  . TYR F  3 28  ? -53.163 20.920  -19.528 1.00 26.60 ? 398  TYR F CB  1 
ATOM   5103  C  CG  . TYR F  3 28  ? -53.161 22.137  -18.656 1.00 27.30 ? 398  TYR F CG  1 
ATOM   5104  C  CD1 . TYR F  3 28  ? -51.996 22.870  -18.445 1.00 26.73 ? 398  TYR F CD1 1 
ATOM   5105  C  CD2 . TYR F  3 28  ? -54.327 22.575  -18.057 1.00 28.69 ? 398  TYR F CD2 1 
ATOM   5106  C  CE1 . TYR F  3 28  ? -51.994 23.996  -17.651 1.00 27.41 ? 398  TYR F CE1 1 
ATOM   5107  C  CE2 . TYR F  3 28  ? -54.333 23.702  -17.257 1.00 29.61 ? 398  TYR F CE2 1 
ATOM   5108  C  CZ  . TYR F  3 28  ? -53.166 24.403  -17.068 1.00 28.82 ? 398  TYR F CZ  1 
ATOM   5109  O  OH  . TYR F  3 28  ? -53.190 25.508  -16.286 1.00 29.82 ? 398  TYR F OH  1 
ATOM   5110  N  N   . TRP F  3 29  ? -50.418 19.820  -19.522 1.00 23.03 ? 399  TRP F N   1 
ATOM   5111  C  CA  . TRP F  3 29  ? -48.993 20.120  -19.426 1.00 22.01 ? 399  TRP F CA  1 
ATOM   5112  C  C   . TRP F  3 29  ? -48.789 21.499  -20.003 1.00 22.42 ? 399  TRP F C   1 
ATOM   5113  O  O   . TRP F  3 29  ? -49.474 21.854  -20.954 1.00 23.04 ? 399  TRP F O   1 
ATOM   5114  C  CB  . TRP F  3 29  ? -48.150 19.155  -20.272 1.00 20.78 ? 399  TRP F CB  1 
ATOM   5115  C  CG  . TRP F  3 29  ? -48.111 17.742  -19.813 1.00 20.11 ? 399  TRP F CG  1 
ATOM   5116  C  CD1 . TRP F  3 29  ? -48.615 16.663  -20.464 1.00 20.03 ? 399  TRP F CD1 1 
ATOM   5117  C  CD2 . TRP F  3 29  ? -47.506 17.242  -18.614 1.00 19.69 ? 399  TRP F CD2 1 
ATOM   5118  N  NE1 . TRP F  3 29  ? -48.376 15.516  -19.743 1.00 19.72 ? 399  TRP F NE1 1 
ATOM   5119  C  CE2 . TRP F  3 29  ? -47.688 15.845  -18.606 1.00 19.46 ? 399  TRP F CE2 1 
ATOM   5120  C  CE3 . TRP F  3 29  ? -46.834 17.839  -17.545 1.00 19.56 ? 399  TRP F CE3 1 
ATOM   5121  C  CZ2 . TRP F  3 29  ? -47.239 15.043  -17.566 1.00 19.21 ? 399  TRP F CZ2 1 
ATOM   5122  C  CZ3 . TRP F  3 29  ? -46.376 17.036  -16.520 1.00 19.37 ? 399  TRP F CZ3 1 
ATOM   5123  C  CH2 . TRP F  3 29  ? -46.583 15.653  -16.537 1.00 19.25 ? 399  TRP F CH2 1 
ATOM   5124  N  N   . ILE F  3 30  ? -47.852 22.264  -19.436 1.00 22.15 ? 400  ILE F N   1 
ATOM   5125  C  CA  . ILE F  3 30  ? -47.353 23.502  -20.049 1.00 22.26 ? 400  ILE F CA  1 
ATOM   5126  C  C   . ILE F  3 30  ? -46.041 23.181  -20.773 1.00 21.32 ? 400  ILE F C   1 
ATOM   5127  O  O   . ILE F  3 30  ? -45.114 22.619  -20.192 1.00 20.57 ? 400  ILE F O   1 
ATOM   5128  C  CB  . ILE F  3 30  ? -47.122 24.628  -19.009 1.00 22.90 ? 400  ILE F CB  1 
ATOM   5129  C  CG1 . ILE F  3 30  ? -48.343 24.818  -18.106 1.00 23.85 ? 400  ILE F CG1 1 
ATOM   5130  C  CG2 . ILE F  3 30  ? -46.816 25.958  -19.701 1.00 23.52 ? 400  ILE F CG2 1 
ATOM   5131  C  CD1 . ILE F  3 30  ? -48.120 25.785  -16.953 1.00 24.53 ? 400  ILE F CD1 1 
ATOM   5132  N  N   . VAL F  3 31  ? -45.959 23.554  -22.044 1.00 21.64 ? 401  VAL F N   1 
ATOM   5133  C  CA  . VAL F  3 31  ? -44.875 23.106  -22.907 1.00 21.17 ? 401  VAL F CA  1 
ATOM   5134  C  C   . VAL F  3 31  ? -44.309 24.259  -23.715 1.00 22.00 ? 401  VAL F C   1 
ATOM   5135  O  O   . VAL F  3 31  ? -45.055 25.038  -24.314 1.00 23.15 ? 401  VAL F O   1 
ATOM   5136  C  CB  . VAL F  3 31  ? -45.354 22.001  -23.868 1.00 20.95 ? 401  VAL F CB  1 
ATOM   5137  C  CG1 . VAL F  3 31  ? -44.177 21.402  -24.615 1.00 20.30 ? 401  VAL F CG1 1 
ATOM   5138  C  CG2 . VAL F  3 31  ? -46.091 20.907  -23.107 1.00 20.66 ? 401  VAL F CG2 1 
ATOM   5139  N  N   . LYS F  3 32  ? -42.984 24.367  -23.725 1.00 21.93 ? 402  LYS F N   1 
ATOM   5140  C  CA  . LYS F  3 32  ? -42.308 25.437  -24.445 1.00 22.98 ? 402  LYS F CA  1 
ATOM   5141  C  C   . LYS F  3 32  ? -41.906 24.941  -25.827 1.00 23.18 ? 402  LYS F C   1 
ATOM   5142  O  O   . LYS F  3 32  ? -41.118 23.998  -25.945 1.00 22.97 ? 402  LYS F O   1 
ATOM   5143  C  CB  . LYS F  3 32  ? -41.069 25.879  -23.685 1.00 22.85 ? 402  LYS F CB  1 
ATOM   5144  C  CG  . LYS F  3 32  ? -40.324 27.060  -24.288 1.00 24.04 ? 402  LYS F CG  1 
ATOM   5145  C  CD  . LYS F  3 32  ? -38.978 27.195  -23.588 1.00 24.22 ? 402  LYS F CD  1 
ATOM   5146  C  CE  . LYS F  3 32  ? -38.155 28.334  -24.123 1.00 25.36 ? 402  LYS F CE  1 
ATOM   5147  N  NZ  . LYS F  3 32  ? -36.711 28.034  -23.928 1.00 25.41 ? 402  LYS F NZ  1 
ATOM   5148  N  N   . ASN F  3 33  ? -42.449 25.583  -26.857 1.00 23.94 ? 403  ASN F N   1 
ATOM   5149  C  CA  . ASN F  3 33  ? -42.134 25.251  -28.244 1.00 24.52 ? 403  ASN F CA  1 
ATOM   5150  C  C   . ASN F  3 33  ? -40.970 26.123  -28.716 1.00 24.92 ? 403  ASN F C   1 
ATOM   5151  O  O   . ASN F  3 33  ? -40.495 26.988  -27.980 1.00 24.85 ? 403  ASN F O   1 
ATOM   5152  C  CB  . ASN F  3 33  ? -43.379 25.432  -29.143 1.00 25.35 ? 403  ASN F CB  1 
ATOM   5153  C  CG  . ASN F  3 33  ? -43.339 24.586  -30.417 1.00 25.57 ? 403  ASN F CG  1 
ATOM   5154  O  OD1 . ASN F  3 33  ? -42.315 24.032  -30.784 1.00 25.13 ? 403  ASN F OD1 1 
ATOM   5155  N  ND2 . ASN F  3 33  ? -44.474 24.500  -31.099 1.00 26.40 ? 403  ASN F ND2 1 
ATOM   5156  N  N   . SER F  3 34  ? -40.510 25.859  -29.937 1.00 25.57 ? 404  SER F N   1 
ATOM   5157  C  CA  . SER F  3 34  ? -39.380 26.564  -30.532 1.00 26.32 ? 404  SER F CA  1 
ATOM   5158  C  C   . SER F  3 34  ? -39.772 27.111  -31.910 1.00 27.61 ? 404  SER F C   1 
ATOM   5159  O  O   . SER F  3 34  ? -39.024 27.006  -32.886 1.00 27.95 ? 404  SER F O   1 
ATOM   5160  C  CB  . SER F  3 34  ? -38.194 25.612  -30.642 1.00 25.86 ? 404  SER F CB  1 
ATOM   5161  O  OG  . SER F  3 34  ? -38.574 24.449  -31.355 1.00 25.80 ? 404  SER F OG  1 
ATOM   5162  N  N   . TRP F  3 35  ? -40.965 27.689  -31.975 1.00 28.17 ? 405  TRP F N   1 
ATOM   5163  C  CA  . TRP F  3 35  ? -41.485 28.225  -33.217 1.00 29.78 ? 405  TRP F CA  1 
ATOM   5164  C  C   . TRP F  3 35  ? -41.748 29.730  -33.085 1.00 30.69 ? 405  TRP F C   1 
ATOM   5165  O  O   . TRP F  3 35  ? -42.623 30.262  -33.756 1.00 31.55 ? 405  TRP F O   1 
ATOM   5166  C  CB  . TRP F  3 35  ? -42.777 27.507  -33.601 1.00 30.15 ? 405  TRP F CB  1 
ATOM   5167  C  CG  . TRP F  3 35  ? -42.634 26.074  -33.969 1.00 29.65 ? 405  TRP F CG  1 
ATOM   5168  C  CD1 . TRP F  3 35  ? -41.477 25.364  -34.141 1.00 29.13 ? 405  TRP F CD1 1 
ATOM   5169  C  CD2 . TRP F  3 35  ? -43.701 25.176  -34.267 1.00 29.90 ? 405  TRP F CD2 1 
ATOM   5170  N  NE1 . TRP F  3 35  ? -41.764 24.073  -34.495 1.00 29.01 ? 405  TRP F NE1 1 
ATOM   5171  C  CE2 . TRP F  3 35  ? -43.124 23.932  -34.589 1.00 29.44 ? 405  TRP F CE2 1 
ATOM   5172  C  CE3 . TRP F  3 35  ? -45.093 25.296  -34.275 1.00 30.59 ? 405  TRP F CE3 1 
ATOM   5173  C  CZ2 . TRP F  3 35  ? -43.893 22.817  -34.918 1.00 29.51 ? 405  TRP F CZ2 1 
ATOM   5174  C  CZ3 . TRP F  3 35  ? -45.855 24.188  -34.603 1.00 30.73 ? 405  TRP F CZ3 1 
ATOM   5175  C  CH2 . TRP F  3 35  ? -45.252 22.965  -34.920 1.00 30.18 ? 405  TRP F CH2 1 
ATOM   5176  N  N   . GLY F  3 36  ? -40.989 30.392  -32.206 1.00 30.24 ? 406  GLY F N   1 
ATOM   5177  C  CA  . GLY F  3 36  ? -41.075 31.839  -32.006 1.00 31.15 ? 406  GLY F CA  1 
ATOM   5178  C  C   . GLY F  3 36  ? -42.160 32.227  -31.022 1.00 31.36 ? 406  GLY F C   1 
ATOM   5179  O  O   . GLY F  3 36  ? -42.985 31.401  -30.637 1.00 31.21 ? 406  GLY F O   1 
ATOM   5180  N  N   . THR F  3 37  ? -42.159 33.490  -30.613 1.00 32.19 ? 407  THR F N   1 
ATOM   5181  C  CA  . THR F  3 37  ? -43.162 34.007  -29.688 1.00 32.53 ? 407  THR F CA  1 
ATOM   5182  C  C   . THR F  3 37  ? -44.525 34.278  -30.361 1.00 33.87 ? 407  THR F C   1 
ATOM   5183  O  O   . THR F  3 37  ? -45.551 34.301  -29.684 1.00 34.31 ? 407  THR F O   1 
ATOM   5184  C  CB  . THR F  3 37  ? -42.650 35.280  -28.992 1.00 33.08 ? 407  THR F CB  1 
ATOM   5185  O  OG1 . THR F  3 37  ? -42.034 36.141  -29.962 1.00 34.73 ? 407  THR F OG1 1 
ATOM   5186  C  CG2 . THR F  3 37  ? -41.625 34.936  -27.931 1.00 31.71 ? 407  THR F CG2 1 
ATOM   5187  N  N   . GLY F  3 38  ? -44.539 34.468  -31.682 1.00 34.96 ? 408  GLY F N   1 
ATOM   5188  C  CA  . GLY F  3 38  ? -45.788 34.686  -32.433 1.00 36.20 ? 408  GLY F CA  1 
ATOM   5189  C  C   . GLY F  3 38  ? -46.720 33.479  -32.496 1.00 35.72 ? 408  GLY F C   1 
ATOM   5190  O  O   . GLY F  3 38  ? -47.919 33.619  -32.765 1.00 36.71 ? 408  GLY F O   1 
ATOM   5191  N  N   . TRP F  3 39  ? -46.171 32.294  -32.242 1.00 34.06 ? 409  TRP F N   1 
ATOM   5192  C  CA  . TRP F  3 39  ? -46.931 31.054  -32.287 1.00 33.63 ? 409  TRP F CA  1 
ATOM   5193  C  C   . TRP F  3 39  ? -47.551 30.695  -30.937 1.00 33.05 ? 409  TRP F C   1 
ATOM   5194  O  O   . TRP F  3 39  ? -46.962 30.933  -29.893 1.00 32.70 ? 409  TRP F O   1 
ATOM   5195  C  CB  . TRP F  3 39  ? -46.026 29.901  -32.732 1.00 32.44 ? 409  TRP F CB  1 
ATOM   5196  C  CG  . TRP F  3 39  ? -46.781 28.636  -32.875 1.00 31.95 ? 409  TRP F CG  1 
ATOM   5197  C  CD1 . TRP F  3 39  ? -47.432 28.191  -33.995 1.00 32.97 ? 409  TRP F CD1 1 
ATOM   5198  C  CD2 . TRP F  3 39  ? -47.022 27.667  -31.853 1.00 30.56 ? 409  TRP F CD2 1 
ATOM   5199  N  NE1 . TRP F  3 39  ? -48.038 26.990  -33.736 1.00 32.43 ? 409  TRP F NE1 1 
ATOM   5200  C  CE2 . TRP F  3 39  ? -47.806 26.646  -32.426 1.00 30.87 ? 409  TRP F CE2 1 
ATOM   5201  C  CE3 . TRP F  3 39  ? -46.625 27.549  -30.509 1.00 29.42 ? 409  TRP F CE3 1 
ATOM   5202  C  CZ2 . TRP F  3 39  ? -48.210 25.520  -31.702 1.00 29.83 ? 409  TRP F CZ2 1 
ATOM   5203  C  CZ3 . TRP F  3 39  ? -47.031 26.450  -29.785 1.00 28.27 ? 409  TRP F CZ3 1 
ATOM   5204  C  CH2 . TRP F  3 39  ? -47.814 25.437  -30.382 1.00 28.65 ? 409  TRP F CH2 1 
ATOM   5205  N  N   . GLY F  3 40  ? -48.728 30.082  -30.969 1.00 33.56 ? 410  GLY F N   1 
ATOM   5206  C  CA  . GLY F  3 40  ? -49.386 29.589  -29.767 1.00 33.22 ? 410  GLY F CA  1 
ATOM   5207  C  C   . GLY F  3 40  ? -49.574 30.670  -28.724 1.00 34.08 ? 410  GLY F C   1 
ATOM   5208  O  O   . GLY F  3 40  ? -49.849 31.814  -29.061 1.00 35.43 ? 410  GLY F O   1 
ATOM   5209  N  N   . GLU F  3 41  ? -49.413 30.295  -27.457 1.00 33.80 ? 411  GLU F N   1 
ATOM   5210  C  CA  . GLU F  3 41  ? -49.605 31.196  -26.323 1.00 34.46 ? 411  GLU F CA  1 
ATOM   5211  C  C   . GLU F  3 41  ? -48.255 31.782  -25.939 1.00 34.00 ? 411  GLU F C   1 
ATOM   5212  O  O   . GLU F  3 41  ? -47.614 31.310  -25.006 1.00 33.10 ? 411  GLU F O   1 
ATOM   5213  C  CB  . GLU F  3 41  ? -50.221 30.429  -25.133 1.00 34.18 ? 411  GLU F CB  1 
ATOM   5214  C  CG  . GLU F  3 41  ? -51.627 29.892  -25.410 1.00 34.96 ? 411  GLU F CG  1 
ATOM   5215  C  CD  . GLU F  3 41  ? -52.170 28.985  -24.309 1.00 34.75 ? 411  GLU F CD  1 
ATOM   5216  O  OE1 . GLU F  3 41  ? -51.371 28.460  -23.504 1.00 34.14 ? 411  GLU F OE1 1 
ATOM   5217  O  OE2 . GLU F  3 41  ? -53.411 28.782  -24.254 1.00 35.99 ? 411  GLU F OE2 1 
ATOM   5218  N  N   . ASN F  3 42  ? -47.833 32.806  -26.678 1.00 34.94 ? 412  ASN F N   1 
ATOM   5219  C  CA  . ASN F  3 42  ? -46.531 33.449  -26.504 1.00 34.66 ? 412  ASN F CA  1 
ATOM   5220  C  C   . ASN F  3 42  ? -45.384 32.461  -26.535 1.00 32.98 ? 412  ASN F C   1 
ATOM   5221  O  O   . ASN F  3 42  ? -44.481 32.505  -25.690 1.00 32.35 ? 412  ASN F O   1 
ATOM   5222  C  CB  . ASN F  3 42  ? -46.491 34.253  -25.207 1.00 35.40 ? 412  ASN F CB  1 
ATOM   5223  C  CG  . ASN F  3 42  ? -47.288 35.523  -25.295 1.00 37.38 ? 412  ASN F CG  1 
ATOM   5224  O  OD1 . ASN F  3 42  ? -48.339 35.637  -24.681 1.00 38.95 ? 412  ASN F OD1 1 
ATOM   5225  N  ND2 . ASN F  3 42  ? -46.801 36.482  -26.071 1.00 38.24 ? 412  ASN F ND2 1 
ATOM   5226  N  N   . GLY F  3 43  ? -45.431 31.563  -27.513 1.00 32.25 ? 413  GLY F N   1 
ATOM   5227  C  CA  . GLY F  3 43  ? -44.395 30.548  -27.692 1.00 30.59 ? 413  GLY F CA  1 
ATOM   5228  C  C   . GLY F  3 43  ? -44.729 29.218  -27.055 1.00 28.91 ? 413  GLY F C   1 
ATOM   5229  O  O   . GLY F  3 43  ? -44.166 28.196  -27.427 1.00 27.94 ? 413  GLY F O   1 
ATOM   5230  N  N   . TYR F  3 44  ? -45.643 29.233  -26.095 1.00 28.81 ? 414  TYR F N   1 
ATOM   5231  C  CA  . TYR F  3 44  ? -45.993 28.039  -25.342 1.00 27.90 ? 414  TYR F CA  1 
ATOM   5232  C  C   . TYR F  3 44  ? -47.285 27.392  -25.827 1.00 28.09 ? 414  TYR F C   1 
ATOM   5233  O  O   . TYR F  3 44  ? -48.089 28.013  -26.527 1.00 29.37 ? 414  TYR F O   1 
ATOM   5234  C  CB  . TYR F  3 44  ? -46.140 28.383  -23.856 1.00 27.80 ? 414  TYR F CB  1 
ATOM   5235  C  CG  . TYR F  3 44  ? -44.830 28.716  -23.207 1.00 27.38 ? 414  TYR F CG  1 
ATOM   5236  C  CD1 . TYR F  3 44  ? -44.254 29.970  -23.369 1.00 28.19 ? 414  TYR F CD1 1 
ATOM   5237  C  CD2 . TYR F  3 44  ? -44.154 27.773  -22.444 1.00 26.26 ? 414  TYR F CD2 1 
ATOM   5238  C  CE1 . TYR F  3 44  ? -43.044 30.280  -22.784 1.00 27.98 ? 414  TYR F CE1 1 
ATOM   5239  C  CE2 . TYR F  3 44  ? -42.946 28.073  -21.851 1.00 26.03 ? 414  TYR F CE2 1 
ATOM   5240  C  CZ  . TYR F  3 44  ? -42.393 29.320  -22.029 1.00 27.06 ? 414  TYR F CZ  1 
ATOM   5241  O  OH  . TYR F  3 44  ? -41.198 29.606  -21.423 1.00 27.65 ? 414  TYR F OH  1 
ATOM   5242  N  N   . PHE F  3 45  ? -47.489 26.144  -25.429 1.00 26.77 ? 415  PHE F N   1 
ATOM   5243  C  CA  . PHE F  3 45  ? -48.797 25.537  -25.568 1.00 26.97 ? 415  PHE F CA  1 
ATOM   5244  C  C   . PHE F  3 45  ? -49.137 24.645  -24.400 1.00 26.13 ? 415  PHE F C   1 
ATOM   5245  O  O   . PHE F  3 45  ? -48.276 24.224  -23.634 1.00 24.74 ? 415  PHE F O   1 
ATOM   5246  C  CB  . PHE F  3 45  ? -48.931 24.764  -26.883 1.00 27.04 ? 415  PHE F CB  1 
ATOM   5247  C  CG  . PHE F  3 45  ? -48.103 23.512  -26.967 1.00 25.87 ? 415  PHE F CG  1 
ATOM   5248  C  CD1 . PHE F  3 45  ? -46.764 23.573  -27.299 1.00 25.35 ? 415  PHE F CD1 1 
ATOM   5249  C  CD2 . PHE F  3 45  ? -48.686 22.260  -26.792 1.00 25.58 ? 415  PHE F CD2 1 
ATOM   5250  C  CE1 . PHE F  3 45  ? -46.006 22.416  -27.409 1.00 24.52 ? 415  PHE F CE1 1 
ATOM   5251  C  CE2 . PHE F  3 45  ? -47.935 21.103  -26.903 1.00 24.62 ? 415  PHE F CE2 1 
ATOM   5252  C  CZ  . PHE F  3 45  ? -46.594 21.179  -27.215 1.00 24.15 ? 415  PHE F CZ  1 
ATOM   5253  N  N   . ARG F  3 46  ? -50.428 24.375  -24.281 1.00 26.83 ? 416  ARG F N   1 
ATOM   5254  C  CA  . ARG F  3 46  ? -50.912 23.444  -23.302 1.00 26.30 ? 416  ARG F CA  1 
ATOM   5255  C  C   . ARG F  3 46  ? -51.485 22.248  -24.023 1.00 26.07 ? 416  ARG F C   1 
ATOM   5256  O  O   . ARG F  3 46  ? -52.034 22.369  -25.113 1.00 26.79 ? 416  ARG F O   1 
ATOM   5257  C  CB  . ARG F  3 46  ? -51.939 24.116  -22.411 1.00 27.50 ? 416  ARG F CB  1 
ATOM   5258  C  CG  . ARG F  3 46  ? -51.340 25.223  -21.575 1.00 27.87 ? 416  ARG F CG  1 
ATOM   5259  C  CD  . ARG F  3 46  ? -52.408 25.889  -20.722 1.00 29.44 ? 416  ARG F CD  1 
ATOM   5260  N  NE  . ARG F  3 46  ? -53.261 26.765  -21.523 1.00 31.01 ? 416  ARG F NE  1 
ATOM   5261  C  CZ  . ARG F  3 46  ? -54.514 27.096  -21.221 1.00 32.47 ? 416  ARG F CZ  1 
ATOM   5262  N  NH1 . ARG F  3 46  ? -55.103 26.628  -20.119 1.00 32.72 ? 416  ARG F NH1 1 
ATOM   5263  N  NH2 . ARG F  3 46  ? -55.187 27.904  -22.034 1.00 33.74 ? 416  ARG F NH2 1 
ATOM   5264  N  N   . ILE F  3 47  ? -51.347 21.089  -23.405 1.00 25.44 ? 417  ILE F N   1 
ATOM   5265  C  CA  . ILE F  3 47  ? -51.773 19.841  -24.009 1.00 25.42 ? 417  ILE F CA  1 
ATOM   5266  C  C   . ILE F  3 47  ? -52.280 18.932  -22.905 1.00 25.48 ? 417  ILE F C   1 
ATOM   5267  O  O   . ILE F  3 47  ? -51.746 18.968  -21.794 1.00 24.76 ? 417  ILE F O   1 
ATOM   5268  C  CB  . ILE F  3 47  ? -50.610 19.205  -24.784 1.00 24.59 ? 417  ILE F CB  1 
ATOM   5269  C  CG1 . ILE F  3 47  ? -51.022 17.870  -25.394 1.00 24.82 ? 417  ILE F CG1 1 
ATOM   5270  C  CG2 . ILE F  3 47  ? -49.397 19.027  -23.890 1.00 23.72 ? 417  ILE F CG2 1 
ATOM   5271  C  CD1 . ILE F  3 47  ? -50.083 17.391  -26.481 1.00 24.54 ? 417  ILE F CD1 1 
ATOM   5272  N  N   . ARG F  3 48  ? -53.317 18.141  -23.202 1.00 26.59 ? 418  ARG F N   1 
ATOM   5273  C  CA  . ARG F  3 48  ? -53.895 17.214  -22.220 1.00 27.03 ? 418  ARG F CA  1 
ATOM   5274  C  C   . ARG F  3 48  ? -52.840 16.374  -21.539 1.00 25.17 ? 418  ARG F C   1 
ATOM   5275  O  O   . ARG F  3 48  ? -51.922 15.874  -22.191 1.00 24.10 ? 418  ARG F O   1 
ATOM   5276  C  CB  . ARG F  3 48  ? -54.867 16.234  -22.856 1.00 28.95 ? 418  ARG F CB  1 
ATOM   5277  C  CG  . ARG F  3 48  ? -56.284 16.738  -22.952 1.00 31.79 ? 418  ARG F CG  1 
ATOM   5278  C  CD  . ARG F  3 48  ? -57.261 15.574  -22.934 1.00 33.54 ? 418  ARG F CD  1 
ATOM   5279  N  NE  . ARG F  3 48  ? -58.527 15.808  -23.642 1.00 35.42 ? 418  ARG F NE  1 
ATOM   5280  C  CZ  . ARG F  3 48  ? -59.188 16.963  -23.749 1.00 36.59 ? 418  ARG F CZ  1 
ATOM   5281  N  NH1 . ARG F  3 48  ? -58.756 18.098  -23.184 1.00 36.04 ? 418  ARG F NH1 1 
ATOM   5282  N  NH2 . ARG F  3 48  ? -60.333 16.969  -24.437 1.00 37.60 ? 418  ARG F NH2 1 
ATOM   5283  N  N   . ARG F  3 49  ? -53.027 16.197  -20.234 1.00 24.57 ? 419  ARG F N   1 
ATOM   5284  C  CA  . ARG F  3 49  ? -52.123 15.446  -19.395 1.00 23.40 ? 419  ARG F CA  1 
ATOM   5285  C  C   . ARG F  3 49  ? -52.856 14.238  -18.832 1.00 23.40 ? 419  ARG F C   1 
ATOM   5286  O  O   . ARG F  3 49  ? -54.045 14.303  -18.556 1.00 23.83 ? 419  ARG F O   1 
ATOM   5287  C  CB  . ARG F  3 49  ? -51.601 16.355  -18.278 1.00 23.12 ? 419  ARG F CB  1 
ATOM   5288  C  CG  . ARG F  3 49  ? -50.884 15.657  -17.140 1.00 22.50 ? 419  ARG F CG  1 
ATOM   5289  C  CD  . ARG F  3 49  ? -50.115 16.637  -16.272 1.00 22.42 ? 419  ARG F CD  1 
ATOM   5290  N  NE  . ARG F  3 49  ? -51.000 17.540  -15.547 1.00 23.53 ? 419  ARG F NE  1 
ATOM   5291  C  CZ  . ARG F  3 49  ? -51.593 17.276  -14.385 1.00 24.44 ? 419  ARG F CZ  1 
ATOM   5292  N  NH1 . ARG F  3 49  ? -51.422 16.114  -13.758 1.00 24.10 ? 419  ARG F NH1 1 
ATOM   5293  N  NH2 . ARG F  3 49  ? -52.379 18.194  -13.844 1.00 25.51 ? 419  ARG F NH2 1 
ATOM   5294  N  N   . GLY F  3 50  ? -52.119 13.139  -18.675 1.00 23.02 ? 420  GLY F N   1 
ATOM   5295  C  CA  . GLY F  3 50  ? -52.626 11.909  -18.039 1.00 23.58 ? 420  GLY F CA  1 
ATOM   5296  C  C   . GLY F  3 50  ? -53.192 10.847  -18.976 1.00 24.02 ? 420  GLY F C   1 
ATOM   5297  O  O   . GLY F  3 50  ? -53.632 9.810   -18.518 1.00 24.80 ? 420  GLY F O   1 
ATOM   5298  N  N   . THR F  3 51  ? -53.182 11.088  -20.283 1.00 24.16 ? 421  THR F N   1 
ATOM   5299  C  CA  . THR F  3 51  ? -53.713 10.124  -21.244 1.00 24.71 ? 421  THR F CA  1 
ATOM   5300  C  C   . THR F  3 51  ? -52.723 9.823   -22.374 1.00 24.03 ? 421  THR F C   1 
ATOM   5301  O  O   . THR F  3 51  ? -53.108 9.282   -23.413 1.00 24.73 ? 421  THR F O   1 
ATOM   5302  C  CB  . THR F  3 51  ? -55.034 10.647  -21.834 1.00 25.97 ? 421  THR F CB  1 
ATOM   5303  O  OG1 . THR F  3 51  ? -54.892 12.039  -22.157 1.00 26.22 ? 421  THR F OG1 1 
ATOM   5304  C  CG2 . THR F  3 51  ? -56.163 10.494  -20.824 1.00 26.95 ? 421  THR F CG2 1 
ATOM   5305  N  N   . ASP F  3 52  ? -51.457 10.164  -22.160 1.00 22.95 ? 422  ASP F N   1 
ATOM   5306  C  CA  . ASP F  3 52  ? -50.409 10.014  -23.168 1.00 22.58 ? 422  ASP F CA  1 
ATOM   5307  C  C   . ASP F  3 52  ? -50.783 10.671  -24.512 1.00 23.06 ? 422  ASP F C   1 
ATOM   5308  O  O   . ASP F  3 52  ? -50.590 10.093  -25.583 1.00 23.16 ? 422  ASP F O   1 
ATOM   5309  C  CB  . ASP F  3 52  ? -50.102 8.534   -23.350 1.00 22.73 ? 422  ASP F CB  1 
ATOM   5310  C  CG  . ASP F  3 52  ? -48.807 8.284   -24.104 1.00 22.51 ? 422  ASP F CG  1 
ATOM   5311  O  OD1 . ASP F  3 52  ? -47.913 9.182   -24.134 1.00 21.58 ? 422  ASP F OD1 1 
ATOM   5312  O  OD2 . ASP F  3 52  ? -48.699 7.158   -24.664 1.00 22.62 ? 422  ASP F OD2 1 
ATOM   5313  N  N   . GLU F  3 53  ? -51.313 11.890  -24.438 1.00 23.43 ? 423  GLU F N   1 
ATOM   5314  C  CA  . GLU F  3 53  ? -51.798 12.603  -25.618 1.00 24.17 ? 423  GLU F CA  1 
ATOM   5315  C  C   . GLU F  3 53  ? -50.671 12.790  -26.642 1.00 23.18 ? 423  GLU F C   1 
ATOM   5316  O  O   . GLU F  3 53  ? -49.656 13.407  -26.348 1.00 22.40 ? 423  GLU F O   1 
ATOM   5317  C  CB  . GLU F  3 53  ? -52.388 13.956  -25.204 1.00 25.12 ? 423  GLU F CB  1 
ATOM   5318  C  CG  . GLU F  3 53  ? -53.127 14.691  -26.310 1.00 26.55 ? 423  GLU F CG  1 
ATOM   5319  C  CD  . GLU F  3 53  ? -54.378 13.967  -26.764 1.00 28.19 ? 423  GLU F CD  1 
ATOM   5320  O  OE1 . GLU F  3 53  ? -55.052 13.334  -25.914 1.00 29.01 ? 423  GLU F OE1 1 
ATOM   5321  O  OE2 . GLU F  3 53  ? -54.697 14.028  -27.973 1.00 29.55 ? 423  GLU F OE2 1 
ATOM   5322  N  N   . CYS F  3 54  ? -50.846 12.219  -27.827 1.00 23.20 ? 424  CYS F N   1 
ATOM   5323  C  CA  . CYS F  3 54  ? -49.841 12.279  -28.890 1.00 22.93 ? 424  CYS F CA  1 
ATOM   5324  C  C   . CYS F  3 54  ? -48.444 11.765  -28.494 1.00 21.36 ? 424  CYS F C   1 
ATOM   5325  O  O   . CYS F  3 54  ? -47.433 12.213  -29.014 1.00 20.78 ? 424  CYS F O   1 
ATOM   5326  C  CB  . CYS F  3 54  ? -49.780 13.692  -29.473 1.00 23.35 ? 424  CYS F CB  1 
ATOM   5327  S  SG  . CYS F  3 54  ? -51.369 14.173  -30.166 1.00 25.05 ? 424  CYS F SG  1 
ATOM   5328  N  N   . ALA F  3 55  ? -48.409 10.780  -27.607 1.00 20.74 ? 425  ALA F N   1 
ATOM   5329  C  CA  . ALA F  3 55  ? -47.152 10.210  -27.119 1.00 19.77 ? 425  ALA F CA  1 
ATOM   5330  C  C   . ALA F  3 55  ? -46.292 11.173  -26.268 1.00 18.74 ? 425  ALA F C   1 
ATOM   5331  O  O   . ALA F  3 55  ? -45.112 10.934  -26.086 1.00 18.29 ? 425  ALA F O   1 
ATOM   5332  C  CB  . ALA F  3 55  ? -46.344 9.628   -28.280 1.00 19.94 ? 425  ALA F CB  1 
ATOM   5333  N  N   . ILE F  3 56  ? -46.889 12.222  -25.713 1.00 18.55 ? 426  ILE F N   1 
ATOM   5334  C  CA  . ILE F  3 56  ? -46.141 13.213  -24.897 1.00 18.04 ? 426  ILE F CA  1 
ATOM   5335  C  C   . ILE F  3 56  ? -45.614 12.660  -23.552 1.00 17.45 ? 426  ILE F C   1 
ATOM   5336  O  O   . ILE F  3 56  ? -44.780 13.273  -22.920 1.00 16.86 ? 426  ILE F O   1 
ATOM   5337  C  CB  . ILE F  3 56  ? -47.004 14.477  -24.624 1.00 18.33 ? 426  ILE F CB  1 
ATOM   5338  C  CG1 . ILE F  3 56  ? -46.140 15.654  -24.155 1.00 18.00 ? 426  ILE F CG1 1 
ATOM   5339  C  CG2 . ILE F  3 56  ? -48.104 14.175  -23.608 1.00 18.56 ? 426  ILE F CG2 1 
ATOM   5340  C  CD1 . ILE F  3 56  ? -45.848 16.685  -25.211 1.00 18.39 ? 426  ILE F CD1 1 
ATOM   5341  N  N   . GLU F  3 57  ? -46.118 11.506  -23.124 1.00 17.65 ? 427  GLU F N   1 
ATOM   5342  C  CA  . GLU F  3 57  ? -45.662 10.864  -21.903 1.00 17.41 ? 427  GLU F CA  1 
ATOM   5343  C  C   . GLU F  3 57  ? -44.942 9.549   -22.194 1.00 17.49 ? 427  GLU F C   1 
ATOM   5344  O  O   . GLU F  3 57  ? -44.981 8.613   -21.377 1.00 18.53 ? 427  GLU F O   1 
ATOM   5345  C  CB  . GLU F  3 57  ? -46.848 10.659  -20.966 1.00 17.91 ? 427  GLU F CB  1 
ATOM   5346  C  CG  . GLU F  3 57  ? -47.435 11.982  -20.483 1.00 18.16 ? 427  GLU F CG  1 
ATOM   5347  C  CD  . GLU F  3 57  ? -48.918 11.934  -20.158 1.00 18.92 ? 427  GLU F CD  1 
ATOM   5348  O  OE1 . GLU F  3 57  ? -49.522 10.835  -20.119 1.00 19.16 ? 427  GLU F OE1 1 
ATOM   5349  O  OE2 . GLU F  3 57  ? -49.472 13.027  -19.943 1.00 19.25 ? 427  GLU F OE2 1 
ATOM   5350  N  N   . SER F  3 58  ? -44.229 9.511   -23.325 1.00 17.07 ? 428  SER F N   1 
ATOM   5351  C  CA  . SER F  3 58  ? -43.524 8.321   -23.799 1.00 16.93 ? 428  SER F CA  1 
ATOM   5352  C  C   . SER F  3 58  ? -41.991 8.420   -23.764 1.00 16.40 ? 428  SER F C   1 
ATOM   5353  O  O   . SER F  3 58  ? -41.330 7.398   -23.695 1.00 16.48 ? 428  SER F O   1 
ATOM   5354  C  CB  . SER F  3 58  ? -43.969 8.007   -25.236 1.00 17.52 ? 428  SER F CB  1 
ATOM   5355  O  OG  . SER F  3 58  ? -43.345 8.828   -26.225 1.00 17.44 ? 428  SER F OG  1 
ATOM   5356  N  N   . ILE F  3 59  ? -41.409 9.618   -23.832 1.00 15.87 ? 429  ILE F N   1 
ATOM   5357  C  CA  . ILE F  3 59  ? -39.958 9.710   -24.036 1.00 15.66 ? 429  ILE F CA  1 
ATOM   5358  C  C   . ILE F  3 59  ? -39.313 10.939  -23.382 1.00 15.23 ? 429  ILE F C   1 
ATOM   5359  O  O   . ILE F  3 59  ? -38.474 11.621  -23.995 1.00 15.28 ? 429  ILE F O   1 
ATOM   5360  C  CB  . ILE F  3 59  ? -39.634 9.634   -25.555 1.00 16.12 ? 429  ILE F CB  1 
ATOM   5361  C  CG1 . ILE F  3 59  ? -38.141 9.428   -25.811 1.00 16.18 ? 429  ILE F CG1 1 
ATOM   5362  C  CG2 . ILE F  3 59  ? -40.162 10.840  -26.318 1.00 16.32 ? 429  ILE F CG2 1 
ATOM   5363  C  CD1 . ILE F  3 59  ? -37.836 9.079   -27.251 1.00 16.80 ? 429  ILE F CD1 1 
ATOM   5364  N  N   . ALA F  3 60  ? -39.705 11.221  -22.140 1.00 14.89 ? 430  ALA F N   1 
ATOM   5365  C  CA  . ALA F  3 60  ? -39.117 12.324  -21.383 1.00 14.54 ? 430  ALA F CA  1 
ATOM   5366  C  C   . ALA F  3 60  ? -37.688 11.972  -20.996 1.00 14.35 ? 430  ALA F C   1 
ATOM   5367  O  O   . ALA F  3 60  ? -37.425 10.855  -20.580 1.00 14.40 ? 430  ALA F O   1 
ATOM   5368  C  CB  . ALA F  3 60  ? -39.934 12.623  -20.137 1.00 14.61 ? 430  ALA F CB  1 
ATOM   5369  N  N   . VAL F  3 61  ? -36.783 12.937  -21.158 1.00 14.10 ? 431  VAL F N   1 
ATOM   5370  C  CA  . VAL F  3 61  ? -35.357 12.765  -20.895 1.00 14.09 ? 431  VAL F CA  1 
ATOM   5371  C  C   . VAL F  3 61  ? -34.948 13.774  -19.855 1.00 14.01 ? 431  VAL F C   1 
ATOM   5372  O  O   . VAL F  3 61  ? -35.338 14.922  -19.954 1.00 14.03 ? 431  VAL F O   1 
ATOM   5373  C  CB  . VAL F  3 61  ? -34.510 13.068  -22.147 1.00 14.17 ? 431  VAL F CB  1 
ATOM   5374  C  CG1 . VAL F  3 61  ? -33.033 13.195  -21.780 1.00 14.35 ? 431  VAL F CG1 1 
ATOM   5375  C  CG2 . VAL F  3 61  ? -34.702 11.998  -23.201 1.00 14.42 ? 431  VAL F CG2 1 
ATOM   5376  N  N   . ALA F  3 62  ? -34.142 13.352  -18.885 1.00 14.15 ? 432  ALA F N   1 
ATOM   5377  C  CA  . ALA F  3 62  ? -33.597 14.270  -17.880 1.00 14.33 ? 432  ALA F CA  1 
ATOM   5378  C  C   . ALA F  3 62  ? -32.067 14.308  -17.952 1.00 14.45 ? 432  ALA F C   1 
ATOM   5379  O  O   . ALA F  3 62  ? -31.422 13.280  -18.115 1.00 14.53 ? 432  ALA F O   1 
ATOM   5380  C  CB  . ALA F  3 62  ? -34.043 13.862  -16.484 1.00 14.67 ? 432  ALA F CB  1 
ATOM   5381  N  N   . ALA F  3 63  ? -31.500 15.505  -17.838 1.00 14.45 ? 433  ALA F N   1 
ATOM   5382  C  CA  . ALA F  3 63  ? -30.052 15.663  -17.748 1.00 14.72 ? 433  ALA F CA  1 
ATOM   5383  C  C   . ALA F  3 63  ? -29.691 16.757  -16.748 1.00 14.89 ? 433  ALA F C   1 
ATOM   5384  O  O   . ALA F  3 63  ? -30.426 17.710  -16.562 1.00 14.73 ? 433  ALA F O   1 
ATOM   5385  C  CB  . ALA F  3 63  ? -29.455 15.956  -19.113 1.00 14.70 ? 433  ALA F CB  1 
ATOM   5386  N  N   . THR F  3 64  ? -28.545 16.606  -16.110 1.00 15.26 ? 434  THR F N   1 
ATOM   5387  C  CA  . THR F  3 64  ? -28.128 17.527  -15.083 1.00 15.63 ? 434  THR F CA  1 
ATOM   5388  C  C   . THR F  3 64  ? -26.925 18.306  -15.592 1.00 15.96 ? 434  THR F C   1 
ATOM   5389  O  O   . THR F  3 64  ? -25.851 17.746  -15.759 1.00 16.29 ? 434  THR F O   1 
ATOM   5390  C  CB  . THR F  3 64  ? -27.825 16.768  -13.781 1.00 16.10 ? 434  THR F CB  1 
ATOM   5391  O  OG1 . THR F  3 64  ? -29.013 16.081  -13.373 1.00 15.88 ? 434  THR F OG1 1 
ATOM   5392  C  CG2 . THR F  3 64  ? -27.404 17.717  -12.673 1.00 16.65 ? 434  THR F CG2 1 
ATOM   5393  N  N   . PRO F  3 65  ? -27.117 19.605  -15.881 1.00 16.02 ? 435  PRO F N   1 
ATOM   5394  C  CA  . PRO F  3 65  ? -26.000 20.416  -16.358 1.00 16.51 ? 435  PRO F CA  1 
ATOM   5395  C  C   . PRO F  3 65  ? -25.070 20.781  -15.210 1.00 17.25 ? 435  PRO F C   1 
ATOM   5396  O  O   . PRO F  3 65  ? -25.523 20.922  -14.083 1.00 17.56 ? 435  PRO F O   1 
ATOM   5397  C  CB  . PRO F  3 65  ? -26.693 21.660  -16.910 1.00 16.37 ? 435  PRO F CB  1 
ATOM   5398  C  CG  . PRO F  3 65  ? -27.900 21.805  -16.045 1.00 16.18 ? 435  PRO F CG  1 
ATOM   5399  C  CD  . PRO F  3 65  ? -28.344 20.406  -15.712 1.00 15.79 ? 435  PRO F CD  1 
ATOM   5400  N  N   . ILE F  3 66  ? -23.779 20.880  -15.501 1.00 17.99 ? 436  ILE F N   1 
ATOM   5401  C  CA  . ILE F  3 66  ? -22.771 21.356  -14.547 1.00 18.97 ? 436  ILE F CA  1 
ATOM   5402  C  C   . ILE F  3 66  ? -22.551 22.845  -14.803 1.00 19.49 ? 436  ILE F C   1 
ATOM   5403  O  O   . ILE F  3 66  ? -22.011 23.227  -15.838 1.00 19.74 ? 436  ILE F O   1 
ATOM   5404  C  CB  . ILE F  3 66  ? -21.445 20.600  -14.705 1.00 19.46 ? 436  ILE F CB  1 
ATOM   5405  C  CG1 . ILE F  3 66  ? -21.683 19.112  -14.499 1.00 19.19 ? 436  ILE F CG1 1 
ATOM   5406  C  CG2 . ILE F  3 66  ? -20.387 21.108  -13.714 1.00 20.40 ? 436  ILE F CG2 1 
ATOM   5407  C  CD1 . ILE F  3 66  ? -20.417 18.288  -14.572 1.00 19.88 ? 436  ILE F CD1 1 
ATOM   5408  N  N   . PRO F  3 67  ? -22.989 23.698  -13.873 1.00 20.01 ? 437  PRO F N   1 
ATOM   5409  C  CA  . PRO F  3 67  ? -22.798 25.144  -14.040 1.00 20.68 ? 437  PRO F CA  1 
ATOM   5410  C  C   . PRO F  3 67  ? -21.347 25.551  -13.925 1.00 21.91 ? 437  PRO F C   1 
ATOM   5411  O  O   . PRO F  3 67  ? -20.521 24.742  -13.520 1.00 21.93 ? 437  PRO F O   1 
ATOM   5412  C  CB  . PRO F  3 67  ? -23.557 25.739  -12.846 1.00 20.83 ? 437  PRO F CB  1 
ATOM   5413  C  CG  . PRO F  3 67  ? -24.399 24.629  -12.298 1.00 20.22 ? 437  PRO F CG  1 
ATOM   5414  C  CD  . PRO F  3 67  ? -23.639 23.381  -12.590 1.00 20.05 ? 437  PRO F CD  1 
ATOM   5415  N  N   . LYS F  3 68  ? -21.040 26.800  -14.261 1.00 23.16 ? 438  LYS F N   1 
ATOM   5416  C  CA  . LYS F  3 68  ? -19.745 27.387  -13.876 1.00 24.71 ? 438  LYS F CA  1 
ATOM   5417  C  C   . LYS F  3 68  ? -19.661 27.485  -12.362 1.00 25.86 ? 438  LYS F C   1 
ATOM   5418  O  O   . LYS F  3 68  ? -20.677 27.497  -11.675 1.00 25.84 ? 438  LYS F O   1 
ATOM   5419  C  CB  . LYS F  3 68  ? -19.572 28.792  -14.443 1.00 25.28 ? 438  LYS F CB  1 
ATOM   5420  C  CG  . LYS F  3 68  ? -19.343 28.840  -15.945 1.00 25.22 ? 438  LYS F CG  1 
ATOM   5421  C  CD  . LYS F  3 68  ? -18.971 30.251  -16.377 1.00 26.09 ? 438  LYS F CD  1 
ATOM   5422  C  CE  . LYS F  3 68  ? -18.678 30.298  -17.865 1.00 26.30 ? 438  LYS F CE  1 
ATOM   5423  N  NZ  . LYS F  3 68  ? -18.490 31.696  -18.331 1.00 27.30 ? 438  LYS F NZ  1 
ATOM   5424  N  N   . LEU F  3 69  ? -18.452 27.554  -11.829 1.00 27.69 ? 439  LEU F N   1 
ATOM   5425  C  CA  . LEU F  3 69  ? -18.302 27.927  -10.433 1.00 28.99 ? 439  LEU F CA  1 
ATOM   5426  C  C   . LEU F  3 69  ? -18.842 29.367  -10.255 1.00 30.04 ? 439  LEU F C   1 
ATOM   5427  O  O   . LEU F  3 69  ? -18.666 30.248  -11.126 1.00 30.39 ? 439  LEU F O   1 
ATOM   5428  C  CB  . LEU F  3 69  ? -16.842 27.829  -9.995  1.00 30.09 ? 439  LEU F CB  1 
ATOM   5429  C  CG  . LEU F  3 69  ? -16.296 26.437  -9.680  1.00 30.11 ? 439  LEU F CG  1 
ATOM   5430  C  CD1 . LEU F  3 69  ? -14.822 26.548  -9.338  1.00 31.15 ? 439  LEU F CD1 1 
ATOM   5431  C  CD2 . LEU F  3 69  ? -17.060 25.801  -8.524  1.00 30.17 ? 439  LEU F CD2 1 
ATOM   5432  O  OXT . LEU F  3 69  ? -19.490 29.677  -9.236  1.00 31.35 ? 439  LEU F OXT 1 
ATOM   5433  N  N   . ASP G  1 1   ? -55.398 -21.214 -8.289  1.00 28.18 ? 1    ASP G N   1 
ATOM   5434  C  CA  . ASP G  1 1   ? -55.855 -20.184 -9.255  1.00 27.48 ? 1    ASP G CA  1 
ATOM   5435  C  C   . ASP G  1 1   ? -57.354 -19.998 -9.118  1.00 27.99 ? 1    ASP G C   1 
ATOM   5436  O  O   . ASP G  1 1   ? -58.060 -20.926 -8.749  1.00 29.23 ? 1    ASP G O   1 
ATOM   5437  C  CB  . ASP G  1 1   ? -55.534 -20.576 -10.703 1.00 28.34 ? 1    ASP G CB  1 
ATOM   5438  C  CG  . ASP G  1 1   ? -54.067 -20.908 -10.927 1.00 27.97 ? 1    ASP G CG  1 
ATOM   5439  O  OD1 . ASP G  1 1   ? -53.384 -21.323 -9.961  1.00 28.04 ? 1    ASP G OD1 1 
ATOM   5440  O  OD2 . ASP G  1 1   ? -53.610 -20.781 -12.088 1.00 27.52 ? 1    ASP G OD2 1 
ATOM   5441  N  N   . THR G  1 2   ? -57.814 -18.781 -9.383  1.00 26.87 ? 2    THR G N   1 
ATOM   5442  C  CA  . THR G  1 2   ? -59.218 -18.474 -9.554  1.00 27.55 ? 2    THR G CA  1 
ATOM   5443  C  C   . THR G  1 2   ? -59.487 -18.632 -11.039 1.00 28.76 ? 2    THR G C   1 
ATOM   5444  O  O   . THR G  1 2   ? -58.538 -18.757 -11.825 1.00 29.21 ? 2    THR G O   1 
ATOM   5445  C  CB  . THR G  1 2   ? -59.549 -17.022 -9.127  1.00 26.36 ? 2    THR G CB  1 
ATOM   5446  O  OG1 . THR G  1 2   ? -59.045 -16.088 -10.096 1.00 25.22 ? 2    THR G OG1 1 
ATOM   5447  C  CG2 . THR G  1 2   ? -58.944 -16.687 -7.733  1.00 25.46 ? 2    THR G CG2 1 
ATOM   5448  N  N   . PRO G  1 3   ? -60.770 -18.633 -11.441 1.00 29.96 ? 3    PRO G N   1 
ATOM   5449  C  CA  . PRO G  1 3   ? -61.123 -18.678 -12.859 1.00 30.87 ? 3    PRO G CA  1 
ATOM   5450  C  C   . PRO G  1 3   ? -60.692 -17.458 -13.678 1.00 30.32 ? 3    PRO G C   1 
ATOM   5451  O  O   . PRO G  1 3   ? -60.644 -17.544 -14.905 1.00 30.79 ? 3    PRO G O   1 
ATOM   5452  C  CB  . PRO G  1 3   ? -62.653 -18.762 -12.832 1.00 31.96 ? 3    PRO G CB  1 
ATOM   5453  C  CG  . PRO G  1 3   ? -62.967 -19.387 -11.516 1.00 32.26 ? 3    PRO G CG  1 
ATOM   5454  C  CD  . PRO G  1 3   ? -61.952 -18.827 -10.581 1.00 30.65 ? 3    PRO G CD  1 
ATOM   5455  N  N   . ALA G  1 4   ? -60.378 -16.344 -13.009 1.00 29.56 ? 4    ALA G N   1 
ATOM   5456  C  CA  . ALA G  1 4   ? -60.034 -15.088 -13.686 1.00 29.27 ? 4    ALA G CA  1 
ATOM   5457  C  C   . ALA G  1 4   ? -58.789 -15.186 -14.565 1.00 29.80 ? 4    ALA G C   1 
ATOM   5458  O  O   . ALA G  1 4   ? -57.826 -15.875 -14.226 1.00 30.08 ? 4    ALA G O   1 
ATOM   5459  C  CB  . ALA G  1 4   ? -59.856 -13.981 -12.666 1.00 27.98 ? 4    ALA G CB  1 
ATOM   5460  N  N   . ASN G  1 5   ? -58.830 -14.490 -15.700 1.00 31.36 ? 5    ASN G N   1 
ATOM   5461  C  CA  . ASN G  1 5   ? -57.683 -14.372 -16.606 1.00 32.52 ? 5    ASN G CA  1 
ATOM   5462  C  C   . ASN G  1 5   ? -57.545 -12.938 -17.101 1.00 32.16 ? 5    ASN G C   1 
ATOM   5463  O  O   . ASN G  1 5   ? -57.737 -12.652 -18.286 1.00 33.21 ? 5    ASN G O   1 
ATOM   5464  C  CB  . ASN G  1 5   ? -57.839 -15.314 -17.793 1.00 36.14 ? 5    ASN G CB  1 
ATOM   5465  C  CG  . ASN G  1 5   ? -56.576 -15.417 -18.637 1.00 39.22 ? 5    ASN G CG  1 
ATOM   5466  O  OD1 . ASN G  1 5   ? -55.559 -14.778 -18.366 1.00 37.81 ? 5    ASN G OD1 1 
ATOM   5467  N  ND2 . ASN G  1 5   ? -56.648 -16.234 -19.670 1.00 45.98 ? 5    ASN G ND2 1 
ATOM   5468  N  N   . CYS G  1 6   ? -57.212 -12.039 -16.184 1.00 30.33 ? 6    CYS G N   1 
ATOM   5469  C  CA  . CYS G  1 6   ? -57.115 -10.624 -16.503 1.00 29.44 ? 6    CYS G CA  1 
ATOM   5470  C  C   . CYS G  1 6   ? -55.694 -10.249 -16.888 1.00 27.22 ? 6    CYS G C   1 
ATOM   5471  O  O   . CYS G  1 6   ? -54.742 -10.948 -16.546 1.00 26.05 ? 6    CYS G O   1 
ATOM   5472  C  CB  . CYS G  1 6   ? -57.599 -9.798  -15.323 1.00 30.15 ? 6    CYS G CB  1 
ATOM   5473  S  SG  . CYS G  1 6   ? -59.271 -10.309 -14.821 1.00 33.63 ? 6    CYS G SG  1 
ATOM   5474  N  N   . THR G  1 7   ? -55.578 -9.146  -17.622 1.00 26.06 ? 7    THR G N   1 
ATOM   5475  C  CA  . THR G  1 7   ? -54.326 -8.707  -18.199 1.00 25.20 ? 7    THR G CA  1 
ATOM   5476  C  C   . THR G  1 7   ? -53.799 -7.508  -17.445 1.00 23.58 ? 7    THR G C   1 
ATOM   5477  O  O   . THR G  1 7   ? -54.557 -6.795  -16.781 1.00 22.75 ? 7    THR G O   1 
ATOM   5478  C  CB  . THR G  1 7   ? -54.502 -8.245  -19.656 1.00 26.37 ? 7    THR G CB  1 
ATOM   5479  O  OG1 . THR G  1 7   ? -55.368 -7.105  -19.682 1.00 26.27 ? 7    THR G OG1 1 
ATOM   5480  C  CG2 . THR G  1 7   ? -55.068 -9.362  -20.550 1.00 27.41 ? 7    THR G CG2 1 
ATOM   5481  N  N   . TYR G  1 8   ? -52.496 -7.282  -17.588 1.00 22.90 ? 8    TYR G N   1 
ATOM   5482  C  CA  . TYR G  1 8   ? -51.843 -6.087  -17.080 1.00 21.95 ? 8    TYR G CA  1 
ATOM   5483  C  C   . TYR G  1 8   ? -52.555 -4.801  -17.524 1.00 22.56 ? 8    TYR G C   1 
ATOM   5484  O  O   . TYR G  1 8   ? -52.754 -3.906  -16.710 1.00 21.50 ? 8    TYR G O   1 
ATOM   5485  C  CB  . TYR G  1 8   ? -50.383 -6.088  -17.528 1.00 22.08 ? 8    TYR G CB  1 
ATOM   5486  C  CG  . TYR G  1 8   ? -49.583 -4.882  -17.104 1.00 21.45 ? 8    TYR G CG  1 
ATOM   5487  C  CD1 . TYR G  1 8   ? -49.024 -4.807  -15.841 1.00 20.31 ? 8    TYR G CD1 1 
ATOM   5488  C  CD2 . TYR G  1 8   ? -49.382 -3.827  -17.978 1.00 22.27 ? 8    TYR G CD2 1 
ATOM   5489  C  CE1 . TYR G  1 8   ? -48.290 -3.712  -15.447 1.00 20.13 ? 8    TYR G CE1 1 
ATOM   5490  C  CE2 . TYR G  1 8   ? -48.649 -2.724  -17.601 1.00 22.33 ? 8    TYR G CE2 1 
ATOM   5491  C  CZ  . TYR G  1 8   ? -48.096 -2.674  -16.332 1.00 21.06 ? 8    TYR G CZ  1 
ATOM   5492  O  OH  . TYR G  1 8   ? -47.373 -1.576  -15.963 1.00 20.25 ? 8    TYR G OH  1 
ATOM   5493  N  N   . LEU G  1 9   ? -52.935 -4.721  -18.804 1.00 24.27 ? 9    LEU G N   1 
ATOM   5494  C  CA  . LEU G  1 9   ? -53.688 -3.574  -19.345 1.00 25.46 ? 9    LEU G CA  1 
ATOM   5495  C  C   . LEU G  1 9   ? -55.026 -3.317  -18.638 1.00 24.98 ? 9    LEU G C   1 
ATOM   5496  O  O   . LEU G  1 9   ? -55.420 -2.170  -18.448 1.00 25.37 ? 9    LEU G O   1 
ATOM   5497  C  CB  . LEU G  1 9   ? -53.979 -3.761  -20.844 1.00 27.64 ? 9    LEU G CB  1 
ATOM   5498  C  CG  . LEU G  1 9   ? -53.069 -3.006  -21.821 1.00 29.19 ? 9    LEU G CG  1 
ATOM   5499  C  CD1 . LEU G  1 9   ? -51.671 -3.611  -21.848 1.00 29.50 ? 9    LEU G CD1 1 
ATOM   5500  C  CD2 . LEU G  1 9   ? -53.671 -2.994  -23.221 1.00 30.97 ? 9    LEU G CD2 1 
ATOM   5501  N  N   . ASP G  1 10  ? -55.737 -4.379  -18.276 1.00 24.48 ? 10   ASP G N   1 
ATOM   5502  C  CA  . ASP G  1 10  ? -57.006 -4.231  -17.551 1.00 24.40 ? 10   ASP G CA  1 
ATOM   5503  C  C   . ASP G  1 10  ? -56.796 -3.539  -16.203 1.00 22.99 ? 10   ASP G C   1 
ATOM   5504  O  O   . ASP G  1 10  ? -57.703 -2.890  -15.671 1.00 22.80 ? 10   ASP G O   1 
ATOM   5505  C  CB  . ASP G  1 10  ? -57.667 -5.596  -17.316 1.00 24.70 ? 10   ASP G CB  1 
ATOM   5506  C  CG  . ASP G  1 10  ? -58.132 -6.255  -18.601 1.00 26.31 ? 10   ASP G CG  1 
ATOM   5507  O  OD1 . ASP G  1 10  ? -58.490 -5.528  -19.552 1.00 27.27 ? 10   ASP G OD1 1 
ATOM   5508  O  OD2 . ASP G  1 10  ? -58.151 -7.511  -18.650 1.00 27.28 ? 10   ASP G OD2 1 
ATOM   5509  N  N   . LEU G  1 11  ? -55.586 -3.680  -15.672 1.00 21.46 ? 11   LEU G N   1 
ATOM   5510  C  CA  . LEU G  1 11  ? -55.220 -3.120  -14.398 1.00 20.28 ? 11   LEU G CA  1 
ATOM   5511  C  C   . LEU G  1 11  ? -54.861 -1.639  -14.444 1.00 20.13 ? 11   LEU G C   1 
ATOM   5512  O  O   . LEU G  1 11  ? -55.083 -0.916  -13.481 1.00 19.99 ? 11   LEU G O   1 
ATOM   5513  C  CB  . LEU G  1 11  ? -54.055 -3.932  -13.845 1.00 19.55 ? 11   LEU G CB  1 
ATOM   5514  C  CG  . LEU G  1 11  ? -53.560 -3.644  -12.440 1.00 18.81 ? 11   LEU G CG  1 
ATOM   5515  C  CD1 . LEU G  1 11  ? -54.674 -3.786  -11.414 1.00 18.55 ? 11   LEU G CD1 1 
ATOM   5516  C  CD2 . LEU G  1 11  ? -52.386 -4.581  -12.153 1.00 18.37 ? 11   LEU G CD2 1 
ATOM   5517  N  N   . LEU G  1 12  ? -54.314 -1.174  -15.552 1.00 20.80 ? 12   LEU G N   1 
ATOM   5518  C  CA  . LEU G  1 12  ? -53.859 0.220   -15.647 1.00 21.13 ? 12   LEU G CA  1 
ATOM   5519  C  C   . LEU G  1 12  ? -55.040 1.193   -15.699 1.00 21.76 ? 12   LEU G C   1 
ATOM   5520  O  O   . LEU G  1 12  ? -56.002 0.946   -16.417 1.00 22.73 ? 12   LEU G O   1 
ATOM   5521  C  CB  . LEU G  1 12  ? -52.996 0.414   -16.892 1.00 21.91 ? 12   LEU G CB  1 
ATOM   5522  C  CG  . LEU G  1 12  ? -51.691 -0.381  -16.965 1.00 21.52 ? 12   LEU G CG  1 
ATOM   5523  C  CD1 . LEU G  1 12  ? -51.025 -0.127  -18.313 1.00 22.70 ? 12   LEU G CD1 1 
ATOM   5524  C  CD2 . LEU G  1 12  ? -50.762 -0.010  -15.824 1.00 20.68 ? 12   LEU G CD2 1 
ATOM   5525  N  N   . GLY G  1 13  ? -54.952 2.301   -14.961 1.00 21.40 ? 13   GLY G N   1 
ATOM   5526  C  CA  . GLY G  1 13  ? -55.992 3.323   -14.970 1.00 22.17 ? 13   GLY G CA  1 
ATOM   5527  C  C   . GLY G  1 13  ? -56.375 3.751   -13.567 1.00 21.63 ? 13   GLY G C   1 
ATOM   5528  O  O   . GLY G  1 13  ? -55.585 3.613   -12.617 1.00 20.58 ? 13   GLY G O   1 
ATOM   5529  N  N   . THR G  1 14  ? -57.591 4.272   -13.433 1.00 22.36 ? 14   THR G N   1 
ATOM   5530  C  CA  . THR G  1 14  ? -58.073 4.800   -12.152 1.00 22.29 ? 14   THR G CA  1 
ATOM   5531  C  C   . THR G  1 14  ? -58.931 3.767   -11.430 1.00 21.52 ? 14   THR G C   1 
ATOM   5532  O  O   . THR G  1 14  ? -59.902 3.269   -11.986 1.00 22.20 ? 14   THR G O   1 
ATOM   5533  C  CB  . THR G  1 14  ? -58.897 6.075   -12.384 1.00 23.98 ? 14   THR G CB  1 
ATOM   5534  O  OG1 . THR G  1 14  ? -58.105 7.010   -13.120 1.00 24.94 ? 14   THR G OG1 1 
ATOM   5535  C  CG2 . THR G  1 14  ? -59.342 6.713   -11.068 1.00 24.16 ? 14   THR G CG2 1 
ATOM   5536  N  N   . TRP G  1 15  ? -58.571 3.430   -10.198 1.00 20.35 ? 15   TRP G N   1 
ATOM   5537  C  CA  . TRP G  1 15  ? -59.400 2.526   -9.397  1.00 19.91 ? 15   TRP G CA  1 
ATOM   5538  C  C   . TRP G  1 15  ? -60.025 3.266   -8.222  1.00 20.49 ? 15   TRP G C   1 
ATOM   5539  O  O   . TRP G  1 15  ? -59.440 4.200   -7.659  1.00 20.65 ? 15   TRP G O   1 
ATOM   5540  C  CB  . TRP G  1 15  ? -58.599 1.319   -8.907  1.00 18.53 ? 15   TRP G CB  1 
ATOM   5541  C  CG  . TRP G  1 15  ? -58.257 0.340   -10.002 1.00 18.18 ? 15   TRP G CG  1 
ATOM   5542  C  CD1 . TRP G  1 15  ? -57.274 0.467   -10.936 1.00 18.03 ? 15   TRP G CD1 1 
ATOM   5543  C  CD2 . TRP G  1 15  ? -58.901 -0.918  -10.269 1.00 18.06 ? 15   TRP G CD2 1 
ATOM   5544  N  NE1 . TRP G  1 15  ? -57.265 -0.630  -11.771 1.00 17.89 ? 15   TRP G NE1 1 
ATOM   5545  C  CE2 . TRP G  1 15  ? -58.254 -1.491  -11.384 1.00 17.87 ? 15   TRP G CE2 1 
ATOM   5546  C  CE3 . TRP G  1 15  ? -59.962 -1.613  -9.671  1.00 18.31 ? 15   TRP G CE3 1 
ATOM   5547  C  CZ2 . TRP G  1 15  ? -58.627 -2.723  -11.915 1.00 17.98 ? 15   TRP G CZ2 1 
ATOM   5548  C  CZ3 . TRP G  1 15  ? -60.329 -2.857  -10.201 1.00 18.41 ? 15   TRP G CZ3 1 
ATOM   5549  C  CH2 . TRP G  1 15  ? -59.664 -3.389  -11.318 1.00 18.20 ? 15   TRP G CH2 1 
ATOM   5550  N  N   . VAL G  1 16  ? -61.237 2.858   -7.876  1.00 21.03 ? 16   VAL G N   1 
ATOM   5551  C  CA  . VAL G  1 16  ? -61.878 3.348   -6.679  1.00 21.69 ? 16   VAL G CA  1 
ATOM   5552  C  C   . VAL G  1 16  ? -62.007 2.179   -5.728  1.00 21.21 ? 16   VAL G C   1 
ATOM   5553  O  O   . VAL G  1 16  ? -62.608 1.166   -6.057  1.00 21.22 ? 16   VAL G O   1 
ATOM   5554  C  CB  . VAL G  1 16  ? -63.256 3.951   -6.966  1.00 23.08 ? 16   VAL G CB  1 
ATOM   5555  C  CG1 . VAL G  1 16  ? -63.855 4.469   -5.676  1.00 23.84 ? 16   VAL G CG1 1 
ATOM   5556  C  CG2 . VAL G  1 16  ? -63.146 5.068   -7.989  1.00 23.93 ? 16   VAL G CG2 1 
ATOM   5557  N  N   . PHE G  1 17  ? -61.403 2.312   -4.556  1.00 21.13 ? 17   PHE G N   1 
ATOM   5558  C  CA  . PHE G  1 17  ? -61.453 1.259   -3.561  1.00 20.99 ? 17   PHE G CA  1 
ATOM   5559  C  C   . PHE G  1 17  ? -62.401 1.683   -2.462  1.00 22.44 ? 17   PHE G C   1 
ATOM   5560  O  O   . PHE G  1 17  ? -62.265 2.766   -1.901  1.00 23.01 ? 17   PHE G O   1 
ATOM   5561  C  CB  . PHE G  1 17  ? -60.068 0.972   -2.973  1.00 19.85 ? 17   PHE G CB  1 
ATOM   5562  C  CG  . PHE G  1 17  ? -59.076 0.426   -3.955  1.00 18.82 ? 17   PHE G CG  1 
ATOM   5563  C  CD1 . PHE G  1 17  ? -59.470 -0.349  -5.026  1.00 18.82 ? 17   PHE G CD1 1 
ATOM   5564  C  CD2 . PHE G  1 17  ? -57.722 0.649   -3.760  1.00 18.19 ? 17   PHE G CD2 1 
ATOM   5565  C  CE1 . PHE G  1 17  ? -58.543 -0.860  -5.913  1.00 18.13 ? 17   PHE G CE1 1 
ATOM   5566  C  CE2 . PHE G  1 17  ? -56.791 0.151   -4.635  1.00 17.48 ? 17   PHE G CE2 1 
ATOM   5567  C  CZ  . PHE G  1 17  ? -57.201 -0.608  -5.718  1.00 17.48 ? 17   PHE G CZ  1 
ATOM   5568  N  N   . GLN G  1 18  ? -63.364 0.813   -2.171  1.00 23.46 ? 18   GLN G N   1 
ATOM   5569  C  CA  . GLN G  1 18  ? -64.385 1.058   -1.164  1.00 24.95 ? 18   GLN G CA  1 
ATOM   5570  C  C   . GLN G  1 18  ? -64.002 0.249   0.071   1.00 24.57 ? 18   GLN G C   1 
ATOM   5571  O  O   . GLN G  1 18  ? -63.921 -0.966  0.022   1.00 23.88 ? 18   GLN G O   1 
ATOM   5572  C  CB  . GLN G  1 18  ? -65.745 0.609   -1.706  1.00 26.27 ? 18   GLN G CB  1 
ATOM   5573  C  CG  . GLN G  1 18  ? -66.104 1.196   -3.066  1.00 26.99 ? 18   GLN G CG  1 
ATOM   5574  C  CD  . GLN G  1 18  ? -66.705 2.589   -2.973  1.00 28.62 ? 18   GLN G CD  1 
ATOM   5575  O  OE1 . GLN G  1 18  ? -66.714 3.192   -1.909  1.00 29.77 ? 18   GLN G OE1 1 
ATOM   5576  N  NE2 . GLN G  1 18  ? -67.224 3.098   -4.088  1.00 29.53 ? 18   GLN G NE2 1 
ATOM   5577  N  N   . VAL G  1 19  ? -63.759 0.930   1.177   1.00 25.35 ? 19   VAL G N   1 
ATOM   5578  C  CA  . VAL G  1 19  ? -63.150 0.293   2.338   1.00 25.35 ? 19   VAL G CA  1 
ATOM   5579  C  C   . VAL G  1 19  ? -64.157 0.181   3.471   1.00 27.26 ? 19   VAL G C   1 
ATOM   5580  O  O   . VAL G  1 19  ? -64.820 1.156   3.813   1.00 28.49 ? 19   VAL G O   1 
ATOM   5581  C  CB  . VAL G  1 19  ? -61.900 1.069   2.829   1.00 24.58 ? 19   VAL G CB  1 
ATOM   5582  C  CG1 . VAL G  1 19  ? -61.252 0.341   3.992   1.00 24.52 ? 19   VAL G CG1 1 
ATOM   5583  C  CG2 . VAL G  1 19  ? -60.887 1.229   1.712   1.00 23.22 ? 19   VAL G CG2 1 
ATOM   5584  N  N   . GLY G  1 20  ? -64.242 -1.010  4.054   1.00 27.93 ? 20   GLY G N   1 
ATOM   5585  C  CA  . GLY G  1 20  ? -65.116 -1.269  5.187   1.00 30.40 ? 20   GLY G CA  1 
ATOM   5586  C  C   . GLY G  1 20  ? -64.396 -2.058  6.260   1.00 31.29 ? 20   GLY G C   1 
ATOM   5587  O  O   . GLY G  1 20  ? -63.237 -2.412  6.091   1.00 29.74 ? 20   GLY G O   1 
ATOM   5588  N  N   . SER G  1 21  ? -65.086 -2.332  7.367   1.00 33.91 ? 21   SER G N   1 
ATOM   5589  C  CA  . SER G  1 21  ? -64.487 -3.032  8.507   1.00 34.74 ? 21   SER G CA  1 
ATOM   5590  C  C   . SER G  1 21  ? -63.183 -2.353  8.955   1.00 34.20 ? 21   SER G C   1 
ATOM   5591  O  O   . SER G  1 21  ? -62.220 -3.029  9.315   1.00 33.69 ? 21   SER G O   1 
ATOM   5592  C  CB  . SER G  1 21  ? -64.221 -4.514  8.158   1.00 34.04 ? 21   SER G CB  1 
ATOM   5593  O  OG  . SER G  1 21  ? -65.407 -5.190  7.762   1.00 34.85 ? 21   SER G OG  1 
ATOM   5594  N  N   . SER G  1 22  ? -63.141 -1.022  8.922   1.00 34.81 ? 22   SER G N   1 
ATOM   5595  C  CA  . SER G  1 22  ? -61.885 -0.318  9.202   1.00 34.86 ? 22   SER G CA  1 
ATOM   5596  C  C   . SER G  1 22  ? -61.647 -0.261  10.695  1.00 36.52 ? 22   SER G C   1 
ATOM   5597  O  O   . SER G  1 22  ? -62.594 -0.170  11.474  1.00 39.11 ? 22   SER G O   1 
ATOM   5598  C  CB  . SER G  1 22  ? -61.860 1.088   8.581   1.00 34.94 ? 22   SER G CB  1 
ATOM   5599  O  OG  . SER G  1 22  ? -63.066 1.789   8.808   1.00 36.35 ? 22   SER G OG  1 
ATOM   5600  N  N   . GLY G  1 23  ? -60.379 -0.332  11.090  1.00 36.33 ? 23   GLY G N   1 
ATOM   5601  C  CA  . GLY G  1 23  ? -60.014 -0.370  12.507  1.00 37.71 ? 23   GLY G CA  1 
ATOM   5602  C  C   . GLY G  1 23  ? -59.939 -1.782  13.079  1.00 38.00 ? 23   GLY G C   1 
ATOM   5603  O  O   . GLY G  1 23  ? -59.819 -1.955  14.296  1.00 40.52 ? 23   GLY G O   1 
ATOM   5604  N  N   . SER G  1 24  ? -60.002 -2.788  12.210  1.00 36.23 ? 24   SER G N   1 
ATOM   5605  C  CA  . SER G  1 24  ? -59.848 -4.184  12.620  1.00 36.12 ? 24   SER G CA  1 
ATOM   5606  C  C   . SER G  1 24  ? -58.372 -4.551  12.753  1.00 34.63 ? 24   SER G C   1 
ATOM   5607  O  O   . SER G  1 24  ? -57.491 -3.751  12.443  1.00 33.42 ? 24   SER G O   1 
ATOM   5608  C  CB  . SER G  1 24  ? -60.500 -5.129  11.591  1.00 35.41 ? 24   SER G CB  1 
ATOM   5609  O  OG  . SER G  1 24  ? -61.742 -4.638  11.128  1.00 35.58 ? 24   SER G OG  1 
ATOM   5610  N  N   . GLN G  1 25  ? -58.131 -5.780  13.200  1.00 34.80 ? 25   GLN G N   1 
ATOM   5611  C  CA  . GLN G  1 25  ? -56.796 -6.350  13.309  1.00 34.09 ? 25   GLN G CA  1 
ATOM   5612  C  C   . GLN G  1 25  ? -56.717 -7.502  12.319  1.00 32.64 ? 25   GLN G C   1 
ATOM   5613  O  O   . GLN G  1 25  ? -57.681 -7.747  11.596  1.00 31.68 ? 25   GLN G O   1 
ATOM   5614  C  CB  . GLN G  1 25  ? -56.563 -6.824  14.745  1.00 36.48 ? 25   GLN G CB  1 
ATOM   5615  C  CG  . GLN G  1 25  ? -56.917 -5.756  15.778  1.00 38.13 ? 25   GLN G CG  1 
ATOM   5616  C  CD  . GLN G  1 25  ? -56.865 -6.267  17.202  1.00 40.78 ? 25   GLN G CD  1 
ATOM   5617  O  OE1 . GLN G  1 25  ? -57.898 -6.619  17.780  1.00 42.69 ? 25   GLN G OE1 1 
ATOM   5618  N  NE2 . GLN G  1 25  ? -55.658 -6.317  17.779  1.00 40.92 ? 25   GLN G NE2 1 
ATOM   5619  N  N   . ARG G  1 26  ? -55.601 -8.229  12.286  1.00 31.80 ? 26   ARG G N   1 
ATOM   5620  C  CA  . ARG G  1 26  ? -55.397 -9.223  11.220  1.00 30.78 ? 26   ARG G CA  1 
ATOM   5621  C  C   . ARG G  1 26  ? -56.365 -10.409 11.233  1.00 33.06 ? 26   ARG G C   1 
ATOM   5622  O  O   . ARG G  1 26  ? -56.417 -11.165 10.264  1.00 32.52 ? 26   ARG G O   1 
ATOM   5623  C  CB  . ARG G  1 26  ? -53.951 -9.726  11.179  1.00 29.82 ? 26   ARG G CB  1 
ATOM   5624  C  CG  . ARG G  1 26  ? -53.692 -11.014 11.937  1.00 31.34 ? 26   ARG G CG  1 
ATOM   5625  C  CD  . ARG G  1 26  ? -52.200 -11.270 12.016  1.00 30.61 ? 26   ARG G CD  1 
ATOM   5626  N  NE  . ARG G  1 26  ? -51.901 -12.514 12.716  1.00 32.04 ? 26   ARG G NE  1 
ATOM   5627  C  CZ  . ARG G  1 26  ? -50.671 -12.966 12.951  1.00 32.07 ? 26   ARG G CZ  1 
ATOM   5628  N  NH1 . ARG G  1 26  ? -49.606 -12.278 12.548  1.00 30.65 ? 26   ARG G NH1 1 
ATOM   5629  N  NH2 . ARG G  1 26  ? -50.508 -14.113 13.593  1.00 33.82 ? 26   ARG G NH2 1 
ATOM   5630  N  N   . ASP G  1 27  ? -57.130 -10.585 12.303  1.00 36.07 ? 27   ASP G N   1 
ATOM   5631  C  CA  . ASP G  1 27  ? -58.117 -11.676 12.343  1.00 38.49 ? 27   ASP G CA  1 
ATOM   5632  C  C   . ASP G  1 27  ? -59.410 -11.379 11.562  1.00 38.62 ? 27   ASP G C   1 
ATOM   5633  O  O   . ASP G  1 27  ? -60.295 -12.234 11.495  1.00 40.48 ? 27   ASP G O   1 
ATOM   5634  C  CB  . ASP G  1 27  ? -58.457 -12.053 13.793  1.00 41.04 ? 27   ASP G CB  1 
ATOM   5635  C  CG  . ASP G  1 27  ? -58.990 -10.879 14.604  1.00 42.19 ? 27   ASP G CG  1 
ATOM   5636  O  OD1 . ASP G  1 27  ? -59.431 -9.863  14.010  1.00 41.55 ? 27   ASP G OD1 1 
ATOM   5637  O  OD2 . ASP G  1 27  ? -58.968 -10.986 15.849  1.00 44.73 ? 27   ASP G OD2 1 
ATOM   5638  N  N   . VAL G  1 28  ? -59.513 -10.175 10.995  1.00 37.24 ? 28   VAL G N   1 
ATOM   5639  C  CA  . VAL G  1 28  ? -60.711 -9.714  10.293  1.00 36.90 ? 28   VAL G CA  1 
ATOM   5640  C  C   . VAL G  1 28  ? -61.177 -10.735 9.276   1.00 37.11 ? 28   VAL G C   1 
ATOM   5641  O  O   . VAL G  1 28  ? -60.369 -11.336 8.575   1.00 36.58 ? 28   VAL G O   1 
ATOM   5642  C  CB  . VAL G  1 28  ? -60.470 -8.360  9.569   1.00 35.39 ? 28   VAL G CB  1 
ATOM   5643  C  CG1 . VAL G  1 28  ? -59.402 -8.483  8.485   1.00 33.35 ? 28   VAL G CG1 1 
ATOM   5644  C  CG2 . VAL G  1 28  ? -61.769 -7.818  8.982   1.00 35.65 ? 28   VAL G CG2 1 
ATOM   5645  N  N   . ASN G  1 29  ? -62.486 -10.937 9.218   1.00 38.64 ? 29   ASN G N   1 
ATOM   5646  C  CA  . ASN G  1 29  ? -63.088 -11.837 8.256   1.00 39.12 ? 29   ASN G CA  1 
ATOM   5647  C  C   . ASN G  1 29  ? -63.697 -10.950 7.181   1.00 37.94 ? 29   ASN G C   1 
ATOM   5648  O  O   . ASN G  1 29  ? -64.687 -10.262 7.423   1.00 38.92 ? 29   ASN G O   1 
ATOM   5649  C  CB  . ASN G  1 29  ? -64.148 -12.723 8.939   1.00 41.81 ? 29   ASN G CB  1 
ATOM   5650  C  CG  . ASN G  1 29  ? -64.592 -13.892 8.071   1.00 42.54 ? 29   ASN G CG  1 
ATOM   5651  O  OD1 . ASN G  1 29  ? -64.426 -13.879 6.850   1.00 41.31 ? 29   ASN G OD1 1 
ATOM   5652  N  ND2 . ASN G  1 29  ? -65.166 -14.912 8.703   1.00 45.62 ? 29   ASN G ND2 1 
ATOM   5653  N  N   . CYS G  1 30  ? -63.083 -10.938 6.006   1.00 36.16 ? 30   CYS G N   1 
ATOM   5654  C  CA  . CYS G  1 30  ? -63.509 -10.036 4.942   1.00 34.97 ? 30   CYS G CA  1 
ATOM   5655  C  C   . CYS G  1 30  ? -64.719 -10.550 4.150   1.00 36.79 ? 30   CYS G C   1 
ATOM   5656  O  O   . CYS G  1 30  ? -65.398 -9.776  3.477   1.00 36.54 ? 30   CYS G O   1 
ATOM   5657  C  CB  . CYS G  1 30  ? -62.345 -9.733  4.006   1.00 32.05 ? 30   CYS G CB  1 
ATOM   5658  S  SG  . CYS G  1 30  ? -61.144 -8.562  4.700   1.00 31.45 ? 30   CYS G SG  1 
ATOM   5659  N  N   . SER G  1 31  ? -64.998 -11.844 4.248   1.00 38.47 ? 31   SER G N   1 
ATOM   5660  C  CA  . SER G  1 31  ? -66.108 -12.439 3.524   1.00 39.96 ? 31   SER G CA  1 
ATOM   5661  C  C   . SER G  1 31  ? -67.468 -12.076 4.142   1.00 41.47 ? 31   SER G C   1 
ATOM   5662  O  O   . SER G  1 31  ? -68.502 -12.238 3.491   1.00 42.07 ? 31   SER G O   1 
ATOM   5663  C  CB  . SER G  1 31  ? -65.930 -13.959 3.463   1.00 41.46 ? 31   SER G CB  1 
ATOM   5664  O  OG  . SER G  1 31  ? -65.965 -14.515 4.768   1.00 43.60 ? 31   SER G OG  1 
ATOM   5665  N  N   . VAL G  1 32  ? -67.457 -11.597 5.390   1.00 42.23 ? 32   VAL G N   1 
ATOM   5666  C  CA  . VAL G  1 32  ? -68.671 -11.093 6.069   1.00 43.85 ? 32   VAL G CA  1 
ATOM   5667  C  C   . VAL G  1 32  ? -68.721 -9.554  6.169   1.00 43.20 ? 32   VAL G C   1 
ATOM   5668  O  O   . VAL G  1 32  ? -69.527 -8.999  6.935   1.00 44.06 ? 32   VAL G O   1 
ATOM   5669  C  CB  . VAL G  1 32  ? -68.838 -11.712 7.480   1.00 45.37 ? 32   VAL G CB  1 
ATOM   5670  C  CG1 . VAL G  1 32  ? -68.841 -13.228 7.385   1.00 46.50 ? 32   VAL G CG1 1 
ATOM   5671  C  CG2 . VAL G  1 32  ? -67.753 -11.240 8.440   1.00 44.39 ? 32   VAL G CG2 1 
ATOM   5672  N  N   . MET G  1 33  ? -67.878 -8.870  5.387   1.00 41.46 ? 33   MET G N   1 
ATOM   5673  C  CA  . MET G  1 33  ? -67.850 -7.406  5.392   1.00 40.98 ? 33   MET G CA  1 
ATOM   5674  C  C   . MET G  1 33  ? -69.235 -6.822  5.115   1.00 41.53 ? 33   MET G C   1 
ATOM   5675  O  O   . MET G  1 33  ? -69.806 -7.011  4.027   1.00 40.74 ? 33   MET G O   1 
ATOM   5676  C  CB  . MET G  1 33  ? -66.872 -6.849  4.354   1.00 39.70 ? 33   MET G CB  1 
ATOM   5677  C  CG  . MET G  1 33  ? -66.799 -5.317  4.373   1.00 40.07 ? 33   MET G CG  1 
ATOM   5678  S  SD  . MET G  1 33  ? -65.711 -4.581  3.135   1.00 39.91 ? 33   MET G SD  1 
ATOM   5679  C  CE  . MET G  1 33  ? -66.344 -5.307  1.615   1.00 38.44 ? 33   MET G CE  1 
ATOM   5680  N  N   . GLY G  1 34  ? -69.754 -6.097  6.101   1.00 41.78 ? 34   GLY G N   1 
ATOM   5681  C  CA  . GLY G  1 34  ? -71.008 -5.387  5.949   1.00 41.95 ? 34   GLY G CA  1 
ATOM   5682  C  C   . GLY G  1 34  ? -70.809 -4.067  5.231   1.00 40.20 ? 34   GLY G C   1 
ATOM   5683  O  O   . GLY G  1 34  ? -70.408 -4.050  4.060   1.00 38.44 ? 34   GLY G O   1 
ATOM   5684  N  N   . PRO G  1 35  ? -71.086 -2.953  5.929   1.00 40.46 ? 35   PRO G N   1 
ATOM   5685  C  CA  . PRO G  1 35  ? -71.070 -1.643  5.297   1.00 40.02 ? 35   PRO G CA  1 
ATOM   5686  C  C   . PRO G  1 35  ? -69.656 -1.154  5.021   1.00 38.23 ? 35   PRO G C   1 
ATOM   5687  O  O   . PRO G  1 35  ? -68.710 -1.554  5.707   1.00 38.08 ? 35   PRO G O   1 
ATOM   5688  C  CB  . PRO G  1 35  ? -71.745 -0.744  6.332   1.00 41.79 ? 35   PRO G CB  1 
ATOM   5689  C  CG  . PRO G  1 35  ? -71.458 -1.392  7.641   1.00 42.40 ? 35   PRO G CG  1 
ATOM   5690  C  CD  . PRO G  1 35  ? -71.264 -2.861  7.390   1.00 41.84 ? 35   PRO G CD  1 
ATOM   5691  N  N   . GLN G  1 36  ? -69.526 -0.295  4.020   1.00 37.28 ? 36   GLN G N   1 
ATOM   5692  C  CA  . GLN G  1 36  ? -68.245 0.272   3.653   1.00 35.88 ? 36   GLN G CA  1 
ATOM   5693  C  C   . GLN G  1 36  ? -68.323 1.768   3.955   1.00 36.69 ? 36   GLN G C   1 
ATOM   5694  O  O   . GLN G  1 36  ? -69.337 2.407   3.654   1.00 37.48 ? 36   GLN G O   1 
ATOM   5695  C  CB  . GLN G  1 36  ? -67.951 -0.041  2.189   1.00 34.69 ? 36   GLN G CB  1 
ATOM   5696  C  CG  . GLN G  1 36  ? -68.075 -1.529  1.902   1.00 34.54 ? 36   GLN G CG  1 
ATOM   5697  C  CD  . GLN G  1 36  ? -67.638 -1.931  0.508   1.00 33.62 ? 36   GLN G CD  1 
ATOM   5698  O  OE1 . GLN G  1 36  ? -68.416 -1.901  -0.426  1.00 34.62 ? 36   GLN G OE1 1 
ATOM   5699  N  NE2 . GLN G  1 36  ? -66.398 -2.347  0.375   1.00 33.14 ? 36   GLN G NE2 1 
ATOM   5700  N  N   . GLU G  1 37  ? -67.280 2.300   4.595   1.00 35.89 ? 37   GLU G N   1 
ATOM   5701  C  CA  . GLU G  1 37  ? -67.310 3.657   5.159   1.00 37.23 ? 37   GLU G CA  1 
ATOM   5702  C  C   . GLU G  1 37  ? -66.560 4.705   4.352   1.00 35.84 ? 37   GLU G C   1 
ATOM   5703  O  O   . GLU G  1 37  ? -66.901 5.876   4.425   1.00 36.84 ? 37   GLU G O   1 
ATOM   5704  C  CB  . GLU G  1 37  ? -66.713 3.677   6.573   1.00 38.43 ? 37   GLU G CB  1 
ATOM   5705  C  CG  . GLU G  1 37  ? -67.499 2.897   7.614   1.00 40.25 ? 37   GLU G CG  1 
ATOM   5706  C  CD  . GLU G  1 37  ? -67.047 1.453   7.733   1.00 39.82 ? 37   GLU G CD  1 
ATOM   5707  O  OE1 . GLU G  1 37  ? -65.816 1.221   7.840   1.00 39.12 ? 37   GLU G OE1 1 
ATOM   5708  O  OE2 . GLU G  1 37  ? -67.926 0.555   7.729   1.00 40.97 ? 37   GLU G OE2 1 
ATOM   5709  N  N   . LYS G  1 38  ? -65.522 4.307   3.620   1.00 33.41 ? 38   LYS G N   1 
ATOM   5710  C  CA  . LYS G  1 38  ? -64.654 5.279   2.970   1.00 32.51 ? 38   LYS G CA  1 
ATOM   5711  C  C   . LYS G  1 38  ? -64.182 4.812   1.615   1.00 30.54 ? 38   LYS G C   1 
ATOM   5712  O  O   . LYS G  1 38  ? -64.011 3.615   1.400   1.00 28.99 ? 38   LYS G O   1 
ATOM   5713  C  CB  . LYS G  1 38  ? -63.436 5.567   3.849   1.00 32.39 ? 38   LYS G CB  1 
ATOM   5714  C  CG  . LYS G  1 38  ? -62.692 6.830   3.445   1.00 32.87 ? 38   LYS G CG  1 
ATOM   5715  C  CD  . LYS G  1 38  ? -61.649 7.204   4.486   1.00 33.24 ? 38   LYS G CD  1 
ATOM   5716  C  CE  . LYS G  1 38  ? -61.075 8.596   4.241   1.00 34.40 ? 38   LYS G CE  1 
ATOM   5717  N  NZ  . LYS G  1 38  ? -60.165 8.625   3.060   1.00 33.64 ? 38   LYS G NZ  1 
ATOM   5718  N  N   . LYS G  1 39  ? -63.975 5.771   0.712   1.00 30.27 ? 39   LYS G N   1 
ATOM   5719  C  CA  . LYS G  1 39  ? -63.413 5.485   -0.594  1.00 28.99 ? 39   LYS G CA  1 
ATOM   5720  C  C   . LYS G  1 39  ? -62.010 6.076   -0.710  1.00 27.78 ? 39   LYS G C   1 
ATOM   5721  O  O   . LYS G  1 39  ? -61.702 7.099   -0.088  1.00 28.73 ? 39   LYS G O   1 
ATOM   5722  C  CB  . LYS G  1 39  ? -64.309 5.995   -1.731  1.00 30.35 ? 39   LYS G CB  1 
ATOM   5723  C  CG  . LYS G  1 39  ? -64.126 7.462   -2.103  1.00 31.71 ? 39   LYS G CG  1 
ATOM   5724  C  CD  . LYS G  1 39  ? -64.828 7.799   -3.411  1.00 33.16 ? 39   LYS G CD  1 
ATOM   5725  C  CE  . LYS G  1 39  ? -64.816 9.304   -3.685  1.00 35.15 ? 39   LYS G CE  1 
ATOM   5726  N  NZ  . LYS G  1 39  ? -65.147 9.639   -5.110  1.00 35.96 ? 39   LYS G NZ  1 
ATOM   5727  N  N   . VAL G  1 40  ? -61.176 5.407   -1.504  1.00 25.85 ? 40   VAL G N   1 
ATOM   5728  C  CA  . VAL G  1 40  ? -59.834 5.855   -1.836  1.00 24.90 ? 40   VAL G CA  1 
ATOM   5729  C  C   . VAL G  1 40  ? -59.645 5.679   -3.339  1.00 24.21 ? 40   VAL G C   1 
ATOM   5730  O  O   . VAL G  1 40  ? -59.933 4.617   -3.879  1.00 23.36 ? 40   VAL G O   1 
ATOM   5731  C  CB  . VAL G  1 40  ? -58.762 5.022   -1.096  1.00 23.76 ? 40   VAL G CB  1 
ATOM   5732  C  CG1 . VAL G  1 40  ? -57.360 5.418   -1.550  1.00 23.20 ? 40   VAL G CG1 1 
ATOM   5733  C  CG2 . VAL G  1 40  ? -58.898 5.158   0.421   1.00 24.31 ? 40   VAL G CG2 1 
ATOM   5734  N  N   . VAL G  1 41  ? -59.161 6.724   -4.004  1.00 24.66 ? 41   VAL G N   1 
ATOM   5735  C  CA  . VAL G  1 41  ? -58.873 6.681   -5.433  1.00 24.40 ? 41   VAL G CA  1 
ATOM   5736  C  C   . VAL G  1 41  ? -57.376 6.438   -5.671  1.00 23.11 ? 41   VAL G C   1 
ATOM   5737  O  O   . VAL G  1 41  ? -56.537 7.125   -5.123  1.00 23.22 ? 41   VAL G O   1 
ATOM   5738  C  CB  . VAL G  1 41  ? -59.337 7.974   -6.138  1.00 26.19 ? 41   VAL G CB  1 
ATOM   5739  C  CG1 . VAL G  1 41  ? -59.191 7.851   -7.654  1.00 26.19 ? 41   VAL G CG1 1 
ATOM   5740  C  CG2 . VAL G  1 41  ? -60.785 8.276   -5.774  1.00 27.71 ? 41   VAL G CG2 1 
ATOM   5741  N  N   . VAL G  1 42  ? -57.065 5.445   -6.490  1.00 22.22 ? 42   VAL G N   1 
ATOM   5742  C  CA  . VAL G  1 42  ? -55.694 5.050   -6.781  1.00 21.39 ? 42   VAL G CA  1 
ATOM   5743  C  C   . VAL G  1 42  ? -55.474 4.975   -8.292  1.00 21.52 ? 42   VAL G C   1 
ATOM   5744  O  O   . VAL G  1 42  ? -56.260 4.370   -8.995  1.00 21.66 ? 42   VAL G O   1 
ATOM   5745  C  CB  . VAL G  1 42  ? -55.401 3.657   -6.182  1.00 20.38 ? 42   VAL G CB  1 
ATOM   5746  C  CG1 . VAL G  1 42  ? -54.021 3.174   -6.597  1.00 19.81 ? 42   VAL G CG1 1 
ATOM   5747  C  CG2 . VAL G  1 42  ? -55.515 3.700   -4.662  1.00 20.46 ? 42   VAL G CG2 1 
ATOM   5748  N  N   . TYR G  1 43  ? -54.394 5.573   -8.780  1.00 21.85 ? 43   TYR G N   1 
ATOM   5749  C  CA  . TYR G  1 43  ? -54.069 5.559   -10.205 1.00 22.03 ? 43   TYR G CA  1 
ATOM   5750  C  C   . TYR G  1 43  ? -52.882 4.645   -10.420 1.00 20.53 ? 43   TYR G C   1 
ATOM   5751  O  O   . TYR G  1 43  ? -51.904 4.740   -9.716  1.00 20.11 ? 43   TYR G O   1 
ATOM   5752  C  CB  . TYR G  1 43  ? -53.733 6.961   -10.708 1.00 23.56 ? 43   TYR G CB  1 
ATOM   5753  C  CG  . TYR G  1 43  ? -54.788 7.984   -10.377 1.00 25.02 ? 43   TYR G CG  1 
ATOM   5754  C  CD1 . TYR G  1 43  ? -54.733 8.684   -9.182  1.00 25.45 ? 43   TYR G CD1 1 
ATOM   5755  C  CD2 . TYR G  1 43  ? -55.841 8.251   -11.245 1.00 26.09 ? 43   TYR G CD2 1 
ATOM   5756  C  CE1 . TYR G  1 43  ? -55.689 9.618   -8.855  1.00 27.01 ? 43   TYR G CE1 1 
ATOM   5757  C  CE2 . TYR G  1 43  ? -56.813 9.187   -10.920 1.00 27.60 ? 43   TYR G CE2 1 
ATOM   5758  C  CZ  . TYR G  1 43  ? -56.723 9.867   -9.718  1.00 27.96 ? 43   TYR G CZ  1 
ATOM   5759  O  OH  . TYR G  1 43  ? -57.637 10.814  -9.346  1.00 29.95 ? 43   TYR G OH  1 
ATOM   5760  N  N   . LEU G  1 44  ? -52.982 3.757   -11.394 1.00 19.92 ? 44   LEU G N   1 
ATOM   5761  C  CA  . LEU G  1 44  ? -51.925 2.826   -11.706 1.00 18.99 ? 44   LEU G CA  1 
ATOM   5762  C  C   . LEU G  1 44  ? -51.395 3.170   -13.091 1.00 19.94 ? 44   LEU G C   1 
ATOM   5763  O  O   . LEU G  1 44  ? -52.151 3.203   -14.078 1.00 20.90 ? 44   LEU G O   1 
ATOM   5764  C  CB  . LEU G  1 44  ? -52.463 1.398   -11.669 1.00 18.17 ? 44   LEU G CB  1 
ATOM   5765  C  CG  . LEU G  1 44  ? -53.152 0.963   -10.361 1.00 17.50 ? 44   LEU G CG  1 
ATOM   5766  C  CD1 . LEU G  1 44  ? -53.528 -0.509  -10.398 1.00 16.94 ? 44   LEU G CD1 1 
ATOM   5767  C  CD2 . LEU G  1 44  ? -52.257 1.237   -9.166  1.00 17.01 ? 44   LEU G CD2 1 
ATOM   5768  N  N   . GLN G  1 45  ? -50.100 3.453   -13.163 1.00 20.00 ? 45   GLN G N   1 
ATOM   5769  C  CA  . GLN G  1 45  ? -49.463 3.770   -14.431 1.00 20.97 ? 45   GLN G CA  1 
ATOM   5770  C  C   . GLN G  1 45  ? -48.286 2.840   -14.642 1.00 20.18 ? 45   GLN G C   1 
ATOM   5771  O  O   . GLN G  1 45  ? -47.588 2.482   -13.695 1.00 19.12 ? 45   GLN G O   1 
ATOM   5772  C  CB  . GLN G  1 45  ? -49.010 5.226   -14.468 1.00 22.33 ? 45   GLN G CB  1 
ATOM   5773  C  CG  . GLN G  1 45  ? -50.133 6.219   -14.258 1.00 23.43 ? 45   GLN G CG  1 
ATOM   5774  C  CD  . GLN G  1 45  ? -49.678 7.666   -14.344 1.00 25.23 ? 45   GLN G CD  1 
ATOM   5775  O  OE1 . GLN G  1 45  ? -48.502 7.974   -14.185 1.00 25.19 ? 45   GLN G OE1 1 
ATOM   5776  N  NE2 . GLN G  1 45  ? -50.620 8.562   -14.596 1.00 26.71 ? 45   GLN G NE2 1 
ATOM   5777  N  N   . LYS G  1 46  ? -48.075 2.453   -15.893 1.00 20.80 ? 46   LYS G N   1 
ATOM   5778  C  CA  . LYS G  1 46  ? -46.962 1.587   -16.249 1.00 20.60 ? 46   LYS G CA  1 
ATOM   5779  C  C   . LYS G  1 46  ? -45.643 2.298   -15.959 1.00 20.77 ? 46   LYS G C   1 
ATOM   5780  O  O   . LYS G  1 46  ? -45.587 3.519   -16.046 1.00 21.35 ? 46   LYS G O   1 
ATOM   5781  C  CB  . LYS G  1 46  ? -47.048 1.162   -17.718 1.00 21.67 ? 46   LYS G CB  1 
ATOM   5782  C  CG  . LYS G  1 46  ? -47.098 2.290   -18.743 1.00 23.32 ? 46   LYS G CG  1 
ATOM   5783  C  CD  . LYS G  1 46  ? -45.706 2.708   -19.163 1.00 24.23 ? 46   LYS G CD  1 
ATOM   5784  C  CE  . LYS G  1 46  ? -45.728 3.637   -20.349 1.00 26.22 ? 46   LYS G CE  1 
ATOM   5785  N  NZ  . LYS G  1 46  ? -44.306 3.913   -20.714 1.00 27.33 ? 46   LYS G NZ  1 
ATOM   5786  N  N   . LEU G  1 47  ? -44.594 1.555   -15.600 1.00 20.26 ? 47   LEU G N   1 
ATOM   5787  C  CA  . LEU G  1 47  ? -44.624 0.092   -15.494 1.00 19.56 ? 47   LEU G CA  1 
ATOM   5788  C  C   . LEU G  1 47  ? -45.121 -0.433  -14.148 1.00 18.57 ? 47   LEU G C   1 
ATOM   5789  O  O   . LEU G  1 47  ? -45.734 -1.506  -14.080 1.00 18.15 ? 47   LEU G O   1 
ATOM   5790  C  CB  . LEU G  1 47  ? -43.238 -0.470  -15.740 1.00 19.85 ? 47   LEU G CB  1 
ATOM   5791  C  CG  . LEU G  1 47  ? -42.761 -0.341  -17.187 1.00 21.13 ? 47   LEU G CG  1 
ATOM   5792  C  CD1 . LEU G  1 47  ? -41.253 -0.469  -17.214 1.00 21.64 ? 47   LEU G CD1 1 
ATOM   5793  C  CD2 . LEU G  1 47  ? -43.403 -1.391  -18.070 1.00 21.31 ? 47   LEU G CD2 1 
ATOM   5794  N  N   . ASP G  1 48  ? -44.836 0.293   -13.073 1.00 18.35 ? 48   ASP G N   1 
ATOM   5795  C  CA  . ASP G  1 48  ? -45.197 -0.173  -11.742 1.00 17.53 ? 48   ASP G CA  1 
ATOM   5796  C  C   . ASP G  1 48  ? -45.488 0.950   -10.759 1.00 17.44 ? 48   ASP G C   1 
ATOM   5797  O  O   . ASP G  1 48  ? -45.289 0.761   -9.573  1.00 16.92 ? 48   ASP G O   1 
ATOM   5798  C  CB  . ASP G  1 48  ? -44.081 -1.072  -11.183 1.00 17.42 ? 48   ASP G CB  1 
ATOM   5799  C  CG  . ASP G  1 48  ? -42.854 -0.274  -10.665 1.00 18.18 ? 48   ASP G CG  1 
ATOM   5800  O  OD1 . ASP G  1 48  ? -42.450 0.751   -11.274 1.00 19.20 ? 48   ASP G OD1 1 
ATOM   5801  O  OD2 . ASP G  1 48  ? -42.278 -0.691  -9.632  1.00 18.77 ? 48   ASP G OD2 1 
ATOM   5802  N  N   . THR G  1 49  ? -45.940 2.101   -11.253 1.00 18.17 ? 49   THR G N   1 
ATOM   5803  C  CA  . THR G  1 49  ? -46.187 3.287   -10.418 1.00 18.70 ? 49   THR G CA  1 
ATOM   5804  C  C   . THR G  1 49  ? -47.641 3.357   -9.945  1.00 18.77 ? 49   THR G C   1 
ATOM   5805  O  O   . THR G  1 49  ? -48.577 3.220   -10.733 1.00 19.01 ? 49   THR G O   1 
ATOM   5806  C  CB  . THR G  1 49  ? -45.875 4.601   -11.187 1.00 19.80 ? 49   THR G CB  1 
ATOM   5807  O  OG1 . THR G  1 49  ? -44.489 4.655   -11.522 1.00 20.09 ? 49   THR G OG1 1 
ATOM   5808  C  CG2 . THR G  1 49  ? -46.226 5.831   -10.351 1.00 20.38 ? 49   THR G CG2 1 
ATOM   5809  N  N   . ALA G  1 50  ? -47.815 3.583   -8.650  1.00 19.23 ? 50   ALA G N   1 
ATOM   5810  C  CA  . ALA G  1 50  ? -49.129 3.811   -8.054  1.00 19.84 ? 50   ALA G CA  1 
ATOM   5811  C  C   . ALA G  1 50  ? -49.138 5.217   -7.489  1.00 21.51 ? 50   ALA G C   1 
ATOM   5812  O  O   . ALA G  1 50  ? -48.162 5.613   -6.846  1.00 21.73 ? 50   ALA G O   1 
ATOM   5813  C  CB  . ALA G  1 50  ? -49.370 2.815   -6.936  1.00 18.99 ? 50   ALA G CB  1 
ATOM   5814  N  N   . TYR G  1 51  ? -50.205 5.979   -7.722  1.00 23.32 ? 51   TYR G N   1 
ATOM   5815  C  CA  . TYR G  1 51  ? -50.363 7.251   -7.005  1.00 25.63 ? 51   TYR G CA  1 
ATOM   5816  C  C   . TYR G  1 51  ? -51.818 7.605   -6.621  1.00 26.87 ? 51   TYR G C   1 
ATOM   5817  O  O   . TYR G  1 51  ? -52.770 7.016   -7.136  1.00 25.84 ? 51   TYR G O   1 
ATOM   5818  C  CB  . TYR G  1 51  ? -49.614 8.401   -7.720  1.00 27.22 ? 51   TYR G CB  1 
ATOM   5819  C  CG  . TYR G  1 51  ? -50.314 9.025   -8.903  1.00 28.95 ? 51   TYR G CG  1 
ATOM   5820  C  CD1 . TYR G  1 51  ? -50.278 8.432   -10.153 1.00 28.96 ? 51   TYR G CD1 1 
ATOM   5821  C  CD2 . TYR G  1 51  ? -50.998 10.232  -8.774  1.00 31.22 ? 51   TYR G CD2 1 
ATOM   5822  C  CE1 . TYR G  1 51  ? -50.923 9.012   -11.242 1.00 30.83 ? 51   TYR G CE1 1 
ATOM   5823  C  CE2 . TYR G  1 51  ? -51.636 10.824  -9.853  1.00 32.88 ? 51   TYR G CE2 1 
ATOM   5824  C  CZ  . TYR G  1 51  ? -51.605 10.208  -11.090 1.00 33.19 ? 51   TYR G CZ  1 
ATOM   5825  O  OH  . TYR G  1 51  ? -52.249 10.801  -12.172 1.00 36.40 ? 51   TYR G OH  1 
ATOM   5826  N  N   . ASP G  1 52  ? -51.949 8.523   -5.658  1.00 29.51 ? 52   ASP G N   1 
ATOM   5827  C  CA  . ASP G  1 52  ? -53.236 8.977   -5.128  1.00 31.50 ? 52   ASP G CA  1 
ATOM   5828  C  C   . ASP G  1 52  ? -53.455 10.464  -5.384  1.00 34.50 ? 52   ASP G C   1 
ATOM   5829  O  O   . ASP G  1 52  ? -52.581 11.134  -5.928  1.00 35.20 ? 52   ASP G O   1 
ATOM   5830  C  CB  . ASP G  1 52  ? -53.343 8.655   -3.638  1.00 32.26 ? 52   ASP G CB  1 
ATOM   5831  C  CG  . ASP G  1 52  ? -52.410 9.497   -2.761  1.00 33.43 ? 52   ASP G CG  1 
ATOM   5832  O  OD1 . ASP G  1 52  ? -51.588 10.313  -3.264  1.00 35.66 ? 52   ASP G OD1 1 
ATOM   5833  O  OD2 . ASP G  1 52  ? -52.508 9.326   -1.527  1.00 35.28 ? 52   ASP G OD2 1 
ATOM   5834  N  N   . ASP G  1 53  ? -54.624 10.979  -5.002  1.00 37.62 ? 53   ASP G N   1 
ATOM   5835  C  CA  . ASP G  1 53  ? -55.002 12.368  -5.332  1.00 40.56 ? 53   ASP G CA  1 
ATOM   5836  C  C   . ASP G  1 53  ? -54.065 13.428  -4.738  1.00 41.35 ? 53   ASP G C   1 
ATOM   5837  O  O   . ASP G  1 53  ? -53.884 14.496  -5.323  1.00 42.88 ? 53   ASP G O   1 
ATOM   5838  C  CB  . ASP G  1 53  ? -56.464 12.655  -4.932  1.00 42.38 ? 53   ASP G CB  1 
ATOM   5839  C  CG  . ASP G  1 53  ? -57.475 12.042  -5.905  1.00 43.47 ? 53   ASP G CG  1 
ATOM   5840  O  OD1 . ASP G  1 53  ? -57.225 12.034  -7.133  1.00 41.00 ? 53   ASP G OD1 1 
ATOM   5841  O  OD2 . ASP G  1 53  ? -58.541 11.577  -5.443  1.00 48.45 ? 53   ASP G OD2 1 
ATOM   5842  N  N   . LEU G  1 54  ? -53.457 13.134  -3.590  1.00 40.88 ? 54   LEU G N   1 
ATOM   5843  C  CA  . LEU G  1 54  ? -52.430 14.020  -3.028  1.00 41.36 ? 54   LEU G CA  1 
ATOM   5844  C  C   . LEU G  1 54  ? -51.120 13.967  -3.806  1.00 41.35 ? 54   LEU G C   1 
ATOM   5845  O  O   . LEU G  1 54  ? -50.286 14.872  -3.695  1.00 43.47 ? 54   LEU G O   1 
ATOM   5846  C  CB  . LEU G  1 54  ? -52.166 13.679  -1.566  1.00 40.44 ? 54   LEU G CB  1 
ATOM   5847  C  CG  . LEU G  1 54  ? -53.345 13.974  -0.646  1.00 41.49 ? 54   LEU G CG  1 
ATOM   5848  C  CD1 . LEU G  1 54  ? -52.986 13.550  0.767   1.00 40.74 ? 54   LEU G CD1 1 
ATOM   5849  C  CD2 . LEU G  1 54  ? -53.718 15.457  -0.688  1.00 43.81 ? 54   LEU G CD2 1 
ATOM   5850  N  N   . GLY G  1 55  ? -50.935 12.913  -4.591  1.00 39.52 ? 55   GLY G N   1 
ATOM   5851  C  CA  . GLY G  1 55  ? -49.724 12.767  -5.383  1.00 39.57 ? 55   GLY G CA  1 
ATOM   5852  C  C   . GLY G  1 55  ? -48.635 12.191  -4.506  1.00 38.29 ? 55   GLY G C   1 
ATOM   5853  O  O   . GLY G  1 55  ? -47.479 12.584  -4.623  1.00 38.08 ? 55   GLY G O   1 
ATOM   5854  N  N   . ASN G  1 56  ? -49.037 11.301  -3.595  1.00 36.18 ? 56   ASN G N   1 
ATOM   5855  C  CA  . ASN G  1 56  ? -48.123 10.360  -2.952  1.00 34.25 ? 56   ASN G CA  1 
ATOM   5856  C  C   . ASN G  1 56  ? -47.953 9.188   -3.900  1.00 31.72 ? 56   ASN G C   1 
ATOM   5857  O  O   . ASN G  1 56  ? -48.937 8.729   -4.492  1.00 30.34 ? 56   ASN G O   1 
ATOM   5858  C  CB  . ASN G  1 56  ? -48.708 9.841   -1.650  1.00 33.73 ? 56   ASN G CB  1 
ATOM   5859  C  CG  . ASN G  1 56  ? -49.026 10.948  -0.675  1.00 35.91 ? 56   ASN G CG  1 
ATOM   5860  O  OD1 . ASN G  1 56  ? -48.162 11.751  -0.321  1.00 37.09 ? 56   ASN G OD1 1 
ATOM   5861  N  ND2 . ASN G  1 56  ? -50.280 10.997  -0.228  1.00 37.22 ? 56   ASN G ND2 1 
ATOM   5862  N  N   . SER G  1 57  ? -46.722 8.719   -4.073  1.00 29.30 ? 57   SER G N   1 
ATOM   5863  C  CA  . SER G  1 57  ? -46.465 7.668   -5.040  1.00 27.21 ? 57   SER G CA  1 
ATOM   5864  C  C   . SER G  1 57  ? -46.041 6.357   -4.379  1.00 24.88 ? 57   SER G C   1 
ATOM   5865  O  O   . SER G  1 57  ? -45.616 6.311   -3.224  1.00 24.82 ? 57   SER G O   1 
ATOM   5866  C  CB  . SER G  1 57  ? -45.455 8.123   -6.095  1.00 28.02 ? 57   SER G CB  1 
ATOM   5867  O  OG  . SER G  1 57  ? -44.189 8.377   -5.528  1.00 29.37 ? 57   SER G OG  1 
ATOM   5868  N  N   . GLY G  1 58  ? -46.207 5.277   -5.122  1.00 22.34 ? 58   GLY G N   1 
ATOM   5869  C  CA  . GLY G  1 58  ? -45.831 3.981   -4.641  1.00 20.39 ? 58   GLY G CA  1 
ATOM   5870  C  C   . GLY G  1 58  ? -45.760 3.028   -5.793  1.00 18.79 ? 58   GLY G C   1 
ATOM   5871  O  O   . GLY G  1 58  ? -45.540 3.427   -6.932  1.00 18.63 ? 58   GLY G O   1 
ATOM   5872  N  N   . HIS G  1 59  ? -45.959 1.753   -5.497  1.00 17.47 ? 59   HIS G N   1 
ATOM   5873  C  CA  . HIS G  1 59  ? -45.699 0.718   -6.479  1.00 16.60 ? 59   HIS G CA  1 
ATOM   5874  C  C   . HIS G  1 59  ? -46.816 -0.279  -6.531  1.00 15.23 ? 59   HIS G C   1 
ATOM   5875  O  O   . HIS G  1 59  ? -47.608 -0.383  -5.602  1.00 14.87 ? 59   HIS G O   1 
ATOM   5876  C  CB  . HIS G  1 59  ? -44.354 0.068   -6.184  1.00 16.97 ? 59   HIS G CB  1 
ATOM   5877  C  CG  . HIS G  1 59  ? -43.219 1.041   -6.235  1.00 18.18 ? 59   HIS G CG  1 
ATOM   5878  N  ND1 . HIS G  1 59  ? -42.618 1.549   -5.101  1.00 18.65 ? 59   HIS G ND1 1 
ATOM   5879  C  CD2 . HIS G  1 59  ? -42.618 1.655   -7.283  1.00 19.36 ? 59   HIS G CD2 1 
ATOM   5880  C  CE1 . HIS G  1 59  ? -41.672 2.403   -5.448  1.00 19.44 ? 59   HIS G CE1 1 
ATOM   5881  N  NE2 . HIS G  1 59  ? -41.656 2.491   -6.767  1.00 19.92 ? 59   HIS G NE2 1 
ATOM   5882  N  N   . PHE G  1 60  ? -46.900 -0.981  -7.651  1.00 14.50 ? 60   PHE G N   1 
ATOM   5883  C  CA  . PHE G  1 60  ? -47.879 -2.040  -7.820  1.00 13.86 ? 60   PHE G CA  1 
ATOM   5884  C  C   . PHE G  1 60  ? -47.326 -3.151  -8.695  1.00 13.62 ? 60   PHE G C   1 
ATOM   5885  O  O   . PHE G  1 60  ? -46.382 -2.970  -9.469  1.00 13.93 ? 60   PHE G O   1 
ATOM   5886  C  CB  . PHE G  1 60  ? -49.204 -1.506  -8.399  1.00 14.06 ? 60   PHE G CB  1 
ATOM   5887  C  CG  . PHE G  1 60  ? -49.184 -1.320  -9.888  1.00 14.57 ? 60   PHE G CG  1 
ATOM   5888  C  CD1 . PHE G  1 60  ? -49.540 -2.364  -10.741 1.00 14.67 ? 60   PHE G CD1 1 
ATOM   5889  C  CD2 . PHE G  1 60  ? -48.787 -0.114  -10.445 1.00 15.16 ? 60   PHE G CD2 1 
ATOM   5890  C  CE1 . PHE G  1 60  ? -49.501 -2.209  -12.121 1.00 15.27 ? 60   PHE G CE1 1 
ATOM   5891  C  CE2 . PHE G  1 60  ? -48.746 0.050   -11.819 1.00 15.86 ? 60   PHE G CE2 1 
ATOM   5892  C  CZ  . PHE G  1 60  ? -49.113 -0.998  -12.660 1.00 15.88 ? 60   PHE G CZ  1 
ATOM   5893  N  N   . THR G  1 61  ? -47.927 -4.316  -8.550  1.00 13.12 ? 61   THR G N   1 
ATOM   5894  C  CA  . THR G  1 61  ? -47.682 -5.395  -9.467  1.00 13.25 ? 61   THR G CA  1 
ATOM   5895  C  C   . THR G  1 61  ? -48.980 -6.155  -9.707  1.00 13.23 ? 61   THR G C   1 
ATOM   5896  O  O   . THR G  1 61  ? -49.843 -6.225  -8.823  1.00 12.99 ? 61   THR G O   1 
ATOM   5897  C  CB  . THR G  1 61  ? -46.584 -6.335  -8.935  1.00 13.23 ? 61   THR G CB  1 
ATOM   5898  O  OG1 . THR G  1 61  ? -46.217 -7.278  -9.956  1.00 13.70 ? 61   THR G OG1 1 
ATOM   5899  C  CG2 . THR G  1 61  ? -47.052 -7.077  -7.668  1.00 13.04 ? 61   THR G CG2 1 
ATOM   5900  N  N   . ILE G  1 62  ? -49.131 -6.689  -10.916 1.00 13.56 ? 62   ILE G N   1 
ATOM   5901  C  CA  . ILE G  1 62  ? -50.131 -7.719  -11.149 1.00 13.78 ? 62   ILE G CA  1 
ATOM   5902  C  C   . ILE G  1 62  ? -49.515 -9.031  -10.670 1.00 13.86 ? 62   ILE G C   1 
ATOM   5903  O  O   . ILE G  1 62  ? -48.304 -9.196  -10.687 1.00 13.93 ? 62   ILE G O   1 
ATOM   5904  C  CB  . ILE G  1 62  ? -50.601 -7.803  -12.620 1.00 14.44 ? 62   ILE G CB  1 
ATOM   5905  C  CG1 . ILE G  1 62  ? -51.887 -8.646  -12.718 1.00 14.77 ? 62   ILE G CG1 1 
ATOM   5906  C  CG2 . ILE G  1 62  ? -49.523 -8.383  -13.532 1.00 14.94 ? 62   ILE G CG2 1 
ATOM   5907  C  CD1 . ILE G  1 62  ? -52.574 -8.566  -14.065 1.00 15.50 ? 62   ILE G CD1 1 
ATOM   5908  N  N   . ILE G  1 63  ? -50.359 -9.917  -10.173 1.00 14.03 ? 63   ILE G N   1 
ATOM   5909  C  CA  . ILE G  1 63  ? -49.943 -11.217 -9.705  1.00 14.46 ? 63   ILE G CA  1 
ATOM   5910  C  C   . ILE G  1 63  ? -50.495 -12.175 -10.724 1.00 15.34 ? 63   ILE G C   1 
ATOM   5911  O  O   . ILE G  1 63  ? -51.666 -12.467 -10.706 1.00 15.67 ? 63   ILE G O   1 
ATOM   5912  C  CB  . ILE G  1 63  ? -50.521 -11.485 -8.304  1.00 14.30 ? 63   ILE G CB  1 
ATOM   5913  C  CG1 . ILE G  1 63  ? -49.988 -10.447 -7.328  1.00 13.66 ? 63   ILE G CG1 1 
ATOM   5914  C  CG2 . ILE G  1 63  ? -50.206 -12.891 -7.820  1.00 14.92 ? 63   ILE G CG2 1 
ATOM   5915  C  CD1 . ILE G  1 63  ? -50.918 -10.221 -6.158  1.00 13.64 ? 63   ILE G CD1 1 
ATOM   5916  N  N   . TYR G  1 64  ? -49.648 -12.607 -11.644 1.00 16.02 ? 64   TYR G N   1 
ATOM   5917  C  CA  . TYR G  1 64  ? -50.034 -13.443 -12.781 1.00 17.18 ? 64   TYR G CA  1 
ATOM   5918  C  C   . TYR G  1 64  ? -51.238 -12.840 -13.553 1.00 17.48 ? 64   TYR G C   1 
ATOM   5919  O  O   . TYR G  1 64  ? -51.094 -11.791 -14.181 1.00 17.27 ? 64   TYR G O   1 
ATOM   5920  C  CB  . TYR G  1 64  ? -50.242 -14.883 -12.304 1.00 17.99 ? 64   TYR G CB  1 
ATOM   5921  C  CG  . TYR G  1 64  ? -50.346 -15.934 -13.393 1.00 19.29 ? 64   TYR G CG  1 
ATOM   5922  C  CD1 . TYR G  1 64  ? -49.350 -16.088 -14.343 1.00 19.81 ? 64   TYR G CD1 1 
ATOM   5923  C  CD2 . TYR G  1 64  ? -51.431 -16.812 -13.436 1.00 20.16 ? 64   TYR G CD2 1 
ATOM   5924  C  CE1 . TYR G  1 64  ? -49.449 -17.069 -15.327 1.00 21.19 ? 64   TYR G CE1 1 
ATOM   5925  C  CE2 . TYR G  1 64  ? -51.534 -17.793 -14.402 1.00 21.34 ? 64   TYR G CE2 1 
ATOM   5926  C  CZ  . TYR G  1 64  ? -50.553 -17.921 -15.352 1.00 21.98 ? 64   TYR G CZ  1 
ATOM   5927  O  OH  . TYR G  1 64  ? -50.664 -18.900 -16.313 1.00 23.35 ? 64   TYR G OH  1 
ATOM   5928  N  N   . ASN G  1 65  ? -52.399 -13.497 -13.516 1.00 18.33 ? 65   ASN G N   1 
ATOM   5929  C  CA  . ASN G  1 65  ? -53.618 -12.993 -14.147 1.00 18.84 ? 65   ASN G CA  1 
ATOM   5930  C  C   . ASN G  1 65  ? -54.758 -12.901 -13.140 1.00 18.65 ? 65   ASN G C   1 
ATOM   5931  O  O   . ASN G  1 65  ? -55.901 -12.731 -13.521 1.00 19.08 ? 65   ASN G O   1 
ATOM   5932  C  CB  . ASN G  1 65  ? -54.013 -13.902 -15.307 1.00 20.20 ? 65   ASN G CB  1 
ATOM   5933  C  CG  . ASN G  1 65  ? -54.305 -15.337 -14.864 1.00 21.13 ? 65   ASN G CG  1 
ATOM   5934  O  OD1 . ASN G  1 65  ? -54.383 -15.632 -13.669 1.00 20.69 ? 65   ASN G OD1 1 
ATOM   5935  N  ND2 . ASN G  1 65  ? -54.471 -16.233 -15.830 1.00 22.19 ? 65   ASN G ND2 1 
ATOM   5936  N  N   . GLN G  1 66  ? -54.418 -12.976 -11.853 1.00 18.16 ? 66   GLN G N   1 
ATOM   5937  C  CA  . GLN G  1 66  ? -55.376 -13.246 -10.780 1.00 18.37 ? 66   GLN G CA  1 
ATOM   5938  C  C   . GLN G  1 66  ? -55.800 -12.018 -10.018 1.00 17.72 ? 66   GLN G C   1 
ATOM   5939  O  O   . GLN G  1 66  ? -56.963 -11.862 -9.673  1.00 18.37 ? 66   GLN G O   1 
ATOM   5940  C  CB  . GLN G  1 66  ? -54.731 -14.171 -9.757  1.00 18.56 ? 66   GLN G CB  1 
ATOM   5941  C  CG  . GLN G  1 66  ? -54.315 -15.513 -10.295 1.00 19.59 ? 66   GLN G CG  1 
ATOM   5942  C  CD  . GLN G  1 66  ? -55.492 -16.441 -10.355 1.00 20.86 ? 66   GLN G CD  1 
ATOM   5943  O  OE1 . GLN G  1 66  ? -55.905 -16.986 -9.330  1.00 21.87 ? 66   GLN G OE1 1 
ATOM   5944  N  NE2 . GLN G  1 66  ? -56.060 -16.610 -11.543 1.00 21.37 ? 66   GLN G NE2 1 
ATOM   5945  N  N   . GLY G  1 67  ? -54.830 -11.174 -9.702  1.00 16.75 ? 67   GLY G N   1 
ATOM   5946  C  CA  . GLY G  1 67  ? -55.056 -10.032 -8.827  1.00 16.05 ? 67   GLY G CA  1 
ATOM   5947  C  C   . GLY G  1 67  ? -53.910 -9.045  -8.903  1.00 15.14 ? 67   GLY G C   1 
ATOM   5948  O  O   . GLY G  1 67  ? -53.159 -9.043  -9.878  1.00 14.92 ? 67   GLY G O   1 
ATOM   5949  N  N   . PHE G  1 68  ? -53.791 -8.210  -7.872  1.00 14.62 ? 68   PHE G N   1 
ATOM   5950  C  CA  . PHE G  1 68  ? -52.783 -7.141  -7.825  1.00 14.14 ? 68   PHE G CA  1 
ATOM   5951  C  C   . PHE G  1 68  ? -52.357 -6.897  -6.378  1.00 13.88 ? 68   PHE G C   1 
ATOM   5952  O  O   . PHE G  1 68  ? -53.096 -7.198  -5.446  1.00 14.15 ? 68   PHE G O   1 
ATOM   5953  C  CB  . PHE G  1 68  ? -53.338 -5.835  -8.450  1.00 14.24 ? 68   PHE G CB  1 
ATOM   5954  C  CG  . PHE G  1 68  ? -54.558 -5.294  -7.750  1.00 14.55 ? 68   PHE G CG  1 
ATOM   5955  C  CD1 . PHE G  1 68  ? -54.474 -4.771  -6.458  1.00 14.50 ? 68   PHE G CD1 1 
ATOM   5956  C  CD2 . PHE G  1 68  ? -55.798 -5.331  -8.362  1.00 15.24 ? 68   PHE G CD2 1 
ATOM   5957  C  CE1 . PHE G  1 68  ? -55.604 -4.300  -5.796  1.00 14.99 ? 68   PHE G CE1 1 
ATOM   5958  C  CE2 . PHE G  1 68  ? -56.929 -4.861  -7.718  1.00 15.67 ? 68   PHE G CE2 1 
ATOM   5959  C  CZ  . PHE G  1 68  ? -56.841 -4.351  -6.432  1.00 15.53 ? 68   PHE G CZ  1 
ATOM   5960  N  N   . GLU G  1 69  ? -51.159 -6.372  -6.182  1.00 13.62 ? 69   GLU G N   1 
ATOM   5961  C  CA  . GLU G  1 69  ? -50.788 -5.791  -4.903  1.00 13.48 ? 69   GLU G CA  1 
ATOM   5962  C  C   . GLU G  1 69  ? -50.303 -4.373  -5.142  1.00 13.49 ? 69   GLU G C   1 
ATOM   5963  O  O   . GLU G  1 69  ? -49.537 -4.111  -6.069  1.00 13.36 ? 69   GLU G O   1 
ATOM   5964  C  CB  . GLU G  1 69  ? -49.722 -6.594  -4.155  1.00 13.49 ? 69   GLU G CB  1 
ATOM   5965  C  CG  . GLU G  1 69  ? -49.569 -6.091  -2.716  1.00 13.63 ? 69   GLU G CG  1 
ATOM   5966  C  CD  . GLU G  1 69  ? -48.500 -6.812  -1.893  1.00 13.90 ? 69   GLU G CD  1 
ATOM   5967  O  OE1 . GLU G  1 69  ? -47.309 -6.880  -2.339  1.00 13.71 ? 69   GLU G OE1 1 
ATOM   5968  O  OE2 . GLU G  1 69  ? -48.855 -7.272  -0.775  1.00 14.19 ? 69   GLU G OE2 1 
ATOM   5969  N  N   . ILE G  1 70  ? -50.781 -3.463  -4.304  1.00 13.77 ? 70   ILE G N   1 
ATOM   5970  C  CA  . ILE G  1 70  ? -50.358 -2.092  -4.327  1.00 14.11 ? 70   ILE G CA  1 
ATOM   5971  C  C   . ILE G  1 70  ? -49.789 -1.726  -2.962  1.00 14.54 ? 70   ILE G C   1 
ATOM   5972  O  O   . ILE G  1 70  ? -50.359 -2.048  -1.933  1.00 14.68 ? 70   ILE G O   1 
ATOM   5973  C  CB  . ILE G  1 70  ? -51.532 -1.161  -4.631  1.00 14.41 ? 70   ILE G CB  1 
ATOM   5974  C  CG1 . ILE G  1 70  ? -52.115 -1.462  -6.007  1.00 14.46 ? 70   ILE G CG1 1 
ATOM   5975  C  CG2 . ILE G  1 70  ? -51.062 0.289   -4.543  1.00 14.87 ? 70   ILE G CG2 1 
ATOM   5976  C  CD1 . ILE G  1 70  ? -53.486 -0.865  -6.219  1.00 15.05 ? 70   ILE G CD1 1 
ATOM   5977  N  N   . VAL G  1 71  ? -48.647 -1.060  -2.964  1.00 15.33 ? 71   VAL G N   1 
ATOM   5978  C  CA  . VAL G  1 71  ? -48.047 -0.548  -1.738  1.00 16.11 ? 71   VAL G CA  1 
ATOM   5979  C  C   . VAL G  1 71  ? -47.953 0.956   -1.920  1.00 17.21 ? 71   VAL G C   1 
ATOM   5980  O  O   . VAL G  1 71  ? -47.315 1.426   -2.853  1.00 17.14 ? 71   VAL G O   1 
ATOM   5981  C  CB  . VAL G  1 71  ? -46.671 -1.164  -1.486  1.00 16.26 ? 71   VAL G CB  1 
ATOM   5982  C  CG1 . VAL G  1 71  ? -46.096 -0.671  -0.153  1.00 17.00 ? 71   VAL G CG1 1 
ATOM   5983  C  CG2 . VAL G  1 71  ? -46.772 -2.676  -1.500  1.00 15.87 ? 71   VAL G CG2 1 
ATOM   5984  N  N   . LEU G  1 72  ? -48.634 1.692   -1.043  1.00 18.21 ? 72   LEU G N   1 
ATOM   5985  C  CA  . LEU G  1 72  ? -48.901 3.121   -1.233  1.00 19.25 ? 72   LEU G CA  1 
ATOM   5986  C  C   . LEU G  1 72  ? -49.341 3.747   0.084   1.00 19.89 ? 72   LEU G C   1 
ATOM   5987  O  O   . LEU G  1 72  ? -50.213 3.204   0.748   1.00 19.88 ? 72   LEU G O   1 
ATOM   5988  C  CB  . LEU G  1 72  ? -50.033 3.282   -2.253  1.00 19.67 ? 72   LEU G CB  1 
ATOM   5989  C  CG  . LEU G  1 72  ? -50.445 4.724   -2.569  1.00 20.73 ? 72   LEU G CG  1 
ATOM   5990  C  CD1 . LEU G  1 72  ? -49.254 5.477   -3.149  1.00 21.14 ? 72   LEU G CD1 1 
ATOM   5991  C  CD2 . LEU G  1 72  ? -51.639 4.758   -3.502  1.00 20.84 ? 72   LEU G CD2 1 
ATOM   5992  N  N   . ASN G  1 73  ? -48.745 4.882   0.450   1.00 21.03 ? 73   ASN G N   1 
ATOM   5993  C  CA  . ASN G  1 73  ? -49.020 5.574   1.733   1.00 22.10 ? 73   ASN G CA  1 
ATOM   5994  C  C   . ASN G  1 73  ? -48.986 4.672   2.967   1.00 20.90 ? 73   ASN G C   1 
ATOM   5995  O  O   . ASN G  1 73  ? -49.866 4.754   3.834   1.00 21.07 ? 73   ASN G O   1 
ATOM   5996  C  CB  . ASN G  1 73  ? -50.369 6.307   1.686   1.00 23.61 ? 73   ASN G CB  1 
ATOM   5997  C  CG  . ASN G  1 73  ? -50.372 7.455   0.701   1.00 25.69 ? 73   ASN G CG  1 
ATOM   5998  O  OD1 . ASN G  1 73  ? -49.502 8.341   0.746   1.00 28.45 ? 73   ASN G OD1 1 
ATOM   5999  N  ND2 . ASN G  1 73  ? -51.352 7.452   -0.207  1.00 26.40 ? 73   ASN G ND2 1 
ATOM   6000  N  N   . ASP G  1 74  ? -47.982 3.804   3.020   1.00 19.78 ? 74   ASP G N   1 
ATOM   6001  C  CA  . ASP G  1 74  ? -47.788 2.865   4.123   1.00 19.48 ? 74   ASP G CA  1 
ATOM   6002  C  C   . ASP G  1 74  ? -48.965 1.905   4.320   1.00 18.66 ? 74   ASP G C   1 
ATOM   6003  O  O   . ASP G  1 74  ? -49.187 1.420   5.418   1.00 18.55 ? 74   ASP G O   1 
ATOM   6004  C  CB  . ASP G  1 74  ? -47.470 3.612   5.428   1.00 20.76 ? 74   ASP G CB  1 
ATOM   6005  C  CG  . ASP G  1 74  ? -46.007 4.038   5.535   1.00 21.46 ? 74   ASP G CG  1 
ATOM   6006  O  OD1 . ASP G  1 74  ? -45.115 3.399   4.910   1.00 21.46 ? 74   ASP G OD1 1 
ATOM   6007  O  OD2 . ASP G  1 74  ? -45.746 5.014   6.290   1.00 22.82 ? 74   ASP G OD2 1 
ATOM   6008  N  N   . TYR G  1 75  ? -49.694 1.632   3.239   1.00 17.71 ? 75   TYR G N   1 
ATOM   6009  C  CA  . TYR G  1 75  ? -50.692 0.569   3.212   1.00 17.26 ? 75   TYR G CA  1 
ATOM   6010  C  C   . TYR G  1 75  ? -50.417 -0.382  2.037   1.00 16.48 ? 75   TYR G C   1 
ATOM   6011  O  O   . TYR G  1 75  ? -49.946 0.028   0.982   1.00 16.09 ? 75   TYR G O   1 
ATOM   6012  C  CB  . TYR G  1 75  ? -52.133 1.138   3.152   1.00 17.54 ? 75   TYR G CB  1 
ATOM   6013  C  CG  . TYR G  1 75  ? -52.610 1.705   4.482   1.00 18.46 ? 75   TYR G CG  1 
ATOM   6014  C  CD1 . TYR G  1 75  ? -53.228 0.897   5.429   1.00 18.86 ? 75   TYR G CD1 1 
ATOM   6015  C  CD2 . TYR G  1 75  ? -52.420 3.036   4.797   1.00 18.96 ? 75   TYR G CD2 1 
ATOM   6016  C  CE1 . TYR G  1 75  ? -53.648 1.405   6.645   1.00 19.89 ? 75   TYR G CE1 1 
ATOM   6017  C  CE2 . TYR G  1 75  ? -52.840 3.554   6.005   1.00 19.99 ? 75   TYR G CE2 1 
ATOM   6018  C  CZ  . TYR G  1 75  ? -53.449 2.737   6.933   1.00 20.46 ? 75   TYR G CZ  1 
ATOM   6019  O  OH  . TYR G  1 75  ? -53.861 3.256   8.137   1.00 21.65 ? 75   TYR G OH  1 
ATOM   6020  N  N   . LYS G  1 76  ? -50.712 -1.661  2.246   1.00 16.52 ? 76   LYS G N   1 
ATOM   6021  C  CA  . LYS G  1 76  ? -50.662 -2.652  1.195   1.00 15.83 ? 76   LYS G CA  1 
ATOM   6022  C  C   . LYS G  1 76  ? -52.088 -3.130  0.887   1.00 15.60 ? 76   LYS G C   1 
ATOM   6023  O  O   . LYS G  1 76  ? -52.801 -3.595  1.782   1.00 15.84 ? 76   LYS G O   1 
ATOM   6024  C  CB  . LYS G  1 76  ? -49.811 -3.838  1.613   1.00 16.36 ? 76   LYS G CB  1 
ATOM   6025  C  CG  . LYS G  1 76  ? -48.405 -3.513  2.069   1.00 17.16 ? 76   LYS G CG  1 
ATOM   6026  C  CD  . LYS G  1 76  ? -47.585 -4.796  2.183   1.00 18.30 ? 76   LYS G CD  1 
ATOM   6027  C  CE  . LYS G  1 76  ? -46.134 -4.528  2.520   1.00 19.74 ? 76   LYS G CE  1 
ATOM   6028  N  NZ  . LYS G  1 76  ? -45.274 -5.634  2.036   1.00 20.03 ? 76   LYS G NZ  1 
ATOM   6029  N  N   . TRP G  1 77  ? -52.471 -3.005  -0.384  1.00 14.88 ? 77   TRP G N   1 
ATOM   6030  C  CA  . TRP G  1 77  ? -53.757 -3.453  -0.886  1.00 14.97 ? 77   TRP G CA  1 
ATOM   6031  C  C   . TRP G  1 77  ? -53.566 -4.715  -1.691  1.00 14.66 ? 77   TRP G C   1 
ATOM   6032  O  O   . TRP G  1 77  ? -52.670 -4.796  -2.510  1.00 14.22 ? 77   TRP G O   1 
ATOM   6033  C  CB  . TRP G  1 77  ? -54.372 -2.412  -1.817  1.00 14.97 ? 77   TRP G CB  1 
ATOM   6034  C  CG  . TRP G  1 77  ? -54.478 -1.043  -1.233  1.00 15.35 ? 77   TRP G CG  1 
ATOM   6035  C  CD1 . TRP G  1 77  ? -53.469 -0.146  -1.073  1.00 15.23 ? 77   TRP G CD1 1 
ATOM   6036  C  CD2 . TRP G  1 77  ? -55.659 -0.410  -0.752  1.00 16.03 ? 77   TRP G CD2 1 
ATOM   6037  N  NE1 . TRP G  1 77  ? -53.948 1.010   -0.528  1.00 15.85 ? 77   TRP G NE1 1 
ATOM   6038  C  CE2 . TRP G  1 77  ? -55.291 0.878   -0.319  1.00 16.40 ? 77   TRP G CE2 1 
ATOM   6039  C  CE3 . TRP G  1 77  ? -56.997 -0.804  -0.649  1.00 16.57 ? 77   TRP G CE3 1 
ATOM   6040  C  CZ2 . TRP G  1 77  ? -56.209 1.783   0.212   1.00 17.40 ? 77   TRP G CZ2 1 
ATOM   6041  C  CZ3 . TRP G  1 77  ? -57.909 0.091   -0.133  1.00 17.47 ? 77   TRP G CZ3 1 
ATOM   6042  C  CH2 . TRP G  1 77  ? -57.512 1.372   0.298   1.00 17.88 ? 77   TRP G CH2 1 
ATOM   6043  N  N   . PHE G  1 78  ? -54.413 -5.701  -1.468  1.00 15.05 ? 78   PHE G N   1 
ATOM   6044  C  CA  . PHE G  1 78  ? -54.395 -6.880  -2.284  1.00 15.08 ? 78   PHE G CA  1 
ATOM   6045  C  C   . PHE G  1 78  ? -55.816 -7.371  -2.485  1.00 15.75 ? 78   PHE G C   1 
ATOM   6046  O  O   . PHE G  1 78  ? -56.594 -7.432  -1.531  1.00 16.41 ? 78   PHE G O   1 
ATOM   6047  C  CB  . PHE G  1 78  ? -53.546 -7.978  -1.642  1.00 15.18 ? 78   PHE G CB  1 
ATOM   6048  C  CG  . PHE G  1 78  ? -53.887 -9.336  -2.137  1.00 15.59 ? 78   PHE G CG  1 
ATOM   6049  C  CD1 . PHE G  1 78  ? -53.677 -9.664  -3.465  1.00 15.44 ? 78   PHE G CD1 1 
ATOM   6050  C  CD2 . PHE G  1 78  ? -54.471 -10.257 -1.311  1.00 16.43 ? 78   PHE G CD2 1 
ATOM   6051  C  CE1 . PHE G  1 78  ? -54.042 -10.899 -3.961  1.00 15.99 ? 78   PHE G CE1 1 
ATOM   6052  C  CE2 . PHE G  1 78  ? -54.838 -11.500 -1.796  1.00 17.08 ? 78   PHE G CE2 1 
ATOM   6053  C  CZ  . PHE G  1 78  ? -54.623 -11.823 -3.123  1.00 16.82 ? 78   PHE G CZ  1 
ATOM   6054  N  N   . ALA G  1 79  ? -56.145 -7.706  -3.732  1.00 15.86 ? 79   ALA G N   1 
ATOM   6055  C  CA  . ALA G  1 79  ? -57.401 -8.395  -4.035  1.00 16.86 ? 79   ALA G CA  1 
ATOM   6056  C  C   . ALA G  1 79  ? -57.245 -9.282  -5.248  1.00 16.94 ? 79   ALA G C   1 
ATOM   6057  O  O   . ALA G  1 79  ? -56.344 -9.080  -6.057  1.00 16.29 ? 79   ALA G O   1 
ATOM   6058  C  CB  . ALA G  1 79  ? -58.538 -7.402  -4.262  1.00 17.29 ? 79   ALA G CB  1 
ATOM   6059  N  N   . PHE G  1 80  ? -58.119 -10.284 -5.331  1.00 17.93 ? 80   PHE G N   1 
ATOM   6060  C  CA  . PHE G  1 80  ? -58.304 -11.075 -6.544  1.00 18.34 ? 80   PHE G CA  1 
ATOM   6061  C  C   . PHE G  1 80  ? -59.316 -10.378 -7.456  1.00 18.84 ? 80   PHE G C   1 
ATOM   6062  O  O   . PHE G  1 80  ? -60.268 -9.762  -6.978  1.00 19.04 ? 80   PHE G O   1 
ATOM   6063  C  CB  . PHE G  1 80  ? -58.804 -12.477 -6.199  1.00 19.17 ? 80   PHE G CB  1 
ATOM   6064  C  CG  . PHE G  1 80  ? -57.763 -13.357 -5.585  1.00 19.02 ? 80   PHE G CG  1 
ATOM   6065  C  CD1 . PHE G  1 80  ? -56.627 -13.700 -6.301  1.00 18.61 ? 80   PHE G CD1 1 
ATOM   6066  C  CD2 . PHE G  1 80  ? -57.932 -13.870 -4.309  1.00 19.49 ? 80   PHE G CD2 1 
ATOM   6067  C  CE1 . PHE G  1 80  ? -55.669 -14.521 -5.749  1.00 18.74 ? 80   PHE G CE1 1 
ATOM   6068  C  CE2 . PHE G  1 80  ? -56.983 -14.693 -3.748  1.00 19.64 ? 80   PHE G CE2 1 
ATOM   6069  C  CZ  . PHE G  1 80  ? -55.842 -15.010 -4.467  1.00 19.35 ? 80   PHE G CZ  1 
ATOM   6070  N  N   . PHE G  1 81  ? -59.096 -10.472 -8.766  1.00 19.22 ? 81   PHE G N   1 
ATOM   6071  C  CA  . PHE G  1 81  ? -60.032 -9.909  -9.735  1.00 20.06 ? 81   PHE G CA  1 
ATOM   6072  C  C   . PHE G  1 81  ? -61.355 -10.665 -9.614  1.00 21.63 ? 81   PHE G C   1 
ATOM   6073  O  O   . PHE G  1 81  ? -61.376 -11.859 -9.297  1.00 22.20 ? 81   PHE G O   1 
ATOM   6074  C  CB  . PHE G  1 81  ? -59.502 -10.002 -11.159 1.00 20.10 ? 81   PHE G CB  1 
ATOM   6075  C  CG  . PHE G  1 81  ? -58.340 -9.088  -11.451 1.00 19.37 ? 81   PHE G CG  1 
ATOM   6076  C  CD1 . PHE G  1 81  ? -58.503 -7.710  -11.454 1.00 19.20 ? 81   PHE G CD1 1 
ATOM   6077  C  CD2 . PHE G  1 81  ? -57.094 -9.607  -11.766 1.00 19.21 ? 81   PHE G CD2 1 
ATOM   6078  C  CE1 . PHE G  1 81  ? -57.443 -6.874  -11.755 1.00 18.84 ? 81   PHE G CE1 1 
ATOM   6079  C  CE2 . PHE G  1 81  ? -56.015 -8.775  -12.054 1.00 18.63 ? 81   PHE G CE2 1 
ATOM   6080  C  CZ  . PHE G  1 81  ? -56.190 -7.407  -12.054 1.00 18.51 ? 81   PHE G CZ  1 
ATOM   6081  N  N   . LYS G  1 82  ? -62.447 -9.948  -9.857  1.00 22.79 ? 82   LYS G N   1 
ATOM   6082  C  CA  . LYS G  1 82  ? -63.793 -10.458 -9.617  1.00 24.80 ? 82   LYS G CA  1 
ATOM   6083  C  C   . LYS G  1 82  ? -64.241 -11.556 -10.580 1.00 26.08 ? 82   LYS G C   1 
ATOM   6084  O  O   . LYS G  1 82  ? -64.051 -11.468 -11.791 1.00 25.96 ? 82   LYS G O   1 
ATOM   6085  C  CB  . LYS G  1 82  ? -64.803 -9.320  -9.685  1.00 25.69 ? 82   LYS G CB  1 
ATOM   6086  C  CG  . LYS G  1 82  ? -66.127 -9.675  -9.050  1.00 27.55 ? 82   LYS G CG  1 
ATOM   6087  C  CD  . LYS G  1 82  ? -67.141 -8.572  -9.252  1.00 28.96 ? 82   LYS G CD  1 
ATOM   6088  C  CE  . LYS G  1 82  ? -68.294 -8.747  -8.290  1.00 30.91 ? 82   LYS G CE  1 
ATOM   6089  N  NZ  . LYS G  1 82  ? -69.304 -7.673  -8.487  1.00 32.48 ? 82   LYS G NZ  1 
ATOM   6090  N  N   . TYR G  1 83  ? -64.867 -12.581 -10.014 1.00 27.83 ? 83   TYR G N   1 
ATOM   6091  C  CA  . TYR G  1 83  ? -65.475 -13.641 -10.800 1.00 29.73 ? 83   TYR G CA  1 
ATOM   6092  C  C   . TYR G  1 83  ? -66.755 -14.133 -10.118 1.00 31.91 ? 83   TYR G C   1 
ATOM   6093  O  O   . TYR G  1 83  ? -66.845 -14.138 -8.887  1.00 31.64 ? 83   TYR G O   1 
ATOM   6094  C  CB  . TYR G  1 83  ? -64.470 -14.779 -11.015 1.00 29.55 ? 83   TYR G CB  1 
ATOM   6095  C  CG  . TYR G  1 83  ? -64.053 -15.466 -9.748  1.00 29.52 ? 83   TYR G CG  1 
ATOM   6096  C  CD1 . TYR G  1 83  ? -63.087 -14.914 -8.919  1.00 28.54 ? 83   TYR G CD1 1 
ATOM   6097  C  CD2 . TYR G  1 83  ? -64.633 -16.664 -9.369  1.00 31.10 ? 83   TYR G CD2 1 
ATOM   6098  C  CE1 . TYR G  1 83  ? -62.704 -15.548 -7.750  1.00 28.90 ? 83   TYR G CE1 1 
ATOM   6099  C  CE2 . TYR G  1 83  ? -64.262 -17.304 -8.202  1.00 31.47 ? 83   TYR G CE2 1 
ATOM   6100  C  CZ  . TYR G  1 83  ? -63.306 -16.738 -7.397  1.00 30.44 ? 83   TYR G CZ  1 
ATOM   6101  O  OH  . TYR G  1 83  ? -62.954 -17.387 -6.241  1.00 31.95 ? 83   TYR G OH  1 
ATOM   6102  N  N   . LYS G  1 84  ? -67.734 -14.531 -10.936 1.00 34.46 ? 84   LYS G N   1 
ATOM   6103  C  CA  . LYS G  1 84  ? -69.046 -14.974 -10.477 1.00 37.21 ? 84   LYS G CA  1 
ATOM   6104  C  C   . LYS G  1 84  ? -69.236 -16.445 -10.809 1.00 38.73 ? 84   LYS G C   1 
ATOM   6105  O  O   . LYS G  1 84  ? -68.989 -16.855 -11.943 1.00 39.10 ? 84   LYS G O   1 
ATOM   6106  C  CB  . LYS G  1 84  ? -70.147 -14.166 -11.168 1.00 38.87 ? 84   LYS G CB  1 
ATOM   6107  C  CG  . LYS G  1 84  ? -70.284 -12.730 -10.668 1.00 38.98 ? 84   LYS G CG  1 
ATOM   6108  C  CD  . LYS G  1 84  ? -71.277 -12.620 -9.514  1.00 40.70 ? 84   LYS G CD  1 
ATOM   6109  C  CE  . LYS G  1 84  ? -71.519 -11.172 -9.102  1.00 40.71 ? 84   LYS G CE  1 
ATOM   6110  N  NZ  . LYS G  1 84  ? -72.510 -10.507 -9.998  1.00 42.04 ? 84   LYS G NZ  1 
ATOM   6111  N  N   . VAL G  1 90  ? -69.670 -19.302 -15.300 1.00 43.94 ? 90   VAL G N   1 
ATOM   6112  C  CA  . VAL G  1 90  ? -68.407 -18.714 -14.819 1.00 42.82 ? 90   VAL G CA  1 
ATOM   6113  C  C   . VAL G  1 90  ? -68.016 -17.447 -15.588 1.00 40.91 ? 90   VAL G C   1 
ATOM   6114  O  O   . VAL G  1 90  ? -67.447 -17.532 -16.669 1.00 41.12 ? 90   VAL G O   1 
ATOM   6115  C  CB  . VAL G  1 90  ? -67.243 -19.733 -14.901 1.00 43.04 ? 90   VAL G CB  1 
ATOM   6116  C  CG1 . VAL G  1 90  ? -65.969 -19.145 -14.314 1.00 41.15 ? 90   VAL G CG1 1 
ATOM   6117  C  CG2 . VAL G  1 90  ? -67.615 -21.028 -14.190 1.00 44.76 ? 90   VAL G CG2 1 
ATOM   6118  N  N   . THR G  1 91  ? -68.311 -16.279 -15.022 1.00 39.45 ? 91   THR G N   1 
ATOM   6119  C  CA  . THR G  1 91  ? -68.032 -14.998 -15.681 1.00 38.39 ? 91   THR G CA  1 
ATOM   6120  C  C   . THR G  1 91  ? -66.965 -14.209 -14.894 1.00 36.05 ? 91   THR G C   1 
ATOM   6121  O  O   . THR G  1 91  ? -66.853 -14.350 -13.683 1.00 34.64 ? 91   THR G O   1 
ATOM   6122  C  CB  . THR G  1 91  ? -69.323 -14.162 -15.846 1.00 39.30 ? 91   THR G CB  1 
ATOM   6123  O  OG1 . THR G  1 91  ? -70.325 -14.947 -16.511 1.00 42.31 ? 91   THR G OG1 1 
ATOM   6124  C  CG2 . THR G  1 91  ? -69.072 -12.898 -16.665 1.00 38.59 ? 91   THR G CG2 1 
ATOM   6125  N  N   . THR G  1 92  ? -66.197 -13.385 -15.604 1.00 35.18 ? 92   THR G N   1 
ATOM   6126  C  CA  . THR G  1 92  ? -65.062 -12.663 -15.034 1.00 33.99 ? 92   THR G CA  1 
ATOM   6127  C  C   . THR G  1 92  ? -65.185 -11.173 -15.304 1.00 33.75 ? 92   THR G C   1 
ATOM   6128  O  O   . THR G  1 92  ? -65.478 -10.763 -16.418 1.00 35.00 ? 92   THR G O   1 
ATOM   6129  C  CB  . THR G  1 92  ? -63.756 -13.157 -15.661 1.00 33.56 ? 92   THR G CB  1 
ATOM   6130  O  OG1 . THR G  1 92  ? -63.556 -14.524 -15.308 1.00 33.91 ? 92   THR G OG1 1 
ATOM   6131  C  CG2 . THR G  1 92  ? -62.574 -12.351 -15.166 1.00 32.99 ? 92   THR G CG2 1 
ATOM   6132  N  N   . TYR G  1 93  ? -64.959 -10.361 -14.286 1.00 32.73 ? 93   TYR G N   1 
ATOM   6133  C  CA  . TYR G  1 93  ? -65.050 -8.919  -14.447 1.00 32.95 ? 93   TYR G CA  1 
ATOM   6134  C  C   . TYR G  1 93  ? -63.703 -8.324  -14.108 1.00 31.57 ? 93   TYR G C   1 
ATOM   6135  O  O   . TYR G  1 93  ? -63.411 -8.058  -12.945 1.00 30.73 ? 93   TYR G O   1 
ATOM   6136  C  CB  . TYR G  1 93  ? -66.149 -8.345  -13.550 1.00 33.51 ? 93   TYR G CB  1 
ATOM   6137  C  CG  . TYR G  1 93  ? -67.476 -9.000  -13.767 1.00 35.12 ? 93   TYR G CG  1 
ATOM   6138  C  CD1 . TYR G  1 93  ? -67.769 -10.218 -13.178 1.00 35.60 ? 93   TYR G CD1 1 
ATOM   6139  C  CD2 . TYR G  1 93  ? -68.441 -8.417  -14.587 1.00 37.39 ? 93   TYR G CD2 1 
ATOM   6140  C  CE1 . TYR G  1 93  ? -68.982 -10.841 -13.396 1.00 37.48 ? 93   TYR G CE1 1 
ATOM   6141  C  CE2 . TYR G  1 93  ? -69.664 -9.031  -14.812 1.00 38.23 ? 93   TYR G CE2 1 
ATOM   6142  C  CZ  . TYR G  1 93  ? -69.928 -10.243 -14.213 1.00 38.84 ? 93   TYR G CZ  1 
ATOM   6143  O  OH  . TYR G  1 93  ? -71.145 -10.860 -14.420 1.00 41.48 ? 93   TYR G OH  1 
ATOM   6144  N  N   . CYS G  1 94  ? -62.882 -8.108  -15.128 1.00 32.13 ? 94   CYS G N   1 
ATOM   6145  C  CA  . CYS G  1 94  ? -61.529 -7.609  -14.922 1.00 31.78 ? 94   CYS G CA  1 
ATOM   6146  C  C   . CYS G  1 94  ? -61.444 -6.120  -14.567 1.00 30.00 ? 94   CYS G C   1 
ATOM   6147  O  O   . CYS G  1 94  ? -60.342 -5.573  -14.442 1.00 29.74 ? 94   CYS G O   1 
ATOM   6148  C  CB  . CYS G  1 94  ? -60.678 -7.925  -16.150 1.00 33.82 ? 94   CYS G CB  1 
ATOM   6149  S  SG  . CYS G  1 94  ? -60.471 -9.722  -16.386 1.00 37.93 ? 94   CYS G SG  1 
ATOM   6150  N  N   . ASN G  1 95  ? -62.600 -5.479  -14.409 1.00 29.25 ? 95   ASN G N   1 
ATOM   6151  C  CA  . ASN G  1 95  ? -62.702 -4.093  -13.958 1.00 28.42 ? 95   ASN G CA  1 
ATOM   6152  C  C   . ASN G  1 95  ? -63.314 -4.002  -12.554 1.00 27.69 ? 95   ASN G C   1 
ATOM   6153  O  O   . ASN G  1 95  ? -63.802 -2.943  -12.146 1.00 27.85 ? 95   ASN G O   1 
ATOM   6154  C  CB  . ASN G  1 95  ? -63.521 -3.265  -14.961 1.00 29.85 ? 95   ASN G CB  1 
ATOM   6155  C  CG  . ASN G  1 95  ? -64.937 -3.800  -15.167 1.00 31.16 ? 95   ASN G CG  1 
ATOM   6156  O  OD1 . ASN G  1 95  ? -65.338 -4.816  -14.597 1.00 30.87 ? 95   ASN G OD1 1 
ATOM   6157  N  ND2 . ASN G  1 95  ? -65.700 -3.110  -15.992 1.00 33.13 ? 95   ASN G ND2 1 
ATOM   6158  N  N   . GLU G  1 96  ? -63.302 -5.121  -11.827 1.00 26.53 ? 96   GLU G N   1 
ATOM   6159  C  CA  . GLU G  1 96  ? -63.727 -5.151  -10.429 1.00 25.64 ? 96   GLU G CA  1 
ATOM   6160  C  C   . GLU G  1 96  ? -62.918 -6.208  -9.696  1.00 23.78 ? 96   GLU G C   1 
ATOM   6161  O  O   . GLU G  1 96  ? -62.340 -7.082  -10.330 1.00 23.48 ? 96   GLU G O   1 
ATOM   6162  C  CB  . GLU G  1 96  ? -65.219 -5.484  -10.296 1.00 27.52 ? 96   GLU G CB  1 
ATOM   6163  C  CG  . GLU G  1 96  ? -66.145 -4.733  -11.244 1.00 29.17 ? 96   GLU G CG  1 
ATOM   6164  C  CD  . GLU G  1 96  ? -67.611 -5.085  -11.041 1.00 31.08 ? 96   GLU G CD  1 
ATOM   6165  O  OE1 . GLU G  1 96  ? -68.056 -5.078  -9.872  1.00 31.87 ? 96   GLU G OE1 1 
ATOM   6166  O  OE2 . GLU G  1 96  ? -68.322 -5.356  -12.042 1.00 32.04 ? 96   GLU G OE2 1 
ATOM   6167  N  N   . THR G  1 97  ? -62.887 -6.119  -8.368  1.00 22.34 ? 97   THR G N   1 
ATOM   6168  C  CA  . THR G  1 97  ? -62.228 -7.111  -7.530  1.00 21.34 ? 97   THR G CA  1 
ATOM   6169  C  C   . THR G  1 97  ? -63.233 -7.902  -6.691  1.00 21.84 ? 97   THR G C   1 
ATOM   6170  O  O   . THR G  1 97  ? -64.347 -7.448  -6.439  1.00 22.34 ? 97   THR G O   1 
ATOM   6171  C  CB  . THR G  1 97  ? -61.254 -6.459  -6.528  1.00 20.31 ? 97   THR G CB  1 
ATOM   6172  O  OG1 . THR G  1 97  ? -61.989 -5.902  -5.437  1.00 20.78 ? 97   THR G OG1 1 
ATOM   6173  C  CG2 . THR G  1 97  ? -60.394 -5.353  -7.186  1.00 19.73 ? 97   THR G CG2 1 
ATOM   6174  N  N   . MET G  1 98  ? -62.814 -9.080  -6.251  1.00 21.49 ? 98   MET G N   1 
ATOM   6175  C  CA  . MET G  1 98  ? -63.421 -9.712  -5.091  1.00 22.32 ? 98   MET G CA  1 
ATOM   6176  C  C   . MET G  1 98  ? -63.117 -8.832  -3.884  1.00 21.92 ? 98   MET G C   1 
ATOM   6177  O  O   . MET G  1 98  ? -62.394 -7.842  -3.979  1.00 21.11 ? 98   MET G O   1 
ATOM   6178  C  CB  . MET G  1 98  ? -62.838 -11.113 -4.848  1.00 22.50 ? 98   MET G CB  1 
ATOM   6179  C  CG  . MET G  1 98  ? -63.042 -12.101 -5.982  1.00 23.03 ? 98   MET G CG  1 
ATOM   6180  S  SD  . MET G  1 98  ? -64.774 -12.306 -6.402  1.00 24.81 ? 98   MET G SD  1 
ATOM   6181  C  CE  . MET G  1 98  ? -65.352 -13.316 -5.041  1.00 25.96 ? 98   MET G CE  1 
ATOM   6182  N  N   . THR G  1 99  ? -63.657 -9.204  -2.741  1.00 22.83 ? 99   THR G N   1 
ATOM   6183  C  CA  . THR G  1 99  ? -63.332 -8.516  -1.510  1.00 22.89 ? 99   THR G CA  1 
ATOM   6184  C  C   . THR G  1 99  ? -61.876 -8.798  -1.192  1.00 21.78 ? 99   THR G C   1 
ATOM   6185  O  O   . THR G  1 99  ? -61.439 -9.942  -1.272  1.00 21.96 ? 99   THR G O   1 
ATOM   6186  C  CB  . THR G  1 99  ? -64.226 -8.958  -0.357  1.00 24.47 ? 99   THR G CB  1 
ATOM   6187  O  OG1 . THR G  1 99  ? -65.579 -8.680  -0.711  1.00 25.58 ? 99   THR G OG1 1 
ATOM   6188  C  CG2 . THR G  1 99  ? -63.895 -8.177  0.882   1.00 25.03 ? 99   THR G CG2 1 
ATOM   6189  N  N   . GLY G  1 100 ? -61.136 -7.741  -0.872  1.00 20.66 ? 100  GLY G N   1 
ATOM   6190  C  CA  . GLY G  1 100 ? -59.692 -7.822  -0.657  1.00 19.68 ? 100  GLY G CA  1 
ATOM   6191  C  C   . GLY G  1 100 ? -59.276 -7.351  0.729   1.00 19.68 ? 100  GLY G C   1 
ATOM   6192  O  O   . GLY G  1 100 ? -60.126 -6.969  1.543   1.00 20.89 ? 100  GLY G O   1 
ATOM   6193  N  N   . TRP G  1 101 ? -57.971 -7.375  0.987   1.00 18.67 ? 101  TRP G N   1 
ATOM   6194  C  CA  . TRP G  1 101 ? -57.421 -7.013  2.294   1.00 18.81 ? 101  TRP G CA  1 
ATOM   6195  C  C   . TRP G  1 101 ? -56.527 -5.792  2.159   1.00 17.73 ? 101  TRP G C   1 
ATOM   6196  O  O   . TRP G  1 101 ? -55.654 -5.742  1.303   1.00 16.65 ? 101  TRP G O   1 
ATOM   6197  C  CB  . TRP G  1 101 ? -56.595 -8.165  2.883   1.00 19.12 ? 101  TRP G CB  1 
ATOM   6198  C  CG  . TRP G  1 101 ? -57.391 -9.368  3.102   1.00 20.21 ? 101  TRP G CG  1 
ATOM   6199  C  CD1 . TRP G  1 101 ? -57.990 -9.749  4.263   1.00 21.73 ? 101  TRP G CD1 1 
ATOM   6200  C  CD2 . TRP G  1 101 ? -57.734 -10.356 2.123   1.00 20.24 ? 101  TRP G CD2 1 
ATOM   6201  N  NE1 . TRP G  1 101 ? -58.675 -10.914 4.067   1.00 22.36 ? 101  TRP G NE1 1 
ATOM   6202  C  CE2 . TRP G  1 101 ? -58.535 -11.310 2.764   1.00 21.54 ? 101  TRP G CE2 1 
ATOM   6203  C  CE3 . TRP G  1 101 ? -57.439 -10.524 0.766   1.00 19.43 ? 101  TRP G CE3 1 
ATOM   6204  C  CZ2 . TRP G  1 101 ? -59.041 -12.425 2.102   1.00 22.07 ? 101  TRP G CZ2 1 
ATOM   6205  C  CZ3 . TRP G  1 101 ? -57.950 -11.633 0.104   1.00 19.98 ? 101  TRP G CZ3 1 
ATOM   6206  C  CH2 . TRP G  1 101 ? -58.743 -12.564 0.770   1.00 21.23 ? 101  TRP G CH2 1 
ATOM   6207  N  N   . VAL G  1 102 ? -56.752 -4.808  3.015   1.00 18.02 ? 102  VAL G N   1 
ATOM   6208  C  CA  . VAL G  1 102 ? -55.832 -3.687  3.117   1.00 17.44 ? 102  VAL G CA  1 
ATOM   6209  C  C   . VAL G  1 102 ? -55.346 -3.603  4.562   1.00 18.00 ? 102  VAL G C   1 
ATOM   6210  O  O   . VAL G  1 102 ? -56.109 -3.826  5.494   1.00 19.10 ? 102  VAL G O   1 
ATOM   6211  C  CB  . VAL G  1 102 ? -56.461 -2.378  2.596   1.00 17.50 ? 102  VAL G CB  1 
ATOM   6212  C  CG1 . VAL G  1 102 ? -57.598 -1.906  3.486   1.00 18.76 ? 102  VAL G CG1 1 
ATOM   6213  C  CG2 . VAL G  1 102 ? -55.411 -1.291  2.460   1.00 17.06 ? 102  VAL G CG2 1 
ATOM   6214  N  N   . HIS G  1 103 ? -54.064 -3.325  4.736   1.00 17.53 ? 103  HIS G N   1 
ATOM   6215  C  CA  . HIS G  1 103 ? -53.481 -3.142  6.051   1.00 18.21 ? 103  HIS G CA  1 
ATOM   6216  C  C   . HIS G  1 103 ? -52.221 -2.297  5.944   1.00 17.77 ? 103  HIS G C   1 
ATOM   6217  O  O   . HIS G  1 103 ? -51.612 -2.215  4.886   1.00 16.82 ? 103  HIS G O   1 
ATOM   6218  C  CB  . HIS G  1 103 ? -53.171 -4.490  6.696   1.00 18.65 ? 103  HIS G CB  1 
ATOM   6219  C  CG  . HIS G  1 103 ? -52.217 -5.324  5.907   1.00 17.89 ? 103  HIS G CG  1 
ATOM   6220  N  ND1 . HIS G  1 103 ? -50.862 -5.079  5.885   1.00 17.53 ? 103  HIS G ND1 1 
ATOM   6221  C  CD2 . HIS G  1 103 ? -52.421 -6.392  5.099   1.00 17.61 ? 103  HIS G CD2 1 
ATOM   6222  C  CE1 . HIS G  1 103 ? -50.270 -5.959  5.096   1.00 17.10 ? 103  HIS G CE1 1 
ATOM   6223  N  NE2 . HIS G  1 103 ? -51.195 -6.764  4.601   1.00 17.12 ? 103  HIS G NE2 1 
ATOM   6224  N  N   . ASP G  1 104 ? -51.846 -1.641  7.038   1.00 18.53 ? 104  ASP G N   1 
ATOM   6225  C  CA  . ASP G  1 104 ? -50.661 -0.801  7.028   1.00 18.34 ? 104  ASP G CA  1 
ATOM   6226  C  C   . ASP G  1 104 ? -49.441 -1.701  6.872   1.00 17.87 ? 104  ASP G C   1 
ATOM   6227  O  O   . ASP G  1 104 ? -49.536 -2.907  7.073   1.00 17.94 ? 104  ASP G O   1 
ATOM   6228  C  CB  . ASP G  1 104 ? -50.578 0.098   8.270   1.00 19.41 ? 104  ASP G CB  1 
ATOM   6229  C  CG  . ASP G  1 104 ? -50.539 -0.678  9.565   1.00 20.43 ? 104  ASP G CG  1 
ATOM   6230  O  OD1 . ASP G  1 104 ? -49.638 -1.529  9.727   1.00 20.34 ? 104  ASP G OD1 1 
ATOM   6231  O  OD2 . ASP G  1 104 ? -51.398 -0.417  10.439  1.00 21.58 ? 104  ASP G OD2 1 
ATOM   6232  N  N   . VAL G  1 105 ? -48.307 -1.125  6.494   1.00 17.56 ? 105  VAL G N   1 
ATOM   6233  C  CA  . VAL G  1 105 ? -47.099 -1.923  6.188   1.00 17.25 ? 105  VAL G CA  1 
ATOM   6234  C  C   . VAL G  1 105 ? -46.525 -2.711  7.361   1.00 18.03 ? 105  VAL G C   1 
ATOM   6235  O  O   . VAL G  1 105 ? -45.721 -3.611  7.152   1.00 17.96 ? 105  VAL G O   1 
ATOM   6236  C  CB  . VAL G  1 105 ? -45.963 -1.070  5.559   1.00 17.03 ? 105  VAL G CB  1 
ATOM   6237  C  CG1 . VAL G  1 105 ? -46.340 -0.646  4.145   1.00 16.29 ? 105  VAL G CG1 1 
ATOM   6238  C  CG2 . VAL G  1 105 ? -45.631 0.140   6.411   1.00 17.70 ? 105  VAL G CG2 1 
ATOM   6239  N  N   . LEU G  1 106 ? -46.914 -2.370  8.587   1.00 19.04 ? 106  LEU G N   1 
ATOM   6240  C  CA  . LEU G  1 106 ? -46.516 -3.158  9.757   1.00 20.07 ? 106  LEU G CA  1 
ATOM   6241  C  C   . LEU G  1 106 ? -47.474 -4.316  10.002  1.00 20.62 ? 106  LEU G C   1 
ATOM   6242  O  O   . LEU G  1 106 ? -47.173 -5.222  10.778  1.00 21.55 ? 106  LEU G O   1 
ATOM   6243  C  CB  . LEU G  1 106 ? -46.488 -2.288  11.022  1.00 21.15 ? 106  LEU G CB  1 
ATOM   6244  C  CG  . LEU G  1 106 ? -45.517 -1.109  11.076  1.00 21.21 ? 106  LEU G CG  1 
ATOM   6245  C  CD1 . LEU G  1 106 ? -45.798 -0.268  12.321  1.00 22.43 ? 106  LEU G CD1 1 
ATOM   6246  C  CD2 . LEU G  1 106 ? -44.073 -1.588  11.030  1.00 21.21 ? 106  LEU G CD2 1 
ATOM   6247  N  N   . GLY G  1 107 ? -48.652 -4.264  9.391   1.00 20.32 ? 107  GLY G N   1 
ATOM   6248  C  CA  . GLY G  1 107 ? -49.697 -5.256  9.665   1.00 21.04 ? 107  GLY G CA  1 
ATOM   6249  C  C   . GLY G  1 107 ? -50.512 -4.989  10.920  1.00 22.24 ? 107  GLY G C   1 
ATOM   6250  O  O   . GLY G  1 107 ? -51.198 -5.879  11.404  1.00 22.92 ? 107  GLY G O   1 
ATOM   6251  N  N   . ARG G  1 108 ? -50.471 -3.769  11.450  1.00 22.60 ? 108  ARG G N   1 
ATOM   6252  C  CA  . ARG G  1 108 ? -51.214 -3.472  12.690  1.00 24.14 ? 108  ARG G CA  1 
ATOM   6253  C  C   . ARG G  1 108 ? -52.724 -3.352  12.446  1.00 24.63 ? 108  ARG G C   1 
ATOM   6254  O  O   . ARG G  1 108 ? -53.505 -4.133  12.987  1.00 26.08 ? 108  ARG G O   1 
ATOM   6255  C  CB  . ARG G  1 108 ? -50.702 -2.195  13.352  1.00 24.62 ? 108  ARG G CB  1 
ATOM   6256  C  CG  . ARG G  1 108 ? -49.233 -2.223  13.741  1.00 24.65 ? 108  ARG G CG  1 
ATOM   6257  C  CD  . ARG G  1 108 ? -48.938 -3.069  14.969  1.00 26.06 ? 108  ARG G CD  1 
ATOM   6258  N  NE  . ARG G  1 108 ? -47.534 -2.871  15.319  1.00 26.27 ? 108  ARG G NE  1 
ATOM   6259  C  CZ  . ARG G  1 108 ? -46.512 -3.550  14.796  1.00 25.57 ? 108  ARG G CZ  1 
ATOM   6260  N  NH1 . ARG G  1 108 ? -46.705 -4.547  13.932  1.00 24.68 ? 108  ARG G NH1 1 
ATOM   6261  N  NH2 . ARG G  1 108 ? -45.283 -3.243  15.152  1.00 25.89 ? 108  ARG G NH2 1 
ATOM   6262  N  N   . ASN G  1 109 ? -53.116 -2.373  11.636  1.00 24.08 ? 109  ASN G N   1 
ATOM   6263  C  CA  . ASN G  1 109 ? -54.512 -2.079  11.357  1.00 24.63 ? 109  ASN G CA  1 
ATOM   6264  C  C   . ASN G  1 109 ? -54.913 -2.612  9.979   1.00 23.33 ? 109  ASN G C   1 
ATOM   6265  O  O   . ASN G  1 109 ? -54.270 -2.319  8.965   1.00 21.68 ? 109  ASN G O   1 
ATOM   6266  C  CB  . ASN G  1 109 ? -54.782 -0.575  11.407  1.00 25.28 ? 109  ASN G CB  1 
ATOM   6267  C  CG  . ASN G  1 109 ? -54.648 0.003   12.800  1.00 27.10 ? 109  ASN G CG  1 
ATOM   6268  O  OD1 . ASN G  1 109 ? -55.110 -0.586  13.781  1.00 28.45 ? 109  ASN G OD1 1 
ATOM   6269  N  ND2 . ASN G  1 109 ? -54.012 1.175   12.896  1.00 27.59 ? 109  ASN G ND2 1 
ATOM   6270  N  N   . TRP G  1 110 ? -55.993 -3.382  9.978   1.00 23.92 ? 110  TRP G N   1 
ATOM   6271  C  CA  . TRP G  1 110 ? -56.497 -4.054  8.809   1.00 23.31 ? 110  TRP G CA  1 
ATOM   6272  C  C   . TRP G  1 110 ? -57.890 -3.540  8.459   1.00 24.16 ? 110  TRP G C   1 
ATOM   6273  O  O   . TRP G  1 110 ? -58.583 -2.937  9.290   1.00 25.71 ? 110  TRP G O   1 
ATOM   6274  C  CB  . TRP G  1 110 ? -56.595 -5.546  9.096   1.00 23.74 ? 110  TRP G CB  1 
ATOM   6275  C  CG  . TRP G  1 110 ? -55.306 -6.244  9.074   1.00 23.09 ? 110  TRP G CG  1 
ATOM   6276  C  CD1 . TRP G  1 110 ? -54.260 -6.053  9.909   1.00 23.26 ? 110  TRP G CD1 1 
ATOM   6277  C  CD2 . TRP G  1 110 ? -54.920 -7.272  8.165   1.00 22.34 ? 110  TRP G CD2 1 
ATOM   6278  N  NE1 . TRP G  1 110 ? -53.224 -6.889  9.569   1.00 22.70 ? 110  TRP G NE1 1 
ATOM   6279  C  CE2 . TRP G  1 110 ? -53.607 -7.654  8.503   1.00 22.32 ? 110  TRP G CE2 1 
ATOM   6280  C  CE3 . TRP G  1 110 ? -55.552 -7.902  7.086   1.00 21.82 ? 110  TRP G CE3 1 
ATOM   6281  C  CZ2 . TRP G  1 110 ? -52.918 -8.645  7.812   1.00 21.69 ? 110  TRP G CZ2 1 
ATOM   6282  C  CZ3 . TRP G  1 110 ? -54.866 -8.890  6.398   1.00 21.25 ? 110  TRP G CZ3 1 
ATOM   6283  C  CH2 . TRP G  1 110 ? -53.562 -9.249  6.764   1.00 21.22 ? 110  TRP G CH2 1 
ATOM   6284  N  N   . ALA G  1 111 ? -58.286 -3.802  7.217   1.00 23.63 ? 111  ALA G N   1 
ATOM   6285  C  CA  . ALA G  1 111 ? -59.641 -3.540  6.740   1.00 24.27 ? 111  ALA G CA  1 
ATOM   6286  C  C   . ALA G  1 111 ? -59.862 -4.331  5.455   1.00 23.76 ? 111  ALA G C   1 
ATOM   6287  O  O   . ALA G  1 111 ? -58.920 -4.912  4.912   1.00 22.55 ? 111  ALA G O   1 
ATOM   6288  C  CB  . ALA G  1 111 ? -59.856 -2.053  6.504   1.00 24.16 ? 111  ALA G CB  1 
ATOM   6289  N  N   . CYS G  1 112 ? -61.109 -4.355  4.992   1.00 25.11 ? 112  CYS G N   1 
ATOM   6290  C  CA  . CYS G  1 112 ? -61.496 -5.041  3.768   1.00 25.13 ? 112  CYS G CA  1 
ATOM   6291  C  C   . CYS G  1 112 ? -61.982 -4.039  2.738   1.00 24.00 ? 112  CYS G C   1 
ATOM   6292  O  O   . CYS G  1 112 ? -62.463 -2.966  3.088   1.00 24.41 ? 112  CYS G O   1 
ATOM   6293  C  CB  . CYS G  1 112 ? -62.606 -6.040  4.054   1.00 27.90 ? 112  CYS G CB  1 
ATOM   6294  S  SG  . CYS G  1 112 ? -62.273 -7.078  5.494   1.00 30.54 ? 112  CYS G SG  1 
ATOM   6295  N  N   . PHE G  1 113 ? -61.876 -4.401  1.468   1.00 22.48 ? 113  PHE G N   1 
ATOM   6296  C  CA  . PHE G  1 113 ? -62.191 -3.473  0.397   1.00 21.95 ? 113  PHE G CA  1 
ATOM   6297  C  C   . PHE G  1 113 ? -62.616 -4.183  -0.876  1.00 21.73 ? 113  PHE G C   1 
ATOM   6298  O  O   . PHE G  1 113 ? -62.259 -5.318  -1.099  1.00 21.21 ? 113  PHE G O   1 
ATOM   6299  C  CB  . PHE G  1 113 ? -60.983 -2.543  0.113   1.00 20.70 ? 113  PHE G CB  1 
ATOM   6300  C  CG  . PHE G  1 113 ? -59.902 -3.161  -0.759  1.00 19.33 ? 113  PHE G CG  1 
ATOM   6301  C  CD1 . PHE G  1 113 ? -58.942 -4.006  -0.214  1.00 18.67 ? 113  PHE G CD1 1 
ATOM   6302  C  CD2 . PHE G  1 113 ? -59.832 -2.873  -2.117  1.00 18.77 ? 113  PHE G CD2 1 
ATOM   6303  C  CE1 . PHE G  1 113 ? -57.956 -4.568  -1.010  1.00 17.66 ? 113  PHE G CE1 1 
ATOM   6304  C  CE2 . PHE G  1 113 ? -58.845 -3.427  -2.915  1.00 17.81 ? 113  PHE G CE2 1 
ATOM   6305  C  CZ  . PHE G  1 113 ? -57.905 -4.279  -2.363  1.00 17.26 ? 113  PHE G CZ  1 
ATOM   6306  N  N   . THR G  1 114 ? -63.403 -3.488  -1.687  1.00 22.53 ? 114  THR G N   1 
ATOM   6307  C  CA  . THR G  1 114 ? -63.690 -3.890  -3.063  1.00 22.66 ? 114  THR G CA  1 
ATOM   6308  C  C   . THR G  1 114 ? -63.261 -2.764  -3.982  1.00 22.34 ? 114  THR G C   1 
ATOM   6309  O  O   . THR G  1 114 ? -63.306 -1.601  -3.596  1.00 22.62 ? 114  THR G O   1 
ATOM   6310  C  CB  . THR G  1 114 ? -65.186 -4.100  -3.290  1.00 24.16 ? 114  THR G CB  1 
ATOM   6311  O  OG1 . THR G  1 114 ? -65.886 -2.921  -2.880  1.00 25.37 ? 114  THR G OG1 1 
ATOM   6312  C  CG2 . THR G  1 114 ? -65.685 -5.297  -2.493  1.00 24.86 ? 114  THR G CG2 1 
ATOM   6313  N  N   . GLY G  1 115 ? -62.840 -3.119  -5.190  1.00 21.98 ? 115  GLY G N   1 
ATOM   6314  C  CA  . GLY G  1 115 ? -62.397 -2.146  -6.176  1.00 21.88 ? 115  GLY G CA  1 
ATOM   6315  C  C   . GLY G  1 115 ? -63.220 -2.190  -7.451  1.00 22.98 ? 115  GLY G C   1 
ATOM   6316  O  O   . GLY G  1 115 ? -63.623 -3.254  -7.906  1.00 23.11 ? 115  GLY G O   1 
ATOM   6317  N  N   . LYS G  1 116 ? -63.484 -1.013  -8.008  1.00 24.20 ? 116  LYS G N   1 
ATOM   6318  C  CA  . LYS G  1 116 ? -64.050 -0.880  -9.348  1.00 25.45 ? 116  LYS G CA  1 
ATOM   6319  C  C   . LYS G  1 116 ? -63.194 0.099   -10.126 1.00 24.91 ? 116  LYS G C   1 
ATOM   6320  O  O   . LYS G  1 116 ? -62.785 1.141   -9.609  1.00 24.30 ? 116  LYS G O   1 
ATOM   6321  C  CB  . LYS G  1 116 ? -65.503 -0.388  -9.314  1.00 27.76 ? 116  LYS G CB  1 
ATOM   6322  C  CG  . LYS G  1 116 ? -66.442 -1.332  -8.595  1.00 29.29 ? 116  LYS G CG  1 
ATOM   6323  C  CD  . LYS G  1 116 ? -67.914 -1.039  -8.885  1.00 32.56 ? 116  LYS G CD  1 
ATOM   6324  C  CE  . LYS G  1 116 ? -68.780 -1.706  -7.822  1.00 33.90 ? 116  LYS G CE  1 
ATOM   6325  N  NZ  . LYS G  1 116 ? -70.235 -1.557  -8.097  1.00 36.49 ? 116  LYS G NZ  1 
ATOM   6326  N  N   . LYS G  1 117 ? -62.910 -0.259  -11.369 1.00 24.90 ? 117  LYS G N   1 
ATOM   6327  C  CA  . LYS G  1 117 ? -62.164 0.607   -12.244 1.00 25.08 ? 117  LYS G CA  1 
ATOM   6328  C  C   . LYS G  1 117 ? -63.099 1.649   -12.820 1.00 26.71 ? 117  LYS G C   1 
ATOM   6329  O  O   . LYS G  1 117 ? -64.203 1.320   -13.232 1.00 27.86 ? 117  LYS G O   1 
ATOM   6330  C  CB  . LYS G  1 117 ? -61.530 -0.211  -13.352 1.00 24.89 ? 117  LYS G CB  1 
ATOM   6331  C  CG  . LYS G  1 117 ? -60.602 0.599   -14.228 1.00 25.11 ? 117  LYS G CG  1 
ATOM   6332  C  CD  . LYS G  1 117 ? -59.563 -0.279  -14.897 1.00 24.43 ? 117  LYS G CD  1 
ATOM   6333  C  CE  . LYS G  1 117 ? -58.904 0.482   -16.031 1.00 25.16 ? 117  LYS G CE  1 
ATOM   6334  N  NZ  . LYS G  1 117 ? -58.254 -0.422  -17.023 1.00 25.25 ? 117  LYS G NZ  1 
ATOM   6335  N  N   . VAL G  1 118 ? -62.665 2.905   -12.826 1.00 27.35 ? 118  VAL G N   1 
ATOM   6336  C  CA  . VAL G  1 118 ? -63.434 3.991   -13.426 1.00 29.42 ? 118  VAL G CA  1 
ATOM   6337  C  C   . VAL G  1 118 ? -63.418 3.833   -14.950 1.00 31.10 ? 118  VAL G C   1 
ATOM   6338  O  O   . VAL G  1 118 ? -62.390 3.477   -15.525 1.00 31.07 ? 118  VAL G O   1 
ATOM   6339  C  CB  . VAL G  1 118 ? -62.859 5.378   -13.049 1.00 29.59 ? 118  VAL G CB  1 
ATOM   6340  C  CG1 . VAL G  1 118 ? -63.668 6.497   -13.702 1.00 31.70 ? 118  VAL G CG1 1 
ATOM   6341  C  CG2 . VAL G  1 118 ? -62.825 5.557   -11.537 1.00 28.57 ? 118  VAL G CG2 1 
ATOM   6342  N  N   . GLY G  1 119 ? -64.560 4.072   -15.594 1.00 33.52 ? 119  GLY G N   1 
ATOM   6343  C  CA  . GLY G  1 119 ? -64.667 3.961   -17.045 1.00 35.37 ? 119  GLY G CA  1 
ATOM   6344  C  C   . GLY G  1 119 ? -63.995 5.141   -17.733 1.00 37.36 ? 119  GLY G C   1 
ATOM   6345  O  O   . GLY G  1 119 ? -63.361 4.986   -18.780 1.00 39.64 ? 119  GLY G O   1 
ATOM   6346  N  N   A HIS H  2 1   ? -18.876 -10.256 -9.822  0.50 29.63 ? 206  HIS H N   1 
ATOM   6347  N  N   B HIS H  2 1   ? -18.376 -10.554 -9.588  0.50 31.38 ? 206  HIS H N   1 
ATOM   6348  C  CA  A HIS H  2 1   ? -18.834 -11.358 -10.822 0.50 29.89 ? 206  HIS H CA  1 
ATOM   6349  C  CA  B HIS H  2 1   ? -18.907 -11.281 -10.772 0.50 31.12 ? 206  HIS H CA  1 
ATOM   6350  C  C   A HIS H  2 1   ? -19.449 -12.625 -10.251 0.50 29.05 ? 206  HIS H C   1 
ATOM   6351  C  C   B HIS H  2 1   ? -19.323 -12.699 -10.377 0.50 29.81 ? 206  HIS H C   1 
ATOM   6352  O  O   A HIS H  2 1   ? -19.082 -13.064 -9.165  0.50 29.13 ? 206  HIS H O   1 
ATOM   6353  O  O   B HIS H  2 1   ? -18.656 -13.339 -9.567  0.50 30.06 ? 206  HIS H O   1 
ATOM   6354  C  CB  A HIS H  2 1   ? -17.396 -11.645 -11.241 0.50 31.38 ? 206  HIS H CB  1 
ATOM   6355  C  CB  B HIS H  2 1   ? -17.859 -11.314 -11.891 0.50 33.02 ? 206  HIS H CB  1 
ATOM   6356  C  CG  A HIS H  2 1   ? -16.705 -10.468 -11.850 0.50 32.45 ? 206  HIS H CG  1 
ATOM   6357  C  CG  B HIS H  2 1   ? -16.829 -12.394 -11.735 0.50 34.30 ? 206  HIS H CG  1 
ATOM   6358  N  ND1 A HIS H  2 1   ? -16.689 -9.227  -11.250 0.50 32.34 ? 206  HIS H ND1 1 
ATOM   6359  N  ND1 B HIS H  2 1   ? -17.142 -13.735 -11.774 0.50 33.98 ? 206  HIS H ND1 1 
ATOM   6360  C  CD2 A HIS H  2 1   ? -15.999 -10.343 -12.997 0.50 33.71 ? 206  HIS H CD2 1 
ATOM   6361  C  CD2 B HIS H  2 1   ? -15.487 -12.329 -11.554 0.50 35.91 ? 206  HIS H CD2 1 
ATOM   6362  C  CE1 A HIS H  2 1   ? -16.008 -8.387  -12.007 0.50 33.35 ? 206  HIS H CE1 1 
ATOM   6363  C  CE1 B HIS H  2 1   ? -16.043 -14.450 -11.618 0.50 35.77 ? 206  HIS H CE1 1 
ATOM   6364  N  NE2 A HIS H  2 1   ? -15.582 -9.038  -13.073 0.50 34.09 ? 206  HIS H NE2 1 
ATOM   6365  N  NE2 B HIS H  2 1   ? -15.024 -13.621 -11.484 0.50 36.56 ? 206  HIS H NE2 1 
ATOM   6366  N  N   . LEU H  2 2   ? -20.406 -13.192 -10.978 1.00 28.56 ? 207  LEU H N   1 
ATOM   6367  C  CA  . LEU H  2 2   ? -20.994 -14.495 -10.610 1.00 27.43 ? 207  LEU H CA  1 
ATOM   6368  C  C   . LEU H  2 2   ? -20.136 -15.683 -11.051 1.00 28.03 ? 207  LEU H C   1 
ATOM   6369  O  O   . LEU H  2 2   ? -19.509 -15.627 -12.095 1.00 29.03 ? 207  LEU H O   1 
ATOM   6370  C  CB  . LEU H  2 2   ? -22.387 -14.626 -11.223 1.00 26.33 ? 207  LEU H CB  1 
ATOM   6371  C  CG  . LEU H  2 2   ? -23.598 -14.210 -10.381 1.00 25.22 ? 207  LEU H CG  1 
ATOM   6372  C  CD1 . LEU H  2 2   ? -23.266 -13.331 -9.178  1.00 24.87 ? 207  LEU H CD1 1 
ATOM   6373  C  CD2 . LEU H  2 2   ? -24.628 -13.539 -11.286 1.00 24.93 ? 207  LEU H CD2 1 
ATOM   6374  N  N   . PRO H  2 3   ? -20.125 -16.770 -10.256 1.00 27.54 ? 208  PRO H N   1 
ATOM   6375  C  CA  . PRO H  2 3   ? -19.420 -17.981 -10.671 1.00 28.26 ? 208  PRO H CA  1 
ATOM   6376  C  C   . PRO H  2 3   ? -20.126 -18.680 -11.827 1.00 27.74 ? 208  PRO H C   1 
ATOM   6377  O  O   . PRO H  2 3   ? -21.301 -18.418 -12.099 1.00 26.28 ? 208  PRO H O   1 
ATOM   6378  C  CB  . PRO H  2 3   ? -19.443 -18.856 -9.423  1.00 27.94 ? 208  PRO H CB  1 
ATOM   6379  C  CG  . PRO H  2 3   ? -20.668 -18.429 -8.691  1.00 26.63 ? 208  PRO H CG  1 
ATOM   6380  C  CD  . PRO H  2 3   ? -20.907 -16.979 -9.023  1.00 26.41 ? 208  PRO H CD  1 
ATOM   6381  N  N   . THR H  2 4   ? -19.388 -19.547 -12.510 1.00 28.56 ? 209  THR H N   1 
ATOM   6382  C  CA  . THR H  2 4   ? -19.874 -20.197 -13.721 1.00 28.67 ? 209  THR H CA  1 
ATOM   6383  C  C   . THR H  2 4   ? -20.945 -21.224 -13.413 1.00 27.56 ? 209  THR H C   1 
ATOM   6384  O  O   . THR H  2 4   ? -21.778 -21.526 -14.263 1.00 27.31 ? 209  THR H O   1 
ATOM   6385  C  CB  . THR H  2 4   ? -18.720 -20.881 -14.462 1.00 30.40 ? 209  THR H CB  1 
ATOM   6386  O  OG1 . THR H  2 4   ? -17.622 -19.968 -14.530 1.00 31.96 ? 209  THR H OG1 1 
ATOM   6387  C  CG2 . THR H  2 4   ? -19.120 -21.265 -15.876 1.00 30.95 ? 209  THR H CG2 1 
ATOM   6388  N  N   . SER H  2 5   ? -20.896 -21.780 -12.207 1.00 27.00 ? 210  SER H N   1 
ATOM   6389  C  CA  . SER H  2 5   ? -21.909 -22.705 -11.746 1.00 26.01 ? 210  SER H CA  1 
ATOM   6390  C  C   . SER H  2 5   ? -22.227 -22.451 -10.282 1.00 24.75 ? 210  SER H C   1 
ATOM   6391  O  O   . SER H  2 5   ? -21.471 -21.786 -9.563  1.00 24.70 ? 210  SER H O   1 
ATOM   6392  C  CB  . SER H  2 5   ? -21.453 -24.153 -11.947 1.00 27.26 ? 210  SER H CB  1 
ATOM   6393  O  OG  . SER H  2 5   ? -20.502 -24.542 -10.967 1.00 28.03 ? 210  SER H OG  1 
ATOM   6394  N  N   . TRP H  2 6   ? -23.371 -22.980 -9.862  1.00 23.58 ? 211  TRP H N   1 
ATOM   6395  C  CA  . TRP H  2 6   ? -23.815 -22.850 -8.494  1.00 22.64 ? 211  TRP H CA  1 
ATOM   6396  C  C   . TRP H  2 6   ? -24.833 -23.936 -8.191  1.00 22.13 ? 211  TRP H C   1 
ATOM   6397  O  O   . TRP H  2 6   ? -25.711 -24.211 -9.003  1.00 21.74 ? 211  TRP H O   1 
ATOM   6398  C  CB  . TRP H  2 6   ? -24.424 -21.461 -8.256  1.00 21.65 ? 211  TRP H CB  1 
ATOM   6399  C  CG  . TRP H  2 6   ? -24.543 -21.120 -6.796  1.00 21.08 ? 211  TRP H CG  1 
ATOM   6400  C  CD1 . TRP H  2 6   ? -25.663 -21.233 -6.026  1.00 20.28 ? 211  TRP H CD1 1 
ATOM   6401  C  CD2 . TRP H  2 6   ? -23.500 -20.645 -5.922  1.00 21.47 ? 211  TRP H CD2 1 
ATOM   6402  N  NE1 . TRP H  2 6   ? -25.382 -20.851 -4.734  1.00 20.19 ? 211  TRP H NE1 1 
ATOM   6403  C  CE2 . TRP H  2 6   ? -24.069 -20.481 -4.645  1.00 20.87 ? 211  TRP H CE2 1 
ATOM   6404  C  CE3 . TRP H  2 6   ? -22.148 -20.333 -6.101  1.00 22.51 ? 211  TRP H CE3 1 
ATOM   6405  C  CZ2 . TRP H  2 6   ? -23.338 -20.024 -3.547  1.00 21.25 ? 211  TRP H CZ2 1 
ATOM   6406  C  CZ3 . TRP H  2 6   ? -21.415 -19.869 -5.009  1.00 22.77 ? 211  TRP H CZ3 1 
ATOM   6407  C  CH2 . TRP H  2 6   ? -22.012 -19.726 -3.747  1.00 22.15 ? 211  TRP H CH2 1 
ATOM   6408  N  N   . ASP H  2 7   ? -24.696 -24.558 -7.026  1.00 22.18 ? 212  ASP H N   1 
ATOM   6409  C  CA  . ASP H  2 7   ? -25.667 -25.523 -6.531  1.00 21.86 ? 212  ASP H CA  1 
ATOM   6410  C  C   . ASP H  2 7   ? -25.771 -25.362 -5.023  1.00 21.58 ? 212  ASP H C   1 
ATOM   6411  O  O   . ASP H  2 7   ? -24.812 -25.622 -4.308  1.00 22.28 ? 212  ASP H O   1 
ATOM   6412  C  CB  . ASP H  2 7   ? -25.234 -26.946 -6.900  1.00 22.91 ? 212  ASP H CB  1 
ATOM   6413  C  CG  . ASP H  2 7   ? -26.308 -27.995 -6.611  1.00 22.91 ? 212  ASP H CG  1 
ATOM   6414  O  OD1 . ASP H  2 7   ? -27.246 -27.753 -5.804  1.00 22.15 ? 212  ASP H OD1 1 
ATOM   6415  O  OD2 . ASP H  2 7   ? -26.221 -29.080 -7.213  1.00 23.76 ? 212  ASP H OD2 1 
ATOM   6416  N  N   . TRP H  2 8   ? -26.934 -24.941 -4.531  1.00 20.64 ? 213  TRP H N   1 
ATOM   6417  C  CA  . TRP H  2 8   ? -27.126 -24.786 -3.070  1.00 20.50 ? 213  TRP H CA  1 
ATOM   6418  C  C   . TRP H  2 8   ? -27.161 -26.111 -2.299  1.00 21.51 ? 213  TRP H C   1 
ATOM   6419  O  O   . TRP H  2 8   ? -27.215 -26.104 -1.067  1.00 21.52 ? 213  TRP H O   1 
ATOM   6420  C  CB  . TRP H  2 8   ? -28.381 -23.977 -2.743  1.00 19.34 ? 213  TRP H CB  1 
ATOM   6421  C  CG  . TRP H  2 8   ? -28.187 -22.494 -2.841  1.00 18.72 ? 213  TRP H CG  1 
ATOM   6422  C  CD1 . TRP H  2 8   ? -28.701 -21.665 -3.794  1.00 18.07 ? 213  TRP H CD1 1 
ATOM   6423  C  CD2 . TRP H  2 8   ? -27.422 -21.670 -1.960  1.00 18.78 ? 213  TRP H CD2 1 
ATOM   6424  N  NE1 . TRP H  2 8   ? -28.317 -20.379 -3.549  1.00 17.78 ? 213  TRP H NE1 1 
ATOM   6425  C  CE2 . TRP H  2 8   ? -27.532 -20.349 -2.431  1.00 18.20 ? 213  TRP H CE2 1 
ATOM   6426  C  CE3 . TRP H  2 8   ? -26.657 -21.920 -0.809  1.00 19.46 ? 213  TRP H CE3 1 
ATOM   6427  C  CZ2 . TRP H  2 8   ? -26.892 -19.274 -1.808  1.00 18.28 ? 213  TRP H CZ2 1 
ATOM   6428  C  CZ3 . TRP H  2 8   ? -26.039 -20.858 -0.180  1.00 19.43 ? 213  TRP H CZ3 1 
ATOM   6429  C  CH2 . TRP H  2 8   ? -26.149 -19.546 -0.688  1.00 18.88 ? 213  TRP H CH2 1 
ATOM   6430  N  N   . ARG H  2 9   ? -27.142 -27.237 -3.008  1.00 22.29 ? 214  ARG H N   1 
ATOM   6431  C  CA  . ARG H  2 9   ? -26.953 -28.521 -2.339  1.00 23.64 ? 214  ARG H CA  1 
ATOM   6432  C  C   . ARG H  2 9   ? -25.487 -28.792 -2.054  1.00 25.14 ? 214  ARG H C   1 
ATOM   6433  O  O   . ARG H  2 9   ? -25.174 -29.642 -1.236  1.00 26.38 ? 214  ARG H O   1 
ATOM   6434  C  CB  . ARG H  2 9   ? -27.528 -29.667 -3.164  1.00 23.87 ? 214  ARG H CB  1 
ATOM   6435  C  CG  . ARG H  2 9   ? -29.018 -29.531 -3.420  1.00 22.99 ? 214  ARG H CG  1 
ATOM   6436  C  CD  . ARG H  2 9   ? -29.479 -30.501 -4.490  1.00 23.46 ? 214  ARG H CD  1 
ATOM   6437  N  NE  . ARG H  2 9   ? -28.804 -30.272 -5.762  1.00 23.62 ? 214  ARG H NE  1 
ATOM   6438  C  CZ  . ARG H  2 9   ? -28.918 -31.068 -6.822  1.00 24.21 ? 214  ARG H CZ  1 
ATOM   6439  N  NH1 . ARG H  2 9   ? -29.682 -32.146 -6.775  1.00 24.75 ? 214  ARG H NH1 1 
ATOM   6440  N  NH2 . ARG H  2 9   ? -28.266 -30.786 -7.935  1.00 24.38 ? 214  ARG H NH2 1 
ATOM   6441  N  N   . ASN H  2 10  ? -24.594 -28.072 -2.721  1.00 25.41 ? 215  ASN H N   1 
ATOM   6442  C  CA  . ASN H  2 10  ? -23.176 -28.358 -2.629  1.00 27.36 ? 215  ASN H CA  1 
ATOM   6443  C  C   . ASN H  2 10  ? -22.349 -27.079 -2.736  1.00 27.71 ? 215  ASN H C   1 
ATOM   6444  O  O   . ASN H  2 10  ? -21.832 -26.733 -3.800  1.00 27.87 ? 215  ASN H O   1 
ATOM   6445  C  CB  . ASN H  2 10  ? -22.793 -29.367 -3.721  1.00 28.34 ? 215  ASN H CB  1 
ATOM   6446  C  CG  . ASN H  2 10  ? -21.407 -29.946 -3.527  1.00 29.93 ? 215  ASN H CG  1 
ATOM   6447  O  OD1 . ASN H  2 10  ? -20.564 -29.373 -2.840  1.00 30.10 ? 215  ASN H OD1 1 
ATOM   6448  N  ND2 . ASN H  2 10  ? -21.168 -31.102 -4.133  1.00 31.19 ? 215  ASN H ND2 1 
ATOM   6449  N  N   . VAL H  2 11  ? -22.269 -26.368 -1.621  1.00 28.76 ? 216  VAL H N   1 
ATOM   6450  C  CA  . VAL H  2 11  ? -21.495 -25.147 -1.525  1.00 30.05 ? 216  VAL H CA  1 
ATOM   6451  C  C   . VAL H  2 11  ? -20.254 -25.483 -0.714  1.00 33.00 ? 216  VAL H C   1 
ATOM   6452  O  O   . VAL H  2 11  ? -20.293 -25.484 0.514   1.00 33.43 ? 216  VAL H O   1 
ATOM   6453  C  CB  . VAL H  2 11  ? -22.285 -24.029 -0.822  1.00 28.92 ? 216  VAL H CB  1 
ATOM   6454  C  CG1 . VAL H  2 11  ? -21.419 -22.780 -0.675  1.00 29.36 ? 216  VAL H CG1 1 
ATOM   6455  C  CG2 . VAL H  2 11  ? -23.568 -23.732 -1.584  1.00 27.35 ? 216  VAL H CG2 1 
ATOM   6456  N  N   . HIS H  2 12  ? -19.162 -25.784 -1.415  1.00 36.70 ? 217  HIS H N   1 
ATOM   6457  C  CA  . HIS H  2 12  ? -17.956 -26.329 -0.792  1.00 40.06 ? 217  HIS H CA  1 
ATOM   6458  C  C   . HIS H  2 12  ? -18.352 -27.449 0.175   1.00 39.14 ? 217  HIS H C   1 
ATOM   6459  O  O   . HIS H  2 12  ? -18.021 -27.413 1.357   1.00 40.87 ? 217  HIS H O   1 
ATOM   6460  C  CB  . HIS H  2 12  ? -17.152 -25.209 -0.110  1.00 44.07 ? 217  HIS H CB  1 
ATOM   6461  C  CG  . HIS H  2 12  ? -17.002 -23.986 -0.966  1.00 48.36 ? 217  HIS H CG  1 
ATOM   6462  N  ND1 . HIS H  2 12  ? -17.412 -22.732 -0.560  1.00 51.87 ? 217  HIS H ND1 1 
ATOM   6463  C  CD2 . HIS H  2 12  ? -16.538 -23.838 -2.233  1.00 51.53 ? 217  HIS H CD2 1 
ATOM   6464  C  CE1 . HIS H  2 12  ? -17.185 -21.860 -1.529  1.00 52.17 ? 217  HIS H CE1 1 
ATOM   6465  N  NE2 . HIS H  2 12  ? -16.654 -22.505 -2.555  1.00 53.35 ? 217  HIS H NE2 1 
ATOM   6466  N  N   . GLY H  2 13  ? -19.122 -28.405 -0.339  1.00 37.64 ? 218  GLY H N   1 
ATOM   6467  C  CA  . GLY H  2 13  ? -19.475 -29.612 0.395   1.00 37.79 ? 218  GLY H CA  1 
ATOM   6468  C  C   . GLY H  2 13  ? -20.672 -29.544 1.328   1.00 35.98 ? 218  GLY H C   1 
ATOM   6469  O  O   . GLY H  2 13  ? -21.061 -30.573 1.900   1.00 36.16 ? 218  GLY H O   1 
ATOM   6470  N  N   . ILE H  2 14  ? -21.266 -28.358 1.485   1.00 33.42 ? 219  ILE H N   1 
ATOM   6471  C  CA  . ILE H  2 14  ? -22.368 -28.187 2.422   1.00 31.65 ? 219  ILE H CA  1 
ATOM   6472  C  C   . ILE H  2 14  ? -23.685 -28.099 1.664   1.00 29.65 ? 219  ILE H C   1 
ATOM   6473  O  O   . ILE H  2 14  ? -23.742 -27.585 0.536   1.00 28.57 ? 219  ILE H O   1 
ATOM   6474  C  CB  . ILE H  2 14  ? -22.171 -26.944 3.308   1.00 31.29 ? 219  ILE H CB  1 
ATOM   6475  C  CG1 . ILE H  2 14  ? -20.817 -27.003 4.026   1.00 32.75 ? 219  ILE H CG1 1 
ATOM   6476  C  CG2 . ILE H  2 14  ? -23.277 -26.835 4.350   1.00 30.50 ? 219  ILE H CG2 1 
ATOM   6477  C  CD1 . ILE H  2 14  ? -20.266 -25.627 4.339   1.00 32.70 ? 219  ILE H CD1 1 
ATOM   6478  N  N   . ASN H  2 15  ? -24.741 -28.619 2.288   1.00 28.71 ? 220  ASN H N   1 
ATOM   6479  C  CA  . ASN H  2 15  ? -26.071 -28.610 1.702   1.00 26.63 ? 220  ASN H CA  1 
ATOM   6480  C  C   . ASN H  2 15  ? -26.958 -27.661 2.473   1.00 25.18 ? 220  ASN H C   1 
ATOM   6481  O  O   . ASN H  2 15  ? -26.993 -27.705 3.695   1.00 25.72 ? 220  ASN H O   1 
ATOM   6482  C  CB  . ASN H  2 15  ? -26.665 -30.018 1.715   1.00 27.12 ? 220  ASN H CB  1 
ATOM   6483  C  CG  . ASN H  2 15  ? -28.130 -30.039 1.305   1.00 26.06 ? 220  ASN H CG  1 
ATOM   6484  O  OD1 . ASN H  2 15  ? -28.491 -29.619 0.210   1.00 25.11 ? 220  ASN H OD1 1 
ATOM   6485  N  ND2 . ASN H  2 15  ? -28.979 -30.514 2.191   1.00 26.34 ? 220  ASN H ND2 1 
ATOM   6486  N  N   . PHE H  2 16  ? -27.681 -26.807 1.763   1.00 23.53 ? 221  PHE H N   1 
ATOM   6487  C  CA  . PHE H  2 16  ? -28.593 -25.868 2.405   1.00 22.47 ? 221  PHE H CA  1 
ATOM   6488  C  C   . PHE H  2 16  ? -30.041 -26.056 1.989   1.00 21.58 ? 221  PHE H C   1 
ATOM   6489  O  O   . PHE H  2 16  ? -30.890 -25.283 2.400   1.00 20.74 ? 221  PHE H O   1 
ATOM   6490  C  CB  . PHE H  2 16  ? -28.162 -24.435 2.094   1.00 21.73 ? 221  PHE H CB  1 
ATOM   6491  C  CG  . PHE H  2 16  ? -26.874 -24.043 2.745   1.00 22.38 ? 221  PHE H CG  1 
ATOM   6492  C  CD1 . PHE H  2 16  ? -26.872 -23.474 4.007   1.00 22.56 ? 221  PHE H CD1 1 
ATOM   6493  C  CD2 . PHE H  2 16  ? -25.668 -24.240 2.100   1.00 22.92 ? 221  PHE H CD2 1 
ATOM   6494  C  CE1 . PHE H  2 16  ? -25.683 -23.102 4.611   1.00 23.34 ? 221  PHE H CE1 1 
ATOM   6495  C  CE2 . PHE H  2 16  ? -24.473 -23.877 2.695   1.00 23.70 ? 221  PHE H CE2 1 
ATOM   6496  C  CZ  . PHE H  2 16  ? -24.474 -23.307 3.951   1.00 23.87 ? 221  PHE H CZ  1 
ATOM   6497  N  N   . VAL H  2 17  ? -30.330 -27.069 1.176   1.00 21.88 ? 222  VAL H N   1 
ATOM   6498  C  CA  . VAL H  2 17  ? -31.699 -27.296 0.697   1.00 21.30 ? 222  VAL H CA  1 
ATOM   6499  C  C   . VAL H  2 17  ? -32.313 -28.478 1.423   1.00 21.97 ? 222  VAL H C   1 
ATOM   6500  O  O   . VAL H  2 17  ? -31.690 -29.514 1.571   1.00 22.95 ? 222  VAL H O   1 
ATOM   6501  C  CB  . VAL H  2 17  ? -31.745 -27.511 -0.830  1.00 21.10 ? 222  VAL H CB  1 
ATOM   6502  C  CG1 . VAL H  2 17  ? -33.174 -27.577 -1.319  1.00 20.61 ? 222  VAL H CG1 1 
ATOM   6503  C  CG2 . VAL H  2 17  ? -31.017 -26.367 -1.536  1.00 20.66 ? 222  VAL H CG2 1 
ATOM   6504  N  N   . SER H  2 18  ? -33.542 -28.299 1.883   1.00 21.71 ? 223  SER H N   1 
ATOM   6505  C  CA  . SER H  2 18  ? -34.260 -29.324 2.601   1.00 22.54 ? 223  SER H CA  1 
ATOM   6506  C  C   . SER H  2 18  ? -34.701 -30.453 1.660   1.00 23.04 ? 223  SER H C   1 
ATOM   6507  O  O   . SER H  2 18  ? -34.712 -30.284 0.438   1.00 22.69 ? 223  SER H O   1 
ATOM   6508  C  CB  . SER H  2 18  ? -35.463 -28.693 3.272   1.00 22.18 ? 223  SER H CB  1 
ATOM   6509  O  OG  . SER H  2 18  ? -36.237 -28.038 2.303   1.00 21.51 ? 223  SER H OG  1 
ATOM   6510  N  N   . PRO H  2 19  ? -35.071 -31.609 2.233   1.00 24.11 ? 224  PRO H N   1 
ATOM   6511  C  CA  . PRO H  2 19  ? -35.369 -32.788 1.416   1.00 24.82 ? 224  PRO H CA  1 
ATOM   6512  C  C   . PRO H  2 19  ? -36.518 -32.604 0.428   1.00 24.27 ? 224  PRO H C   1 
ATOM   6513  O  O   . PRO H  2 19  ? -37.414 -31.789 0.654   1.00 23.91 ? 224  PRO H O   1 
ATOM   6514  C  CB  . PRO H  2 19  ? -35.735 -33.856 2.462   1.00 25.97 ? 224  PRO H CB  1 
ATOM   6515  C  CG  . PRO H  2 19  ? -35.099 -33.398 3.733   1.00 26.09 ? 224  PRO H CG  1 
ATOM   6516  C  CD  . PRO H  2 19  ? -35.194 -31.904 3.676   1.00 24.85 ? 224  PRO H CD  1 
ATOM   6517  N  N   . VAL H  2 20  ? -36.462 -33.357 -0.666  1.00 24.53 ? 225  VAL H N   1 
ATOM   6518  C  CA  . VAL H  2 20  ? -37.525 -33.382 -1.660  1.00 24.23 ? 225  VAL H CA  1 
ATOM   6519  C  C   . VAL H  2 20  ? -38.763 -34.042 -1.046  1.00 24.84 ? 225  VAL H C   1 
ATOM   6520  O  O   . VAL H  2 20  ? -38.655 -35.037 -0.354  1.00 25.87 ? 225  VAL H O   1 
ATOM   6521  C  CB  . VAL H  2 20  ? -37.076 -34.158 -2.927  1.00 24.79 ? 225  VAL H CB  1 
ATOM   6522  C  CG1 . VAL H  2 20  ? -38.244 -34.429 -3.881  1.00 24.81 ? 225  VAL H CG1 1 
ATOM   6523  C  CG2 . VAL H  2 20  ? -35.962 -33.403 -3.637  1.00 24.10 ? 225  VAL H CG2 1 
ATOM   6524  N  N   . ARG H  2 21  ? -39.931 -33.468 -1.311  1.00 24.32 ? 226  ARG H N   1 
ATOM   6525  C  CA  . ARG H  2 21  ? -41.202 -33.979 -0.810  1.00 24.96 ? 226  ARG H CA  1 
ATOM   6526  C  C   . ARG H  2 21  ? -42.143 -34.354 -1.952  1.00 25.20 ? 226  ARG H C   1 
ATOM   6527  O  O   . ARG H  2 21  ? -41.838 -34.137 -3.129  1.00 24.54 ? 226  ARG H O   1 
ATOM   6528  C  CB  . ARG H  2 21  ? -41.872 -32.934 0.076   1.00 24.45 ? 226  ARG H CB  1 
ATOM   6529  C  CG  . ARG H  2 21  ? -41.053 -32.589 1.305   1.00 24.49 ? 226  ARG H CG  1 
ATOM   6530  C  CD  . ARG H  2 21  ? -41.844 -31.776 2.297   1.00 24.38 ? 226  ARG H CD  1 
ATOM   6531  N  NE  . ARG H  2 21  ? -42.943 -32.560 2.864   1.00 25.55 ? 226  ARG H NE  1 
ATOM   6532  C  CZ  . ARG H  2 21  ? -43.733 -32.139 3.845   1.00 25.99 ? 226  ARG H CZ  1 
ATOM   6533  N  NH1 . ARG H  2 21  ? -43.548 -30.938 4.395   1.00 25.50 ? 226  ARG H NH1 1 
ATOM   6534  N  NH2 . ARG H  2 21  ? -44.715 -32.914 4.275   1.00 27.19 ? 226  ARG H NH2 1 
ATOM   6535  N  N   . ASN H  2 22  ? -43.283 -34.941 -1.591  1.00 26.14 ? 227  ASN H N   1 
ATOM   6536  C  CA  . ASN H  2 22  ? -44.337 -35.239 -2.549  1.00 26.52 ? 227  ASN H CA  1 
ATOM   6537  C  C   . ASN H  2 22  ? -45.623 -34.485 -2.247  1.00 26.26 ? 227  ASN H C   1 
ATOM   6538  O  O   . ASN H  2 22  ? -46.186 -34.619 -1.177  1.00 26.79 ? 227  ASN H O   1 
ATOM   6539  C  CB  . ASN H  2 22  ? -44.621 -36.742 -2.568  1.00 28.04 ? 227  ASN H CB  1 
ATOM   6540  C  CG  . ASN H  2 22  ? -45.304 -37.180 -3.851  1.00 28.52 ? 227  ASN H CG  1 
ATOM   6541  O  OD1 . ASN H  2 22  ? -46.070 -36.422 -4.464  1.00 28.03 ? 227  ASN H OD1 1 
ATOM   6542  N  ND2 . ASN H  2 22  ? -45.006 -38.383 -4.284  1.00 29.63 ? 227  ASN H ND2 1 
ATOM   6543  N  N   . GLN H  2 23  ? -46.092 -33.704 -3.203  1.00 25.85 ? 228  GLN H N   1 
ATOM   6544  C  CA  . GLN H  2 23  ? -47.369 -32.993 -3.070  1.00 25.92 ? 228  GLN H CA  1 
ATOM   6545  C  C   . GLN H  2 23  ? -48.608 -33.902 -3.292  1.00 27.34 ? 228  GLN H C   1 
ATOM   6546  O  O   . GLN H  2 23  ? -49.738 -33.496 -3.010  1.00 27.53 ? 228  GLN H O   1 
ATOM   6547  C  CB  . GLN H  2 23  ? -47.411 -31.804 -4.039  1.00 25.04 ? 228  GLN H CB  1 
ATOM   6548  C  CG  . GLN H  2 23  ? -47.521 -32.180 -5.510  1.00 25.44 ? 228  GLN H CG  1 
ATOM   6549  C  CD  . GLN H  2 23  ? -47.399 -30.978 -6.425  1.00 24.83 ? 228  GLN H CD  1 
ATOM   6550  O  OE1 . GLN H  2 23  ? -46.352 -30.338 -6.490  1.00 23.91 ? 228  GLN H OE1 1 
ATOM   6551  N  NE2 . GLN H  2 23  ? -48.466 -30.669 -7.137  1.00 25.47 ? 228  GLN H NE2 1 
ATOM   6552  N  N   . ALA H  2 24  ? -48.390 -35.109 -3.815  1.00 28.30 ? 229  ALA H N   1 
ATOM   6553  C  CA  . ALA H  2 24  ? -49.477 -36.048 -4.117  1.00 29.95 ? 229  ALA H CA  1 
ATOM   6554  C  C   . ALA H  2 24  ? -50.418 -35.466 -5.186  1.00 29.93 ? 229  ALA H C   1 
ATOM   6555  O  O   . ALA H  2 24  ? -49.955 -34.769 -6.084  1.00 29.62 ? 229  ALA H O   1 
ATOM   6556  C  CB  . ALA H  2 24  ? -50.215 -36.446 -2.835  1.00 30.86 ? 229  ALA H CB  1 
ATOM   6557  N  N   . SER H  2 25  ? -51.716 -35.740 -5.108  1.00 31.18 ? 230  SER H N   1 
ATOM   6558  C  CA  . SER H  2 25  ? -52.653 -35.272 -6.143  1.00 31.60 ? 230  SER H CA  1 
ATOM   6559  C  C   . SER H  2 25  ? -53.190 -33.839 -5.934  1.00 30.95 ? 230  SER H C   1 
ATOM   6560  O  O   . SER H  2 25  ? -53.774 -33.251 -6.854  1.00 31.19 ? 230  SER H O   1 
ATOM   6561  C  CB  . SER H  2 25  ? -53.813 -36.264 -6.308  1.00 33.09 ? 230  SER H CB  1 
ATOM   6562  O  OG  . SER H  2 25  ? -54.662 -36.235 -5.187  1.00 33.77 ? 230  SER H OG  1 
ATOM   6563  N  N   . CYS H  2 26  ? -52.987 -33.290 -4.739  1.00 30.49 ? 231  CYS H N   1 
ATOM   6564  C  CA  . CYS H  2 26  ? -53.395 -31.923 -4.402  1.00 29.77 ? 231  CYS H CA  1 
ATOM   6565  C  C   . CYS H  2 26  ? -52.598 -30.902 -5.228  1.00 28.16 ? 231  CYS H C   1 
ATOM   6566  O  O   . CYS H  2 26  ? -51.384 -31.034 -5.384  1.00 27.42 ? 231  CYS H O   1 
ATOM   6567  C  CB  . CYS H  2 26  ? -53.175 -31.711 -2.891  1.00 29.91 ? 231  CYS H CB  1 
ATOM   6568  S  SG  . CYS H  2 26  ? -53.608 -30.110 -2.165  1.00 29.31 ? 231  CYS H SG  1 
ATOM   6569  N  N   . GLY H  2 27  ? -53.278 -29.886 -5.752  1.00 27.72 ? 232  GLY H N   1 
ATOM   6570  C  CA  . GLY H  2 27  ? -52.618 -28.815 -6.498  1.00 26.64 ? 232  GLY H CA  1 
ATOM   6571  C  C   . GLY H  2 27  ? -51.918 -27.810 -5.586  1.00 25.63 ? 232  GLY H C   1 
ATOM   6572  O  O   . GLY H  2 27  ? -52.254 -26.621 -5.577  1.00 25.19 ? 232  GLY H O   1 
ATOM   6573  N  N   . SER H  2 28  ? -50.939 -28.285 -4.826  1.00 25.14 ? 233  SER H N   1 
ATOM   6574  C  CA  . SER H  2 28  ? -50.329 -27.496 -3.780  1.00 24.32 ? 233  SER H CA  1 
ATOM   6575  C  C   . SER H  2 28  ? -48.873 -27.163 -4.099  1.00 23.28 ? 233  SER H C   1 
ATOM   6576  O  O   . SER H  2 28  ? -48.123 -26.782 -3.218  1.00 22.65 ? 233  SER H O   1 
ATOM   6577  C  CB  . SER H  2 28  ? -50.407 -28.271 -2.468  1.00 24.95 ? 233  SER H CB  1 
ATOM   6578  O  OG  . SER H  2 28  ? -49.830 -29.554 -2.623  1.00 25.28 ? 233  SER H OG  1 
ATOM   6579  N  N   . CYS H  2 29  ? -48.476 -27.295 -5.357  1.00 23.51 ? 234  CYS H N   1 
ATOM   6580  C  CA  . CYS H  2 29  ? -47.103 -26.999 -5.764  1.00 22.75 ? 234  CYS H CA  1 
ATOM   6581  C  C   . CYS H  2 29  ? -46.626 -25.601 -5.339  1.00 21.10 ? 234  CYS H C   1 
ATOM   6582  O  O   . CYS H  2 29  ? -45.458 -25.425 -5.009  1.00 20.70 ? 234  CYS H O   1 
ATOM   6583  C  CB  . CYS H  2 29  ? -46.962 -27.151 -7.287  1.00 23.28 ? 234  CYS H CB  1 
ATOM   6584  S  SG  . CYS H  2 29  ? -48.040 -26.071 -8.256  1.00 25.01 ? 234  CYS H SG  1 
ATOM   6585  N  N   . TYR H  2 30  ? -47.523 -24.618 -5.372  1.00 20.46 ? 235  TYR H N   1 
ATOM   6586  C  CA  . TYR H  2 30  ? -47.205 -23.248 -4.963  1.00 19.46 ? 235  TYR H CA  1 
ATOM   6587  C  C   . TYR H  2 30  ? -46.777 -23.195 -3.496  1.00 19.33 ? 235  TYR H C   1 
ATOM   6588  O  O   . TYR H  2 30  ? -45.949 -22.361 -3.097  1.00 18.62 ? 235  TYR H O   1 
ATOM   6589  C  CB  . TYR H  2 30  ? -48.398 -22.304 -5.200  1.00 19.42 ? 235  TYR H CB  1 
ATOM   6590  C  CG  . TYR H  2 30  ? -49.607 -22.608 -4.331  1.00 20.05 ? 235  TYR H CG  1 
ATOM   6591  C  CD1 . TYR H  2 30  ? -50.560 -23.539 -4.728  1.00 20.93 ? 235  TYR H CD1 1 
ATOM   6592  C  CD2 . TYR H  2 30  ? -49.790 -21.961 -3.113  1.00 19.78 ? 235  TYR H CD2 1 
ATOM   6593  C  CE1 . TYR H  2 30  ? -51.659 -23.822 -3.936  1.00 21.67 ? 235  TYR H CE1 1 
ATOM   6594  C  CE2 . TYR H  2 30  ? -50.879 -22.239 -2.309  1.00 20.51 ? 235  TYR H CE2 1 
ATOM   6595  C  CZ  . TYR H  2 30  ? -51.815 -23.175 -2.725  1.00 21.48 ? 235  TYR H CZ  1 
ATOM   6596  O  OH  . TYR H  2 30  ? -52.905 -23.463 -1.939  1.00 22.32 ? 235  TYR H OH  1 
ATOM   6597  N  N   . SER H  2 31  ? -47.365 -24.075 -2.695  1.00 19.90 ? 236  SER H N   1 
ATOM   6598  C  CA  . SER H  2 31  ? -47.047 -24.142 -1.289  1.00 19.94 ? 236  SER H CA  1 
ATOM   6599  C  C   . SER H  2 31  ? -45.728 -24.847 -1.044  1.00 19.55 ? 236  SER H C   1 
ATOM   6600  O  O   . SER H  2 31  ? -44.971 -24.432 -0.187  1.00 19.02 ? 236  SER H O   1 
ATOM   6601  C  CB  . SER H  2 31  ? -48.126 -24.875 -0.515  1.00 21.07 ? 236  SER H CB  1 
ATOM   6602  O  OG  . SER H  2 31  ? -47.815 -24.749 0.856   1.00 21.46 ? 236  SER H OG  1 
ATOM   6603  N  N   . PHE H  2 32  ? -45.470 -25.926 -1.779  1.00 19.69 ? 237  PHE H N   1 
ATOM   6604  C  CA  . PHE H  2 32  ? -44.213 -26.650 -1.631  1.00 19.68 ? 237  PHE H CA  1 
ATOM   6605  C  C   . PHE H  2 32  ? -43.018 -25.831 -2.129  1.00 18.69 ? 237  PHE H C   1 
ATOM   6606  O  O   . PHE H  2 32  ? -41.919 -25.926 -1.571  1.00 18.91 ? 237  PHE H O   1 
ATOM   6607  C  CB  . PHE H  2 32  ? -44.277 -27.999 -2.341  1.00 20.42 ? 237  PHE H CB  1 
ATOM   6608  C  CG  . PHE H  2 32  ? -44.978 -29.053 -1.550  1.00 21.48 ? 237  PHE H CG  1 
ATOM   6609  C  CD1 . PHE H  2 32  ? -46.358 -29.137 -1.558  1.00 22.02 ? 237  PHE H CD1 1 
ATOM   6610  C  CD2 . PHE H  2 32  ? -44.262 -29.948 -0.777  1.00 22.05 ? 237  PHE H CD2 1 
ATOM   6611  C  CE1 . PHE H  2 32  ? -47.012 -30.099 -0.815  1.00 23.10 ? 237  PHE H CE1 1 
ATOM   6612  C  CE2 . PHE H  2 32  ? -44.910 -30.915 -0.040  1.00 23.13 ? 237  PHE H CE2 1 
ATOM   6613  C  CZ  . PHE H  2 32  ? -46.287 -30.993 -0.059  1.00 23.66 ? 237  PHE H CZ  1 
ATOM   6614  N  N   . ALA H  2 33  ? -43.251 -25.047 -3.183  1.00 17.90 ? 238  ALA H N   1 
ATOM   6615  C  CA  . ALA H  2 33  ? -42.256 -24.111 -3.720  1.00 16.99 ? 238  ALA H CA  1 
ATOM   6616  C  C   . ALA H  2 33  ? -41.940 -23.027 -2.701  1.00 16.42 ? 238  ALA H C   1 
ATOM   6617  O  O   . ALA H  2 33  ? -40.781 -22.792 -2.377  1.00 16.14 ? 238  ALA H O   1 
ATOM   6618  C  CB  . ALA H  2 33  ? -42.770 -23.479 -4.997  1.00 16.79 ? 238  ALA H CB  1 
ATOM   6619  N  N   . SER H  2 34  ? -42.986 -22.386 -2.195  1.00 16.21 ? 239  SER H N   1 
ATOM   6620  C  CA  . SER H  2 34  ? -42.873 -21.373 -1.161  1.00 15.87 ? 239  SER H CA  1 
ATOM   6621  C  C   . SER H  2 34  ? -42.158 -21.876 0.072   1.00 16.16 ? 239  SER H C   1 
ATOM   6622  O  O   . SER H  2 34  ? -41.173 -21.288 0.512   1.00 15.82 ? 239  SER H O   1 
ATOM   6623  C  CB  . SER H  2 34  ? -44.267 -20.894 -0.746  1.00 16.08 ? 239  SER H CB  1 
ATOM   6624  O  OG  . SER H  2 34  ? -44.873 -20.167 -1.798  1.00 15.92 ? 239  SER H OG  1 
ATOM   6625  N  N   . MET H  2 35  ? -42.688 -22.938 0.672   1.00 16.92 ? 240  MET H N   1 
ATOM   6626  C  CA  . MET H  2 35  ? -42.091 -23.481 1.885   1.00 17.42 ? 240  MET H CA  1 
ATOM   6627  C  C   . MET H  2 35  ? -40.620 -23.793 1.614   1.00 17.25 ? 240  MET H C   1 
ATOM   6628  O  O   . MET H  2 35  ? -39.757 -23.432 2.398   1.00 17.45 ? 240  MET H O   1 
ATOM   6629  C  CB  . MET H  2 35  ? -42.813 -24.753 2.339   1.00 18.37 ? 240  MET H CB  1 
ATOM   6630  C  CG  . MET H  2 35  ? -44.288 -24.602 2.678   1.00 18.81 ? 240  MET H CG  1 
ATOM   6631  S  SD  . MET H  2 35  ? -44.654 -23.315 3.872   1.00 18.93 ? 240  MET H SD  1 
ATOM   6632  C  CE  . MET H  2 35  ? -44.823 -21.843 2.849   1.00 17.91 ? 240  MET H CE  1 
ATOM   6633  N  N   . GLY H  2 36  ? -40.337 -24.435 0.483   1.00 17.15 ? 241  GLY H N   1 
ATOM   6634  C  CA  . GLY H  2 36  ? -38.971 -24.820 0.132   1.00 17.17 ? 241  GLY H CA  1 
ATOM   6635  C  C   . GLY H  2 36  ? -37.993 -23.657 0.028   1.00 16.52 ? 241  GLY H C   1 
ATOM   6636  O  O   . GLY H  2 36  ? -36.833 -23.773 0.418   1.00 16.81 ? 241  GLY H O   1 
ATOM   6637  N  N   . MET H  2 37  ? -38.464 -22.537 -0.510  1.00 15.84 ? 242  MET H N   1 
ATOM   6638  C  CA  . MET H  2 37  ? -37.655 -21.321 -0.566  1.00 15.31 ? 242  MET H CA  1 
ATOM   6639  C  C   . MET H  2 37  ? -37.301 -20.839 0.830   1.00 15.40 ? 242  MET H C   1 
ATOM   6640  O  O   . MET H  2 37  ? -36.155 -20.579 1.118   1.00 15.48 ? 242  MET H O   1 
ATOM   6641  C  CB  . MET H  2 37  ? -38.372 -20.193 -1.316  1.00 14.73 ? 242  MET H CB  1 
ATOM   6642  C  CG  . MET H  2 37  ? -37.714 -18.831 -1.103  1.00 14.35 ? 242  MET H CG  1 
ATOM   6643  S  SD  . MET H  2 37  ? -38.152 -17.605 -2.341  1.00 13.92 ? 242  MET H SD  1 
ATOM   6644  C  CE  . MET H  2 37  ? -39.915 -17.492 -2.073  1.00 13.94 ? 242  MET H CE  1 
ATOM   6645  N  N   . LEU H  2 38  ? -38.300 -20.712 1.688   1.00 15.63 ? 243  LEU H N   1 
ATOM   6646  C  CA  . LEU H  2 38  ? -38.073 -20.190 3.032   1.00 15.90 ? 243  LEU H CA  1 
ATOM   6647  C  C   . LEU H  2 38  ? -37.217 -21.141 3.857   1.00 16.63 ? 243  LEU H C   1 
ATOM   6648  O  O   . LEU H  2 38  ? -36.335 -20.690 4.567   1.00 16.70 ? 243  LEU H O   1 
ATOM   6649  C  CB  . LEU H  2 38  ? -39.397 -19.886 3.730   1.00 16.04 ? 243  LEU H CB  1 
ATOM   6650  C  CG  . LEU H  2 38  ? -40.293 -18.891 2.980   1.00 15.58 ? 243  LEU H CG  1 
ATOM   6651  C  CD1 . LEU H  2 38  ? -41.615 -18.749 3.678   1.00 15.99 ? 243  LEU H CD1 1 
ATOM   6652  C  CD2 . LEU H  2 38  ? -39.637 -17.521 2.854   1.00 15.22 ? 243  LEU H CD2 1 
ATOM   6653  N  N   . GLU H  2 39  ? -37.462 -22.447 3.731   1.00 17.28 ? 244  GLU H N   1 
ATOM   6654  C  CA  . GLU H  2 39  ? -36.688 -23.446 4.455   1.00 18.24 ? 244  GLU H CA  1 
ATOM   6655  C  C   . GLU H  2 39  ? -35.221 -23.382 4.055   1.00 18.10 ? 244  GLU H C   1 
ATOM   6656  O  O   . GLU H  2 39  ? -34.358 -23.429 4.909   1.00 18.79 ? 244  GLU H O   1 
ATOM   6657  C  CB  . GLU H  2 39  ? -37.220 -24.864 4.200   1.00 19.17 ? 244  GLU H CB  1 
ATOM   6658  C  CG  . GLU H  2 39  ? -38.591 -25.175 4.798   1.00 19.80 ? 244  GLU H CG  1 
ATOM   6659  C  CD  . GLU H  2 39  ? -39.239 -26.421 4.191   1.00 20.72 ? 244  GLU H CD  1 
ATOM   6660  O  OE1 . GLU H  2 39  ? -38.699 -26.943 3.189   1.00 20.57 ? 244  GLU H OE1 1 
ATOM   6661  O  OE2 . GLU H  2 39  ? -40.292 -26.894 4.711   1.00 22.02 ? 244  GLU H OE2 1 
ATOM   6662  N  N   . ALA H  2 40  ? -34.933 -23.286 2.760   1.00 17.50 ? 245  ALA H N   1 
ATOM   6663  C  CA  . ALA H  2 40  ? -33.547 -23.210 2.316   1.00 17.57 ? 245  ALA H CA  1 
ATOM   6664  C  C   . ALA H  2 40  ? -32.899 -21.946 2.854   1.00 17.36 ? 245  ALA H C   1 
ATOM   6665  O  O   . ALA H  2 40  ? -31.794 -21.981 3.384   1.00 17.89 ? 245  ALA H O   1 
ATOM   6666  C  CB  . ALA H  2 40  ? -33.454 -23.228 0.799   1.00 17.14 ? 245  ALA H CB  1 
ATOM   6667  N  N   . ARG H  2 41  ? -33.605 -20.828 2.718   1.00 16.67 ? 246  ARG H N   1 
ATOM   6668  C  CA  . ARG H  2 41  ? -33.072 -19.531 3.112   1.00 16.48 ? 246  ARG H CA  1 
ATOM   6669  C  C   . ARG H  2 41  ? -32.896 -19.363 4.627   1.00 16.97 ? 246  ARG H C   1 
ATOM   6670  O  O   . ARG H  2 41  ? -31.994 -18.667 5.050   1.00 17.15 ? 246  ARG H O   1 
ATOM   6671  C  CB  . ARG H  2 41  ? -33.922 -18.411 2.512   1.00 15.87 ? 246  ARG H CB  1 
ATOM   6672  C  CG  . ARG H  2 41  ? -33.761 -18.294 0.995   1.00 15.60 ? 246  ARG H CG  1 
ATOM   6673  C  CD  . ARG H  2 41  ? -34.532 -17.122 0.417   1.00 15.23 ? 246  ARG H CD  1 
ATOM   6674  N  NE  . ARG H  2 41  ? -34.201 -16.907 -0.986  1.00 15.00 ? 246  ARG H NE  1 
ATOM   6675  C  CZ  . ARG H  2 41  ? -34.294 -15.739 -1.624  1.00 14.76 ? 246  ARG H CZ  1 
ATOM   6676  N  NH1 . ARG H  2 41  ? -34.736 -14.647 -1.019  1.00 14.66 ? 246  ARG H NH1 1 
ATOM   6677  N  NH2 . ARG H  2 41  ? -33.936 -15.663 -2.890  1.00 14.77 ? 246  ARG H NH2 1 
ATOM   6678  N  N   . ILE H  2 42  ? -33.730 -20.013 5.438   1.00 17.35 ? 247  ILE H N   1 
ATOM   6679  C  CA  . ILE H  2 42  ? -33.517 -20.047 6.895   1.00 18.08 ? 247  ILE H CA  1 
ATOM   6680  C  C   . ILE H  2 42  ? -32.185 -20.750 7.184   1.00 18.90 ? 247  ILE H C   1 
ATOM   6681  O  O   . ILE H  2 42  ? -31.401 -20.296 8.009   1.00 19.48 ? 247  ILE H O   1 
ATOM   6682  C  CB  . ILE H  2 42  ? -34.692 -20.724 7.650   1.00 18.39 ? 247  ILE H CB  1 
ATOM   6683  C  CG1 . ILE H  2 42  ? -35.884 -19.774 7.708   1.00 17.92 ? 247  ILE H CG1 1 
ATOM   6684  C  CG2 . ILE H  2 42  ? -34.294 -21.084 9.078   1.00 19.42 ? 247  ILE H CG2 1 
ATOM   6685  C  CD1 . ILE H  2 42  ? -37.207 -20.428 8.044   1.00 18.21 ? 247  ILE H CD1 1 
ATOM   6686  N  N   . ARG H  2 43  ? -31.919 -21.838 6.469   1.00 19.26 ? 248  ARG H N   1 
ATOM   6687  C  CA  . ARG H  2 43  ? -30.653 -22.552 6.610   1.00 20.19 ? 248  ARG H CA  1 
ATOM   6688  C  C   . ARG H  2 43  ? -29.447 -21.707 6.203   1.00 20.06 ? 248  ARG H C   1 
ATOM   6689  O  O   . ARG H  2 43  ? -28.413 -21.742 6.868   1.00 20.77 ? 248  ARG H O   1 
ATOM   6690  C  CB  . ARG H  2 43  ? -30.670 -23.817 5.776   1.00 20.65 ? 248  ARG H CB  1 
ATOM   6691  C  CG  . ARG H  2 43  ? -31.533 -24.924 6.329   1.00 21.48 ? 248  ARG H CG  1 
ATOM   6692  C  CD  . ARG H  2 43  ? -31.659 -25.971 5.263   1.00 21.78 ? 248  ARG H CD  1 
ATOM   6693  N  NE  . ARG H  2 43  ? -31.951 -27.314 5.749   1.00 23.08 ? 248  ARG H NE  1 
ATOM   6694  C  CZ  . ARG H  2 43  ? -31.057 -28.304 5.853   1.00 24.05 ? 248  ARG H CZ  1 
ATOM   6695  N  NH1 . ARG H  2 43  ? -29.760 -28.132 5.543   1.00 24.13 ? 248  ARG H NH1 1 
ATOM   6696  N  NH2 . ARG H  2 43  ? -31.477 -29.483 6.291   1.00 25.08 ? 248  ARG H NH2 1 
ATOM   6697  N  N   . ILE H  2 44  ? -29.577 -20.963 5.104   1.00 19.30 ? 249  ILE H N   1 
ATOM   6698  C  CA  . ILE H  2 44  ? -28.493 -20.111 4.640   1.00 19.34 ? 249  ILE H CA  1 
ATOM   6699  C  C   . ILE H  2 44  ? -28.238 -19.013 5.657   1.00 19.67 ? 249  ILE H C   1 
ATOM   6700  O  O   . ILE H  2 44  ? -27.111 -18.835 6.094   1.00 20.25 ? 249  ILE H O   1 
ATOM   6701  C  CB  . ILE H  2 44  ? -28.775 -19.513 3.258   1.00 18.56 ? 249  ILE H CB  1 
ATOM   6702  C  CG1 . ILE H  2 44  ? -28.774 -20.627 2.210   1.00 18.61 ? 249  ILE H CG1 1 
ATOM   6703  C  CG2 . ILE H  2 44  ? -27.715 -18.476 2.903   1.00 18.66 ? 249  ILE H CG2 1 
ATOM   6704  C  CD1 . ILE H  2 44  ? -29.337 -20.214 0.862   1.00 17.92 ? 249  ILE H CD1 1 
ATOM   6705  N  N   . LEU H  2 45  ? -29.290 -18.304 6.063   1.00 19.40 ? 250  LEU H N   1 
ATOM   6706  C  CA  . LEU H  2 45  ? -29.148 -17.222 7.043   1.00 19.76 ? 250  LEU H CA  1 
ATOM   6707  C  C   . LEU H  2 45  ? -28.555 -17.678 8.383   1.00 21.08 ? 250  LEU H C   1 
ATOM   6708  O  O   . LEU H  2 45  ? -27.888 -16.892 9.045   1.00 21.54 ? 250  LEU H O   1 
ATOM   6709  C  CB  . LEU H  2 45  ? -30.493 -16.547 7.317   1.00 19.17 ? 250  LEU H CB  1 
ATOM   6710  C  CG  . LEU H  2 45  ? -31.099 -15.697 6.204   1.00 18.34 ? 250  LEU H CG  1 
ATOM   6711  C  CD1 . LEU H  2 45  ? -32.573 -15.441 6.501   1.00 17.91 ? 250  LEU H CD1 1 
ATOM   6712  C  CD2 . LEU H  2 45  ? -30.322 -14.389 6.028   1.00 18.41 ? 250  LEU H CD2 1 
ATOM   6713  N  N   . THR H  2 46  ? -28.837 -18.917 8.797   1.00 21.92 ? 251  THR H N   1 
ATOM   6714  C  CA  . THR H  2 46  ? -28.419 -19.418 10.118  1.00 23.39 ? 251  THR H CA  1 
ATOM   6715  C  C   . THR H  2 46  ? -27.280 -20.435 10.033  1.00 25.01 ? 251  THR H C   1 
ATOM   6716  O  O   . THR H  2 46  ? -27.019 -21.146 10.996  1.00 26.05 ? 251  THR H O   1 
ATOM   6717  C  CB  . THR H  2 46  ? -29.592 -20.106 10.858  1.00 23.49 ? 251  THR H CB  1 
ATOM   6718  O  OG1 . THR H  2 46  ? -29.944 -21.326 10.181  1.00 23.24 ? 251  THR H OG1 1 
ATOM   6719  C  CG2 . THR H  2 46  ? -30.810 -19.173 10.970  1.00 22.55 ? 251  THR H CG2 1 
ATOM   6720  N  N   . ASN H  2 47  ? -26.615 -20.496 8.880   1.00 25.80 ? 252  ASN H N   1 
ATOM   6721  C  CA  . ASN H  2 47  ? -25.540 -21.456 8.614   1.00 28.33 ? 252  ASN H CA  1 
ATOM   6722  C  C   . ASN H  2 47  ? -25.852 -22.896 9.077   1.00 28.07 ? 252  ASN H C   1 
ATOM   6723  O  O   . ASN H  2 47  ? -25.076 -23.535 9.795   1.00 29.09 ? 252  ASN H O   1 
ATOM   6724  C  CB  . ASN H  2 47  ? -24.229 -20.965 9.211   1.00 31.75 ? 252  ASN H CB  1 
ATOM   6725  C  CG  . ASN H  2 47  ? -23.032 -21.682 8.639   1.00 34.51 ? 252  ASN H CG  1 
ATOM   6726  O  OD1 . ASN H  2 47  ? -23.037 -22.076 7.478   1.00 34.48 ? 252  ASN H OD1 1 
ATOM   6727  N  ND2 . ASN H  2 47  ? -21.990 -21.856 9.458   1.00 40.21 ? 252  ASN H ND2 1 
ATOM   6728  N  N   . ASN H  2 48  ? -27.008 -23.378 8.638   1.00 26.61 ? 253  ASN H N   1 
ATOM   6729  C  CA  . ASN H  2 48  ? -27.528 -24.693 9.002   1.00 26.97 ? 253  ASN H CA  1 
ATOM   6730  C  C   . ASN H  2 48  ? -27.721 -24.940 10.487  1.00 27.66 ? 253  ASN H C   1 
ATOM   6731  O  O   . ASN H  2 48  ? -27.784 -26.082 10.898  1.00 28.71 ? 253  ASN H O   1 
ATOM   6732  C  CB  . ASN H  2 48  ? -26.671 -25.807 8.381   1.00 27.67 ? 253  ASN H CB  1 
ATOM   6733  C  CG  . ASN H  2 48  ? -27.043 -26.080 6.944   1.00 26.80 ? 253  ASN H CG  1 
ATOM   6734  O  OD1 . ASN H  2 48  ? -28.210 -26.029 6.592   1.00 25.62 ? 253  ASN H OD1 1 
ATOM   6735  N  ND2 . ASN H  2 48  ? -26.049 -26.358 6.103   1.00 27.15 ? 253  ASN H ND2 1 
ATOM   6736  N  N   . SER H  2 49  ? -27.841 -23.897 11.301  1.00 27.28 ? 254  SER H N   1 
ATOM   6737  C  CA  . SER H  2 49  ? -28.099 -24.118 12.727  1.00 28.06 ? 254  SER H CA  1 
ATOM   6738  C  C   . SER H  2 49  ? -29.604 -24.173 13.024  1.00 27.44 ? 254  SER H C   1 
ATOM   6739  O  O   . SER H  2 49  ? -30.009 -24.668 14.070  1.00 28.30 ? 254  SER H O   1 
ATOM   6740  C  CB  . SER H  2 49  ? -27.392 -23.078 13.591  1.00 28.44 ? 254  SER H CB  1 
ATOM   6741  O  OG  . SER H  2 49  ? -28.077 -21.857 13.569  1.00 27.61 ? 254  SER H OG  1 
ATOM   6742  N  N   . GLN H  2 50  ? -30.423 -23.653 12.110  1.00 26.00 ? 255  GLN H N   1 
ATOM   6743  C  CA  . GLN H  2 50  ? -31.871 -23.839 12.147  1.00 25.46 ? 255  GLN H CA  1 
ATOM   6744  C  C   . GLN H  2 50  ? -32.235 -24.489 10.829  1.00 24.81 ? 255  GLN H C   1 
ATOM   6745  O  O   . GLN H  2 50  ? -31.894 -23.955 9.770   1.00 23.82 ? 255  GLN H O   1 
ATOM   6746  C  CB  . GLN H  2 50  ? -32.619 -22.510 12.294  1.00 24.63 ? 255  GLN H CB  1 
ATOM   6747  C  CG  . GLN H  2 50  ? -32.493 -21.846 13.657  1.00 25.40 ? 255  GLN H CG  1 
ATOM   6748  C  CD  . GLN H  2 50  ? -33.204 -20.496 13.737  1.00 24.75 ? 255  GLN H CD  1 
ATOM   6749  O  OE1 . GLN H  2 50  ? -34.353 -20.360 13.333  1.00 24.38 ? 255  GLN H OE1 1 
ATOM   6750  N  NE2 . GLN H  2 50  ? -32.521 -19.495 14.269  1.00 24.91 ? 255  GLN H NE2 1 
ATOM   6751  N  N   . THR H  2 51  ? -32.900 -25.647 10.896  1.00 25.37 ? 256  THR H N   1 
ATOM   6752  C  CA  . THR H  2 51  ? -33.271 -26.429 9.707   1.00 24.95 ? 256  THR H CA  1 
ATOM   6753  C  C   . THR H  2 51  ? -34.746 -26.876 9.754   1.00 25.03 ? 256  THR H C   1 
ATOM   6754  O  O   . THR H  2 51  ? -35.043 -28.031 9.498   1.00 25.52 ? 256  THR H O   1 
ATOM   6755  C  CB  . THR H  2 51  ? -32.394 -27.700 9.591   1.00 25.92 ? 256  THR H CB  1 
ATOM   6756  O  OG1 . THR H  2 51  ? -32.528 -28.484 10.783  1.00 27.37 ? 256  THR H OG1 1 
ATOM   6757  C  CG2 . THR H  2 51  ? -30.926 -27.359 9.407   1.00 26.02 ? 256  THR H CG2 1 
ATOM   6758  N  N   . PRO H  2 52  ? -35.672 -25.954 10.082  1.00 24.71 ? 257  PRO H N   1 
ATOM   6759  C  CA  . PRO H  2 52  ? -37.066 -26.332 10.278  1.00 24.96 ? 257  PRO H CA  1 
ATOM   6760  C  C   . PRO H  2 52  ? -37.755 -26.637 8.961   1.00 24.38 ? 257  PRO H C   1 
ATOM   6761  O  O   . PRO H  2 52  ? -37.493 -25.957 7.964   1.00 23.57 ? 257  PRO H O   1 
ATOM   6762  C  CB  . PRO H  2 52  ? -37.676 -25.066 10.879  1.00 24.58 ? 257  PRO H CB  1 
ATOM   6763  C  CG  . PRO H  2 52  ? -36.920 -23.968 10.220  1.00 23.53 ? 257  PRO H CG  1 
ATOM   6764  C  CD  . PRO H  2 52  ? -35.510 -24.487 10.115  1.00 23.84 ? 257  PRO H CD  1 
ATOM   6765  N  N   . ILE H  2 53  ? -38.607 -27.658 8.963   1.00 25.06 ? 258  ILE H N   1 
ATOM   6766  C  CA  . ILE H  2 53  ? -39.470 -27.938 7.839   1.00 24.78 ? 258  ILE H CA  1 
ATOM   6767  C  C   . ILE H  2 53  ? -40.813 -27.270 8.134   1.00 24.63 ? 258  ILE H C   1 
ATOM   6768  O  O   . ILE H  2 53  ? -41.386 -27.461 9.212   1.00 25.21 ? 258  ILE H O   1 
ATOM   6769  C  CB  . ILE H  2 53  ? -39.715 -29.448 7.606   1.00 25.87 ? 258  ILE H CB  1 
ATOM   6770  C  CG1 . ILE H  2 53  ? -38.449 -30.307 7.821   1.00 26.70 ? 258  ILE H CG1 1 
ATOM   6771  C  CG2 . ILE H  2 53  ? -40.241 -29.660 6.201   1.00 25.34 ? 258  ILE H CG2 1 
ATOM   6772  C  CD1 . ILE H  2 53  ? -37.308 -30.026 6.858   1.00 25.97 ? 258  ILE H CD1 1 
ATOM   6773  N  N   . LEU H  2 54  ? -41.284 -26.482 7.164   1.00 23.69 ? 259  LEU H N   1 
ATOM   6774  C  CA  . LEU H  2 54  ? -42.519 -25.717 7.271   1.00 23.72 ? 259  LEU H CA  1 
ATOM   6775  C  C   . LEU H  2 54  ? -43.692 -26.461 6.660   1.00 24.25 ? 259  LEU H C   1 
ATOM   6776  O  O   . LEU H  2 54  ? -43.512 -27.245 5.736   1.00 24.82 ? 259  LEU H O   1 
ATOM   6777  C  CB  . LEU H  2 54  ? -42.362 -24.380 6.551   1.00 22.56 ? 259  LEU H CB  1 
ATOM   6778  C  CG  . LEU H  2 54  ? -41.370 -23.423 7.183   1.00 22.17 ? 259  LEU H CG  1 
ATOM   6779  C  CD1 . LEU H  2 54  ? -41.189 -22.224 6.272   1.00 21.31 ? 259  LEU H CD1 1 
ATOM   6780  C  CD2 . LEU H  2 54  ? -41.837 -22.978 8.551   1.00 22.90 ? 259  LEU H CD2 1 
ATOM   6781  N  N   . SER H  2 55  ? -44.895 -26.182 7.150   1.00 24.60 ? 260  SER H N   1 
ATOM   6782  C  CA  . SER H  2 55  ? -46.098 -26.918 6.748   1.00 25.21 ? 260  SER H CA  1 
ATOM   6783  C  C   . SER H  2 55  ? -46.784 -26.354 5.492   1.00 24.45 ? 260  SER H C   1 
ATOM   6784  O  O   . SER H  2 55  ? -47.392 -25.276 5.557   1.00 24.22 ? 260  SER H O   1 
ATOM   6785  C  CB  . SER H  2 55  ? -47.117 -26.875 7.879   1.00 26.25 ? 260  SER H CB  1 
ATOM   6786  O  OG  . SER H  2 55  ? -48.365 -27.360 7.422   1.00 27.27 ? 260  SER H OG  1 
ATOM   6787  N  N   . PRO H  2 56  ? -46.729 -27.085 4.358   1.00 24.18 ? 261  PRO H N   1 
ATOM   6788  C  CA  . PRO H  2 56  ? -47.560 -26.673 3.228   1.00 23.60 ? 261  PRO H CA  1 
ATOM   6789  C  C   . PRO H  2 56  ? -49.043 -26.819 3.512   1.00 24.33 ? 261  PRO H C   1 
ATOM   6790  O  O   . PRO H  2 56  ? -49.836 -26.078 2.949   1.00 23.87 ? 261  PRO H O   1 
ATOM   6791  C  CB  . PRO H  2 56  ? -47.171 -27.644 2.111   1.00 23.61 ? 261  PRO H CB  1 
ATOM   6792  C  CG  . PRO H  2 56  ? -45.901 -28.255 2.543   1.00 24.00 ? 261  PRO H CG  1 
ATOM   6793  C  CD  . PRO H  2 56  ? -45.959 -28.294 4.037   1.00 24.78 ? 261  PRO H CD  1 
ATOM   6794  N  N   . GLN H  2 57  ? -49.399 -27.771 4.376   1.00 25.37 ? 262  GLN H N   1 
ATOM   6795  C  CA  . GLN H  2 57  ? -50.789 -28.072 4.667   1.00 26.45 ? 262  GLN H CA  1 
ATOM   6796  C  C   . GLN H  2 57  ? -51.498 -26.905 5.318   1.00 26.31 ? 262  GLN H C   1 
ATOM   6797  O  O   . GLN H  2 57  ? -52.657 -26.628 5.015   1.00 26.52 ? 262  GLN H O   1 
ATOM   6798  C  CB  . GLN H  2 57  ? -50.890 -29.295 5.585   1.00 28.05 ? 262  GLN H CB  1 
ATOM   6799  C  CG  . GLN H  2 57  ? -52.310 -29.803 5.770   1.00 29.37 ? 262  GLN H CG  1 
ATOM   6800  C  CD  . GLN H  2 57  ? -52.924 -30.234 4.460   1.00 29.26 ? 262  GLN H CD  1 
ATOM   6801  O  OE1 . GLN H  2 57  ? -52.309 -30.973 3.694   1.00 28.89 ? 262  GLN H OE1 1 
ATOM   6802  N  NE2 . GLN H  2 57  ? -54.137 -29.769 4.189   1.00 29.63 ? 262  GLN H NE2 1 
ATOM   6803  N  N   . GLU H  2 58  ? -50.808 -26.221 6.226   1.00 25.94 ? 263  GLU H N   1 
ATOM   6804  C  CA  . GLU H  2 58  ? -51.393 -25.042 6.840   1.00 26.00 ? 263  GLU H CA  1 
ATOM   6805  C  C   . GLU H  2 58  ? -51.699 -24.004 5.768   1.00 25.04 ? 263  GLU H C   1 
ATOM   6806  O  O   . GLU H  2 58  ? -52.692 -23.288 5.862   1.00 25.86 ? 263  GLU H O   1 
ATOM   6807  C  CB  . GLU H  2 58  ? -50.495 -24.463 7.917   1.00 25.83 ? 263  GLU H CB  1 
ATOM   6808  C  CG  . GLU H  2 58  ? -51.160 -23.353 8.722   1.00 26.18 ? 263  GLU H CG  1 
ATOM   6809  C  CD  . GLU H  2 58  ? -50.873 -21.958 8.182   1.00 25.15 ? 263  GLU H CD  1 
ATOM   6810  O  OE1 . GLU H  2 58  ? -49.813 -21.770 7.535   1.00 24.22 ? 263  GLU H OE1 1 
ATOM   6811  O  OE2 . GLU H  2 58  ? -51.698 -21.042 8.423   1.00 25.08 ? 263  GLU H OE2 1 
ATOM   6812  N  N   . VAL H  2 59  ? -50.878 -23.943 4.732   1.00 23.69 ? 264  VAL H N   1 
ATOM   6813  C  CA  . VAL H  2 59  ? -51.179 -23.047 3.638   1.00 22.98 ? 264  VAL H CA  1 
ATOM   6814  C  C   . VAL H  2 59  ? -52.423 -23.553 2.904   1.00 23.78 ? 264  VAL H C   1 
ATOM   6815  O  O   . VAL H  2 59  ? -53.384 -22.810 2.730   1.00 23.99 ? 264  VAL H O   1 
ATOM   6816  C  CB  . VAL H  2 59  ? -49.974 -22.872 2.694   1.00 21.70 ? 264  VAL H CB  1 
ATOM   6817  C  CG1 . VAL H  2 59  ? -50.402 -22.253 1.375   1.00 21.32 ? 264  VAL H CG1 1 
ATOM   6818  C  CG2 . VAL H  2 59  ? -48.919 -22.017 3.361   1.00 21.03 ? 264  VAL H CG2 1 
ATOM   6819  N  N   . VAL H  2 60  ? -52.410 -24.824 2.512   1.00 24.33 ? 265  VAL H N   1 
ATOM   6820  C  CA  . VAL H  2 60  ? -53.504 -25.403 1.748   1.00 25.20 ? 265  VAL H CA  1 
ATOM   6821  C  C   . VAL H  2 60  ? -54.836 -25.282 2.500   1.00 26.64 ? 265  VAL H C   1 
ATOM   6822  O  O   . VAL H  2 60  ? -55.851 -24.946 1.901   1.00 27.05 ? 265  VAL H O   1 
ATOM   6823  C  CB  . VAL H  2 60  ? -53.219 -26.873 1.381   1.00 25.71 ? 265  VAL H CB  1 
ATOM   6824  C  CG1 . VAL H  2 60  ? -54.448 -27.529 0.753   1.00 26.85 ? 265  VAL H CG1 1 
ATOM   6825  C  CG2 . VAL H  2 60  ? -52.037 -26.974 0.428   1.00 24.62 ? 265  VAL H CG2 1 
ATOM   6826  N  N   . SER H  2 61  ? -54.819 -25.518 3.810   1.00 27.65 ? 266  SER H N   1 
ATOM   6827  C  CA  . SER H  2 61  ? -56.046 -25.513 4.601   1.00 29.38 ? 266  SER H CA  1 
ATOM   6828  C  C   . SER H  2 61  ? -56.509 -24.148 5.120   1.00 29.95 ? 266  SER H C   1 
ATOM   6829  O  O   . SER H  2 61  ? -57.704 -23.955 5.293   1.00 31.74 ? 266  SER H O   1 
ATOM   6830  C  CB  . SER H  2 61  ? -55.914 -26.485 5.785   1.00 30.34 ? 266  SER H CB  1 
ATOM   6831  O  OG  . SER H  2 61  ? -55.720 -27.816 5.332   1.00 30.60 ? 266  SER H OG  1 
ATOM   6832  N  N   . CYS H  2 62  ? -55.593 -23.210 5.380   1.00 29.49 ? 267  CYS H N   1 
ATOM   6833  C  CA  . CYS H  2 62  ? -55.954 -21.974 6.104   1.00 30.02 ? 267  CYS H CA  1 
ATOM   6834  C  C   . CYS H  2 62  ? -55.897 -20.646 5.352   1.00 28.31 ? 267  CYS H C   1 
ATOM   6835  O  O   . CYS H  2 62  ? -56.518 -19.687 5.802   1.00 28.72 ? 267  CYS H O   1 
ATOM   6836  C  CB  . CYS H  2 62  ? -55.088 -21.820 7.354   1.00 31.03 ? 267  CYS H CB  1 
ATOM   6837  S  SG  . CYS H  2 62  ? -55.118 -23.251 8.454   1.00 34.22 ? 267  CYS H SG  1 
ATOM   6838  N  N   . SER H  2 63  ? -55.165 -20.569 4.243   1.00 26.38 ? 268  SER H N   1 
ATOM   6839  C  CA  . SER H  2 63  ? -54.862 -19.276 3.639   1.00 25.15 ? 268  SER H CA  1 
ATOM   6840  C  C   . SER H  2 63  ? -55.928 -18.771 2.661   1.00 25.39 ? 268  SER H C   1 
ATOM   6841  O  O   . SER H  2 63  ? -56.258 -19.430 1.677   1.00 25.77 ? 268  SER H O   1 
ATOM   6842  C  CB  . SER H  2 63  ? -53.485 -19.291 2.950   1.00 23.61 ? 268  SER H CB  1 
ATOM   6843  O  OG  . SER H  2 63  ? -53.186 -18.016 2.405   1.00 22.27 ? 268  SER H OG  1 
ATOM   6844  N  N   . GLN H  2 64  ? -56.419 -17.567 2.932   1.00 25.67 ? 269  GLN H N   1 
ATOM   6845  C  CA  . GLN H  2 64  ? -57.334 -16.876 2.041   1.00 26.14 ? 269  GLN H CA  1 
ATOM   6846  C  C   . GLN H  2 64  ? -56.640 -16.366 0.771   1.00 24.57 ? 269  GLN H C   1 
ATOM   6847  O  O   . GLN H  2 64  ? -57.318 -15.897 -0.145  1.00 24.85 ? 269  GLN H O   1 
ATOM   6848  C  CB  . GLN H  2 64  ? -57.978 -15.671 2.738   1.00 27.19 ? 269  GLN H CB  1 
ATOM   6849  C  CG  . GLN H  2 64  ? -58.577 -15.907 4.127   1.00 28.52 ? 269  GLN H CG  1 
ATOM   6850  C  CD  . GLN H  2 64  ? -59.866 -16.675 4.085   1.00 30.27 ? 269  GLN H CD  1 
ATOM   6851  O  OE1 . GLN H  2 64  ? -60.899 -16.160 3.637   1.00 31.78 ? 269  GLN H OE1 1 
ATOM   6852  N  NE2 . GLN H  2 64  ? -59.830 -17.919 4.565   1.00 30.99 ? 269  GLN H NE2 1 
ATOM   6853  N  N   . TYR H  2 65  ? -55.306 -16.435 0.720   1.00 23.02 ? 270  TYR H N   1 
ATOM   6854  C  CA  . TYR H  2 65  ? -54.531 -15.877 -0.402  1.00 21.77 ? 270  TYR H CA  1 
ATOM   6855  C  C   . TYR H  2 65  ? -54.259 -16.901 -1.492  1.00 21.64 ? 270  TYR H C   1 
ATOM   6856  O  O   . TYR H  2 65  ? -53.584 -16.613 -2.473  1.00 20.96 ? 270  TYR H O   1 
ATOM   6857  C  CB  . TYR H  2 65  ? -53.193 -15.310 0.081   1.00 20.64 ? 270  TYR H CB  1 
ATOM   6858  C  CG  . TYR H  2 65  ? -53.262 -14.166 1.064   1.00 20.62 ? 270  TYR H CG  1 
ATOM   6859  C  CD1 . TYR H  2 65  ? -54.383 -13.365 1.181   1.00 21.42 ? 270  TYR H CD1 1 
ATOM   6860  C  CD2 . TYR H  2 65  ? -52.174 -13.859 1.847   1.00 19.96 ? 270  TYR H CD2 1 
ATOM   6861  C  CE1 . TYR H  2 65  ? -54.423 -12.306 2.077   1.00 21.60 ? 270  TYR H CE1 1 
ATOM   6862  C  CE2 . TYR H  2 65  ? -52.200 -12.799 2.744   1.00 20.20 ? 270  TYR H CE2 1 
ATOM   6863  C  CZ  . TYR H  2 65  ? -53.328 -12.024 2.857   1.00 20.97 ? 270  TYR H CZ  1 
ATOM   6864  O  OH  . TYR H  2 65  ? -53.352 -10.971 3.744   1.00 21.19 ? 270  TYR H OH  1 
ATOM   6865  N  N   . ALA H  2 66  ? -54.782 -18.106 -1.322  1.00 22.58 ? 271  ALA H N   1 
ATOM   6866  C  CA  . ALA H  2 66  ? -54.664 -19.137 -2.349  1.00 22.70 ? 271  ALA H CA  1 
ATOM   6867  C  C   . ALA H  2 66  ? -55.954 -19.943 -2.350  1.00 23.90 ? 271  ALA H C   1 
ATOM   6868  O  O   . ALA H  2 66  ? -56.861 -19.636 -1.605  1.00 24.69 ? 271  ALA H O   1 
ATOM   6869  C  CB  . ALA H  2 66  ? -53.442 -20.008 -2.090  1.00 22.06 ? 271  ALA H CB  1 
ATOM   6870  N  N   . GLN H  2 67  ? -56.047 -20.948 -3.212  1.00 24.36 ? 272  GLN H N   1 
ATOM   6871  C  CA  . GLN H  2 67  ? -57.282 -21.700 -3.388  1.00 25.62 ? 272  GLN H CA  1 
ATOM   6872  C  C   . GLN H  2 67  ? -57.044 -23.167 -3.021  1.00 26.26 ? 272  GLN H C   1 
ATOM   6873  O  O   . GLN H  2 67  ? -57.463 -24.088 -3.731  1.00 27.27 ? 272  GLN H O   1 
ATOM   6874  C  CB  . GLN H  2 67  ? -57.788 -21.536 -4.831  1.00 25.81 ? 272  GLN H CB  1 
ATOM   6875  C  CG  . GLN H  2 67  ? -58.309 -20.135 -5.169  1.00 25.77 ? 272  GLN H CG  1 
ATOM   6876  C  CD  . GLN H  2 67  ? -57.201 -19.089 -5.353  1.00 24.61 ? 272  GLN H CD  1 
ATOM   6877  O  OE1 . GLN H  2 67  ? -56.195 -19.326 -6.025  1.00 23.83 ? 272  GLN H OE1 1 
ATOM   6878  N  NE2 . GLN H  2 67  ? -57.392 -17.920 -4.753  1.00 24.45 ? 272  GLN H NE2 1 
ATOM   6879  N  N   . GLY H  2 68  ? -56.362 -23.373 -1.897  1.00 26.09 ? 273  GLY H N   1 
ATOM   6880  C  CA  . GLY H  2 68  ? -56.119 -24.708 -1.360  1.00 26.89 ? 273  GLY H CA  1 
ATOM   6881  C  C   . GLY H  2 68  ? -55.534 -25.694 -2.353  1.00 27.06 ? 273  GLY H C   1 
ATOM   6882  O  O   . GLY H  2 68  ? -54.453 -25.472 -2.889  1.00 26.00 ? 273  GLY H O   1 
ATOM   6883  N  N   . CYS H  2 69  ? -56.256 -26.783 -2.606  1.00 28.78 ? 274  CYS H N   1 
ATOM   6884  C  CA  . CYS H  2 69  ? -55.777 -27.855 -3.492  1.00 29.23 ? 274  CYS H CA  1 
ATOM   6885  C  C   . CYS H  2 69  ? -56.017 -27.563 -4.970  1.00 29.26 ? 274  CYS H C   1 
ATOM   6886  O  O   . CYS H  2 69  ? -55.623 -28.360 -5.816  1.00 29.23 ? 274  CYS H O   1 
ATOM   6887  C  CB  . CYS H  2 69  ? -56.428 -29.210 -3.144  1.00 30.86 ? 274  CYS H CB  1 
ATOM   6888  S  SG  . CYS H  2 69  ? -55.650 -30.147 -1.799  1.00 31.75 ? 274  CYS H SG  1 
ATOM   6889  N  N   . GLU H  2 70  ? -56.668 -26.447 -5.287  1.00 29.47 ? 275  GLU H N   1 
ATOM   6890  C  CA  . GLU H  2 70  ? -56.809 -26.052 -6.686  1.00 30.00 ? 275  GLU H CA  1 
ATOM   6891  C  C   . GLU H  2 70  ? -56.014 -24.781 -6.999  1.00 29.06 ? 275  GLU H C   1 
ATOM   6892  O  O   . GLU H  2 70  ? -56.455 -23.918 -7.747  1.00 29.63 ? 275  GLU H O   1 
ATOM   6893  C  CB  . GLU H  2 70  ? -58.282 -25.966 -7.096  1.00 31.95 ? 275  GLU H CB  1 
ATOM   6894  C  CG  . GLU H  2 70  ? -59.122 -25.025 -6.259  1.00 32.48 ? 275  GLU H CG  1 
ATOM   6895  C  CD  . GLU H  2 70  ? -60.355 -25.701 -5.701  1.00 34.94 ? 275  GLU H CD  1 
ATOM   6896  O  OE1 . GLU H  2 70  ? -61.315 -25.911 -6.484  1.00 37.20 ? 275  GLU H OE1 1 
ATOM   6897  O  OE2 . GLU H  2 70  ? -60.359 -26.011 -4.478  1.00 35.32 ? 275  GLU H OE2 1 
ATOM   6898  N  N   . GLY H  2 71  ? -54.826 -24.692 -6.409  1.00 27.46 ? 276  GLY H N   1 
ATOM   6899  C  CA  . GLY H  2 71  ? -53.783 -23.778 -6.871  1.00 26.16 ? 276  GLY H CA  1 
ATOM   6900  C  C   . GLY H  2 71  ? -53.545 -22.519 -6.067  1.00 24.20 ? 276  GLY H C   1 
ATOM   6901  O  O   . GLY H  2 71  ? -54.266 -22.192 -5.126  1.00 24.50 ? 276  GLY H O   1 
ATOM   6902  N  N   . GLY H  2 72  ? -52.509 -21.806 -6.466  1.00 22.59 ? 277  GLY H N   1 
ATOM   6903  C  CA  . GLY H  2 72  ? -52.119 -20.572 -5.803  1.00 21.39 ? 277  GLY H CA  1 
ATOM   6904  C  C   . GLY H  2 72  ? -50.816 -20.062 -6.363  1.00 19.99 ? 277  GLY H C   1 
ATOM   6905  O  O   . GLY H  2 72  ? -50.285 -20.611 -7.329  1.00 20.03 ? 277  GLY H O   1 
ATOM   6906  N  N   . PHE H  2 73  ? -50.292 -19.010 -5.740  1.00 18.98 ? 278  PHE H N   1 
ATOM   6907  C  CA  . PHE H  2 73  ? -49.104 -18.341 -6.249  1.00 17.86 ? 278  PHE H CA  1 
ATOM   6908  C  C   . PHE H  2 73  ? -48.114 -18.027 -5.132  1.00 16.88 ? 278  PHE H C   1 
ATOM   6909  O  O   . PHE H  2 73  ? -48.499 -17.474 -4.096  1.00 16.77 ? 278  PHE H O   1 
ATOM   6910  C  CB  . PHE H  2 73  ? -49.532 -17.109 -7.034  1.00 18.02 ? 278  PHE H CB  1 
ATOM   6911  C  CG  . PHE H  2 73  ? -50.271 -17.463 -8.278  1.00 18.62 ? 278  PHE H CG  1 
ATOM   6912  C  CD1 . PHE H  2 73  ? -51.628 -17.656 -8.244  1.00 19.44 ? 278  PHE H CD1 1 
ATOM   6913  C  CD2 . PHE H  2 73  ? -49.594 -17.683 -9.468  1.00 18.47 ? 278  PHE H CD2 1 
ATOM   6914  C  CE1 . PHE H  2 73  ? -52.323 -18.035 -9.380  1.00 20.02 ? 278  PHE H CE1 1 
ATOM   6915  C  CE2 . PHE H  2 73  ? -50.270 -18.057 -10.609 1.00 19.07 ? 278  PHE H CE2 1 
ATOM   6916  C  CZ  . PHE H  2 73  ? -51.642 -18.239 -10.564 1.00 19.85 ? 278  PHE H CZ  1 
ATOM   6917  N  N   . PRO H  2 74  ? -46.832 -18.395 -5.339  1.00 16.12 ? 279  PRO H N   1 
ATOM   6918  C  CA  . PRO H  2 74  ? -45.814 -18.199 -4.313  1.00 15.47 ? 279  PRO H CA  1 
ATOM   6919  C  C   . PRO H  2 74  ? -45.668 -16.763 -3.800  1.00 14.90 ? 279  PRO H C   1 
ATOM   6920  O  O   . PRO H  2 74  ? -45.439 -16.571 -2.595  1.00 14.72 ? 279  PRO H O   1 
ATOM   6921  C  CB  . PRO H  2 74  ? -44.525 -18.674 -5.002  1.00 15.27 ? 279  PRO H CB  1 
ATOM   6922  C  CG  . PRO H  2 74  ? -44.984 -19.666 -6.008  1.00 15.75 ? 279  PRO H CG  1 
ATOM   6923  C  CD  . PRO H  2 74  ? -46.299 -19.140 -6.500  1.00 16.22 ? 279  PRO H CD  1 
ATOM   6924  N  N   . TYR H  2 75  ? -45.802 -15.767 -4.676  1.00 14.64 ? 280  TYR H N   1 
ATOM   6925  C  CA  . TYR H  2 75  ? -45.730 -14.360 -4.237  1.00 14.32 ? 280  TYR H CA  1 
ATOM   6926  C  C   . TYR H  2 75  ? -46.678 -14.108 -3.053  1.00 14.67 ? 280  TYR H C   1 
ATOM   6927  O  O   . TYR H  2 75  ? -46.320 -13.402 -2.105  1.00 14.53 ? 280  TYR H O   1 
ATOM   6928  C  CB  . TYR H  2 75  ? -46.027 -13.402 -5.393  1.00 14.37 ? 280  TYR H CB  1 
ATOM   6929  C  CG  . TYR H  2 75  ? -45.998 -11.912 -5.065  1.00 14.34 ? 280  TYR H CG  1 
ATOM   6930  C  CD1 . TYR H  2 75  ? -47.074 -11.296 -4.466  1.00 14.77 ? 280  TYR H CD1 1 
ATOM   6931  C  CD2 . TYR H  2 75  ? -44.913 -11.123 -5.409  1.00 14.11 ? 280  TYR H CD2 1 
ATOM   6932  C  CE1 . TYR H  2 75  ? -47.070 -9.941  -4.179  1.00 14.95 ? 280  TYR H CE1 1 
ATOM   6933  C  CE2 . TYR H  2 75  ? -44.889 -9.759  -5.129  1.00 14.31 ? 280  TYR H CE2 1 
ATOM   6934  C  CZ  . TYR H  2 75  ? -45.979 -9.169  -4.519  1.00 14.74 ? 280  TYR H CZ  1 
ATOM   6935  O  OH  . TYR H  2 75  ? -45.988 -7.819  -4.223  1.00 15.08 ? 280  TYR H OH  1 
ATOM   6936  N  N   . LEU H  2 76  ? -47.861 -14.717 -3.106  1.00 15.19 ? 281  LEU H N   1 
ATOM   6937  C  CA  . LEU H  2 76  ? -48.891 -14.529 -2.082  1.00 15.72 ? 281  LEU H CA  1 
ATOM   6938  C  C   . LEU H  2 76  ? -48.706 -15.420 -0.859  1.00 15.78 ? 281  LEU H C   1 
ATOM   6939  O  O   . LEU H  2 76  ? -49.285 -15.155 0.181   1.00 16.17 ? 281  LEU H O   1 
ATOM   6940  C  CB  . LEU H  2 76  ? -50.280 -14.770 -2.683  1.00 16.44 ? 281  LEU H CB  1 
ATOM   6941  C  CG  . LEU H  2 76  ? -50.725 -13.721 -3.689  1.00 16.67 ? 281  LEU H CG  1 
ATOM   6942  C  CD1 . LEU H  2 76  ? -51.966 -14.156 -4.439  1.00 17.46 ? 281  LEU H CD1 1 
ATOM   6943  C  CD2 . LEU H  2 76  ? -50.952 -12.401 -2.978  1.00 16.89 ? 281  LEU H CD2 1 
ATOM   6944  N  N   . ILE H  2 77  ? -47.906 -16.466 -0.997  1.00 15.53 ? 282  ILE H N   1 
ATOM   6945  C  CA  . ILE H  2 77  ? -47.688 -17.444 0.066   1.00 15.84 ? 282  ILE H CA  1 
ATOM   6946  C  C   . ILE H  2 77  ? -46.311 -17.287 0.723   1.00 15.34 ? 282  ILE H C   1 
ATOM   6947  O  O   . ILE H  2 77  ? -46.238 -17.012 1.913   1.00 15.54 ? 282  ILE H O   1 
ATOM   6948  C  CB  . ILE H  2 77  ? -47.869 -18.881 -0.472  1.00 16.20 ? 282  ILE H CB  1 
ATOM   6949  C  CG1 . ILE H  2 77  ? -49.302 -19.057 -0.998  1.00 16.91 ? 282  ILE H CG1 1 
ATOM   6950  C  CG2 . ILE H  2 77  ? -47.530 -19.916 0.596   1.00 16.57 ? 282  ILE H CG2 1 
ATOM   6951  C  CD1 . ILE H  2 77  ? -50.406 -18.541 -0.096  1.00 17.49 ? 282  ILE H CD1 1 
ATOM   6952  N  N   . ALA H  2 78  ? -45.229 -17.453 -0.040  1.00 14.83 ? 283  ALA H N   1 
ATOM   6953  C  CA  . ALA H  2 78  ? -43.878 -17.227 0.515   1.00 14.55 ? 283  ALA H CA  1 
ATOM   6954  C  C   . ALA H  2 78  ? -43.696 -15.776 0.911   1.00 14.31 ? 283  ALA H C   1 
ATOM   6955  O  O   . ALA H  2 78  ? -42.951 -15.470 1.823   1.00 14.30 ? 283  ALA H O   1 
ATOM   6956  C  CB  . ALA H  2 78  ? -42.796 -17.636 -0.464  1.00 14.26 ? 283  ALA H CB  1 
ATOM   6957  N  N   . GLY H  2 79  ? -44.384 -14.897 0.198   1.00 14.28 ? 284  GLY H N   1 
ATOM   6958  C  CA  . GLY H  2 79  ? -44.381 -13.473 0.468   1.00 14.27 ? 284  GLY H CA  1 
ATOM   6959  C  C   . GLY H  2 79  ? -45.515 -13.079 1.381   1.00 14.88 ? 284  GLY H C   1 
ATOM   6960  O  O   . GLY H  2 79  ? -45.358 -13.055 2.601   1.00 15.16 ? 284  GLY H O   1 
ATOM   6961  N  N   . LYS H  2 80  ? -46.676 -12.797 0.806   1.00 15.23 ? 285  LYS H N   1 
ATOM   6962  C  CA  . LYS H  2 80  ? -47.679 -12.046 1.544   1.00 15.93 ? 285  LYS H CA  1 
ATOM   6963  C  C   . LYS H  2 80  ? -48.284 -12.789 2.731   1.00 16.50 ? 285  LYS H C   1 
ATOM   6964  O  O   . LYS H  2 80  ? -48.460 -12.194 3.796   1.00 16.94 ? 285  LYS H O   1 
ATOM   6965  C  CB  . LYS H  2 80  ? -48.766 -11.517 0.630   1.00 16.41 ? 285  LYS H CB  1 
ATOM   6966  C  CG  . LYS H  2 80  ? -49.570 -10.425 1.300   1.00 17.25 ? 285  LYS H CG  1 
ATOM   6967  C  CD  . LYS H  2 80  ? -50.679 -9.874  0.433   1.00 17.86 ? 285  LYS H CD  1 
ATOM   6968  C  CE  . LYS H  2 80  ? -51.396 -8.756  1.182   1.00 18.76 ? 285  LYS H CE  1 
ATOM   6969  N  NZ  . LYS H  2 80  ? -50.479 -7.610  1.476   1.00 18.57 ? 285  LYS H NZ  1 
ATOM   6970  N  N   . TYR H  2 81  ? -48.573 -14.082 2.564   1.00 16.56 ? 286  TYR H N   1 
ATOM   6971  C  CA  . TYR H  2 81  ? -49.104 -14.870 3.656   1.00 17.24 ? 286  TYR H CA  1 
ATOM   6972  C  C   . TYR H  2 81  ? -48.099 -15.002 4.802   1.00 17.18 ? 286  TYR H C   1 
ATOM   6973  O  O   . TYR H  2 81  ? -48.444 -14.839 5.967   1.00 17.70 ? 286  TYR H O   1 
ATOM   6974  C  CB  . TYR H  2 81  ? -49.556 -16.256 3.173   1.00 17.53 ? 286  TYR H CB  1 
ATOM   6975  C  CG  . TYR H  2 81  ? -50.298 -17.026 4.240   1.00 18.49 ? 286  TYR H CG  1 
ATOM   6976  C  CD1 . TYR H  2 81  ? -51.584 -16.664 4.615   1.00 19.43 ? 286  TYR H CD1 1 
ATOM   6977  C  CD2 . TYR H  2 81  ? -49.686 -18.077 4.911   1.00 18.72 ? 286  TYR H CD2 1 
ATOM   6978  C  CE1 . TYR H  2 81  ? -52.269 -17.360 5.602   1.00 20.43 ? 286  TYR H CE1 1 
ATOM   6979  C  CE2 . TYR H  2 81  ? -50.343 -18.768 5.912   1.00 19.78 ? 286  TYR H CE2 1 
ATOM   6980  C  CZ  . TYR H  2 81  ? -51.635 -18.407 6.246   1.00 20.63 ? 286  TYR H CZ  1 
ATOM   6981  O  OH  . TYR H  2 81  ? -52.274 -19.097 7.231   1.00 21.95 ? 286  TYR H OH  1 
ATOM   6982  N  N   . ALA H  2 82  ? -46.854 -15.299 4.456   1.00 16.63 ? 287  ALA H N   1 
ATOM   6983  C  CA  . ALA H  2 82  ? -45.767 -15.400 5.435   1.00 16.63 ? 287  ALA H CA  1 
ATOM   6984  C  C   . ALA H  2 82  ? -45.560 -14.083 6.198   1.00 16.93 ? 287  ALA H C   1 
ATOM   6985  O  O   . ALA H  2 82  ? -45.328 -14.098 7.405   1.00 17.62 ? 287  ALA H O   1 
ATOM   6986  C  CB  . ALA H  2 82  ? -44.493 -15.822 4.745   1.00 15.93 ? 287  ALA H CB  1 
ATOM   6987  N  N   . GLN H  2 83  ? -45.662 -12.949 5.511   1.00 16.69 ? 288  GLN H N   1 
ATOM   6988  C  CA  . GLN H  2 83  ? -45.560 -11.664 6.186   1.00 17.09 ? 288  GLN H CA  1 
ATOM   6989  C  C   . GLN H  2 83  ? -46.767 -11.416 7.093   1.00 18.00 ? 288  GLN H C   1 
ATOM   6990  O  O   . GLN H  2 83  ? -46.609 -11.052 8.260   1.00 18.49 ? 288  GLN H O   1 
ATOM   6991  C  CB  . GLN H  2 83  ? -45.395 -10.516 5.174   1.00 16.79 ? 288  GLN H CB  1 
ATOM   6992  C  CG  . GLN H  2 83  ? -45.259 -9.134  5.809   1.00 17.30 ? 288  GLN H CG  1 
ATOM   6993  C  CD  . GLN H  2 83  ? -44.758 -8.073  4.831   1.00 17.22 ? 288  GLN H CD  1 
ATOM   6994  O  OE1 . GLN H  2 83  ? -45.530 -7.257  4.326   1.00 17.50 ? 288  GLN H OE1 1 
ATOM   6995  N  NE2 . GLN H  2 83  ? -43.466 -8.096  4.551   1.00 16.80 ? 288  GLN H NE2 1 
ATOM   6996  N  N   . ASP H  2 84  ? -47.965 -11.624 6.560   1.00 18.33 ? 289  ASP H N   1 
ATOM   6997  C  CA  . ASP H  2 84  ? -49.179 -11.246 7.278   1.00 19.41 ? 289  ASP H CA  1 
ATOM   6998  C  C   . ASP H  2 84  ? -49.510 -12.173 8.431   1.00 20.16 ? 289  ASP H C   1 
ATOM   6999  O  O   . ASP H  2 84  ? -49.839 -11.707 9.515   1.00 21.12 ? 289  ASP H O   1 
ATOM   7000  C  CB  . ASP H  2 84  ? -50.370 -11.130 6.322   1.00 19.66 ? 289  ASP H CB  1 
ATOM   7001  C  CG  . ASP H  2 84  ? -50.206 -9.999  5.313   1.00 19.38 ? 289  ASP H CG  1 
ATOM   7002  O  OD1 . ASP H  2 84  ? -49.329 -9.112  5.537   1.00 19.60 ? 289  ASP H OD1 1 
ATOM   7003  O  OD2 . ASP H  2 84  ? -50.942 -9.999  4.291   1.00 19.31 ? 289  ASP H OD2 1 
ATOM   7004  N  N   . PHE H  2 85  ? -49.422 -13.481 8.202   1.00 20.09 ? 290  PHE H N   1 
ATOM   7005  C  CA  . PHE H  2 85  ? -49.906 -14.482 9.184   1.00 21.00 ? 290  PHE H CA  1 
ATOM   7006  C  C   . PHE H  2 85  ? -48.857 -15.465 9.686   1.00 20.89 ? 290  PHE H C   1 
ATOM   7007  O  O   . PHE H  2 85  ? -49.031 -16.066 10.741  1.00 21.81 ? 290  PHE H O   1 
ATOM   7008  C  CB  . PHE H  2 85  ? -51.075 -15.266 8.589   1.00 21.46 ? 290  PHE H CB  1 
ATOM   7009  C  CG  . PHE H  2 85  ? -52.251 -14.404 8.207   1.00 22.00 ? 290  PHE H CG  1 
ATOM   7010  C  CD1 . PHE H  2 85  ? -53.232 -14.090 9.138   1.00 23.29 ? 290  PHE H CD1 1 
ATOM   7011  C  CD2 . PHE H  2 85  ? -52.377 -13.909 6.919   1.00 21.38 ? 290  PHE H CD2 1 
ATOM   7012  C  CE1 . PHE H  2 85  ? -54.324 -13.305 8.782   1.00 23.97 ? 290  PHE H CE1 1 
ATOM   7013  C  CE2 . PHE H  2 85  ? -53.457 -13.117 6.555   1.00 22.01 ? 290  PHE H CE2 1 
ATOM   7014  C  CZ  . PHE H  2 85  ? -54.429 -12.806 7.487   1.00 23.25 ? 290  PHE H CZ  1 
ATOM   7015  N  N   . GLY H  2 86  ? -47.784 -15.655 8.931   1.00 20.01 ? 291  GLY H N   1 
ATOM   7016  C  CA  . GLY H  2 86  ? -46.694 -16.516 9.357   1.00 20.09 ? 291  GLY H CA  1 
ATOM   7017  C  C   . GLY H  2 86  ? -46.948 -17.979 9.066   1.00 20.55 ? 291  GLY H C   1 
ATOM   7018  O  O   . GLY H  2 86  ? -48.082 -18.392 8.864   1.00 21.07 ? 291  GLY H O   1 
ATOM   7019  N  N   . LEU H  2 87  ? -45.880 -18.764 9.075   1.00 20.47 ? 292  LEU H N   1 
ATOM   7020  C  CA  . LEU H  2 87  ? -45.949 -20.170 8.720   1.00 20.96 ? 292  LEU H CA  1 
ATOM   7021  C  C   . LEU H  2 87  ? -45.569 -21.063 9.908   1.00 22.30 ? 292  LEU H C   1 
ATOM   7022  O  O   . LEU H  2 87  ? -44.674 -20.735 10.683  1.00 22.55 ? 292  LEU H O   1 
ATOM   7023  C  CB  . LEU H  2 87  ? -45.043 -20.435 7.521   1.00 19.92 ? 292  LEU H CB  1 
ATOM   7024  C  CG  . LEU H  2 87  ? -45.247 -19.454 6.361   1.00 18.92 ? 292  LEU H CG  1 
ATOM   7025  C  CD1 . LEU H  2 87  ? -44.120 -19.578 5.366   1.00 18.03 ? 292  LEU H CD1 1 
ATOM   7026  C  CD2 . LEU H  2 87  ? -46.579 -19.690 5.686   1.00 19.14 ? 292  LEU H CD2 1 
ATOM   7027  N  N   . VAL H  2 88  ? -46.248 -22.192 10.052  1.00 23.64 ? 293  VAL H N   1 
ATOM   7028  C  CA  . VAL H  2 88  ? -45.923 -23.117 11.148  1.00 25.26 ? 293  VAL H CA  1 
ATOM   7029  C  C   . VAL H  2 88  ? -45.061 -24.253 10.636  1.00 25.92 ? 293  VAL H C   1 
ATOM   7030  O  O   . VAL H  2 88  ? -44.972 -24.480 9.434   1.00 25.33 ? 293  VAL H O   1 
ATOM   7031  C  CB  . VAL H  2 88  ? -47.177 -23.672 11.857  1.00 26.36 ? 293  VAL H CB  1 
ATOM   7032  C  CG1 . VAL H  2 88  ? -48.042 -22.534 12.367  1.00 26.56 ? 293  VAL H CG1 1 
ATOM   7033  C  CG2 . VAL H  2 88  ? -47.984 -24.582 10.943  1.00 26.58 ? 293  VAL H CG2 1 
ATOM   7034  N  N   . GLU H  2 89  ? -44.420 -24.960 11.555  1.00 27.85 ? 294  GLU H N   1 
ATOM   7035  C  CA  . GLU H  2 89  ? -43.614 -26.118 11.191  1.00 28.64 ? 294  GLU H CA  1 
ATOM   7036  C  C   . GLU H  2 89  ? -44.505 -27.297 10.814  1.00 29.22 ? 294  GLU H C   1 
ATOM   7037  O  O   . GLU H  2 89  ? -45.681 -27.324 11.164  1.00 29.69 ? 294  GLU H O   1 
ATOM   7038  C  CB  . GLU H  2 89  ? -42.651 -26.476 12.328  1.00 30.41 ? 294  GLU H CB  1 
ATOM   7039  C  CG  . GLU H  2 89  ? -41.619 -25.375 12.545  1.00 30.09 ? 294  GLU H CG  1 
ATOM   7040  C  CD  . GLU H  2 89  ? -40.613 -25.687 13.628  1.00 31.87 ? 294  GLU H CD  1 
ATOM   7041  O  OE1 . GLU H  2 89  ? -40.273 -26.877 13.804  1.00 33.93 ? 294  GLU H OE1 1 
ATOM   7042  O  OE2 . GLU H  2 89  ? -40.149 -24.742 14.300  1.00 31.72 ? 294  GLU H OE2 1 
ATOM   7043  N  N   . GLU H  2 90  ? -43.934 -28.259 10.090  1.00 29.41 ? 295  GLU H N   1 
ATOM   7044  C  CA  . GLU H  2 90  ? -44.673 -29.431 9.607   1.00 30.17 ? 295  GLU H CA  1 
ATOM   7045  C  C   . GLU H  2 90  ? -45.276 -30.220 10.754  1.00 32.28 ? 295  GLU H C   1 
ATOM   7046  O  O   . GLU H  2 90  ? -46.414 -30.648 10.661  1.00 32.92 ? 295  GLU H O   1 
ATOM   7047  C  CB  . GLU H  2 90  ? -43.774 -30.340 8.748   1.00 29.82 ? 295  GLU H CB  1 
ATOM   7048  C  CG  . GLU H  2 90  ? -44.394 -31.667 8.294   1.00 30.66 ? 295  GLU H CG  1 
ATOM   7049  C  CD  . GLU H  2 90  ? -45.446 -31.539 7.190   1.00 30.12 ? 295  GLU H CD  1 
ATOM   7050  O  OE1 . GLU H  2 90  ? -45.460 -30.533 6.441   1.00 28.78 ? 295  GLU H OE1 1 
ATOM   7051  O  OE2 . GLU H  2 90  ? -46.256 -32.485 7.035   1.00 31.25 ? 295  GLU H OE2 1 
ATOM   7052  N  N   . ALA H  2 91  ? -44.516 -30.398 11.833  1.00 33.75 ? 296  ALA H N   1 
ATOM   7053  C  CA  . ALA H  2 91  ? -44.996 -31.145 13.011  1.00 36.09 ? 296  ALA H CA  1 
ATOM   7054  C  C   . ALA H  2 91  ? -46.238 -30.528 13.662  1.00 37.12 ? 296  ALA H C   1 
ATOM   7055  O  O   . ALA H  2 91  ? -46.932 -31.191 14.410  1.00 39.85 ? 296  ALA H O   1 
ATOM   7056  C  CB  . ALA H  2 91  ? -43.888 -31.264 14.042  1.00 36.79 ? 296  ALA H CB  1 
ATOM   7057  N  N   . CYS H  2 92  ? -46.503 -29.257 13.384  1.00 36.65 ? 297  CYS H N   1 
ATOM   7058  C  CA  . CYS H  2 92  ? -47.674 -28.575 13.923  1.00 38.42 ? 297  CYS H CA  1 
ATOM   7059  C  C   . CYS H  2 92  ? -48.947 -28.886 13.110  1.00 37.78 ? 297  CYS H C   1 
ATOM   7060  O  O   . CYS H  2 92  ? -50.035 -28.960 13.683  1.00 39.31 ? 297  CYS H O   1 
ATOM   7061  C  CB  . CYS H  2 92  ? -47.401 -27.061 13.993  1.00 38.94 ? 297  CYS H CB  1 
ATOM   7062  S  SG  . CYS H  2 92  ? -48.822 -26.031 14.436  1.00 43.36 ? 297  CYS H SG  1 
ATOM   7063  N  N   . PHE H  2 93  ? -48.792 -29.078 11.792  1.00 35.39 ? 298  PHE H N   1 
ATOM   7064  C  CA  . PHE H  2 93  ? -49.900 -29.360 10.859  1.00 34.61 ? 298  PHE H CA  1 
ATOM   7065  C  C   . PHE H  2 93  ? -49.402 -30.299 9.737   1.00 33.41 ? 298  PHE H C   1 
ATOM   7066  O  O   . PHE H  2 93  ? -49.125 -29.855 8.614   1.00 31.70 ? 298  PHE H O   1 
ATOM   7067  C  CB  . PHE H  2 93  ? -50.425 -28.040 10.252  1.00 33.58 ? 298  PHE H CB  1 
ATOM   7068  C  CG  . PHE H  2 93  ? -51.855 -28.097 9.746   1.00 34.34 ? 298  PHE H CG  1 
ATOM   7069  C  CD1 . PHE H  2 93  ? -52.416 -29.273 9.239   1.00 35.18 ? 298  PHE H CD1 1 
ATOM   7070  C  CD2 . PHE H  2 93  ? -52.644 -26.947 9.767   1.00 34.34 ? 298  PHE H CD2 1 
ATOM   7071  C  CE1 . PHE H  2 93  ? -53.738 -29.300 8.788   1.00 35.69 ? 298  PHE H CE1 1 
ATOM   7072  C  CE2 . PHE H  2 93  ? -53.955 -26.969 9.317   1.00 34.93 ? 298  PHE H CE2 1 
ATOM   7073  C  CZ  . PHE H  2 93  ? -54.506 -28.146 8.825   1.00 35.73 ? 298  PHE H CZ  1 
ATOM   7074  N  N   . PRO H  2 94  ? -49.278 -31.606 10.037  1.00 33.87 ? 299  PRO H N   1 
ATOM   7075  C  CA  . PRO H  2 94  ? -48.764 -32.570 9.052   1.00 33.23 ? 299  PRO H CA  1 
ATOM   7076  C  C   . PRO H  2 94  ? -49.499 -32.570 7.702   1.00 32.24 ? 299  PRO H C   1 
ATOM   7077  O  O   . PRO H  2 94  ? -50.703 -32.318 7.645   1.00 32.59 ? 299  PRO H O   1 
ATOM   7078  C  CB  . PRO H  2 94  ? -48.943 -33.911 9.756   1.00 35.05 ? 299  PRO H CB  1 
ATOM   7079  C  CG  . PRO H  2 94  ? -48.871 -33.578 11.203  1.00 36.03 ? 299  PRO H CG  1 
ATOM   7080  C  CD  . PRO H  2 94  ? -49.544 -32.247 11.339  1.00 35.51 ? 299  PRO H CD  1 
ATOM   7081  N  N   . TYR H  2 95  ? -48.773 -32.873 6.631   1.00 31.03 ? 300  TYR H N   1 
ATOM   7082  C  CA  . TYR H  2 95  ? -49.348 -32.861 5.295   1.00 30.40 ? 300  TYR H CA  1 
ATOM   7083  C  C   . TYR H  2 95  ? -50.248 -34.057 5.039   1.00 32.07 ? 300  TYR H C   1 
ATOM   7084  O  O   . TYR H  2 95  ? -49.823 -35.201 5.198   1.00 32.98 ? 300  TYR H O   1 
ATOM   7085  C  CB  . TYR H  2 95  ? -48.251 -32.839 4.240   1.00 29.07 ? 300  TYR H CB  1 
ATOM   7086  C  CG  . TYR H  2 95  ? -48.749 -32.594 2.827   1.00 28.13 ? 300  TYR H CG  1 
ATOM   7087  C  CD1 . TYR H  2 95  ? -49.311 -31.374 2.469   1.00 27.17 ? 300  TYR H CD1 1 
ATOM   7088  C  CD2 . TYR H  2 95  ? -48.633 -33.574 1.846   1.00 28.40 ? 300  TYR H CD2 1 
ATOM   7089  C  CE1 . TYR H  2 95  ? -49.753 -31.136 1.179   1.00 26.62 ? 300  TYR H CE1 1 
ATOM   7090  C  CE2 . TYR H  2 95  ? -49.064 -33.343 0.551   1.00 27.86 ? 300  TYR H CE2 1 
ATOM   7091  C  CZ  . TYR H  2 95  ? -49.624 -32.124 0.221   1.00 27.05 ? 300  TYR H CZ  1 
ATOM   7092  O  OH  . TYR H  2 95  ? -50.053 -31.892 -1.056  1.00 26.46 ? 300  TYR H OH  1 
ATOM   7093  N  N   . THR H  2 96  ? -51.487 -33.775 4.641   1.00 32.62 ? 301  THR H N   1 
ATOM   7094  C  CA  . THR H  2 96  ? -52.397 -34.799 4.160   1.00 34.25 ? 301  THR H CA  1 
ATOM   7095  C  C   . THR H  2 96  ? -52.486 -34.812 2.619   1.00 34.13 ? 301  THR H C   1 
ATOM   7096  O  O   . THR H  2 96  ? -52.693 -35.867 2.015   1.00 35.55 ? 301  THR H O   1 
ATOM   7097  C  CB  . THR H  2 96  ? -53.811 -34.645 4.786   1.00 35.29 ? 301  THR H CB  1 
ATOM   7098  O  OG1 . THR H  2 96  ? -54.484 -33.493 4.258   1.00 34.46 ? 301  THR H OG1 1 
ATOM   7099  C  CG2 . THR H  2 96  ? -53.719 -34.511 6.299   1.00 35.87 ? 301  THR H CG2 1 
ATOM   7100  N  N   . GLY H  2 97  ? -52.334 -33.654 1.981   1.00 32.96 ? 302  GLY H N   1 
ATOM   7101  C  CA  . GLY H  2 97  ? -52.611 -33.544 0.546   1.00 32.75 ? 302  GLY H CA  1 
ATOM   7102  C  C   . GLY H  2 97  ? -54.100 -33.565 0.231   1.00 34.42 ? 302  GLY H C   1 
ATOM   7103  O  O   . GLY H  2 97  ? -54.509 -34.035 -0.827  1.00 34.69 ? 302  GLY H O   1 
ATOM   7104  N  N   . THR H  2 98  ? -54.912 -33.060 1.160   1.00 35.92 ? 303  THR H N   1 
ATOM   7105  C  CA  . THR H  2 98  ? -56.354 -32.904 0.949   1.00 37.65 ? 303  THR H CA  1 
ATOM   7106  C  C   . THR H  2 98  ? -56.793 -31.582 1.552   1.00 38.01 ? 303  THR H C   1 
ATOM   7107  O  O   . THR H  2 98  ? -56.030 -30.948 2.263   1.00 36.94 ? 303  THR H O   1 
ATOM   7108  C  CB  . THR H  2 98  ? -57.158 -34.022 1.630   1.00 39.70 ? 303  THR H CB  1 
ATOM   7109  O  OG1 . THR H  2 98  ? -56.947 -33.954 3.046   1.00 40.23 ? 303  THR H OG1 1 
ATOM   7110  C  CG2 . THR H  2 98  ? -56.735 -35.396 1.105   1.00 40.24 ? 303  THR H CG2 1 
ATOM   7111  N  N   . ASP H  2 99  ? -58.034 -31.182 1.295   1.00 39.94 ? 304  ASP H N   1 
ATOM   7112  C  CA  . ASP H  2 99  ? -58.539 -29.925 1.833   1.00 40.74 ? 304  ASP H CA  1 
ATOM   7113  C  C   . ASP H  2 99  ? -59.118 -30.108 3.233   1.00 42.28 ? 304  ASP H C   1 
ATOM   7114  O  O   . ASP H  2 99  ? -60.291 -29.830 3.467   1.00 43.27 ? 304  ASP H O   1 
ATOM   7115  C  CB  . ASP H  2 99  ? -59.583 -29.306 0.903   1.00 41.42 ? 304  ASP H CB  1 
ATOM   7116  C  CG  . ASP H  2 99  ? -59.947 -27.877 1.313   1.00 42.12 ? 304  ASP H CG  1 
ATOM   7117  O  OD1 . ASP H  2 99  ? -59.009 -27.020 1.472   1.00 41.04 ? 304  ASP H OD1 1 
ATOM   7118  O  OD2 . ASP H  2 99  ? -61.171 -27.631 1.493   1.00 43.23 ? 304  ASP H OD2 1 
ATOM   7119  N  N   . SER H  2 100 ? -58.275 -30.555 4.163   1.00 42.55 ? 305  SER H N   1 
ATOM   7120  C  CA  . SER H  2 100 ? -58.683 -30.767 5.547   1.00 44.30 ? 305  SER H CA  1 
ATOM   7121  C  C   . SER H  2 100 ? -59.051 -29.442 6.214   1.00 44.26 ? 305  SER H C   1 
ATOM   7122  O  O   . SER H  2 100 ? -58.699 -28.381 5.706   1.00 42.94 ? 305  SER H O   1 
ATOM   7123  C  CB  . SER H  2 100 ? -57.590 -31.503 6.342   1.00 44.38 ? 305  SER H CB  1 
ATOM   7124  O  OG  . SER H  2 100 ? -56.290 -31.100 5.966   1.00 42.73 ? 305  SER H OG  1 
ATOM   7125  N  N   . PRO H  2 101 ? -59.788 -29.501 7.342   1.00 46.01 ? 306  PRO H N   1 
ATOM   7126  C  CA  . PRO H  2 101 ? -60.178 -28.255 8.006   1.00 46.33 ? 306  PRO H CA  1 
ATOM   7127  C  C   . PRO H  2 101 ? -58.972 -27.581 8.650   1.00 45.28 ? 306  PRO H C   1 
ATOM   7128  O  O   . PRO H  2 101 ? -57.986 -28.259 8.934   1.00 44.58 ? 306  PRO H O   1 
ATOM   7129  C  CB  . PRO H  2 101 ? -61.195 -28.709 9.071   1.00 48.17 ? 306  PRO H CB  1 
ATOM   7130  C  CG  . PRO H  2 101 ? -61.416 -30.171 8.859   1.00 49.08 ? 306  PRO H CG  1 
ATOM   7131  C  CD  . PRO H  2 101 ? -60.252 -30.688 8.080   1.00 47.63 ? 306  PRO H CD  1 
ATOM   7132  N  N   . CYS H  2 102 ? -59.049 -26.269 8.875   1.00 44.91 ? 307  CYS H N   1 
ATOM   7133  C  CA  . CYS H  2 102 ? -57.915 -25.508 9.429   1.00 44.53 ? 307  CYS H CA  1 
ATOM   7134  C  C   . CYS H  2 102 ? -57.748 -25.728 10.939  1.00 47.06 ? 307  CYS H C   1 
ATOM   7135  O  O   . CYS H  2 102 ? -57.936 -24.808 11.733  1.00 48.28 ? 307  CYS H O   1 
ATOM   7136  C  CB  . CYS H  2 102 ? -58.061 -24.012 9.105   1.00 42.88 ? 307  CYS H CB  1 
ATOM   7137  S  SG  . CYS H  2 102 ? -56.718 -22.930 9.705   1.00 42.17 ? 307  CYS H SG  1 
ATOM   7138  N  N   . LYS H  2 103 ? -57.394 -26.955 11.323  1.00 49.33 ? 308  LYS H N   1 
ATOM   7139  C  CA  . LYS H  2 103 ? -57.161 -27.323 12.719  1.00 50.98 ? 308  LYS H CA  1 
ATOM   7140  C  C   . LYS H  2 103 ? -55.719 -27.761 12.889  1.00 50.92 ? 308  LYS H C   1 
ATOM   7141  O  O   . LYS H  2 103 ? -55.153 -28.412 12.009  1.00 51.66 ? 308  LYS H O   1 
ATOM   7142  C  CB  . LYS H  2 103 ? -58.073 -28.473 13.123  1.00 54.05 ? 308  LYS H CB  1 
ATOM   7143  C  CG  . LYS H  2 103 ? -59.533 -28.090 13.243  1.00 55.93 ? 308  LYS H CG  1 
ATOM   7144  C  CD  . LYS H  2 103 ? -60.385 -29.313 13.515  1.00 58.58 ? 308  LYS H CD  1 
ATOM   7145  C  CE  . LYS H  2 103 ? -61.861 -28.978 13.432  1.00 60.58 ? 308  LYS H CE  1 
ATOM   7146  N  NZ  . LYS H  2 103 ? -62.681 -30.078 14.002  1.00 63.45 ? 308  LYS H NZ  1 
ATOM   7147  N  N   . MET H  2 104 ? -55.126 -27.418 14.024  1.00 51.36 ? 309  MET H N   1 
ATOM   7148  C  CA  . MET H  2 104 ? -53.725 -27.740 14.281  1.00 50.83 ? 309  MET H CA  1 
ATOM   7149  C  C   . MET H  2 104 ? -53.448 -27.677 15.784  1.00 52.75 ? 309  MET H C   1 
ATOM   7150  O  O   . MET H  2 104 ? -54.369 -27.452 16.571  1.00 53.07 ? 309  MET H O   1 
ATOM   7151  C  CB  . MET H  2 104 ? -52.819 -26.773 13.496  1.00 48.42 ? 309  MET H CB  1 
ATOM   7152  C  CG  . MET H  2 104 ? -52.909 -25.308 13.912  1.00 47.93 ? 309  MET H CG  1 
ATOM   7153  S  SD  . MET H  2 104 ? -52.306 -24.171 12.640  1.00 46.92 ? 309  MET H SD  1 
ATOM   7154  C  CE  . MET H  2 104 ? -53.838 -23.677 11.841  1.00 46.57 ? 309  MET H CE  1 
ATOM   7155  N  N   . LYS H  2 105 ? -52.193 -27.882 16.183  1.00 53.11 ? 310  LYS H N   1 
ATOM   7156  C  CA  . LYS H  2 105 ? -51.823 -27.820 17.610  1.00 55.19 ? 310  LYS H CA  1 
ATOM   7157  C  C   . LYS H  2 105 ? -51.788 -26.353 18.093  1.00 54.93 ? 310  LYS H C   1 
ATOM   7158  O  O   . LYS H  2 105 ? -51.789 -25.432 17.278  1.00 54.26 ? 310  LYS H O   1 
ATOM   7159  C  CB  . LYS H  2 105 ? -50.480 -28.520 17.857  1.00 55.06 ? 310  LYS H CB  1 
ATOM   7160  C  CG  . LYS H  2 105 ? -50.442 -30.004 17.484  1.00 55.13 ? 310  LYS H CG  1 
ATOM   7161  C  CD  . LYS H  2 105 ? -49.006 -30.520 17.525  1.00 55.13 ? 310  LYS H CD  1 
ATOM   7162  C  CE  . LYS H  2 105 ? -48.853 -31.936 16.983  1.00 55.53 ? 310  LYS H CE  1 
ATOM   7163  N  NZ  . LYS H  2 105 ? -49.164 -32.973 18.004  1.00 57.66 ? 310  LYS H NZ  1 
ATOM   7164  N  N   . GLU H  2 106 ? -51.745 -26.139 19.406  1.00 56.93 ? 311  GLU H N   1 
ATOM   7165  C  CA  . GLU H  2 106 ? -52.090 -24.826 19.985  1.00 57.09 ? 311  GLU H CA  1 
ATOM   7166  C  C   . GLU H  2 106 ? -50.954 -23.800 20.157  1.00 54.30 ? 311  GLU H C   1 
ATOM   7167  O  O   . GLU H  2 106 ? -51.156 -22.616 19.877  1.00 54.25 ? 311  GLU H O   1 
ATOM   7168  C  CB  . GLU H  2 106 ? -52.810 -25.025 21.327  1.00 60.52 ? 311  GLU H CB  1 
ATOM   7169  C  CG  . GLU H  2 106 ? -54.222 -25.582 21.192  1.00 62.60 ? 311  GLU H CG  1 
ATOM   7170  C  CD  . GLU H  2 106 ? -54.921 -25.757 22.531  1.00 66.78 ? 311  GLU H CD  1 
ATOM   7171  O  OE1 . GLU H  2 106 ? -54.337 -25.369 23.566  1.00 69.14 ? 311  GLU H OE1 1 
ATOM   7172  O  OE2 . GLU H  2 106 ? -56.055 -26.284 22.557  1.00 68.58 ? 311  GLU H OE2 1 
ATOM   7173  N  N   . ASP H  2 107 ? -49.779 -24.243 20.607  1.00 53.02 ? 312  ASP H N   1 
ATOM   7174  C  CA  . ASP H  2 107 ? -48.674 -23.329 20.986  1.00 51.73 ? 312  ASP H CA  1 
ATOM   7175  C  C   . ASP H  2 107 ? -47.746 -22.917 19.836  1.00 47.92 ? 312  ASP H C   1 
ATOM   7176  O  O   . ASP H  2 107 ? -46.655 -22.412 20.084  1.00 47.21 ? 312  ASP H O   1 
ATOM   7177  C  CB  . ASP H  2 107 ? -47.809 -23.986 22.079  1.00 53.72 ? 312  ASP H CB  1 
ATOM   7178  C  CG  . ASP H  2 107 ? -48.287 -23.663 23.482  1.00 56.68 ? 312  ASP H CG  1 
ATOM   7179  O  OD1 . ASP H  2 107 ? -47.929 -22.576 23.987  1.00 57.81 ? 312  ASP H OD1 1 
ATOM   7180  O  OD2 . ASP H  2 107 ? -48.997 -24.501 24.088  1.00 58.43 ? 312  ASP H OD2 1 
ATOM   7181  N  N   . CYS H  2 108 ? -48.174 -23.100 18.590  1.00 45.59 ? 313  CYS H N   1 
ATOM   7182  C  CA  . CYS H  2 108 ? -47.231 -23.149 17.477  1.00 42.34 ? 313  CYS H CA  1 
ATOM   7183  C  C   . CYS H  2 108 ? -46.535 -21.810 17.177  1.00 38.57 ? 313  CYS H C   1 
ATOM   7184  O  O   . CYS H  2 108 ? -47.179 -20.773 17.002  1.00 37.01 ? 313  CYS H O   1 
ATOM   7185  C  CB  . CYS H  2 108 ? -47.915 -23.710 16.223  1.00 43.11 ? 313  CYS H CB  1 
ATOM   7186  S  SG  . CYS H  2 108 ? -48.428 -25.453 16.384  1.00 47.59 ? 313  CYS H SG  1 
ATOM   7187  N  N   . PHE H  2 109 ? -45.206 -21.853 17.131  1.00 36.02 ? 314  PHE H N   1 
ATOM   7188  C  CA  . PHE H  2 109 ? -44.404 -20.691 16.763  1.00 33.39 ? 314  PHE H CA  1 
ATOM   7189  C  C   . PHE H  2 109 ? -44.619 -20.429 15.272  1.00 30.70 ? 314  PHE H C   1 
ATOM   7190  O  O   . PHE H  2 109 ? -44.772 -21.372 14.497  1.00 30.64 ? 314  PHE H O   1 
ATOM   7191  C  CB  . PHE H  2 109 ? -42.926 -20.945 17.069  1.00 33.00 ? 314  PHE H CB  1 
ATOM   7192  C  CG  . PHE H  2 109 ? -42.019 -19.828 16.649  1.00 31.53 ? 314  PHE H CG  1 
ATOM   7193  C  CD1 . PHE H  2 109 ? -41.741 -18.782 17.509  1.00 31.99 ? 314  PHE H CD1 1 
ATOM   7194  C  CD2 . PHE H  2 109 ? -41.444 -19.821 15.385  1.00 30.33 ? 314  PHE H CD2 1 
ATOM   7195  C  CE1 . PHE H  2 109 ? -40.907 -17.746 17.121  1.00 31.00 ? 314  PHE H CE1 1 
ATOM   7196  C  CE2 . PHE H  2 109 ? -40.615 -18.787 14.986  1.00 29.28 ? 314  PHE H CE2 1 
ATOM   7197  C  CZ  . PHE H  2 109 ? -40.342 -17.753 15.858  1.00 29.65 ? 314  PHE H CZ  1 
ATOM   7198  N  N   . ARG H  2 110 ? -44.664 -19.160 14.874  1.00 28.00 ? 315  ARG H N   1 
ATOM   7199  C  CA  . ARG H  2 110 ? -44.910 -18.823 13.472  1.00 25.91 ? 315  ARG H CA  1 
ATOM   7200  C  C   . ARG H  2 110 ? -43.730 -18.066 12.904  1.00 24.00 ? 315  ARG H C   1 
ATOM   7201  O  O   . ARG H  2 110 ? -43.281 -17.098 13.503  1.00 23.82 ? 315  ARG H O   1 
ATOM   7202  C  CB  . ARG H  2 110 ? -46.230 -18.060 13.308  1.00 25.96 ? 315  ARG H CB  1 
ATOM   7203  C  CG  . ARG H  2 110 ? -47.401 -18.864 13.861  1.00 27.29 ? 315  ARG H CG  1 
ATOM   7204  C  CD  . ARG H  2 110 ? -48.773 -18.331 13.497  1.00 27.52 ? 315  ARG H CD  1 
ATOM   7205  N  NE  . ARG H  2 110 ? -49.098 -18.554 12.089  1.00 26.71 ? 315  ARG H NE  1 
ATOM   7206  C  CZ  . ARG H  2 110 ? -49.995 -19.416 11.613  1.00 27.00 ? 315  ARG H CZ  1 
ATOM   7207  N  NH1 . ARG H  2 110 ? -50.710 -20.203 12.404  1.00 28.20 ? 315  ARG H NH1 1 
ATOM   7208  N  NH2 . ARG H  2 110 ? -50.172 -19.483 10.296  1.00 26.21 ? 315  ARG H NH2 1 
ATOM   7209  N  N   . TYR H  2 111 ? -43.221 -18.548 11.763  1.00 22.55 ? 316  TYR H N   1 
ATOM   7210  C  CA  . TYR H  2 111 ? -42.117 -17.906 11.038  1.00 21.25 ? 316  TYR H CA  1 
ATOM   7211  C  C   . TYR H  2 111 ? -42.665 -16.931 10.003  1.00 19.96 ? 316  TYR H C   1 
ATOM   7212  O  O   . TYR H  2 111 ? -43.523 -17.299 9.200   1.00 19.52 ? 316  TYR H O   1 
ATOM   7213  C  CB  . TYR H  2 111 ? -41.266 -18.935 10.292  1.00 20.99 ? 316  TYR H CB  1 
ATOM   7214  C  CG  . TYR H  2 111 ? -40.426 -19.885 11.136  1.00 21.86 ? 316  TYR H CG  1 
ATOM   7215  C  CD1 . TYR H  2 111 ? -40.989 -21.024 11.719  1.00 22.89 ? 316  TYR H CD1 1 
ATOM   7216  C  CD2 . TYR H  2 111 ? -39.055 -19.687 11.278  1.00 21.83 ? 316  TYR H CD2 1 
ATOM   7217  C  CE1 . TYR H  2 111 ? -40.220 -21.911 12.457  1.00 23.82 ? 316  TYR H CE1 1 
ATOM   7218  C  CE2 . TYR H  2 111 ? -38.276 -20.560 12.016  1.00 22.80 ? 316  TYR H CE2 1 
ATOM   7219  C  CZ  . TYR H  2 111 ? -38.867 -21.675 12.599  1.00 23.83 ? 316  TYR H CZ  1 
ATOM   7220  O  OH  . TYR H  2 111 ? -38.091 -22.542 13.325  1.00 25.04 ? 316  TYR H OH  1 
ATOM   7221  N  N   . TYR H  2 112 ? -42.129 -15.710 9.992   1.00 19.25 ? 317  TYR H N   1 
ATOM   7222  C  CA  . TYR H  2 112 ? -42.583 -14.656 9.083   1.00 18.42 ? 317  TYR H CA  1 
ATOM   7223  C  C   . TYR H  2 112 ? -41.559 -14.220 8.018   1.00 17.36 ? 317  TYR H C   1 
ATOM   7224  O  O   . TYR H  2 112 ? -40.355 -14.373 8.190   1.00 17.35 ? 317  TYR H O   1 
ATOM   7225  C  CB  . TYR H  2 112 ? -42.965 -13.437 9.903   1.00 18.96 ? 317  TYR H CB  1 
ATOM   7226  C  CG  . TYR H  2 112 ? -44.116 -13.653 10.838  1.00 19.91 ? 317  TYR H CG  1 
ATOM   7227  C  CD1 . TYR H  2 112 ? -43.926 -14.184 12.105  1.00 20.81 ? 317  TYR H CD1 1 
ATOM   7228  C  CD2 . TYR H  2 112 ? -45.397 -13.295 10.462  1.00 20.10 ? 317  TYR H CD2 1 
ATOM   7229  C  CE1 . TYR H  2 112 ? -44.997 -14.367 12.971  1.00 21.95 ? 317  TYR H CE1 1 
ATOM   7230  C  CE2 . TYR H  2 112 ? -46.468 -13.470 11.309  1.00 21.28 ? 317  TYR H CE2 1 
ATOM   7231  C  CZ  . TYR H  2 112 ? -46.269 -14.001 12.556  1.00 22.16 ? 317  TYR H CZ  1 
ATOM   7232  O  OH  . TYR H  2 112 ? -47.351 -14.153 13.356  1.00 23.53 ? 317  TYR H OH  1 
ATOM   7233  N  N   . SER H  2 113 ? -42.046 -13.639 6.932   1.00 16.58 ? 318  SER H N   1 
ATOM   7234  C  CA  . SER H  2 113 ? -41.174 -13.025 5.922   1.00 15.81 ? 318  SER H CA  1 
ATOM   7235  C  C   . SER H  2 113 ? -41.080 -11.513 6.115   1.00 15.79 ? 318  SER H C   1 
ATOM   7236  O  O   . SER H  2 113 ? -42.109 -10.838 6.223   1.00 16.00 ? 318  SER H O   1 
ATOM   7237  C  CB  . SER H  2 113 ? -41.710 -13.310 4.522   1.00 15.32 ? 318  SER H CB  1 
ATOM   7238  O  OG  . SER H  2 113 ? -41.575 -14.689 4.210   1.00 15.28 ? 318  SER H OG  1 
ATOM   7239  N  N   . SER H  2 114 ? -39.863 -10.981 6.128   1.00 15.60 ? 319  SER H N   1 
ATOM   7240  C  CA  . SER H  2 114 ? -39.664 -9.533  6.240   1.00 15.82 ? 319  SER H CA  1 
ATOM   7241  C  C   . SER H  2 114 ? -39.871 -8.821  4.923   1.00 15.49 ? 319  SER H C   1 
ATOM   7242  O  O   . SER H  2 114 ? -40.217 -7.653  4.912   1.00 16.25 ? 319  SER H O   1 
ATOM   7243  C  CB  . SER H  2 114 ? -38.265 -9.203  6.762   1.00 15.99 ? 319  SER H CB  1 
ATOM   7244  O  OG  . SER H  2 114 ? -37.280 -9.813  5.961   1.00 15.59 ? 319  SER H OG  1 
ATOM   7245  N  N   . GLU H  2 115 ? -39.665 -9.519  3.809   1.00 14.95 ? 320  GLU H N   1 
ATOM   7246  C  CA  . GLU H  2 115 ? -39.661 -8.863  2.493   1.00 14.71 ? 320  GLU H CA  1 
ATOM   7247  C  C   . GLU H  2 115 ? -40.001 -9.873  1.429   1.00 14.21 ? 320  GLU H C   1 
ATOM   7248  O  O   . GLU H  2 115 ? -39.662 -11.057 1.543   1.00 13.98 ? 320  GLU H O   1 
ATOM   7249  C  CB  . GLU H  2 115 ? -38.274 -8.248  2.179   1.00 14.76 ? 320  GLU H CB  1 
ATOM   7250  C  CG  . GLU H  2 115 ? -38.228 -7.179  1.076   1.00 14.92 ? 320  GLU H CG  1 
ATOM   7251  C  CD  . GLU H  2 115 ? -38.213 -7.717  -0.368  1.00 14.70 ? 320  GLU H CD  1 
ATOM   7252  O  OE1 . GLU H  2 115 ? -37.755 -8.886  -0.595  1.00 14.68 ? 320  GLU H OE1 1 
ATOM   7253  O  OE2 . GLU H  2 115 ? -38.681 -6.966  -1.298  1.00 15.00 ? 320  GLU H OE2 1 
ATOM   7254  N  N   . TYR H  2 116 ? -40.648 -9.395  0.382   1.00 14.00 ? 321  TYR H N   1 
ATOM   7255  C  CA  . TYR H  2 116 ? -40.925 -10.232 -0.763  1.00 13.68 ? 321  TYR H CA  1 
ATOM   7256  C  C   . TYR H  2 116 ? -41.075 -9.368  -1.999  1.00 13.75 ? 321  TYR H C   1 
ATOM   7257  O  O   . TYR H  2 116 ? -41.537 -8.221  -1.921  1.00 14.39 ? 321  TYR H O   1 
ATOM   7258  C  CB  . TYR H  2 116 ? -42.169 -11.097 -0.541  1.00 13.67 ? 321  TYR H CB  1 
ATOM   7259  C  CG  . TYR H  2 116 ? -43.416 -10.336 -0.185  1.00 14.07 ? 321  TYR H CG  1 
ATOM   7260  C  CD1 . TYR H  2 116 ? -43.681 -9.986  1.133   1.00 14.40 ? 321  TYR H CD1 1 
ATOM   7261  C  CD2 . TYR H  2 116 ? -44.355 -9.992  -1.156  1.00 14.25 ? 321  TYR H CD2 1 
ATOM   7262  C  CE1 . TYR H  2 116 ? -44.828 -9.304  1.474   1.00 14.89 ? 321  TYR H CE1 1 
ATOM   7263  C  CE2 . TYR H  2 116 ? -45.508 -9.302  -0.821  1.00 14.76 ? 321  TYR H CE2 1 
ATOM   7264  C  CZ  . TYR H  2 116 ? -45.736 -8.962  0.502   1.00 15.09 ? 321  TYR H CZ  1 
ATOM   7265  O  OH  . TYR H  2 116 ? -46.866 -8.262  0.864   1.00 15.77 ? 321  TYR H OH  1 
ATOM   7266  N  N   . HIS H  2 117 ? -40.679 -9.932  -3.129  1.00 13.48 ? 322  HIS H N   1 
ATOM   7267  C  CA  . HIS H  2 117 ? -40.792 -9.245  -4.403  1.00 13.68 ? 322  HIS H CA  1 
ATOM   7268  C  C   . HIS H  2 117 ? -40.674 -10.221 -5.574  1.00 13.52 ? 322  HIS H C   1 
ATOM   7269  O  O   . HIS H  2 117 ? -40.053 -11.276 -5.463  1.00 13.24 ? 322  HIS H O   1 
ATOM   7270  C  CB  . HIS H  2 117 ? -39.744 -8.108  -4.514  1.00 13.88 ? 322  HIS H CB  1 
ATOM   7271  C  CG  . HIS H  2 117 ? -38.315 -8.571  -4.541  1.00 13.79 ? 322  HIS H CG  1 
ATOM   7272  N  ND1 . HIS H  2 117 ? -37.531 -8.654  -3.406  1.00 13.80 ? 322  HIS H ND1 1 
ATOM   7273  C  CD2 . HIS H  2 117 ? -37.509 -8.925  -5.571  1.00 13.88 ? 322  HIS H CD2 1 
ATOM   7274  C  CE1 . HIS H  2 117 ? -36.325 -9.076  -3.729  1.00 13.78 ? 322  HIS H CE1 1 
ATOM   7275  N  NE2 . HIS H  2 117 ? -36.279 -9.236  -5.039  1.00 13.85 ? 322  HIS H NE2 1 
ATOM   7276  N  N   . TYR H  2 118 ? -41.292 -9.874  -6.691  1.00 13.79 ? 323  TYR H N   1 
ATOM   7277  C  CA  . TYR H  2 118 ? -40.972 -10.538 -7.940  1.00 13.93 ? 323  TYR H CA  1 
ATOM   7278  C  C   . TYR H  2 118 ? -39.576 -10.094 -8.324  1.00 13.98 ? 323  TYR H C   1 
ATOM   7279  O  O   . TYR H  2 118 ? -39.261 -8.922  -8.213  1.00 14.22 ? 323  TYR H O   1 
ATOM   7280  C  CB  . TYR H  2 118 ? -41.962 -10.148 -9.034  1.00 14.45 ? 323  TYR H CB  1 
ATOM   7281  C  CG  . TYR H  2 118 ? -43.303 -10.844 -8.950  1.00 14.55 ? 323  TYR H CG  1 
ATOM   7282  C  CD1 . TYR H  2 118 ? -43.395 -12.213 -9.069  1.00 14.50 ? 323  TYR H CD1 1 
ATOM   7283  C  CD2 . TYR H  2 118 ? -44.469 -10.128 -8.803  1.00 14.93 ? 323  TYR H CD2 1 
ATOM   7284  C  CE1 . TYR H  2 118 ? -44.620 -12.851 -8.996  1.00 14.83 ? 323  TYR H CE1 1 
ATOM   7285  C  CE2 . TYR H  2 118 ? -45.701 -10.752 -8.740  1.00 15.17 ? 323  TYR H CE2 1 
ATOM   7286  C  CZ  . TYR H  2 118 ? -45.768 -12.107 -8.835  1.00 15.09 ? 323  TYR H CZ  1 
ATOM   7287  O  OH  . TYR H  2 118 ? -46.980 -12.735 -8.781  1.00 15.53 ? 323  TYR H OH  1 
ATOM   7288  N  N   . VAL H  2 119 ? -38.736 -11.031 -8.743  1.00 13.95 ? 324  VAL H N   1 
ATOM   7289  C  CA  . VAL H  2 119 ? -37.418 -10.709 -9.262  1.00 14.29 ? 324  VAL H CA  1 
ATOM   7290  C  C   . VAL H  2 119 ? -37.583 -9.772  -10.445 1.00 14.95 ? 324  VAL H C   1 
ATOM   7291  O  O   . VAL H  2 119 ? -38.280 -10.102 -11.412 1.00 15.19 ? 324  VAL H O   1 
ATOM   7292  C  CB  . VAL H  2 119 ? -36.644 -11.961 -9.722  1.00 14.27 ? 324  VAL H CB  1 
ATOM   7293  C  CG1 . VAL H  2 119 ? -35.371 -11.561 -10.464 1.00 14.74 ? 324  VAL H CG1 1 
ATOM   7294  C  CG2 . VAL H  2 119 ? -36.309 -12.853 -8.539  1.00 13.86 ? 324  VAL H CG2 1 
ATOM   7295  N  N   . GLY H  2 120 ? -36.937 -8.604  -10.350 1.00 15.59 ? 325  GLY H N   1 
ATOM   7296  C  CA  . GLY H  2 120 ? -37.088 -7.528  -11.333 1.00 16.21 ? 325  GLY H CA  1 
ATOM   7297  C  C   . GLY H  2 120 ? -38.017 -6.414  -10.872 1.00 16.46 ? 325  GLY H C   1 
ATOM   7298  O  O   . GLY H  2 120 ? -38.258 -5.463  -11.610 1.00 17.45 ? 325  GLY H O   1 
ATOM   7299  N  N   . GLY H  2 121 ? -38.562 -6.540  -9.665  1.00 15.97 ? 326  GLY H N   1 
ATOM   7300  C  CA  . GLY H  2 121 ? -39.376 -5.481  -9.060  1.00 16.22 ? 326  GLY H CA  1 
ATOM   7301  C  C   . GLY H  2 121 ? -40.880 -5.688  -9.160  1.00 16.24 ? 326  GLY H C   1 
ATOM   7302  O  O   . GLY H  2 121 ? -41.628 -5.239  -8.292  1.00 16.73 ? 326  GLY H O   1 
ATOM   7303  N  N   . PHE H  2 122 ? -41.317 -6.357  -10.220 1.00 16.24 ? 327  PHE H N   1 
ATOM   7304  C  CA  . PHE H  2 122 ? -42.735 -6.565  -10.502 1.00 16.39 ? 327  PHE H CA  1 
ATOM   7305  C  C   . PHE H  2 122 ? -42.910 -7.681  -11.539 1.00 16.42 ? 327  PHE H C   1 
ATOM   7306  O  O   . PHE H  2 122 ? -41.971 -8.004  -12.257 1.00 16.43 ? 327  PHE H O   1 
ATOM   7307  C  CB  . PHE H  2 122 ? -43.349 -5.256  -11.019 1.00 17.13 ? 327  PHE H CB  1 
ATOM   7308  C  CG  . PHE H  2 122 ? -42.567 -4.613  -12.134 1.00 17.65 ? 327  PHE H CG  1 
ATOM   7309  C  CD1 . PHE H  2 122 ? -42.817 -4.939  -13.460 1.00 18.14 ? 327  PHE H CD1 1 
ATOM   7310  C  CD2 . PHE H  2 122 ? -41.568 -3.704  -11.857 1.00 17.82 ? 327  PHE H CD2 1 
ATOM   7311  C  CE1 . PHE H  2 122 ? -42.085 -4.365  -14.482 1.00 18.81 ? 327  PHE H CE1 1 
ATOM   7312  C  CE2 . PHE H  2 122 ? -40.836 -3.117  -12.877 1.00 18.47 ? 327  PHE H CE2 1 
ATOM   7313  C  CZ  . PHE H  2 122 ? -41.099 -3.444  -14.190 1.00 19.00 ? 327  PHE H CZ  1 
ATOM   7314  N  N   . TYR H  2 123 ? -44.102 -8.271  -11.613 1.00 16.63 ? 328  TYR H N   1 
ATOM   7315  C  CA  . TYR H  2 123 ? -44.402 -9.272  -12.654 1.00 16.98 ? 328  TYR H CA  1 
ATOM   7316  C  C   . TYR H  2 123 ? -44.208 -8.601  -13.998 1.00 17.81 ? 328  TYR H C   1 
ATOM   7317  O  O   . TYR H  2 123 ? -44.828 -7.570  -14.264 1.00 18.38 ? 328  TYR H O   1 
ATOM   7318  C  CB  . TYR H  2 123 ? -45.838 -9.816  -12.554 1.00 17.16 ? 328  TYR H CB  1 
ATOM   7319  C  CG  . TYR H  2 123 ? -46.167 -10.905 -13.551 1.00 17.51 ? 328  TYR H CG  1 
ATOM   7320  C  CD1 . TYR H  2 123 ? -45.571 -12.155 -13.469 1.00 17.21 ? 328  TYR H CD1 1 
ATOM   7321  C  CD2 . TYR H  2 123 ? -47.072 -10.703 -14.573 1.00 18.42 ? 328  TYR H CD2 1 
ATOM   7322  C  CE1 . TYR H  2 123 ? -45.867 -13.167 -14.377 1.00 17.61 ? 328  TYR H CE1 1 
ATOM   7323  C  CE2 . TYR H  2 123 ? -47.377 -11.721 -15.488 1.00 18.87 ? 328  TYR H CE2 1 
ATOM   7324  C  CZ  . TYR H  2 123 ? -46.770 -12.951 -15.379 1.00 18.40 ? 328  TYR H CZ  1 
ATOM   7325  O  OH  . TYR H  2 123 ? -47.048 -13.976 -16.266 1.00 19.02 ? 328  TYR H OH  1 
ATOM   7326  N  N   . GLY H  2 124 ? -43.342 -9.192  -14.816 1.00 18.05 ? 329  GLY H N   1 
ATOM   7327  C  CA  . GLY H  2 124 ? -42.930 -8.616  -16.087 1.00 19.19 ? 329  GLY H CA  1 
ATOM   7328  C  C   . GLY H  2 124 ? -41.431 -8.357  -16.197 1.00 18.96 ? 329  GLY H C   1 
ATOM   7329  O  O   . GLY H  2 124 ? -40.866 -8.423  -17.282 1.00 19.57 ? 329  GLY H O   1 
ATOM   7330  N  N   . GLY H  2 125 ? -40.775 -8.091  -15.074 1.00 18.24 ? 330  GLY H N   1 
ATOM   7331  C  CA  . GLY H  2 125 ? -39.366 -7.705  -15.068 1.00 18.22 ? 330  GLY H CA  1 
ATOM   7332  C  C   . GLY H  2 125 ? -38.364 -8.818  -14.869 1.00 17.75 ? 330  GLY H C   1 
ATOM   7333  O  O   . GLY H  2 125 ? -37.190 -8.542  -14.732 1.00 18.04 ? 330  GLY H O   1 
ATOM   7334  N  N   . CYS H  2 126 ? -38.788 -10.077 -14.877 1.00 17.35 ? 331  CYS H N   1 
ATOM   7335  C  CA  . CYS H  2 126 ? -37.841 -11.160 -14.659 1.00 17.07 ? 331  CYS H CA  1 
ATOM   7336  C  C   . CYS H  2 126 ? -36.921 -11.422 -15.869 1.00 17.71 ? 331  CYS H C   1 
ATOM   7337  O  O   . CYS H  2 126 ? -37.305 -11.187 -17.019 1.00 18.34 ? 331  CYS H O   1 
ATOM   7338  C  CB  . CYS H  2 126 ? -38.578 -12.443 -14.255 1.00 16.73 ? 331  CYS H CB  1 
ATOM   7339  S  SG  . CYS H  2 126 ? -37.513 -13.717 -13.537 1.00 16.25 ? 331  CYS H SG  1 
ATOM   7340  N  N   . ASN H  2 127 ? -35.694 -11.860 -15.581 1.00 17.55 ? 332  ASN H N   1 
ATOM   7341  C  CA  . ASN H  2 127 ? -34.777 -12.383 -16.599 1.00 18.28 ? 332  ASN H CA  1 
ATOM   7342  C  C   . ASN H  2 127 ? -33.707 -13.294 -15.976 1.00 18.06 ? 332  ASN H C   1 
ATOM   7343  O  O   . ASN H  2 127 ? -33.545 -13.340 -14.757 1.00 17.36 ? 332  ASN H O   1 
ATOM   7344  C  CB  . ASN H  2 127 ? -34.137 -11.252 -17.429 1.00 19.16 ? 332  ASN H CB  1 
ATOM   7345  C  CG  . ASN H  2 127 ? -33.189 -10.365 -16.614 1.00 19.09 ? 332  ASN H CG  1 
ATOM   7346  O  OD1 . ASN H  2 127 ? -32.301 -10.848 -15.919 1.00 18.72 ? 332  ASN H OD1 1 
ATOM   7347  N  ND2 . ASN H  2 127 ? -33.364 -9.061  -16.728 1.00 19.42 ? 332  ASN H ND2 1 
ATOM   7348  N  N   . GLU H  2 128 ? -32.979 -14.011 -16.824 1.00 18.82 ? 333  GLU H N   1 
ATOM   7349  C  CA  . GLU H  2 128 ? -31.977 -14.984 -16.381 1.00 18.95 ? 333  GLU H CA  1 
ATOM   7350  C  C   . GLU H  2 128 ? -30.926 -14.382 -15.441 1.00 18.55 ? 333  GLU H C   1 
ATOM   7351  O  O   . GLU H  2 128 ? -30.632 -14.939 -14.383 1.00 17.94 ? 333  GLU H O   1 
ATOM   7352  C  CB  . GLU H  2 128 ? -31.299 -15.628 -17.594 1.00 20.42 ? 333  GLU H CB  1 
ATOM   7353  C  CG  . GLU H  2 128 ? -30.147 -16.569 -17.249 1.00 21.04 ? 333  GLU H CG  1 
ATOM   7354  C  CD  . GLU H  2 128 ? -29.085 -16.665 -18.326 1.00 22.90 ? 333  GLU H CD  1 
ATOM   7355  O  OE1 . GLU H  2 128 ? -29.060 -15.815 -19.253 1.00 23.55 ? 333  GLU H OE1 1 
ATOM   7356  O  OE2 . GLU H  2 128 ? -28.264 -17.607 -18.253 1.00 23.88 ? 333  GLU H OE2 1 
ATOM   7357  N  N   . ALA H  2 129 ? -30.376 -13.244 -15.834 1.00 18.84 ? 334  ALA H N   1 
ATOM   7358  C  CA  . ALA H  2 129 ? -29.307 -12.600 -15.075 1.00 18.81 ? 334  ALA H CA  1 
ATOM   7359  C  C   . ALA H  2 129 ? -29.741 -12.209 -13.676 1.00 17.84 ? 334  ALA H C   1 
ATOM   7360  O  O   . ALA H  2 129 ? -29.039 -12.484 -12.712 1.00 17.61 ? 334  ALA H O   1 
ATOM   7361  C  CB  . ALA H  2 129 ? -28.794 -11.383 -15.817 1.00 19.64 ? 334  ALA H CB  1 
ATOM   7362  N  N   . LEU H  2 130 ? -30.897 -11.565 -13.566 1.00 17.36 ? 335  LEU H N   1 
ATOM   7363  C  CA  . LEU H  2 130 ? -31.416 -11.167 -12.260 1.00 16.61 ? 335  LEU H CA  1 
ATOM   7364  C  C   . LEU H  2 130 ? -31.677 -12.399 -11.400 1.00 16.07 ? 335  LEU H C   1 
ATOM   7365  O  O   . LEU H  2 130 ? -31.438 -12.382 -10.204 1.00 16.05 ? 335  LEU H O   1 
ATOM   7366  C  CB  . LEU H  2 130 ? -32.662 -10.293 -12.395 1.00 16.34 ? 335  LEU H CB  1 
ATOM   7367  C  CG  . LEU H  2 130 ? -32.449 -8.889  -12.995 1.00 17.02 ? 335  LEU H CG  1 
ATOM   7368  C  CD1 . LEU H  2 130 ? -33.790 -8.227  -13.244 1.00 16.92 ? 335  LEU H CD1 1 
ATOM   7369  C  CD2 . LEU H  2 130 ? -31.569 -7.976  -12.147 1.00 17.16 ? 335  LEU H CD2 1 
ATOM   7370  N  N   . MET H  2 131 ? -32.123 -13.483 -12.030 1.00 16.12 ? 336  MET H N   1 
ATOM   7371  C  CA  . MET H  2 131 ? -32.330 -14.750 -11.341 1.00 15.74 ? 336  MET H CA  1 
ATOM   7372  C  C   . MET H  2 131 ? -31.030 -15.366 -10.805 1.00 16.00 ? 336  MET H C   1 
ATOM   7373  O  O   . MET H  2 131 ? -30.965 -15.702 -9.641  1.00 15.71 ? 336  MET H O   1 
ATOM   7374  C  CB  . MET H  2 131 ? -33.069 -15.733 -12.248 1.00 15.92 ? 336  MET H CB  1 
ATOM   7375  C  CG  . MET H  2 131 ? -34.525 -15.364 -12.450 1.00 15.65 ? 336  MET H CG  1 
ATOM   7376  S  SD  . MET H  2 131 ? -35.307 -16.316 -13.758 1.00 16.27 ? 336  MET H SD  1 
ATOM   7377  C  CE  . MET H  2 131 ? -35.322 -17.939 -12.995 1.00 15.95 ? 336  MET H CE  1 
ATOM   7378  N  N   . LYS H  2 132 ? -30.000 -15.505 -11.629 1.00 16.72 ? 337  LYS H N   1 
ATOM   7379  C  CA  . LYS H  2 132 ? -28.713 -15.993 -11.127 1.00 17.20 ? 337  LYS H CA  1 
ATOM   7380  C  C   . LYS H  2 132 ? -28.220 -15.132 -9.962  1.00 17.13 ? 337  LYS H C   1 
ATOM   7381  O  O   . LYS H  2 132 ? -27.759 -15.665 -8.962  1.00 17.14 ? 337  LYS H O   1 
ATOM   7382  C  CB  . LYS H  2 132 ? -27.645 -15.970 -12.203 1.00 18.12 ? 337  LYS H CB  1 
ATOM   7383  C  CG  . LYS H  2 132 ? -27.835 -16.942 -13.337 1.00 18.58 ? 337  LYS H CG  1 
ATOM   7384  C  CD  . LYS H  2 132 ? -26.987 -16.513 -14.529 1.00 19.60 ? 337  LYS H CD  1 
ATOM   7385  C  CE  . LYS H  2 132 ? -25.523 -16.839 -14.350 1.00 20.40 ? 337  LYS H CE  1 
ATOM   7386  N  NZ  . LYS H  2 132 ? -24.786 -16.433 -15.585 1.00 21.55 ? 337  LYS H NZ  1 
ATOM   7387  N  N   . LEU H  2 133 ? -28.318 -13.812 -10.116 1.00 17.27 ? 338  LEU H N   1 
ATOM   7388  C  CA  . LEU H  2 133 ? -27.939 -12.854 -9.086  1.00 17.42 ? 338  LEU H CA  1 
ATOM   7389  C  C   . LEU H  2 133 ? -28.631 -13.116 -7.754  1.00 16.80 ? 338  LEU H C   1 
ATOM   7390  O  O   . LEU H  2 133 ? -27.965 -13.245 -6.704  1.00 16.92 ? 338  LEU H O   1 
ATOM   7391  C  CB  . LEU H  2 133 ? -28.285 -11.419 -9.515  1.00 17.64 ? 338  LEU H CB  1 
ATOM   7392  C  CG  . LEU H  2 133 ? -27.210 -10.372 -9.807  1.00 18.62 ? 338  LEU H CG  1 
ATOM   7393  C  CD1 . LEU H  2 133 ? -25.935 -10.653 -9.019  1.00 19.17 ? 338  LEU H CD1 1 
ATOM   7394  C  CD2 . LEU H  2 133 ? -26.880 -10.257 -11.290 1.00 19.41 ? 338  LEU H CD2 1 
ATOM   7395  N  N   . GLU H  2 134 ? -29.968 -13.175 -7.803  1.00 16.29 ? 339  GLU H N   1 
ATOM   7396  C  CA  . GLU H  2 134 ? -30.793 -13.407 -6.619  1.00 15.80 ? 339  GLU H CA  1 
ATOM   7397  C  C   . GLU H  2 134 ? -30.436 -14.774 -6.034  1.00 15.72 ? 339  GLU H C   1 
ATOM   7398  O  O   . GLU H  2 134 ? -30.212 -14.900 -4.840  1.00 15.47 ? 339  GLU H O   1 
ATOM   7399  C  CB  . GLU H  2 134 ? -32.288 -13.329 -6.988  1.00 15.58 ? 339  GLU H CB  1 
ATOM   7400  C  CG  . GLU H  2 134 ? -33.275 -13.722 -5.888  1.00 15.23 ? 339  GLU H CG  1 
ATOM   7401  C  CD  . GLU H  2 134 ? -33.414 -12.676 -4.786  1.00 15.37 ? 339  GLU H CD  1 
ATOM   7402  O  OE1 . GLU H  2 134 ? -33.392 -11.461 -5.102  1.00 16.01 ? 339  GLU H OE1 1 
ATOM   7403  O  OE2 . GLU H  2 134 ? -33.567 -13.053 -3.592  1.00 15.43 ? 339  GLU H OE2 1 
ATOM   7404  N  N   . LEU H  2 135 ? -30.352 -15.780 -6.901  1.00 15.86 ? 340  LEU H N   1 
ATOM   7405  C  CA  . LEU H  2 135 ? -30.017 -17.144 -6.484  1.00 16.00 ? 340  LEU H CA  1 
ATOM   7406  C  C   . LEU H  2 135 ? -28.712 -17.219 -5.677  1.00 16.42 ? 340  LEU H C   1 
ATOM   7407  O  O   . LEU H  2 135 ? -28.665 -17.863 -4.640  1.00 16.46 ? 340  LEU H O   1 
ATOM   7408  C  CB  . LEU H  2 135 ? -29.906 -18.067 -7.700  1.00 16.38 ? 340  LEU H CB  1 
ATOM   7409  C  CG  . LEU H  2 135 ? -29.682 -19.552 -7.427  1.00 16.76 ? 340  LEU H CG  1 
ATOM   7410  C  CD1 . LEU H  2 135 ? -30.775 -20.104 -6.534  1.00 16.31 ? 340  LEU H CD1 1 
ATOM   7411  C  CD2 . LEU H  2 135 ? -29.675 -20.314 -8.742  1.00 17.29 ? 340  LEU H CD2 1 
ATOM   7412  N  N   . VAL H  2 136 ? -27.664 -16.562 -6.154  1.00 16.92 ? 341  VAL H N   1 
ATOM   7413  C  CA  . VAL H  2 136 ? -26.334 -16.696 -5.545  1.00 17.59 ? 341  VAL H CA  1 
ATOM   7414  C  C   . VAL H  2 136 ? -26.176 -15.810 -4.303  1.00 17.48 ? 341  VAL H C   1 
ATOM   7415  O  O   . VAL H  2 136 ? -25.610 -16.233 -3.321  1.00 17.76 ? 341  VAL H O   1 
ATOM   7416  C  CB  . VAL H  2 136 ? -25.218 -16.435 -6.575  1.00 18.40 ? 341  VAL H CB  1 
ATOM   7417  C  CG1 . VAL H  2 136 ? -23.845 -16.373 -5.908  1.00 19.22 ? 341  VAL H CG1 1 
ATOM   7418  C  CG2 . VAL H  2 136 ? -25.233 -17.520 -7.643  1.00 18.76 ? 341  VAL H CG2 1 
ATOM   7419  N  N   . HIS H  2 137 ? -26.723 -14.604 -4.341  1.00 17.24 ? 342  HIS H N   1 
ATOM   7420  C  CA  . HIS H  2 137 ? -26.617 -13.670 -3.222  1.00 17.30 ? 342  HIS H CA  1 
ATOM   7421  C  C   . HIS H  2 137 ? -27.625 -13.892 -2.110  1.00 16.70 ? 342  HIS H C   1 
ATOM   7422  O  O   . HIS H  2 137 ? -27.358 -13.548 -0.965  1.00 16.71 ? 342  HIS H O   1 
ATOM   7423  C  CB  . HIS H  2 137 ? -26.755 -12.236 -3.720  1.00 17.43 ? 342  HIS H CB  1 
ATOM   7424  C  CG  . HIS H  2 137 ? -25.564 -11.753 -4.470  1.00 18.37 ? 342  HIS H CG  1 
ATOM   7425  N  ND1 . HIS H  2 137 ? -25.432 -11.911 -5.830  1.00 18.77 ? 342  HIS H ND1 1 
ATOM   7426  C  CD2 . HIS H  2 137 ? -24.439 -11.132 -4.052  1.00 19.33 ? 342  HIS H CD2 1 
ATOM   7427  C  CE1 . HIS H  2 137 ? -24.274 -11.408 -6.222  1.00 19.76 ? 342  HIS H CE1 1 
ATOM   7428  N  NE2 . HIS H  2 137 ? -23.650 -10.933 -5.160  1.00 20.12 ? 342  HIS H NE2 1 
ATOM   7429  N  N   . HIS H  2 138 ? -28.795 -14.431 -2.439  1.00 16.18 ? 343  HIS H N   1 
ATOM   7430  C  CA  . HIS H  2 138 ? -29.858 -14.549 -1.444  1.00 15.82 ? 343  HIS H CA  1 
ATOM   7431  C  C   . HIS H  2 138 ? -30.435 -15.940 -1.280  1.00 15.72 ? 343  HIS H C   1 
ATOM   7432  O  O   . HIS H  2 138 ? -31.148 -16.180 -0.322  1.00 15.79 ? 343  HIS H O   1 
ATOM   7433  C  CB  . HIS H  2 138 ? -30.987 -13.577 -1.756  1.00 15.45 ? 343  HIS H CB  1 
ATOM   7434  C  CG  . HIS H  2 138 ? -30.553 -12.147 -1.869  1.00 15.74 ? 343  HIS H CG  1 
ATOM   7435  N  ND1 . HIS H  2 138 ? -30.298 -11.354 -0.767  1.00 16.06 ? 343  HIS H ND1 1 
ATOM   7436  C  CD2 . HIS H  2 138 ? -30.333 -11.361 -2.954  1.00 15.97 ? 343  HIS H CD2 1 
ATOM   7437  C  CE1 . HIS H  2 138 ? -29.941 -10.141 -1.167  1.00 16.31 ? 343  HIS H CE1 1 
ATOM   7438  N  NE2 . HIS H  2 138 ? -29.956 -10.118 -2.489  1.00 16.26 ? 343  HIS H NE2 1 
ATOM   7439  N  N   . GLY H  2 139 ? -30.167 -16.859 -2.199  1.00 15.80 ? 344  GLY H N   1 
ATOM   7440  C  CA  . GLY H  2 139 ? -30.568 -18.245 -2.010  1.00 15.83 ? 344  GLY H CA  1 
ATOM   7441  C  C   . GLY H  2 139 ? -31.674 -18.685 -2.949  1.00 15.43 ? 344  GLY H C   1 
ATOM   7442  O  O   . GLY H  2 139 ? -32.134 -17.905 -3.771  1.00 15.09 ? 344  GLY H O   1 
ATOM   7443  N  N   . PRO H  2 140 ? -32.108 -19.954 -2.829  1.00 15.52 ? 345  PRO H N   1 
ATOM   7444  C  CA  . PRO H  2 140 ? -33.120 -20.524 -3.703  1.00 15.36 ? 345  PRO H CA  1 
ATOM   7445  C  C   . PRO H  2 140 ? -34.400 -19.686 -3.787  1.00 14.91 ? 345  PRO H C   1 
ATOM   7446  O  O   . PRO H  2 140 ? -34.739 -18.970 -2.838  1.00 14.71 ? 345  PRO H O   1 
ATOM   7447  C  CB  . PRO H  2 140 ? -33.395 -21.875 -3.048  1.00 15.74 ? 345  PRO H CB  1 
ATOM   7448  C  CG  . PRO H  2 140 ? -32.059 -22.246 -2.470  1.00 16.30 ? 345  PRO H CG  1 
ATOM   7449  C  CD  . PRO H  2 140 ? -31.567 -20.958 -1.898  1.00 16.04 ? 345  PRO H CD  1 
ATOM   7450  N  N   . MET H  2 141 ? -35.107 -19.790 -4.914  1.00 14.90 ? 346  MET H N   1 
ATOM   7451  C  CA  . MET H  2 141 ? -36.278 -18.971 -5.159  1.00 14.60 ? 346  MET H CA  1 
ATOM   7452  C  C   . MET H  2 141 ? -37.367 -19.758 -5.885  1.00 14.69 ? 346  MET H C   1 
ATOM   7453  O  O   . MET H  2 141 ? -37.084 -20.707 -6.638  1.00 14.99 ? 346  MET H O   1 
ATOM   7454  C  CB  . MET H  2 141 ? -35.888 -17.730 -5.966  1.00 14.71 ? 346  MET H CB  1 
ATOM   7455  C  CG  . MET H  2 141 ? -35.681 -18.004 -7.452  1.00 15.10 ? 346  MET H CG  1 
ATOM   7456  S  SD  . MET H  2 141 ? -34.725 -16.704 -8.262  1.00 15.72 ? 346  MET H SD  1 
ATOM   7457  C  CE  . MET H  2 141 ? -33.191 -17.050 -7.419  1.00 15.57 ? 346  MET H CE  1 
ATOM   7458  N  N   . ALA H  2 142 ? -38.614 -19.364 -5.645  1.00 14.39 ? 347  ALA H N   1 
ATOM   7459  C  CA  . ALA H  2 142 ? -39.730 -20.018 -6.287  1.00 14.57 ? 347  ALA H CA  1 
ATOM   7460  C  C   . ALA H  2 142 ? -39.798 -19.505 -7.720  1.00 14.68 ? 347  ALA H C   1 
ATOM   7461  O  O   . ALA H  2 142 ? -39.698 -18.311 -7.961  1.00 14.45 ? 347  ALA H O   1 
ATOM   7462  C  CB  . ALA H  2 142 ? -41.025 -19.747 -5.540  1.00 14.45 ? 347  ALA H CB  1 
ATOM   7463  N  N   . VAL H  2 143 ? -39.906 -20.423 -8.664  1.00 15.15 ? 348  VAL H N   1 
ATOM   7464  C  CA  . VAL H  2 143 ? -40.161 -20.078 -10.040 1.00 15.58 ? 348  VAL H CA  1 
ATOM   7465  C  C   . VAL H  2 143 ? -41.370 -20.885 -10.496 1.00 16.23 ? 348  VAL H C   1 
ATOM   7466  O  O   . VAL H  2 143 ? -41.860 -21.750 -9.771  1.00 16.51 ? 348  VAL H O   1 
ATOM   7467  C  CB  . VAL H  2 143 ? -38.944 -20.333 -10.955 1.00 15.81 ? 348  VAL H CB  1 
ATOM   7468  C  CG1 . VAL H  2 143 ? -37.766 -19.483 -10.509 1.00 15.48 ? 348  VAL H CG1 1 
ATOM   7469  C  CG2 . VAL H  2 143 ? -38.556 -21.809 -10.985 1.00 16.25 ? 348  VAL H CG2 1 
ATOM   7470  N  N   . ALA H  2 144 ? -41.864 -20.578 -11.682 1.00 16.86 ? 349  ALA H N   1 
ATOM   7471  C  CA  . ALA H  2 144 ? -42.979 -21.317 -12.255 1.00 17.69 ? 349  ALA H CA  1 
ATOM   7472  C  C   . ALA H  2 144 ? -42.727 -21.563 -13.731 1.00 18.43 ? 349  ALA H C   1 
ATOM   7473  O  O   . ALA H  2 144 ? -42.007 -20.816 -14.381 1.00 18.45 ? 349  ALA H O   1 
ATOM   7474  C  CB  . ALA H  2 144 ? -44.283 -20.554 -12.056 1.00 17.76 ? 349  ALA H CB  1 
ATOM   7475  N  N   . PHE H  2 145 ? -43.318 -22.630 -14.249 1.00 19.28 ? 350  PHE H N   1 
ATOM   7476  C  CA  . PHE H  2 145 ? -43.242 -22.927 -15.666 1.00 20.08 ? 350  PHE H CA  1 
ATOM   7477  C  C   . PHE H  2 145 ? -44.448 -23.770 -16.125 1.00 21.03 ? 350  PHE H C   1 
ATOM   7478  O  O   . PHE H  2 145 ? -45.268 -24.209 -15.315 1.00 20.94 ? 350  PHE H O   1 
ATOM   7479  C  CB  . PHE H  2 145 ? -41.931 -23.623 -15.969 1.00 20.33 ? 350  PHE H CB  1 
ATOM   7480  C  CG  . PHE H  2 145 ? -41.880 -25.044 -15.510 1.00 20.68 ? 350  PHE H CG  1 
ATOM   7481  C  CD1 . PHE H  2 145 ? -41.918 -25.353 -14.171 1.00 20.28 ? 350  PHE H CD1 1 
ATOM   7482  C  CD2 . PHE H  2 145 ? -41.781 -26.070 -16.426 1.00 21.67 ? 350  PHE H CD2 1 
ATOM   7483  C  CE1 . PHE H  2 145 ? -41.865 -26.667 -13.746 1.00 20.83 ? 350  PHE H CE1 1 
ATOM   7484  C  CE2 . PHE H  2 145 ? -41.733 -27.383 -16.011 1.00 22.14 ? 350  PHE H CE2 1 
ATOM   7485  C  CZ  . PHE H  2 145 ? -41.770 -27.681 -14.670 1.00 21.73 ? 350  PHE H CZ  1 
ATOM   7486  N  N   . GLU H  2 146 ? -44.546 -23.961 -17.436 1.00 21.97 ? 351  GLU H N   1 
ATOM   7487  C  CA  . GLU H  2 146 ? -45.615 -24.713 -18.038 1.00 23.13 ? 351  GLU H CA  1 
ATOM   7488  C  C   . GLU H  2 146 ? -45.155 -26.159 -18.247 1.00 24.00 ? 351  GLU H C   1 
ATOM   7489  O  O   . GLU H  2 146 ? -44.224 -26.426 -19.008 1.00 24.43 ? 351  GLU H O   1 
ATOM   7490  C  CB  . GLU H  2 146 ? -46.026 -24.060 -19.360 1.00 23.84 ? 351  GLU H CB  1 
ATOM   7491  C  CG  . GLU H  2 146 ? -47.246 -24.677 -20.044 1.00 25.02 ? 351  GLU H CG  1 
ATOM   7492  C  CD  . GLU H  2 146 ? -48.564 -24.445 -19.309 1.00 24.91 ? 351  GLU H CD  1 
ATOM   7493  O  OE1 . GLU H  2 146 ? -48.563 -23.783 -18.249 1.00 23.91 ? 351  GLU H OE1 1 
ATOM   7494  O  OE2 . GLU H  2 146 ? -49.610 -24.935 -19.799 1.00 25.81 ? 351  GLU H OE2 1 
ATOM   7495  N  N   . VAL H  2 147 ? -45.807 -27.073 -17.527 1.00 24.44 ? 352  VAL H N   1 
ATOM   7496  C  CA  . VAL H  2 147 ? -45.598 -28.511 -17.667 1.00 25.43 ? 352  VAL H CA  1 
ATOM   7497  C  C   . VAL H  2 147 ? -46.375 -29.000 -18.893 1.00 26.91 ? 352  VAL H C   1 
ATOM   7498  O  O   . VAL H  2 147 ? -47.565 -28.745 -19.015 1.00 27.15 ? 352  VAL H O   1 
ATOM   7499  C  CB  . VAL H  2 147 ? -46.080 -29.264 -16.400 1.00 25.19 ? 352  VAL H CB  1 
ATOM   7500  C  CG1 . VAL H  2 147 ? -46.132 -30.777 -16.620 1.00 26.21 ? 352  VAL H CG1 1 
ATOM   7501  C  CG2 . VAL H  2 147 ? -45.188 -28.922 -15.218 1.00 24.10 ? 352  VAL H CG2 1 
ATOM   7502  N  N   . TYR H  2 148 ? -45.680 -29.669 -19.805 1.00 28.27 ? 353  TYR H N   1 
ATOM   7503  C  CA  . TYR H  2 148 ? -46.312 -30.336 -20.935 1.00 30.19 ? 353  TYR H CA  1 
ATOM   7504  C  C   . TYR H  2 148 ? -46.219 -31.843 -20.763 1.00 31.58 ? 353  TYR H C   1 
ATOM   7505  O  O   . TYR H  2 148 ? -45.484 -32.330 -19.914 1.00 31.10 ? 353  TYR H O   1 
ATOM   7506  C  CB  . TYR H  2 148 ? -45.636 -29.934 -22.244 1.00 30.74 ? 353  TYR H CB  1 
ATOM   7507  C  CG  . TYR H  2 148 ? -45.807 -28.481 -22.600 1.00 30.32 ? 353  TYR H CG  1 
ATOM   7508  C  CD1 . TYR H  2 148 ? -46.962 -28.024 -23.235 1.00 30.91 ? 353  TYR H CD1 1 
ATOM   7509  C  CD2 . TYR H  2 148 ? -44.810 -27.553 -22.303 1.00 29.45 ? 353  TYR H CD2 1 
ATOM   7510  C  CE1 . TYR H  2 148 ? -47.116 -26.682 -23.563 1.00 30.69 ? 353  TYR H CE1 1 
ATOM   7511  C  CE2 . TYR H  2 148 ? -44.957 -26.217 -22.634 1.00 29.12 ? 353  TYR H CE2 1 
ATOM   7512  C  CZ  . TYR H  2 148 ? -46.105 -25.789 -23.258 1.00 29.78 ? 353  TYR H CZ  1 
ATOM   7513  O  OH  . TYR H  2 148 ? -46.230 -24.462 -23.564 1.00 30.06 ? 353  TYR H OH  1 
ATOM   7514  N  N   . ASP H  2 149 ? -46.962 -32.577 -21.585 1.00 33.83 ? 354  ASP H N   1 
ATOM   7515  C  CA  . ASP H  2 149 ? -46.933 -34.047 -21.557 1.00 35.44 ? 354  ASP H CA  1 
ATOM   7516  C  C   . ASP H  2 149 ? -45.496 -34.574 -21.521 1.00 35.36 ? 354  ASP H C   1 
ATOM   7517  O  O   . ASP H  2 149 ? -45.157 -35.371 -20.650 1.00 35.53 ? 354  ASP H O   1 
ATOM   7518  C  CB  . ASP H  2 149 ? -47.675 -34.654 -22.772 1.00 37.38 ? 354  ASP H CB  1 
ATOM   7519  C  CG  . ASP H  2 149 ? -49.196 -34.668 -22.606 1.00 38.25 ? 354  ASP H CG  1 
ATOM   7520  O  OD1 . ASP H  2 149 ? -49.720 -34.008 -21.682 1.00 37.78 ? 354  ASP H OD1 1 
ATOM   7521  O  OD2 . ASP H  2 149 ? -49.877 -35.345 -23.417 1.00 40.45 ? 354  ASP H OD2 1 
ATOM   7522  N  N   . ASP H  2 150 ? -44.650 -34.110 -22.444 1.00 35.53 ? 355  ASP H N   1 
ATOM   7523  C  CA  . ASP H  2 150 ? -43.284 -34.646 -22.569 1.00 36.01 ? 355  ASP H CA  1 
ATOM   7524  C  C   . ASP H  2 150 ? -42.422 -34.482 -21.304 1.00 35.10 ? 355  ASP H C   1 
ATOM   7525  O  O   . ASP H  2 150 ? -41.395 -35.125 -21.174 1.00 36.15 ? 355  ASP H O   1 
ATOM   7526  C  CB  . ASP H  2 150 ? -42.570 -34.081 -23.818 1.00 36.44 ? 355  ASP H CB  1 
ATOM   7527  C  CG  . ASP H  2 150 ? -42.063 -32.645 -23.642 1.00 35.22 ? 355  ASP H CG  1 
ATOM   7528  O  OD1 . ASP H  2 150 ? -42.570 -31.899 -22.773 1.00 34.47 ? 355  ASP H OD1 1 
ATOM   7529  O  OD2 . ASP H  2 150 ? -41.151 -32.254 -24.402 1.00 35.13 ? 355  ASP H OD2 1 
ATOM   7530  N  N   . PHE H  2 151 ? -42.848 -33.623 -20.382 1.00 34.26 ? 356  PHE H N   1 
ATOM   7531  C  CA  . PHE H  2 151 ? -42.143 -33.393 -19.121 1.00 33.14 ? 356  PHE H CA  1 
ATOM   7532  C  C   . PHE H  2 151 ? -42.508 -34.426 -18.061 1.00 34.42 ? 356  PHE H C   1 
ATOM   7533  O  O   . PHE H  2 151 ? -41.674 -34.776 -17.219 1.00 33.91 ? 356  PHE H O   1 
ATOM   7534  C  CB  . PHE H  2 151 ? -42.455 -31.987 -18.603 1.00 31.14 ? 356  PHE H CB  1 
ATOM   7535  C  CG  . PHE H  2 151 ? -41.774 -31.648 -17.313 1.00 29.88 ? 356  PHE H CG  1 
ATOM   7536  C  CD1 . PHE H  2 151 ? -40.436 -31.268 -17.296 1.00 29.40 ? 356  PHE H CD1 1 
ATOM   7537  C  CD2 . PHE H  2 151 ? -42.465 -31.701 -16.112 1.00 29.05 ? 356  PHE H CD2 1 
ATOM   7538  C  CE1 . PHE H  2 151 ? -39.805 -30.940 -16.105 1.00 28.14 ? 356  PHE H CE1 1 
ATOM   7539  C  CE2 . PHE H  2 151 ? -41.834 -31.379 -14.923 1.00 27.95 ? 356  PHE H CE2 1 
ATOM   7540  C  CZ  . PHE H  2 151 ? -40.507 -30.994 -14.919 1.00 27.32 ? 356  PHE H CZ  1 
ATOM   7541  N  N   . LEU H  2 152 ? -43.757 -34.900 -18.092 1.00 36.39 ? 357  LEU H N   1 
ATOM   7542  C  CA  . LEU H  2 152 ? -44.220 -35.917 -17.138 1.00 37.44 ? 357  LEU H CA  1 
ATOM   7543  C  C   . LEU H  2 152 ? -43.321 -37.148 -17.246 1.00 39.35 ? 357  LEU H C   1 
ATOM   7544  O  O   . LEU H  2 152 ? -42.904 -37.704 -16.231 1.00 40.86 ? 357  LEU H O   1 
ATOM   7545  C  CB  . LEU H  2 152 ? -45.693 -36.287 -17.381 1.00 38.25 ? 357  LEU H CB  1 
ATOM   7546  C  CG  . LEU H  2 152 ? -46.761 -35.172 -17.359 1.00 37.41 ? 357  LEU H CG  1 
ATOM   7547  C  CD1 . LEU H  2 152 ? -48.122 -35.747 -17.720 1.00 38.50 ? 357  LEU H CD1 1 
ATOM   7548  C  CD2 . LEU H  2 152 ? -46.835 -34.447 -16.024 1.00 35.99 ? 357  LEU H CD2 1 
ATOM   7549  N  N   . HIS H  2 153 ? -42.964 -37.515 -18.477 1.00 41.42 ? 358  HIS H N   1 
ATOM   7550  C  CA  . HIS H  2 153 ? -42.059 -38.641 -18.741 1.00 43.92 ? 358  HIS H CA  1 
ATOM   7551  C  C   . HIS H  2 153 ? -40.554 -38.305 -18.679 1.00 41.90 ? 358  HIS H C   1 
ATOM   7552  O  O   . HIS H  2 153 ? -39.749 -39.010 -19.298 1.00 42.92 ? 358  HIS H O   1 
ATOM   7553  C  CB  . HIS H  2 153 ? -42.374 -39.248 -20.119 1.00 47.61 ? 358  HIS H CB  1 
ATOM   7554  C  CG  . HIS H  2 153 ? -43.835 -39.495 -20.351 1.00 50.46 ? 358  HIS H CG  1 
ATOM   7555  N  ND1 . HIS H  2 153 ? -44.634 -40.147 -19.435 1.00 51.76 ? 358  HIS H ND1 1 
ATOM   7556  C  CD2 . HIS H  2 153 ? -44.639 -39.173 -21.393 1.00 53.22 ? 358  HIS H CD2 1 
ATOM   7557  C  CE1 . HIS H  2 153 ? -45.870 -40.212 -19.900 1.00 54.43 ? 358  HIS H CE1 1 
ATOM   7558  N  NE2 . HIS H  2 153 ? -45.899 -39.631 -21.088 1.00 55.10 ? 358  HIS H NE2 1 
ATOM   7559  N  N   . TYR H  2 154 ? -40.172 -37.258 -17.936 1.00 38.49 ? 359  TYR H N   1 
ATOM   7560  C  CA  . TYR H  2 154 ? -38.753 -36.892 -17.770 1.00 36.40 ? 359  TYR H CA  1 
ATOM   7561  C  C   . TYR H  2 154 ? -38.054 -37.776 -16.743 1.00 36.46 ? 359  TYR H C   1 
ATOM   7562  O  O   . TYR H  2 154 ? -38.622 -38.102 -15.693 1.00 36.95 ? 359  TYR H O   1 
ATOM   7563  C  CB  . TYR H  2 154 ? -38.605 -35.420 -17.368 1.00 33.98 ? 359  TYR H CB  1 
ATOM   7564  C  CG  . TYR H  2 154 ? -37.225 -35.014 -16.886 1.00 32.56 ? 359  TYR H CG  1 
ATOM   7565  C  CD1 . TYR H  2 154 ? -36.885 -35.113 -15.543 1.00 31.83 ? 359  TYR H CD1 1 
ATOM   7566  C  CD2 . TYR H  2 154 ? -36.275 -34.507 -17.761 1.00 32.24 ? 359  TYR H CD2 1 
ATOM   7567  C  CE1 . TYR H  2 154 ? -35.639 -34.739 -15.083 1.00 30.80 ? 359  TYR H CE1 1 
ATOM   7568  C  CE2 . TYR H  2 154 ? -35.024 -34.123 -17.312 1.00 31.63 ? 359  TYR H CE2 1 
ATOM   7569  C  CZ  . TYR H  2 154 ? -34.709 -34.241 -15.968 1.00 31.14 ? 359  TYR H CZ  1 
ATOM   7570  O  OH  . TYR H  2 154 ? -33.473 -33.857 -15.492 1.00 30.43 ? 359  TYR H OH  1 
ATOM   7571  N  N   . LYS H  2 155 ? -36.813 -38.146 -17.057 1.00 36.78 ? 360  LYS H N   1 
ATOM   7572  C  CA  . LYS H  2 155 ? -35.981 -38.972 -16.185 1.00 36.94 ? 360  LYS H CA  1 
ATOM   7573  C  C   . LYS H  2 155 ? -34.666 -38.287 -15.873 1.00 35.76 ? 360  LYS H C   1 
ATOM   7574  O  O   . LYS H  2 155 ? -34.285 -38.151 -14.711 1.00 34.54 ? 360  LYS H O   1 
ATOM   7575  C  CB  . LYS H  2 155 ? -35.689 -40.310 -16.854 1.00 38.91 ? 360  LYS H CB  1 
ATOM   7576  C  CG  . LYS H  2 155 ? -36.832 -41.294 -16.751 1.00 40.27 ? 360  LYS H CG  1 
ATOM   7577  C  CD  . LYS H  2 155 ? -36.345 -42.719 -16.988 1.00 42.48 ? 360  LYS H CD  1 
ATOM   7578  C  CE  . LYS H  2 155 ? -37.442 -43.743 -16.780 1.00 43.50 ? 360  LYS H CE  1 
ATOM   7579  N  NZ  . LYS H  2 155 ? -36.870 -45.115 -16.871 1.00 45.88 ? 360  LYS H NZ  1 
ATOM   7580  N  N   . LYS H  2 156 ? -33.958 -37.887 -16.923 1.00 35.68 ? 361  LYS H N   1 
ATOM   7581  C  CA  . LYS H  2 156 ? -32.663 -37.243 -16.760 1.00 35.05 ? 361  LYS H CA  1 
ATOM   7582  C  C   . LYS H  2 156 ? -32.328 -36.345 -17.945 1.00 34.46 ? 361  LYS H C   1 
ATOM   7583  O  O   . LYS H  2 156 ? -33.013 -36.359 -18.968 1.00 34.59 ? 361  LYS H O   1 
ATOM   7584  C  CB  . LYS H  2 156 ? -31.569 -38.304 -16.587 1.00 36.50 ? 361  LYS H CB  1 
ATOM   7585  C  CG  . LYS H  2 156 ? -31.430 -39.221 -17.788 1.00 38.29 ? 361  LYS H CG  1 
ATOM   7586  C  CD  . LYS H  2 156 ? -30.350 -40.263 -17.593 1.00 40.01 ? 361  LYS H CD  1 
ATOM   7587  C  CE  . LYS H  2 156 ? -30.344 -41.216 -18.774 1.00 41.90 ? 361  LYS H CE  1 
ATOM   7588  N  NZ  . LYS H  2 156 ? -29.381 -42.335 -18.583 1.00 43.76 ? 361  LYS H NZ  1 
ATOM   7589  N  N   . GLY H  2 157 ? -31.256 -35.575 -17.786 1.00 33.59 ? 362  GLY H N   1 
ATOM   7590  C  CA  . GLY H  2 157 ? -30.759 -34.696 -18.832 1.00 33.22 ? 362  GLY H CA  1 
ATOM   7591  C  C   . GLY H  2 157 ? -31.267 -33.276 -18.691 1.00 31.33 ? 362  GLY H C   1 
ATOM   7592  O  O   . GLY H  2 157 ? -31.841 -32.892 -17.673 1.00 30.10 ? 362  GLY H O   1 
ATOM   7593  N  N   . ILE H  2 158 ? -31.046 -32.491 -19.729 1.00 31.16 ? 363  ILE H N   1 
ATOM   7594  C  CA  . ILE H  2 158 ? -31.446 -31.106 -19.726 1.00 29.97 ? 363  ILE H CA  1 
ATOM   7595  C  C   . ILE H  2 158 ? -32.742 -31.014 -20.513 1.00 29.69 ? 363  ILE H C   1 
ATOM   7596  O  O   . ILE H  2 158 ? -32.765 -31.157 -21.732 1.00 30.53 ? 363  ILE H O   1 
ATOM   7597  C  CB  . ILE H  2 158 ? -30.323 -30.190 -20.272 1.00 30.28 ? 363  ILE H CB  1 
ATOM   7598  C  CG1 . ILE H  2 158 ? -29.054 -30.369 -19.429 1.00 30.56 ? 363  ILE H CG1 1 
ATOM   7599  C  CG2 . ILE H  2 158 ? -30.736 -28.730 -20.212 1.00 29.15 ? 363  ILE H CG2 1 
ATOM   7600  C  CD1 . ILE H  2 158 ? -27.770 -30.067 -20.165 1.00 31.78 ? 363  ILE H CD1 1 
ATOM   7601  N  N   . TYR H  2 159 ? -33.825 -30.817 -19.780 1.00 28.52 ? 364  TYR H N   1 
ATOM   7602  C  CA  . TYR H  2 159 ? -35.136 -30.769 -20.365 1.00 28.62 ? 364  TYR H CA  1 
ATOM   7603  C  C   . TYR H  2 159 ? -35.309 -29.569 -21.286 1.00 28.83 ? 364  TYR H C   1 
ATOM   7604  O  O   . TYR H  2 159 ? -34.933 -28.436 -20.957 1.00 27.97 ? 364  TYR H O   1 
ATOM   7605  C  CB  . TYR H  2 159 ? -36.219 -30.755 -19.281 1.00 27.55 ? 364  TYR H CB  1 
ATOM   7606  C  CG  . TYR H  2 159 ? -37.589 -30.506 -19.855 1.00 27.52 ? 364  TYR H CG  1 
ATOM   7607  C  CD1 . TYR H  2 159 ? -38.256 -31.502 -20.559 1.00 28.47 ? 364  TYR H CD1 1 
ATOM   7608  C  CD2 . TYR H  2 159 ? -38.195 -29.261 -19.735 1.00 26.50 ? 364  TYR H CD2 1 
ATOM   7609  C  CE1 . TYR H  2 159 ? -39.495 -31.267 -21.121 1.00 28.69 ? 364  TYR H CE1 1 
ATOM   7610  C  CE2 . TYR H  2 159 ? -39.438 -29.015 -20.281 1.00 26.75 ? 364  TYR H CE2 1 
ATOM   7611  C  CZ  . TYR H  2 159 ? -40.086 -30.023 -20.977 1.00 27.90 ? 364  TYR H CZ  1 
ATOM   7612  O  OH  . TYR H  2 159 ? -41.320 -29.779 -21.530 1.00 28.46 ? 364  TYR H OH  1 
ATOM   7613  N  N   . HIS H  2 160 ? -35.872 -29.852 -22.452 1.00 30.37 ? 365  HIS H N   1 
ATOM   7614  C  CA  . HIS H  2 160 ? -36.252 -28.854 -23.436 1.00 31.17 ? 365  HIS H CA  1 
ATOM   7615  C  C   . HIS H  2 160 ? -37.546 -29.358 -24.042 1.00 32.25 ? 365  HIS H C   1 
ATOM   7616  O  O   . HIS H  2 160 ? -37.636 -30.531 -24.408 1.00 33.27 ? 365  HIS H O   1 
ATOM   7617  C  CB  . HIS H  2 160 ? -35.183 -28.735 -24.526 1.00 32.53 ? 365  HIS H CB  1 
ATOM   7618  C  CG  . HIS H  2 160 ? -35.638 -27.979 -25.739 1.00 33.42 ? 365  HIS H CG  1 
ATOM   7619  N  ND1 . HIS H  2 160 ? -35.882 -26.617 -25.724 1.00 32.75 ? 365  HIS H ND1 1 
ATOM   7620  C  CD2 . HIS H  2 160 ? -35.899 -28.395 -27.002 1.00 34.82 ? 365  HIS H CD2 1 
ATOM   7621  C  CE1 . HIS H  2 160 ? -36.274 -26.229 -26.925 1.00 33.76 ? 365  HIS H CE1 1 
ATOM   7622  N  NE2 . HIS H  2 160 ? -36.297 -27.289 -27.718 1.00 35.09 ? 365  HIS H NE2 1 
ATOM   7623  N  N   . HIS H  2 161 ? -38.539 -28.479 -24.144 1.00 32.26 ? 366  HIS H N   1 
ATOM   7624  C  CA  . HIS H  2 161 ? -39.838 -28.860 -24.675 1.00 33.28 ? 366  HIS H CA  1 
ATOM   7625  C  C   . HIS H  2 161 ? -39.777 -28.965 -26.181 1.00 35.67 ? 366  HIS H C   1 
ATOM   7626  O  O   . HIS H  2 161 ? -39.280 -28.057 -26.850 1.00 36.18 ? 366  HIS H O   1 
ATOM   7627  C  CB  . HIS H  2 161 ? -40.917 -27.851 -24.291 1.00 32.18 ? 366  HIS H CB  1 
ATOM   7628  C  CG  . HIS H  2 161 ? -42.224 -28.082 -24.980 1.00 33.06 ? 366  HIS H CG  1 
ATOM   7629  N  ND1 . HIS H  2 161 ? -42.919 -29.270 -24.878 1.00 33.76 ? 366  HIS H ND1 1 
ATOM   7630  C  CD2 . HIS H  2 161 ? -42.961 -27.282 -25.787 1.00 33.46 ? 366  HIS H CD2 1 
ATOM   7631  C  CE1 . HIS H  2 161 ? -44.028 -29.190 -25.590 1.00 34.54 ? 366  HIS H CE1 1 
ATOM   7632  N  NE2 . HIS H  2 161 ? -44.080 -27.992 -26.147 1.00 34.42 ? 366  HIS H NE2 1 
ATOM   7633  N  N   . THR H  2 162 ? -40.280 -30.087 -26.698 1.00 38.13 ? 367  THR H N   1 
ATOM   7634  C  CA  . THR H  2 162 ? -40.547 -30.249 -28.124 1.00 40.56 ? 367  THR H CA  1 
ATOM   7635  C  C   . THR H  2 162 ? -41.737 -31.195 -28.334 1.00 41.82 ? 367  THR H C   1 
ATOM   7636  O  O   . THR H  2 162 ? -42.775 -30.794 -28.869 1.00 43.23 ? 367  THR H O   1 
ATOM   7637  C  CB  . THR H  2 162 ? -39.315 -30.787 -28.869 1.00 41.99 ? 367  THR H CB  1 
ATOM   7638  O  OG1 . THR H  2 162 ? -39.571 -30.761 -30.280 1.00 43.91 ? 367  THR H OG1 1 
ATOM   7639  C  CG2 . THR H  2 162 ? -38.985 -32.219 -28.423 1.00 42.39 ? 367  THR H CG2 1 
ATOM   7640  N  N   . PRO I  3 2   ? -49.241 -2.916  -25.555 1.00 50.63 ? 372  PRO I N   1 
ATOM   7641  C  CA  . PRO I  3 2   ? -47.987 -2.198  -25.290 1.00 48.66 ? 372  PRO I CA  1 
ATOM   7642  C  C   . PRO I  3 2   ? -47.050 -2.948  -24.313 1.00 45.21 ? 372  PRO I C   1 
ATOM   7643  O  O   . PRO I  3 2   ? -45.911 -3.278  -24.676 1.00 45.88 ? 372  PRO I O   1 
ATOM   7644  C  CB  . PRO I  3 2   ? -48.469 -0.855  -24.715 1.00 49.45 ? 372  PRO I CB  1 
ATOM   7645  C  CG  . PRO I  3 2   ? -49.891 -0.696  -25.192 1.00 51.82 ? 372  PRO I CG  1 
ATOM   7646  C  CD  . PRO I  3 2   ? -50.366 -1.995  -25.798 1.00 52.18 ? 372  PRO I CD  1 
ATOM   7647  N  N   . PHE I  3 3   ? -47.522 -3.200  -23.092 1.00 40.83 ? 373  PHE I N   1 
ATOM   7648  C  CA  . PHE I  3 3   ? -46.820 -4.056  -22.134 1.00 36.00 ? 373  PHE I CA  1 
ATOM   7649  C  C   . PHE I  3 3   ? -47.827 -5.084  -21.647 1.00 34.50 ? 373  PHE I C   1 
ATOM   7650  O  O   . PHE I  3 3   ? -48.890 -4.733  -21.129 1.00 34.21 ? 373  PHE I O   1 
ATOM   7651  C  CB  . PHE I  3 3   ? -46.268 -3.243  -20.962 1.00 34.23 ? 373  PHE I CB  1 
ATOM   7652  C  CG  . PHE I  3 3   ? -45.415 -4.043  -19.996 1.00 32.09 ? 373  PHE I CG  1 
ATOM   7653  C  CD1 . PHE I  3 3   ? -44.309 -4.752  -20.437 1.00 31.53 ? 373  PHE I CD1 1 
ATOM   7654  C  CD2 . PHE I  3 3   ? -45.715 -4.069  -18.639 1.00 30.15 ? 373  PHE I CD2 1 
ATOM   7655  C  CE1 . PHE I  3 3   ? -43.532 -5.479  -19.552 1.00 29.99 ? 373  PHE I CE1 1 
ATOM   7656  C  CE2 . PHE I  3 3   ? -44.940 -4.783  -17.750 1.00 28.92 ? 373  PHE I CE2 1 
ATOM   7657  C  CZ  . PHE I  3 3   ? -43.843 -5.491  -18.205 1.00 28.66 ? 373  PHE I CZ  1 
ATOM   7658  N  N   . ASN I  3 4   ? -47.520 -6.354  -21.873 1.00 32.91 ? 374  ASN I N   1 
ATOM   7659  C  CA  . ASN I  3 4   ? -48.364 -7.443  -21.415 1.00 30.97 ? 374  ASN I CA  1 
ATOM   7660  C  C   . ASN I  3 4   ? -47.495 -8.610  -21.018 1.00 28.57 ? 374  ASN I C   1 
ATOM   7661  O  O   . ASN I  3 4   ? -47.187 -9.453  -21.843 1.00 28.98 ? 374  ASN I O   1 
ATOM   7662  C  CB  . ASN I  3 4   ? -49.369 -7.867  -22.484 1.00 32.87 ? 374  ASN I CB  1 
ATOM   7663  C  CG  . ASN I  3 4   ? -50.433 -8.815  -21.929 1.00 33.14 ? 374  ASN I CG  1 
ATOM   7664  O  OD1 . ASN I  3 4   ? -50.165 -9.619  -21.031 1.00 32.53 ? 374  ASN I OD1 1 
ATOM   7665  N  ND2 . ASN I  3 4   ? -51.646 -8.704  -22.442 1.00 34.59 ? 374  ASN I ND2 1 
ATOM   7666  N  N   . PRO I  3 5   ? -47.107 -8.667  -19.742 1.00 26.14 ? 375  PRO I N   1 
ATOM   7667  C  CA  . PRO I  3 5   ? -46.102 -9.612  -19.281 1.00 24.62 ? 375  PRO I CA  1 
ATOM   7668  C  C   . PRO I  3 5   ? -46.547 -11.069 -19.120 1.00 24.27 ? 375  PRO I C   1 
ATOM   7669  O  O   . PRO I  3 5   ? -45.732 -11.896 -18.688 1.00 23.85 ? 375  PRO I O   1 
ATOM   7670  C  CB  . PRO I  3 5   ? -45.715 -9.047  -17.915 1.00 23.18 ? 375  PRO I CB  1 
ATOM   7671  C  CG  . PRO I  3 5   ? -46.932 -8.358  -17.434 1.00 23.89 ? 375  PRO I CG  1 
ATOM   7672  C  CD  . PRO I  3 5   ? -47.569 -7.783  -18.661 1.00 25.61 ? 375  PRO I CD  1 
ATOM   7673  N  N   . PHE I  3 6   ? -47.802 -11.386 -19.437 1.00 24.53 ? 376  PHE I N   1 
ATOM   7674  C  CA  . PHE I  3 6   ? -48.350 -12.716 -19.186 1.00 24.14 ? 376  PHE I CA  1 
ATOM   7675  C  C   . PHE I  3 6   ? -47.586 -13.811 -19.922 1.00 23.87 ? 376  PHE I C   1 
ATOM   7676  O  O   . PHE I  3 6   ? -47.300 -13.690 -21.098 1.00 24.45 ? 376  PHE I O   1 
ATOM   7677  C  CB  . PHE I  3 6   ? -49.832 -12.770 -19.608 1.00 25.49 ? 376  PHE I CB  1 
ATOM   7678  C  CG  . PHE I  3 6   ? -50.473 -14.108 -19.389 1.00 25.83 ? 376  PHE I CG  1 
ATOM   7679  C  CD1 . PHE I  3 6   ? -50.883 -14.491 -18.121 1.00 25.28 ? 376  PHE I CD1 1 
ATOM   7680  C  CD2 . PHE I  3 6   ? -50.648 -14.996 -20.444 1.00 27.12 ? 376  PHE I CD2 1 
ATOM   7681  C  CE1 . PHE I  3 6   ? -51.468 -15.735 -17.906 1.00 25.83 ? 376  PHE I CE1 1 
ATOM   7682  C  CE2 . PHE I  3 6   ? -51.228 -16.242 -20.241 1.00 28.14 ? 376  PHE I CE2 1 
ATOM   7683  C  CZ  . PHE I  3 6   ? -51.649 -16.612 -18.969 1.00 27.03 ? 376  PHE I CZ  1 
ATOM   7684  N  N   . GLU I  3 7   ? -47.252 -14.873 -19.212 1.00 22.80 ? 377  GLU I N   1 
ATOM   7685  C  CA  . GLU I  3 7   ? -46.774 -16.092 -19.835 1.00 23.03 ? 377  GLU I CA  1 
ATOM   7686  C  C   . GLU I  3 7   ? -47.407 -17.273 -19.132 1.00 22.67 ? 377  GLU I C   1 
ATOM   7687  O  O   . GLU I  3 7   ? -47.411 -17.341 -17.906 1.00 21.63 ? 377  GLU I O   1 
ATOM   7688  C  CB  . GLU I  3 7   ? -45.265 -16.192 -19.752 1.00 22.50 ? 377  GLU I CB  1 
ATOM   7689  C  CG  . GLU I  3 7   ? -44.555 -15.335 -20.777 1.00 23.25 ? 377  GLU I CG  1 
ATOM   7690  C  CD  . GLU I  3 7   ? -43.046 -15.459 -20.670 1.00 22.98 ? 377  GLU I CD  1 
ATOM   7691  O  OE1 . GLU I  3 7   ? -42.531 -16.591 -20.524 1.00 22.62 ? 377  GLU I OE1 1 
ATOM   7692  O  OE2 . GLU I  3 7   ? -42.362 -14.422 -20.716 1.00 23.48 ? 377  GLU I OE2 1 
ATOM   7693  N  N   . LEU I  3 8   ? -47.947 -18.196 -19.914 1.00 23.66 ? 378  LEU I N   1 
ATOM   7694  C  CA  . LEU I  3 8   ? -48.688 -19.315 -19.362 1.00 23.56 ? 378  LEU I CA  1 
ATOM   7695  C  C   . LEU I  3 8   ? -47.770 -20.181 -18.484 1.00 22.47 ? 378  LEU I C   1 
ATOM   7696  O  O   . LEU I  3 8   ? -46.678 -20.562 -18.901 1.00 22.15 ? 378  LEU I O   1 
ATOM   7697  C  CB  . LEU I  3 8   ? -49.320 -20.138 -20.495 1.00 25.07 ? 378  LEU I CB  1 
ATOM   7698  C  CG  . LEU I  3 8   ? -50.368 -21.205 -20.150 1.00 25.62 ? 378  LEU I CG  1 
ATOM   7699  C  CD1 . LEU I  3 8   ? -51.463 -20.670 -19.235 1.00 25.25 ? 378  LEU I CD1 1 
ATOM   7700  C  CD2 . LEU I  3 8   ? -50.975 -21.777 -21.429 1.00 27.14 ? 378  LEU I CD2 1 
ATOM   7701  N  N   . THR I  3 9   ? -48.211 -20.439 -17.254 1.00 21.80 ? 379  THR I N   1 
ATOM   7702  C  CA  . THR I  3 9   ? -47.558 -21.406 -16.373 1.00 21.28 ? 379  THR I CA  1 
ATOM   7703  C  C   . THR I  3 9   ? -48.614 -22.209 -15.628 1.00 21.56 ? 379  THR I C   1 
ATOM   7704  O  O   . THR I  3 9   ? -49.750 -21.783 -15.516 1.00 22.42 ? 379  THR I O   1 
ATOM   7705  C  CB  . THR I  3 9   ? -46.639 -20.734 -15.345 1.00 20.10 ? 379  THR I CB  1 
ATOM   7706  O  OG1 . THR I  3 9   ? -47.396 -19.814 -14.555 1.00 19.95 ? 379  THR I OG1 1 
ATOM   7707  C  CG2 . THR I  3 9   ? -45.530 -20.002 -16.030 1.00 19.88 ? 379  THR I CG2 1 
ATOM   7708  N  N   . ASN I  3 10  ? -48.228 -23.379 -15.142 1.00 21.37 ? 380  ASN I N   1 
ATOM   7709  C  CA  . ASN I  3 10  ? -49.133 -24.249 -14.400 1.00 21.78 ? 380  ASN I CA  1 
ATOM   7710  C  C   . ASN I  3 10  ? -48.469 -25.021 -13.240 1.00 21.29 ? 380  ASN I C   1 
ATOM   7711  O  O   . ASN I  3 10  ? -49.154 -25.731 -12.508 1.00 21.83 ? 380  ASN I O   1 
ATOM   7712  C  CB  . ASN I  3 10  ? -49.830 -25.228 -15.365 1.00 22.96 ? 380  ASN I CB  1 
ATOM   7713  C  CG  . ASN I  3 10  ? -48.855 -26.157 -16.051 1.00 23.44 ? 380  ASN I CG  1 
ATOM   7714  O  OD1 . ASN I  3 10  ? -47.709 -26.310 -15.610 1.00 22.72 ? 380  ASN I OD1 1 
ATOM   7715  N  ND2 . ASN I  3 10  ? -49.289 -26.777 -17.141 1.00 24.59 ? 380  ASN I ND2 1 
ATOM   7716  N  N   . HIS I  3 11  ? -47.157 -24.878 -13.066 1.00 20.52 ? 381  HIS I N   1 
ATOM   7717  C  CA  . HIS I  3 11  ? -46.433 -25.595 -12.009 1.00 20.20 ? 381  HIS I CA  1 
ATOM   7718  C  C   . HIS I  3 11  ? -45.350 -24.715 -11.340 1.00 19.06 ? 381  HIS I C   1 
ATOM   7719  O  O   . HIS I  3 11  ? -44.595 -23.999 -12.005 1.00 18.45 ? 381  HIS I O   1 
ATOM   7720  C  CB  . HIS I  3 11  ? -45.829 -26.897 -12.559 1.00 20.95 ? 381  HIS I CB  1 
ATOM   7721  C  CG  . HIS I  3 11  ? -45.334 -27.838 -11.501 1.00 21.09 ? 381  HIS I CG  1 
ATOM   7722  N  ND1 . HIS I  3 11  ? -46.064 -28.148 -10.378 1.00 21.33 ? 381  HIS I ND1 1 
ATOM   7723  C  CD2 . HIS I  3 11  ? -44.187 -28.552 -11.407 1.00 21.21 ? 381  HIS I CD2 1 
ATOM   7724  C  CE1 . HIS I  3 11  ? -45.387 -29.003 -9.632  1.00 21.63 ? 381  HIS I CE1 1 
ATOM   7725  N  NE2 . HIS I  3 11  ? -44.244 -29.264 -10.234 1.00 21.46 ? 381  HIS I NE2 1 
ATOM   7726  N  N   . ALA I  3 12  ? -45.306 -24.797 -10.009 1.00 18.77 ? 382  ALA I N   1 
ATOM   7727  C  CA  . ALA I  3 12  ? -44.402 -24.026 -9.184  1.00 17.96 ? 382  ALA I CA  1 
ATOM   7728  C  C   . ALA I  3 12  ? -43.335 -24.945 -8.619  1.00 17.76 ? 382  ALA I C   1 
ATOM   7729  O  O   . ALA I  3 12  ? -43.641 -26.009 -8.108  1.00 18.50 ? 382  ALA I O   1 
ATOM   7730  C  CB  . ALA I  3 12  ? -45.171 -23.373 -8.059  1.00 18.10 ? 382  ALA I CB  1 
ATOM   7731  N  N   . VAL I  3 13  ? -42.085 -24.509 -8.703  1.00 16.96 ? 383  VAL I N   1 
ATOM   7732  C  CA  . VAL I  3 13  ? -40.939 -25.314 -8.285  1.00 16.99 ? 383  VAL I CA  1 
ATOM   7733  C  C   . VAL I  3 13  ? -39.861 -24.384 -7.717  1.00 16.09 ? 383  VAL I C   1 
ATOM   7734  O  O   . VAL I  3 13  ? -39.994 -23.155 -7.796  1.00 15.29 ? 383  VAL I O   1 
ATOM   7735  C  CB  . VAL I  3 13  ? -40.377 -26.136 -9.472  1.00 17.52 ? 383  VAL I CB  1 
ATOM   7736  C  CG1 . VAL I  3 13  ? -41.308 -27.292 -9.809  1.00 18.45 ? 383  VAL I CG1 1 
ATOM   7737  C  CG2 . VAL I  3 13  ? -40.197 -25.246 -10.703 1.00 17.25 ? 383  VAL I CG2 1 
ATOM   7738  N  N   . LEU I  3 14  ? -38.811 -24.977 -7.150  1.00 16.06 ? 384  LEU I N   1 
ATOM   7739  C  CA  . LEU I  3 14  ? -37.758 -24.223 -6.469  1.00 15.44 ? 384  LEU I CA  1 
ATOM   7740  C  C   . LEU I  3 14  ? -36.449 -24.282 -7.231  1.00 15.46 ? 384  LEU I C   1 
ATOM   7741  O  O   . LEU I  3 14  ? -35.861 -25.352 -7.409  1.00 16.09 ? 384  LEU I O   1 
ATOM   7742  C  CB  . LEU I  3 14  ? -37.542 -24.756 -5.051  1.00 15.72 ? 384  LEU I CB  1 
ATOM   7743  C  CG  . LEU I  3 14  ? -36.511 -24.023 -4.185  1.00 15.42 ? 384  LEU I CG  1 
ATOM   7744  C  CD1 . LEU I  3 14  ? -37.052 -22.663 -3.757  1.00 14.84 ? 384  LEU I CD1 1 
ATOM   7745  C  CD2 . LEU I  3 14  ? -36.135 -24.849 -2.972  1.00 16.05 ? 384  LEU I CD2 1 
ATOM   7746  N  N   . LEU I  3 15  ? -35.990 -23.117 -7.673  1.00 14.96 ? 385  LEU I N   1 
ATOM   7747  C  CA  . LEU I  3 15  ? -34.692 -23.001 -8.328  1.00 15.12 ? 385  LEU I CA  1 
ATOM   7748  C  C   . LEU I  3 15  ? -33.590 -23.072 -7.290  1.00 15.23 ? 385  LEU I C   1 
ATOM   7749  O  O   . LEU I  3 15  ? -33.588 -22.280 -6.363  1.00 14.86 ? 385  LEU I O   1 
ATOM   7750  C  CB  . LEU I  3 15  ? -34.613 -21.668 -9.050  1.00 14.71 ? 385  LEU I CB  1 
ATOM   7751  C  CG  . LEU I  3 15  ? -33.380 -21.400 -9.886  1.00 14.96 ? 385  LEU I CG  1 
ATOM   7752  C  CD1 . LEU I  3 15  ? -33.249 -22.455 -10.962 1.00 15.65 ? 385  LEU I CD1 1 
ATOM   7753  C  CD2 . LEU I  3 15  ? -33.471 -20.005 -10.486 1.00 14.63 ? 385  LEU I CD2 1 
ATOM   7754  N  N   . VAL I  3 16  ? -32.671 -24.024 -7.428  1.00 15.89 ? 386  VAL I N   1 
ATOM   7755  C  CA  . VAL I  3 16  ? -31.587 -24.168 -6.453  1.00 16.24 ? 386  VAL I CA  1 
ATOM   7756  C  C   . VAL I  3 16  ? -30.187 -24.023 -7.041  1.00 16.59 ? 386  VAL I C   1 
ATOM   7757  O  O   . VAL I  3 16  ? -29.222 -24.003 -6.296  1.00 16.88 ? 386  VAL I O   1 
ATOM   7758  C  CB  . VAL I  3 16  ? -31.653 -25.519 -5.670  1.00 16.99 ? 386  VAL I CB  1 
ATOM   7759  C  CG1 . VAL I  3 16  ? -33.004 -25.709 -5.007  1.00 16.90 ? 386  VAL I CG1 1 
ATOM   7760  C  CG2 . VAL I  3 16  ? -31.336 -26.709 -6.548  1.00 17.73 ? 386  VAL I CG2 1 
ATOM   7761  N  N   . GLY I  3 17  ? -30.063 -23.938 -8.360  1.00 16.80 ? 387  GLY I N   1 
ATOM   7762  C  CA  . GLY I  3 17  ? -28.745 -23.924 -8.975  1.00 17.44 ? 387  GLY I CA  1 
ATOM   7763  C  C   . GLY I  3 17  ? -28.708 -23.704 -10.468 1.00 17.73 ? 387  GLY I C   1 
ATOM   7764  O  O   . GLY I  3 17  ? -29.735 -23.647 -11.121 1.00 17.47 ? 387  GLY I O   1 
ATOM   7765  N  N   . TYR I  3 18  ? -27.493 -23.586 -11.001 1.00 18.59 ? 388  TYR I N   1 
ATOM   7766  C  CA  . TYR I  3 18  ? -27.273 -23.437 -12.439 1.00 19.21 ? 388  TYR I CA  1 
ATOM   7767  C  C   . TYR I  3 18  ? -25.906 -23.981 -12.861 1.00 20.45 ? 388  TYR I C   1 
ATOM   7768  O  O   . TYR I  3 18  ? -24.993 -24.116 -12.062 1.00 20.82 ? 388  TYR I O   1 
ATOM   7769  C  CB  . TYR I  3 18  ? -27.448 -21.967 -12.875 1.00 18.70 ? 388  TYR I CB  1 
ATOM   7770  C  CG  . TYR I  3 18  ? -26.394 -20.988 -12.380 1.00 18.65 ? 388  TYR I CG  1 
ATOM   7771  C  CD1 . TYR I  3 18  ? -25.167 -20.849 -13.032 1.00 19.46 ? 388  TYR I CD1 1 
ATOM   7772  C  CD2 . TYR I  3 18  ? -26.642 -20.177 -11.284 1.00 17.96 ? 388  TYR I CD2 1 
ATOM   7773  C  CE1 . TYR I  3 18  ? -24.223 -19.947 -12.585 1.00 19.65 ? 388  TYR I CE1 1 
ATOM   7774  C  CE2 . TYR I  3 18  ? -25.706 -19.267 -10.829 1.00 18.09 ? 388  TYR I CE2 1 
ATOM   7775  C  CZ  . TYR I  3 18  ? -24.497 -19.158 -11.471 1.00 19.01 ? 388  TYR I CZ  1 
ATOM   7776  O  OH  . TYR I  3 18  ? -23.570 -18.242 -11.003 1.00 19.45 ? 388  TYR I OH  1 
ATOM   7777  N  N   . GLY I  3 19  ? -25.772 -24.294 -14.136 1.00 21.75 ? 389  GLY I N   1 
ATOM   7778  C  CA  . GLY I  3 19  ? -24.509 -24.790 -14.663 1.00 23.34 ? 389  GLY I CA  1 
ATOM   7779  C  C   . GLY I  3 19  ? -24.588 -24.971 -16.164 1.00 24.82 ? 389  GLY I C   1 
ATOM   7780  O  O   . GLY I  3 19  ? -25.600 -24.634 -16.788 1.00 24.51 ? 389  GLY I O   1 
ATOM   7781  N  N   . THR I  3 20  ? -23.515 -25.513 -16.731 1.00 27.15 ? 390  THR I N   1 
ATOM   7782  C  CA  . THR I  3 20  ? -23.376 -25.718 -18.178 1.00 29.09 ? 390  THR I CA  1 
ATOM   7783  C  C   . THR I  3 20  ? -22.883 -27.134 -18.445 1.00 31.04 ? 390  THR I C   1 
ATOM   7784  O  O   . THR I  3 20  ? -21.986 -27.607 -17.764 1.00 31.90 ? 390  THR I O   1 
ATOM   7785  C  CB  . THR I  3 20  ? -22.363 -24.726 -18.779 1.00 29.61 ? 390  THR I CB  1 
ATOM   7786  O  OG1 . THR I  3 20  ? -22.656 -23.418 -18.294 1.00 28.55 ? 390  THR I OG1 1 
ATOM   7787  C  CG2 . THR I  3 20  ? -22.426 -24.719 -20.309 1.00 30.75 ? 390  THR I CG2 1 
ATOM   7788  N  N   . ASP I  3 21  ? -23.480 -27.808 -19.422 1.00 32.97 ? 391  ASP I N   1 
ATOM   7789  C  CA  . ASP I  3 21  ? -23.036 -29.143 -19.810 1.00 35.82 ? 391  ASP I CA  1 
ATOM   7790  C  C   . ASP I  3 21  ? -21.709 -29.033 -20.561 1.00 38.04 ? 391  ASP I C   1 
ATOM   7791  O  O   . ASP I  3 21  ? -21.605 -28.319 -21.559 1.00 38.50 ? 391  ASP I O   1 
ATOM   7792  C  CB  . ASP I  3 21  ? -24.083 -29.823 -20.687 1.00 36.60 ? 391  ASP I CB  1 
ATOM   7793  C  CG  . ASP I  3 21  ? -23.656 -31.201 -21.146 1.00 39.11 ? 391  ASP I CG  1 
ATOM   7794  O  OD1 . ASP I  3 21  ? -23.533 -32.102 -20.290 1.00 39.96 ? 391  ASP I OD1 1 
ATOM   7795  O  OD2 . ASP I  3 21  ? -23.448 -31.388 -22.368 1.00 41.14 ? 391  ASP I OD2 1 
ATOM   7796  N  N   . SER I  3 22  ? -20.692 -29.729 -20.062 1.00 40.34 ? 392  SER I N   1 
ATOM   7797  C  CA  . SER I  3 22  ? -19.368 -29.723 -20.693 1.00 42.54 ? 392  SER I CA  1 
ATOM   7798  C  C   . SER I  3 22  ? -19.416 -30.212 -22.135 1.00 44.28 ? 392  SER I C   1 
ATOM   7799  O  O   . SER I  3 22  ? -18.815 -29.593 -23.013 1.00 45.91 ? 392  SER I O   1 
ATOM   7800  C  CB  . SER I  3 22  ? -18.377 -30.576 -19.895 1.00 43.26 ? 392  SER I CB  1 
ATOM   7801  O  OG  . SER I  3 22  ? -17.813 -29.807 -18.848 1.00 42.74 ? 392  SER I OG  1 
ATOM   7802  N  N   . ALA I  3 23  ? -20.145 -31.305 -22.369 1.00 44.95 ? 393  ALA I N   1 
ATOM   7803  C  CA  . ALA I  3 23  ? -20.187 -31.956 -23.687 1.00 46.91 ? 393  ALA I CA  1 
ATOM   7804  C  C   . ALA I  3 23  ? -20.779 -31.079 -24.800 1.00 46.74 ? 393  ALA I C   1 
ATOM   7805  O  O   . ALA I  3 23  ? -20.212 -31.010 -25.890 1.00 48.65 ? 393  ALA I O   1 
ATOM   7806  C  CB  . ALA I  3 23  ? -20.942 -33.278 -23.601 1.00 47.28 ? 393  ALA I CB  1 
ATOM   7807  N  N   . SER I  3 24  ? -21.908 -30.422 -24.525 1.00 44.30 ? 394  SER I N   1 
ATOM   7808  C  CA  . SER I  3 24  ? -22.618 -29.613 -25.530 1.00 43.86 ? 394  SER I CA  1 
ATOM   7809  C  C   . SER I  3 24  ? -22.489 -28.092 -25.333 1.00 42.53 ? 394  SER I C   1 
ATOM   7810  O  O   . SER I  3 24  ? -22.695 -27.316 -26.271 1.00 42.66 ? 394  SER I O   1 
ATOM   7811  C  CB  . SER I  3 24  ? -24.100 -29.980 -25.520 1.00 42.93 ? 394  SER I CB  1 
ATOM   7812  O  OG  . SER I  3 24  ? -24.702 -29.597 -24.298 1.00 41.06 ? 394  SER I OG  1 
ATOM   7813  N  N   . GLY I  3 25  ? -22.165 -27.666 -24.115 1.00 40.67 ? 395  GLY I N   1 
ATOM   7814  C  CA  . GLY I  3 25  ? -22.184 -26.256 -23.770 1.00 39.15 ? 395  GLY I CA  1 
ATOM   7815  C  C   . GLY I  3 25  ? -23.573 -25.718 -23.451 1.00 37.26 ? 395  GLY I C   1 
ATOM   7816  O  O   . GLY I  3 25  ? -23.757 -24.506 -23.398 1.00 37.04 ? 395  GLY I O   1 
ATOM   7817  N  N   . MET I  3 26  ? -24.550 -26.595 -23.227 1.00 36.46 ? 396  MET I N   1 
ATOM   7818  C  CA  . MET I  3 26  ? -25.914 -26.157 -22.912 1.00 34.88 ? 396  MET I CA  1 
ATOM   7819  C  C   . MET I  3 26  ? -25.982 -25.622 -21.485 1.00 32.02 ? 396  MET I C   1 
ATOM   7820  O  O   . MET I  3 26  ? -25.721 -26.364 -20.535 1.00 31.02 ? 396  MET I O   1 
ATOM   7821  C  CB  . MET I  3 26  ? -26.901 -27.324 -23.078 1.00 35.86 ? 396  MET I CB  1 
ATOM   7822  C  CG  . MET I  3 26  ? -28.378 -26.965 -22.907 1.00 35.66 ? 396  MET I CG  1 
ATOM   7823  S  SD  . MET I  3 26  ? -29.009 -25.860 -24.205 1.00 38.09 ? 396  MET I SD  1 
ATOM   7824  C  CE  . MET I  3 26  ? -28.992 -24.263 -23.395 1.00 36.52 ? 396  MET I CE  1 
ATOM   7825  N  N   . ASP I  3 27  ? -26.299 -24.331 -21.343 1.00 30.11 ? 397  ASP I N   1 
ATOM   7826  C  CA  . ASP I  3 27  ? -26.637 -23.739 -20.033 1.00 27.55 ? 397  ASP I CA  1 
ATOM   7827  C  C   . ASP I  3 27  ? -27.933 -24.352 -19.466 1.00 25.69 ? 397  ASP I C   1 
ATOM   7828  O  O   . ASP I  3 27  ? -28.875 -24.613 -20.205 1.00 25.81 ? 397  ASP I O   1 
ATOM   7829  C  CB  . ASP I  3 27  ? -26.804 -22.214 -20.148 1.00 27.28 ? 397  ASP I CB  1 
ATOM   7830  C  CG  . ASP I  3 27  ? -25.469 -21.467 -20.364 1.00 28.56 ? 397  ASP I CG  1 
ATOM   7831  O  OD1 . ASP I  3 27  ? -24.383 -22.087 -20.237 1.00 29.59 ? 397  ASP I OD1 1 
ATOM   7832  O  OD2 . ASP I  3 27  ? -25.511 -20.242 -20.647 1.00 28.42 ? 397  ASP I OD2 1 
ATOM   7833  N  N   . TYR I  3 28  ? -27.977 -24.559 -18.150 1.00 23.79 ? 398  TYR I N   1 
ATOM   7834  C  CA  . TYR I  3 28  ? -29.177 -25.079 -17.502 1.00 22.61 ? 398  TYR I CA  1 
ATOM   7835  C  C   . TYR I  3 28  ? -29.430 -24.556 -16.091 1.00 21.01 ? 398  TYR I C   1 
ATOM   7836  O  O   . TYR I  3 28  ? -28.540 -24.062 -15.421 1.00 20.54 ? 398  TYR I O   1 
ATOM   7837  C  CB  . TYR I  3 28  ? -29.144 -26.617 -17.468 1.00 23.35 ? 398  TYR I CB  1 
ATOM   7838  C  CG  . TYR I  3 28  ? -27.992 -27.210 -16.679 1.00 23.63 ? 398  TYR I CG  1 
ATOM   7839  C  CD1 . TYR I  3 28  ? -28.049 -27.297 -15.285 1.00 22.92 ? 398  TYR I CD1 1 
ATOM   7840  C  CD2 . TYR I  3 28  ? -26.847 -27.680 -17.321 1.00 24.68 ? 398  TYR I CD2 1 
ATOM   7841  C  CE1 . TYR I  3 28  ? -27.003 -27.832 -14.556 1.00 23.38 ? 398  TYR I CE1 1 
ATOM   7842  C  CE2 . TYR I  3 28  ? -25.791 -28.218 -16.600 1.00 25.14 ? 398  TYR I CE2 1 
ATOM   7843  C  CZ  . TYR I  3 28  ? -25.877 -28.299 -15.216 1.00 24.50 ? 398  TYR I CZ  1 
ATOM   7844  O  OH  . TYR I  3 28  ? -24.848 -28.835 -14.473 1.00 24.99 ? 398  TYR I OH  1 
ATOM   7845  N  N   . TRP I  3 29  ? -30.683 -24.668 -15.669 1.00 20.06 ? 399  TRP I N   1 
ATOM   7846  C  CA  . TRP I  3 29  ? -31.075 -24.464 -14.295 1.00 18.93 ? 399  TRP I CA  1 
ATOM   7847  C  C   . TRP I  3 29  ? -31.202 -25.819 -13.615 1.00 19.23 ? 399  TRP I C   1 
ATOM   7848  O  O   . TRP I  3 29  ? -31.614 -26.791 -14.241 1.00 19.94 ? 399  TRP I O   1 
ATOM   7849  C  CB  . TRP I  3 29  ? -32.430 -23.796 -14.224 1.00 18.19 ? 399  TRP I CB  1 
ATOM   7850  C  CG  . TRP I  3 29  ? -32.550 -22.426 -14.835 1.00 17.79 ? 399  TRP I CG  1 
ATOM   7851  C  CD1 . TRP I  3 29  ? -33.294 -22.089 -15.916 1.00 18.01 ? 399  TRP I CD1 1 
ATOM   7852  C  CD2 . TRP I  3 29  ? -31.973 -21.217 -14.353 1.00 17.24 ? 399  TRP I CD2 1 
ATOM   7853  N  NE1 . TRP I  3 29  ? -33.211 -20.748 -16.157 1.00 17.75 ? 399  TRP I NE1 1 
ATOM   7854  C  CE2 . TRP I  3 29  ? -32.409 -20.179 -15.208 1.00 17.30 ? 399  TRP I CE2 1 
ATOM   7855  C  CE3 . TRP I  3 29  ? -31.111 -20.905 -13.292 1.00 16.87 ? 399  TRP I CE3 1 
ATOM   7856  C  CZ2 . TRP I  3 29  ? -32.000 -18.849 -15.051 1.00 16.88 ? 399  TRP I CZ2 1 
ATOM   7857  C  CZ3 . TRP I  3 29  ? -30.717 -19.577 -13.124 1.00 16.50 ? 399  TRP I CZ3 1 
ATOM   7858  C  CH2 . TRP I  3 29  ? -31.172 -18.566 -13.999 1.00 16.53 ? 399  TRP I CH2 1 
ATOM   7859  N  N   . ILE I  3 30  ? -30.862 -25.863 -12.327 1.00 18.74 ? 400  ILE I N   1 
ATOM   7860  C  CA  . ILE I  3 30  ? -31.112 -27.021 -11.476 1.00 18.95 ? 400  ILE I CA  1 
ATOM   7861  C  C   . ILE I  3 30  ? -32.332 -26.708 -10.614 1.00 18.25 ? 400  ILE I C   1 
ATOM   7862  O  O   . ILE I  3 30  ? -32.311 -25.765 -9.836  1.00 17.53 ? 400  ILE I O   1 
ATOM   7863  C  CB  . ILE I  3 30  ? -29.914 -27.315 -10.564 1.00 19.22 ? 400  ILE I CB  1 
ATOM   7864  C  CG1 . ILE I  3 30  ? -28.634 -27.481 -11.394 1.00 19.97 ? 400  ILE I CG1 1 
ATOM   7865  C  CG2 . ILE I  3 30  ? -30.183 -28.561 -9.733  1.00 19.81 ? 400  ILE I CG2 1 
ATOM   7866  C  CD1 . ILE I  3 30  ? -27.357 -27.324 -10.607 1.00 20.14 ? 400  ILE I CD1 1 
ATOM   7867  N  N   . VAL I  3 31  ? -33.382 -27.513 -10.741 1.00 18.59 ? 401  VAL I N   1 
ATOM   7868  C  CA  . VAL I  3 31  ? -34.668 -27.205 -10.144 1.00 18.20 ? 401  VAL I CA  1 
ATOM   7869  C  C   . VAL I  3 31  ? -35.193 -28.370 -9.318  1.00 18.91 ? 401  VAL I C   1 
ATOM   7870  O  O   . VAL I  3 31  ? -35.184 -29.501 -9.775  1.00 19.92 ? 401  VAL I O   1 
ATOM   7871  C  CB  . VAL I  3 31  ? -35.716 -26.889 -11.234 1.00 18.13 ? 401  VAL I CB  1 
ATOM   7872  C  CG1 . VAL I  3 31  ? -36.988 -26.327 -10.607 1.00 17.58 ? 401  VAL I CG1 1 
ATOM   7873  C  CG2 . VAL I  3 31  ? -35.142 -25.930 -12.271 1.00 17.90 ? 401  VAL I CG2 1 
ATOM   7874  N  N   . LYS I  3 32  ? -35.663 -28.064 -8.109  1.00 18.77 ? 402  LYS I N   1 
ATOM   7875  C  CA  . LYS I  3 32  ? -36.234 -29.047 -7.176  1.00 19.49 ? 402  LYS I CA  1 
ATOM   7876  C  C   . LYS I  3 32  ? -37.735 -29.120 -7.381  1.00 19.62 ? 402  LYS I C   1 
ATOM   7877  O  O   . LYS I  3 32  ? -38.435 -28.113 -7.251  1.00 19.07 ? 402  LYS I O   1 
ATOM   7878  C  CB  . LYS I  3 32  ? -35.967 -28.623 -5.738  1.00 19.30 ? 402  LYS I CB  1 
ATOM   7879  C  CG  . LYS I  3 32  ? -36.557 -29.513 -4.647  1.00 20.10 ? 402  LYS I CG  1 
ATOM   7880  C  CD  . LYS I  3 32  ? -36.407 -28.805 -3.307  1.00 19.88 ? 402  LYS I CD  1 
ATOM   7881  C  CE  . LYS I  3 32  ? -36.737 -29.678 -2.124  1.00 20.92 ? 402  LYS I CE  1 
ATOM   7882  N  NZ  . LYS I  3 32  ? -36.766 -28.844 -0.895  1.00 20.73 ? 402  LYS I NZ  1 
ATOM   7883  N  N   . ASN I  3 33  ? -38.220 -30.318 -7.686  1.00 20.57 ? 403  ASN I N   1 
ATOM   7884  C  CA  . ASN I  3 33  ? -39.633 -30.546 -7.876  1.00 20.90 ? 403  ASN I CA  1 
ATOM   7885  C  C   . ASN I  3 33  ? -40.256 -31.058 -6.575  1.00 21.38 ? 403  ASN I C   1 
ATOM   7886  O  O   . ASN I  3 33  ? -39.577 -31.210 -5.557  1.00 21.58 ? 403  ASN I O   1 
ATOM   7887  C  CB  . ASN I  3 33  ? -39.833 -31.550 -9.000  1.00 21.91 ? 403  ASN I CB  1 
ATOM   7888  C  CG  . ASN I  3 33  ? -41.123 -31.342 -9.759  1.00 21.99 ? 403  ASN I CG  1 
ATOM   7889  O  OD1 . ASN I  3 33  ? -42.080 -30.726 -9.276  1.00 21.43 ? 403  ASN I OD1 1 
ATOM   7890  N  ND2 . ASN I  3 33  ? -41.151 -31.864 -10.971 1.00 22.71 ? 403  ASN I ND2 1 
ATOM   7891  N  N   . SER I  3 34  ? -41.558 -31.300 -6.613  1.00 21.72 ? 404  SER I N   1 
ATOM   7892  C  CA  . SER I  3 34  ? -42.286 -31.765 -5.453  1.00 22.31 ? 404  SER I CA  1 
ATOM   7893  C  C   . SER I  3 34  ? -43.111 -33.011 -5.820  1.00 23.49 ? 404  SER I C   1 
ATOM   7894  O  O   . SER I  3 34  ? -44.237 -33.170 -5.379  1.00 23.97 ? 404  SER I O   1 
ATOM   7895  C  CB  . SER I  3 34  ? -43.167 -30.629 -4.933  1.00 21.61 ? 404  SER I CB  1 
ATOM   7896  O  OG  . SER I  3 34  ? -43.798 -29.965 -6.016  1.00 21.34 ? 404  SER I OG  1 
ATOM   7897  N  N   . TRP I  3 35  ? -42.527 -33.873 -6.644  1.00 24.05 ? 405  TRP I N   1 
ATOM   7898  C  CA  . TRP I  3 35  ? -43.160 -35.115 -7.068  1.00 25.44 ? 405  TRP I CA  1 
ATOM   7899  C  C   . TRP I  3 35  ? -42.441 -36.338 -6.460  1.00 26.81 ? 405  TRP I C   1 
ATOM   7900  O  O   . TRP I  3 35  ? -42.488 -37.438 -7.010  1.00 28.06 ? 405  TRP I O   1 
ATOM   7901  C  CB  . TRP I  3 35  ? -43.194 -35.194 -8.606  1.00 25.49 ? 405  TRP I CB  1 
ATOM   7902  C  CG  . TRP I  3 35  ? -44.119 -34.172 -9.285  1.00 24.69 ? 405  TRP I CG  1 
ATOM   7903  C  CD1 . TRP I  3 35  ? -45.069 -33.402 -8.689  1.00 24.14 ? 405  TRP I CD1 1 
ATOM   7904  C  CD2 . TRP I  3 35  ? -44.199 -33.877 -10.689 1.00 24.58 ? 405  TRP I CD2 1 
ATOM   7905  N  NE1 . TRP I  3 35  ? -45.718 -32.641 -9.620  1.00 23.72 ? 405  TRP I NE1 1 
ATOM   7906  C  CE2 . TRP I  3 35  ? -45.201 -32.906 -10.855 1.00 23.99 ? 405  TRP I CE2 1 
ATOM   7907  C  CE3 . TRP I  3 35  ? -43.511 -34.334 -11.818 1.00 25.09 ? 405  TRP I CE3 1 
ATOM   7908  C  CZ2 . TRP I  3 35  ? -45.537 -32.380 -12.101 1.00 23.97 ? 405  TRP I CZ2 1 
ATOM   7909  C  CZ3 . TRP I  3 35  ? -43.828 -33.801 -13.046 1.00 25.02 ? 405  TRP I CZ3 1 
ATOM   7910  C  CH2 . TRP I  3 35  ? -44.836 -32.830 -13.182 1.00 24.49 ? 405  TRP I CH2 1 
ATOM   7911  N  N   . GLY I  3 36  ? -41.776 -36.137 -5.322  1.00 26.77 ? 406  GLY I N   1 
ATOM   7912  C  CA  . GLY I  3 36  ? -41.082 -37.219 -4.624  1.00 28.22 ? 406  GLY I CA  1 
ATOM   7913  C  C   . GLY I  3 36  ? -39.693 -37.462 -5.174  1.00 28.58 ? 406  GLY I C   1 
ATOM   7914  O  O   . GLY I  3 36  ? -39.333 -36.927 -6.228  1.00 28.26 ? 406  GLY I O   1 
ATOM   7915  N  N   . THR I  3 37  ? -38.913 -38.255 -4.446  1.00 29.67 ? 407  THR I N   1 
ATOM   7916  C  CA  . THR I  3 37  ? -37.535 -38.579 -4.813  1.00 30.08 ? 407  THR I CA  1 
ATOM   7917  C  C   . THR I  3 37  ? -37.419 -39.564 -5.976  1.00 31.35 ? 407  THR I C   1 
ATOM   7918  O  O   . THR I  3 37  ? -36.361 -39.663 -6.597  1.00 31.71 ? 407  THR I O   1 
ATOM   7919  C  CB  . THR I  3 37  ? -36.772 -39.186 -3.615  1.00 31.11 ? 407  THR I CB  1 
ATOM   7920  O  OG1 . THR I  3 37  ? -37.569 -40.212 -3.008  1.00 32.58 ? 407  THR I OG1 1 
ATOM   7921  C  CG2 . THR I  3 37  ? -36.457 -38.118 -2.574  1.00 30.12 ? 407  THR I CG2 1 
ATOM   7922  N  N   . GLY I  3 38  ? -38.478 -40.319 -6.250  1.00 32.39 ? 408  GLY I N   1 
ATOM   7923  C  CA  . GLY I  3 38  ? -38.466 -41.282 -7.336  1.00 33.58 ? 408  GLY I CA  1 
ATOM   7924  C  C   . GLY I  3 38  ? -38.472 -40.650 -8.716  1.00 32.83 ? 408  GLY I C   1 
ATOM   7925  O  O   . GLY I  3 38  ? -37.915 -41.211 -9.658  1.00 33.70 ? 408  GLY I O   1 
ATOM   7926  N  N   . TRP I  3 39  ? -39.098 -39.483 -8.846  1.00 31.49 ? 409  TRP I N   1 
ATOM   7927  C  CA  . TRP I  3 39  ? -39.158 -38.782 -10.136 1.00 30.75 ? 409  TRP I CA  1 
ATOM   7928  C  C   . TRP I  3 39  ? -37.830 -38.081 -10.494 1.00 29.86 ? 409  TRP I C   1 
ATOM   7929  O  O   . TRP I  3 39  ? -37.106 -37.607 -9.621  1.00 28.93 ? 409  TRP I O   1 
ATOM   7930  C  CB  . TRP I  3 39  ? -40.308 -37.770 -10.137 1.00 29.66 ? 409  TRP I CB  1 
ATOM   7931  C  CG  . TRP I  3 39  ? -40.453 -37.041 -11.436 1.00 29.10 ? 409  TRP I CG  1 
ATOM   7932  C  CD1 . TRP I  3 39  ? -41.156 -37.446 -12.527 1.00 30.04 ? 409  TRP I CD1 1 
ATOM   7933  C  CD2 . TRP I  3 39  ? -39.862 -35.783 -11.782 1.00 27.72 ? 409  TRP I CD2 1 
ATOM   7934  N  NE1 . TRP I  3 39  ? -41.047 -36.513 -13.540 1.00 29.34 ? 409  TRP I NE1 1 
ATOM   7935  C  CE2 . TRP I  3 39  ? -40.256 -35.484 -13.105 1.00 27.88 ? 409  TRP I CE2 1 
ATOM   7936  C  CE3 . TRP I  3 39  ? -39.023 -34.886 -11.108 1.00 26.51 ? 409  TRP I CE3 1 
ATOM   7937  C  CZ2 . TRP I  3 39  ? -39.850 -34.320 -13.760 1.00 26.94 ? 409  TRP I CZ2 1 
ATOM   7938  C  CZ3 . TRP I  3 39  ? -38.619 -33.734 -11.760 1.00 25.38 ? 409  TRP I CZ3 1 
ATOM   7939  C  CH2 . TRP I  3 39  ? -39.033 -33.460 -13.071 1.00 25.61 ? 409  TRP I CH2 1 
ATOM   7940  N  N   . GLY I  3 40  ? -37.541 -38.046 -11.793 1.00 30.22 ? 410  GLY I N   1 
ATOM   7941  C  CA  . GLY I  3 40  ? -36.395 -37.359 -12.359 1.00 29.72 ? 410  GLY I CA  1 
ATOM   7942  C  C   . GLY I  3 40  ? -35.083 -37.736 -11.716 1.00 30.21 ? 410  GLY I C   1 
ATOM   7943  O  O   . GLY I  3 40  ? -34.856 -38.880 -11.396 1.00 31.43 ? 410  GLY I O   1 
ATOM   7944  N  N   . GLU I  3 41  ? -34.226 -36.748 -11.517 1.00 29.45 ? 411  GLU I N   1 
ATOM   7945  C  CA  . GLU I  3 41  ? -32.901 -36.951 -10.945 1.00 29.77 ? 411  GLU I CA  1 
ATOM   7946  C  C   . GLU I  3 41  ? -32.998 -36.770 -9.424  1.00 29.12 ? 411  GLU I C   1 
ATOM   7947  O  O   . GLU I  3 41  ? -32.791 -35.682 -8.896  1.00 28.00 ? 411  GLU I O   1 
ATOM   7948  C  CB  . GLU I  3 41  ? -31.917 -35.969 -11.608 1.00 29.38 ? 411  GLU I CB  1 
ATOM   7949  C  CG  . GLU I  3 41  ? -31.899 -36.101 -13.138 1.00 30.21 ? 411  GLU I CG  1 
ATOM   7950  C  CD  . GLU I  3 41  ? -30.948 -35.149 -13.853 1.00 30.19 ? 411  GLU I CD  1 
ATOM   7951  O  OE1 . GLU I  3 41  ? -30.695 -34.039 -13.351 1.00 29.89 ? 411  GLU I OE1 1 
ATOM   7952  O  OE2 . GLU I  3 41  ? -30.465 -35.506 -14.953 1.00 31.58 ? 411  GLU I OE2 1 
ATOM   7953  N  N   . ASN I  3 42  ? -33.372 -37.849 -8.740  1.00 30.18 ? 412  ASN I N   1 
ATOM   7954  C  CA  . ASN I  3 42  ? -33.616 -37.852 -7.289  1.00 30.07 ? 412  ASN I CA  1 
ATOM   7955  C  C   . ASN I  3 42  ? -34.494 -36.701 -6.809  1.00 28.60 ? 412  ASN I C   1 
ATOM   7956  O  O   . ASN I  3 42  ? -34.246 -36.103 -5.744  1.00 28.08 ? 412  ASN I O   1 
ATOM   7957  C  CB  . ASN I  3 42  ? -32.302 -37.893 -6.523  1.00 30.38 ? 412  ASN I CB  1 
ATOM   7958  C  CG  . ASN I  3 42  ? -31.521 -39.158 -6.805  1.00 32.18 ? 412  ASN I CG  1 
ATOM   7959  O  OD1 . ASN I  3 42  ? -32.051 -40.279 -6.705  1.00 33.67 ? 412  ASN I OD1 1 
ATOM   7960  N  ND2 . ASN I  3 42  ? -30.261 -38.995 -7.178  1.00 32.31 ? 412  ASN I ND2 1 
ATOM   7961  N  N   . GLY I  3 43  ? -35.521 -36.406 -7.610  1.00 27.94 ? 413  GLY I N   1 
ATOM   7962  C  CA  . GLY I  3 43  ? -36.531 -35.409 -7.270  1.00 26.68 ? 413  GLY I CA  1 
ATOM   7963  C  C   . GLY I  3 43  ? -36.320 -34.068 -7.937  1.00 25.20 ? 413  GLY I C   1 
ATOM   7964  O  O   . GLY I  3 43  ? -37.195 -33.216 -7.875  1.00 24.61 ? 413  GLY I O   1 
ATOM   7965  N  N   . TYR I  3 44  ? -35.148 -33.885 -8.550  1.00 24.95 ? 414  TYR I N   1 
ATOM   7966  C  CA  . TYR I  3 44  ? -34.798 -32.661 -9.273  1.00 23.70 ? 414  TYR I CA  1 
ATOM   7967  C  C   . TYR I  3 44  ? -34.822 -32.869 -10.778 1.00 24.05 ? 414  TYR I C   1 
ATOM   7968  O  O   . TYR I  3 44  ? -34.816 -34.006 -11.275 1.00 25.25 ? 414  TYR I O   1 
ATOM   7969  C  CB  . TYR I  3 44  ? -33.386 -32.213 -8.905  1.00 23.44 ? 414  TYR I CB  1 
ATOM   7970  C  CG  . TYR I  3 44  ? -33.232 -31.787 -7.471  1.00 23.08 ? 414  TYR I CG  1 
ATOM   7971  C  CD1 . TYR I  3 44  ? -33.286 -32.717 -6.433  1.00 23.90 ? 414  TYR I CD1 1 
ATOM   7972  C  CD2 . TYR I  3 44  ? -33.023 -30.455 -7.151  1.00 21.99 ? 414  TYR I CD2 1 
ATOM   7973  C  CE1 . TYR I  3 44  ? -33.147 -32.321 -5.119  1.00 23.71 ? 414  TYR I CE1 1 
ATOM   7974  C  CE2 . TYR I  3 44  ? -32.880 -30.053 -5.841  1.00 21.78 ? 414  TYR I CE2 1 
ATOM   7975  C  CZ  . TYR I  3 44  ? -32.952 -30.985 -4.831  1.00 22.73 ? 414  TYR I CZ  1 
ATOM   7976  O  OH  . TYR I  3 44  ? -32.793 -30.559 -3.540  1.00 22.98 ? 414  TYR I OH  1 
ATOM   7977  N  N   . PHE I  3 45  ? -34.838 -31.755 -11.498 1.00 23.07 ? 415  PHE I N   1 
ATOM   7978  C  CA  . PHE I  3 45  ? -34.571 -31.772 -12.918 1.00 23.53 ? 415  PHE I CA  1 
ATOM   7979  C  C   . PHE I  3 45  ? -33.662 -30.624 -13.322 1.00 22.89 ? 415  PHE I C   1 
ATOM   7980  O  O   . PHE I  3 45  ? -33.428 -29.691 -12.563 1.00 21.94 ? 415  PHE I O   1 
ATOM   7981  C  CB  . PHE I  3 45  ? -35.861 -31.733 -13.727 1.00 23.71 ? 415  PHE I CB  1 
ATOM   7982  C  CG  . PHE I  3 45  ? -36.698 -30.503 -13.507 1.00 22.40 ? 415  PHE I CG  1 
ATOM   7983  C  CD1 . PHE I  3 45  ? -37.451 -30.358 -12.356 1.00 21.84 ? 415  PHE I CD1 1 
ATOM   7984  C  CD2 . PHE I  3 45  ? -36.779 -29.519 -14.484 1.00 21.94 ? 415  PHE I CD2 1 
ATOM   7985  C  CE1 . PHE I  3 45  ? -38.246 -29.244 -12.165 1.00 20.83 ? 415  PHE I CE1 1 
ATOM   7986  C  CE2 . PHE I  3 45  ? -37.574 -28.407 -14.306 1.00 20.96 ? 415  PHE I CE2 1 
ATOM   7987  C  CZ  . PHE I  3 45  ? -38.301 -28.265 -13.141 1.00 20.45 ? 415  PHE I CZ  1 
ATOM   7988  N  N   . ARG I  3 46  ? -33.130 -30.740 -14.526 1.00 23.69 ? 416  ARG I N   1 
ATOM   7989  C  CA  . ARG I  3 46  ? -32.399 -29.676 -15.162 1.00 23.35 ? 416  ARG I CA  1 
ATOM   7990  C  C   . ARG I  3 46  ? -33.173 -29.282 -16.406 1.00 23.62 ? 416  ARG I C   1 
ATOM   7991  O  O   . ARG I  3 46  ? -33.846 -30.112 -17.022 1.00 24.42 ? 416  ARG I O   1 
ATOM   7992  C  CB  . ARG I  3 46  ? -30.975 -30.118 -15.479 1.00 24.34 ? 416  ARG I CB  1 
ATOM   7993  C  CG  . ARG I  3 46  ? -30.151 -30.336 -14.222 1.00 24.33 ? 416  ARG I CG  1 
ATOM   7994  C  CD  . ARG I  3 46  ? -28.764 -30.893 -14.527 1.00 25.61 ? 416  ARG I CD  1 
ATOM   7995  N  NE  . ARG I  3 46  ? -28.866 -32.217 -15.118 1.00 27.09 ? 416  ARG I NE  1 
ATOM   7996  C  CZ  . ARG I  3 46  ? -27.931 -32.810 -15.853 1.00 28.42 ? 416  ARG I CZ  1 
ATOM   7997  N  NH1 . ARG I  3 46  ? -26.767 -32.215 -16.094 1.00 28.47 ? 416  ARG I NH1 1 
ATOM   7998  N  NH2 . ARG I  3 46  ? -28.177 -34.016 -16.354 1.00 29.74 ? 416  ARG I NH2 1 
ATOM   7999  N  N   . ILE I  3 47  ? -33.106 -27.998 -16.737 1.00 23.02 ? 417  ILE I N   1 
ATOM   8000  C  CA  . ILE I  3 47  ? -33.911 -27.424 -17.799 1.00 23.26 ? 417  ILE I CA  1 
ATOM   8001  C  C   . ILE I  3 47  ? -33.092 -26.310 -18.434 1.00 23.32 ? 417  ILE I C   1 
ATOM   8002  O  O   . ILE I  3 47  ? -32.322 -25.641 -17.752 1.00 22.58 ? 417  ILE I O   1 
ATOM   8003  C  CB  . ILE I  3 47  ? -35.271 -26.899 -17.241 1.00 22.47 ? 417  ILE I CB  1 
ATOM   8004  C  CG1 . ILE I  3 47  ? -36.147 -26.311 -18.354 1.00 22.85 ? 417  ILE I CG1 1 
ATOM   8005  C  CG2 . ILE I  3 47  ? -35.073 -25.858 -16.141 1.00 21.18 ? 417  ILE I CG2 1 
ATOM   8006  C  CD1 . ILE I  3 47  ? -37.605 -26.181 -17.968 1.00 22.53 ? 417  ILE I CD1 1 
ATOM   8007  N  N   . ARG I  3 48  ? -33.243 -26.128 -19.738 1.00 24.51 ? 418  ARG I N   1 
ATOM   8008  C  CA  . ARG I  3 48  ? -32.496 -25.105 -20.458 1.00 24.91 ? 418  ARG I CA  1 
ATOM   8009  C  C   . ARG I  3 48  ? -32.606 -23.702 -19.836 1.00 23.64 ? 418  ARG I C   1 
ATOM   8010  O  O   . ARG I  3 48  ? -33.693 -23.242 -19.452 1.00 23.06 ? 418  ARG I O   1 
ATOM   8011  C  CB  . ARG I  3 48  ? -32.917 -25.057 -21.921 1.00 26.41 ? 418  ARG I CB  1 
ATOM   8012  C  CG  . ARG I  3 48  ? -32.384 -26.245 -22.687 1.00 28.45 ? 418  ARG I CG  1 
ATOM   8013  C  CD  . ARG I  3 48  ? -32.469 -26.050 -24.189 1.00 30.52 ? 418  ARG I CD  1 
ATOM   8014  N  NE  . ARG I  3 48  ? -32.125 -27.285 -24.899 1.00 32.03 ? 418  ARG I NE  1 
ATOM   8015  C  CZ  . ARG I  3 48  ? -32.210 -27.436 -26.216 1.00 33.57 ? 418  ARG I CZ  1 
ATOM   8016  N  NH1 . ARG I  3 48  ? -32.619 -26.422 -26.979 1.00 33.85 ? 418  ARG I NH1 1 
ATOM   8017  N  NH2 . ARG I  3 48  ? -31.881 -28.598 -26.772 1.00 34.95 ? 418  ARG I NH2 1 
ATOM   8018  N  N   . ARG I  3 49  ? -31.451 -23.050 -19.744 1.00 23.20 ? 419  ARG I N   1 
ATOM   8019  C  CA  . ARG I  3 49  ? -31.339 -21.721 -19.189 1.00 22.14 ? 419  ARG I CA  1 
ATOM   8020  C  C   . ARG I  3 49  ? -31.058 -20.755 -20.319 1.00 22.79 ? 419  ARG I C   1 
ATOM   8021  O  O   . ARG I  3 49  ? -30.354 -21.102 -21.253 1.00 23.85 ? 419  ARG I O   1 
ATOM   8022  C  CB  . ARG I  3 49  ? -30.189 -21.671 -18.190 1.00 21.44 ? 419  ARG I CB  1 
ATOM   8023  C  CG  . ARG I  3 49  ? -29.918 -20.283 -17.648 1.00 20.53 ? 419  ARG I CG  1 
ATOM   8024  C  CD  . ARG I  3 49  ? -29.198 -20.348 -16.327 1.00 19.76 ? 419  ARG I CD  1 
ATOM   8025  N  NE  . ARG I  3 49  ? -27.986 -21.164 -16.389 1.00 20.45 ? 419  ARG I NE  1 
ATOM   8026  C  CZ  . ARG I  3 49  ? -26.802 -20.730 -16.802 1.00 21.11 ? 419  ARG I CZ  1 
ATOM   8027  N  NH1 . ARG I  3 49  ? -26.652 -19.488 -17.226 1.00 21.06 ? 419  ARG I NH1 1 
ATOM   8028  N  NH2 . ARG I  3 49  ? -25.768 -21.548 -16.802 1.00 21.76 ? 419  ARG I NH2 1 
ATOM   8029  N  N   . GLY I  3 50  ? -31.622 -19.552 -20.219 1.00 22.40 ? 420  GLY I N   1 
ATOM   8030  C  CA  . GLY I  3 50  ? -31.272 -18.435 -21.092 1.00 23.05 ? 420  GLY I CA  1 
ATOM   8031  C  C   . GLY I  3 50  ? -32.219 -18.245 -22.256 1.00 23.87 ? 420  GLY I C   1 
ATOM   8032  O  O   . GLY I  3 50  ? -32.051 -17.310 -23.034 1.00 24.41 ? 420  GLY I O   1 
ATOM   8033  N  N   . THR I  3 51  ? -33.219 -19.122 -22.366 1.00 23.97 ? 421  THR I N   1 
ATOM   8034  C  CA  . THR I  3 51  ? -34.196 -19.046 -23.451 1.00 24.83 ? 421  THR I CA  1 
ATOM   8035  C  C   . THR I  3 51  ? -35.645 -18.964 -22.982 1.00 24.15 ? 421  THR I C   1 
ATOM   8036  O  O   . THR I  3 51  ? -36.557 -19.220 -23.757 1.00 24.93 ? 421  THR I O   1 
ATOM   8037  C  CB  . THR I  3 51  ? -34.050 -20.275 -24.355 1.00 26.16 ? 421  THR I CB  1 
ATOM   8038  O  OG1 . THR I  3 51  ? -34.201 -21.479 -23.564 1.00 25.77 ? 421  THR I OG1 1 
ATOM   8039  C  CG2 . THR I  3 51  ? -32.678 -20.243 -25.046 1.00 27.05 ? 421  THR I CG2 1 
ATOM   8040  N  N   . ASP I  3 52  ? -35.865 -18.609 -21.722 1.00 22.87 ? 422  ASP I N   1 
ATOM   8041  C  CA  . ASP I  3 52  ? -37.213 -18.620 -21.156 1.00 22.30 ? 422  ASP I CA  1 
ATOM   8042  C  C   . ASP I  3 52  ? -37.971 -19.944 -21.462 1.00 22.84 ? 422  ASP I C   1 
ATOM   8043  O  O   . ASP I  3 52  ? -39.135 -19.932 -21.866 1.00 23.26 ? 422  ASP I O   1 
ATOM   8044  C  CB  . ASP I  3 52  ? -37.996 -17.402 -21.655 1.00 22.45 ? 422  ASP I CB  1 
ATOM   8045  C  CG  . ASP I  3 52  ? -39.242 -17.120 -20.821 1.00 21.86 ? 422  ASP I CG  1 
ATOM   8046  O  OD1 . ASP I  3 52  ? -39.288 -17.478 -19.609 1.00 20.74 ? 422  ASP I OD1 1 
ATOM   8047  O  OD2 . ASP I  3 52  ? -40.183 -16.524 -21.387 1.00 22.44 ? 422  ASP I OD2 1 
ATOM   8048  N  N   . GLU I  3 53  ? -37.289 -21.071 -21.258 1.00 22.96 ? 423  GLU I N   1 
ATOM   8049  C  CA  . GLU I  3 53  ? -37.848 -22.399 -21.522 1.00 23.88 ? 423  GLU I CA  1 
ATOM   8050  C  C   . GLU I  3 53  ? -39.122 -22.661 -20.718 1.00 23.18 ? 423  GLU I C   1 
ATOM   8051  O  O   . GLU I  3 53  ? -39.080 -22.723 -19.490 1.00 22.04 ? 423  GLU I O   1 
ATOM   8052  C  CB  . GLU I  3 53  ? -36.813 -23.476 -21.200 1.00 24.16 ? 423  GLU I CB  1 
ATOM   8053  C  CG  . GLU I  3 53  ? -37.267 -24.904 -21.438 1.00 25.22 ? 423  GLU I CG  1 
ATOM   8054  C  CD  . GLU I  3 53  ? -37.464 -25.243 -22.905 1.00 27.17 ? 423  GLU I CD  1 
ATOM   8055  O  OE1 . GLU I  3 53  ? -36.564 -24.916 -23.727 1.00 27.88 ? 423  GLU I OE1 1 
ATOM   8056  O  OE2 . GLU I  3 53  ? -38.519 -25.855 -23.235 1.00 28.04 ? 423  GLU I OE2 1 
ATOM   8057  N  N   . CYS I  3 54  ? -40.242 -22.830 -21.424 1.00 23.86 ? 424  CYS I N   1 
ATOM   8058  C  CA  . CYS I  3 54  ? -41.540 -23.070 -20.787 1.00 23.62 ? 424  CYS I CA  1 
ATOM   8059  C  C   . CYS I  3 54  ? -41.905 -21.984 -19.794 1.00 22.12 ? 424  CYS I C   1 
ATOM   8060  O  O   . CYS I  3 54  ? -42.530 -22.253 -18.764 1.00 21.28 ? 424  CYS I O   1 
ATOM   8061  C  CB  . CYS I  3 54  ? -41.546 -24.433 -20.096 1.00 23.68 ? 424  CYS I CB  1 
ATOM   8062  S  SG  . CYS I  3 54  ? -41.339 -25.746 -21.297 1.00 25.49 ? 424  CYS I SG  1 
ATOM   8063  N  N   . ALA I  3 55  ? -41.489 -20.756 -20.104 1.00 21.67 ? 425  ALA I N   1 
ATOM   8064  C  CA  . ALA I  3 55  ? -41.758 -19.616 -19.249 1.00 20.55 ? 425  ALA I CA  1 
ATOM   8065  C  C   . ALA I  3 55  ? -41.084 -19.710 -17.873 1.00 19.26 ? 425  ALA I C   1 
ATOM   8066  O  O   . ALA I  3 55  ? -41.516 -19.056 -16.938 1.00 18.51 ? 425  ALA I O   1 
ATOM   8067  C  CB  . ALA I  3 55  ? -43.266 -19.433 -19.089 1.00 20.71 ? 425  ALA I CB  1 
ATOM   8068  N  N   . ILE I  3 56  ? -40.023 -20.495 -17.737 1.00 19.13 ? 426  ILE I N   1 
ATOM   8069  C  CA  . ILE I  3 56  ? -39.393 -20.644 -16.424 1.00 18.26 ? 426  ILE I CA  1 
ATOM   8070  C  C   . ILE I  3 56  ? -38.596 -19.426 -15.976 1.00 17.68 ? 426  ILE I C   1 
ATOM   8071  O  O   . ILE I  3 56  ? -38.241 -19.325 -14.807 1.00 17.12 ? 426  ILE I O   1 
ATOM   8072  C  CB  . ILE I  3 56  ? -38.522 -21.916 -16.307 1.00 18.46 ? 426  ILE I CB  1 
ATOM   8073  C  CG1 . ILE I  3 56  ? -38.301 -22.235 -14.833 1.00 17.82 ? 426  ILE I CG1 1 
ATOM   8074  C  CG2 . ILE I  3 56  ? -37.201 -21.768 -17.055 1.00 18.84 ? 426  ILE I CG2 1 
ATOM   8075  C  CD1 . ILE I  3 56  ? -37.784 -23.616 -14.577 1.00 18.36 ? 426  ILE I CD1 1 
ATOM   8076  N  N   . GLU I  3 57  ? -38.327 -18.497 -16.891 1.00 18.00 ? 427  GLU I N   1 
ATOM   8077  C  CA  . GLU I  3 57  ? -37.673 -17.244 -16.539 1.00 17.58 ? 427  GLU I CA  1 
ATOM   8078  C  C   . GLU I  3 57  ? -38.646 -16.062 -16.499 1.00 17.39 ? 427  GLU I C   1 
ATOM   8079  O  O   . GLU I  3 57  ? -38.227 -14.894 -16.625 1.00 17.49 ? 427  GLU I O   1 
ATOM   8080  C  CB  . GLU I  3 57  ? -36.509 -16.986 -17.498 1.00 18.32 ? 427  GLU I CB  1 
ATOM   8081  C  CG  . GLU I  3 57  ? -35.347 -17.957 -17.271 1.00 18.53 ? 427  GLU I CG  1 
ATOM   8082  C  CD  . GLU I  3 57  ? -34.457 -18.132 -18.489 1.00 19.63 ? 427  GLU I CD  1 
ATOM   8083  O  OE1 . GLU I  3 57  ? -34.509 -17.261 -19.380 1.00 20.38 ? 427  GLU I OE1 1 
ATOM   8084  O  OE2 . GLU I  3 57  ? -33.717 -19.139 -18.551 1.00 20.25 ? 427  GLU I OE2 1 
ATOM   8085  N  N   . SER I  3 58  ? -39.926 -16.345 -16.258 1.00 17.19 ? 428  SER I N   1 
ATOM   8086  C  CA  . SER I  3 58  ? -40.967 -15.311 -16.354 1.00 17.28 ? 428  SER I CA  1 
ATOM   8087  C  C   . SER I  3 58  ? -41.547 -14.831 -15.036 1.00 16.37 ? 428  SER I C   1 
ATOM   8088  O  O   . SER I  3 58  ? -42.142 -13.764 -15.023 1.00 16.59 ? 428  SER I O   1 
ATOM   8089  C  CB  . SER I  3 58  ? -42.128 -15.781 -17.255 1.00 18.18 ? 428  SER I CB  1 
ATOM   8090  O  OG  . SER I  3 58  ? -42.861 -16.852 -16.682 1.00 18.04 ? 428  SER I OG  1 
ATOM   8091  N  N   . ILE I  3 59  ? -41.412 -15.598 -13.949 1.00 15.59 ? 429  ILE I N   1 
ATOM   8092  C  CA  . ILE I  3 59  ? -42.103 -15.255 -12.693 1.00 15.01 ? 429  ILE I CA  1 
ATOM   8093  C  C   . ILE I  3 59  ? -41.346 -15.708 -11.435 1.00 14.31 ? 429  ILE I C   1 
ATOM   8094  O  O   . ILE I  3 59  ? -41.925 -16.265 -10.498 1.00 14.22 ? 429  ILE I O   1 
ATOM   8095  C  CB  . ILE I  3 59  ? -43.572 -15.776 -12.712 1.00 15.37 ? 429  ILE I CB  1 
ATOM   8096  C  CG1 . ILE I  3 59  ? -44.410 -15.203 -11.566 1.00 15.11 ? 429  ILE I CG1 1 
ATOM   8097  C  CG2 . ILE I  3 59  ? -43.653 -17.295 -12.677 1.00 15.62 ? 429  ILE I CG2 1 
ATOM   8098  C  CD1 . ILE I  3 59  ? -45.901 -15.425 -11.755 1.00 15.69 ? 429  ILE I CD1 1 
ATOM   8099  N  N   . ALA I  3 60  ? -40.049 -15.448 -11.390 1.00 13.92 ? 430  ALA I N   1 
ATOM   8100  C  CA  . ALA I  3 60  ? -39.287 -15.755 -10.184 1.00 13.45 ? 430  ALA I CA  1 
ATOM   8101  C  C   . ALA I  3 60  ? -39.746 -14.876 -9.018  1.00 13.09 ? 430  ALA I C   1 
ATOM   8102  O  O   . ALA I  3 60  ? -39.970 -13.680 -9.177  1.00 13.15 ? 430  ALA I O   1 
ATOM   8103  C  CB  . ALA I  3 60  ? -37.801 -15.602 -10.422 1.00 13.44 ? 430  ALA I CB  1 
ATOM   8104  N  N   . VAL I  3 61  ? -39.936 -15.503 -7.869  1.00 12.84 ? 431  VAL I N   1 
ATOM   8105  C  CA  . VAL I  3 61  ? -40.378 -14.823 -6.660  1.00 12.71 ? 431  VAL I CA  1 
ATOM   8106  C  C   . VAL I  3 61  ? -39.361 -15.022 -5.534  1.00 12.53 ? 431  VAL I C   1 
ATOM   8107  O  O   . VAL I  3 61  ? -38.947 -16.136 -5.273  1.00 12.58 ? 431  VAL I O   1 
ATOM   8108  C  CB  . VAL I  3 61  ? -41.736 -15.367 -6.181  1.00 12.91 ? 431  VAL I CB  1 
ATOM   8109  C  CG1 . VAL I  3 61  ? -42.048 -14.866 -4.789  1.00 12.91 ? 431  VAL I CG1 1 
ATOM   8110  C  CG2 . VAL I  3 61  ? -42.830 -14.928 -7.132  1.00 13.22 ? 431  VAL I CG2 1 
ATOM   8111  N  N   . ALA I  3 62  ? -38.989 -13.930 -4.876  1.00 12.44 ? 432  ALA I N   1 
ATOM   8112  C  CA  . ALA I  3 62  ? -38.021 -13.958 -3.785  1.00 12.51 ? 432  ALA I CA  1 
ATOM   8113  C  C   . ALA I  3 62  ? -38.670 -13.461 -2.491  1.00 12.65 ? 432  ALA I C   1 
ATOM   8114  O  O   . ALA I  3 62  ? -39.454 -12.525 -2.505  1.00 12.64 ? 432  ALA I O   1 
ATOM   8115  C  CB  . ALA I  3 62  ? -36.821 -13.095 -4.150  1.00 12.55 ? 432  ALA I CB  1 
ATOM   8116  N  N   . ALA I  3 63  ? -38.358 -14.112 -1.378  1.00 12.90 ? 433  ALA I N   1 
ATOM   8117  C  CA  . ALA I  3 63  ? -38.837 -13.664 -0.068  1.00 13.29 ? 433  ALA I CA  1 
ATOM   8118  C  C   . ALA I  3 63  ? -37.807 -13.994 0.980   1.00 13.70 ? 433  ALA I C   1 
ATOM   8119  O  O   . ALA I  3 63  ? -37.092 -14.986 0.864   1.00 13.75 ? 433  ALA I O   1 
ATOM   8120  C  CB  . ALA I  3 63  ? -40.178 -14.304 0.282   1.00 13.47 ? 433  ALA I CB  1 
ATOM   8121  N  N   . THR I  3 64  ? -37.746 -13.150 1.996   1.00 14.20 ? 434  THR I N   1 
ATOM   8122  C  CA  . THR I  3 64  ? -36.738 -13.222 3.040   1.00 14.87 ? 434  THR I CA  1 
ATOM   8123  C  C   . THR I  3 64  ? -37.359 -13.661 4.378   1.00 15.59 ? 434  THR I C   1 
ATOM   8124  O  O   . THR I  3 64  ? -38.092 -12.917 5.014   1.00 15.96 ? 434  THR I O   1 
ATOM   8125  C  CB  . THR I  3 64  ? -36.039 -11.857 3.170   1.00 15.11 ? 434  THR I CB  1 
ATOM   8126  O  OG1 . THR I  3 64  ? -35.405 -11.564 1.926   1.00 14.89 ? 434  THR I OG1 1 
ATOM   8127  C  CG2 . THR I  3 64  ? -34.977 -11.860 4.262   1.00 15.85 ? 434  THR I CG2 1 
ATOM   8128  N  N   . PRO I  3 65  ? -37.067 -14.884 4.809   1.00 16.04 ? 435  PRO I N   1 
ATOM   8129  C  CA  . PRO I  3 65  ? -37.670 -15.324 6.063   1.00 17.02 ? 435  PRO I CA  1 
ATOM   8130  C  C   . PRO I  3 65  ? -36.939 -14.767 7.289   1.00 18.09 ? 435  PRO I C   1 
ATOM   8131  O  O   . PRO I  3 65  ? -35.786 -14.350 7.194   1.00 18.35 ? 435  PRO I O   1 
ATOM   8132  C  CB  . PRO I  3 65  ? -37.562 -16.845 5.990   1.00 17.12 ? 435  PRO I CB  1 
ATOM   8133  C  CG  . PRO I  3 65  ? -36.442 -17.113 5.041   1.00 16.59 ? 435  PRO I CG  1 
ATOM   8134  C  CD  . PRO I  3 65  ? -36.163 -15.888 4.238   1.00 15.85 ? 435  PRO I CD  1 
ATOM   8135  N  N   . ILE I  3 66  ? -37.633 -14.723 8.413   1.00 19.20 ? 436  ILE I N   1 
ATOM   8136  C  CA  . ILE I  3 66  ? -37.035 -14.323 9.679   1.00 20.58 ? 436  ILE I CA  1 
ATOM   8137  C  C   . ILE I  3 66  ? -36.896 -15.562 10.555  1.00 21.78 ? 436  ILE I C   1 
ATOM   8138  O  O   . ILE I  3 66  ? -37.896 -16.094 11.033  1.00 22.55 ? 436  ILE I O   1 
ATOM   8139  C  CB  . ILE I  3 66  ? -37.898 -13.280 10.402  1.00 21.09 ? 436  ILE I CB  1 
ATOM   8140  C  CG1 . ILE I  3 66  ? -38.021 -12.004 9.565   1.00 20.25 ? 436  ILE I CG1 1 
ATOM   8141  C  CG2 . ILE I  3 66  ? -37.313 -12.968 11.775  1.00 22.48 ? 436  ILE I CG2 1 
ATOM   8142  C  CD1 . ILE I  3 66  ? -39.178 -11.132 9.985   1.00 20.64 ? 436  ILE I CD1 1 
ATOM   8143  N  N   . PRO I  3 67  ? -35.665 -16.043 10.752  1.00 22.46 ? 437  PRO I N   1 
ATOM   8144  C  CA  . PRO I  3 67  ? -35.487 -17.183 11.646  1.00 23.87 ? 437  PRO I CA  1 
ATOM   8145  C  C   . PRO I  3 67  ? -35.752 -16.848 13.107  1.00 25.68 ? 437  PRO I C   1 
ATOM   8146  O  O   . PRO I  3 67  ? -35.990 -15.694 13.443  1.00 25.65 ? 437  PRO I O   1 
ATOM   8147  C  CB  . PRO I  3 67  ? -34.005 -17.534 11.467  1.00 23.95 ? 437  PRO I CB  1 
ATOM   8148  C  CG  . PRO I  3 67  ? -33.363 -16.282 10.997  1.00 23.23 ? 437  PRO I CG  1 
ATOM   8149  C  CD  . PRO I  3 67  ? -34.393 -15.668 10.096  1.00 22.01 ? 437  PRO I CD  1 
ATOM   8150  N  N   . LYS I  3 68  ? -35.688 -17.860 13.965  1.00 27.35 ? 438  LYS I N   1 
ATOM   8151  C  CA  . LYS I  3 68  ? -35.757 -17.641 15.405  1.00 29.43 ? 438  LYS I CA  1 
ATOM   8152  C  C   . LYS I  3 68  ? -34.500 -16.940 15.887  1.00 30.65 ? 438  LYS I C   1 
ATOM   8153  O  O   . LYS I  3 68  ? -33.471 -17.005 15.231  1.00 30.14 ? 438  LYS I O   1 
ATOM   8154  C  CB  . LYS I  3 68  ? -35.885 -18.973 16.135  1.00 30.68 ? 438  LYS I CB  1 
ATOM   8155  C  CG  . LYS I  3 68  ? -37.194 -19.682 15.877  1.00 30.50 ? 438  LYS I CG  1 
ATOM   8156  C  CD  . LYS I  3 68  ? -37.195 -21.045 16.533  1.00 31.91 ? 438  LYS I CD  1 
ATOM   8157  C  CE  . LYS I  3 68  ? -38.594 -21.602 16.638  1.00 32.27 ? 438  LYS I CE  1 
ATOM   8158  N  NZ  . LYS I  3 68  ? -38.591 -22.733 17.601  1.00 34.31 ? 438  LYS I NZ  1 
ATOM   8159  N  N   . LEU I  3 69  ? -34.571 -16.272 17.032  1.00 32.89 ? 439  LEU I N   1 
ATOM   8160  C  CA  . LEU I  3 69  ? -33.339 -15.816 17.670  1.00 34.75 ? 439  LEU I CA  1 
ATOM   8161  C  C   . LEU I  3 69  ? -32.438 -17.033 17.923  1.00 36.80 ? 439  LEU I C   1 
ATOM   8162  O  O   . LEU I  3 69  ? -32.899 -18.045 18.488  1.00 38.26 ? 439  LEU I O   1 
ATOM   8163  C  CB  . LEU I  3 69  ? -33.604 -15.079 18.995  1.00 36.06 ? 439  LEU I CB  1 
ATOM   8164  C  CG  . LEU I  3 69  ? -34.027 -13.616 18.868  1.00 35.34 ? 439  LEU I CG  1 
ATOM   8165  C  CD1 . LEU I  3 69  ? -34.160 -13.000 20.246  1.00 37.10 ? 439  LEU I CD1 1 
ATOM   8166  C  CD2 . LEU I  3 69  ? -33.030 -12.835 18.023  1.00 34.42 ? 439  LEU I CD2 1 
ATOM   8167  O  OXT . LEU I  3 69  ? -31.249 -17.025 17.548  1.00 38.22 ? 439  LEU I OXT 1 
ATOM   8168  N  N   . ASP J  1 1   ? -36.271 10.354  32.078  1.00 30.91 ? 1    ASP J N   1 
ATOM   8169  C  CA  . ASP J  1 1   ? -34.883 9.837   32.208  1.00 29.92 ? 1    ASP J CA  1 
ATOM   8170  C  C   . ASP J  1 1   ? -34.747 8.870   33.389  1.00 30.81 ? 1    ASP J C   1 
ATOM   8171  O  O   . ASP J  1 1   ? -35.392 9.052   34.431  1.00 32.81 ? 1    ASP J O   1 
ATOM   8172  C  CB  . ASP J  1 1   ? -33.890 10.992  32.376  1.00 30.63 ? 1    ASP J CB  1 
ATOM   8173  C  CG  . ASP J  1 1   ? -34.078 12.098  31.344  1.00 30.50 ? 1    ASP J CG  1 
ATOM   8174  O  OD1 . ASP J  1 1   ? -35.239 12.378  30.964  1.00 31.31 ? 1    ASP J OD1 1 
ATOM   8175  O  OD2 . ASP J  1 1   ? -33.061 12.699  30.928  1.00 29.80 ? 1    ASP J OD2 1 
ATOM   8176  N  N   . THR J  1 2   ? -33.931 7.835   33.196  1.00 29.34 ? 2    THR J N   1 
ATOM   8177  C  CA  . THR J  1 2   ? -33.393 7.038   34.291  1.00 30.76 ? 2    THR J CA  1 
ATOM   8178  C  C   . THR J  1 2   ? -32.243 7.833   34.889  1.00 31.90 ? 2    THR J C   1 
ATOM   8179  O  O   . THR J  1 2   ? -31.839 8.844   34.328  1.00 31.32 ? 2    THR J O   1 
ATOM   8180  C  CB  . THR J  1 2   ? -32.843 5.681   33.816  1.00 29.30 ? 2    THR J CB  1 
ATOM   8181  O  OG1 . THR J  1 2   ? -31.698 5.885   32.977  1.00 27.59 ? 2    THR J OG1 1 
ATOM   8182  C  CG2 . THR J  1 2   ? -33.900 4.895   33.074  1.00 28.29 ? 2    THR J CG2 1 
ATOM   8183  N  N   . PRO J  1 3   ? -31.717 7.390   36.041  1.00 34.01 ? 3    PRO J N   1 
ATOM   8184  C  CA  . PRO J  1 3   ? -30.574 8.133   36.577  1.00 35.09 ? 3    PRO J CA  1 
ATOM   8185  C  C   . PRO J  1 3   ? -29.240 7.771   35.914  1.00 34.13 ? 3    PRO J C   1 
ATOM   8186  O  O   . PRO J  1 3   ? -28.232 8.387   36.218  1.00 35.12 ? 3    PRO J O   1 
ATOM   8187  C  CB  . PRO J  1 3   ? -30.578 7.775   38.073  1.00 37.59 ? 3    PRO J CB  1 
ATOM   8188  C  CG  . PRO J  1 3   ? -31.347 6.506   38.189  1.00 37.47 ? 3    PRO J CG  1 
ATOM   8189  C  CD  . PRO J  1 3   ? -32.286 6.441   37.022  1.00 35.52 ? 3    PRO J CD  1 
ATOM   8190  N  N   . ALA J  1 4   ? -29.234 6.797   35.008  1.00 32.99 ? 4    ALA J N   1 
ATOM   8191  C  CA  . ALA J  1 4   ? -28.009 6.409   34.307  1.00 32.36 ? 4    ALA J CA  1 
ATOM   8192  C  C   . ALA J  1 4   ? -27.468 7.514   33.403  1.00 32.06 ? 4    ALA J C   1 
ATOM   8193  O  O   . ALA J  1 4   ? -28.226 8.272   32.798  1.00 31.94 ? 4    ALA J O   1 
ATOM   8194  C  CB  . ALA J  1 4   ? -28.244 5.149   33.496  1.00 31.06 ? 4    ALA J CB  1 
ATOM   8195  N  N   . ASN J  1 5   ? -26.142 7.593   33.335  1.00 33.22 ? 5    ASN J N   1 
ATOM   8196  C  CA  . ASN J  1 5   ? -25.439 8.538   32.482  1.00 33.70 ? 5    ASN J CA  1 
ATOM   8197  C  C   . ASN J  1 5   ? -24.237 7.822   31.869  1.00 32.23 ? 5    ASN J C   1 
ATOM   8198  O  O   . ASN J  1 5   ? -23.088 8.083   32.215  1.00 33.01 ? 5    ASN J O   1 
ATOM   8199  C  CB  . ASN J  1 5   ? -25.013 9.771   33.285  1.00 38.11 ? 5    ASN J CB  1 
ATOM   8200  C  CG  . ASN J  1 5   ? -24.400 10.862  32.415  1.00 40.64 ? 5    ASN J CG  1 
ATOM   8201  O  OD1 . ASN J  1 5   ? -24.580 10.885  31.187  1.00 38.24 ? 5    ASN J OD1 1 
ATOM   8202  N  ND2 . ASN J  1 5   ? -23.667 11.787  33.064  1.00 46.78 ? 5    ASN J ND2 1 
ATOM   8203  N  N   . CYS J  1 6   ? -24.542 6.902   30.959  1.00 29.88 ? 6    CYS J N   1 
ATOM   8204  C  CA  . CYS J  1 6   ? -23.553 6.041   30.324  1.00 28.84 ? 6    CYS J CA  1 
ATOM   8205  C  C   . CYS J  1 6   ? -23.086 6.619   28.996  1.00 26.58 ? 6    CYS J C   1 
ATOM   8206  O  O   . CYS J  1 6   ? -23.850 7.267   28.285  1.00 25.60 ? 6    CYS J O   1 
ATOM   8207  C  CB  . CYS J  1 6   ? -24.147 4.651   30.105  1.00 28.69 ? 6    CYS J CB  1 
ATOM   8208  S  SG  . CYS J  1 6   ? -24.581 3.858   31.675  1.00 31.90 ? 6    CYS J SG  1 
ATOM   8209  N  N   . THR J  1 7   ? -21.823 6.376   28.663  1.00 25.50 ? 7    THR J N   1 
ATOM   8210  C  CA  . THR J  1 7   ? -21.246 6.971   27.483  1.00 24.25 ? 7    THR J CA  1 
ATOM   8211  C  C   . THR J  1 7   ? -21.352 6.035   26.286  1.00 22.23 ? 7    THR J C   1 
ATOM   8212  O  O   . THR J  1 7   ? -21.547 4.837   26.428  1.00 21.62 ? 7    THR J O   1 
ATOM   8213  C  CB  . THR J  1 7   ? -19.770 7.322   27.705  1.00 25.76 ? 7    THR J CB  1 
ATOM   8214  O  OG1 . THR J  1 7   ? -18.987 6.124   27.663  1.00 25.99 ? 7    THR J OG1 1 
ATOM   8215  C  CG2 . THR J  1 7   ? -19.568 8.046   29.049  1.00 27.35 ? 7    THR J CG2 1 
ATOM   8216  N  N   . TYR J  1 8   ? -21.214 6.610   25.103  1.00 21.32 ? 8    TYR J N   1 
ATOM   8217  C  CA  . TYR J  1 8   ? -21.073 5.838   23.870  1.00 20.43 ? 8    TYR J CA  1 
ATOM   8218  C  C   . TYR J  1 8   ? -19.887 4.859   23.953  1.00 21.04 ? 8    TYR J C   1 
ATOM   8219  O  O   . TYR J  1 8   ? -19.998 3.712   23.529  1.00 20.35 ? 8    TYR J O   1 
ATOM   8220  C  CB  . TYR J  1 8   ? -20.933 6.807   22.692  1.00 20.44 ? 8    TYR J CB  1 
ATOM   8221  C  CG  . TYR J  1 8   ? -20.689 6.191   21.348  1.00 19.99 ? 8    TYR J CG  1 
ATOM   8222  C  CD1 . TYR J  1 8   ? -19.390 5.925   20.912  1.00 21.24 ? 8    TYR J CD1 1 
ATOM   8223  C  CD2 . TYR J  1 8   ? -21.747 5.935   20.472  1.00 18.83 ? 8    TYR J CD2 1 
ATOM   8224  C  CE1 . TYR J  1 8   ? -19.158 5.381   19.656  1.00 21.18 ? 8    TYR J CE1 1 
ATOM   8225  C  CE2 . TYR J  1 8   ? -21.529 5.392   19.215  1.00 18.53 ? 8    TYR J CE2 1 
ATOM   8226  C  CZ  . TYR J  1 8   ? -20.239 5.112   18.817  1.00 19.87 ? 8    TYR J CZ  1 
ATOM   8227  O  OH  . TYR J  1 8   ? -20.004 4.574   17.591  1.00 19.16 ? 8    TYR J OH  1 
ATOM   8228  N  N   . LEU J  1 9   ? -18.772 5.294   24.529  1.00 22.54 ? 9    LEU J N   1 
ATOM   8229  C  CA  . LEU J  1 9   ? -17.617 4.397   24.699  1.00 23.76 ? 9    LEU J CA  1 
ATOM   8230  C  C   . LEU J  1 9   ? -17.956 3.167   25.567  1.00 23.51 ? 9    LEU J C   1 
ATOM   8231  O  O   . LEU J  1 9   ? -17.527 2.055   25.257  1.00 23.82 ? 9    LEU J O   1 
ATOM   8232  C  CB  . LEU J  1 9   ? -16.410 5.146   25.259  1.00 25.69 ? 9    LEU J CB  1 
ATOM   8233  C  CG  . LEU J  1 9   ? -15.069 4.396   25.142  1.00 27.51 ? 9    LEU J CG  1 
ATOM   8234  C  CD1 . LEU J  1 9   ? -14.679 4.142   23.691  1.00 27.56 ? 9    LEU J CD1 1 
ATOM   8235  C  CD2 . LEU J  1 9   ? -13.957 5.170   25.829  1.00 29.49 ? 9    LEU J CD2 1 
ATOM   8236  N  N   . ASP J  1 10  ? -18.751 3.352   26.620  1.00 23.19 ? 10   ASP J N   1 
ATOM   8237  C  CA  . ASP J  1 10  ? -19.221 2.216   27.431  1.00 23.36 ? 10   ASP J CA  1 
ATOM   8238  C  C   . ASP J  1 10  ? -19.983 1.186   26.583  1.00 21.78 ? 10   ASP J C   1 
ATOM   8239  O  O   . ASP J  1 10  ? -19.907 -0.018  26.824  1.00 22.09 ? 10   ASP J O   1 
ATOM   8240  C  CB  . ASP J  1 10  ? -20.173 2.683   28.551  1.00 23.65 ? 10   ASP J CB  1 
ATOM   8241  C  CG  . ASP J  1 10  ? -19.492 3.544   29.598  1.00 25.28 ? 10   ASP J CG  1 
ATOM   8242  O  OD1 . ASP J  1 10  ? -18.347 3.216   29.983  1.00 26.98 ? 10   ASP J OD1 1 
ATOM   8243  O  OD2 . ASP J  1 10  ? -20.116 4.543   30.041  1.00 25.27 ? 10   ASP J OD2 1 
ATOM   8244  N  N   . LEU J  1 11  ? -20.736 1.675   25.604  1.00 20.05 ? 11   LEU J N   1 
ATOM   8245  C  CA  . LEU J  1 11  ? -21.551 0.812   24.765  1.00 18.68 ? 11   LEU J CA  1 
ATOM   8246  C  C   . LEU J  1 11  ? -20.750 -0.017  23.744  1.00 18.76 ? 11   LEU J C   1 
ATOM   8247  O  O   . LEU J  1 11  ? -21.165 -1.117  23.378  1.00 18.34 ? 11   LEU J O   1 
ATOM   8248  C  CB  . LEU J  1 11  ? -22.619 1.652   24.071  1.00 17.37 ? 11   LEU J CB  1 
ATOM   8249  C  CG  . LEU J  1 11  ? -23.588 0.915   23.156  1.00 16.26 ? 11   LEU J CG  1 
ATOM   8250  C  CD1 . LEU J  1 11  ? -24.360 -0.113  23.948  1.00 16.36 ? 11   LEU J CD1 1 
ATOM   8251  C  CD2 . LEU J  1 11  ? -24.520 1.892   22.460  1.00 15.37 ? 11   LEU J CD2 1 
ATOM   8252  N  N   . LEU J  1 12  ? -19.611 0.499   23.291  1.00 19.49 ? 12   LEU J N   1 
ATOM   8253  C  CA  . LEU J  1 12  ? -18.836 -0.170  22.250  1.00 19.98 ? 12   LEU J CA  1 
ATOM   8254  C  C   . LEU J  1 12  ? -18.167 -1.435  22.782  1.00 21.13 ? 12   LEU J C   1 
ATOM   8255  O  O   . LEU J  1 12  ? -17.622 -1.449  23.881  1.00 22.35 ? 12   LEU J O   1 
ATOM   8256  C  CB  . LEU J  1 12  ? -17.766 0.762   21.683  1.00 20.95 ? 12   LEU J CB  1 
ATOM   8257  C  CG  . LEU J  1 12  ? -18.187 1.946   20.798  1.00 20.33 ? 12   LEU J CG  1 
ATOM   8258  C  CD1 . LEU J  1 12  ? -16.939 2.747   20.454  1.00 21.87 ? 12   LEU J CD1 1 
ATOM   8259  C  CD2 . LEU J  1 12  ? -18.884 1.516   19.510  1.00 19.46 ? 12   LEU J CD2 1 
ATOM   8260  N  N   . GLY J  1 13  ? -18.196 -2.493  21.982  1.00 21.10 ? 13   GLY J N   1 
ATOM   8261  C  CA  . GLY J  1 13  ? -17.544 -3.749  22.333  1.00 22.44 ? 13   GLY J CA  1 
ATOM   8262  C  C   . GLY J  1 13  ? -18.484 -4.926  22.192  1.00 21.85 ? 13   GLY J C   1 
ATOM   8263  O  O   . GLY J  1 13  ? -19.449 -4.866  21.434  1.00 20.45 ? 13   GLY J O   1 
ATOM   8264  N  N   . THR J  1 14  ? -18.197 -5.982  22.949  1.00 23.11 ? 14   THR J N   1 
ATOM   8265  C  CA  . THR J  1 14  ? -18.913 -7.248  22.874  1.00 23.20 ? 14   THR J CA  1 
ATOM   8266  C  C   . THR J  1 14  ? -19.962 -7.327  23.986  1.00 22.68 ? 14   THR J C   1 
ATOM   8267  O  O   . THR J  1 14  ? -19.645 -7.154  25.167  1.00 23.62 ? 14   THR J O   1 
ATOM   8268  C  CB  . THR J  1 14  ? -17.917 -8.416  22.982  1.00 25.47 ? 14   THR J CB  1 
ATOM   8269  O  OG1 . THR J  1 14  ? -16.869 -8.228  22.025  1.00 26.34 ? 14   THR J OG1 1 
ATOM   8270  C  CG2 . THR J  1 14  ? -18.593 -9.758  22.723  1.00 25.81 ? 14   THR J CG2 1 
ATOM   8271  N  N   . TRP J  1 15  ? -21.215 -7.533  23.599  1.00 21.44 ? 15   TRP J N   1 
ATOM   8272  C  CA  . TRP J  1 15  ? -22.299 -7.747  24.549  1.00 21.35 ? 15   TRP J CA  1 
ATOM   8273  C  C   . TRP J  1 15  ? -22.818 -9.158  24.408  1.00 22.35 ? 15   TRP J C   1 
ATOM   8274  O  O   . TRP J  1 15  ? -22.959 -9.655  23.296  1.00 22.19 ? 15   TRP J O   1 
ATOM   8275  C  CB  . TRP J  1 15  ? -23.448 -6.780  24.297  1.00 19.45 ? 15   TRP J CB  1 
ATOM   8276  C  CG  . TRP J  1 15  ? -23.144 -5.391  24.691  1.00 18.81 ? 15   TRP J CG  1 
ATOM   8277  C  CD1 . TRP J  1 15  ? -22.474 -4.475  23.956  1.00 18.28 ? 15   TRP J CD1 1 
ATOM   8278  C  CD2 . TRP J  1 15  ? -23.506 -4.747  25.914  1.00 18.91 ? 15   TRP J CD2 1 
ATOM   8279  N  NE1 . TRP J  1 15  ? -22.388 -3.290  24.641  1.00 18.10 ? 15   TRP J NE1 1 
ATOM   8280  C  CE2 . TRP J  1 15  ? -23.012 -3.430  25.852  1.00 18.48 ? 15   TRP J CE2 1 
ATOM   8281  C  CE3 . TRP J  1 15  ? -24.202 -5.151  27.058  1.00 19.68 ? 15   TRP J CE3 1 
ATOM   8282  C  CZ2 . TRP J  1 15  ? -23.182 -2.510  26.897  1.00 18.71 ? 15   TRP J CZ2 1 
ATOM   8283  C  CZ3 . TRP J  1 15  ? -24.379 -4.232  28.101  1.00 19.93 ? 15   TRP J CZ3 1 
ATOM   8284  C  CH2 . TRP J  1 15  ? -23.863 -2.934  28.014  1.00 19.42 ? 15   TRP J CH2 1 
ATOM   8285  N  N   . VAL J  1 16  ? -23.078 -9.801  25.540  1.00 23.90 ? 16   VAL J N   1 
ATOM   8286  C  CA  . VAL J  1 16  ? -23.740 -11.103 25.579  1.00 25.16 ? 16   VAL J CA  1 
ATOM   8287  C  C   . VAL J  1 16  ? -25.194 -10.841 25.956  1.00 24.64 ? 16   VAL J C   1 
ATOM   8288  O  O   . VAL J  1 16  ? -25.455 -10.169 26.949  1.00 24.80 ? 16   VAL J O   1 
ATOM   8289  C  CB  . VAL J  1 16  ? -23.090 -12.037 26.627  1.00 27.62 ? 16   VAL J CB  1 
ATOM   8290  C  CG1 . VAL J  1 16  ? -23.744 -13.410 26.623  1.00 29.03 ? 16   VAL J CG1 1 
ATOM   8291  C  CG2 . VAL J  1 16  ? -21.602 -12.154 26.367  1.00 28.72 ? 16   VAL J CG2 1 
ATOM   8292  N  N   . PHE J  1 17  ? -26.136 -11.331 25.154  1.00 24.47 ? 17   PHE J N   1 
ATOM   8293  C  CA  . PHE J  1 17  ? -27.556 -11.176 25.472  1.00 24.35 ? 17   PHE J CA  1 
ATOM   8294  C  C   . PHE J  1 17  ? -28.173 -12.507 25.866  1.00 26.87 ? 17   PHE J C   1 
ATOM   8295  O  O   . PHE J  1 17  ? -28.061 -13.493 25.141  1.00 27.62 ? 17   PHE J O   1 
ATOM   8296  C  CB  . PHE J  1 17  ? -28.336 -10.582 24.301  1.00 22.34 ? 17   PHE J CB  1 
ATOM   8297  C  CG  . PHE J  1 17  ? -27.975 -9.159  23.981  1.00 20.67 ? 17   PHE J CG  1 
ATOM   8298  C  CD1 . PHE J  1 17  ? -27.465 -8.304  24.955  1.00 20.72 ? 17   PHE J CD1 1 
ATOM   8299  C  CD2 . PHE J  1 17  ? -28.176 -8.665  22.706  1.00 19.14 ? 17   PHE J CD2 1 
ATOM   8300  C  CE1 . PHE J  1 17  ? -27.147 -6.998  24.654  1.00 19.52 ? 17   PHE J CE1 1 
ATOM   8301  C  CE2 . PHE J  1 17  ? -27.865 -7.357  22.404  1.00 18.13 ? 17   PHE J CE2 1 
ATOM   8302  C  CZ  . PHE J  1 17  ? -27.353 -6.519  23.376  1.00 18.26 ? 17   PHE J CZ  1 
ATOM   8303  N  N   . GLN J  1 18  ? -28.813 -12.511 27.034  1.00 28.86 ? 18   GLN J N   1 
ATOM   8304  C  CA  . GLN J  1 18  ? -29.546 -13.662 27.522  1.00 31.79 ? 18   GLN J CA  1 
ATOM   8305  C  C   . GLN J  1 18  ? -31.031 -13.467 27.231  1.00 31.13 ? 18   GLN J C   1 
ATOM   8306  O  O   . GLN J  1 18  ? -31.662 -12.573 27.782  1.00 30.11 ? 18   GLN J O   1 
ATOM   8307  C  CB  . GLN J  1 18  ? -29.299 -13.846 29.022  1.00 34.47 ? 18   GLN J CB  1 
ATOM   8308  C  CG  . GLN J  1 18  ? -27.918 -14.386 29.338  1.00 36.57 ? 18   GLN J CG  1 
ATOM   8309  C  CD  . GLN J  1 18  ? -27.705 -15.807 28.821  1.00 39.03 ? 18   GLN J CD  1 
ATOM   8310  O  OE1 . GLN J  1 18  ? -28.660 -16.567 28.612  1.00 40.27 ? 18   GLN J OE1 1 
ATOM   8311  N  NE2 . GLN J  1 18  ? -26.441 -16.179 28.628  1.00 40.36 ? 18   GLN J NE2 1 
ATOM   8312  N  N   . VAL J  1 19  ? -31.574 -14.311 26.359  1.00 31.87 ? 19   VAL J N   1 
ATOM   8313  C  CA  . VAL J  1 19  ? -32.949 -14.178 25.906  1.00 32.06 ? 19   VAL J CA  1 
ATOM   8314  C  C   . VAL J  1 19  ? -33.841 -15.153 26.654  1.00 35.28 ? 19   VAL J C   1 
ATOM   8315  O  O   . VAL J  1 19  ? -33.540 -16.346 26.758  1.00 37.23 ? 19   VAL J O   1 
ATOM   8316  C  CB  . VAL J  1 19  ? -33.065 -14.437 24.395  1.00 30.91 ? 19   VAL J CB  1 
ATOM   8317  C  CG1 . VAL J  1 19  ? -34.456 -14.072 23.897  1.00 30.38 ? 19   VAL J CG1 1 
ATOM   8318  C  CG2 . VAL J  1 19  ? -32.014 -13.634 23.647  1.00 29.22 ? 19   VAL J CG2 1 
ATOM   8319  N  N   . GLY J  1 20  ? -34.936 -14.638 27.192  1.00 37.01 ? 20   GLY J N   1 
ATOM   8320  C  CA  . GLY J  1 20  ? -35.906 -15.482 27.884  1.00 41.14 ? 20   GLY J CA  1 
ATOM   8321  C  C   . GLY J  1 20  ? -37.260 -15.323 27.245  1.00 42.69 ? 20   GLY J C   1 
ATOM   8322  O  O   . GLY J  1 20  ? -37.457 -14.431 26.427  1.00 41.43 ? 20   GLY J O   1 
ATOM   8323  N  N   . SER J  1 21  ? -38.197 -16.191 27.601  1.00 46.80 ? 21   SER J N   1 
ATOM   8324  C  CA  . SER J  1 21  ? -39.590 -15.963 27.244  1.00 48.13 ? 21   SER J CA  1 
ATOM   8325  C  C   . SER J  1 21  ? -39.737 -15.823 25.721  1.00 45.54 ? 21   SER J C   1 
ATOM   8326  O  O   . SER J  1 21  ? -40.440 -14.949 25.228  1.00 43.80 ? 21   SER J O   1 
ATOM   8327  C  CB  . SER J  1 21  ? -40.086 -14.694 27.956  1.00 48.09 ? 21   SER J CB  1 
ATOM   8328  O  OG  . SER J  1 21  ? -39.514 -14.587 29.256  1.00 50.22 ? 21   SER J OG  1 
ATOM   8329  N  N   . SER J  1 22  ? -39.061 -16.704 24.993  1.00 45.85 ? 22   SER J N   1 
ATOM   8330  C  CA  . SER J  1 22  ? -39.026 -16.648 23.538  1.00 44.73 ? 22   SER J CA  1 
ATOM   8331  C  C   . SER J  1 22  ? -40.410 -16.883 22.958  1.00 45.63 ? 22   SER J C   1 
ATOM   8332  O  O   . SER J  1 22  ? -41.309 -17.345 23.652  1.00 47.71 ? 22   SER J O   1 
ATOM   8333  C  CB  . SER J  1 22  ? -38.024 -17.674 22.983  1.00 45.55 ? 22   SER J CB  1 
ATOM   8334  O  OG  . SER J  1 22  ? -38.338 -18.991 23.416  1.00 48.22 ? 22   SER J OG  1 
ATOM   8335  N  N   . GLY J  1 23  ? -40.580 -16.516 21.691  1.00 45.28 ? 23   GLY J N   1 
ATOM   8336  C  CA  . GLY J  1 23  ? -41.832 -16.731 20.968  1.00 46.93 ? 23   GLY J CA  1 
ATOM   8337  C  C   . GLY J  1 23  ? -43.098 -16.112 21.556  1.00 47.71 ? 23   GLY J C   1 
ATOM   8338  O  O   . GLY J  1 23  ? -44.210 -16.509 21.187  1.00 50.86 ? 23   GLY J O   1 
ATOM   8339  N  N   . SER J  1 24  ? -42.946 -15.146 22.461  1.00 45.84 ? 24   SER J N   1 
ATOM   8340  C  CA  . SER J  1 24  ? -44.088 -14.402 22.988  1.00 45.72 ? 24   SER J CA  1 
ATOM   8341  C  C   . SER J  1 24  ? -44.586 -13.405 21.940  1.00 43.09 ? 24   SER J C   1 
ATOM   8342  O  O   . SER J  1 24  ? -43.973 -13.253 20.889  1.00 40.10 ? 24   SER J O   1 
ATOM   8343  C  CB  . SER J  1 24  ? -43.697 -13.655 24.268  1.00 45.95 ? 24   SER J CB  1 
ATOM   8344  O  OG  . SER J  1 24  ? -43.088 -14.522 25.211  1.00 48.19 ? 24   SER J OG  1 
ATOM   8345  N  N   . GLN J  1 25  ? -45.703 -12.749 22.253  1.00 43.54 ? 25   GLN J N   1 
ATOM   8346  C  CA  . GLN J  1 25  ? -46.312 -11.691 21.441  1.00 42.01 ? 25   GLN J CA  1 
ATOM   8347  C  C   . GLN J  1 25  ? -46.110 -10.353 22.152  1.00 39.23 ? 25   GLN J C   1 
ATOM   8348  O  O   . GLN J  1 25  ? -45.576 -10.321 23.257  1.00 39.12 ? 25   GLN J O   1 
ATOM   8349  C  CB  . GLN J  1 25  ? -47.805 -11.966 21.241  1.00 45.53 ? 25   GLN J CB  1 
ATOM   8350  C  CG  . GLN J  1 25  ? -48.158 -12.676 19.943  1.00 47.53 ? 25   GLN J CG  1 
ATOM   8351  C  CD  . GLN J  1 25  ? -47.386 -13.971 19.725  1.00 48.88 ? 25   GLN J CD  1 
ATOM   8352  O  OE1 . GLN J  1 25  ? -46.763 -14.171 18.668  1.00 48.62 ? 25   GLN J OE1 1 
ATOM   8353  N  NE2 . GLN J  1 25  ? -47.420 -14.859 20.722  1.00 51.02 ? 25   GLN J NE2 1 
ATOM   8354  N  N   . ARG J  1 26  ? -46.543 -9.252  21.544  1.00 37.11 ? 26   ARG J N   1 
ATOM   8355  C  CA  . ARG J  1 26  ? -46.198 -7.924  22.071  1.00 35.57 ? 26   ARG J CA  1 
ATOM   8356  C  C   . ARG J  1 26  ? -46.767 -7.595  23.460  1.00 38.43 ? 26   ARG J C   1 
ATOM   8357  O  O   . ARG J  1 26  ? -46.301 -6.660  24.122  1.00 37.35 ? 26   ARG J O   1 
ATOM   8358  C  CB  . ARG J  1 26  ? -46.569 -6.821  21.077  1.00 33.96 ? 26   ARG J CB  1 
ATOM   8359  C  CG  . ARG J  1 26  ? -48.039 -6.473  21.047  1.00 36.22 ? 26   ARG J CG  1 
ATOM   8360  C  CD  . ARG J  1 26  ? -48.254 -5.096  20.457  1.00 35.04 ? 26   ARG J CD  1 
ATOM   8361  N  NE  . ARG J  1 26  ? -49.581 -5.008  19.853  1.00 36.56 ? 26   ARG J NE  1 
ATOM   8362  C  CZ  . ARG J  1 26  ? -49.946 -4.079  18.974  1.00 35.88 ? 26   ARG J CZ  1 
ATOM   8363  N  NH1 . ARG J  1 26  ? -49.097 -3.136  18.600  1.00 33.22 ? 26   ARG J NH1 1 
ATOM   8364  N  NH2 . ARG J  1 26  ? -51.176 -4.091  18.474  1.00 37.97 ? 26   ARG J NH2 1 
ATOM   8365  N  N   . ASP J  1 27  ? -47.763 -8.364  23.890  1.00 42.07 ? 27   ASP J N   1 
ATOM   8366  C  CA  . ASP J  1 27  ? -48.319 -8.276  25.251  1.00 45.39 ? 27   ASP J CA  1 
ATOM   8367  C  C   . ASP J  1 27  ? -47.323 -8.643  26.368  1.00 45.73 ? 27   ASP J C   1 
ATOM   8368  O  O   . ASP J  1 27  ? -47.628 -8.482  27.556  1.00 47.85 ? 27   ASP J O   1 
ATOM   8369  C  CB  . ASP J  1 27  ? -49.481 -9.249  25.362  1.00 48.12 ? 27   ASP J CB  1 
ATOM   8370  C  CG  . ASP J  1 27  ? -49.022 -10.686 25.217  1.00 48.82 ? 27   ASP J CG  1 
ATOM   8371  O  OD1 . ASP J  1 27  ? -48.833 -11.145 24.064  1.00 48.47 ? 27   ASP J OD1 1 
ATOM   8372  O  OD2 . ASP J  1 27  ? -48.807 -11.337 26.257  1.00 50.58 ? 27   ASP J OD2 1 
ATOM   8373  N  N   . VAL J  1 28  ? -46.162 -9.173  25.981  1.00 44.32 ? 28   VAL J N   1 
ATOM   8374  C  CA  . VAL J  1 28  ? -45.178 -9.733  26.914  1.00 44.63 ? 28   VAL J CA  1 
ATOM   8375  C  C   . VAL J  1 28  ? -44.848 -8.810  28.091  1.00 44.88 ? 28   VAL J C   1 
ATOM   8376  O  O   . VAL J  1 28  ? -44.780 -7.592  27.944  1.00 43.54 ? 28   VAL J O   1 
ATOM   8377  C  CB  . VAL J  1 28  ? -43.877 -10.136 26.172  1.00 42.49 ? 28   VAL J CB  1 
ATOM   8378  C  CG1 . VAL J  1 28  ? -43.188 -8.916  25.557  1.00 40.25 ? 28   VAL J CG1 1 
ATOM   8379  C  CG2 . VAL J  1 28  ? -42.931 -10.892 27.096  1.00 43.16 ? 28   VAL J CG2 1 
ATOM   8380  N  N   . ASN J  1 29  ? -44.673 -9.415  29.264  1.00 47.43 ? 29   ASN J N   1 
ATOM   8381  C  CA  . ASN J  1 29  ? -44.334 -8.691  30.484  1.00 47.55 ? 29   ASN J CA  1 
ATOM   8382  C  C   . ASN J  1 29  ? -42.851 -8.910  30.783  1.00 46.25 ? 29   ASN J C   1 
ATOM   8383  O  O   . ASN J  1 29  ? -42.445 -9.984  31.237  1.00 46.84 ? 29   ASN J O   1 
ATOM   8384  C  CB  . ASN J  1 29  ? -45.224 -9.148  31.646  1.00 50.55 ? 29   ASN J CB  1 
ATOM   8385  C  CG  . ASN J  1 29  ? -45.206 -8.178  32.812  1.00 51.96 ? 29   ASN J CG  1 
ATOM   8386  O  OD1 . ASN J  1 29  ? -44.300 -7.339  32.924  1.00 50.71 ? 29   ASN J OD1 1 
ATOM   8387  N  ND2 . ASN J  1 29  ? -46.203 -8.284  33.692  1.00 54.36 ? 29   ASN J ND2 1 
ATOM   8388  N  N   . CYS J  1 30  ? -42.048 -7.889  30.488  1.00 43.64 ? 30   CYS J N   1 
ATOM   8389  C  CA  . CYS J  1 30  ? -40.609 -7.955  30.681  1.00 42.32 ? 30   CYS J CA  1 
ATOM   8390  C  C   . CYS J  1 30  ? -40.160 -7.323  32.006  1.00 46.45 ? 30   CYS J C   1 
ATOM   8391  O  O   . CYS J  1 30  ? -38.971 -7.085  32.202  1.00 44.80 ? 30   CYS J O   1 
ATOM   8392  C  CB  . CYS J  1 30  ? -39.883 -7.316  29.483  1.00 38.22 ? 30   CYS J CB  1 
ATOM   8393  S  SG  . CYS J  1 30  ? -39.826 -8.356  27.981  1.00 36.15 ? 30   CYS J SG  1 
ATOM   8394  N  N   . SER J  1 31  ? -41.096 -7.063  32.921  1.00 52.05 ? 31   SER J N   1 
ATOM   8395  C  CA  . SER J  1 31  ? -40.736 -6.628  34.274  1.00 56.66 ? 31   SER J CA  1 
ATOM   8396  C  C   . SER J  1 31  ? -39.754 -7.654  34.844  1.00 59.78 ? 31   SER J C   1 
ATOM   8397  O  O   . SER J  1 31  ? -38.587 -7.342  35.096  1.00 59.07 ? 31   SER J O   1 
ATOM   8398  C  CB  . SER J  1 31  ? -41.976 -6.517  35.191  1.00 59.65 ? 31   SER J CB  1 
ATOM   8399  O  OG  . SER J  1 31  ? -42.998 -5.714  34.614  1.00 58.12 ? 31   SER J OG  1 
ATOM   8400  N  N   . VAL J  1 32  ? -40.238 -8.886  35.000  1.00 64.79 ? 32   VAL J N   1 
ATOM   8401  C  CA  . VAL J  1 32  ? -39.431 -9.995  35.504  1.00 68.30 ? 32   VAL J CA  1 
ATOM   8402  C  C   . VAL J  1 32  ? -39.311 -11.068 34.416  1.00 68.63 ? 32   VAL J C   1 
ATOM   8403  O  O   . VAL J  1 32  ? -40.282 -11.780 34.116  1.00 70.06 ? 32   VAL J O   1 
ATOM   8404  C  CB  . VAL J  1 32  ? -39.997 -10.588 36.825  1.00 72.73 ? 32   VAL J CB  1 
ATOM   8405  C  CG1 . VAL J  1 32  ? -41.494 -10.875 36.736  1.00 74.47 ? 32   VAL J CG1 1 
ATOM   8406  C  CG2 . VAL J  1 32  ? -39.228 -11.840 37.238  1.00 75.07 ? 32   VAL J CG2 1 
ATOM   8407  N  N   . MET J  1 33  ? -38.122 -11.150 33.812  1.00 64.05 ? 33   MET J N   1 
ATOM   8408  C  CA  . MET J  1 33  ? -37.799 -12.214 32.860  1.00 60.41 ? 33   MET J CA  1 
ATOM   8409  C  C   . MET J  1 33  ? -37.716 -13.574 33.561  1.00 63.06 ? 33   MET J C   1 
ATOM   8410  O  O   . MET J  1 33  ? -37.165 -13.678 34.662  1.00 65.07 ? 33   MET J O   1 
ATOM   8411  C  CB  . MET J  1 33  ? -36.469 -11.913 32.166  1.00 56.04 ? 33   MET J CB  1 
ATOM   8412  C  CG  . MET J  1 33  ? -35.789 -13.125 31.543  1.00 55.33 ? 33   MET J CG  1 
ATOM   8413  S  SD  . MET J  1 33  ? -34.575 -12.679 30.297  1.00 50.09 ? 33   MET J SD  1 
ATOM   8414  C  CE  . MET J  1 33  ? -33.534 -11.575 31.242  1.00 45.95 ? 33   MET J CE  1 
ATOM   8415  N  N   . GLY J  1 34  ? -38.259 -14.605 32.910  1.00 62.74 ? 34   GLY J N   1 
ATOM   8416  C  CA  . GLY J  1 34  ? -38.153 -15.984 33.382  1.00 64.21 ? 34   GLY J CA  1 
ATOM   8417  C  C   . GLY J  1 34  ? -36.772 -16.544 33.088  1.00 62.75 ? 34   GLY J C   1 
ATOM   8418  O  O   . GLY J  1 34  ? -35.824 -15.785 32.912  1.00 60.54 ? 34   GLY J O   1 
ATOM   8419  N  N   . PRO J  1 35  ? -36.640 -17.879 33.026  1.00 64.44 ? 35   PRO J N   1 
ATOM   8420  C  CA  . PRO J  1 35  ? -35.307 -18.440 32.767  1.00 64.24 ? 35   PRO J CA  1 
ATOM   8421  C  C   . PRO J  1 35  ? -34.747 -18.031 31.400  1.00 59.73 ? 35   PRO J C   1 
ATOM   8422  O  O   . PRO J  1 35  ? -35.486 -17.528 30.559  1.00 58.65 ? 35   PRO J O   1 
ATOM   8423  C  CB  . PRO J  1 35  ? -35.537 -19.957 32.839  1.00 67.72 ? 35   PRO J CB  1 
ATOM   8424  C  CG  . PRO J  1 35  ? -36.995 -20.143 32.584  1.00 68.61 ? 35   PRO J CG  1 
ATOM   8425  C  CD  . PRO J  1 35  ? -37.672 -18.925 33.142  1.00 67.55 ? 35   PRO J CD  1 
ATOM   8426  N  N   . GLN J  1 36  ? -33.449 -18.239 31.195  1.00 57.74 ? 36   GLN J N   1 
ATOM   8427  C  CA  . GLN J  1 36  ? -32.801 -17.866 29.936  1.00 54.04 ? 36   GLN J CA  1 
ATOM   8428  C  C   . GLN J  1 36  ? -32.519 -19.082 29.044  1.00 54.31 ? 36   GLN J C   1 
ATOM   8429  O  O   . GLN J  1 36  ? -31.794 -20.002 29.428  1.00 56.52 ? 36   GLN J O   1 
ATOM   8430  C  CB  . GLN J  1 36  ? -31.539 -17.020 30.173  1.00 52.34 ? 36   GLN J CB  1 
ATOM   8431  C  CG  . GLN J  1 36  ? -30.513 -17.536 31.177  1.00 54.62 ? 36   GLN J CG  1 
ATOM   8432  C  CD  . GLN J  1 36  ? -29.664 -16.414 31.775  1.00 53.28 ? 36   GLN J CD  1 
ATOM   8433  O  OE1 . GLN J  1 36  ? -28.434 -16.474 31.768  1.00 52.13 ? 36   GLN J OE1 1 
ATOM   8434  N  NE2 . GLN J  1 36  ? -30.324 -15.381 32.293  1.00 52.31 ? 36   GLN J NE2 1 
ATOM   8435  N  N   . GLU J  1 37  ? -33.099 -19.050 27.845  1.00 51.85 ? 37   GLU J N   1 
ATOM   8436  C  CA  . GLU J  1 37  ? -33.162 -20.198 26.937  1.00 52.48 ? 37   GLU J CA  1 
ATOM   8437  C  C   . GLU J  1 37  ? -32.225 -20.105 25.724  1.00 49.27 ? 37   GLU J C   1 
ATOM   8438  O  O   . GLU J  1 37  ? -32.157 -21.039 24.925  1.00 49.59 ? 37   GLU J O   1 
ATOM   8439  C  CB  . GLU J  1 37  ? -34.597 -20.335 26.415  1.00 53.51 ? 37   GLU J CB  1 
ATOM   8440  C  CG  . GLU J  1 37  ? -35.648 -20.567 27.497  1.00 56.66 ? 37   GLU J CG  1 
ATOM   8441  C  CD  . GLU J  1 37  ? -36.800 -19.570 27.437  1.00 56.38 ? 37   GLU J CD  1 
ATOM   8442  O  OE1 . GLU J  1 37  ? -37.219 -19.183 26.315  1.00 54.62 ? 37   GLU J OE1 1 
ATOM   8443  O  OE2 . GLU J  1 37  ? -37.288 -19.172 28.524  1.00 57.86 ? 37   GLU J OE2 1 
ATOM   8444  N  N   . LYS J  1 38  ? -31.524 -18.985 25.573  1.00 45.71 ? 38   LYS J N   1 
ATOM   8445  C  CA  . LYS J  1 38  ? -30.686 -18.757 24.401  1.00 42.90 ? 38   LYS J CA  1 
ATOM   8446  C  C   . LYS J  1 38  ? -29.728 -17.599 24.664  1.00 39.49 ? 38   LYS J C   1 
ATOM   8447  O  O   . LYS J  1 38  ? -30.142 -16.550 25.153  1.00 37.45 ? 38   LYS J O   1 
ATOM   8448  C  CB  . LYS J  1 38  ? -31.572 -18.442 23.195  1.00 42.30 ? 38   LYS J CB  1 
ATOM   8449  C  CG  . LYS J  1 38  ? -30.829 -18.104 21.903  1.00 41.77 ? 38   LYS J CG  1 
ATOM   8450  C  CD  . LYS J  1 38  ? -30.234 -19.342 21.244  1.00 43.89 ? 38   LYS J CD  1 
ATOM   8451  C  CE  . LYS J  1 38  ? -29.724 -19.018 19.847  1.00 43.16 ? 38   LYS J CE  1 
ATOM   8452  N  NZ  . LYS J  1 38  ? -29.399 -20.245 19.069  1.00 45.56 ? 38   LYS J NZ  1 
ATOM   8453  N  N   . LYS J  1 39  ? -28.449 -17.795 24.359  1.00 37.96 ? 39   LYS J N   1 
ATOM   8454  C  CA  . LYS J  1 39  ? -27.494 -16.706 24.417  1.00 35.48 ? 39   LYS J CA  1 
ATOM   8455  C  C   . LYS J  1 39  ? -27.177 -16.233 23.007  1.00 32.81 ? 39   LYS J C   1 
ATOM   8456  O  O   . LYS J  1 39  ? -26.946 -17.042 22.106  1.00 33.77 ? 39   LYS J O   1 
ATOM   8457  C  CB  . LYS J  1 39  ? -26.217 -17.103 25.179  1.00 37.53 ? 39   LYS J CB  1 
ATOM   8458  C  CG  . LYS J  1 39  ? -25.167 -17.866 24.373  1.00 38.88 ? 39   LYS J CG  1 
ATOM   8459  C  CD  . LYS J  1 39  ? -23.888 -18.081 25.175  1.00 40.70 ? 39   LYS J CD  1 
ATOM   8460  C  CE  . LYS J  1 39  ? -23.135 -16.774 25.388  1.00 39.20 ? 39   LYS J CE  1 
ATOM   8461  N  NZ  . LYS J  1 39  ? -21.734 -16.999 25.853  1.00 41.27 ? 39   LYS J NZ  1 
ATOM   8462  N  N   . VAL J  1 40  ? -27.188 -14.915 22.829  1.00 29.72 ? 40   VAL J N   1 
ATOM   8463  C  CA  . VAL J  1 40  ? -26.849 -14.276 21.564  1.00 27.67 ? 40   VAL J CA  1 
ATOM   8464  C  C   . VAL J  1 40  ? -25.759 -13.241 21.813  1.00 26.59 ? 40   VAL J C   1 
ATOM   8465  O  O   . VAL J  1 40  ? -25.906 -12.373 22.686  1.00 25.69 ? 40   VAL J O   1 
ATOM   8466  C  CB  . VAL J  1 40  ? -28.073 -13.567 20.959  1.00 25.91 ? 40   VAL J CB  1 
ATOM   8467  C  CG1 . VAL J  1 40  ? -27.700 -12.840 19.673  1.00 24.65 ? 40   VAL J CG1 1 
ATOM   8468  C  CG2 . VAL J  1 40  ? -29.197 -14.566 20.712  1.00 26.80 ? 40   VAL J CG2 1 
ATOM   8469  N  N   . VAL J  1 41  ? -24.669 -13.340 21.053  1.00 26.49 ? 41   VAL J N   1 
ATOM   8470  C  CA  . VAL J  1 41  ? -23.526 -12.433 21.188  1.00 25.90 ? 41   VAL J CA  1 
ATOM   8471  C  C   . VAL J  1 41  ? -23.571 -11.364 20.082  1.00 23.97 ? 41   VAL J C   1 
ATOM   8472  O  O   . VAL J  1 41  ? -23.862 -11.666 18.918  1.00 23.86 ? 41   VAL J O   1 
ATOM   8473  C  CB  . VAL J  1 41  ? -22.191 -13.215 21.147  1.00 27.96 ? 41   VAL J CB  1 
ATOM   8474  C  CG1 . VAL J  1 41  ? -20.997 -12.277 21.314  1.00 28.01 ? 41   VAL J CG1 1 
ATOM   8475  C  CG2 . VAL J  1 41  ? -22.169 -14.275 22.233  1.00 29.84 ? 41   VAL J CG2 1 
ATOM   8476  N  N   . VAL J  1 42  ? -23.302 -10.116 20.456  1.00 22.66 ? 42   VAL J N   1 
ATOM   8477  C  CA  . VAL J  1 42  ? -23.343 -8.995  19.526  1.00 21.10 ? 42   VAL J CA  1 
ATOM   8478  C  C   . VAL J  1 42  ? -22.116 -8.108  19.714  1.00 21.11 ? 42   VAL J C   1 
ATOM   8479  O  O   . VAL J  1 42  ? -21.642 -7.892  20.823  1.00 21.24 ? 42   VAL J O   1 
ATOM   8480  C  CB  . VAL J  1 42  ? -24.627 -8.158  19.706  1.00 19.69 ? 42   VAL J CB  1 
ATOM   8481  C  CG1 . VAL J  1 42  ? -24.724 -7.063  18.649  1.00 18.77 ? 42   VAL J CG1 1 
ATOM   8482  C  CG2 . VAL J  1 42  ? -25.859 -9.038  19.594  1.00 19.84 ? 42   VAL J CG2 1 
ATOM   8483  N  N   . TYR J  1 43  ? -21.602 -7.596  18.605  1.00 20.96 ? 43   TYR J N   1 
ATOM   8484  C  CA  . TYR J  1 43  ? -20.434 -6.745  18.633  1.00 21.27 ? 43   TYR J CA  1 
ATOM   8485  C  C   . TYR J  1 43  ? -20.824 -5.377  18.131  1.00 19.58 ? 43   TYR J C   1 
ATOM   8486  O  O   . TYR J  1 43  ? -21.446 -5.253  17.094  1.00 19.04 ? 43   TYR J O   1 
ATOM   8487  C  CB  . TYR J  1 43  ? -19.337 -7.330  17.754  1.00 23.21 ? 43   TYR J CB  1 
ATOM   8488  C  CG  . TYR J  1 43  ? -18.963 -8.756  18.085  1.00 25.07 ? 43   TYR J CG  1 
ATOM   8489  C  CD1 . TYR J  1 43  ? -17.981 -9.048  19.030  1.00 26.63 ? 43   TYR J CD1 1 
ATOM   8490  C  CD2 . TYR J  1 43  ? -19.589 -9.814  17.448  1.00 25.59 ? 43   TYR J CD2 1 
ATOM   8491  C  CE1 . TYR J  1 43  ? -17.637 -10.358 19.325  1.00 28.56 ? 43   TYR J CE1 1 
ATOM   8492  C  CE2 . TYR J  1 43  ? -19.251 -11.126 17.728  1.00 27.65 ? 43   TYR J CE2 1 
ATOM   8493  C  CZ  . TYR J  1 43  ? -18.277 -11.394 18.665  1.00 29.01 ? 43   TYR J CZ  1 
ATOM   8494  O  OH  . TYR J  1 43  ? -17.963 -12.704 18.935  1.00 31.40 ? 43   TYR J OH  1 
ATOM   8495  N  N   . LEU J  1 44  ? -20.440 -4.347  18.858  1.00 19.03 ? 44   LEU J N   1 
ATOM   8496  C  CA  . LEU J  1 44  ? -20.754 -2.994  18.479  1.00 17.95 ? 44   LEU J CA  1 
ATOM   8497  C  C   . LEU J  1 44  ? -19.468 -2.196  18.223  1.00 18.93 ? 44   LEU J C   1 
ATOM   8498  O  O   . LEU J  1 44  ? -18.655 -1.977  19.121  1.00 19.70 ? 44   LEU J O   1 
ATOM   8499  C  CB  . LEU J  1 44  ? -21.609 -2.343  19.572  1.00 16.95 ? 44   LEU J CB  1 
ATOM   8500  C  CG  . LEU J  1 44  ? -22.907 -3.079  19.967  1.00 16.13 ? 44   LEU J CG  1 
ATOM   8501  C  CD1 . LEU J  1 44  ? -23.628 -2.280  21.038  1.00 15.59 ? 44   LEU J CD1 1 
ATOM   8502  C  CD2 . LEU J  1 44  ? -23.839 -3.290  18.790  1.00 15.37 ? 44   LEU J CD2 1 
ATOM   8503  N  N   . GLN J  1 45  ? -19.299 -1.784  16.974  1.00 19.11 ? 45   GLN J N   1 
ATOM   8504  C  CA  . GLN J  1 45  ? -18.167 -0.998  16.537  1.00 20.26 ? 45   GLN J CA  1 
ATOM   8505  C  C   . GLN J  1 45  ? -18.664 0.355   16.043  1.00 19.44 ? 45   GLN J C   1 
ATOM   8506  O  O   . GLN J  1 45  ? -19.807 0.488   15.562  1.00 18.09 ? 45   GLN J O   1 
ATOM   8507  C  CB  . GLN J  1 45  ? -17.425 -1.723  15.423  1.00 21.93 ? 45   GLN J CB  1 
ATOM   8508  C  CG  . GLN J  1 45  ? -17.053 -3.161  15.778  1.00 23.00 ? 45   GLN J CG  1 
ATOM   8509  C  CD  . GLN J  1 45  ? -16.219 -3.868  14.706  1.00 25.18 ? 45   GLN J CD  1 
ATOM   8510  O  OE1 . GLN J  1 45  ? -16.202 -3.475  13.528  1.00 25.64 ? 45   GLN J OE1 1 
ATOM   8511  N  NE2 . GLN J  1 45  ? -15.509 -4.918  15.117  1.00 26.85 ? 45   GLN J NE2 1 
ATOM   8512  N  N   . LYS J  1 46  ? -17.804 1.363   16.186  1.00 20.23 ? 46   LYS J N   1 
ATOM   8513  C  CA  . LYS J  1 46  ? -18.125 2.705   15.747  1.00 19.99 ? 46   LYS J CA  1 
ATOM   8514  C  C   . LYS J  1 46  ? -18.084 2.774   14.217  1.00 20.69 ? 46   LYS J C   1 
ATOM   8515  O  O   . LYS J  1 46  ? -17.375 2.003   13.583  1.00 21.78 ? 46   LYS J O   1 
ATOM   8516  C  CB  . LYS J  1 46  ? -17.191 3.734   16.402  1.00 21.10 ? 46   LYS J CB  1 
ATOM   8517  C  CG  . LYS J  1 46  ? -15.710 3.603   16.100  1.00 23.18 ? 46   LYS J CG  1 
ATOM   8518  C  CD  . LYS J  1 46  ? -15.279 4.379   14.858  1.00 24.55 ? 46   LYS J CD  1 
ATOM   8519  C  CE  . LYS J  1 46  ? -13.763 4.349   14.700  1.00 26.96 ? 46   LYS J CE  1 
ATOM   8520  N  NZ  . LYS J  1 46  ? -13.338 4.682   13.315  1.00 28.54 ? 46   LYS J NZ  1 
ATOM   8521  N  N   . LEU J  1 47  ? -18.846 3.673   13.609  1.00 20.26 ? 47   LEU J N   1 
ATOM   8522  C  CA  . LEU J  1 47  ? -19.699 4.635   14.296  1.00 19.19 ? 47   LEU J CA  1 
ATOM   8523  C  C   . LEU J  1 47  ? -21.072 4.073   14.628  1.00 17.73 ? 47   LEU J C   1 
ATOM   8524  O  O   . LEU J  1 47  ? -21.680 4.487   15.613  1.00 16.90 ? 47   LEU J O   1 
ATOM   8525  C  CB  . LEU J  1 47  ? -19.867 5.882   13.426  1.00 19.88 ? 47   LEU J CB  1 
ATOM   8526  C  CG  . LEU J  1 47  ? -18.593 6.696   13.265  1.00 21.65 ? 47   LEU J CG  1 
ATOM   8527  C  CD1 . LEU J  1 47  ? -18.688 7.639   12.079  1.00 22.85 ? 47   LEU J CD1 1 
ATOM   8528  C  CD2 . LEU J  1 47  ? -18.301 7.457   14.539  1.00 21.55 ? 47   LEU J CD2 1 
ATOM   8529  N  N   . ASP J  1 48  ? -21.585 3.161   13.801  1.00 17.67 ? 48   ASP J N   1 
ATOM   8530  C  CA  . ASP J  1 48  ? -22.898 2.585   14.068  1.00 16.51 ? 48   ASP J CA  1 
ATOM   8531  C  C   . ASP J  1 48  ? -23.077 1.136   13.600  1.00 16.55 ? 48   ASP J C   1 
ATOM   8532  O  O   . ASP J  1 48  ? -24.186 0.702   13.339  1.00 15.85 ? 48   ASP J O   1 
ATOM   8533  C  CB  . ASP J  1 48  ? -23.994 3.494   13.483  1.00 16.33 ? 48   ASP J CB  1 
ATOM   8534  C  CG  . ASP J  1 48  ? -24.104 3.381   11.992  1.00 17.41 ? 48   ASP J CG  1 
ATOM   8535  O  OD1 . ASP J  1 48  ? -23.057 3.231   11.319  1.00 18.88 ? 48   ASP J OD1 1 
ATOM   8536  O  OD2 . ASP J  1 48  ? -25.243 3.437   11.468  1.00 17.77 ? 48   ASP J OD2 1 
ATOM   8537  N  N   . THR J  1 49  ? -22.000 0.374   13.543  1.00 17.60 ? 49   THR J N   1 
ATOM   8538  C  CA  . THR J  1 49  ? -22.073 -0.972  13.013  1.00 18.19 ? 49   THR J CA  1 
ATOM   8539  C  C   . THR J  1 49  ? -22.322 -1.961  14.132  1.00 17.71 ? 49   THR J C   1 
ATOM   8540  O  O   . THR J  1 49  ? -21.692 -1.893  15.182  1.00 17.57 ? 49   THR J O   1 
ATOM   8541  C  CB  . THR J  1 49  ? -20.779 -1.373  12.266  1.00 19.98 ? 49   THR J CB  1 
ATOM   8542  O  OG1 . THR J  1 49  ? -20.591 -0.518  11.136  1.00 21.28 ? 49   THR J OG1 1 
ATOM   8543  C  CG2 . THR J  1 49  ? -20.858 -2.819  11.792  1.00 20.61 ? 49   THR J CG2 1 
ATOM   8544  N  N   . ALA J  1 50  ? -23.245 -2.885  13.887  1.00 17.82 ? 50   ALA J N   1 
ATOM   8545  C  CA  . ALA J  1 50  ? -23.476 -4.012  14.770  1.00 18.23 ? 50   ALA J CA  1 
ATOM   8546  C  C   . ALA J  1 50  ? -23.243 -5.273  13.970  1.00 19.99 ? 50   ALA J C   1 
ATOM   8547  O  O   . ALA J  1 50  ? -23.627 -5.337  12.803  1.00 20.35 ? 50   ALA J O   1 
ATOM   8548  C  CB  . ALA J  1 50  ? -24.899 -3.984  15.306  1.00 17.15 ? 50   ALA J CB  1 
ATOM   8549  N  N   . TYR J  1 51  ? -22.611 -6.272  14.575  1.00 21.81 ? 51   TYR J N   1 
ATOM   8550  C  CA  . TYR J  1 51  ? -22.500 -7.565  13.910  1.00 24.13 ? 51   TYR J CA  1 
ATOM   8551  C  C   . TYR J  1 51  ? -22.552 -8.750  14.865  1.00 25.39 ? 51   TYR J C   1 
ATOM   8552  O  O   . TYR J  1 51  ? -22.521 -8.567  16.084  1.00 24.66 ? 51   TYR J O   1 
ATOM   8553  C  CB  . TYR J  1 51  ? -21.304 -7.580  12.932  1.00 26.14 ? 51   TYR J CB  1 
ATOM   8554  C  CG  . TYR J  1 51  ? -19.938 -7.946  13.448  1.00 27.83 ? 51   TYR J CG  1 
ATOM   8555  C  CD1 . TYR J  1 51  ? -19.095 -6.994  13.997  1.00 27.90 ? 51   TYR J CD1 1 
ATOM   8556  C  CD2 . TYR J  1 51  ? -19.448 -9.244  13.302  1.00 30.52 ? 51   TYR J CD2 1 
ATOM   8557  C  CE1 . TYR J  1 51  ? -17.816 -7.335  14.446  1.00 29.91 ? 51   TYR J CE1 1 
ATOM   8558  C  CE2 . TYR J  1 51  ? -18.175 -9.595  13.736  1.00 31.97 ? 51   TYR J CE2 1 
ATOM   8559  C  CZ  . TYR J  1 51  ? -17.357 -8.642  14.313  1.00 31.84 ? 51   TYR J CZ  1 
ATOM   8560  O  OH  . TYR J  1 51  ? -16.083 -9.004  14.740  1.00 34.08 ? 51   TYR J OH  1 
ATOM   8561  N  N   . ASP J  1 52  ? -22.732 -9.947  14.299  1.00 27.93 ? 52   ASP J N   1 
ATOM   8562  C  CA  . ASP J  1 52  ? -22.855 -11.193 15.085  1.00 29.87 ? 52   ASP J CA  1 
ATOM   8563  C  C   . ASP J  1 52  ? -21.866 -12.244 14.601  1.00 33.17 ? 52   ASP J C   1 
ATOM   8564  O  O   . ASP J  1 52  ? -21.153 -12.016 13.630  1.00 35.06 ? 52   ASP J O   1 
ATOM   8565  C  CB  . ASP J  1 52  ? -24.288 -11.745 15.044  1.00 29.63 ? 52   ASP J CB  1 
ATOM   8566  C  CG  . ASP J  1 52  ? -24.689 -12.263 13.666  1.00 30.33 ? 52   ASP J CG  1 
ATOM   8567  O  OD1 . ASP J  1 52  ? -23.859 -12.209 12.721  1.00 32.76 ? 52   ASP J OD1 1 
ATOM   8568  O  OD2 . ASP J  1 52  ? -25.847 -12.717 13.518  1.00 29.86 ? 52   ASP J OD2 1 
ATOM   8569  N  N   . ASP J  1 53  ? -21.826 -13.397 15.271  1.00 35.64 ? 53   ASP J N   1 
ATOM   8570  C  CA  . ASP J  1 53  ? -20.808 -14.432 14.985  1.00 38.17 ? 53   ASP J CA  1 
ATOM   8571  C  C   . ASP J  1 53  ? -20.941 -15.071 13.607  1.00 40.09 ? 53   ASP J C   1 
ATOM   8572  O  O   . ASP J  1 53  ? -19.965 -15.593 13.077  1.00 43.56 ? 53   ASP J O   1 
ATOM   8573  C  CB  . ASP J  1 53  ? -20.842 -15.523 16.057  1.00 39.38 ? 53   ASP J CB  1 
ATOM   8574  C  CG  . ASP J  1 53  ? -20.378 -15.021 17.419  1.00 38.75 ? 53   ASP J CG  1 
ATOM   8575  O  OD1 . ASP J  1 53  ? -19.342 -14.324 17.475  1.00 37.48 ? 53   ASP J OD1 1 
ATOM   8576  O  OD2 . ASP J  1 53  ? -21.044 -15.335 18.433  1.00 38.15 ? 53   ASP J OD2 1 
ATOM   8577  N  N   . LEU J  1 54  ? -22.138 -15.028 13.025  1.00 39.90 ? 54   LEU J N   1 
ATOM   8578  C  CA  . LEU J  1 54  ? -22.357 -15.531 11.656  1.00 41.23 ? 54   LEU J CA  1 
ATOM   8579  C  C   . LEU J  1 54  ? -21.879 -14.586 10.552  1.00 41.49 ? 54   LEU J C   1 
ATOM   8580  O  O   . LEU J  1 54  ? -21.881 -14.958 9.375   1.00 44.40 ? 54   LEU J O   1 
ATOM   8581  C  CB  . LEU J  1 54  ? -23.830 -15.870 11.440  1.00 40.41 ? 54   LEU J CB  1 
ATOM   8582  C  CG  . LEU J  1 54  ? -24.214 -17.205 12.078  1.00 41.83 ? 54   LEU J CG  1 
ATOM   8583  C  CD1 . LEU J  1 54  ? -25.724 -17.321 12.255  1.00 40.82 ? 54   LEU J CD1 1 
ATOM   8584  C  CD2 . LEU J  1 54  ? -23.653 -18.360 11.250  1.00 43.94 ? 54   LEU J CD2 1 
ATOM   8585  N  N   . GLY J  1 55  ? -21.467 -13.376 10.918  1.00 39.47 ? 55   GLY J N   1 
ATOM   8586  C  CA  . GLY J  1 55  ? -20.903 -12.438 9.949   1.00 39.84 ? 55   GLY J CA  1 
ATOM   8587  C  C   . GLY J  1 55  ? -21.967 -11.603 9.260   1.00 37.73 ? 55   GLY J C   1 
ATOM   8588  O  O   . GLY J  1 55  ? -21.775 -11.173 8.116   1.00 39.14 ? 55   GLY J O   1 
ATOM   8589  N  N   . ASN J  1 56  ? -23.083 -11.391 9.961   1.00 34.34 ? 56   ASN J N   1 
ATOM   8590  C  CA  . ASN J  1 56  ? -24.153 -10.487 9.525   1.00 32.43 ? 56   ASN J CA  1 
ATOM   8591  C  C   . ASN J  1 56  ? -24.000 -9.124  10.178  1.00 28.80 ? 56   ASN J C   1 
ATOM   8592  O  O   . ASN J  1 56  ? -23.661 -9.034  11.367  1.00 27.42 ? 56   ASN J O   1 
ATOM   8593  C  CB  . ASN J  1 56  ? -25.513 -11.033 9.938   1.00 31.93 ? 56   ASN J CB  1 
ATOM   8594  C  CG  . ASN J  1 56  ? -25.651 -12.496 9.636   1.00 34.62 ? 56   ASN J CG  1 
ATOM   8595  O  OD1 . ASN J  1 56  ? -25.618 -13.318 10.544  1.00 36.83 ? 56   ASN J OD1 1 
ATOM   8596  N  ND2 . ASN J  1 56  ? -25.767 -12.840 8.349   1.00 37.01 ? 56   ASN J ND2 1 
ATOM   8597  N  N   . SER J  1 57  ? -24.275 -8.069  9.424   1.00 26.52 ? 57   SER J N   1 
ATOM   8598  C  CA  . SER J  1 57  ? -24.094 -6.727  9.953   1.00 24.36 ? 57   SER J CA  1 
ATOM   8599  C  C   . SER J  1 57  ? -25.413 -5.954  10.034  1.00 21.70 ? 57   SER J C   1 
ATOM   8600  O  O   . SER J  1 57  ? -26.356 -6.193  9.291   1.00 21.43 ? 57   SER J O   1 
ATOM   8601  C  CB  . SER J  1 57  ? -23.018 -5.967  9.168   1.00 25.57 ? 57   SER J CB  1 
ATOM   8602  O  OG  . SER J  1 57  ? -23.390 -5.771  7.825   1.00 26.79 ? 57   SER J OG  1 
ATOM   8603  N  N   . GLY J  1 58  ? -25.470 -5.050  10.993  1.00 19.51 ? 58   GLY J N   1 
ATOM   8604  C  CA  . GLY J  1 58  ? -26.644 -4.227  11.205  1.00 17.63 ? 58   GLY J CA  1 
ATOM   8605  C  C   . GLY J  1 58  ? -26.221 -2.916  11.832  1.00 16.55 ? 58   GLY J C   1 
ATOM   8606  O  O   . GLY J  1 58  ? -25.066 -2.494  11.719  1.00 16.97 ? 58   GLY J O   1 
ATOM   8607  N  N   . HIS J  1 59  ? -27.142 -2.276  12.528  1.00 15.02 ? 59   HIS J N   1 
ATOM   8608  C  CA  . HIS J  1 59  ? -26.885 -0.962  12.997  1.00 14.40 ? 59   HIS J CA  1 
ATOM   8609  C  C   . HIS J  1 59  ? -27.276 -0.820  14.469  1.00 13.25 ? 59   HIS J C   1 
ATOM   8610  O  O   . HIS J  1 59  ? -28.044 -1.609  15.007  1.00 12.80 ? 59   HIS J O   1 
ATOM   8611  C  CB  . HIS J  1 59  ? -27.569 0.045   12.064  1.00 14.64 ? 59   HIS J CB  1 
ATOM   8612  C  CG  . HIS J  1 59  ? -26.988 0.072   10.682  1.00 16.00 ? 59   HIS J CG  1 
ATOM   8613  N  ND1 . HIS J  1 59  ? -27.641 -0.444  9.582   1.00 16.69 ? 59   HIS J ND1 1 
ATOM   8614  C  CD2 . HIS J  1 59  ? -25.798 0.537   10.220  1.00 17.16 ? 59   HIS J CD2 1 
ATOM   8615  C  CE1 . HIS J  1 59  ? -26.895 -0.283  8.503   1.00 18.00 ? 59   HIS J CE1 1 
ATOM   8616  N  NE2 . HIS J  1 59  ? -25.771 0.314   8.862   1.00 18.36 ? 59   HIS J NE2 1 
ATOM   8617  N  N   . PHE J  1 60  ? -26.676 0.154   15.135  1.00 12.89 ? 60   PHE J N   1 
ATOM   8618  C  CA  . PHE J  1 60  ? -27.064 0.478   16.482  1.00 12.20 ? 60   PHE J CA  1 
ATOM   8619  C  C   . PHE J  1 60  ? -26.960 1.973   16.721  1.00 12.14 ? 60   PHE J C   1 
ATOM   8620  O  O   . PHE J  1 60  ? -26.251 2.699   16.013  1.00 12.69 ? 60   PHE J O   1 
ATOM   8621  C  CB  . PHE J  1 60  ? -26.192 -0.270  17.485  1.00 12.41 ? 60   PHE J CB  1 
ATOM   8622  C  CG  . PHE J  1 60  ? -24.832 0.341   17.678  1.00 13.05 ? 60   PHE J CG  1 
ATOM   8623  C  CD1 . PHE J  1 60  ? -24.624 1.325   18.641  1.00 13.04 ? 60   PHE J CD1 1 
ATOM   8624  C  CD2 . PHE J  1 60  ? -23.758 -0.065  16.901  1.00 13.91 ? 60   PHE J CD2 1 
ATOM   8625  C  CE1 . PHE J  1 60  ? -23.382 1.891   18.815  1.00 13.83 ? 60   PHE J CE1 1 
ATOM   8626  C  CE2 . PHE J  1 60  ? -22.514 0.485   17.083  1.00 14.78 ? 60   PHE J CE2 1 
ATOM   8627  C  CZ  . PHE J  1 60  ? -22.318 1.467   18.045  1.00 14.69 ? 60   PHE J CZ  1 
ATOM   8628  N  N   . THR J  1 61  ? -27.656 2.410   17.760  1.00 11.70 ? 61   THR J N   1 
ATOM   8629  C  CA  . THR J  1 61  ? -27.524 3.762   18.258  1.00 11.91 ? 61   THR J CA  1 
ATOM   8630  C  C   . THR J  1 61  ? -27.645 3.758   19.749  1.00 11.95 ? 61   THR J C   1 
ATOM   8631  O  O   . THR J  1 61  ? -28.387 2.971   20.321  1.00 11.76 ? 61   THR J O   1 
ATOM   8632  C  CB  . THR J  1 61  ? -28.579 4.714   17.659  1.00 11.91 ? 61   THR J CB  1 
ATOM   8633  O  OG1 . THR J  1 61  ? -28.308 6.043   18.097  1.00 12.39 ? 61   THR J OG1 1 
ATOM   8634  C  CG2 . THR J  1 61  ? -30.008 4.309   18.039  1.00 11.58 ? 61   THR J CG2 1 
ATOM   8635  N  N   . ILE J  1 62  ? -26.892 4.635   20.393  1.00 12.58 ? 62   ILE J N   1 
ATOM   8636  C  CA  . ILE J  1 62  ? -27.136 4.914   21.790  1.00 12.89 ? 62   ILE J CA  1 
ATOM   8637  C  C   . ILE J  1 62  ? -28.284 5.919   21.788  1.00 13.05 ? 62   ILE J C   1 
ATOM   8638  O  O   . ILE J  1 62  ? -28.486 6.666   20.829  1.00 13.11 ? 62   ILE J O   1 
ATOM   8639  C  CB  . ILE J  1 62  ? -25.866 5.409   22.510  1.00 13.70 ? 62   ILE J CB  1 
ATOM   8640  C  CG1 . ILE J  1 62  ? -25.975 5.147   24.006  1.00 14.28 ? 62   ILE J CG1 1 
ATOM   8641  C  CG2 . ILE J  1 62  ? -25.583 6.879   22.221  1.00 14.28 ? 62   ILE J CG2 1 
ATOM   8642  C  CD1 . ILE J  1 62  ? -24.789 5.621   24.813  1.00 15.31 ? 62   ILE J CD1 1 
ATOM   8643  N  N   . ILE J  1 63  ? -29.082 5.872   22.838  1.00 13.45 ? 63   ILE J N   1 
ATOM   8644  C  CA  . ILE J  1 63  ? -30.219 6.751   22.993  1.00 13.96 ? 63   ILE J CA  1 
ATOM   8645  C  C   . ILE J  1 63  ? -29.842 7.692   24.119  1.00 15.08 ? 63   ILE J C   1 
ATOM   8646  O  O   . ILE J  1 63  ? -29.973 7.347   25.299  1.00 15.65 ? 63   ILE J O   1 
ATOM   8647  C  CB  . ILE J  1 63  ? -31.473 5.914   23.297  1.00 13.89 ? 63   ILE J CB  1 
ATOM   8648  C  CG1 . ILE J  1 63  ? -31.795 5.048   22.062  1.00 13.14 ? 63   ILE J CG1 1 
ATOM   8649  C  CG2 . ILE J  1 63  ? -32.638 6.808   23.714  1.00 14.70 ? 63   ILE J CG2 1 
ATOM   8650  C  CD1 . ILE J  1 63  ? -32.390 3.693   22.372  1.00 13.05 ? 63   ILE J CD1 1 
ATOM   8651  N  N   . TYR J  1 64  ? -29.302 8.846   23.741  1.00 15.70 ? 64   TYR J N   1 
ATOM   8652  C  CA  . TYR J  1 64  ? -28.762 9.814   24.682  1.00 17.07 ? 64   TYR J CA  1 
ATOM   8653  C  C   . TYR J  1 64  ? -27.745 9.149   25.635  1.00 17.41 ? 64   TYR J C   1 
ATOM   8654  O  O   . TYR J  1 64  ? -26.649 8.792   25.212  1.00 17.57 ? 64   TYR J O   1 
ATOM   8655  C  CB  . TYR J  1 64  ? -29.918 10.533  25.409  1.00 18.10 ? 64   TYR J CB  1 
ATOM   8656  C  CG  . TYR J  1 64  ? -29.536 11.769  26.208  1.00 19.62 ? 64   TYR J CG  1 
ATOM   8657  C  CD1 . TYR J  1 64  ? -29.021 12.896  25.586  1.00 20.24 ? 64   TYR J CD1 1 
ATOM   8658  C  CD2 . TYR J  1 64  ? -29.726 11.817  27.586  1.00 20.78 ? 64   TYR J CD2 1 
ATOM   8659  C  CE1 . TYR J  1 64  ? -28.686 14.035  26.313  1.00 21.86 ? 64   TYR J CE1 1 
ATOM   8660  C  CE2 . TYR J  1 64  ? -29.401 12.948  28.317  1.00 22.36 ? 64   TYR J CE2 1 
ATOM   8661  C  CZ  . TYR J  1 64  ? -28.878 14.051  27.673  1.00 22.95 ? 64   TYR J CZ  1 
ATOM   8662  O  OH  . TYR J  1 64  ? -28.547 15.155  28.401  1.00 24.83 ? 64   TYR J OH  1 
ATOM   8663  N  N   . ASN J  1 65  ? -28.100 8.961   26.900  1.00 18.19 ? 65   ASN J N   1 
ATOM   8664  C  CA  . ASN J  1 65  ? -27.199 8.325   27.872  1.00 18.78 ? 65   ASN J CA  1 
ATOM   8665  C  C   . ASN J  1 65  ? -27.901 7.187   28.607  1.00 18.84 ? 65   ASN J C   1 
ATOM   8666  O  O   . ASN J  1 65  ? -27.440 6.730   29.663  1.00 19.81 ? 65   ASN J O   1 
ATOM   8667  C  CB  . ASN J  1 65  ? -26.695 9.365   28.870  1.00 20.31 ? 65   ASN J CB  1 
ATOM   8668  C  CG  . ASN J  1 65  ? -27.822 10.001  29.702  1.00 21.28 ? 65   ASN J CG  1 
ATOM   8669  O  OD1 . ASN J  1 65  ? -28.972 9.560   29.670  1.00 20.93 ? 65   ASN J OD1 1 
ATOM   8670  N  ND2 . ASN J  1 65  ? -27.486 11.041  30.455  1.00 22.64 ? 65   ASN J ND2 1 
ATOM   8671  N  N   . GLN J  1 66  ? -29.012 6.733   28.025  1.00 18.06 ? 66   GLN J N   1 
ATOM   8672  C  CA  . GLN J  1 66  ? -30.018 5.932   28.726  1.00 18.49 ? 66   GLN J CA  1 
ATOM   8673  C  C   . GLN J  1 66  ? -29.954 4.448   28.390  1.00 17.67 ? 66   GLN J C   1 
ATOM   8674  O  O   . GLN J  1 66  ? -30.145 3.595   29.251  1.00 18.62 ? 66   GLN J O   1 
ATOM   8675  C  CB  . GLN J  1 66  ? -31.400 6.447   28.341  1.00 18.64 ? 66   GLN J CB  1 
ATOM   8676  C  CG  . GLN J  1 66  ? -31.684 7.860   28.802  1.00 19.94 ? 66   GLN J CG  1 
ATOM   8677  C  CD  . GLN J  1 66  ? -32.085 7.913   30.268  1.00 21.81 ? 66   GLN J CD  1 
ATOM   8678  O  OE1 . GLN J  1 66  ? -33.150 7.428   30.631  1.00 22.94 ? 66   GLN J OE1 1 
ATOM   8679  N  NE2 . GLN J  1 66  ? -31.239 8.492   31.109  1.00 22.75 ? 66   GLN J NE2 1 
ATOM   8680  N  N   . GLY J  1 67  ? -29.727 4.160   27.115  1.00 16.18 ? 67   GLY J N   1 
ATOM   8681  C  CA  . GLY J  1 67  ? -29.724 2.813   26.589  1.00 15.39 ? 67   GLY J CA  1 
ATOM   8682  C  C   . GLY J  1 67  ? -29.379 2.816   25.109  1.00 14.20 ? 67   GLY J C   1 
ATOM   8683  O  O   . GLY J  1 67  ? -28.773 3.763   24.586  1.00 13.86 ? 67   GLY J O   1 
ATOM   8684  N  N   . PHE J  1 68  ? -29.761 1.746   24.432  1.00 13.67 ? 68   PHE J N   1 
ATOM   8685  C  CA  . PHE J  1 68  ? -29.392 1.544   23.052  1.00 12.94 ? 68   PHE J CA  1 
ATOM   8686  C  C   . PHE J  1 68  ? -30.498 0.818   22.327  1.00 12.64 ? 68   PHE J C   1 
ATOM   8687  O  O   . PHE J  1 68  ? -31.302 0.130   22.947  1.00 12.82 ? 68   PHE J O   1 
ATOM   8688  C  CB  . PHE J  1 68  ? -28.107 0.711   22.980  1.00 13.21 ? 68   PHE J CB  1 
ATOM   8689  C  CG  . PHE J  1 68  ? -28.222 -0.629  23.647  1.00 13.71 ? 68   PHE J CG  1 
ATOM   8690  C  CD1 . PHE J  1 68  ? -28.897 -1.669  23.028  1.00 13.57 ? 68   PHE J CD1 1 
ATOM   8691  C  CD2 . PHE J  1 68  ? -27.683 -0.834  24.888  1.00 14.73 ? 68   PHE J CD2 1 
ATOM   8692  C  CE1 . PHE J  1 68  ? -29.038 -2.892  23.654  1.00 14.42 ? 68   PHE J CE1 1 
ATOM   8693  C  CE2 . PHE J  1 68  ? -27.811 -2.055  25.531  1.00 15.54 ? 68   PHE J CE2 1 
ATOM   8694  C  CZ  . PHE J  1 68  ? -28.480 -3.089  24.911  1.00 15.37 ? 68   PHE J CZ  1 
ATOM   8695  N  N   . GLU J  1 69  ? -30.536 0.987   21.004  1.00 12.32 ? 69   GLU J N   1 
ATOM   8696  C  CA  . GLU J  1 69  ? -31.314 0.105   20.158  1.00 12.24 ? 69   GLU J CA  1 
ATOM   8697  C  C   . GLU J  1 69  ? -30.391 -0.509  19.121  1.00 12.13 ? 69   GLU J C   1 
ATOM   8698  O  O   . GLU J  1 69  ? -29.534 0.174   18.570  1.00 12.15 ? 69   GLU J O   1 
ATOM   8699  C  CB  . GLU J  1 69  ? -32.474 0.827   19.472  1.00 12.53 ? 69   GLU J CB  1 
ATOM   8700  C  CG  . GLU J  1 69  ? -33.450 -0.140  18.796  1.00 12.79 ? 69   GLU J CG  1 
ATOM   8701  C  CD  . GLU J  1 69  ? -34.598 0.551   18.089  1.00 13.41 ? 69   GLU J CD  1 
ATOM   8702  O  OE1 . GLU J  1 69  ? -34.342 1.457   17.250  1.00 13.72 ? 69   GLU J OE1 1 
ATOM   8703  O  OE2 . GLU J  1 69  ? -35.766 0.188   18.373  1.00 14.05 ? 69   GLU J OE2 1 
ATOM   8704  N  N   . ILE J  1 70  ? -30.563 -1.803  18.877  1.00 12.21 ? 70   ILE J N   1 
ATOM   8705  C  CA  . ILE J  1 70  ? -29.799 -2.531  17.883  1.00 12.37 ? 70   ILE J CA  1 
ATOM   8706  C  C   . ILE J  1 70  ? -30.794 -3.107  16.877  1.00 12.57 ? 70   ILE J C   1 
ATOM   8707  O  O   . ILE J  1 70  ? -31.830 -3.627  17.280  1.00 12.59 ? 70   ILE J O   1 
ATOM   8708  C  CB  . ILE J  1 70  ? -29.000 -3.682  18.525  1.00 12.81 ? 70   ILE J CB  1 
ATOM   8709  C  CG1 . ILE J  1 70  ? -27.948 -3.138  19.479  1.00 12.97 ? 70   ILE J CG1 1 
ATOM   8710  C  CG2 . ILE J  1 70  ? -28.302 -4.526  17.462  1.00 13.32 ? 70   ILE J CG2 1 
ATOM   8711  C  CD1 . ILE J  1 70  ? -27.376 -4.188  20.417  1.00 13.78 ? 70   ILE J CD1 1 
ATOM   8712  N  N   . VAL J  1 71  ? -30.479 -2.988  15.582  1.00 12.91 ? 71   VAL J N   1 
ATOM   8713  C  CA  . VAL J  1 71  ? -31.257 -3.610  14.503  1.00 13.34 ? 71   VAL J CA  1 
ATOM   8714  C  C   . VAL J  1 71  ? -30.322 -4.529  13.722  1.00 14.09 ? 71   VAL J C   1 
ATOM   8715  O  O   . VAL J  1 71  ? -29.387 -4.065  13.076  1.00 14.26 ? 71   VAL J O   1 
ATOM   8716  C  CB  . VAL J  1 71  ? -31.855 -2.561  13.541  1.00 13.54 ? 71   VAL J CB  1 
ATOM   8717  C  CG1 . VAL J  1 71  ? -32.665 -3.236  12.442  1.00 14.18 ? 71   VAL J CG1 1 
ATOM   8718  C  CG2 . VAL J  1 71  ? -32.736 -1.591  14.295  1.00 13.35 ? 71   VAL J CG2 1 
ATOM   8719  N  N   . LEU J  1 72  ? -30.600 -5.833  13.768  1.00 14.79 ? 72   LEU J N   1 
ATOM   8720  C  CA  . LEU J  1 72  ? -29.673 -6.858  13.284  1.00 15.78 ? 72   LEU J CA  1 
ATOM   8721  C  C   . LEU J  1 72  ? -30.420 -8.174  13.043  1.00 16.76 ? 72   LEU J C   1 
ATOM   8722  O  O   . LEU J  1 72  ? -31.182 -8.609  13.901  1.00 16.87 ? 72   LEU J O   1 
ATOM   8723  C  CB  . LEU J  1 72  ? -28.579 -7.050  14.347  1.00 15.82 ? 72   LEU J CB  1 
ATOM   8724  C  CG  . LEU J  1 72  ? -27.485 -8.098  14.134  1.00 16.98 ? 72   LEU J CG  1 
ATOM   8725  C  CD1 . LEU J  1 72  ? -26.650 -7.792  12.888  1.00 17.54 ? 72   LEU J CD1 1 
ATOM   8726  C  CD2 . LEU J  1 72  ? -26.624 -8.182  15.392  1.00 17.06 ? 72   LEU J CD2 1 
ATOM   8727  N  N   . ASN J  1 73  ? -30.208 -8.789  11.882  1.00 18.02 ? 73   ASN J N   1 
ATOM   8728  C  CA  . ASN J  1 73  ? -30.878 -10.033 11.483  1.00 19.26 ? 73   ASN J CA  1 
ATOM   8729  C  C   . ASN J  1 73  ? -32.402 -9.966  11.556  1.00 18.58 ? 73   ASN J C   1 
ATOM   8730  O  O   . ASN J  1 73  ? -33.044 -10.925 11.956  1.00 19.18 ? 73   ASN J O   1 
ATOM   8731  C  CB  . ASN J  1 73  ? -30.368 -11.214 12.322  1.00 20.32 ? 73   ASN J CB  1 
ATOM   8732  C  CG  . ASN J  1 73  ? -28.872 -11.395 12.197  1.00 21.70 ? 73   ASN J CG  1 
ATOM   8733  O  OD1 . ASN J  1 73  ? -28.326 -11.449 11.073  1.00 23.61 ? 73   ASN J OD1 1 
ATOM   8734  N  ND2 . ASN J  1 73  ? -28.180 -11.463 13.344  1.00 21.76 ? 73   ASN J ND2 1 
ATOM   8735  N  N   . ASP J  1 74  ? -32.967 -8.829  11.166  1.00 17.70 ? 74   ASP J N   1 
ATOM   8736  C  CA  . ASP J  1 74  ? -34.402 -8.582  11.236  1.00 17.45 ? 74   ASP J CA  1 
ATOM   8737  C  C   . ASP J  1 74  ? -34.992 -8.589  12.663  1.00 16.74 ? 74   ASP J C   1 
ATOM   8738  O  O   . ASP J  1 74  ? -36.190 -8.774  12.828  1.00 16.98 ? 74   ASP J O   1 
ATOM   8739  C  CB  . ASP J  1 74  ? -35.152 -9.553  10.303  1.00 18.87 ? 74   ASP J CB  1 
ATOM   8740  C  CG  . ASP J  1 74  ? -35.123 -9.104  8.825   1.00 19.62 ? 74   ASP J CG  1 
ATOM   8741  O  OD1 . ASP J  1 74  ? -35.060 -7.874  8.568   1.00 19.06 ? 74   ASP J OD1 1 
ATOM   8742  O  OD2 . ASP J  1 74  ? -35.194 -9.979  7.921   1.00 21.01 ? 74   ASP J OD2 1 
ATOM   8743  N  N   . TYR J  1 75  ? -34.155 -8.359  13.682  1.00 15.90 ? 75   TYR J N   1 
ATOM   8744  C  CA  . TYR J  1 75  ? -34.625 -8.168  15.069  1.00 15.38 ? 75   TYR J CA  1 
ATOM   8745  C  C   . TYR J  1 75  ? -34.177 -6.805  15.583  1.00 14.28 ? 75   TYR J C   1 
ATOM   8746  O  O   . TYR J  1 75  ? -33.092 -6.338  15.246  1.00 13.94 ? 75   TYR J O   1 
ATOM   8747  C  CB  . TYR J  1 75  ? -34.113 -9.282  16.000  1.00 15.97 ? 75   TYR J CB  1 
ATOM   8748  C  CG  . TYR J  1 75  ? -34.878 -10.575 15.847  1.00 17.26 ? 75   TYR J CG  1 
ATOM   8749  C  CD1 . TYR J  1 75  ? -36.024 -10.820 16.589  1.00 17.88 ? 75   TYR J CD1 1 
ATOM   8750  C  CD2 . TYR J  1 75  ? -34.491 -11.528 14.925  1.00 18.22 ? 75   TYR J CD2 1 
ATOM   8751  C  CE1 . TYR J  1 75  ? -36.751 -11.997 16.432  1.00 19.27 ? 75   TYR J CE1 1 
ATOM   8752  C  CE2 . TYR J  1 75  ? -35.208 -12.700 14.753  1.00 19.53 ? 75   TYR J CE2 1 
ATOM   8753  C  CZ  . TYR J  1 75  ? -36.341 -12.928 15.515  1.00 20.05 ? 75   TYR J CZ  1 
ATOM   8754  O  OH  . TYR J  1 75  ? -37.052 -14.092 15.360  1.00 21.64 ? 75   TYR J OH  1 
ATOM   8755  N  N   . LYS J  1 76  ? -35.028 -6.165  16.378  1.00 13.97 ? 76   LYS J N   1 
ATOM   8756  C  CA  . LYS J  1 76  ? -34.673 -4.973  17.122  1.00 13.18 ? 76   LYS J CA  1 
ATOM   8757  C  C   . LYS J  1 76  ? -34.538 -5.282  18.615  1.00 13.39 ? 76   LYS J C   1 
ATOM   8758  O  O   . LYS J  1 76  ? -35.461 -5.779  19.251  1.00 14.30 ? 76   LYS J O   1 
ATOM   8759  C  CB  . LYS J  1 76  ? -35.728 -3.895  16.948  1.00 13.10 ? 76   LYS J CB  1 
ATOM   8760  C  CG  . LYS J  1 76  ? -36.029 -3.559  15.515  1.00 13.22 ? 76   LYS J CG  1 
ATOM   8761  C  CD  . LYS J  1 76  ? -36.764 -2.239  15.397  1.00 13.27 ? 76   LYS J CD  1 
ATOM   8762  C  CE  . LYS J  1 76  ? -37.201 -2.021  13.966  1.00 13.80 ? 76   LYS J CE  1 
ATOM   8763  N  NZ  . LYS J  1 76  ? -37.773 -0.656  13.778  1.00 14.15 ? 76   LYS J NZ  1 
ATOM   8764  N  N   . TRP J  1 77  ? -33.376 -4.969  19.156  1.00 12.96 ? 77   TRP J N   1 
ATOM   8765  C  CA  . TRP J  1 77  ? -33.094 -5.085  20.561  1.00 13.33 ? 77   TRP J CA  1 
ATOM   8766  C  C   . TRP J  1 77  ? -33.109 -3.682  21.179  1.00 12.99 ? 77   TRP J C   1 
ATOM   8767  O  O   . TRP J  1 77  ? -32.485 -2.775  20.658  1.00 12.40 ? 77   TRP J O   1 
ATOM   8768  C  CB  . TRP J  1 77  ? -31.696 -5.660  20.766  1.00 13.46 ? 77   TRP J CB  1 
ATOM   8769  C  CG  . TRP J  1 77  ? -31.425 -6.937  20.079  1.00 13.95 ? 77   TRP J CG  1 
ATOM   8770  C  CD1 . TRP J  1 77  ? -31.186 -7.121  18.753  1.00 13.72 ? 77   TRP J CD1 1 
ATOM   8771  C  CD2 . TRP J  1 77  ? -31.317 -8.218  20.689  1.00 15.03 ? 77   TRP J CD2 1 
ATOM   8772  N  NE1 . TRP J  1 77  ? -30.951 -8.434  18.501  1.00 14.58 ? 77   TRP J NE1 1 
ATOM   8773  C  CE2 . TRP J  1 77  ? -31.021 -9.135  19.671  1.00 15.43 ? 77   TRP J CE2 1 
ATOM   8774  C  CE3 . TRP J  1 77  ? -31.440 -8.679  22.007  1.00 16.04 ? 77   TRP J CE3 1 
ATOM   8775  C  CZ2 . TRP J  1 77  ? -30.835 -10.489 19.918  1.00 16.70 ? 77   TRP J CZ2 1 
ATOM   8776  C  CZ3 . TRP J  1 77  ? -31.260 -10.021 22.257  1.00 17.34 ? 77   TRP J CZ3 1 
ATOM   8777  C  CH2 . TRP J  1 77  ? -30.960 -10.916 21.217  1.00 17.63 ? 77   TRP J CH2 1 
ATOM   8778  N  N   . PHE J  1 78  ? -33.829 -3.514  22.283  1.00 13.68 ? 78   PHE J N   1 
ATOM   8779  C  CA  . PHE J  1 78  ? -33.782 -2.277  23.040  1.00 13.76 ? 78   PHE J CA  1 
ATOM   8780  C  C   . PHE J  1 78  ? -33.728 -2.574  24.532  1.00 14.98 ? 78   PHE J C   1 
ATOM   8781  O  O   . PHE J  1 78  ? -34.485 -3.417  25.034  1.00 16.10 ? 78   PHE J O   1 
ATOM   8782  C  CB  . PHE J  1 78  ? -34.991 -1.397  22.761  1.00 13.78 ? 78   PHE J CB  1 
ATOM   8783  C  CG  . PHE J  1 78  ? -35.218 -0.361  23.814  1.00 14.36 ? 78   PHE J CG  1 
ATOM   8784  C  CD1 . PHE J  1 78  ? -34.281 0.631   24.038  1.00 14.03 ? 78   PHE J CD1 1 
ATOM   8785  C  CD2 . PHE J  1 78  ? -36.354 -0.402  24.632  1.00 15.59 ? 78   PHE J CD2 1 
ATOM   8786  C  CE1 . PHE J  1 78  ? -34.464 1.576   25.038  1.00 14.75 ? 78   PHE J CE1 1 
ATOM   8787  C  CE2 . PHE J  1 78  ? -36.543 0.547   25.634  1.00 16.36 ? 78   PHE J CE2 1 
ATOM   8788  C  CZ  . PHE J  1 78  ? -35.589 1.531   25.839  1.00 15.92 ? 78   PHE J CZ  1 
ATOM   8789  N  N   . ALA J  1 79  ? -32.861 -1.857  25.238  1.00 15.14 ? 79   ALA J N   1 
ATOM   8790  C  CA  . ALA J  1 79  ? -32.853 -1.902  26.704  1.00 16.61 ? 79   ALA J CA  1 
ATOM   8791  C  C   . ALA J  1 79  ? -32.190 -0.673  27.299  1.00 16.80 ? 79   ALA J C   1 
ATOM   8792  O  O   . ALA J  1 79  ? -31.356 -0.024  26.667  1.00 15.87 ? 79   ALA J O   1 
ATOM   8793  C  CB  . ALA J  1 79  ? -32.140 -3.144  27.187  1.00 17.39 ? 79   ALA J CB  1 
ATOM   8794  N  N   . PHE J  1 80  ? -32.588 -0.359  28.519  1.00 18.29 ? 80   PHE J N   1 
ATOM   8795  C  CA  . PHE J  1 80  ? -31.985 0.724   29.280  1.00 19.00 ? 80   PHE J CA  1 
ATOM   8796  C  C   . PHE J  1 80  ? -30.798 0.152   30.002  1.00 19.94 ? 80   PHE J C   1 
ATOM   8797  O  O   . PHE J  1 80  ? -30.802 -1.020  30.356  1.00 20.78 ? 80   PHE J O   1 
ATOM   8798  C  CB  . PHE J  1 80  ? -32.958 1.260   30.327  1.00 20.43 ? 80   PHE J CB  1 
ATOM   8799  C  CG  . PHE J  1 80  ? -34.087 2.063   29.759  1.00 20.14 ? 80   PHE J CG  1 
ATOM   8800  C  CD1 . PHE J  1 80  ? -33.842 3.289   29.148  1.00 19.43 ? 80   PHE J CD1 1 
ATOM   8801  C  CD2 . PHE J  1 80  ? -35.397 1.610   29.854  1.00 20.93 ? 80   PHE J CD2 1 
ATOM   8802  C  CE1 . PHE J  1 80  ? -34.879 4.043   28.634  1.00 19.46 ? 80   PHE J CE1 1 
ATOM   8803  C  CE2 . PHE J  1 80  ? -36.438 2.353   29.344  1.00 21.01 ? 80   PHE J CE2 1 
ATOM   8804  C  CZ  . PHE J  1 80  ? -36.174 3.573   28.721  1.00 20.31 ? 80   PHE J CZ  1 
ATOM   8805  N  N   . PHE J  1 81  ? -29.793 0.982   30.253  1.00 20.33 ? 81   PHE J N   1 
ATOM   8806  C  CA  . PHE J  1 81  ? -28.663 0.558   31.074  1.00 21.57 ? 81   PHE J CA  1 
ATOM   8807  C  C   . PHE J  1 81  ? -29.132 0.378   32.507  1.00 23.96 ? 81   PHE J C   1 
ATOM   8808  O  O   . PHE J  1 81  ? -30.036 1.082   32.955  1.00 24.44 ? 81   PHE J O   1 
ATOM   8809  C  CB  . PHE J  1 81  ? -27.533 1.576   31.017  1.00 21.36 ? 81   PHE J CB  1 
ATOM   8810  C  CG  . PHE J  1 81  ? -26.934 1.727   29.656  1.00 19.81 ? 81   PHE J CG  1 
ATOM   8811  C  CD1 . PHE J  1 81  ? -26.282 0.662   29.053  1.00 19.44 ? 81   PHE J CD1 1 
ATOM   8812  C  CD2 . PHE J  1 81  ? -27.019 2.934   28.973  1.00 19.06 ? 81   PHE J CD2 1 
ATOM   8813  C  CE1 . PHE J  1 81  ? -25.733 0.797   27.797  1.00 18.36 ? 81   PHE J CE1 1 
ATOM   8814  C  CE2 . PHE J  1 81  ? -26.472 3.072   27.715  1.00 17.86 ? 81   PHE J CE2 1 
ATOM   8815  C  CZ  . PHE J  1 81  ? -25.823 2.005   27.132  1.00 17.61 ? 81   PHE J CZ  1 
ATOM   8816  N  N   . LYS J  1 82  ? -28.485 -0.556  33.207  1.00 25.88 ? 82   LYS J N   1 
ATOM   8817  C  CA  . LYS J  1 82  ? -28.877 -0.989  34.543  1.00 28.73 ? 82   LYS J CA  1 
ATOM   8818  C  C   . LYS J  1 82  ? -28.582 0.057   35.623  1.00 30.52 ? 82   LYS J C   1 
ATOM   8819  O  O   . LYS J  1 82  ? -27.546 0.706   35.600  1.00 30.36 ? 82   LYS J O   1 
ATOM   8820  C  CB  . LYS J  1 82  ? -28.157 -2.298  34.894  1.00 30.32 ? 82   LYS J CB  1 
ATOM   8821  C  CG  . LYS J  1 82  ? -28.758 -3.079  36.063  1.00 33.43 ? 82   LYS J CG  1 
ATOM   8822  C  CD  . LYS J  1 82  ? -27.861 -4.260  36.439  1.00 35.39 ? 82   LYS J CD  1 
ATOM   8823  C  CE  . LYS J  1 82  ? -28.617 -5.531  36.809  1.00 37.19 ? 82   LYS J CE  1 
ATOM   8824  N  NZ  . LYS J  1 82  ? -29.136 -5.495  38.190  1.00 40.42 ? 82   LYS J NZ  1 
ATOM   8825  N  N   . TYR J  1 83  ? -29.510 0.206   36.563  1.00 32.76 ? 83   TYR J N   1 
ATOM   8826  C  CA  . TYR J  1 83  ? -29.292 1.019   37.755  1.00 35.27 ? 83   TYR J CA  1 
ATOM   8827  C  C   . TYR J  1 83  ? -30.079 0.406   38.910  1.00 38.24 ? 83   TYR J C   1 
ATOM   8828  O  O   . TYR J  1 83  ? -31.117 -0.217  38.672  1.00 38.40 ? 83   TYR J O   1 
ATOM   8829  C  CB  . TYR J  1 83  ? -29.721 2.474   37.524  1.00 34.63 ? 83   TYR J CB  1 
ATOM   8830  C  CG  . TYR J  1 83  ? -31.169 2.595   37.129  1.00 34.32 ? 83   TYR J CG  1 
ATOM   8831  C  CD1 . TYR J  1 83  ? -31.547 2.486   35.795  1.00 31.92 ? 83   TYR J CD1 1 
ATOM   8832  C  CD2 . TYR J  1 83  ? -32.170 2.779   38.090  1.00 36.59 ? 83   TYR J CD2 1 
ATOM   8833  C  CE1 . TYR J  1 83  ? -32.868 2.577   35.420  1.00 31.93 ? 83   TYR J CE1 1 
ATOM   8834  C  CE2 . TYR J  1 83  ? -33.506 2.864   37.722  1.00 36.46 ? 83   TYR J CE2 1 
ATOM   8835  C  CZ  . TYR J  1 83  ? -33.838 2.767   36.385  1.00 34.42 ? 83   TYR J CZ  1 
ATOM   8836  O  OH  . TYR J  1 83  ? -35.144 2.854   35.979  1.00 35.51 ? 83   TYR J OH  1 
ATOM   8837  N  N   . LYS J  1 84  ? -29.570 0.581   40.134  1.00 41.34 ? 84   LYS J N   1 
ATOM   8838  C  CA  . LYS J  1 84  ? -30.242 0.159   41.379  1.00 44.93 ? 84   LYS J CA  1 
ATOM   8839  C  C   . LYS J  1 84  ? -30.726 1.367   42.187  1.00 46.36 ? 84   LYS J C   1 
ATOM   8840  O  O   . LYS J  1 84  ? -29.950 2.280   42.470  1.00 46.17 ? 84   LYS J O   1 
ATOM   8841  C  CB  . LYS J  1 84  ? -29.293 -0.663  42.265  1.00 47.86 ? 84   LYS J CB  1 
ATOM   8842  C  CG  . LYS J  1 84  ? -29.075 -2.110  41.817  1.00 47.98 ? 84   LYS J CG  1 
ATOM   8843  C  CD  . LYS J  1 84  ? -28.376 -2.916  42.912  1.00 51.77 ? 84   LYS J CD  1 
ATOM   8844  C  CE  . LYS J  1 84  ? -28.462 -4.421  42.681  1.00 52.72 ? 84   LYS J CE  1 
ATOM   8845  N  NZ  . LYS J  1 84  ? -27.762 -5.186  43.755  1.00 56.00 ? 84   LYS J NZ  1 
ATOM   8846  N  N   . VAL J  1 90  ? -28.204 5.623   44.697  1.00 50.99 ? 90   VAL J N   1 
ATOM   8847  C  CA  . VAL J  1 90  ? -28.384 5.090   43.348  1.00 48.04 ? 90   VAL J CA  1 
ATOM   8848  C  C   . VAL J  1 90  ? -27.044 4.758   42.688  1.00 46.13 ? 90   VAL J C   1 
ATOM   8849  O  O   . VAL J  1 90  ? -26.119 5.563   42.741  1.00 46.29 ? 90   VAL J O   1 
ATOM   8850  C  CB  . VAL J  1 90  ? -29.212 6.063   42.449  1.00 46.30 ? 90   VAL J CB  1 
ATOM   8851  C  CG1 . VAL J  1 90  ? -28.649 6.171   41.029  1.00 42.88 ? 90   VAL J CG1 1 
ATOM   8852  C  CG2 . VAL J  1 90  ? -30.682 5.635   42.414  1.00 46.53 ? 90   VAL J CG2 1 
ATOM   8853  N  N   . THR J  1 91  ? -26.966 3.580   42.063  1.00 44.38 ? 91   THR J N   1 
ATOM   8854  C  CA  . THR J  1 91  ? -25.756 3.131   41.374  1.00 43.05 ? 91   THR J CA  1 
ATOM   8855  C  C   . THR J  1 91  ? -26.054 2.755   39.915  1.00 39.99 ? 91   THR J C   1 
ATOM   8856  O  O   . THR J  1 91  ? -27.135 2.254   39.602  1.00 38.91 ? 91   THR J O   1 
ATOM   8857  C  CB  . THR J  1 91  ? -25.135 1.898   42.065  1.00 45.08 ? 91   THR J CB  1 
ATOM   8858  O  OG1 . THR J  1 91  ? -25.147 2.063   43.494  1.00 48.60 ? 91   THR J OG1 1 
ATOM   8859  C  CG2 . THR J  1 91  ? -23.693 1.683   41.584  1.00 44.53 ? 91   THR J CG2 1 
ATOM   8860  N  N   . THR J  1 92  ? -25.082 2.977   39.038  1.00 38.53 ? 92   THR J N   1 
ATOM   8861  C  CA  . THR J  1 92  ? -25.252 2.730   37.614  1.00 36.21 ? 92   THR J CA  1 
ATOM   8862  C  C   . THR J  1 92  ? -24.252 1.696   37.114  1.00 36.10 ? 92   THR J C   1 
ATOM   8863  O  O   . THR J  1 92  ? -23.083 1.738   37.469  1.00 37.06 ? 92   THR J O   1 
ATOM   8864  C  CB  . THR J  1 92  ? -25.095 4.033   36.813  1.00 35.00 ? 92   THR J CB  1 
ATOM   8865  O  OG1 . THR J  1 92  ? -26.196 4.897   37.110  1.00 34.99 ? 92   THR J OG1 1 
ATOM   8866  C  CG2 . THR J  1 92  ? -25.075 3.756   35.296  1.00 32.94 ? 92   THR J CG2 1 
ATOM   8867  N  N   . TYR J  1 93  ? -24.731 0.771   36.285  1.00 34.96 ? 93   TYR J N   1 
ATOM   8868  C  CA  . TYR J  1 93  ? -23.893 -0.272  35.709  1.00 34.93 ? 93   TYR J CA  1 
ATOM   8869  C  C   . TYR J  1 93  ? -23.996 -0.182  34.202  1.00 32.89 ? 93   TYR J C   1 
ATOM   8870  O  O   . TYR J  1 93  ? -24.855 -0.802  33.574  1.00 31.82 ? 93   TYR J O   1 
ATOM   8871  C  CB  . TYR J  1 93  ? -24.306 -1.665  36.196  1.00 36.19 ? 93   TYR J CB  1 
ATOM   8872  C  CG  . TYR J  1 93  ? -24.438 -1.781  37.691  1.00 39.05 ? 93   TYR J CG  1 
ATOM   8873  C  CD1 . TYR J  1 93  ? -25.612 -1.401  38.326  1.00 39.90 ? 93   TYR J CD1 1 
ATOM   8874  C  CD2 . TYR J  1 93  ? -23.399 -2.272  38.472  1.00 41.48 ? 93   TYR J CD2 1 
ATOM   8875  C  CE1 . TYR J  1 93  ? -25.755 -1.504  39.695  1.00 42.83 ? 93   TYR J CE1 1 
ATOM   8876  C  CE2 . TYR J  1 93  ? -23.530 -2.382  39.850  1.00 44.49 ? 93   TYR J CE2 1 
ATOM   8877  C  CZ  . TYR J  1 93  ? -24.714 -1.992  40.452  1.00 45.15 ? 93   TYR J CZ  1 
ATOM   8878  O  OH  . TYR J  1 93  ? -24.874 -2.079  41.813  1.00 48.52 ? 93   TYR J OH  1 
ATOM   8879  N  N   . CYS J  1 94  ? -23.102 0.613   33.632  1.00 33.02 ? 94   CYS J N   1 
ATOM   8880  C  CA  . CYS J  1 94  ? -23.034 0.821   32.202  1.00 31.40 ? 94   CYS J CA  1 
ATOM   8881  C  C   . CYS J  1 94  ? -22.557 -0.418  31.422  1.00 29.93 ? 94   CYS J C   1 
ATOM   8882  O  O   . CYS J  1 94  ? -22.664 -0.454  30.189  1.00 28.55 ? 94   CYS J O   1 
ATOM   8883  C  CB  . CYS J  1 94  ? -22.136 2.031   31.918  1.00 32.69 ? 94   CYS J CB  1 
ATOM   8884  S  SG  . CYS J  1 94  ? -22.771 3.579   32.646  1.00 35.13 ? 94   CYS J SG  1 
ATOM   8885  N  N   . ASN J  1 95  ? -22.047 -1.424  32.133  1.00 30.52 ? 95   ASN J N   1 
ATOM   8886  C  CA  . ASN J  1 95  ? -21.713 -2.710  31.522  1.00 30.23 ? 95   ASN J CA  1 
ATOM   8887  C  C   . ASN J  1 95  ? -22.865 -3.740  31.542  1.00 29.31 ? 95   ASN J C   1 
ATOM   8888  O  O   . ASN J  1 95  ? -22.643 -4.914  31.259  1.00 29.59 ? 95   ASN J O   1 
ATOM   8889  C  CB  . ASN J  1 95  ? -20.452 -3.303  32.182  1.00 32.60 ? 95   ASN J CB  1 
ATOM   8890  C  CG  . ASN J  1 95  ? -20.618 -3.551  33.671  1.00 34.80 ? 95   ASN J CG  1 
ATOM   8891  O  OD1 . ASN J  1 95  ? -21.542 -3.032  34.290  1.00 35.21 ? 95   ASN J OD1 1 
ATOM   8892  N  ND2 . ASN J  1 95  ? -19.713 -4.331  34.257  1.00 37.13 ? 95   ASN J ND2 1 
ATOM   8893  N  N   . GLU J  1 96  ? -24.080 -3.298  31.868  1.00 28.09 ? 96   GLU J N   1 
ATOM   8894  C  CA  . GLU J  1 96  ? -25.246 -4.185  31.995  1.00 27.67 ? 96   GLU J CA  1 
ATOM   8895  C  C   . GLU J  1 96  ? -26.508 -3.442  31.618  1.00 25.55 ? 96   GLU J C   1 
ATOM   8896  O  O   . GLU J  1 96  ? -26.519 -2.227  31.567  1.00 24.72 ? 96   GLU J O   1 
ATOM   8897  C  CB  . GLU J  1 96  ? -25.420 -4.691  33.442  1.00 30.33 ? 96   GLU J CB  1 
ATOM   8898  C  CG  . GLU J  1 96  ? -24.434 -5.759  33.899  1.00 32.48 ? 96   GLU J CG  1 
ATOM   8899  C  CD  . GLU J  1 96  ? -24.743 -6.286  35.293  1.00 35.27 ? 96   GLU J CD  1 
ATOM   8900  O  OE1 . GLU J  1 96  ? -25.689 -7.096  35.454  1.00 36.23 ? 96   GLU J OE1 1 
ATOM   8901  O  OE2 . GLU J  1 96  ? -24.025 -5.905  36.237  1.00 37.20 ? 96   GLU J OE2 1 
ATOM   8902  N  N   . THR J  1 97  ? -27.582 -4.189  31.401  1.00 24.99 ? 97   THR J N   1 
ATOM   8903  C  CA  . THR J  1 97  ? -28.876 -3.608  31.066  1.00 23.86 ? 97   THR J CA  1 
ATOM   8904  C  C   . THR J  1 97  ? -29.952 -4.017  32.060  1.00 25.40 ? 97   THR J C   1 
ATOM   8905  O  O   . THR J  1 97  ? -29.865 -5.075  32.669  1.00 26.93 ? 97   THR J O   1 
ATOM   8906  C  CB  . THR J  1 97  ? -29.324 -4.044  29.648  1.00 22.15 ? 97   THR J CB  1 
ATOM   8907  O  OG1 . THR J  1 97  ? -29.741 -5.413  29.659  1.00 22.75 ? 97   THR J OG1 1 
ATOM   8908  C  CG2 . THR J  1 97  ? -28.182 -3.892  28.653  1.00 21.11 ? 97   THR J CG2 1 
ATOM   8909  N  N   . MET J  1 98  ? -30.971 -3.176  32.214  1.00 25.23 ? 98   MET J N   1 
ATOM   8910  C  CA  . MET J  1 98  ? -32.244 -3.619  32.789  1.00 26.65 ? 98   MET J CA  1 
ATOM   8911  C  C   . MET J  1 98  ? -32.807 -4.666  31.838  1.00 26.35 ? 98   MET J C   1 
ATOM   8912  O  O   . MET J  1 98  ? -32.317 -4.799  30.711  1.00 24.94 ? 98   MET J O   1 
ATOM   8913  C  CB  . MET J  1 98  ? -33.254 -2.461  32.896  1.00 26.47 ? 98   MET J CB  1 
ATOM   8914  C  CG  . MET J  1 98  ? -32.789 -1.270  33.717  1.00 27.08 ? 98   MET J CG  1 
ATOM   8915  S  SD  . MET J  1 98  ? -32.295 -1.743  35.390  1.00 29.89 ? 98   MET J SD  1 
ATOM   8916  C  CE  . MET J  1 98  ? -33.847 -1.527  36.277  1.00 31.90 ? 98   MET J CE  1 
ATOM   8917  N  N   . THR J  1 99  ? -33.847 -5.381  32.250  1.00 28.11 ? 99   THR J N   1 
ATOM   8918  C  CA  . THR J  1 99  ? -34.507 -6.301  31.333  1.00 28.13 ? 99   THR J CA  1 
ATOM   8919  C  C   . THR J  1 99  ? -35.018 -5.524  30.119  1.00 26.07 ? 99   THR J C   1 
ATOM   8920  O  O   . THR J  1 99  ? -35.618 -4.463  30.266  1.00 26.28 ? 99   THR J O   1 
ATOM   8921  C  CB  . THR J  1 99  ? -35.686 -7.044  31.978  1.00 30.54 ? 99   THR J CB  1 
ATOM   8922  O  OG1 . THR J  1 99  ? -35.248 -7.682  33.174  1.00 32.55 ? 99   THR J OG1 1 
ATOM   8923  C  CG2 . THR J  1 99  ? -36.236 -8.114  31.009  1.00 30.77 ? 99   THR J CG2 1 
ATOM   8924  N  N   . GLY J  1 100 ? -34.766 -6.048  28.927  1.00 24.41 ? 100  GLY J N   1 
ATOM   8925  C  CA  . GLY J  1 100 ? -35.123 -5.352  27.698  1.00 22.46 ? 100  GLY J CA  1 
ATOM   8926  C  C   . GLY J  1 100 ? -36.071 -6.122  26.809  1.00 22.19 ? 100  GLY J C   1 
ATOM   8927  O  O   . GLY J  1 100 ? -36.484 -7.229  27.114  1.00 23.71 ? 100  GLY J O   1 
ATOM   8928  N  N   . TRP J  1 101 ? -36.409 -5.512  25.685  1.00 20.77 ? 101  TRP J N   1 
ATOM   8929  C  CA  . TRP J  1 101 ? -37.331 -6.109  24.735  1.00 20.61 ? 101  TRP J CA  1 
ATOM   8930  C  C   . TRP J  1 101 ? -36.608 -6.411  23.439  1.00 19.01 ? 101  TRP J C   1 
ATOM   8931  O  O   . TRP J  1 101 ? -35.929 -5.532  22.886  1.00 17.81 ? 101  TRP J O   1 
ATOM   8932  C  CB  . TRP J  1 101 ? -38.474 -5.133  24.460  1.00 20.79 ? 101  TRP J CB  1 
ATOM   8933  C  CG  . TRP J  1 101 ? -39.298 -4.803  25.674  1.00 22.42 ? 101  TRP J CG  1 
ATOM   8934  C  CD1 . TRP J  1 101 ? -40.462 -5.402  26.058  1.00 24.29 ? 101  TRP J CD1 1 
ATOM   8935  C  CD2 . TRP J  1 101 ? -39.030 -3.789  26.644  1.00 22.67 ? 101  TRP J CD2 1 
ATOM   8936  N  NE1 . TRP J  1 101 ? -40.931 -4.831  27.205  1.00 25.75 ? 101  TRP J NE1 1 
ATOM   8937  C  CE2 . TRP J  1 101 ? -40.072 -3.836  27.592  1.00 24.75 ? 101  TRP J CE2 1 
ATOM   8938  C  CE3 . TRP J  1 101 ? -38.009 -2.847  26.809  1.00 21.72 ? 101  TRP J CE3 1 
ATOM   8939  C  CZ2 . TRP J  1 101 ? -40.122 -2.978  28.697  1.00 25.68 ? 101  TRP J CZ2 1 
ATOM   8940  C  CZ3 . TRP J  1 101 ? -38.055 -1.995  27.917  1.00 22.61 ? 101  TRP J CZ3 1 
ATOM   8941  C  CH2 . TRP J  1 101 ? -39.105 -2.066  28.837  1.00 24.55 ? 101  TRP J CH2 1 
ATOM   8942  N  N   . VAL J  1 102 ? -36.755 -7.642  22.947  1.00 19.19 ? 102  VAL J N   1 
ATOM   8943  C  CA  . VAL J  1 102 ? -36.315 -7.982  21.587  1.00 18.14 ? 102  VAL J CA  1 
ATOM   8944  C  C   . VAL J  1 102 ? -37.499 -8.508  20.774  1.00 18.59 ? 102  VAL J C   1 
ATOM   8945  O  O   . VAL J  1 102 ? -38.314 -9.277  21.280  1.00 19.92 ? 102  VAL J O   1 
ATOM   8946  C  CB  . VAL J  1 102 ? -35.133 -8.976  21.563  1.00 18.43 ? 102  VAL J CB  1 
ATOM   8947  C  CG1 . VAL J  1 102 ? -35.429 -10.229 22.370  1.00 20.16 ? 102  VAL J CG1 1 
ATOM   8948  C  CG2 . VAL J  1 102 ? -34.758 -9.339  20.135  1.00 17.99 ? 102  VAL J CG2 1 
ATOM   8949  N  N   . HIS J  1 103 ? -37.610 -8.056  19.525  1.00 17.52 ? 103  HIS J N   1 
ATOM   8950  C  CA  . HIS J  1 103 ? -38.668 -8.531  18.634  1.00 18.06 ? 103  HIS J CA  1 
ATOM   8951  C  C   . HIS J  1 103 ? -38.268 -8.383  17.177  1.00 17.23 ? 103  HIS J C   1 
ATOM   8952  O  O   . HIS J  1 103 ? -37.384 -7.611  16.854  1.00 16.08 ? 103  HIS J O   1 
ATOM   8953  C  CB  . HIS J  1 103 ? -39.992 -7.804  18.908  1.00 18.59 ? 103  HIS J CB  1 
ATOM   8954  C  CG  . HIS J  1 103 ? -39.938 -6.334  18.652  1.00 17.60 ? 103  HIS J CG  1 
ATOM   8955  N  ND1 . HIS J  1 103 ? -39.800 -5.802  17.389  1.00 16.95 ? 103  HIS J ND1 1 
ATOM   8956  C  CD2 . HIS J  1 103 ? -39.998 -5.281  19.497  1.00 17.38 ? 103  HIS J CD2 1 
ATOM   8957  C  CE1 . HIS J  1 103 ? -39.767 -4.488  17.468  1.00 16.43 ? 103  HIS J CE1 1 
ATOM   8958  N  NE2 . HIS J  1 103 ? -39.883 -4.144  18.734  1.00 16.65 ? 103  HIS J NE2 1 
ATOM   8959  N  N   . ASP J  1 104 ? -38.923 -9.122  16.294  1.00 18.03 ? 104  ASP J N   1 
ATOM   8960  C  CA  . ASP J  1 104 ? -38.596 -9.021  14.885  1.00 17.78 ? 104  ASP J CA  1 
ATOM   8961  C  C   . ASP J  1 104 ? -39.045 -7.657  14.347  1.00 17.22 ? 104  ASP J C   1 
ATOM   8962  O  O   . ASP J  1 104 ? -39.832 -6.962  14.990  1.00 17.22 ? 104  ASP J O   1 
ATOM   8963  C  CB  . ASP J  1 104 ? -39.118 -10.220 14.067  1.00 19.12 ? 104  ASP J CB  1 
ATOM   8964  C  CG  . ASP J  1 104 ? -40.627 -10.423 14.160  1.00 20.42 ? 104  ASP J CG  1 
ATOM   8965  O  OD1 . ASP J  1 104 ? -41.391 -9.538  13.718  1.00 20.37 ? 104  ASP J OD1 1 
ATOM   8966  O  OD2 . ASP J  1 104 ? -41.051 -11.512 14.624  1.00 21.81 ? 104  ASP J OD2 1 
ATOM   8967  N  N   . VAL J  1 105 ? -38.502 -7.261  13.196  1.00 16.93 ? 105  VAL J N   1 
ATOM   8968  C  CA  . VAL J  1 105 ? -38.781 -5.930  12.631  1.00 16.73 ? 105  VAL J CA  1 
ATOM   8969  C  C   . VAL J  1 105 ? -40.261 -5.696  12.306  1.00 17.87 ? 105  VAL J C   1 
ATOM   8970  O  O   . VAL J  1 105 ? -40.680 -4.562  12.110  1.00 18.51 ? 105  VAL J O   1 
ATOM   8971  C  CB  . VAL J  1 105 ? -37.944 -5.610  11.364  1.00 16.58 ? 105  VAL J CB  1 
ATOM   8972  C  CG1 . VAL J  1 105 ? -36.459 -5.534  11.715  1.00 15.68 ? 105  VAL J CG1 1 
ATOM   8973  C  CG2 . VAL J  1 105 ? -38.220 -6.601  10.230  1.00 17.73 ? 105  VAL J CG2 1 
ATOM   8974  N  N   . LEU J  1 106 ? -41.039 -6.762  12.216  1.00 18.88 ? 106  LEU J N   1 
ATOM   8975  C  CA  . LEU J  1 106 ? -42.466 -6.620  12.014  1.00 20.19 ? 106  LEU J CA  1 
ATOM   8976  C  C   . LEU J  1 106 ? -43.188 -6.379  13.336  1.00 20.37 ? 106  LEU J C   1 
ATOM   8977  O  O   . LEU J  1 106 ? -44.300 -5.846  13.348  1.00 21.42 ? 106  LEU J O   1 
ATOM   8978  C  CB  . LEU J  1 106 ? -43.027 -7.865  11.342  1.00 21.54 ? 106  LEU J CB  1 
ATOM   8979  C  CG  . LEU J  1 106 ? -42.429 -8.147  9.976   1.00 21.77 ? 106  LEU J CG  1 
ATOM   8980  C  CD1 . LEU J  1 106 ? -42.951 -9.491  9.480   1.00 23.34 ? 106  LEU J CD1 1 
ATOM   8981  C  CD2 . LEU J  1 106 ? -42.784 -7.026  9.004   1.00 22.17 ? 106  LEU J CD2 1 
ATOM   8982  N  N   . GLY J  1 107 ? -42.555 -6.778  14.432  1.00 19.67 ? 107  GLY J N   1 
ATOM   8983  C  CA  . GLY J  1 107 ? -43.172 -6.744  15.747  1.00 20.27 ? 107  GLY J CA  1 
ATOM   8984  C  C   . GLY J  1 107 ? -44.061 -7.949  16.003  1.00 22.03 ? 107  GLY J C   1 
ATOM   8985  O  O   . GLY J  1 107 ? -44.958 -7.862  16.808  1.00 23.15 ? 107  GLY J O   1 
ATOM   8986  N  N   . ARG J  1 108 ? -43.818 -9.073  15.326  1.00 22.55 ? 108  ARG J N   1 
ATOM   8987  C  CA  . ARG J  1 108 ? -44.638 -10.271 15.510  1.00 24.54 ? 108  ARG J CA  1 
ATOM   8988  C  C   . ARG J  1 108 ? -44.196 -11.073 16.740  1.00 24.88 ? 108  ARG J C   1 
ATOM   8989  O  O   . ARG J  1 108 ? -44.971 -11.256 17.667  1.00 26.48 ? 108  ARG J O   1 
ATOM   8990  C  CB  . ARG J  1 108 ? -44.608 -11.166 14.266  1.00 25.24 ? 108  ARG J CB  1 
ATOM   8991  C  CG  . ARG J  1 108 ? -45.062 -10.490 12.989  1.00 25.47 ? 108  ARG J CG  1 
ATOM   8992  C  CD  . ARG J  1 108 ? -46.577 -10.431 12.819  1.00 27.50 ? 108  ARG J CD  1 
ATOM   8993  N  NE  . ARG J  1 108 ? -46.871 -10.047 11.439  1.00 27.96 ? 108  ARG J NE  1 
ATOM   8994  C  CZ  . ARG J  1 108 ? -46.979 -8.801  10.990  1.00 27.42 ? 108  ARG J CZ  1 
ATOM   8995  N  NH1 . ARG J  1 108 ? -46.911 -7.768  11.802  1.00 26.45 ? 108  ARG J NH1 1 
ATOM   8996  N  NH2 . ARG J  1 108 ? -47.195 -8.595  9.702   1.00 28.28 ? 108  ARG J NH2 1 
ATOM   8997  N  N   . ASN J  1 109 ? -42.950 -11.543 16.730  1.00 23.98 ? 109  ASN J N   1 
ATOM   8998  C  CA  . ASN J  1 109 ? -42.404 -12.349 17.817  1.00 24.51 ? 109  ASN J CA  1 
ATOM   8999  C  C   . ASN J  1 109 ? -41.522 -11.523 18.744  1.00 23.38 ? 109  ASN J C   1 
ATOM   9000  O  O   . ASN J  1 109 ? -40.577 -10.878 18.301  1.00 21.72 ? 109  ASN J O   1 
ATOM   9001  C  CB  . ASN J  1 109 ? -41.629 -13.538 17.262  1.00 24.80 ? 109  ASN J CB  1 
ATOM   9002  C  CG  . ASN J  1 109 ? -42.526 -14.535 16.542  1.00 26.58 ? 109  ASN J CG  1 
ATOM   9003  O  OD1 . ASN J  1 109 ? -43.596 -14.877 17.028  1.00 28.16 ? 109  ASN J OD1 1 
ATOM   9004  N  ND2 . ASN J  1 109 ? -42.089 -15.008 15.379  1.00 26.57 ? 109  ASN J ND2 1 
ATOM   9005  N  N   . TRP J  1 110 ? -41.850 -11.566 20.033  1.00 24.68 ? 110  TRP J N   1 
ATOM   9006  C  CA  . TRP J  1 110 ? -41.201 -10.780 21.074  1.00 24.16 ? 110  TRP J CA  1 
ATOM   9007  C  C   . TRP J  1 110 ? -40.544 -11.676 22.116  1.00 25.57 ? 110  TRP J C   1 
ATOM   9008  O  O   . TRP J  1 110 ? -40.898 -12.844 22.262  1.00 27.36 ? 110  TRP J O   1 
ATOM   9009  C  CB  . TRP J  1 110 ? -42.230 -9.930  21.806  1.00 24.87 ? 110  TRP J CB  1 
ATOM   9010  C  CG  . TRP J  1 110 ? -42.723 -8.756  21.055  1.00 24.10 ? 110  TRP J CG  1 
ATOM   9011  C  CD1 . TRP J  1 110 ? -43.418 -8.759  19.881  1.00 24.23 ? 110  TRP J CD1 1 
ATOM   9012  C  CD2 . TRP J  1 110 ? -42.602 -7.393  21.448  1.00 23.31 ? 110  TRP J CD2 1 
ATOM   9013  N  NE1 . TRP J  1 110 ? -43.709 -7.470  19.503  1.00 23.67 ? 110  TRP J NE1 1 
ATOM   9014  C  CE2 . TRP J  1 110 ? -43.230 -6.614  20.457  1.00 23.19 ? 110  TRP J CE2 1 
ATOM   9015  C  CE3 . TRP J  1 110 ? -42.015 -6.751  22.544  1.00 22.96 ? 110  TRP J CE3 1 
ATOM   9016  C  CZ2 . TRP J  1 110 ? -43.279 -5.225  20.521  1.00 22.44 ? 110  TRP J CZ2 1 
ATOM   9017  C  CZ3 . TRP J  1 110 ? -42.070 -5.370  22.616  1.00 22.30 ? 110  TRP J CZ3 1 
ATOM   9018  C  CH2 . TRP J  1 110 ? -42.697 -4.622  21.608  1.00 22.09 ? 110  TRP J CH2 1 
ATOM   9019  N  N   . ALA J  1 111 ? -39.600 -11.095 22.855  1.00 25.19 ? 111  ALA J N   1 
ATOM   9020  C  CA  . ALA J  1 111 ? -38.949 -11.759 23.973  1.00 26.90 ? 111  ALA J CA  1 
ATOM   9021  C  C   . ALA J  1 111 ? -38.270 -10.724 24.859  1.00 26.60 ? 111  ALA J C   1 
ATOM   9022  O  O   . ALA J  1 111 ? -37.962 -9.616  24.417  1.00 24.50 ? 111  ALA J O   1 
ATOM   9023  C  CB  . ALA J  1 111 ? -37.929 -12.770 23.473  1.00 27.05 ? 111  ALA J CB  1 
ATOM   9024  N  N   . CYS J  1 112 ? -38.049 -11.107 26.113  1.00 28.98 ? 112  CYS J N   1 
ATOM   9025  C  CA  . CYS J  1 112 ? -37.265 -10.319 27.052  1.00 28.93 ? 112  CYS J CA  1 
ATOM   9026  C  C   . CYS J  1 112 ? -35.815 -10.738 26.970  1.00 28.07 ? 112  CYS J C   1 
ATOM   9027  O  O   . CYS J  1 112 ? -35.508 -11.866 26.606  1.00 28.81 ? 112  CYS J O   1 
ATOM   9028  C  CB  . CYS J  1 112 ? -37.750 -10.546 28.474  1.00 32.36 ? 112  CYS J CB  1 
ATOM   9029  S  SG  . CYS J  1 112 ? -39.519 -10.267 28.685  1.00 36.36 ? 112  CYS J SG  1 
ATOM   9030  N  N   . PHE J  1 113 ? -34.921 -9.832  27.338  1.00 26.69 ? 113  PHE J N   1 
ATOM   9031  C  CA  . PHE J  1 113 ? -33.510 -10.165 27.431  1.00 26.46 ? 113  PHE J CA  1 
ATOM   9032  C  C   . PHE J  1 113 ? -32.819 -9.244  28.417  1.00 26.66 ? 113  PHE J C   1 
ATOM   9033  O  O   . PHE J  1 113 ? -33.310 -8.156  28.705  1.00 26.10 ? 113  PHE J O   1 
ATOM   9034  C  CB  . PHE J  1 113 ? -32.838 -10.041 26.059  1.00 24.44 ? 113  PHE J CB  1 
ATOM   9035  C  CG  . PHE J  1 113 ? -32.547 -8.621  25.660  1.00 22.37 ? 113  PHE J CG  1 
ATOM   9036  C  CD1 . PHE J  1 113 ? -33.561 -7.801  25.173  1.00 21.34 ? 113  PHE J CD1 1 
ATOM   9037  C  CD2 . PHE J  1 113 ? -31.274 -8.102  25.792  1.00 21.67 ? 113  PHE J CD2 1 
ATOM   9038  C  CE1 . PHE J  1 113 ? -33.294 -6.487  24.813  1.00 19.95 ? 113  PHE J CE1 1 
ATOM   9039  C  CE2 . PHE J  1 113 ? -31.001 -6.792  25.439  1.00 20.34 ? 113  PHE J CE2 1 
ATOM   9040  C  CZ  . PHE J  1 113 ? -32.007 -5.984  24.935  1.00 19.37 ? 113  PHE J CZ  1 
ATOM   9041  N  N   . THR J  1 114 ? -31.689 -9.701  28.943  1.00 28.08 ? 114  THR J N   1 
ATOM   9042  C  CA  . THR J  1 114 ? -30.780 -8.853  29.700  1.00 28.01 ? 114  THR J CA  1 
ATOM   9043  C  C   . THR J  1 114 ? -29.414 -9.001  29.064  1.00 26.71 ? 114  THR J C   1 
ATOM   9044  O  O   . THR J  1 114 ? -29.110 -10.026 28.461  1.00 26.45 ? 114  THR J O   1 
ATOM   9045  C  CB  . THR J  1 114 ? -30.690 -9.226  31.201  1.00 31.21 ? 114  THR J CB  1 
ATOM   9046  O  OG1 . THR J  1 114 ? -30.440 -10.622 31.336  1.00 33.24 ? 114  THR J OG1 1 
ATOM   9047  C  CG2 . THR J  1 114 ? -31.965 -8.881  31.932  1.00 33.15 ? 114  THR J CG2 1 
ATOM   9048  N  N   . GLY J  1 115 ? -28.599 -7.965  29.200  1.00 25.60 ? 115  GLY J N   1 
ATOM   9049  C  CA  . GLY J  1 115 ? -27.291 -7.938  28.574  1.00 24.90 ? 115  GLY J CA  1 
ATOM   9050  C  C   . GLY J  1 115 ? -26.186 -7.635  29.543  1.00 25.91 ? 115  GLY J C   1 
ATOM   9051  O  O   . GLY J  1 115 ? -26.366 -6.861  30.471  1.00 26.33 ? 115  GLY J O   1 
ATOM   9052  N  N   . LYS J  1 116 ? -25.050 -8.284  29.320  1.00 26.77 ? 116  LYS J N   1 
ATOM   9053  C  CA  . LYS J  1 116 ? -23.823 -8.038  30.058  1.00 28.04 ? 116  LYS J CA  1 
ATOM   9054  C  C   . LYS J  1 116 ? -22.718 -7.809  29.046  1.00 27.37 ? 116  LYS J C   1 
ATOM   9055  O  O   . LYS J  1 116 ? -22.608 -8.539  28.071  1.00 27.14 ? 116  LYS J O   1 
ATOM   9056  C  CB  . LYS J  1 116 ? -23.449 -9.241  30.906  1.00 30.57 ? 116  LYS J CB  1 
ATOM   9057  C  CG  . LYS J  1 116 ? -24.411 -9.562  32.038  1.00 32.02 ? 116  LYS J CG  1 
ATOM   9058  C  CD  . LYS J  1 116 ? -23.886 -10.741 32.852  1.00 34.89 ? 116  LYS J CD  1 
ATOM   9059  C  CE  . LYS J  1 116 ? -24.931 -11.246 33.828  1.00 36.64 ? 116  LYS J CE  1 
ATOM   9060  N  NZ  . LYS J  1 116 ? -24.424 -12.425 34.583  1.00 39.82 ? 116  LYS J NZ  1 
ATOM   9061  N  N   . LYS J  1 117 ? -21.897 -6.802  29.281  1.00 27.33 ? 117  LYS J N   1 
ATOM   9062  C  CA  . LYS J  1 117 ? -20.749 -6.554  28.440  1.00 27.14 ? 117  LYS J CA  1 
ATOM   9063  C  C   . LYS J  1 117 ? -19.554 -7.416  28.838  1.00 29.52 ? 117  LYS J C   1 
ATOM   9064  O  O   . LYS J  1 117 ? -19.218 -7.508  30.011  1.00 31.18 ? 117  LYS J O   1 
ATOM   9065  C  CB  . LYS J  1 117 ? -20.362 -5.092  28.541  1.00 26.42 ? 117  LYS J CB  1 
ATOM   9066  C  CG  . LYS J  1 117 ? -19.535 -4.638  27.365  1.00 25.76 ? 117  LYS J CG  1 
ATOM   9067  C  CD  . LYS J  1 117 ? -19.211 -3.167  27.471  1.00 25.16 ? 117  LYS J CD  1 
ATOM   9068  C  CE  . LYS J  1 117 ? -17.961 -2.868  26.684  1.00 25.52 ? 117  LYS J CE  1 
ATOM   9069  N  NZ  . LYS J  1 117 ? -17.775 -1.406  26.616  1.00 25.09 ? 117  LYS J NZ  1 
ATOM   9070  N  N   . VAL J  1 118 ? -18.910 -8.027  27.847  1.00 30.01 ? 118  VAL J N   1 
ATOM   9071  C  CA  . VAL J  1 118 ? -17.659 -8.761  28.056  1.00 32.60 ? 118  VAL J CA  1 
ATOM   9072  C  C   . VAL J  1 118 ? -16.487 -7.799  28.260  1.00 33.58 ? 118  VAL J C   1 
ATOM   9073  O  O   . VAL J  1 118 ? -15.755 -7.886  29.248  1.00 35.96 ? 118  VAL J O   1 
ATOM   9074  C  CB  . VAL J  1 118 ? -17.328 -9.650  26.843  1.00 32.77 ? 118  VAL J CB  1 
ATOM   9075  C  CG1 . VAL J  1 118 ? -16.013 -10.379 27.055  1.00 35.56 ? 118  VAL J CG1 1 
ATOM   9076  C  CG2 . VAL J  1 118 ? -18.459 -10.630 26.570  1.00 32.18 ? 118  VAL J CG2 1 
ATOM   9077  N  N   . GLY J  1 119 ? -16.320 -6.891  27.301  1.00 32.55 ? 119  GLY J N   1 
ATOM   9078  C  CA  . GLY J  1 119 ? -15.228 -5.906  27.294  1.00 33.62 ? 119  GLY J CA  1 
ATOM   9079  C  C   . GLY J  1 119 ? -15.060 -5.283  25.909  1.00 32.74 ? 119  GLY J C   1 
ATOM   9080  O  O   . GLY J  1 119 ? -15.930 -5.431  25.032  1.00 31.11 ? 119  GLY J O   1 
ATOM   9081  N  N   . HIS K  2 1   ? -33.279 23.209  -4.332  1.00 41.73 ? 206  HIS K N   1 
ATOM   9082  C  CA  . HIS K  2 1   ? -32.549 23.444  -3.047  1.00 40.07 ? 206  HIS K CA  1 
ATOM   9083  C  C   . HIS K  2 1   ? -33.386 24.235  -2.036  1.00 39.58 ? 206  HIS K C   1 
ATOM   9084  O  O   . HIS K  2 1   ? -34.322 24.938  -2.405  1.00 41.19 ? 206  HIS K O   1 
ATOM   9085  C  CB  . HIS K  2 1   ? -31.184 24.115  -3.284  1.00 40.49 ? 206  HIS K CB  1 
ATOM   9086  C  CG  . HIS K  2 1   ? -31.188 25.176  -4.344  1.00 42.62 ? 206  HIS K CG  1 
ATOM   9087  N  ND1 . HIS K  2 1   ? -30.328 25.146  -5.426  1.00 43.29 ? 206  HIS K ND1 1 
ATOM   9088  C  CD2 . HIS K  2 1   ? -31.937 26.298  -4.489  1.00 43.33 ? 206  HIS K CD2 1 
ATOM   9089  C  CE1 . HIS K  2 1   ? -30.549 26.201  -6.189  1.00 44.56 ? 206  HIS K CE1 1 
ATOM   9090  N  NE2 . HIS K  2 1   ? -31.520 26.916  -5.647  1.00 44.90 ? 206  HIS K NE2 1 
ATOM   9091  N  N   . LEU K  2 2   ? -33.029 24.114  -0.759  1.00 38.27 ? 207  LEU K N   1 
ATOM   9092  C  CA  . LEU K  2 2   ? -33.854 24.630  0.339   1.00 36.91 ? 207  LEU K CA  1 
ATOM   9093  C  C   . LEU K  2 2   ? -34.056 26.137  0.260   1.00 37.63 ? 207  LEU K C   1 
ATOM   9094  O  O   . LEU K  2 2   ? -33.138 26.849  -0.128  1.00 39.17 ? 207  LEU K O   1 
ATOM   9095  C  CB  . LEU K  2 2   ? -33.228 24.262  1.684   1.00 35.82 ? 207  LEU K CB  1 
ATOM   9096  C  CG  . LEU K  2 2   ? -33.513 22.871  2.268   1.00 35.14 ? 207  LEU K CG  1 
ATOM   9097  C  CD1 . LEU K  2 2   ? -34.102 21.891  1.253   1.00 35.42 ? 207  LEU K CD1 1 
ATOM   9098  C  CD2 . LEU K  2 2   ? -32.244 22.290  2.893   1.00 34.77 ? 207  LEU K CD2 1 
ATOM   9099  N  N   . PRO K  2 3   ? -35.269 26.623  0.611   1.00 36.64 ? 208  PRO K N   1 
ATOM   9100  C  CA  . PRO K  2 3   ? -35.528 28.068  0.630   1.00 37.37 ? 208  PRO K CA  1 
ATOM   9101  C  C   . PRO K  2 3   ? -34.913 28.769  1.848   1.00 36.37 ? 208  PRO K C   1 
ATOM   9102  O  O   . PRO K  2 3   ? -34.550 28.116  2.835   1.00 33.95 ? 208  PRO K O   1 
ATOM   9103  C  CB  . PRO K  2 3   ? -37.060 28.153  0.683   1.00 37.29 ? 208  PRO K CB  1 
ATOM   9104  C  CG  . PRO K  2 3   ? -37.486 26.887  1.338   1.00 35.57 ? 208  PRO K CG  1 
ATOM   9105  C  CD  . PRO K  2 3   ? -36.478 25.842  0.943   1.00 35.15 ? 208  PRO K CD  1 
ATOM   9106  N  N   . THR K  2 4   ? -34.820 30.093  1.754   1.00 37.20 ? 209  THR K N   1 
ATOM   9107  C  CA  . THR K  2 4   ? -34.206 30.942  2.777   1.00 37.16 ? 209  THR K CA  1 
ATOM   9108  C  C   . THR K  2 4   ? -34.907 30.855  4.125   1.00 35.28 ? 209  THR K C   1 
ATOM   9109  O  O   . THR K  2 4   ? -34.267 30.942  5.175   1.00 34.14 ? 209  THR K O   1 
ATOM   9110  C  CB  . THR K  2 4   ? -34.244 32.415  2.328   1.00 39.57 ? 209  THR K CB  1 
ATOM   9111  O  OG1 . THR K  2 4   ? -33.815 32.496  0.970   1.00 41.33 ? 209  THR K OG1 1 
ATOM   9112  C  CG2 . THR K  2 4   ? -33.338 33.289  3.200   1.00 40.21 ? 209  THR K CG2 1 
ATOM   9113  N  N   . SER K  2 5   ? -36.230 30.735  4.082   1.00 34.62 ? 210  SER K N   1 
ATOM   9114  C  CA  . SER K  2 5   ? -37.029 30.546  5.286   1.00 33.10 ? 210  SER K CA  1 
ATOM   9115  C  C   . SER K  2 5   ? -38.176 29.553  5.050   1.00 31.40 ? 210  SER K C   1 
ATOM   9116  O  O   . SER K  2 5   ? -38.512 29.221  3.924   1.00 31.64 ? 210  SER K O   1 
ATOM   9117  C  CB  . SER K  2 5   ? -37.550 31.896  5.809   1.00 34.57 ? 210  SER K CB  1 
ATOM   9118  O  OG  . SER K  2 5   ? -38.216 32.633  4.803   1.00 36.27 ? 210  SER K OG  1 
ATOM   9119  N  N   . TRP K  2 6   ? -38.735 29.059  6.144   1.00 29.78 ? 211  TRP K N   1 
ATOM   9120  C  CA  . TRP K  2 6   ? -39.787 28.057  6.116   1.00 28.39 ? 211  TRP K CA  1 
ATOM   9121  C  C   . TRP K  2 6   ? -40.530 28.138  7.443   1.00 27.74 ? 211  TRP K C   1 
ATOM   9122  O  O   . TRP K  2 6   ? -39.960 28.529  8.463   1.00 27.80 ? 211  TRP K O   1 
ATOM   9123  C  CB  . TRP K  2 6   ? -39.199 26.659  5.921   1.00 26.96 ? 211  TRP K CB  1 
ATOM   9124  C  CG  . TRP K  2 6   ? -40.236 25.621  5.649   1.00 26.19 ? 211  TRP K CG  1 
ATOM   9125  C  CD1 . TRP K  2 6   ? -40.821 24.806  6.565   1.00 25.15 ? 211  TRP K CD1 1 
ATOM   9126  C  CD2 . TRP K  2 6   ? -40.838 25.300  4.381   1.00 26.69 ? 211  TRP K CD2 1 
ATOM   9127  N  NE1 . TRP K  2 6   ? -41.750 23.999  5.958   1.00 24.94 ? 211  TRP K NE1 1 
ATOM   9128  C  CE2 . TRP K  2 6   ? -41.781 24.278  4.617   1.00 25.91 ? 211  TRP K CE2 1 
ATOM   9129  C  CE3 . TRP K  2 6   ? -40.663 25.768  3.072   1.00 27.92 ? 211  TRP K CE3 1 
ATOM   9130  C  CZ2 . TRP K  2 6   ? -42.551 23.714  3.596   1.00 26.23 ? 211  TRP K CZ2 1 
ATOM   9131  C  CZ3 . TRP K  2 6   ? -41.431 25.211  2.056   1.00 28.38 ? 211  TRP K CZ3 1 
ATOM   9132  C  CH2 . TRP K  2 6   ? -42.363 24.190  2.325   1.00 27.53 ? 211  TRP K CH2 1 
ATOM   9133  N  N   . ASP K  2 7   ? -41.806 27.785  7.420   1.00 27.38 ? 212  ASP K N   1 
ATOM   9134  C  CA  . ASP K  2 7   ? -42.644 27.838  8.606   1.00 27.02 ? 212  ASP K CA  1 
ATOM   9135  C  C   . ASP K  2 7   ? -43.876 26.977  8.365   1.00 26.45 ? 212  ASP K C   1 
ATOM   9136  O  O   . ASP K  2 7   ? -44.742 27.344  7.582   1.00 27.51 ? 212  ASP K O   1 
ATOM   9137  C  CB  . ASP K  2 7   ? -43.045 29.281  8.921   1.00 28.55 ? 212  ASP K CB  1 
ATOM   9138  C  CG  . ASP K  2 7   ? -43.616 29.442  10.321  1.00 28.50 ? 212  ASP K CG  1 
ATOM   9139  O  OD1 . ASP K  2 7   ? -44.049 28.430  10.923  1.00 27.20 ? 212  ASP K OD1 1 
ATOM   9140  O  OD2 . ASP K  2 7   ? -43.627 30.597  10.823  1.00 29.76 ? 212  ASP K OD2 1 
ATOM   9141  N  N   . TRP K  2 8   ? -43.944 25.837  9.043   1.00 24.90 ? 213  TRP K N   1 
ATOM   9142  C  CA  . TRP K  2 8   ? -45.023 24.877  8.843   1.00 24.61 ? 213  TRP K CA  1 
ATOM   9143  C  C   . TRP K  2 8   ? -46.402 25.384  9.298   1.00 25.69 ? 213  TRP K C   1 
ATOM   9144  O  O   . TRP K  2 8   ? -47.418 24.777  8.947   1.00 25.59 ? 213  TRP K O   1 
ATOM   9145  C  CB  . TRP K  2 8   ? -44.684 23.516  9.492   1.00 22.97 ? 213  TRP K CB  1 
ATOM   9146  C  CG  . TRP K  2 8   ? -43.877 22.591  8.589   1.00 22.10 ? 213  TRP K CG  1 
ATOM   9147  C  CD1 . TRP K  2 8   ? -42.588 22.184  8.772   1.00 21.22 ? 213  TRP K CD1 1 
ATOM   9148  C  CD2 . TRP K  2 8   ? -44.325 21.958  7.383   1.00 22.14 ? 213  TRP K CD2 1 
ATOM   9149  N  NE1 . TRP K  2 8   ? -42.206 21.340  7.758   1.00 20.96 ? 213  TRP K NE1 1 
ATOM   9150  C  CE2 . TRP K  2 8   ? -43.255 21.183  6.894   1.00 21.42 ? 213  TRP K CE2 1 
ATOM   9151  C  CE3 . TRP K  2 8   ? -45.522 21.977  6.669   1.00 22.86 ? 213  TRP K CE3 1 
ATOM   9152  C  CZ2 . TRP K  2 8   ? -43.339 20.453  5.712   1.00 21.53 ? 213  TRP K CZ2 1 
ATOM   9153  C  CZ3 . TRP K  2 8   ? -45.608 21.241  5.499   1.00 22.93 ? 213  TRP K CZ3 1 
ATOM   9154  C  CH2 . TRP K  2 8   ? -44.521 20.492  5.031   1.00 22.24 ? 213  TRP K CH2 1 
ATOM   9155  N  N   . ARG K  2 9   ? -46.422 26.483  10.060  1.00 26.74 ? 214  ARG K N   1 
ATOM   9156  C  CA  . ARG K  2 9   ? -47.657 27.194  10.415  1.00 28.26 ? 214  ARG K CA  1 
ATOM   9157  C  C   . ARG K  2 9   ? -48.202 28.045  9.282   1.00 30.12 ? 214  ARG K C   1 
ATOM   9158  O  O   . ARG K  2 9   ? -49.296 28.568  9.397   1.00 31.55 ? 214  ARG K O   1 
ATOM   9159  C  CB  . ARG K  2 9   ? -47.430 28.141  11.596  1.00 28.74 ? 214  ARG K CB  1 
ATOM   9160  C  CG  . ARG K  2 9   ? -46.956 27.473  12.868  1.00 27.64 ? 214  ARG K CG  1 
ATOM   9161  C  CD  . ARG K  2 9   ? -46.587 28.516  13.903  1.00 28.25 ? 214  ARG K CD  1 
ATOM   9162  N  NE  . ARG K  2 9   ? -45.538 29.405  13.420  1.00 28.50 ? 214  ARG K NE  1 
ATOM   9163  C  CZ  . ARG K  2 9   ? -45.051 30.426  14.114  1.00 29.14 ? 214  ARG K CZ  1 
ATOM   9164  N  NH1 . ARG K  2 9   ? -45.495 30.691  15.335  1.00 29.58 ? 214  ARG K NH1 1 
ATOM   9165  N  NH2 . ARG K  2 9   ? -44.107 31.181  13.582  1.00 29.65 ? 214  ARG K NH2 1 
ATOM   9166  N  N   . ASN K  2 10  ? -47.438 28.211  8.209   1.00 30.73 ? 215  ASN K N   1 
ATOM   9167  C  CA  . ASN K  2 10  ? -47.843 29.071  7.101   1.00 33.19 ? 215  ASN K CA  1 
ATOM   9168  C  C   . ASN K  2 10  ? -47.100 28.691  5.836   1.00 33.45 ? 215  ASN K C   1 
ATOM   9169  O  O   . ASN K  2 10  ? -46.071 29.270  5.504   1.00 34.05 ? 215  ASN K O   1 
ATOM   9170  C  CB  . ASN K  2 10  ? -47.609 30.556  7.444   1.00 34.68 ? 215  ASN K CB  1 
ATOM   9171  C  CG  . ASN K  2 10  ? -48.061 31.501  6.334   1.00 36.84 ? 215  ASN K CG  1 
ATOM   9172  O  OD1 . ASN K  2 10  ? -48.880 31.147  5.475   1.00 37.65 ? 215  ASN K OD1 1 
ATOM   9173  N  ND2 . ASN K  2 10  ? -47.531 32.718  6.351   1.00 38.18 ? 215  ASN K ND2 1 
ATOM   9174  N  N   . VAL K  2 11  ? -47.632 27.685  5.160   1.00 34.17 ? 216  VAL K N   1 
ATOM   9175  C  CA  . VAL K  2 11  ? -47.143 27.236  3.872   1.00 35.20 ? 216  VAL K CA  1 
ATOM   9176  C  C   . VAL K  2 11  ? -48.231 27.598  2.866   1.00 37.86 ? 216  VAL K C   1 
ATOM   9177  O  O   . VAL K  2 11  ? -49.311 27.007  2.871   1.00 37.81 ? 216  VAL K O   1 
ATOM   9178  C  CB  . VAL K  2 11  ? -46.880 25.708  3.886   1.00 33.66 ? 216  VAL K CB  1 
ATOM   9179  C  CG1 . VAL K  2 11  ? -46.340 25.230  2.541   1.00 34.00 ? 216  VAL K CG1 1 
ATOM   9180  C  CG2 . VAL K  2 11  ? -45.925 25.342  5.026   1.00 32.14 ? 216  VAL K CG2 1 
ATOM   9181  N  N   . HIS K  2 12  ? -47.946 28.605  2.038   1.00 41.51 ? 217  HIS K N   1 
ATOM   9182  C  CA  . HIS K  2 12  ? -48.925 29.192  1.109   1.00 44.79 ? 217  HIS K CA  1 
ATOM   9183  C  C   . HIS K  2 12  ? -50.252 29.574  1.802   1.00 43.72 ? 217  HIS K C   1 
ATOM   9184  O  O   . HIS K  2 12  ? -51.325 29.364  1.246   1.00 45.04 ? 217  HIS K O   1 
ATOM   9185  C  CB  . HIS K  2 12  ? -49.197 28.238  -0.068  1.00 46.78 ? 217  HIS K CB  1 
ATOM   9186  C  CG  . HIS K  2 12  ? -47.958 27.744  -0.754  1.00 49.37 ? 217  HIS K CG  1 
ATOM   9187  N  ND1 . HIS K  2 12  ? -47.508 26.443  -0.635  1.00 49.82 ? 217  HIS K ND1 1 
ATOM   9188  C  CD2 . HIS K  2 12  ? -47.077 28.373  -1.570  1.00 52.45 ? 217  HIS K CD2 1 
ATOM   9189  C  CE1 . HIS K  2 12  ? -46.405 26.292  -1.349  1.00 51.04 ? 217  HIS K CE1 1 
ATOM   9190  N  NE2 . HIS K  2 12  ? -46.121 27.448  -1.925  1.00 53.43 ? 217  HIS K NE2 1 
ATOM   9191  N  N   . GLY K  2 13  ? -50.170 30.119  3.014   1.00 42.32 ? 218  GLY K N   1 
ATOM   9192  C  CA  . GLY K  2 13  ? -51.365 30.495  3.790   1.00 42.20 ? 218  GLY K CA  1 
ATOM   9193  C  C   . GLY K  2 13  ? -51.997 29.392  4.632   1.00 40.05 ? 218  GLY K C   1 
ATOM   9194  O  O   . GLY K  2 13  ? -52.976 29.636  5.333   1.00 39.87 ? 218  GLY K O   1 
ATOM   9195  N  N   . ILE K  2 14  ? -51.444 28.181  4.567   1.00 37.97 ? 219  ILE K N   1 
ATOM   9196  C  CA  . ILE K  2 14  ? -52.026 27.017  5.250   1.00 35.86 ? 219  ILE K CA  1 
ATOM   9197  C  C   . ILE K  2 14  ? -51.198 26.615  6.467   1.00 33.52 ? 219  ILE K C   1 
ATOM   9198  O  O   . ILE K  2 14  ? -49.968 26.548  6.398   1.00 32.35 ? 219  ILE K O   1 
ATOM   9199  C  CB  . ILE K  2 14  ? -52.141 25.807  4.296   1.00 35.30 ? 219  ILE K CB  1 
ATOM   9200  C  CG1 . ILE K  2 14  ? -52.863 26.207  3.000   1.00 37.02 ? 219  ILE K CG1 1 
ATOM   9201  C  CG2 . ILE K  2 14  ? -52.856 24.645  4.977   1.00 34.33 ? 219  ILE K CG2 1 
ATOM   9202  C  CD1 . ILE K  2 14  ? -54.272 26.732  3.189   1.00 38.38 ? 219  ILE K CD1 1 
ATOM   9203  N  N   . ASN K  2 15  ? -51.892 26.343  7.574   1.00 32.51 ? 220  ASN K N   1 
ATOM   9204  C  CA  . ASN K  2 15  ? -51.269 25.868  8.812   1.00 30.41 ? 220  ASN K CA  1 
ATOM   9205  C  C   . ASN K  2 15  ? -51.299 24.350  8.882   1.00 28.76 ? 220  ASN K C   1 
ATOM   9206  O  O   . ASN K  2 15  ? -52.326 23.737  8.591   1.00 28.95 ? 220  ASN K O   1 
ATOM   9207  C  CB  . ASN K  2 15  ? -52.007 26.418  10.031  1.00 30.85 ? 220  ASN K CB  1 
ATOM   9208  C  CG  . ASN K  2 15  ? -51.509 25.808  11.338  1.00 29.64 ? 220  ASN K CG  1 
ATOM   9209  O  OD1 . ASN K  2 15  ? -50.313 25.791  11.616  1.00 28.46 ? 220  ASN K OD1 1 
ATOM   9210  N  ND2 . ASN K  2 15  ? -52.427 25.292  12.136  1.00 29.83 ? 220  ASN K ND2 1 
ATOM   9211  N  N   . PHE K  2 16  ? -50.187 23.748  9.294   1.00 27.08 ? 221  PHE K N   1 
ATOM   9212  C  CA  . PHE K  2 16  ? -50.100 22.284  9.438   1.00 25.67 ? 221  PHE K CA  1 
ATOM   9213  C  C   . PHE K  2 16  ? -49.756 21.807  10.853  1.00 24.97 ? 221  PHE K C   1 
ATOM   9214  O  O   . PHE K  2 16  ? -49.708 20.605  11.103  1.00 23.98 ? 221  PHE K O   1 
ATOM   9215  C  CB  . PHE K  2 16  ? -49.074 21.728  8.444   1.00 24.69 ? 221  PHE K CB  1 
ATOM   9216  C  CG  . PHE K  2 16  ? -49.539 21.748  7.013   1.00 25.24 ? 221  PHE K CG  1 
ATOM   9217  C  CD1 . PHE K  2 16  ? -50.429 20.793  6.548   1.00 25.29 ? 221  PHE K CD1 1 
ATOM   9218  C  CD2 . PHE K  2 16  ? -49.080 22.711  6.131   1.00 25.94 ? 221  PHE K CD2 1 
ATOM   9219  C  CE1 . PHE K  2 16  ? -50.858 20.798  5.227   1.00 26.14 ? 221  PHE K CE1 1 
ATOM   9220  C  CE2 . PHE K  2 16  ? -49.500 22.724  4.809   1.00 26.91 ? 221  PHE K CE2 1 
ATOM   9221  C  CZ  . PHE K  2 16  ? -50.389 21.762  4.352   1.00 26.91 ? 221  PHE K CZ  1 
ATOM   9222  N  N   . VAL K  2 17  ? -49.533 22.744  11.773  1.00 25.72 ? 222  VAL K N   1 
ATOM   9223  C  CA  . VAL K  2 17  ? -49.087 22.444  13.133  1.00 25.21 ? 222  VAL K CA  1 
ATOM   9224  C  C   . VAL K  2 17  ? -50.277 22.478  14.072  1.00 26.13 ? 222  VAL K C   1 
ATOM   9225  O  O   . VAL K  2 17  ? -51.107 23.363  13.982  1.00 27.36 ? 222  VAL K O   1 
ATOM   9226  C  CB  . VAL K  2 17  ? -48.062 23.486  13.627  1.00 25.34 ? 222  VAL K CB  1 
ATOM   9227  C  CG1 . VAL K  2 17  ? -47.489 23.076  14.977  1.00 24.82 ? 222  VAL K CG1 1 
ATOM   9228  C  CG2 . VAL K  2 17  ? -46.950 23.677  12.601  1.00 24.97 ? 222  VAL K CG2 1 
ATOM   9229  N  N   . SER K  2 18  ? -50.342 21.529  14.992  1.00 25.91 ? 223  SER K N   1 
ATOM   9230  C  CA  . SER K  2 18  ? -51.442 21.461  15.936  1.00 27.10 ? 223  SER K CA  1 
ATOM   9231  C  C   . SER K  2 18  ? -51.348 22.570  16.995  1.00 27.99 ? 223  SER K C   1 
ATOM   9232  O  O   . SER K  2 18  ? -50.296 23.170  17.178  1.00 27.63 ? 223  SER K O   1 
ATOM   9233  C  CB  . SER K  2 18  ? -51.473 20.077  16.590  1.00 26.61 ? 223  SER K CB  1 
ATOM   9234  O  OG  . SER K  2 18  ? -50.288 19.830  17.307  1.00 25.57 ? 223  SER K OG  1 
ATOM   9235  N  N   . PRO K  2 19  ? -52.458 22.858  17.688  1.00 29.40 ? 224  PRO K N   1 
ATOM   9236  C  CA  . PRO K  2 19  ? -52.421 23.927  18.710  1.00 30.59 ? 224  PRO K CA  1 
ATOM   9237  C  C   . PRO K  2 19  ? -51.378 23.701  19.817  1.00 30.42 ? 224  PRO K C   1 
ATOM   9238  O  O   . PRO K  2 19  ? -51.072 22.544  20.159  1.00 29.91 ? 224  PRO K O   1 
ATOM   9239  C  CB  . PRO K  2 19  ? -53.836 23.905  19.301  1.00 31.62 ? 224  PRO K CB  1 
ATOM   9240  C  CG  . PRO K  2 19  ? -54.694 23.350  18.216  1.00 31.74 ? 224  PRO K CG  1 
ATOM   9241  C  CD  . PRO K  2 19  ? -53.830 22.383  17.429  1.00 30.14 ? 224  PRO K CD  1 
ATOM   9242  N  N   . VAL K  2 20  ? -50.836 24.797  20.357  1.00 31.04 ? 225  VAL K N   1 
ATOM   9243  C  CA  . VAL K  2 20  ? -49.895 24.722  21.476  1.00 30.85 ? 225  VAL K CA  1 
ATOM   9244  C  C   . VAL K  2 20  ? -50.643 24.209  22.711  1.00 31.73 ? 225  VAL K C   1 
ATOM   9245  O  O   . VAL K  2 20  ? -51.768 24.630  22.980  1.00 32.94 ? 225  VAL K O   1 
ATOM   9246  C  CB  . VAL K  2 20  ? -49.261 26.094  21.808  1.00 31.43 ? 225  VAL K CB  1 
ATOM   9247  C  CG1 . VAL K  2 20  ? -48.502 26.033  23.130  1.00 31.47 ? 225  VAL K CG1 1 
ATOM   9248  C  CG2 . VAL K  2 20  ? -48.332 26.557  20.688  1.00 30.57 ? 225  VAL K CG2 1 
ATOM   9249  N  N   . ARG K  2 21  ? -50.010 23.303  23.449  1.00 30.89 ? 226  ARG K N   1 
ATOM   9250  C  CA  . ARG K  2 21  ? -50.600 22.715  24.647  1.00 31.50 ? 226  ARG K CA  1 
ATOM   9251  C  C   . ARG K  2 21  ? -49.767 23.091  25.864  1.00 31.83 ? 226  ARG K C   1 
ATOM   9252  O  O   . ARG K  2 21  ? -48.746 23.770  25.743  1.00 31.15 ? 226  ARG K O   1 
ATOM   9253  C  CB  . ARG K  2 21  ? -50.673 21.198  24.495  1.00 30.93 ? 226  ARG K CB  1 
ATOM   9254  C  CG  . ARG K  2 21  ? -51.483 20.755  23.275  1.00 30.95 ? 226  ARG K CG  1 
ATOM   9255  C  CD  . ARG K  2 21  ? -51.935 19.304  23.366  1.00 31.00 ? 226  ARG K CD  1 
ATOM   9256  N  NE  . ARG K  2 21  ? -52.724 19.042  24.572  1.00 32.46 ? 226  ARG K NE  1 
ATOM   9257  C  CZ  . ARG K  2 21  ? -53.196 17.847  24.921  1.00 33.03 ? 226  ARG K CZ  1 
ATOM   9258  N  NH1 . ARG K  2 21  ? -52.983 16.783  24.148  1.00 32.32 ? 226  ARG K NH1 1 
ATOM   9259  N  NH2 . ARG K  2 21  ? -53.901 17.720  26.037  1.00 34.54 ? 226  ARG K NH2 1 
ATOM   9260  N  N   . ASN K  2 22  ? -50.213 22.657  27.038  1.00 32.95 ? 227  ASN K N   1 
ATOM   9261  C  CA  . ASN K  2 22  ? -49.533 22.959  28.291  1.00 33.61 ? 227  ASN K CA  1 
ATOM   9262  C  C   . ASN K  2 22  ? -49.259 21.695  29.097  1.00 33.63 ? 227  ASN K C   1 
ATOM   9263  O  O   . ASN K  2 22  ? -50.178 21.022  29.538  1.00 34.66 ? 227  ASN K O   1 
ATOM   9264  C  CB  . ASN K  2 22  ? -50.365 23.932  29.120  1.00 35.50 ? 227  ASN K CB  1 
ATOM   9265  C  CG  . ASN K  2 22  ? -49.580 24.521  30.282  1.00 36.50 ? 227  ASN K CG  1 
ATOM   9266  O  OD1 . ASN K  2 22  ? -48.811 23.828  30.952  1.00 36.03 ? 227  ASN K OD1 1 
ATOM   9267  N  ND2 . ASN K  2 22  ? -49.765 25.812  30.520  1.00 37.84 ? 227  ASN K ND2 1 
ATOM   9268  N  N   . GLN K  2 23  ? -47.988 21.388  29.315  1.00 32.95 ? 228  GLN K N   1 
ATOM   9269  C  CA  . GLN K  2 23  ? -47.628 20.186  30.053  1.00 33.21 ? 228  GLN K CA  1 
ATOM   9270  C  C   . GLN K  2 23  ? -47.841 20.326  31.571  1.00 35.34 ? 228  GLN K C   1 
ATOM   9271  O  O   . GLN K  2 23  ? -47.830 19.333  32.296  1.00 36.04 ? 228  GLN K O   1 
ATOM   9272  C  CB  . GLN K  2 23  ? -46.183 19.803  29.753  1.00 31.79 ? 228  GLN K CB  1 
ATOM   9273  C  CG  . GLN K  2 23  ? -45.133 20.708  30.383  1.00 32.21 ? 228  GLN K CG  1 
ATOM   9274  C  CD  . GLN K  2 23  ? -43.744 20.389  29.882  1.00 30.72 ? 228  GLN K CD  1 
ATOM   9275  O  OE1 . GLN K  2 23  ? -43.469 20.483  28.697  1.00 29.05 ? 228  GLN K OE1 1 
ATOM   9276  N  NE2 . GLN K  2 23  ? -42.867 20.003  30.784  1.00 31.54 ? 228  GLN K NE2 1 
ATOM   9277  N  N   . ALA K  2 24  ? -48.011 21.557  32.044  1.00 36.58 ? 229  ALA K N   1 
ATOM   9278  C  CA  . ALA K  2 24  ? -48.167 21.815  33.468  1.00 39.19 ? 229  ALA K CA  1 
ATOM   9279  C  C   . ALA K  2 24  ? -46.885 21.424  34.211  1.00 39.11 ? 229  ALA K C   1 
ATOM   9280  O  O   . ALA K  2 24  ? -45.792 21.709  33.725  1.00 38.20 ? 229  ALA K O   1 
ATOM   9281  C  CB  . ALA K  2 24  ? -49.407 21.100  34.020  1.00 40.60 ? 229  ALA K CB  1 
ATOM   9282  N  N   . SER K  2 25  ? -47.010 20.768  35.360  1.00 40.68 ? 230  SER K N   1 
ATOM   9283  C  CA  . SER K  2 25  ? -45.866 20.493  36.220  1.00 41.35 ? 230  SER K CA  1 
ATOM   9284  C  C   . SER K  2 25  ? -45.324 19.061  36.084  1.00 40.65 ? 230  SER K C   1 
ATOM   9285  O  O   . SER K  2 25  ? -44.394 18.676  36.801  1.00 42.03 ? 230  SER K O   1 
ATOM   9286  C  CB  . SER K  2 25  ? -46.241 20.798  37.670  1.00 43.94 ? 230  SER K CB  1 
ATOM   9287  O  OG  . SER K  2 25  ? -46.662 22.150  37.793  1.00 44.89 ? 230  SER K OG  1 
ATOM   9288  N  N   . CYS K  2 26  ? -45.879 18.291  35.146  1.00 39.37 ? 231  CYS K N   1 
ATOM   9289  C  CA  . CYS K  2 26  ? -45.360 16.958  34.800  1.00 37.26 ? 231  CYS K CA  1 
ATOM   9290  C  C   . CYS K  2 26  ? -44.135 17.130  33.904  1.00 35.15 ? 231  CYS K C   1 
ATOM   9291  O  O   . CYS K  2 26  ? -44.078 18.056  33.096  1.00 34.55 ? 231  CYS K O   1 
ATOM   9292  C  CB  . CYS K  2 26  ? -46.466 16.165  34.090  1.00 36.59 ? 231  CYS K CB  1 
ATOM   9293  S  SG  . CYS K  2 26  ? -46.192 14.407  33.718  1.00 35.70 ? 231  CYS K SG  1 
ATOM   9294  N  N   . GLY K  2 27  ? -43.140 16.261  34.041  1.00 34.28 ? 232  GLY K N   1 
ATOM   9295  C  CA  . GLY K  2 27  ? -41.988 16.297  33.136  1.00 31.98 ? 232  GLY K CA  1 
ATOM   9296  C  C   . GLY K  2 27  ? -42.290 15.542  31.848  1.00 30.58 ? 232  GLY K C   1 
ATOM   9297  O  O   . GLY K  2 27  ? -41.568 14.611  31.480  1.00 29.67 ? 232  GLY K O   1 
ATOM   9298  N  N   . SER K  2 28  ? -43.349 15.955  31.157  1.00 29.94 ? 233  SER K N   1 
ATOM   9299  C  CA  . SER K  2 28  ? -43.862 15.218  30.012  1.00 28.77 ? 233  SER K CA  1 
ATOM   9300  C  C   . SER K  2 28  ? -43.535 15.865  28.666  1.00 27.04 ? 233  SER K C   1 
ATOM   9301  O  O   . SER K  2 28  ? -44.197 15.583  27.671  1.00 26.15 ? 233  SER K O   1 
ATOM   9302  C  CB  . SER K  2 28  ? -45.382 15.056  30.146  1.00 29.76 ? 233  SER K CB  1 
ATOM   9303  O  OG  . SER K  2 28  ? -46.027 16.309  30.256  1.00 30.16 ? 233  SER K OG  1 
ATOM   9304  N  N   . CYS K  2 29  ? -42.512 16.713  28.627  1.00 26.69 ? 234  CYS K N   1 
ATOM   9305  C  CA  . CYS K  2 29  ? -42.166 17.425  27.404  1.00 25.64 ? 234  CYS K CA  1 
ATOM   9306  C  C   . CYS K  2 29  ? -41.867 16.477  26.239  1.00 23.74 ? 234  CYS K C   1 
ATOM   9307  O  O   . CYS K  2 29  ? -42.273 16.739  25.099  1.00 23.18 ? 234  CYS K O   1 
ATOM   9308  C  CB  . CYS K  2 29  ? -40.968 18.358  27.627  1.00 26.24 ? 234  CYS K CB  1 
ATOM   9309  S  SG  . CYS K  2 29  ? -39.465 17.539  28.189  1.00 26.74 ? 234  CYS K SG  1 
ATOM   9310  N  N   . TYR K  2 30  ? -41.174 15.383  26.533  1.00 22.58 ? 235  TYR K N   1 
ATOM   9311  C  CA  . TYR K  2 30  ? -40.838 14.397  25.520  1.00 21.24 ? 235  TYR K CA  1 
ATOM   9312  C  C   . TYR K  2 30  ? -42.105 13.835  24.875  1.00 21.17 ? 235  TYR K C   1 
ATOM   9313  O  O   . TYR K  2 30  ? -42.110 13.473  23.699  1.00 20.11 ? 235  TYR K O   1 
ATOM   9314  C  CB  . TYR K  2 30  ? -40.012 13.268  26.128  1.00 20.96 ? 235  TYR K CB  1 
ATOM   9315  C  CG  . TYR K  2 30  ? -40.798 12.422  27.087  1.00 21.88 ? 235  TYR K CG  1 
ATOM   9316  C  CD1 . TYR K  2 30  ? -41.511 11.318  26.642  1.00 21.63 ? 235  TYR K CD1 1 
ATOM   9317  C  CD2 . TYR K  2 30  ? -40.851 12.738  28.438  1.00 22.99 ? 235  TYR K CD2 1 
ATOM   9318  C  CE1 . TYR K  2 30  ? -42.237 10.541  27.515  1.00 22.79 ? 235  TYR K CE1 1 
ATOM   9319  C  CE2 . TYR K  2 30  ? -41.583 11.965  29.321  1.00 23.96 ? 235  TYR K CE2 1 
ATOM   9320  C  CZ  . TYR K  2 30  ? -42.268 10.869  28.859  1.00 23.83 ? 235  TYR K CZ  1 
ATOM   9321  O  OH  . TYR K  2 30  ? -43.001 10.107  29.729  1.00 25.03 ? 235  TYR K OH  1 
ATOM   9322  N  N   . SER K  2 31  ? -43.177 13.774  25.657  1.00 22.18 ? 236  SER K N   1 
ATOM   9323  C  CA  . SER K  2 31  ? -44.455 13.281  25.173  1.00 22.33 ? 236  SER K CA  1 
ATOM   9324  C  C   . SER K  2 31  ? -45.157 14.303  24.285  1.00 21.85 ? 236  SER K C   1 
ATOM   9325  O  O   . SER K  2 31  ? -45.682 13.958  23.237  1.00 21.41 ? 236  SER K O   1 
ATOM   9326  C  CB  . SER K  2 31  ? -45.350 12.898  26.341  1.00 23.95 ? 236  SER K CB  1 
ATOM   9327  O  OG  . SER K  2 31  ? -46.215 11.862  25.927  1.00 24.62 ? 236  SER K OG  1 
ATOM   9328  N  N   . PHE K  2 32  ? -45.133 15.565  24.679  1.00 22.07 ? 237  PHE K N   1 
ATOM   9329  C  CA  . PHE K  2 32  ? -45.762 16.609  23.870  1.00 22.04 ? 237  PHE K CA  1 
ATOM   9330  C  C   . PHE K  2 32  ? -45.018 16.885  22.581  1.00 20.47 ? 237  PHE K C   1 
ATOM   9331  O  O   . PHE K  2 32  ? -45.623 17.232  21.572  1.00 20.15 ? 237  PHE K O   1 
ATOM   9332  C  CB  . PHE K  2 32  ? -45.918 17.897  24.667  1.00 23.10 ? 237  PHE K CB  1 
ATOM   9333  C  CG  . PHE K  2 32  ? -47.040 17.849  25.649  1.00 24.77 ? 237  PHE K CG  1 
ATOM   9334  C  CD1 . PHE K  2 32  ? -46.894 17.189  26.854  1.00 25.64 ? 237  PHE K CD1 1 
ATOM   9335  C  CD2 . PHE K  2 32  ? -48.247 18.459  25.370  1.00 25.80 ? 237  PHE K CD2 1 
ATOM   9336  C  CE1 . PHE K  2 32  ? -47.933 17.153  27.773  1.00 27.30 ? 237  PHE K CE1 1 
ATOM   9337  C  CE2 . PHE K  2 32  ? -49.288 18.425  26.276  1.00 27.36 ? 237  PHE K CE2 1 
ATOM   9338  C  CZ  . PHE K  2 32  ? -49.136 17.771  27.483  1.00 28.02 ? 237  PHE K CZ  1 
ATOM   9339  N  N   . ALA K  2 33  ? -43.701 16.740  22.622  1.00 19.49 ? 238  ALA K N   1 
ATOM   9340  C  CA  . ALA K  2 33  ? -42.894 16.962  21.457  1.00 18.33 ? 238  ALA K CA  1 
ATOM   9341  C  C   . ALA K  2 33  ? -43.120 15.827  20.456  1.00 17.59 ? 238  ALA K C   1 
ATOM   9342  O  O   . ALA K  2 33  ? -43.312 16.077  19.270  1.00 17.19 ? 238  ALA K O   1 
ATOM   9343  C  CB  . ALA K  2 33  ? -41.439 17.042  21.853  1.00 18.05 ? 238  ALA K CB  1 
ATOM   9344  N  N   . SER K  2 34  ? -43.085 14.586  20.938  1.00 17.27 ? 239  SER K N   1 
ATOM   9345  C  CA  . SER K  2 34  ? -43.396 13.427  20.105  1.00 16.85 ? 239  SER K CA  1 
ATOM   9346  C  C   . SER K  2 34  ? -44.783 13.560  19.458  1.00 17.44 ? 239  SER K C   1 
ATOM   9347  O  O   . SER K  2 34  ? -44.909 13.435  18.242  1.00 17.05 ? 239  SER K O   1 
ATOM   9348  C  CB  . SER K  2 34  ? -43.352 12.131  20.923  1.00 16.79 ? 239  SER K CB  1 
ATOM   9349  O  OG  . SER K  2 34  ? -42.056 11.849  21.388  1.00 16.28 ? 239  SER K OG  1 
ATOM   9350  N  N   . MET K  2 35  ? -45.815 13.799  20.270  1.00 18.57 ? 240  MET K N   1 
ATOM   9351  C  CA  . MET K  2 35  ? -47.187 13.851  19.743  1.00 19.28 ? 240  MET K CA  1 
ATOM   9352  C  C   . MET K  2 35  ? -47.301 14.971  18.719  1.00 19.15 ? 240  MET K C   1 
ATOM   9353  O  O   . MET K  2 35  ? -47.913 14.788  17.655  1.00 19.31 ? 240  MET K O   1 
ATOM   9354  C  CB  . MET K  2 35  ? -48.231 14.087  20.841  1.00 20.57 ? 240  MET K CB  1 
ATOM   9355  C  CG  . MET K  2 35  ? -48.263 13.055  21.959  1.00 21.20 ? 240  MET K CG  1 
ATOM   9356  S  SD  . MET K  2 35  ? -48.400 11.353  21.412  1.00 21.08 ? 240  MET K SD  1 
ATOM   9357  C  CE  . MET K  2 35  ? -46.679 10.849  21.238  1.00 19.91 ? 240  MET K CE  1 
ATOM   9358  N  N   . GLY K  2 36  ? -46.713 16.124  19.051  1.00 19.04 ? 241  GLY K N   1 
ATOM   9359  C  CA  . GLY K  2 36  ? -46.710 17.276  18.170  1.00 19.15 ? 241  GLY K CA  1 
ATOM   9360  C  C   . GLY K  2 36  ? -46.153 16.968  16.798  1.00 18.39 ? 241  GLY K C   1 
ATOM   9361  O  O   . GLY K  2 36  ? -46.716 17.385  15.786  1.00 19.08 ? 241  GLY K O   1 
ATOM   9362  N  N   . MET K  2 37  ? -45.048 16.235  16.759  1.00 17.43 ? 242  MET K N   1 
ATOM   9363  C  CA  . MET K  2 37  ? -44.418 15.872  15.489  1.00 16.73 ? 242  MET K CA  1 
ATOM   9364  C  C   . MET K  2 37  ? -45.351 15.026  14.640  1.00 16.80 ? 242  MET K C   1 
ATOM   9365  O  O   . MET K  2 37  ? -45.483 15.254  13.442  1.00 16.79 ? 242  MET K O   1 
ATOM   9366  C  CB  . MET K  2 37  ? -43.125 15.087  15.721  1.00 15.95 ? 242  MET K CB  1 
ATOM   9367  C  CG  . MET K  2 37  ? -42.624 14.372  14.478  1.00 15.50 ? 242  MET K CG  1 
ATOM   9368  S  SD  . MET K  2 37  ? -40.939 13.750  14.629  1.00 14.98 ? 242  MET K SD  1 
ATOM   9369  C  CE  . MET K  2 37  ? -41.123 12.746  16.087  1.00 14.67 ? 242  MET K CE  1 
ATOM   9370  N  N   . LEU K  2 38  ? -45.975 14.035  15.264  1.00 16.87 ? 243  LEU K N   1 
ATOM   9371  C  CA  . LEU K  2 38  ? -46.780 13.080  14.535  1.00 17.03 ? 243  LEU K CA  1 
ATOM   9372  C  C   . LEU K  2 38  ? -48.114 13.676  14.122  1.00 18.07 ? 243  LEU K C   1 
ATOM   9373  O  O   . LEU K  2 38  ? -48.612 13.356  13.042  1.00 18.26 ? 243  LEU K O   1 
ATOM   9374  C  CB  . LEU K  2 38  ? -46.989 11.807  15.358  1.00 16.99 ? 243  LEU K CB  1 
ATOM   9375  C  CG  . LEU K  2 38  ? -45.706 11.036  15.695  1.00 16.25 ? 243  LEU K CG  1 
ATOM   9376  C  CD1 . LEU K  2 38  ? -46.030 9.785   16.492  1.00 16.54 ? 243  LEU K CD1 1 
ATOM   9377  C  CD2 . LEU K  2 38  ? -44.929 10.687  14.443  1.00 15.65 ? 243  LEU K CD2 1 
ATOM   9378  N  N   . GLU K  2 39  ? -48.683 14.536  14.973  1.00 19.02 ? 244  GLU K N   1 
ATOM   9379  C  CA  . GLU K  2 39  ? -49.899 15.286  14.631  1.00 20.11 ? 244  GLU K CA  1 
ATOM   9380  C  C   . GLU K  2 39  ? -49.671 16.113  13.369  1.00 19.90 ? 244  GLU K C   1 
ATOM   9381  O  O   . GLU K  2 39  ? -50.504 16.105  12.466  1.00 20.48 ? 244  GLU K O   1 
ATOM   9382  C  CB  . GLU K  2 39  ? -50.332 16.226  15.776  1.00 21.40 ? 244  GLU K CB  1 
ATOM   9383  C  CG  . GLU K  2 39  ? -50.948 15.521  16.977  1.00 22.33 ? 244  GLU K CG  1 
ATOM   9384  C  CD  . GLU K  2 39  ? -50.889 16.319  18.282  1.00 23.69 ? 244  GLU K CD  1 
ATOM   9385  O  OE1 . GLU K  2 39  ? -50.613 17.549  18.261  1.00 24.61 ? 244  GLU K OE1 1 
ATOM   9386  O  OE2 . GLU K  2 39  ? -51.137 15.715  19.360  1.00 24.80 ? 244  GLU K OE2 1 
ATOM   9387  N  N   . ALA K  2 40  ? -48.540 16.809  13.311  1.00 19.17 ? 245  ALA K N   1 
ATOM   9388  C  CA  . ALA K  2 40  ? -48.235 17.704  12.200  1.00 19.36 ? 245  ALA K CA  1 
ATOM   9389  C  C   . ALA K  2 40  ? -47.970 16.928  10.920  1.00 19.00 ? 245  ALA K C   1 
ATOM   9390  O  O   . ALA K  2 40  ? -48.392 17.331  9.832   1.00 19.55 ? 245  ALA K O   1 
ATOM   9391  C  CB  . ALA K  2 40  ? -47.031 18.575  12.530  1.00 19.01 ? 245  ALA K CB  1 
ATOM   9392  N  N   . ARG K  2 41  ? -47.258 15.816  11.061  1.00 18.14 ? 246  ARG K N   1 
ATOM   9393  C  CA  . ARG K  2 41  ? -46.943 14.965  9.924   1.00 17.84 ? 246  ARG K CA  1 
ATOM   9394  C  C   . ARG K  2 41  ? -48.164 14.231  9.397   1.00 18.30 ? 246  ARG K C   1 
ATOM   9395  O  O   . ARG K  2 41  ? -48.240 13.958  8.211   1.00 18.71 ? 246  ARG K O   1 
ATOM   9396  C  CB  . ARG K  2 41  ? -45.804 14.005  10.265  1.00 16.90 ? 246  ARG K CB  1 
ATOM   9397  C  CG  . ARG K  2 41  ? -44.488 14.742  10.270  1.00 16.66 ? 246  ARG K CG  1 
ATOM   9398  C  CD  . ARG K  2 41  ? -43.294 13.855  10.580  1.00 15.96 ? 246  ARG K CD  1 
ATOM   9399  N  NE  . ARG K  2 41  ? -42.081 14.655  10.524  1.00 15.80 ? 246  ARG K NE  1 
ATOM   9400  C  CZ  . ARG K  2 41  ? -40.877 14.198  10.209  1.00 15.46 ? 246  ARG K CZ  1 
ATOM   9401  N  NH1 . ARG K  2 41  ? -40.686 12.918  9.938   1.00 15.05 ? 246  ARG K NH1 1 
ATOM   9402  N  NH2 . ARG K  2 41  ? -39.850 15.046  10.173  1.00 15.61 ? 246  ARG K NH2 1 
ATOM   9403  N  N   . ILE K  2 42  ? -49.116 13.916  10.267  1.00 18.70 ? 247  ILE K N   1 
ATOM   9404  C  CA  . ILE K  2 42  ? -50.397 13.368  9.800   1.00 19.48 ? 247  ILE K CA  1 
ATOM   9405  C  C   . ILE K  2 42  ? -51.153 14.472  9.044   1.00 20.54 ? 247  ILE K C   1 
ATOM   9406  O  O   . ILE K  2 42  ? -51.680 14.233  7.969   1.00 21.21 ? 247  ILE K O   1 
ATOM   9407  C  CB  . ILE K  2 42  ? -51.227 12.748  10.952  1.00 19.64 ? 247  ILE K CB  1 
ATOM   9408  C  CG1 . ILE K  2 42  ? -50.556 11.463  11.447  1.00 18.82 ? 247  ILE K CG1 1 
ATOM   9409  C  CG2 . ILE K  2 42  ? -52.644 12.395  10.498  1.00 20.59 ? 247  ILE K CG2 1 
ATOM   9410  C  CD1 . ILE K  2 42  ? -51.072 10.966  12.781  1.00 19.14 ? 247  ILE K CD1 1 
ATOM   9411  N  N   . ARG K  2 43  ? -51.154 15.688  9.575   1.00 21.18 ? 248  ARG K N   1 
ATOM   9412  C  CA  . ARG K  2 43  ? -51.750 16.809  8.852   1.00 22.41 ? 248  ARG K CA  1 
ATOM   9413  C  C   . ARG K  2 43  ? -51.073 17.029  7.471   1.00 22.34 ? 248  ARG K C   1 
ATOM   9414  O  O   . ARG K  2 43  ? -51.746 17.255  6.485   1.00 22.88 ? 248  ARG K O   1 
ATOM   9415  C  CB  . ARG K  2 43  ? -51.717 18.096  9.692   1.00 23.09 ? 248  ARG K CB  1 
ATOM   9416  C  CG  . ARG K  2 43  ? -52.826 18.260  10.737  1.00 24.36 ? 248  ARG K CG  1 
ATOM   9417  C  CD  . ARG K  2 43  ? -52.454 19.403  11.677  1.00 25.00 ? 248  ARG K CD  1 
ATOM   9418  N  NE  . ARG K  2 43  ? -53.426 19.780  12.716  1.00 26.66 ? 248  ARG K NE  1 
ATOM   9419  C  CZ  . ARG K  2 43  ? -53.698 19.064  13.819  1.00 26.60 ? 248  ARG K CZ  1 
ATOM   9420  N  NH1 . ARG K  2 43  ? -53.136 17.861  14.031  1.00 25.81 ? 248  ARG K NH1 1 
ATOM   9421  N  NH2 . ARG K  2 43  ? -54.562 19.533  14.703  1.00 27.42 ? 248  ARG K NH2 1 
ATOM   9422  N  N   . ILE K  2 44  ? -49.744 16.962  7.411   1.00 21.75 ? 249  ILE K N   1 
ATOM   9423  C  CA  . ILE K  2 44  ? -49.037 17.166  6.146   1.00 22.05 ? 249  ILE K CA  1 
ATOM   9424  C  C   . ILE K  2 44  ? -49.317 16.049  5.144   1.00 22.38 ? 249  ILE K C   1 
ATOM   9425  O  O   . ILE K  2 44  ? -49.651 16.320  3.991   1.00 23.99 ? 249  ILE K O   1 
ATOM   9426  C  CB  . ILE K  2 44  ? -47.514 17.322  6.360   1.00 21.17 ? 249  ILE K CB  1 
ATOM   9427  C  CG1 . ILE K  2 44  ? -47.234 18.662  7.052   1.00 21.38 ? 249  ILE K CG1 1 
ATOM   9428  C  CG2 . ILE K  2 44  ? -46.755 17.246  5.030   1.00 21.22 ? 249  ILE K CG2 1 
ATOM   9429  C  CD1 . ILE K  2 44  ? -45.882 18.725  7.730   1.00 20.60 ? 249  ILE K CD1 1 
ATOM   9430  N  N   . LEU K  2 45  ? -49.188 14.800  5.581   1.00 21.88 ? 250  LEU K N   1 
ATOM   9431  C  CA  . LEU K  2 45  ? -49.422 13.652  4.695   1.00 22.28 ? 250  LEU K CA  1 
ATOM   9432  C  C   . LEU K  2 45  ? -50.861 13.550  4.168   1.00 23.76 ? 250  LEU K C   1 
ATOM   9433  O  O   . LEU K  2 45  ? -51.079 12.929  3.143   1.00 25.07 ? 250  LEU K O   1 
ATOM   9434  C  CB  . LEU K  2 45  ? -49.076 12.347  5.401   1.00 21.23 ? 250  LEU K CB  1 
ATOM   9435  C  CG  . LEU K  2 45  ? -47.603 12.131  5.753   1.00 20.24 ? 250  LEU K CG  1 
ATOM   9436  C  CD1 . LEU K  2 45  ? -47.497 11.089  6.858   1.00 19.58 ? 250  LEU K CD1 1 
ATOM   9437  C  CD2 . LEU K  2 45  ? -46.800 11.712  4.521   1.00 20.31 ? 250  LEU K CD2 1 
ATOM   9438  N  N   . THR K  2 46  ? -51.831 14.124  4.880   1.00 24.69 ? 251  THR K N   1 
ATOM   9439  C  CA  . THR K  2 46  ? -53.238 14.049  4.469   1.00 26.52 ? 251  THR K CA  1 
ATOM   9440  C  C   . THR K  2 46  ? -53.810 15.388  3.986   1.00 28.59 ? 251  THR K C   1 
ATOM   9441  O  O   . THR K  2 46  ? -55.011 15.497  3.759   1.00 29.76 ? 251  THR K O   1 
ATOM   9442  C  CB  . THR K  2 46  ? -54.117 13.529  5.622   1.00 26.31 ? 251  THR K CB  1 
ATOM   9443  O  OG1 . THR K  2 46  ? -54.114 14.470  6.710   1.00 26.22 ? 251  THR K OG1 1 
ATOM   9444  C  CG2 . THR K  2 46  ? -53.610 12.171  6.107   1.00 25.12 ? 251  THR K CG2 1 
ATOM   9445  N  N   . ASN K  2 47  ? -52.946 16.394  3.837   1.00 29.67 ? 252  ASN K N   1 
ATOM   9446  C  CA  . ASN K  2 47  ? -53.354 17.759  3.463   1.00 32.48 ? 252  ASN K CA  1 
ATOM   9447  C  C   . ASN K  2 47  ? -54.483 18.280  4.354   1.00 31.83 ? 252  ASN K C   1 
ATOM   9448  O  O   . ASN K  2 47  ? -55.513 18.739  3.872   1.00 32.75 ? 252  ASN K O   1 
ATOM   9449  C  CB  . ASN K  2 47  ? -53.760 17.833  1.978   1.00 36.10 ? 252  ASN K CB  1 
ATOM   9450  C  CG  . ASN K  2 47  ? -53.868 19.263  1.466   1.00 39.87 ? 252  ASN K CG  1 
ATOM   9451  O  OD1 . ASN K  2 47  ? -53.157 20.145  1.931   1.00 40.54 ? 252  ASN K OD1 1 
ATOM   9452  N  ND2 . ASN K  2 47  ? -54.772 19.493  0.497   1.00 47.30 ? 252  ASN K ND2 1 
ATOM   9453  N  N   . ASN K  2 48  ? -54.276 18.175  5.661   1.00 30.05 ? 253  ASN K N   1 
ATOM   9454  C  CA  . ASN K  2 48  ? -55.250 18.617  6.659   1.00 30.38 ? 253  ASN K CA  1 
ATOM   9455  C  C   . ASN K  2 48  ? -56.623 17.930  6.665   1.00 30.71 ? 253  ASN K C   1 
ATOM   9456  O  O   . ASN K  2 48  ? -57.529 18.389  7.360   1.00 31.24 ? 253  ASN K O   1 
ATOM   9457  C  CB  . ASN K  2 48  ? -55.415 20.149  6.603   1.00 31.21 ? 253  ASN K CB  1 
ATOM   9458  C  CG  . ASN K  2 48  ? -54.332 20.868  7.374   1.00 30.24 ? 253  ASN K CG  1 
ATOM   9459  O  OD1 . ASN K  2 48  ? -53.995 20.475  8.481   1.00 29.22 ? 253  ASN K OD1 1 
ATOM   9460  N  ND2 . ASN K  2 48  ? -53.779 21.920  6.793   1.00 30.76 ? 253  ASN K ND2 1 
ATOM   9461  N  N   . SER K  2 49  ? -56.775 16.817  5.945   1.00 30.37 ? 254  SER K N   1 
ATOM   9462  C  CA  . SER K  2 49  ? -58.041 16.075  5.987   1.00 31.00 ? 254  SER K CA  1 
ATOM   9463  C  C   . SER K  2 49  ? -58.131 15.201  7.258   1.00 30.02 ? 254  SER K C   1 
ATOM   9464  O  O   . SER K  2 49  ? -59.210 14.741  7.619   1.00 30.87 ? 254  SER K O   1 
ATOM   9465  C  CB  . SER K  2 49  ? -58.246 15.251  4.717   1.00 31.31 ? 254  SER K CB  1 
ATOM   9466  O  OG  . SER K  2 49  ? -57.583 14.005  4.795   1.00 31.05 ? 254  SER K OG  1 
ATOM   9467  N  N   . GLN K  2 50  ? -56.996 14.980  7.919   1.00 28.07 ? 255  GLN K N   1 
ATOM   9468  C  CA  . GLN K  2 50  ? -56.953 14.376  9.247   1.00 27.25 ? 255  GLN K CA  1 
ATOM   9469  C  C   . GLN K  2 50  ? -56.169 15.281  10.198  1.00 26.53 ? 255  GLN K C   1 
ATOM   9470  O  O   . GLN K  2 50  ? -55.031 15.652  9.910   1.00 25.81 ? 255  GLN K O   1 
ATOM   9471  C  CB  . GLN K  2 50  ? -56.282 13.017  9.191   1.00 26.22 ? 255  GLN K CB  1 
ATOM   9472  C  CG  . GLN K  2 50  ? -57.105 11.968  8.484   1.00 26.74 ? 255  GLN K CG  1 
ATOM   9473  C  CD  . GLN K  2 50  ? -56.403 10.636  8.422   1.00 25.77 ? 255  GLN K CD  1 
ATOM   9474  O  OE1 . GLN K  2 50  ? -55.762 10.204  9.383   1.00 25.12 ? 255  GLN K OE1 1 
ATOM   9475  N  NE2 . GLN K  2 50  ? -56.510 9.979   7.283   1.00 25.85 ? 255  GLN K NE2 1 
ATOM   9476  N  N   . THR K  2 51  ? -56.775 15.618  11.332  1.00 27.02 ? 256  THR K N   1 
ATOM   9477  C  CA  . THR K  2 51  ? -56.190 16.549  12.288  1.00 26.84 ? 256  THR K CA  1 
ATOM   9478  C  C   . THR K  2 51  ? -56.298 16.006  13.720  1.00 26.72 ? 256  THR K C   1 
ATOM   9479  O  O   . THR K  2 51  ? -56.656 16.749  14.638  1.00 27.52 ? 256  THR K O   1 
ATOM   9480  C  CB  . THR K  2 51  ? -56.867 17.947  12.191  1.00 28.18 ? 256  THR K CB  1 
ATOM   9481  O  OG1 . THR K  2 51  ? -58.248 17.837  12.548  1.00 29.44 ? 256  THR K OG1 1 
ATOM   9482  C  CG2 . THR K  2 51  ? -56.776 18.527  10.758  1.00 28.37 ? 256  THR K CG2 1 
ATOM   9483  N  N   . PRO K  2 52  ? -55.958 14.718  13.920  1.00 25.92 ? 257  PRO K N   1 
ATOM   9484  C  CA  . PRO K  2 52  ? -56.053 14.108  15.240  1.00 26.11 ? 257  PRO K CA  1 
ATOM   9485  C  C   . PRO K  2 52  ? -55.093 14.719  16.260  1.00 25.74 ? 257  PRO K C   1 
ATOM   9486  O  O   . PRO K  2 52  ? -53.950 15.036  15.923  1.00 24.82 ? 257  PRO K O   1 
ATOM   9487  C  CB  . PRO K  2 52  ? -55.652 12.662  14.975  1.00 25.33 ? 257  PRO K CB  1 
ATOM   9488  C  CG  . PRO K  2 52  ? -54.675 12.776  13.861  1.00 24.39 ? 257  PRO K CG  1 
ATOM   9489  C  CD  . PRO K  2 52  ? -55.305 13.805  12.967  1.00 25.05 ? 257  PRO K CD  1 
ATOM   9490  N  N   . ILE K  2 53  ? -55.585 14.896  17.483  1.00 26.69 ? 258  ILE K N   1 
ATOM   9491  C  CA  . ILE K  2 53  ? -54.784 15.286  18.638  1.00 26.69 ? 258  ILE K CA  1 
ATOM   9492  C  C   . ILE K  2 53  ? -54.528 13.987  19.417  1.00 26.74 ? 258  ILE K C   1 
ATOM   9493  O  O   . ILE K  2 53  ? -55.474 13.354  19.896  1.00 27.77 ? 258  ILE K O   1 
ATOM   9494  C  CB  . ILE K  2 53  ? -55.541 16.312  19.524  1.00 28.00 ? 258  ILE K CB  1 
ATOM   9495  C  CG1 . ILE K  2 53  ? -56.032 17.508  18.699  1.00 28.41 ? 258  ILE K CG1 1 
ATOM   9496  C  CG2 . ILE K  2 53  ? -54.681 16.787  20.683  1.00 27.91 ? 258  ILE K CG2 1 
ATOM   9497  C  CD1 . ILE K  2 53  ? -54.936 18.310  18.035  1.00 27.51 ? 258  ILE K CD1 1 
ATOM   9498  N  N   . LEU K  2 54  ? -53.264 13.574  19.502  1.00 25.84 ? 259  LEU K N   1 
ATOM   9499  C  CA  . LEU K  2 54  ? -52.899 12.305  20.147  1.00 25.94 ? 259  LEU K CA  1 
ATOM   9500  C  C   . LEU K  2 54  ? -52.679 12.543  21.628  1.00 26.76 ? 259  LEU K C   1 
ATOM   9501  O  O   . LEU K  2 54  ? -52.426 13.667  22.032  1.00 27.39 ? 259  LEU K O   1 
ATOM   9502  C  CB  . LEU K  2 54  ? -51.621 11.719  19.530  1.00 24.50 ? 259  LEU K CB  1 
ATOM   9503  C  CG  . LEU K  2 54  ? -51.639 11.526  18.016  1.00 23.98 ? 259  LEU K CG  1 
ATOM   9504  C  CD1 . LEU K  2 54  ? -50.288 11.035  17.518  1.00 22.87 ? 259  LEU K CD1 1 
ATOM   9505  C  CD2 . LEU K  2 54  ? -52.751 10.574  17.597  1.00 24.65 ? 259  LEU K CD2 1 
ATOM   9506  N  N   . SER K  2 55  ? -52.740 11.478  22.421  1.00 27.37 ? 260  SER K N   1 
ATOM   9507  C  CA  . SER K  2 55  ? -52.731 11.578  23.882  1.00 28.73 ? 260  SER K CA  1 
ATOM   9508  C  C   . SER K  2 55  ? -51.329 11.426  24.480  1.00 28.18 ? 260  SER K C   1 
ATOM   9509  O  O   . SER K  2 55  ? -50.793 10.323  24.467  1.00 28.18 ? 260  SER K O   1 
ATOM   9510  C  CB  . SER K  2 55  ? -53.634 10.493  24.479  1.00 29.94 ? 260  SER K CB  1 
ATOM   9511  O  OG  . SER K  2 55  ? -53.335 10.273  25.845  1.00 31.03 ? 260  SER K OG  1 
ATOM   9512  N  N   . PRO K  2 56  ? -50.747 12.518  25.024  1.00 28.11 ? 261  PRO K N   1 
ATOM   9513  C  CA  . PRO K  2 56  ? -49.490 12.417  25.772  1.00 27.86 ? 261  PRO K CA  1 
ATOM   9514  C  C   . PRO K  2 56  ? -49.616 11.618  27.069  1.00 29.13 ? 261  PRO K C   1 
ATOM   9515  O  O   . PRO K  2 56  ? -48.639 11.000  27.489  1.00 28.51 ? 261  PRO K O   1 
ATOM   9516  C  CB  . PRO K  2 56  ? -49.153 13.868  26.132  1.00 28.03 ? 261  PRO K CB  1 
ATOM   9517  C  CG  . PRO K  2 56  ? -49.993 14.710  25.257  1.00 28.18 ? 261  PRO K CG  1 
ATOM   9518  C  CD  . PRO K  2 56  ? -51.196 13.912  24.891  1.00 28.67 ? 261  PRO K CD  1 
ATOM   9519  N  N   . GLN K  2 57  ? -50.801 11.658  27.692  1.00 30.66 ? 262  GLN K N   1 
ATOM   9520  C  CA  . GLN K  2 57  ? -51.070 10.976  28.963  1.00 32.30 ? 262  GLN K CA  1 
ATOM   9521  C  C   . GLN K  2 57  ? -50.965 9.461   28.873  1.00 31.92 ? 262  GLN K C   1 
ATOM   9522  O  O   . GLN K  2 57  ? -50.444 8.823   29.774  1.00 32.61 ? 262  GLN K O   1 
ATOM   9523  C  CB  . GLN K  2 57  ? -52.460 11.352  29.486  1.00 34.68 ? 262  GLN K CB  1 
ATOM   9524  C  CG  . GLN K  2 57  ? -52.744 10.926  30.925  1.00 36.72 ? 262  GLN K CG  1 
ATOM   9525  C  CD  . GLN K  2 57  ? -51.829 11.599  31.933  1.00 36.94 ? 262  GLN K CD  1 
ATOM   9526  O  OE1 . GLN K  2 57  ? -51.673 12.819  31.921  1.00 37.00 ? 262  GLN K OE1 1 
ATOM   9527  N  NE2 . GLN K  2 57  ? -51.218 10.805  32.812  1.00 37.49 ? 262  GLN K NE2 1 
ATOM   9528  N  N   . GLU K  2 58  ? -51.458 8.875   27.793  1.00 31.23 ? 263  GLU K N   1 
ATOM   9529  C  CA  . GLU K  2 58  ? -51.294 7.440   27.593  1.00 31.12 ? 263  GLU K CA  1 
ATOM   9530  C  C   . GLU K  2 58  ? -49.809 7.058   27.560  1.00 29.61 ? 263  GLU K C   1 
ATOM   9531  O  O   . GLU K  2 58  ? -49.420 5.979   28.012  1.00 29.96 ? 263  GLU K O   1 
ATOM   9532  C  CB  . GLU K  2 58  ? -51.989 7.004   26.314  1.00 30.89 ? 263  GLU K CB  1 
ATOM   9533  C  CG  . GLU K  2 58  ? -51.989 5.498   26.083  1.00 31.10 ? 263  GLU K CG  1 
ATOM   9534  C  CD  . GLU K  2 58  ? -50.855 5.032   25.202  1.00 29.65 ? 263  GLU K CD  1 
ATOM   9535  O  OE1 . GLU K  2 58  ? -50.502 5.759   24.247  1.00 29.22 ? 263  GLU K OE1 1 
ATOM   9536  O  OE2 . GLU K  2 58  ? -50.316 3.936   25.463  1.00 29.27 ? 263  GLU K OE2 1 
ATOM   9537  N  N   . VAL K  2 59  ? -48.977 7.943   27.029  1.00 27.83 ? 264  VAL K N   1 
ATOM   9538  C  CA  . VAL K  2 59  ? -47.553 7.692   27.054  1.00 26.70 ? 264  VAL K CA  1 
ATOM   9539  C  C   . VAL K  2 59  ? -47.105 7.810   28.503  1.00 27.53 ? 264  VAL K C   1 
ATOM   9540  O  O   . VAL K  2 59  ? -46.570 6.867   29.070  1.00 27.69 ? 264  VAL K O   1 
ATOM   9541  C  CB  . VAL K  2 59  ? -46.750 8.655   26.153  1.00 25.00 ? 264  VAL K CB  1 
ATOM   9542  C  CG1 . VAL K  2 59  ? -45.262 8.423   26.361  1.00 24.19 ? 264  VAL K CG1 1 
ATOM   9543  C  CG2 . VAL K  2 59  ? -47.122 8.471   24.688  1.00 24.16 ? 264  VAL K CG2 1 
ATOM   9544  N  N   . VAL K  2 60  ? -47.375 8.955   29.109  1.00 28.10 ? 265  VAL K N   1 
ATOM   9545  C  CA  . VAL K  2 60  ? -46.939 9.211   30.475  1.00 29.23 ? 265  VAL K CA  1 
ATOM   9546  C  C   . VAL K  2 60  ? -47.399 8.112   31.438  1.00 30.91 ? 265  VAL K C   1 
ATOM   9547  O  O   . VAL K  2 60  ? -46.649 7.713   32.314  1.00 31.22 ? 265  VAL K O   1 
ATOM   9548  C  CB  . VAL K  2 60  ? -47.394 10.607  30.957  1.00 29.81 ? 265  VAL K CB  1 
ATOM   9549  C  CG1 . VAL K  2 60  ? -47.231 10.746  32.470  1.00 31.44 ? 265  VAL K CG1 1 
ATOM   9550  C  CG2 . VAL K  2 60  ? -46.606 11.698  30.240  1.00 28.35 ? 265  VAL K CG2 1 
ATOM   9551  N  N   . SER K  2 61  ? -48.613 7.605   31.249  1.00 32.15 ? 266  SER K N   1 
ATOM   9552  C  CA  . SER K  2 61  ? -49.183 6.642   32.175  1.00 34.25 ? 266  SER K CA  1 
ATOM   9553  C  C   . SER K  2 61  ? -48.878 5.199   31.822  1.00 34.48 ? 266  SER K C   1 
ATOM   9554  O  O   . SER K  2 61  ? -48.768 4.371   32.717  1.00 36.08 ? 266  SER K O   1 
ATOM   9555  C  CB  . SER K  2 61  ? -50.700 6.840   32.290  1.00 35.70 ? 266  SER K CB  1 
ATOM   9556  O  OG  . SER K  2 61  ? -51.001 8.108   32.853  1.00 36.20 ? 266  SER K OG  1 
ATOM   9557  N  N   . CYS K  2 62  ? -48.735 4.886   30.538  1.00 33.66 ? 267  CYS K N   1 
ATOM   9558  C  CA  . CYS K  2 62  ? -48.624 3.483   30.119  1.00 34.16 ? 267  CYS K CA  1 
ATOM   9559  C  C   . CYS K  2 62  ? -47.277 3.055   29.561  1.00 31.44 ? 267  CYS K C   1 
ATOM   9560  O  O   . CYS K  2 62  ? -46.999 1.866   29.526  1.00 31.36 ? 267  CYS K O   1 
ATOM   9561  C  CB  . CYS K  2 62  ? -49.704 3.137   29.082  1.00 35.76 ? 267  CYS K CB  1 
ATOM   9562  S  SG  . CYS K  2 62  ? -51.372 3.673   29.538  1.00 40.03 ? 267  CYS K SG  1 
ATOM   9563  N  N   . SER K  2 63  ? -46.448 3.986   29.097  1.00 29.32 ? 268  SER K N   1 
ATOM   9564  C  CA  . SER K  2 63  ? -45.213 3.591   28.404  1.00 27.14 ? 268  SER K CA  1 
ATOM   9565  C  C   . SER K  2 63  ? -44.089 3.220   29.365  1.00 27.17 ? 268  SER K C   1 
ATOM   9566  O  O   . SER K  2 63  ? -43.666 4.028   30.205  1.00 27.01 ? 268  SER K O   1 
ATOM   9567  C  CB  . SER K  2 63  ? -44.727 4.677   27.440  1.00 25.42 ? 268  SER K CB  1 
ATOM   9568  O  OG  . SER K  2 63  ? -43.748 4.153   26.557  1.00 23.73 ? 268  SER K OG  1 
ATOM   9569  N  N   . GLN K  2 64  ? -43.617 1.987   29.212  1.00 27.01 ? 269  GLN K N   1 
ATOM   9570  C  CA  . GLN K  2 64  ? -42.385 1.528   29.828  1.00 27.14 ? 269  GLN K CA  1 
ATOM   9571  C  C   . GLN K  2 64  ? -41.163 1.931   28.997  1.00 25.15 ? 269  GLN K C   1 
ATOM   9572  O  O   . GLN K  2 64  ? -40.034 1.644   29.376  1.00 25.40 ? 269  GLN K O   1 
ATOM   9573  C  CB  . GLN K  2 64  ? -42.413 0.005   30.015  1.00 28.53 ? 269  GLN K CB  1 
ATOM   9574  C  CG  . GLN K  2 64  ? -43.129 -0.431  31.280  1.00 30.97 ? 269  GLN K CG  1 
ATOM   9575  C  CD  . GLN K  2 64  ? -43.774 -1.807  31.156  1.00 32.56 ? 269  GLN K CD  1 
ATOM   9576  O  OE1 . GLN K  2 64  ? -43.156 -2.770  30.682  1.00 32.57 ? 269  GLN K OE1 1 
ATOM   9577  N  NE2 . GLN K  2 64  ? -45.032 -1.908  31.592  1.00 34.10 ? 269  GLN K NE2 1 
ATOM   9578  N  N   . TYR K  2 65  ? -41.363 2.588   27.862  1.00 23.40 ? 270  TYR K N   1 
ATOM   9579  C  CA  . TYR K  2 65  ? -40.228 3.132   27.127  1.00 21.78 ? 270  TYR K CA  1 
ATOM   9580  C  C   . TYR K  2 65  ? -39.836 4.526   27.646  1.00 21.61 ? 270  TYR K C   1 
ATOM   9581  O  O   . TYR K  2 65  ? -38.921 5.165   27.100  1.00 20.77 ? 270  TYR K O   1 
ATOM   9582  C  CB  . TYR K  2 65  ? -40.510 3.153   25.627  1.00 20.36 ? 270  TYR K CB  1 
ATOM   9583  C  CG  . TYR K  2 65  ? -40.628 1.789   24.961  1.00 20.27 ? 270  TYR K CG  1 
ATOM   9584  C  CD1 . TYR K  2 65  ? -40.261 0.602   25.607  1.00 21.17 ? 270  TYR K CD1 1 
ATOM   9585  C  CD2 . TYR K  2 65  ? -41.087 1.691   23.655  1.00 19.37 ? 270  TYR K CD2 1 
ATOM   9586  C  CE1 . TYR K  2 65  ? -40.384 -0.624  24.971  1.00 21.17 ? 270  TYR K CE1 1 
ATOM   9587  C  CE2 . TYR K  2 65  ? -41.189 0.472   23.016  1.00 19.41 ? 270  TYR K CE2 1 
ATOM   9588  C  CZ  . TYR K  2 65  ? -40.844 -0.674  23.670  1.00 20.27 ? 270  TYR K CZ  1 
ATOM   9589  O  OH  . TYR K  2 65  ? -40.959 -1.855  22.987  1.00 20.35 ? 270  TYR K OH  1 
ATOM   9590  N  N   . ALA K  2 66  ? -40.509 4.974   28.710  1.00 22.59 ? 271  ALA K N   1 
ATOM   9591  C  CA  . ALA K  2 66  ? -40.200 6.241   29.364  1.00 22.68 ? 271  ALA K CA  1 
ATOM   9592  C  C   . ALA K  2 66  ? -40.442 6.181   30.881  1.00 24.39 ? 271  ALA K C   1 
ATOM   9593  O  O   . ALA K  2 66  ? -40.705 5.115   31.433  1.00 25.25 ? 271  ALA K O   1 
ATOM   9594  C  CB  . ALA K  2 66  ? -41.013 7.355   28.731  1.00 22.05 ? 271  ALA K CB  1 
ATOM   9595  N  N   . GLN K  2 67  ? -40.343 7.334   31.540  1.00 24.93 ? 272  GLN K N   1 
ATOM   9596  C  CA  . GLN K  2 67  ? -40.442 7.413   32.997  1.00 26.94 ? 272  GLN K CA  1 
ATOM   9597  C  C   . GLN K  2 67  ? -41.512 8.419   33.470  1.00 28.15 ? 272  GLN K C   1 
ATOM   9598  O  O   . GLN K  2 67  ? -41.315 9.147   34.441  1.00 29.21 ? 272  GLN K O   1 
ATOM   9599  C  CB  . GLN K  2 67  ? -39.069 7.760   33.599  1.00 26.96 ? 272  GLN K CB  1 
ATOM   9600  C  CG  . GLN K  2 67  ? -38.006 6.684   33.411  1.00 26.59 ? 272  GLN K CG  1 
ATOM   9601  C  CD  . GLN K  2 67  ? -37.418 6.665   32.009  1.00 24.86 ? 272  GLN K CD  1 
ATOM   9602  O  OE1 . GLN K  2 67  ? -37.186 7.708   31.396  1.00 24.10 ? 272  GLN K OE1 1 
ATOM   9603  N  NE2 . GLN K  2 67  ? -37.179 5.471   31.493  1.00 24.56 ? 272  GLN K NE2 1 
ATOM   9604  N  N   . GLY K  2 68  ? -42.638 8.445   32.773  1.00 28.34 ? 273  GLY K N   1 
ATOM   9605  C  CA  . GLY K  2 68  ? -43.802 9.201   33.196  1.00 29.99 ? 273  GLY K CA  1 
ATOM   9606  C  C   . GLY K  2 68  ? -43.521 10.676  33.269  1.00 30.28 ? 273  GLY K C   1 
ATOM   9607  O  O   . GLY K  2 68  ? -43.004 11.264  32.308  1.00 28.85 ? 273  GLY K O   1 
ATOM   9608  N  N   . CYS K  2 69  ? -43.841 11.266  34.422  1.00 32.50 ? 274  CYS K N   1 
ATOM   9609  C  CA  . CYS K  2 69  ? -43.525 12.671  34.712  1.00 33.00 ? 274  CYS K CA  1 
ATOM   9610  C  C   . CYS K  2 69  ? -42.070 12.891  35.074  1.00 32.59 ? 274  CYS K C   1 
ATOM   9611  O  O   . CYS K  2 69  ? -41.652 14.035  35.238  1.00 32.45 ? 274  CYS K O   1 
ATOM   9612  C  CB  . CYS K  2 69  ? -44.385 13.208  35.867  1.00 35.50 ? 274  CYS K CB  1 
ATOM   9613  S  SG  . CYS K  2 69  ? -46.139 13.414  35.506  1.00 36.41 ? 274  CYS K SG  1 
ATOM   9614  N  N   . GLU K  2 70  ? -41.295 11.816  35.210  1.00 32.51 ? 275  GLU K N   1 
ATOM   9615  C  CA  . GLU K  2 70  ? -39.864 11.966  35.442  1.00 32.39 ? 275  GLU K CA  1 
ATOM   9616  C  C   . GLU K  2 70  ? -39.069 11.910  34.129  1.00 30.03 ? 275  GLU K C   1 
ATOM   9617  O  O   . GLU K  2 70  ? -37.893 11.575  34.148  1.00 29.68 ? 275  GLU K O   1 
ATOM   9618  C  CB  . GLU K  2 70  ? -39.315 10.922  36.439  1.00 34.04 ? 275  GLU K CB  1 
ATOM   9619  C  CG  . GLU K  2 70  ? -40.248 10.391  37.535  1.00 36.36 ? 275  GLU K CG  1 
ATOM   9620  C  CD  . GLU K  2 70  ? -41.372 11.331  37.932  1.00 37.62 ? 275  GLU K CD  1 
ATOM   9621  O  OE1 . GLU K  2 70  ? -41.112 12.519  38.218  1.00 38.52 ? 275  GLU K OE1 1 
ATOM   9622  O  OE2 . GLU K  2 70  ? -42.531 10.871  37.957  1.00 38.84 ? 275  GLU K OE2 1 
ATOM   9623  N  N   . GLY K  2 71  ? -39.707 12.222  32.997  1.00 28.56 ? 276  GLY K N   1 
ATOM   9624  C  CA  . GLY K  2 71  ? -38.989 12.414  31.725  1.00 26.54 ? 276  GLY K CA  1 
ATOM   9625  C  C   . GLY K  2 71  ? -38.912 11.219  30.783  1.00 24.67 ? 276  GLY K C   1 
ATOM   9626  O  O   . GLY K  2 71  ? -39.408 10.138  31.080  1.00 25.06 ? 276  GLY K O   1 
ATOM   9627  N  N   . GLY K  2 72  ? -38.276 11.428  29.638  1.00 22.65 ? 277  GLY K N   1 
ATOM   9628  C  CA  . GLY K  2 72  ? -38.232 10.424  28.577  1.00 21.31 ? 277  GLY K CA  1 
ATOM   9629  C  C   . GLY K  2 72  ? -37.653 10.969  27.283  1.00 19.66 ? 277  GLY K C   1 
ATOM   9630  O  O   . GLY K  2 72  ? -37.274 12.138  27.204  1.00 19.44 ? 277  GLY K O   1 
ATOM   9631  N  N   . PHE K  2 73  ? -37.588 10.128  26.256  1.00 18.47 ? 278  PHE K N   1 
ATOM   9632  C  CA  . PHE K  2 73  ? -36.947 10.528  25.007  1.00 17.18 ? 278  PHE K CA  1 
ATOM   9633  C  C   . PHE K  2 73  ? -37.806 10.306  23.771  1.00 16.20 ? 278  PHE K C   1 
ATOM   9634  O  O   . PHE K  2 73  ? -38.353 9.220   23.584  1.00 16.05 ? 278  PHE K O   1 
ATOM   9635  C  CB  . PHE K  2 73  ? -35.581 9.854   24.896  1.00 17.08 ? 278  PHE K CB  1 
ATOM   9636  C  CG  . PHE K  2 73  ? -34.597 10.429  25.851  1.00 17.58 ? 278  PHE K CG  1 
ATOM   9637  C  CD1 . PHE K  2 73  ? -34.512 9.941   27.142  1.00 18.61 ? 278  PHE K CD1 1 
ATOM   9638  C  CD2 . PHE K  2 73  ? -33.843 11.544  25.503  1.00 17.24 ? 278  PHE K CD2 1 
ATOM   9639  C  CE1 . PHE K  2 73  ? -33.647 10.518  28.062  1.00 19.12 ? 278  PHE K CE1 1 
ATOM   9640  C  CE2 . PHE K  2 73  ? -32.976 12.124  26.416  1.00 17.79 ? 278  PHE K CE2 1 
ATOM   9641  C  CZ  . PHE K  2 73  ? -32.879 11.611  27.695  1.00 18.65 ? 278  PHE K CZ  1 
ATOM   9642  N  N   . PRO K  2 74  ? -37.934 11.354  22.927  1.00 15.52 ? 279  PRO K N   1 
ATOM   9643  C  CA  . PRO K  2 74  ? -38.750 11.278  21.733  1.00 14.86 ? 279  PRO K CA  1 
ATOM   9644  C  C   . PRO K  2 74  ? -38.425 10.096  20.810  1.00 14.11 ? 279  PRO K C   1 
ATOM   9645  O  O   . PRO K  2 74  ? -39.322 9.554   20.177  1.00 13.88 ? 279  PRO K O   1 
ATOM   9646  C  CB  . PRO K  2 74  ? -38.460 12.603  21.035  1.00 14.65 ? 279  PRO K CB  1 
ATOM   9647  C  CG  . PRO K  2 74  ? -38.185 13.551  22.133  1.00 15.28 ? 279  PRO K CG  1 
ATOM   9648  C  CD  . PRO K  2 74  ? -37.461 12.734  23.175  1.00 15.71 ? 279  PRO K CD  1 
ATOM   9649  N  N   . TYR K  2 75  ? -37.168 9.685   20.744  1.00 13.72 ? 280  TYR K N   1 
ATOM   9650  C  CA  . TYR K  2 75  ? -36.818 8.564   19.875  1.00 13.31 ? 280  TYR K CA  1 
ATOM   9651  C  C   . TYR K  2 75  ? -37.593 7.297   20.261  1.00 13.58 ? 280  TYR K C   1 
ATOM   9652  O  O   . TYR K  2 75  ? -38.009 6.536   19.384  1.00 13.32 ? 280  TYR K O   1 
ATOM   9653  C  CB  . TYR K  2 75  ? -35.302 8.333   19.881  1.00 13.27 ? 280  TYR K CB  1 
ATOM   9654  C  CG  . TYR K  2 75  ? -34.819 7.126   19.113  1.00 12.93 ? 280  TYR K CG  1 
ATOM   9655  C  CD1 . TYR K  2 75  ? -34.885 5.857   19.667  1.00 13.33 ? 280  TYR K CD1 1 
ATOM   9656  C  CD2 . TYR K  2 75  ? -34.248 7.257   17.846  1.00 12.53 ? 280  TYR K CD2 1 
ATOM   9657  C  CE1 . TYR K  2 75  ? -34.413 4.749   18.989  1.00 13.33 ? 280  TYR K CE1 1 
ATOM   9658  C  CE2 . TYR K  2 75  ? -33.791 6.152   17.152  1.00 12.52 ? 280  TYR K CE2 1 
ATOM   9659  C  CZ  . TYR K  2 75  ? -33.875 4.900   17.729  1.00 12.92 ? 280  TYR K CZ  1 
ATOM   9660  O  OH  . TYR K  2 75  ? -33.410 3.793   17.068  1.00 13.06 ? 280  TYR K OH  1 
ATOM   9661  N  N   . LEU K  2 76  ? -37.796 7.107   21.563  1.00 14.03 ? 281  LEU K N   1 
ATOM   9662  C  CA  . LEU K  2 76  ? -38.430 5.910   22.106  1.00 14.60 ? 281  LEU K CA  1 
ATOM   9663  C  C   . LEU K  2 76  ? -39.960 5.977   22.142  1.00 14.99 ? 281  LEU K C   1 
ATOM   9664  O  O   . LEU K  2 76  ? -40.602 4.947   22.298  1.00 15.45 ? 281  LEU K O   1 
ATOM   9665  C  CB  . LEU K  2 76  ? -37.906 5.614   23.523  1.00 15.35 ? 281  LEU K CB  1 
ATOM   9666  C  CG  . LEU K  2 76  ? -36.491 5.017   23.614  1.00 15.28 ? 281  LEU K CG  1 
ATOM   9667  C  CD1 . LEU K  2 76  ? -35.992 4.936   25.049  1.00 16.09 ? 281  LEU K CD1 1 
ATOM   9668  C  CD2 . LEU K  2 76  ? -36.450 3.637   22.963  1.00 15.34 ? 281  LEU K CD2 1 
ATOM   9669  N  N   . ILE K  2 77  ? -40.527 7.169   21.977  1.00 14.87 ? 282  ILE K N   1 
ATOM   9670  C  CA  . ILE K  2 77  ? -41.969 7.363   22.024  1.00 15.47 ? 282  ILE K CA  1 
ATOM   9671  C  C   . ILE K  2 77  ? -42.529 7.638   20.635  1.00 14.98 ? 282  ILE K C   1 
ATOM   9672  O  O   . ILE K  2 77  ? -43.405 6.918   20.162  1.00 15.25 ? 282  ILE K O   1 
ATOM   9673  C  CB  . ILE K  2 77  ? -42.362 8.531   22.967  1.00 16.09 ? 282  ILE K CB  1 
ATOM   9674  C  CG1 . ILE K  2 77  ? -41.897 8.265   24.408  1.00 16.84 ? 282  ILE K CG1 1 
ATOM   9675  C  CG2 . ILE K  2 77  ? -43.857 8.781   22.915  1.00 16.81 ? 282  ILE K CG2 1 
ATOM   9676  C  CD1 . ILE K  2 77  ? -42.189 6.878   24.939  1.00 17.55 ? 282  ILE K CD1 1 
ATOM   9677  N  N   . ALA K  2 78  ? -42.045 8.696   19.992  1.00 14.46 ? 283  ALA K N   1 
ATOM   9678  C  CA  . ALA K  2 78  ? -42.490 9.038   18.636  1.00 14.17 ? 283  ALA K CA  1 
ATOM   9679  C  C   . ALA K  2 78  ? -42.110 7.936   17.668  1.00 13.70 ? 283  ALA K C   1 
ATOM   9680  O  O   . ALA K  2 78  ? -42.810 7.679   16.673  1.00 13.59 ? 283  ALA K O   1 
ATOM   9681  C  CB  . ALA K  2 78  ? -41.860 10.334  18.173  1.00 13.94 ? 283  ALA K CB  1 
ATOM   9682  N  N   . GLY K  2 79  ? -40.971 7.332   17.959  1.00 13.37 ? 284  GLY K N   1 
ATOM   9683  C  CA  . GLY K  2 79  ? -40.458 6.258   17.175  1.00 13.17 ? 284  GLY K CA  1 
ATOM   9684  C  C   . GLY K  2 79  ? -40.898 4.924   17.725  1.00 13.58 ? 284  GLY K C   1 
ATOM   9685  O  O   . GLY K  2 79  ? -41.879 4.365   17.266  1.00 13.75 ? 284  GLY K O   1 
ATOM   9686  N  N   . LYS K  2 80  ? -40.170 4.426   18.715  1.00 13.71 ? 285  LYS K N   1 
ATOM   9687  C  CA  . LYS K  2 80  ? -40.295 3.044   19.106  1.00 14.33 ? 285  LYS K CA  1 
ATOM   9688  C  C   . LYS K  2 80  ? -41.657 2.690   19.690  1.00 15.12 ? 285  LYS K C   1 
ATOM   9689  O  O   . LYS K  2 80  ? -42.229 1.665   19.338  1.00 15.58 ? 285  LYS K O   1 
ATOM   9690  C  CB  . LYS K  2 80  ? -39.187 2.653   20.088  1.00 14.69 ? 285  LYS K CB  1 
ATOM   9691  C  CG  . LYS K  2 80  ? -38.877 1.182   20.000  1.00 15.30 ? 285  LYS K CG  1 
ATOM   9692  C  CD  . LYS K  2 80  ? -37.898 0.682   21.035  1.00 15.89 ? 285  LYS K CD  1 
ATOM   9693  C  CE  . LYS K  2 80  ? -37.974 -0.833  21.045  1.00 16.80 ? 285  LYS K CE  1 
ATOM   9694  N  NZ  . LYS K  2 80  ? -37.719 -1.415  19.696  1.00 16.45 ? 285  LYS K NZ  1 
ATOM   9695  N  N   . TYR K  2 81  ? -42.175 3.526   20.586  1.00 15.42 ? 286  TYR K N   1 
ATOM   9696  C  CA  . TYR K  2 81  ? -43.453 3.243   21.218  1.00 16.35 ? 286  TYR K CA  1 
ATOM   9697  C  C   . TYR K  2 81  ? -44.569 3.332   20.181  1.00 16.26 ? 286  TYR K C   1 
ATOM   9698  O  O   . TYR K  2 81  ? -45.440 2.479   20.131  1.00 16.86 ? 286  TYR K O   1 
ATOM   9699  C  CB  . TYR K  2 81  ? -43.748 4.197   22.388  1.00 16.86 ? 286  TYR K CB  1 
ATOM   9700  C  CG  . TYR K  2 81  ? -44.937 3.741   23.192  1.00 18.12 ? 286  TYR K CG  1 
ATOM   9701  C  CD1 . TYR K  2 81  ? -44.890 2.547   23.910  1.00 19.06 ? 286  TYR K CD1 1 
ATOM   9702  C  CD2 . TYR K  2 81  ? -46.110 4.473   23.210  1.00 18.54 ? 286  TYR K CD2 1 
ATOM   9703  C  CE1 . TYR K  2 81  ? -45.976 2.105   24.631  1.00 20.45 ? 286  TYR K CE1 1 
ATOM   9704  C  CE2 . TYR K  2 81  ? -47.206 4.035   23.926  1.00 19.91 ? 286  TYR K CE2 1 
ATOM   9705  C  CZ  . TYR K  2 81  ? -47.124 2.852   24.638  1.00 20.88 ? 286  TYR K CZ  1 
ATOM   9706  O  OH  . TYR K  2 81  ? -48.201 2.416   25.352  1.00 22.68 ? 286  TYR K OH  1 
ATOM   9707  N  N   . ALA K  2 82  ? -44.510 4.365   19.349  1.00 15.55 ? 287  ALA K N   1 
ATOM   9708  C  CA  . ALA K  2 82  ? -45.467 4.541   18.268  1.00 15.59 ? 287  ALA K CA  1 
ATOM   9709  C  C   . ALA K  2 82  ? -45.482 3.338   17.326  1.00 15.66 ? 287  ALA K C   1 
ATOM   9710  O  O   . ALA K  2 82  ? -46.536 2.883   16.932  1.00 16.43 ? 287  ALA K O   1 
ATOM   9711  C  CB  . ALA K  2 82  ? -45.171 5.813   17.494  1.00 14.89 ? 287  ALA K CB  1 
ATOM   9712  N  N   . GLN K  2 83  ? -44.318 2.813   16.977  1.00 15.19 ? 288  GLN K N   1 
ATOM   9713  C  CA  . GLN K  2 83  ? -44.265 1.641   16.102  1.00 15.34 ? 288  GLN K CA  1 
ATOM   9714  C  C   . GLN K  2 83  ? -44.756 0.342   16.780  1.00 16.38 ? 288  GLN K C   1 
ATOM   9715  O  O   . GLN K  2 83  ? -45.447 -0.452  16.160  1.00 16.83 ? 288  GLN K O   1 
ATOM   9716  C  CB  . GLN K  2 83  ? -42.841 1.456   15.575  1.00 14.58 ? 288  GLN K CB  1 
ATOM   9717  C  CG  . GLN K  2 83  ? -42.623 0.160   14.827  1.00 14.81 ? 288  GLN K CG  1 
ATOM   9718  C  CD  . GLN K  2 83  ? -41.347 0.185   14.013  1.00 14.24 ? 288  GLN K CD  1 
ATOM   9719  O  OE1 . GLN K  2 83  ? -40.397 -0.551  14.285  1.00 14.28 ? 288  GLN K OE1 1 
ATOM   9720  N  NE2 . GLN K  2 83  ? -41.321 1.040   13.004  1.00 13.76 ? 288  GLN K NE2 1 
ATOM   9721  N  N   . ASP K  2 84  ? -44.374 0.130   18.040  1.00 17.03 ? 289  ASP K N   1 
ATOM   9722  C  CA  . ASP K  2 84  ? -44.607 -1.150  18.709  1.00 18.25 ? 289  ASP K CA  1 
ATOM   9723  C  C   . ASP K  2 84  ? -46.022 -1.264  19.274  1.00 19.54 ? 289  ASP K C   1 
ATOM   9724  O  O   . ASP K  2 84  ? -46.691 -2.265  19.062  1.00 20.49 ? 289  ASP K O   1 
ATOM   9725  C  CB  . ASP K  2 84  ? -43.563 -1.381  19.803  1.00 18.44 ? 289  ASP K CB  1 
ATOM   9726  C  CG  . ASP K  2 84  ? -42.155 -1.542  19.245  1.00 17.77 ? 289  ASP K CG  1 
ATOM   9727  O  OD1 . ASP K  2 84  ? -42.010 -1.709  18.011  1.00 17.38 ? 289  ASP K OD1 1 
ATOM   9728  O  OD2 . ASP K  2 84  ? -41.181 -1.505  20.032  1.00 17.71 ? 289  ASP K OD2 1 
ATOM   9729  N  N   . PHE K  2 85  ? -46.476 -0.222  19.958  1.00 19.69 ? 290  PHE K N   1 
ATOM   9730  C  CA  . PHE K  2 85  ? -47.780 -0.235  20.631  1.00 20.99 ? 290  PHE K CA  1 
ATOM   9731  C  C   . PHE K  2 85  ? -48.779 0.766   20.097  1.00 20.97 ? 290  PHE K C   1 
ATOM   9732  O  O   . PHE K  2 85  ? -49.966 0.567   20.254  1.00 21.96 ? 290  PHE K O   1 
ATOM   9733  C  CB  . PHE K  2 85  ? -47.587 -0.035  22.131  1.00 21.69 ? 290  PHE K CB  1 
ATOM   9734  C  CG  . PHE K  2 85  ? -46.742 -1.105  22.759  1.00 22.24 ? 290  PHE K CG  1 
ATOM   9735  C  CD1 . PHE K  2 85  ? -47.308 -2.301  23.162  1.00 23.64 ? 290  PHE K CD1 1 
ATOM   9736  C  CD2 . PHE K  2 85  ? -45.370 -0.930  22.908  1.00 21.47 ? 290  PHE K CD2 1 
ATOM   9737  C  CE1 . PHE K  2 85  ? -46.529 -3.295  23.734  1.00 24.35 ? 290  PHE K CE1 1 
ATOM   9738  C  CE2 . PHE K  2 85  ? -44.584 -1.918  23.469  1.00 22.10 ? 290  PHE K CE2 1 
ATOM   9739  C  CZ  . PHE K  2 85  ? -45.162 -3.105  23.879  1.00 23.53 ? 290  PHE K CZ  1 
ATOM   9740  N  N   . GLY K  2 86  ? -48.299 1.835   19.468  1.00 20.10 ? 291  GLY K N   1 
ATOM   9741  C  CA  . GLY K  2 86  ? -49.171 2.814   18.845  1.00 20.27 ? 291  GLY K CA  1 
ATOM   9742  C  C   . GLY K  2 86  ? -49.691 3.828   19.836  1.00 21.26 ? 291  GLY K C   1 
ATOM   9743  O  O   . GLY K  2 86  ? -49.561 3.646   21.040  1.00 21.92 ? 291  GLY K O   1 
ATOM   9744  N  N   . LEU K  2 87  ? -50.285 4.894   19.314  1.00 21.48 ? 292  LEU K N   1 
ATOM   9745  C  CA  . LEU K  2 87  ? -50.759 6.012   20.110  1.00 22.53 ? 292  LEU K CA  1 
ATOM   9746  C  C   . LEU K  2 87  ? -52.256 6.219   19.888  1.00 24.02 ? 292  LEU K C   1 
ATOM   9747  O  O   . LEU K  2 87  ? -52.737 6.097   18.752  1.00 23.73 ? 292  LEU K O   1 
ATOM   9748  C  CB  . LEU K  2 87  ? -50.011 7.275   19.696  1.00 21.69 ? 292  LEU K CB  1 
ATOM   9749  C  CG  . LEU K  2 87  ? -48.484 7.155   19.691  1.00 20.58 ? 292  LEU K CG  1 
ATOM   9750  C  CD1 . LEU K  2 87  ? -47.876 8.379   19.039  1.00 19.71 ? 292  LEU K CD1 1 
ATOM   9751  C  CD2 . LEU K  2 87  ? -47.956 6.951   21.108  1.00 20.97 ? 292  LEU K CD2 1 
ATOM   9752  N  N   . VAL K  2 88  ? -52.972 6.550   20.967  1.00 25.74 ? 293  VAL K N   1 
ATOM   9753  C  CA  . VAL K  2 88  ? -54.415 6.825   20.910  1.00 27.46 ? 293  VAL K CA  1 
ATOM   9754  C  C   . VAL K  2 88  ? -54.681 8.327   20.861  1.00 28.15 ? 293  VAL K C   1 
ATOM   9755  O  O   . VAL K  2 88  ? -53.765 9.128   21.019  1.00 27.01 ? 293  VAL K O   1 
ATOM   9756  C  CB  . VAL K  2 88  ? -55.174 6.197   22.106  1.00 29.11 ? 293  VAL K CB  1 
ATOM   9757  C  CG1 . VAL K  2 88  ? -54.881 4.704   22.193  1.00 29.21 ? 293  VAL K CG1 1 
ATOM   9758  C  CG2 . VAL K  2 88  ? -54.821 6.888   23.419  1.00 29.66 ? 293  VAL K CG2 1 
ATOM   9759  N  N   . GLU K  2 89  ? -55.942 8.697   20.632  1.00 30.36 ? 294  GLU K N   1 
ATOM   9760  C  CA  . GLU K  2 89  ? -56.344 10.108  20.574  1.00 31.63 ? 294  GLU K CA  1 
ATOM   9761  C  C   . GLU K  2 89  ? -56.538 10.679  21.979  1.00 32.91 ? 294  GLU K C   1 
ATOM   9762  O  O   . GLU K  2 89  ? -56.756 9.931   22.933  1.00 33.50 ? 294  GLU K O   1 
ATOM   9763  C  CB  . GLU K  2 89  ? -57.617 10.286  19.727  1.00 33.63 ? 294  GLU K CB  1 
ATOM   9764  C  CG  . GLU K  2 89  ? -57.424 9.829   18.280  1.00 33.66 ? 294  GLU K CG  1 
ATOM   9765  C  CD  . GLU K  2 89  ? -58.457 10.363  17.283  1.00 35.92 ? 294  GLU K CD  1 
ATOM   9766  O  OE1 . GLU K  2 89  ? -59.018 11.471  17.497  1.00 37.31 ? 294  GLU K OE1 1 
ATOM   9767  O  OE2 . GLU K  2 89  ? -58.689 9.673   16.251  1.00 36.80 ? 294  GLU K OE2 1 
ATOM   9768  N  N   . GLU K  2 90  ? -56.441 12.008  22.081  1.00 33.34 ? 295  GLU K N   1 
ATOM   9769  C  CA  . GLU K  2 90  ? -56.650 12.739  23.333  1.00 35.33 ? 295  GLU K CA  1 
ATOM   9770  C  C   . GLU K  2 90  ? -57.982 12.376  24.019  1.00 38.10 ? 295  GLU K C   1 
ATOM   9771  O  O   . GLU K  2 90  ? -58.017 12.227  25.241  1.00 39.84 ? 295  GLU K O   1 
ATOM   9772  C  CB  . GLU K  2 90  ? -56.559 14.258  23.087  1.00 35.40 ? 295  GLU K CB  1 
ATOM   9773  C  CG  . GLU K  2 90  ? -56.870 15.154  24.293  1.00 36.95 ? 295  GLU K CG  1 
ATOM   9774  C  CD  . GLU K  2 90  ? -55.803 15.138  25.389  1.00 37.00 ? 295  GLU K CD  1 
ATOM   9775  O  OE1 . GLU K  2 90  ? -54.649 14.733  25.119  1.00 35.65 ? 295  GLU K OE1 1 
ATOM   9776  O  OE2 . GLU K  2 90  ? -56.116 15.568  26.536  1.00 39.32 ? 295  GLU K OE2 1 
ATOM   9777  N  N   . ALA K  2 91  ? -59.057 12.227  23.246  1.00 39.18 ? 296  ALA K N   1 
ATOM   9778  C  CA  . ALA K  2 91  ? -60.362 11.831  23.805  1.00 42.32 ? 296  ALA K CA  1 
ATOM   9779  C  C   . ALA K  2 91  ? -60.329 10.455  24.493  1.00 43.94 ? 296  ALA K C   1 
ATOM   9780  O  O   . ALA K  2 91  ? -61.057 10.213  25.443  1.00 46.66 ? 296  ALA K O   1 
ATOM   9781  C  CB  . ALA K  2 91  ? -61.437 11.852  22.725  1.00 42.22 ? 296  ALA K CB  1 
ATOM   9782  N  N   . CYS K  2 92  ? -59.480 9.557   24.013  1.00 43.98 ? 297  CYS K N   1 
ATOM   9783  C  CA  . CYS K  2 92  ? -59.335 8.237   24.625  1.00 45.88 ? 297  CYS K CA  1 
ATOM   9784  C  C   . CYS K  2 92  ? -58.701 8.314   26.039  1.00 45.19 ? 297  CYS K C   1 
ATOM   9785  O  O   . CYS K  2 92  ? -59.139 7.605   26.955  1.00 46.48 ? 297  CYS K O   1 
ATOM   9786  C  CB  . CYS K  2 92  ? -58.529 7.328   23.684  1.00 46.03 ? 297  CYS K CB  1 
ATOM   9787  S  SG  . CYS K  2 92  ? -58.401 5.580   24.149  1.00 51.99 ? 297  CYS K SG  1 
ATOM   9788  N  N   . PHE K  2 93  ? -57.691 9.178   26.211  1.00 42.72 ? 298  PHE K N   1 
ATOM   9789  C  CA  . PHE K  2 93  ? -56.972 9.323   27.486  1.00 41.32 ? 298  PHE K CA  1 
ATOM   9790  C  C   . PHE K  2 93  ? -56.560 10.792  27.697  1.00 40.14 ? 298  PHE K C   1 
ATOM   9791  O  O   . PHE K  2 93  ? -55.445 11.175  27.342  1.00 37.89 ? 298  PHE K O   1 
ATOM   9792  C  CB  . PHE K  2 93  ? -55.729 8.419   27.486  1.00 40.22 ? 298  PHE K CB  1 
ATOM   9793  C  CG  . PHE K  2 93  ? -55.241 8.018   28.865  1.00 41.33 ? 298  PHE K CG  1 
ATOM   9794  C  CD1 . PHE K  2 93  ? -55.408 8.849   29.979  1.00 42.55 ? 298  PHE K CD1 1 
ATOM   9795  C  CD2 . PHE K  2 93  ? -54.587 6.801   29.041  1.00 41.28 ? 298  PHE K CD2 1 
ATOM   9796  C  CE1 . PHE K  2 93  ? -54.956 8.459   31.234  1.00 43.50 ? 298  PHE K CE1 1 
ATOM   9797  C  CE2 . PHE K  2 93  ? -54.129 6.409   30.291  1.00 42.25 ? 298  PHE K CE2 1 
ATOM   9798  C  CZ  . PHE K  2 93  ? -54.313 7.238   31.389  1.00 43.63 ? 298  PHE K CZ  1 
ATOM   9799  N  N   . PRO K  2 94  ? -57.463 11.618  28.273  1.00 40.77 ? 299  PRO K N   1 
ATOM   9800  C  CA  . PRO K  2 94  ? -57.210 13.052  28.501  1.00 40.23 ? 299  PRO K CA  1 
ATOM   9801  C  C   . PRO K  2 94  ? -56.051 13.367  29.467  1.00 39.50 ? 299  PRO K C   1 
ATOM   9802  O  O   . PRO K  2 94  ? -55.786 12.602  30.396  1.00 39.86 ? 299  PRO K O   1 
ATOM   9803  C  CB  . PRO K  2 94  ? -58.537 13.558  29.088  1.00 42.61 ? 299  PRO K CB  1 
ATOM   9804  C  CG  . PRO K  2 94  ? -59.558 12.568  28.661  1.00 43.42 ? 299  PRO K CG  1 
ATOM   9805  C  CD  . PRO K  2 94  ? -58.851 11.249  28.607  1.00 42.69 ? 299  PRO K CD  1 
ATOM   9806  N  N   . TYR K  2 95  ? -55.396 14.507  29.248  1.00 38.15 ? 300  TYR K N   1 
ATOM   9807  C  CA  . TYR K  2 95  ? -54.204 14.895  30.009  1.00 37.59 ? 300  TYR K CA  1 
ATOM   9808  C  C   . TYR K  2 95  ? -54.519 15.288  31.445  1.00 39.59 ? 300  TYR K C   1 
ATOM   9809  O  O   . TYR K  2 95  ? -55.408 16.098  31.678  1.00 40.93 ? 300  TYR K O   1 
ATOM   9810  C  CB  . TYR K  2 95  ? -53.485 16.066  29.322  1.00 36.05 ? 300  TYR K CB  1 
ATOM   9811  C  CG  . TYR K  2 95  ? -52.110 16.341  29.885  1.00 35.11 ? 300  TYR K CG  1 
ATOM   9812  C  CD1 . TYR K  2 95  ? -51.143 15.343  29.898  1.00 34.07 ? 300  TYR K CD1 1 
ATOM   9813  C  CD2 . TYR K  2 95  ? -51.763 17.593  30.396  1.00 35.53 ? 300  TYR K CD2 1 
ATOM   9814  C  CE1 . TYR K  2 95  ? -49.880 15.573  30.406  1.00 33.33 ? 300  TYR K CE1 1 
ATOM   9815  C  CE2 . TYR K  2 95  ? -50.483 17.831  30.902  1.00 34.63 ? 300  TYR K CE2 1 
ATOM   9816  C  CZ  . TYR K  2 95  ? -49.557 16.807  30.901  1.00 33.55 ? 300  TYR K CZ  1 
ATOM   9817  O  OH  . TYR K  2 95  ? -48.293 16.981  31.385  1.00 33.27 ? 300  TYR K OH  1 
ATOM   9818  N  N   . THR K  2 96  ? -53.775 14.720  32.396  1.00 40.16 ? 301  THR K N   1 
ATOM   9819  C  CA  . THR K  2 96  ? -53.931 15.048  33.822  1.00 42.32 ? 301  THR K CA  1 
ATOM   9820  C  C   . THR K  2 96  ? -52.681 15.677  34.447  1.00 41.94 ? 301  THR K C   1 
ATOM   9821  O  O   . THR K  2 96  ? -52.761 16.260  35.528  1.00 43.25 ? 301  THR K O   1 
ATOM   9822  C  CB  . THR K  2 96  ? -54.333 13.808  34.656  1.00 43.97 ? 301  THR K CB  1 
ATOM   9823  O  OG1 . THR K  2 96  ? -53.199 12.954  34.848  1.00 43.70 ? 301  THR K OG1 1 
ATOM   9824  C  CG2 . THR K  2 96  ? -55.449 13.026  33.961  1.00 44.21 ? 301  THR K CG2 1 
ATOM   9825  N  N   . GLY K  2 97  ? -51.529 15.554  33.788  1.00 40.07 ? 302  GLY K N   1 
ATOM   9826  C  CA  . GLY K  2 97  ? -50.285 16.132  34.306  1.00 39.60 ? 302  GLY K CA  1 
ATOM   9827  C  C   . GLY K  2 97  ? -49.746 15.449  35.553  1.00 40.86 ? 302  GLY K C   1 
ATOM   9828  O  O   . GLY K  2 97  ? -48.977 16.044  36.302  1.00 41.18 ? 302  GLY K O   1 
ATOM   9829  N  N   . THR K  2 98  ? -50.143 14.199  35.775  1.00 41.84 ? 303  THR K N   1 
ATOM   9830  C  CA  . THR K  2 98  ? -49.626 13.404  36.881  1.00 43.46 ? 303  THR K CA  1 
ATOM   9831  C  C   . THR K  2 98  ? -49.386 11.972  36.437  1.00 43.70 ? 303  THR K C   1 
ATOM   9832  O  O   . THR K  2 98  ? -49.919 11.527  35.416  1.00 43.32 ? 303  THR K O   1 
ATOM   9833  C  CB  . THR K  2 98  ? -50.612 13.364  38.068  1.00 46.28 ? 303  THR K CB  1 
ATOM   9834  O  OG1 . THR K  2 98  ? -51.934 13.097  37.579  1.00 46.77 ? 303  THR K OG1 1 
ATOM   9835  C  CG2 . THR K  2 98  ? -50.586 14.678  38.842  1.00 46.90 ? 303  THR K CG2 1 
ATOM   9836  N  N   . ASP K  2 99  ? -48.589 11.248  37.222  1.00 45.03 ? 304  ASP K N   1 
ATOM   9837  C  CA  . ASP K  2 99  ? -48.388 9.812   37.015  1.00 45.07 ? 304  ASP K CA  1 
ATOM   9838  C  C   . ASP K  2 99  ? -49.626 9.048   37.449  1.00 47.41 ? 304  ASP K C   1 
ATOM   9839  O  O   . ASP K  2 99  ? -49.620 8.347   38.456  1.00 49.32 ? 304  ASP K O   1 
ATOM   9840  C  CB  . ASP K  2 99  ? -47.157 9.318   37.773  1.00 45.02 ? 304  ASP K CB  1 
ATOM   9841  C  CG  . ASP K  2 99  ? -45.863 9.707   37.082  1.00 43.11 ? 304  ASP K CG  1 
ATOM   9842  O  OD1 . ASP K  2 99  ? -45.694 9.336   35.895  1.00 41.41 ? 304  ASP K OD1 1 
ATOM   9843  O  OD2 . ASP K  2 99  ? -45.019 10.374  37.719  1.00 42.96 ? 304  ASP K OD2 1 
ATOM   9844  N  N   . SER K  2 100 ? -50.688 9.198   36.667  1.00 47.85 ? 305  SER K N   1 
ATOM   9845  C  CA  . SER K  2 100 ? -51.966 8.547   36.937  1.00 50.26 ? 305  SER K CA  1 
ATOM   9846  C  C   . SER K  2 100 ? -51.860 7.076   36.545  1.00 50.65 ? 305  SER K C   1 
ATOM   9847  O  O   . SER K  2 100 ? -50.931 6.698   35.820  1.00 49.91 ? 305  SER K O   1 
ATOM   9848  C  CB  . SER K  2 100 ? -53.074 9.221   36.122  1.00 49.90 ? 305  SER K CB  1 
ATOM   9849  O  OG  . SER K  2 100 ? -52.829 10.614  35.987  1.00 48.77 ? 305  SER K OG  1 
ATOM   9850  N  N   . PRO K  2 101 ? -52.804 6.241   37.010  1.00 53.09 ? 306  PRO K N   1 
ATOM   9851  C  CA  . PRO K  2 101 ? -52.833 4.858   36.534  1.00 53.32 ? 306  PRO K CA  1 
ATOM   9852  C  C   . PRO K  2 101 ? -53.203 4.782   35.058  1.00 52.63 ? 306  PRO K C   1 
ATOM   9853  O  O   . PRO K  2 101 ? -53.769 5.733   34.501  1.00 51.31 ? 306  PRO K O   1 
ATOM   9854  C  CB  . PRO K  2 101 ? -53.929 4.202   37.390  1.00 56.03 ? 306  PRO K CB  1 
ATOM   9855  C  CG  . PRO K  2 101 ? -54.161 5.135   38.531  1.00 57.37 ? 306  PRO K CG  1 
ATOM   9856  C  CD  . PRO K  2 101 ? -53.873 6.501   37.990  1.00 55.50 ? 306  PRO K CD  1 
ATOM   9857  N  N   . CYS K  2 102 ? -52.888 3.646   34.443  1.00 53.62 ? 307  CYS K N   1 
ATOM   9858  C  CA  . CYS K  2 102 ? -53.106 3.437   33.014  1.00 53.00 ? 307  CYS K CA  1 
ATOM   9859  C  C   . CYS K  2 102 ? -54.416 2.702   32.741  1.00 56.15 ? 307  CYS K C   1 
ATOM   9860  O  O   . CYS K  2 102 ? -54.440 1.477   32.615  1.00 57.68 ? 307  CYS K O   1 
ATOM   9861  C  CB  . CYS K  2 102 ? -51.916 2.675   32.412  1.00 50.95 ? 307  CYS K CB  1 
ATOM   9862  S  SG  . CYS K  2 102 ? -52.117 2.149   30.689  1.00 49.83 ? 307  CYS K SG  1 
ATOM   9863  N  N   . LYS K  2 103 ? -55.509 3.457   32.676  1.00 58.44 ? 308  LYS K N   1 
ATOM   9864  C  CA  . LYS K  2 103 ? -56.798 2.931   32.207  1.00 59.64 ? 308  LYS K CA  1 
ATOM   9865  C  C   . LYS K  2 103 ? -57.501 4.006   31.387  1.00 58.21 ? 308  LYS K C   1 
ATOM   9866  O  O   . LYS K  2 103 ? -57.461 5.186   31.735  1.00 56.34 ? 308  LYS K O   1 
ATOM   9867  C  CB  . LYS K  2 103 ? -57.675 2.457   33.372  1.00 63.50 ? 308  LYS K CB  1 
ATOM   9868  C  CG  . LYS K  2 103 ? -57.175 1.177   34.034  1.00 65.00 ? 308  LYS K CG  1 
ATOM   9869  C  CD  . LYS K  2 103 ? -58.032 0.755   35.220  1.00 67.62 ? 308  LYS K CD  1 
ATOM   9870  C  CE  . LYS K  2 103 ? -57.279 -0.219  36.121  1.00 68.82 ? 308  LYS K CE  1 
ATOM   9871  N  NZ  . LYS K  2 103 ? -58.114 -0.723  37.252  1.00 72.19 ? 308  LYS K NZ  1 
ATOM   9872  N  N   . MET K  2 104 ? -58.131 3.582   30.294  1.00 58.57 ? 309  MET K N   1 
ATOM   9873  C  CA  . MET K  2 104 ? -58.671 4.497   29.288  1.00 58.37 ? 309  MET K CA  1 
ATOM   9874  C  C   . MET K  2 104 ? -59.937 3.904   28.665  1.00 60.54 ? 309  MET K C   1 
ATOM   9875  O  O   . MET K  2 104 ? -60.418 2.858   29.111  1.00 62.29 ? 309  MET K O   1 
ATOM   9876  C  CB  . MET K  2 104 ? -57.602 4.766   28.213  1.00 54.85 ? 309  MET K CB  1 
ATOM   9877  C  CG  . MET K  2 104 ? -57.379 3.619   27.237  1.00 54.11 ? 309  MET K CG  1 
ATOM   9878  S  SD  . MET K  2 104 ? -55.742 3.598   26.472  1.00 52.08 ? 309  MET K SD  1 
ATOM   9879  C  CE  . MET K  2 104 ? -54.975 2.253   27.379  1.00 52.63 ? 309  MET K CE  1 
ATOM   9880  N  N   . LYS K  2 105 ? -60.464 4.567   27.633  1.00 61.85 ? 310  LYS K N   1 
ATOM   9881  C  CA  . LYS K  2 105 ? -61.691 4.128   26.942  1.00 63.67 ? 310  LYS K CA  1 
ATOM   9882  C  C   . LYS K  2 105 ? -61.510 2.798   26.206  1.00 63.21 ? 310  LYS K C   1 
ATOM   9883  O  O   . LYS K  2 105 ? -60.402 2.266   26.116  1.00 63.13 ? 310  LYS K O   1 
ATOM   9884  C  CB  . LYS K  2 105 ? -62.167 5.203   25.952  1.00 63.49 ? 310  LYS K CB  1 
ATOM   9885  C  CG  . LYS K  2 105 ? -62.649 6.491   26.606  1.00 64.86 ? 310  LYS K CG  1 
ATOM   9886  C  CD  . LYS K  2 105 ? -63.221 7.460   25.580  1.00 64.26 ? 310  LYS K CD  1 
ATOM   9887  C  CE  . LYS K  2 105 ? -63.865 8.665   26.252  1.00 65.56 ? 310  LYS K CE  1 
ATOM   9888  N  NZ  . LYS K  2 105 ? -64.434 9.622   25.260  1.00 64.95 ? 310  LYS K NZ  1 
ATOM   9889  N  N   . GLU K  2 106 ? -62.611 2.276   25.675  1.00 64.67 ? 311  GLU K N   1 
ATOM   9890  C  CA  . GLU K  2 106 ? -62.623 0.973   25.010  1.00 64.97 ? 311  GLU K CA  1 
ATOM   9891  C  C   . GLU K  2 106 ? -62.371 1.065   23.507  1.00 61.03 ? 311  GLU K C   1 
ATOM   9892  O  O   . GLU K  2 106 ? -62.682 2.081   22.872  1.00 59.01 ? 311  GLU K O   1 
ATOM   9893  C  CB  . GLU K  2 106 ? -63.975 0.266   25.238  1.00 68.74 ? 311  GLU K CB  1 
ATOM   9894  C  CG  . GLU K  2 106 ? -64.137 -0.395  26.601  1.00 71.68 ? 311  GLU K CG  1 
ATOM   9895  C  CD  . GLU K  2 106 ? -63.084 -1.462  26.874  1.00 71.62 ? 311  GLU K CD  1 
ATOM   9896  O  OE1 . GLU K  2 106 ? -62.522 -2.027  25.906  1.00 67.73 ? 311  GLU K OE1 1 
ATOM   9897  O  OE2 . GLU K  2 106 ? -62.817 -1.736  28.066  1.00 75.02 ? 311  GLU K OE2 1 
ATOM   9898  N  N   . ASP K  2 107 ? -61.814 -0.019  22.957  1.00 59.08 ? 312  ASP K N   1 
ATOM   9899  C  CA  . ASP K  2 107 ? -61.692 -0.228  21.509  1.00 56.72 ? 312  ASP K CA  1 
ATOM   9900  C  C   . ASP K  2 107 ? -61.134 0.992   20.779  1.00 52.70 ? 312  ASP K C   1 
ATOM   9901  O  O   . ASP K  2 107 ? -61.658 1.376   19.730  1.00 52.52 ? 312  ASP K O   1 
ATOM   9902  C  CB  . ASP K  2 107 ? -63.065 -0.593  20.907  1.00 58.69 ? 312  ASP K CB  1 
ATOM   9903  C  CG  . ASP K  2 107 ? -63.762 -1.732  21.652  1.00 61.63 ? 312  ASP K CG  1 
ATOM   9904  O  OD1 . ASP K  2 107 ? -63.159 -2.815  21.779  1.00 62.93 ? 312  ASP K OD1 1 
ATOM   9905  O  OD2 . ASP K  2 107 ? -64.919 -1.549  22.094  1.00 62.40 ? 312  ASP K OD2 1 
ATOM   9906  N  N   . CYS K  2 108 ? -60.090 1.608   21.332  1.00 49.75 ? 313  CYS K N   1 
ATOM   9907  C  CA  . CYS K  2 108 ? -59.527 2.836   20.745  1.00 46.65 ? 313  CYS K CA  1 
ATOM   9908  C  C   . CYS K  2 108 ? -58.638 2.521   19.530  1.00 41.46 ? 313  CYS K C   1 
ATOM   9909  O  O   . CYS K  2 108 ? -57.891 1.535   19.524  1.00 38.99 ? 313  CYS K O   1 
ATOM   9910  C  CB  . CYS K  2 108 ? -58.740 3.654   21.789  1.00 48.17 ? 313  CYS K CB  1 
ATOM   9911  S  SG  . CYS K  2 108 ? -59.767 4.610   22.953  1.00 53.30 ? 313  CYS K SG  1 
ATOM   9912  N  N   . PHE K  2 109 ? -58.745 3.359   18.501  1.00 37.87 ? 314  PHE K N   1 
ATOM   9913  C  CA  . PHE K  2 109 ? -57.890 3.256   17.336  1.00 34.06 ? 314  PHE K CA  1 
ATOM   9914  C  C   . PHE K  2 109 ? -56.461 3.668   17.696  1.00 31.69 ? 314  PHE K C   1 
ATOM   9915  O  O   . PHE K  2 109 ? -56.245 4.706   18.322  1.00 31.15 ? 314  PHE K O   1 
ATOM   9916  C  CB  . PHE K  2 109 ? -58.391 4.137   16.189  1.00 33.24 ? 314  PHE K CB  1 
ATOM   9917  C  CG  . PHE K  2 109 ? -57.596 3.961   14.926  1.00 31.59 ? 314  PHE K CG  1 
ATOM   9918  C  CD1 . PHE K  2 109 ? -57.859 2.901   14.070  1.00 31.74 ? 314  PHE K CD1 1 
ATOM   9919  C  CD2 . PHE K  2 109 ? -56.552 4.820   14.620  1.00 30.00 ? 314  PHE K CD2 1 
ATOM   9920  C  CE1 . PHE K  2 109 ? -57.115 2.713   12.917  1.00 30.53 ? 314  PHE K CE1 1 
ATOM   9921  C  CE2 . PHE K  2 109 ? -55.802 4.638   13.470  1.00 29.00 ? 314  PHE K CE2 1 
ATOM   9922  C  CZ  . PHE K  2 109 ? -56.086 3.584   12.613  1.00 28.97 ? 314  PHE K CZ  1 
ATOM   9923  N  N   . ARG K  2 110 ? -55.488 2.860   17.290  1.00 29.08 ? 315  ARG K N   1 
ATOM   9924  C  CA  . ARG K  2 110 ? -54.092 3.193   17.546  1.00 26.85 ? 315  ARG K CA  1 
ATOM   9925  C  C   . ARG K  2 110 ? -53.371 3.621   16.260  1.00 24.33 ? 315  ARG K C   1 
ATOM   9926  O  O   . ARG K  2 110 ? -53.489 2.962   15.214  1.00 23.74 ? 315  ARG K O   1 
ATOM   9927  C  CB  . ARG K  2 110 ? -53.386 2.032   18.267  1.00 27.33 ? 315  ARG K CB  1 
ATOM   9928  C  CG  . ARG K  2 110 ? -54.116 1.639   19.546  1.00 29.08 ? 315  ARG K CG  1 
ATOM   9929  C  CD  . ARG K  2 110 ? -53.310 0.756   20.466  1.00 29.42 ? 315  ARG K CD  1 
ATOM   9930  N  NE  . ARG K  2 110 ? -52.406 1.528   21.310  1.00 29.08 ? 315  ARG K NE  1 
ATOM   9931  C  CZ  . ARG K  2 110 ? -52.575 1.790   22.606  1.00 30.22 ? 315  ARG K CZ  1 
ATOM   9932  N  NH1 . ARG K  2 110 ? -53.631 1.373   23.281  1.00 31.90 ? 315  ARG K NH1 1 
ATOM   9933  N  NH2 . ARG K  2 110 ? -51.656 2.499   23.243  1.00 30.12 ? 315  ARG K NH2 1 
ATOM   9934  N  N   . TYR K  2 111 ? -52.673 4.758   16.359  1.00 22.65 ? 316  TYR K N   1 
ATOM   9935  C  CA  . TYR K  2 111 ? -51.812 5.294   15.293  1.00 21.02 ? 316  TYR K CA  1 
ATOM   9936  C  C   . TYR K  2 111 ? -50.391 4.780   15.490  1.00 19.54 ? 316  TYR K C   1 
ATOM   9937  O  O   . TYR K  2 111 ? -49.884 4.771   16.612  1.00 19.40 ? 316  TYR K O   1 
ATOM   9938  C  CB  . TYR K  2 111 ? -51.787 6.836   15.310  1.00 20.70 ? 316  TYR K CB  1 
ATOM   9939  C  CG  . TYR K  2 111 ? -53.080 7.496   14.896  1.00 21.52 ? 316  TYR K CG  1 
ATOM   9940  C  CD1 . TYR K  2 111 ? -54.078 7.762   15.825  1.00 22.61 ? 316  TYR K CD1 1 
ATOM   9941  C  CD2 . TYR K  2 111 ? -53.313 7.848   13.569  1.00 21.47 ? 316  TYR K CD2 1 
ATOM   9942  C  CE1 . TYR K  2 111 ? -55.267 8.361   15.452  1.00 23.50 ? 316  TYR K CE1 1 
ATOM   9943  C  CE2 . TYR K  2 111 ? -54.502 8.453   13.178  1.00 22.38 ? 316  TYR K CE2 1 
ATOM   9944  C  CZ  . TYR K  2 111 ? -55.474 8.705   14.126  1.00 23.45 ? 316  TYR K CZ  1 
ATOM   9945  O  OH  . TYR K  2 111 ? -56.651 9.302   13.757  1.00 24.79 ? 316  TYR K OH  1 
ATOM   9946  N  N   . TYR K  2 112 ? -49.746 4.367   14.401  1.00 18.33 ? 317  TYR K N   1 
ATOM   9947  C  CA  . TYR K  2 112 ? -48.395 3.821   14.482  1.00 17.26 ? 317  TYR K CA  1 
ATOM   9948  C  C   . TYR K  2 112 ? -47.398 4.604   13.623  1.00 16.21 ? 317  TYR K C   1 
ATOM   9949  O  O   . TYR K  2 112 ? -47.785 5.391   12.755  1.00 16.13 ? 317  TYR K O   1 
ATOM   9950  C  CB  . TYR K  2 112 ? -48.402 2.358   14.050  1.00 17.50 ? 317  TYR K CB  1 
ATOM   9951  C  CG  . TYR K  2 112 ? -49.185 1.445   14.955  1.00 18.47 ? 317  TYR K CG  1 
ATOM   9952  C  CD1 . TYR K  2 112 ? -50.567 1.286   14.806  1.00 19.39 ? 317  TYR K CD1 1 
ATOM   9953  C  CD2 . TYR K  2 112 ? -48.549 0.726   15.942  1.00 18.60 ? 317  TYR K CD2 1 
ATOM   9954  C  CE1 . TYR K  2 112 ? -51.280 0.442   15.637  1.00 20.47 ? 317  TYR K CE1 1 
ATOM   9955  C  CE2 . TYR K  2 112 ? -49.246 -0.105  16.785  1.00 19.91 ? 317  TYR K CE2 1 
ATOM   9956  C  CZ  . TYR K  2 112 ? -50.609 -0.251  16.628  1.00 20.70 ? 317  TYR K CZ  1 
ATOM   9957  O  OH  . TYR K  2 112 ? -51.273 -1.091  17.468  1.00 21.87 ? 317  TYR K OH  1 
ATOM   9958  N  N   . SER K  2 113 ? -46.115 4.387   13.888  1.00 15.47 ? 318  SER K N   1 
ATOM   9959  C  CA  . SER K  2 113 ? -45.033 4.922   13.049  1.00 14.73 ? 318  SER K CA  1 
ATOM   9960  C  C   . SER K  2 113 ? -44.384 3.802   12.242  1.00 14.61 ? 318  SER K C   1 
ATOM   9961  O  O   . SER K  2 113 ? -44.036 2.774   12.793  1.00 14.64 ? 318  SER K O   1 
ATOM   9962  C  CB  . SER K  2 113 ? -43.961 5.590   13.903  1.00 14.20 ? 318  SER K CB  1 
ATOM   9963  O  OG  . SER K  2 113 ? -44.498 6.669   14.633  1.00 14.34 ? 318  SER K OG  1 
ATOM   9964  N  N   . SER K  2 114 ? -44.217 4.017   10.942  1.00 14.62 ? 319  SER K N   1 
ATOM   9965  C  CA  . SER K  2 114 ? -43.590 3.020   10.072  1.00 14.79 ? 319  SER K CA  1 
ATOM   9966  C  C   . SER K  2 114 ? -42.074 3.084   10.098  1.00 14.45 ? 319  SER K C   1 
ATOM   9967  O  O   . SER K  2 114 ? -41.429 2.104   9.780   1.00 14.56 ? 319  SER K O   1 
ATOM   9968  C  CB  . SER K  2 114 ? -44.070 3.184   8.632   1.00 15.08 ? 319  SER K CB  1 
ATOM   9969  O  OG  . SER K  2 114 ? -43.972 4.533   8.254   1.00 15.00 ? 319  SER K OG  1 
ATOM   9970  N  N   . GLU K  2 115 ? -41.516 4.233   10.478  1.00 14.25 ? 320  GLU K N   1 
ATOM   9971  C  CA  . GLU K  2 115 ? -40.060 4.458   10.453  1.00 14.25 ? 320  GLU K CA  1 
ATOM   9972  C  C   . GLU K  2 115 ? -39.736 5.519   11.477  1.00 13.82 ? 320  GLU K C   1 
ATOM   9973  O  O   . GLU K  2 115 ? -40.583 6.373   11.780  1.00 13.87 ? 320  GLU K O   1 
ATOM   9974  C  CB  . GLU K  2 115 ? -39.594 4.935   9.063   1.00 14.62 ? 320  GLU K CB  1 
ATOM   9975  C  CG  . GLU K  2 115 ? -38.096 4.805   8.782   1.00 14.93 ? 320  GLU K CG  1 
ATOM   9976  C  CD  . GLU K  2 115 ? -37.249 5.996   9.260   1.00 15.09 ? 320  GLU K CD  1 
ATOM   9977  O  OE1 . GLU K  2 115 ? -37.808 7.122   9.503   1.00 15.88 ? 320  GLU K OE1 1 
ATOM   9978  O  OE2 . GLU K  2 115 ? -36.003 5.828   9.386   1.00 15.41 ? 320  GLU K OE2 1 
ATOM   9979  N  N   . TYR K  2 116 ? -38.537 5.451   12.030  1.00 13.41 ? 321  TYR K N   1 
ATOM   9980  C  CA  . TYR K  2 116 ? -38.062 6.473   12.940  1.00 13.14 ? 321  TYR K CA  1 
ATOM   9981  C  C   . TYR K  2 116 ? -36.541 6.445   12.964  1.00 13.15 ? 321  TYR K C   1 
ATOM   9982  O  O   . TYR K  2 116 ? -35.945 5.390   12.828  1.00 13.27 ? 321  TYR K O   1 
ATOM   9983  C  CB  . TYR K  2 116 ? -38.660 6.304   14.348  1.00 13.15 ? 321  TYR K CB  1 
ATOM   9984  C  CG  . TYR K  2 116 ? -38.365 4.970   14.995  1.00 13.32 ? 321  TYR K CG  1 
ATOM   9985  C  CD1 . TYR K  2 116 ? -37.203 4.777   15.726  1.00 13.32 ? 321  TYR K CD1 1 
ATOM   9986  C  CD2 . TYR K  2 116 ? -39.250 3.903   14.880  1.00 13.61 ? 321  TYR K CD2 1 
ATOM   9987  C  CE1 . TYR K  2 116 ? -36.917 3.556   16.304  1.00 13.67 ? 321  TYR K CE1 1 
ATOM   9988  C  CE2 . TYR K  2 116 ? -38.963 2.677   15.461  1.00 13.98 ? 321  TYR K CE2 1 
ATOM   9989  C  CZ  . TYR K  2 116 ? -37.791 2.515   16.162  1.00 14.02 ? 321  TYR K CZ  1 
ATOM   9990  O  OH  . TYR K  2 116 ? -37.487 1.314   16.744  1.00 14.61 ? 321  TYR K OH  1 
ATOM   9991  N  N   . HIS K  2 117 ? -35.909 7.607   13.105  1.00 13.24 ? 322  HIS K N   1 
ATOM   9992  C  CA  . HIS K  2 117 ? -34.456 7.658   13.208  1.00 13.39 ? 322  HIS K CA  1 
ATOM   9993  C  C   . HIS K  2 117 ? -33.968 8.965   13.764  1.00 13.29 ? 322  HIS K C   1 
ATOM   9994  O  O   . HIS K  2 117 ? -34.645 9.982   13.694  1.00 13.20 ? 322  HIS K O   1 
ATOM   9995  C  CB  . HIS K  2 117 ? -33.797 7.414   11.838  1.00 13.83 ? 322  HIS K CB  1 
ATOM   9996  C  CG  . HIS K  2 117 ? -34.116 8.458   10.810  1.00 14.29 ? 322  HIS K CG  1 
ATOM   9997  N  ND1 . HIS K  2 117 ? -35.222 8.383   9.989   1.00 14.88 ? 322  HIS K ND1 1 
ATOM   9998  C  CD2 . HIS K  2 117 ? -33.470 9.596   10.464  1.00 14.70 ? 322  HIS K CD2 1 
ATOM   9999  C  CE1 . HIS K  2 117 ? -35.239 9.428   9.176   1.00 15.33 ? 322  HIS K CE1 1 
ATOM   10000 N  NE2 . HIS K  2 117 ? -34.187 10.183  9.450   1.00 15.37 ? 322  HIS K NE2 1 
ATOM   10001 N  N   . TYR K  2 118 ? -32.774 8.930   14.338  1.00 13.30 ? 323  TYR K N   1 
ATOM   10002 C  CA  . TYR K  2 118 ? -32.070 10.144  14.633  1.00 13.36 ? 323  TYR K CA  1 
ATOM   10003 C  C   . TYR K  2 118 ? -31.618 10.721  13.298  1.00 13.70 ? 323  TYR K C   1 
ATOM   10004 O  O   . TYR K  2 118 ? -31.133 10.005  12.426  1.00 13.63 ? 323  TYR K O   1 
ATOM   10005 C  CB  . TYR K  2 118 ? -30.864 9.874   15.520  1.00 13.50 ? 323  TYR K CB  1 
ATOM   10006 C  CG  . TYR K  2 118 ? -31.176 9.647   16.976  1.00 13.55 ? 323  TYR K CG  1 
ATOM   10007 C  CD1 . TYR K  2 118 ? -31.821 10.619  17.723  1.00 13.64 ? 323  TYR K CD1 1 
ATOM   10008 C  CD2 . TYR K  2 118 ? -30.809 8.475   17.613  1.00 13.70 ? 323  TYR K CD2 1 
ATOM   10009 C  CE1 . TYR K  2 118 ? -32.109 10.428  19.056  1.00 13.93 ? 323  TYR K CE1 1 
ATOM   10010 C  CE2 . TYR K  2 118 ? -31.100 8.273   18.949  1.00 14.01 ? 323  TYR K CE2 1 
ATOM   10011 C  CZ  . TYR K  2 118 ? -31.737 9.259   19.669  1.00 14.06 ? 323  TYR K CZ  1 
ATOM   10012 O  OH  . TYR K  2 118 ? -32.024 9.078   21.000  1.00 14.38 ? 323  TYR K OH  1 
ATOM   10013 N  N   . VAL K  2 119 ? -31.793 12.023  13.152  1.00 14.19 ? 324  VAL K N   1 
ATOM   10014 C  CA  . VAL K  2 119 ? -31.310 12.745  12.004  1.00 14.83 ? 324  VAL K CA  1 
ATOM   10015 C  C   . VAL K  2 119 ? -29.788 12.600  11.936  1.00 15.21 ? 324  VAL K C   1 
ATOM   10016 O  O   . VAL K  2 119 ? -29.068 12.931  12.883  1.00 15.06 ? 324  VAL K O   1 
ATOM   10017 C  CB  . VAL K  2 119 ? -31.710 14.220  12.090  1.00 15.23 ? 324  VAL K CB  1 
ATOM   10018 C  CG1 . VAL K  2 119 ? -30.979 15.043  11.051  1.00 15.91 ? 324  VAL K CG1 1 
ATOM   10019 C  CG2 . VAL K  2 119 ? -33.215 14.351  11.938  1.00 15.25 ? 324  VAL K CG2 1 
ATOM   10020 N  N   . GLY K  2 120 ? -29.320 12.070  10.811  1.00 15.65 ? 325  GLY K N   1 
ATOM   10021 C  CA  . GLY K  2 120 ? -27.926 11.722  10.645  1.00 15.78 ? 325  GLY K CA  1 
ATOM   10022 C  C   . GLY K  2 120 ? -27.694 10.228  10.776  1.00 15.36 ? 325  GLY K C   1 
ATOM   10023 O  O   . GLY K  2 120 ? -26.575 9.771   10.614  1.00 15.81 ? 325  GLY K O   1 
ATOM   10024 N  N   . GLY K  2 121 ? -28.740 9.462   11.084  1.00 14.69 ? 326  GLY K N   1 
ATOM   10025 C  CA  . GLY K  2 121 ? -28.654 8.006   11.092  1.00 14.55 ? 326  GLY K CA  1 
ATOM   10026 C  C   . GLY K  2 121 ? -28.506 7.396   12.470  1.00 14.38 ? 326  GLY K C   1 
ATOM   10027 O  O   . GLY K  2 121 ? -28.917 6.255   12.671  1.00 15.11 ? 326  GLY K O   1 
ATOM   10028 N  N   . PHE K  2 122 ? -27.935 8.147   13.417  1.00 14.05 ? 327  PHE K N   1 
ATOM   10029 C  CA  . PHE K  2 122 ? -27.652 7.660   14.769  1.00 13.85 ? 327  PHE K CA  1 
ATOM   10030 C  C   . PHE K  2 122 ? -27.322 8.849   15.672  1.00 13.81 ? 327  PHE K C   1 
ATOM   10031 O  O   . PHE K  2 122 ? -27.035 9.921   15.177  1.00 13.73 ? 327  PHE K O   1 
ATOM   10032 C  CB  . PHE K  2 122 ? -26.490 6.672   14.761  1.00 14.23 ? 327  PHE K CB  1 
ATOM   10033 C  CG  . PHE K  2 122 ? -25.263 7.196   14.085  1.00 14.58 ? 327  PHE K CG  1 
ATOM   10034 C  CD1 . PHE K  2 122 ? -24.354 7.973   14.772  1.00 14.81 ? 327  PHE K CD1 1 
ATOM   10035 C  CD2 . PHE K  2 122 ? -25.031 6.929   12.746  1.00 14.84 ? 327  PHE K CD2 1 
ATOM   10036 C  CE1 . PHE K  2 122 ? -23.242 8.477   14.150  1.00 15.30 ? 327  PHE K CE1 1 
ATOM   10037 C  CE2 . PHE K  2 122 ? -23.909 7.427   12.111  1.00 15.40 ? 327  PHE K CE2 1 
ATOM   10038 C  CZ  . PHE K  2 122 ? -23.009 8.203   12.820  1.00 15.63 ? 327  PHE K CZ  1 
ATOM   10039 N  N   . TYR K  2 123 ? -27.410 8.657   16.989  1.00 13.97 ? 328  TYR K N   1 
ATOM   10040 C  CA  . TYR K  2 123 ? -27.129 9.723   17.936  1.00 14.29 ? 328  TYR K CA  1 
ATOM   10041 C  C   . TYR K  2 123 ? -25.658 10.077  17.781  1.00 14.90 ? 328  TYR K C   1 
ATOM   10042 O  O   . TYR K  2 123 ? -24.798 9.199   17.878  1.00 15.34 ? 328  TYR K O   1 
ATOM   10043 C  CB  . TYR K  2 123 ? -27.418 9.296   19.387  1.00 14.50 ? 328  TYR K CB  1 
ATOM   10044 C  CG  . TYR K  2 123 ? -27.146 10.390  20.392  1.00 14.85 ? 328  TYR K CG  1 
ATOM   10045 C  CD1 . TYR K  2 123 ? -27.885 11.558  20.383  1.00 14.77 ? 328  TYR K CD1 1 
ATOM   10046 C  CD2 . TYR K  2 123 ? -26.135 10.272  21.333  1.00 15.49 ? 328  TYR K CD2 1 
ATOM   10047 C  CE1 . TYR K  2 123 ? -27.625 12.579  21.283  1.00 15.24 ? 328  TYR K CE1 1 
ATOM   10048 C  CE2 . TYR K  2 123 ? -25.868 11.287  22.238  1.00 15.92 ? 328  TYR K CE2 1 
ATOM   10049 C  CZ  . TYR K  2 123 ? -26.617 12.443  22.212  1.00 15.80 ? 328  TYR K CZ  1 
ATOM   10050 O  OH  . TYR K  2 123 ? -26.380 13.471  23.125  1.00 16.61 ? 328  TYR K OH  1 
ATOM   10051 N  N   . GLY K  2 124 ? -25.391 11.355  17.519  1.00 15.15 ? 329  GLY K N   1 
ATOM   10052 C  CA  . GLY K  2 124 ? -24.071 11.821  17.161  1.00 15.88 ? 329  GLY K CA  1 
ATOM   10053 C  C   . GLY K  2 124 ? -24.015 12.426  15.774  1.00 16.08 ? 329  GLY K C   1 
ATOM   10054 O  O   . GLY K  2 124 ? -23.140 13.239  15.504  1.00 16.64 ? 329  GLY K O   1 
ATOM   10055 N  N   . GLY K  2 125 ? -24.957 12.055  14.901  1.00 15.85 ? 330  GLY K N   1 
ATOM   10056 C  CA  . GLY K  2 125 ? -24.905 12.447  13.484  1.00 16.18 ? 330  GLY K CA  1 
ATOM   10057 C  C   . GLY K  2 125 ? -25.647 13.717  13.084  1.00 16.39 ? 330  GLY K C   1 
ATOM   10058 O  O   . GLY K  2 125 ? -25.650 14.110  11.908  1.00 16.86 ? 330  GLY K O   1 
ATOM   10059 N  N   . CYS K  2 126 ? -26.273 14.381  14.044  1.00 16.32 ? 331  CYS K N   1 
ATOM   10060 C  CA  . CYS K  2 126 ? -27.132 15.524  13.730  1.00 16.52 ? 331  CYS K CA  1 
ATOM   10061 C  C   . CYS K  2 126 ? -26.335 16.733  13.275  1.00 16.92 ? 331  CYS K C   1 
ATOM   10062 O  O   . CYS K  2 126 ? -25.204 16.913  13.705  1.00 17.36 ? 331  CYS K O   1 
ATOM   10063 C  CB  . CYS K  2 126 ? -27.965 15.904  14.954  1.00 16.87 ? 331  CYS K CB  1 
ATOM   10064 S  SG  . CYS K  2 126 ? -29.501 16.730  14.506  1.00 18.03 ? 331  CYS K SG  1 
ATOM   10065 N  N   . ASN K  2 127 ? -26.921 17.545  12.391  1.00 16.93 ? 332  ASN K N   1 
ATOM   10066 C  CA  . ASN K  2 127 ? -26.413 18.885  12.100  1.00 17.54 ? 332  ASN K CA  1 
ATOM   10067 C  C   . ASN K  2 127 ? -27.487 19.798  11.510  1.00 17.76 ? 332  ASN K C   1 
ATOM   10068 O  O   . ASN K  2 127 ? -28.555 19.351  11.123  1.00 17.32 ? 332  ASN K O   1 
ATOM   10069 C  CB  . ASN K  2 127 ? -25.172 18.828  11.199  1.00 18.22 ? 332  ASN K CB  1 
ATOM   10070 C  CG  . ASN K  2 127 ? -25.467 18.291  9.813   1.00 18.22 ? 332  ASN K CG  1 
ATOM   10071 O  OD1 . ASN K  2 127 ? -26.420 18.709  9.156   1.00 18.28 ? 332  ASN K OD1 1 
ATOM   10072 N  ND2 . ASN K  2 127 ? -24.637 17.378  9.352   1.00 18.25 ? 332  ASN K ND2 1 
ATOM   10073 N  N   . GLU K  2 128 ? -27.191 21.085  11.438  1.00 18.70 ? 333  GLU K N   1 
ATOM   10074 C  CA  . GLU K  2 128 ? -28.152 22.065  10.958  1.00 19.30 ? 333  GLU K CA  1 
ATOM   10075 C  C   . GLU K  2 128 ? -28.668 21.711  9.564   1.00 19.30 ? 333  GLU K C   1 
ATOM   10076 O  O   . GLU K  2 128 ? -29.889 21.705  9.339   1.00 18.85 ? 333  GLU K O   1 
ATOM   10077 C  CB  . GLU K  2 128 ? -27.534 23.472  10.946  1.00 20.84 ? 333  GLU K CB  1 
ATOM   10078 C  CG  . GLU K  2 128 ? -28.478 24.572  10.447  1.00 21.78 ? 333  GLU K CG  1 
ATOM   10079 C  CD  . GLU K  2 128 ? -27.797 25.650  9.631   1.00 23.66 ? 333  GLU K CD  1 
ATOM   10080 O  OE1 . GLU K  2 128 ? -26.640 25.435  9.203   1.00 24.37 ? 333  GLU K OE1 1 
ATOM   10081 O  OE2 . GLU K  2 128 ? -28.425 26.718  9.407   1.00 25.24 ? 333  GLU K OE2 1 
ATOM   10082 N  N   . ALA K  2 129 ? -27.746 21.420  8.639   1.00 19.61 ? 334  ALA K N   1 
ATOM   10083 C  CA  . ALA K  2 129 ? -28.123 21.111  7.250   1.00 19.92 ? 334  ALA K CA  1 
ATOM   10084 C  C   . ALA K  2 129 ? -29.107 19.944  7.132   1.00 18.91 ? 334  ALA K C   1 
ATOM   10085 O  O   . ALA K  2 129 ? -30.104 20.041  6.418   1.00 19.09 ? 334  ALA K O   1 
ATOM   10086 C  CB  . ALA K  2 129 ? -26.890 20.847  6.397   1.00 20.69 ? 334  ALA K CB  1 
ATOM   10087 N  N   . LEU K  2 130 ? -28.842 18.851  7.835   1.00 18.02 ? 335  LEU K N   1 
ATOM   10088 C  CA  . LEU K  2 130 ? -29.730 17.684  7.781   1.00 17.28 ? 335  LEU K CA  1 
ATOM   10089 C  C   . LEU K  2 130 ? -31.085 17.955  8.427   1.00 16.84 ? 335  LEU K C   1 
ATOM   10090 O  O   . LEU K  2 130 ? -32.088 17.418  7.984   1.00 16.88 ? 335  LEU K O   1 
ATOM   10091 C  CB  . LEU K  2 130 ? -29.085 16.477  8.452   1.00 16.61 ? 335  LEU K CB  1 
ATOM   10092 C  CG  . LEU K  2 130 ? -27.864 15.905  7.747   1.00 17.13 ? 335  LEU K CG  1 
ATOM   10093 C  CD1 . LEU K  2 130 ? -27.146 14.971  8.703   1.00 16.64 ? 335  LEU K CD1 1 
ATOM   10094 C  CD2 . LEU K  2 130 ? -28.249 15.201  6.446   1.00 17.39 ? 335  LEU K CD2 1 
ATOM   10095 N  N   . MET K  2 131 ? -31.097 18.787  9.473   1.00 16.93 ? 336  MET K N   1 
ATOM   10096 C  CA  . MET K  2 131 ? -32.339 19.202  10.126  1.00 16.73 ? 336  MET K CA  1 
ATOM   10097 C  C   . MET K  2 131 ? -33.211 20.042  9.182   1.00 17.53 ? 336  MET K C   1 
ATOM   10098 O  O   . MET K  2 131 ? -34.419 19.862  9.123   1.00 17.69 ? 336  MET K O   1 
ATOM   10099 C  CB  . MET K  2 131 ? -32.052 19.978  11.422  1.00 16.75 ? 336  MET K CB  1 
ATOM   10100 C  CG  . MET K  2 131 ? -31.419 19.143  12.523  1.00 16.20 ? 336  MET K CG  1 
ATOM   10101 S  SD  . MET K  2 131 ? -30.855 20.125  13.943  1.00 16.69 ? 336  MET K SD  1 
ATOM   10102 C  CE  . MET K  2 131 ? -32.427 20.738  14.553  1.00 16.63 ? 336  MET K CE  1 
ATOM   10103 N  N   . LYS K  2 132 ? -32.601 20.959  8.446   1.00 18.69 ? 337  LYS K N   1 
ATOM   10104 C  CA  . LYS K  2 132 ? -33.344 21.793  7.500   1.00 19.71 ? 337  LYS K CA  1 
ATOM   10105 C  C   . LYS K  2 132 ? -33.966 20.908  6.439   1.00 19.93 ? 337  LYS K C   1 
ATOM   10106 O  O   . LYS K  2 132 ? -35.157 21.043  6.161   1.00 20.17 ? 337  LYS K O   1 
ATOM   10107 C  CB  . LYS K  2 132 ? -32.447 22.818  6.823   1.00 20.77 ? 337  LYS K CB  1 
ATOM   10108 C  CG  . LYS K  2 132 ? -32.000 23.953  7.713   1.00 21.17 ? 337  LYS K CG  1 
ATOM   10109 C  CD  . LYS K  2 132 ? -30.918 24.794  7.049   1.00 22.40 ? 337  LYS K CD  1 
ATOM   10110 C  CE  . LYS K  2 132 ? -31.427 25.536  5.821   1.00 23.68 ? 337  LYS K CE  1 
ATOM   10111 N  NZ  . LYS K  2 132 ? -30.345 26.361  5.210   1.00 25.14 ? 337  LYS K NZ  1 
ATOM   10112 N  N   . LEU K  2 133 ? -33.150 20.006  5.881   1.00 20.04 ? 338  LEU K N   1 
ATOM   10113 C  CA  . LEU K  2 133 ? -33.586 19.037  4.867   1.00 20.56 ? 338  LEU K CA  1 
ATOM   10114 C  C   . LEU K  2 133 ? -34.769 18.190  5.368   1.00 19.77 ? 338  LEU K C   1 
ATOM   10115 O  O   . LEU K  2 133 ? -35.788 18.105  4.703   1.00 20.30 ? 338  LEU K O   1 
ATOM   10116 C  CB  . LEU K  2 133 ? -32.404 18.140  4.454   1.00 20.79 ? 338  LEU K CB  1 
ATOM   10117 C  CG  . LEU K  2 133 ? -32.482 17.250  3.202   1.00 21.63 ? 338  LEU K CG  1 
ATOM   10118 C  CD1 . LEU K  2 133 ? -31.184 16.466  2.963   1.00 21.83 ? 338  LEU K CD1 1 
ATOM   10119 C  CD2 . LEU K  2 133 ? -33.649 16.276  3.259   1.00 21.05 ? 338  LEU K CD2 1 
ATOM   10120 N  N   . GLU K  2 134 ? -34.637 17.596  6.549   1.00 18.97 ? 339  GLU K N   1 
ATOM   10121 C  CA  . GLU K  2 134 ? -35.702 16.811  7.151   1.00 18.39 ? 339  GLU K CA  1 
ATOM   10122 C  C   . GLU K  2 134 ? -36.959 17.652  7.360   1.00 18.63 ? 339  GLU K C   1 
ATOM   10123 O  O   . GLU K  2 134 ? -38.078 17.223  7.057   1.00 18.48 ? 339  GLU K O   1 
ATOM   10124 C  CB  . GLU K  2 134 ? -35.236 16.261  8.484   1.00 17.95 ? 339  GLU K CB  1 
ATOM   10125 C  CG  . GLU K  2 134 ? -36.275 15.440  9.248   1.00 17.68 ? 339  GLU K CG  1 
ATOM   10126 C  CD  . GLU K  2 134 ? -36.593 14.107  8.587   1.00 17.69 ? 339  GLU K CD  1 
ATOM   10127 O  OE1 . GLU K  2 134 ? -35.665 13.501  7.980   1.00 19.01 ? 339  GLU K OE1 1 
ATOM   10128 O  OE2 . GLU K  2 134 ? -37.767 13.670  8.673   1.00 17.19 ? 339  GLU K OE2 1 
ATOM   10129 N  N   . LEU K  2 135 ? -36.779 18.852  7.881   1.00 18.84 ? 340  LEU K N   1 
ATOM   10130 C  CA  . LEU K  2 135 ? -37.914 19.691  8.226   1.00 19.19 ? 340  LEU K CA  1 
ATOM   10131 C  C   . LEU K  2 135 ? -38.761 20.021  6.998   1.00 19.92 ? 340  LEU K C   1 
ATOM   10132 O  O   . LEU K  2 135 ? -39.989 19.888  7.026   1.00 19.92 ? 340  LEU K O   1 
ATOM   10133 C  CB  . LEU K  2 135 ? -37.424 20.980  8.866   1.00 19.57 ? 340  LEU K CB  1 
ATOM   10134 C  CG  . LEU K  2 135 ? -38.506 21.961  9.262   1.00 20.15 ? 340  LEU K CG  1 
ATOM   10135 C  CD1 . LEU K  2 135 ? -39.297 21.429  10.449  1.00 19.61 ? 340  LEU K CD1 1 
ATOM   10136 C  CD2 . LEU K  2 135 ? -37.874 23.307  9.569   1.00 20.98 ? 340  LEU K CD2 1 
ATOM   10137 N  N   . VAL K  2 136 ? -38.088 20.475  5.941   1.00 20.75 ? 341  VAL K N   1 
ATOM   10138 C  CA  . VAL K  2 136 ? -38.732 20.937  4.719   1.00 21.79 ? 341  VAL K CA  1 
ATOM   10139 C  C   . VAL K  2 136 ? -39.328 19.757  3.956   1.00 21.70 ? 341  VAL K C   1 
ATOM   10140 O  O   . VAL K  2 136 ? -40.437 19.837  3.454   1.00 22.15 ? 341  VAL K O   1 
ATOM   10141 C  CB  . VAL K  2 136 ? -37.743 21.731  3.827   1.00 22.80 ? 341  VAL K CB  1 
ATOM   10142 C  CG1 . VAL K  2 136 ? -38.343 22.039  2.457   1.00 24.05 ? 341  VAL K CG1 1 
ATOM   10143 C  CG2 . VAL K  2 136 ? -37.345 23.031  4.510   1.00 23.28 ? 341  VAL K CG2 1 
ATOM   10144 N  N   . HIS K  2 137 ? -38.603 18.652  3.906   1.00 21.46 ? 342  HIS K N   1 
ATOM   10145 C  CA  . HIS K  2 137 ? -39.024 17.504  3.102   1.00 21.53 ? 342  HIS K CA  1 
ATOM   10146 C  C   . HIS K  2 137 ? -39.988 16.556  3.790   1.00 20.32 ? 342  HIS K C   1 
ATOM   10147 O  O   . HIS K  2 137 ? -40.689 15.834  3.110   1.00 20.45 ? 342  HIS K O   1 
ATOM   10148 C  CB  . HIS K  2 137 ? -37.788 16.744  2.618   1.00 21.80 ? 342  HIS K CB  1 
ATOM   10149 C  CG  . HIS K  2 137 ? -37.076 17.427  1.498   1.00 23.51 ? 342  HIS K CG  1 
ATOM   10150 N  ND1 . HIS K  2 137 ? -35.942 16.909  0.911   1.00 24.59 ? 342  HIS K ND1 1 
ATOM   10151 C  CD2 . HIS K  2 137 ? -37.362 18.569  0.821   1.00 25.07 ? 342  HIS K CD2 1 
ATOM   10152 C  CE1 . HIS K  2 137 ? -35.547 17.713  -0.067  1.00 25.94 ? 342  HIS K CE1 1 
ATOM   10153 N  NE2 . HIS K  2 137 ? -36.389 18.731  -0.139  1.00 26.29 ? 342  HIS K NE2 1 
ATOM   10154 N  N   . HIS K  2 138 ? -40.025 16.545  5.122   1.00 19.32 ? 343  HIS K N   1 
ATOM   10155 C  CA  . HIS K  2 138 ? -40.868 15.590  5.860   1.00 18.61 ? 343  HIS K CA  1 
ATOM   10156 C  C   . HIS K  2 138 ? -41.677 16.158  7.018   1.00 18.49 ? 343  HIS K C   1 
ATOM   10157 O  O   . HIS K  2 138 ? -42.511 15.449  7.587   1.00 18.46 ? 343  HIS K O   1 
ATOM   10158 C  CB  . HIS K  2 138 ? -40.024 14.432  6.402   1.00 17.76 ? 343  HIS K CB  1 
ATOM   10159 C  CG  . HIS K  2 138 ? -39.203 13.753  5.357   1.00 18.04 ? 343  HIS K CG  1 
ATOM   10160 N  ND1 . HIS K  2 138 ? -39.754 12.940  4.389   1.00 18.47 ? 343  HIS K ND1 1 
ATOM   10161 C  CD2 . HIS K  2 138 ? -37.875 13.787  5.109   1.00 18.14 ? 343  HIS K CD2 1 
ATOM   10162 C  CE1 . HIS K  2 138 ? -38.799 12.501  3.593   1.00 18.66 ? 343  HIS K CE1 1 
ATOM   10163 N  NE2 . HIS K  2 138 ? -37.650 13.004  4.005   1.00 18.36 ? 343  HIS K NE2 1 
ATOM   10164 N  N   . GLY K  2 139 ? -41.432 17.398  7.406   1.00 18.56 ? 344  GLY K N   1 
ATOM   10165 C  CA  . GLY K  2 139 ? -42.274 18.028  8.400   1.00 18.62 ? 344  GLY K CA  1 
ATOM   10166 C  C   . GLY K  2 139 ? -41.615 18.236  9.741   1.00 17.98 ? 344  GLY K C   1 
ATOM   10167 O  O   . GLY K  2 139 ? -40.490 17.813  9.942   1.00 17.58 ? 344  GLY K O   1 
ATOM   10168 N  N   . PRO K  2 140 ? -42.323 18.904  10.664  1.00 18.24 ? 345  PRO K N   1 
ATOM   10169 C  CA  . PRO K  2 140 ? -41.830 19.169  12.001  1.00 18.15 ? 345  PRO K CA  1 
ATOM   10170 C  C   . PRO K  2 140 ? -41.200 17.952  12.655  1.00 17.56 ? 345  PRO K C   1 
ATOM   10171 O  O   . PRO K  2 140 ? -41.679 16.835  12.467  1.00 17.35 ? 345  PRO K O   1 
ATOM   10172 C  CB  . PRO K  2 140 ? -43.094 19.572  12.758  1.00 18.42 ? 345  PRO K CB  1 
ATOM   10173 C  CG  . PRO K  2 140 ? -43.882 20.273  11.721  1.00 19.23 ? 345  PRO K CG  1 
ATOM   10174 C  CD  . PRO K  2 140 ? -43.674 19.462  10.477  1.00 18.96 ? 345  PRO K CD  1 
ATOM   10175 N  N   . MET K  2 141 ? -40.135 18.172  13.414  1.00 17.64 ? 346  MET K N   1 
ATOM   10176 C  CA  . MET K  2 141 ? -39.472 17.084  14.099  1.00 17.46 ? 346  MET K CA  1 
ATOM   10177 C  C   . MET K  2 141 ? -39.175 17.449  15.548  1.00 17.20 ? 346  MET K C   1 
ATOM   10178 O  O   . MET K  2 141 ? -38.977 18.618  15.867  1.00 17.59 ? 346  MET K O   1 
ATOM   10179 C  CB  . MET K  2 141 ? -38.173 16.723  13.364  1.00 17.95 ? 346  MET K CB  1 
ATOM   10180 C  CG  . MET K  2 141 ? -37.022 17.652  13.698  1.00 18.55 ? 346  MET K CG  1 
ATOM   10181 S  SD  . MET K  2 141 ? -35.885 17.880  12.326  1.00 21.17 ? 346  MET K SD  1 
ATOM   10182 C  CE  . MET K  2 141 ? -37.031 18.500  11.123  1.00 19.52 ? 346  MET K CE  1 
ATOM   10183 N  N   . ALA K  2 142 ? -39.155 16.429  16.402  1.00 16.53 ? 347  ALA K N   1 
ATOM   10184 C  CA  . ALA K  2 142 ? -38.745 16.553  17.795  1.00 16.32 ? 347  ALA K CA  1 
ATOM   10185 C  C   . ALA K  2 142 ? -37.270 16.887  17.903  1.00 16.08 ? 347  ALA K C   1 
ATOM   10186 O  O   . ALA K  2 142 ? -36.427 16.278  17.243  1.00 15.60 ? 347  ALA K O   1 
ATOM   10187 C  CB  . ALA K  2 142 ? -39.027 15.261  18.544  1.00 16.08 ? 347  ALA K CB  1 
ATOM   10188 N  N   . VAL K  2 143 ? -36.969 17.886  18.720  1.00 16.47 ? 348  VAL K N   1 
ATOM   10189 C  CA  . VAL K  2 143 ? -35.597 18.229  19.051  1.00 16.53 ? 348  VAL K CA  1 
ATOM   10190 C  C   . VAL K  2 143 ? -35.500 18.443  20.553  1.00 17.09 ? 348  VAL K C   1 
ATOM   10191 O  O   . VAL K  2 143 ? -36.507 18.598  21.245  1.00 17.58 ? 348  VAL K O   1 
ATOM   10192 C  CB  . VAL K  2 143 ? -35.097 19.477  18.279  1.00 16.92 ? 348  VAL K CB  1 
ATOM   10193 C  CG1 . VAL K  2 143 ? -34.877 19.141  16.814  1.00 16.49 ? 348  VAL K CG1 1 
ATOM   10194 C  CG2 . VAL K  2 143 ? -36.063 20.653  18.399  1.00 17.56 ? 348  VAL K CG2 1 
ATOM   10195 N  N   . ALA K  2 144 ? -34.288 18.423  21.071  1.00 17.34 ? 349  ALA K N   1 
ATOM   10196 C  CA  . ALA K  2 144 ? -34.087 18.720  22.482  1.00 18.02 ? 349  ALA K CA  1 
ATOM   10197 C  C   . ALA K  2 144 ? -32.974 19.744  22.669  1.00 18.45 ? 349  ALA K C   1 
ATOM   10198 O  O   . ALA K  2 144 ? -32.081 19.873  21.837  1.00 18.27 ? 349  ALA K O   1 
ATOM   10199 C  CB  . ALA K  2 144 ? -33.788 17.444  23.256  1.00 18.09 ? 349  ALA K CB  1 
ATOM   10200 N  N   . PHE K  2 145 ? -33.051 20.490  23.763  1.00 19.28 ? 350  PHE K N   1 
ATOM   10201 C  CA  . PHE K  2 145 ? -32.003 21.433  24.103  1.00 19.89 ? 350  PHE K CA  1 
ATOM   10202 C  C   . PHE K  2 145 ? -31.895 21.594  25.612  1.00 20.75 ? 350  PHE K C   1 
ATOM   10203 O  O   . PHE K  2 145 ? -32.739 21.098  26.370  1.00 20.74 ? 350  PHE K O   1 
ATOM   10204 C  CB  . PHE K  2 145 ? -32.231 22.773  23.397  1.00 20.30 ? 350  PHE K CB  1 
ATOM   10205 C  CG  . PHE K  2 145 ? -33.311 23.618  24.000  1.00 21.05 ? 350  PHE K CG  1 
ATOM   10206 C  CD1 . PHE K  2 145 ? -34.645 23.281  23.843  1.00 20.84 ? 350  PHE K CD1 1 
ATOM   10207 C  CD2 . PHE K  2 145 ? -32.991 24.786  24.691  1.00 22.01 ? 350  PHE K CD2 1 
ATOM   10208 C  CE1 . PHE K  2 145 ? -35.644 24.079  24.380  1.00 21.67 ? 350  PHE K CE1 1 
ATOM   10209 C  CE2 . PHE K  2 145 ? -33.986 25.579  25.235  1.00 22.85 ? 350  PHE K CE2 1 
ATOM   10210 C  CZ  . PHE K  2 145 ? -35.314 25.224  25.081  1.00 22.70 ? 350  PHE K CZ  1 
ATOM   10211 N  N   . GLU K  2 146 ? -30.829 22.256  26.039  1.00 21.45 ? 351  GLU K N   1 
ATOM   10212 C  CA  . GLU K  2 146 ? -30.646 22.544  27.446  1.00 22.60 ? 351  GLU K CA  1 
ATOM   10213 C  C   . GLU K  2 146 ? -31.289 23.881  27.757  1.00 23.59 ? 351  GLU K C   1 
ATOM   10214 O  O   . GLU K  2 146 ? -30.857 24.917  27.249  1.00 24.02 ? 351  GLU K O   1 
ATOM   10215 C  CB  . GLU K  2 146 ? -29.168 22.551  27.812  1.00 23.01 ? 351  GLU K CB  1 
ATOM   10216 C  CG  . GLU K  2 146 ? -28.870 22.705  29.306  1.00 24.36 ? 351  GLU K CG  1 
ATOM   10217 C  CD  . GLU K  2 146 ? -29.275 21.505  30.162  1.00 24.42 ? 351  GLU K CD  1 
ATOM   10218 O  OE1 . GLU K  2 146 ? -29.821 20.517  29.617  1.00 23.22 ? 351  GLU K OE1 1 
ATOM   10219 O  OE2 . GLU K  2 146 ? -29.032 21.556  31.400  1.00 25.68 ? 351  GLU K OE2 1 
ATOM   10220 N  N   . VAL K  2 147 ? -32.348 23.834  28.565  1.00 24.23 ? 352  VAL K N   1 
ATOM   10221 C  CA  . VAL K  2 147 ? -32.916 25.024  29.191  1.00 25.63 ? 352  VAL K CA  1 
ATOM   10222 C  C   . VAL K  2 147 ? -31.982 25.475  30.305  1.00 26.94 ? 352  VAL K C   1 
ATOM   10223 O  O   . VAL K  2 147 ? -31.768 24.749  31.276  1.00 27.31 ? 352  VAL K O   1 
ATOM   10224 C  CB  . VAL K  2 147 ? -34.297 24.740  29.822  1.00 26.04 ? 352  VAL K CB  1 
ATOM   10225 C  CG1 . VAL K  2 147 ? -34.729 25.876  30.748  1.00 27.61 ? 352  VAL K CG1 1 
ATOM   10226 C  CG2 . VAL K  2 147 ? -35.340 24.497  28.744  1.00 25.21 ? 352  VAL K CG2 1 
ATOM   10227 N  N   . TYR K  2 148 ? -31.450 26.681  30.169  1.00 27.89 ? 353  TYR K N   1 
ATOM   10228 C  CA  . TYR K  2 148 ? -30.713 27.327  31.252  1.00 29.39 ? 353  TYR K CA  1 
ATOM   10229 C  C   . TYR K  2 148 ? -31.569 28.382  31.941  1.00 30.58 ? 353  TYR K C   1 
ATOM   10230 O  O   . TYR K  2 148 ? -32.627 28.763  31.443  1.00 30.50 ? 353  TYR K O   1 
ATOM   10231 C  CB  . TYR K  2 148 ? -29.447 27.977  30.708  1.00 29.70 ? 353  TYR K CB  1 
ATOM   10232 C  CG  . TYR K  2 148 ? -28.415 27.005  30.199  1.00 29.00 ? 353  TYR K CG  1 
ATOM   10233 C  CD1 . TYR K  2 148 ? -27.663 26.238  31.084  1.00 29.40 ? 353  TYR K CD1 1 
ATOM   10234 C  CD2 . TYR K  2 148 ? -28.170 26.862  28.834  1.00 28.10 ? 353  TYR K CD2 1 
ATOM   10235 C  CE1 . TYR K  2 148 ? -26.694 25.360  30.627  1.00 28.78 ? 353  TYR K CE1 1 
ATOM   10236 C  CE2 . TYR K  2 148 ? -27.198 25.982  28.371  1.00 27.48 ? 353  TYR K CE2 1 
ATOM   10237 C  CZ  . TYR K  2 148 ? -26.466 25.238  29.273  1.00 27.65 ? 353  TYR K CZ  1 
ATOM   10238 O  OH  . TYR K  2 148 ? -25.503 24.367  28.836  1.00 27.11 ? 353  TYR K OH  1 
ATOM   10239 N  N   . ASP K  2 149 ? -31.088 28.867  33.080  1.00 31.89 ? 354  ASP K N   1 
ATOM   10240 C  CA  . ASP K  2 149 ? -31.829 29.841  33.876  1.00 33.37 ? 354  ASP K CA  1 
ATOM   10241 C  C   . ASP K  2 149 ? -32.301 31.029  33.037  1.00 33.90 ? 354  ASP K C   1 
ATOM   10242 O  O   . ASP K  2 149 ? -33.429 31.491  33.209  1.00 34.62 ? 354  ASP K O   1 
ATOM   10243 C  CB  . ASP K  2 149 ? -30.986 30.334  35.062  1.00 34.70 ? 354  ASP K CB  1 
ATOM   10244 C  CG  . ASP K  2 149 ? -30.628 29.212  36.047  1.00 34.75 ? 354  ASP K CG  1 
ATOM   10245 O  OD1 . ASP K  2 149 ? -31.236 28.128  35.940  1.00 33.77 ? 354  ASP K OD1 1 
ATOM   10246 O  OD2 . ASP K  2 149 ? -29.740 29.409  36.919  1.00 35.38 ? 354  ASP K OD2 1 
ATOM   10247 N  N   . ASP K  2 150 ? -31.457 31.511  32.125  1.00 33.80 ? 355  ASP K N   1 
ATOM   10248 C  CA  . ASP K  2 150 ? -31.785 32.723  31.362  1.00 34.70 ? 355  ASP K CA  1 
ATOM   10249 C  C   . ASP K  2 150 ? -32.861 32.515  30.297  1.00 33.87 ? 355  ASP K C   1 
ATOM   10250 O  O   . ASP K  2 150 ? -33.450 33.478  29.813  1.00 34.78 ? 355  ASP K O   1 
ATOM   10251 C  CB  . ASP K  2 150 ? -30.529 33.415  30.792  1.00 35.40 ? 355  ASP K CB  1 
ATOM   10252 C  CG  . ASP K  2 150 ? -29.881 32.664  29.636  1.00 34.39 ? 355  ASP K CG  1 
ATOM   10253 O  OD1 . ASP K  2 150 ? -30.127 31.456  29.433  1.00 33.50 ? 355  ASP K OD1 1 
ATOM   10254 O  OD2 . ASP K  2 150 ? -29.076 33.303  28.929  1.00 35.45 ? 355  ASP K OD2 1 
ATOM   10255 N  N   . PHE K  2 151 ? -33.138 31.260  29.960  1.00 32.39 ? 356  PHE K N   1 
ATOM   10256 C  CA  . PHE K  2 151 ? -34.278 30.933  29.107  1.00 31.58 ? 356  PHE K CA  1 
ATOM   10257 C  C   . PHE K  2 151 ? -35.618 31.243  29.785  1.00 33.00 ? 356  PHE K C   1 
ATOM   10258 O  O   . PHE K  2 151 ? -36.615 31.496  29.114  1.00 32.71 ? 356  PHE K O   1 
ATOM   10259 C  CB  . PHE K  2 151 ? -34.243 29.460  28.726  1.00 29.65 ? 356  PHE K CB  1 
ATOM   10260 C  CG  . PHE K  2 151 ? -35.209 29.098  27.647  1.00 28.55 ? 356  PHE K CG  1 
ATOM   10261 C  CD1 . PHE K  2 151 ? -34.975 29.487  26.337  1.00 28.05 ? 356  PHE K CD1 1 
ATOM   10262 C  CD2 . PHE K  2 151 ? -36.342 28.359  27.933  1.00 28.13 ? 356  PHE K CD2 1 
ATOM   10263 C  CE1 . PHE K  2 151 ? -35.860 29.144  25.333  1.00 27.26 ? 356  PHE K CE1 1 
ATOM   10264 C  CE2 . PHE K  2 151 ? -37.228 28.010  26.933  1.00 27.28 ? 356  PHE K CE2 1 
ATOM   10265 C  CZ  . PHE K  2 151 ? -36.991 28.406  25.634  1.00 26.85 ? 356  PHE K CZ  1 
ATOM   10266 N  N   . LEU K  2 152 ? -35.627 31.214  31.114  1.00 34.49 ? 357  LEU K N   1 
ATOM   10267 C  CA  . LEU K  2 152 ? -36.828 31.504  31.890  1.00 36.18 ? 357  LEU K CA  1 
ATOM   10268 C  C   . LEU K  2 152 ? -37.133 33.006  31.942  1.00 37.84 ? 357  LEU K C   1 
ATOM   10269 O  O   . LEU K  2 152 ? -38.078 33.421  32.575  1.00 39.76 ? 357  LEU K O   1 
ATOM   10270 C  CB  . LEU K  2 152 ? -36.680 30.925  33.300  1.00 37.14 ? 357  LEU K CB  1 
ATOM   10271 C  CG  . LEU K  2 152 ? -36.285 29.436  33.355  1.00 35.81 ? 357  LEU K CG  1 
ATOM   10272 C  CD1 . LEU K  2 152 ? -36.162 28.959  34.797  1.00 36.88 ? 357  LEU K CD1 1 
ATOM   10273 C  CD2 . LEU K  2 152 ? -37.283 28.585  32.589  1.00 34.79 ? 357  LEU K CD2 1 
ATOM   10274 N  N   . HIS K  2 153 ? -36.315 33.805  31.270  1.00 38.52 ? 358  HIS K N   1 
ATOM   10275 C  CA  . HIS K  2 153 ? -36.560 35.225  31.070  1.00 40.47 ? 358  HIS K CA  1 
ATOM   10276 C  C   . HIS K  2 153 ? -37.158 35.517  29.694  1.00 39.90 ? 358  HIS K C   1 
ATOM   10277 O  O   . HIS K  2 153 ? -37.560 36.647  29.428  1.00 41.40 ? 358  HIS K O   1 
ATOM   10278 C  CB  . HIS K  2 153 ? -35.230 35.968  31.186  1.00 41.53 ? 358  HIS K CB  1 
ATOM   10279 C  CG  . HIS K  2 153 ? -35.360 37.458  31.149  1.00 44.02 ? 358  HIS K CG  1 
ATOM   10280 N  ND1 . HIS K  2 153 ? -35.845 38.192  32.212  1.00 46.05 ? 358  HIS K ND1 1 
ATOM   10281 C  CD2 . HIS K  2 153 ? -35.049 38.355  30.182  1.00 44.81 ? 358  HIS K CD2 1 
ATOM   10282 C  CE1 . HIS K  2 153 ? -35.832 39.477  31.900  1.00 47.66 ? 358  HIS K CE1 1 
ATOM   10283 N  NE2 . HIS K  2 153 ? -35.355 39.603  30.674  1.00 47.06 ? 358  HIS K NE2 1 
ATOM   10284 N  N   . TYR K  2 154 ? -37.202 34.516  28.816  1.00 38.13 ? 359  TYR K N   1 
ATOM   10285 C  CA  . TYR K  2 154 ? -37.552 34.751  27.420  1.00 37.57 ? 359  TYR K CA  1 
ATOM   10286 C  C   . TYR K  2 154 ? -39.005 35.153  27.314  1.00 39.04 ? 359  TYR K C   1 
ATOM   10287 O  O   . TYR K  2 154 ? -39.874 34.479  27.863  1.00 39.96 ? 359  TYR K O   1 
ATOM   10288 C  CB  . TYR K  2 154 ? -37.294 33.501  26.561  1.00 35.24 ? 359  TYR K CB  1 
ATOM   10289 C  CG  . TYR K  2 154 ? -37.659 33.675  25.091  1.00 34.36 ? 359  TYR K CG  1 
ATOM   10290 C  CD1 . TYR K  2 154 ? -36.771 34.257  24.200  1.00 34.29 ? 359  TYR K CD1 1 
ATOM   10291 C  CD2 . TYR K  2 154 ? -38.900 33.260  24.598  1.00 33.74 ? 359  TYR K CD2 1 
ATOM   10292 C  CE1 . TYR K  2 154 ? -37.100 34.425  22.866  1.00 33.79 ? 359  TYR K CE1 1 
ATOM   10293 C  CE2 . TYR K  2 154 ? -39.242 33.433  23.266  1.00 32.99 ? 359  TYR K CE2 1 
ATOM   10294 C  CZ  . TYR K  2 154 ? -38.337 34.015  22.401  1.00 33.21 ? 359  TYR K CZ  1 
ATOM   10295 O  OH  . TYR K  2 154 ? -38.662 34.185  21.073  1.00 32.98 ? 359  TYR K OH  1 
ATOM   10296 N  N   . LYS K  2 155 ? -39.257 36.271  26.633  1.00 40.77 ? 360  LYS K N   1 
ATOM   10297 C  CA  . LYS K  2 155 ? -40.610 36.640  26.181  1.00 41.44 ? 360  LYS K CA  1 
ATOM   10298 C  C   . LYS K  2 155 ? -40.695 36.691  24.658  1.00 40.26 ? 360  LYS K C   1 
ATOM   10299 O  O   . LYS K  2 155 ? -41.671 36.233  24.086  1.00 40.00 ? 360  LYS K O   1 
ATOM   10300 C  CB  . LYS K  2 155 ? -41.054 37.982  26.778  1.00 43.93 ? 360  LYS K CB  1 
ATOM   10301 C  CG  . LYS K  2 155 ? -41.632 37.852  28.184  1.00 45.40 ? 360  LYS K CG  1 
ATOM   10302 C  CD  . LYS K  2 155 ? -42.718 38.879  28.495  1.00 47.49 ? 360  LYS K CD  1 
ATOM   10303 C  CE  . LYS K  2 155 ? -42.136 40.223  28.909  1.00 49.41 ? 360  LYS K CE  1 
ATOM   10304 N  NZ  . LYS K  2 155 ? -43.205 41.244  29.120  1.00 51.78 ? 360  LYS K NZ  1 
ATOM   10305 N  N   . LYS K  2 156 ? -39.678 37.251  24.010  1.00 40.02 ? 361  LYS K N   1 
ATOM   10306 C  CA  . LYS K  2 156 ? -39.673 37.404  22.563  1.00 39.53 ? 361  LYS K CA  1 
ATOM   10307 C  C   . LYS K  2 156 ? -38.258 37.504  22.014  1.00 38.68 ? 361  LYS K C   1 
ATOM   10308 O  O   . LYS K  2 156 ? -37.292 37.639  22.768  1.00 38.76 ? 361  LYS K O   1 
ATOM   10309 C  CB  . LYS K  2 156 ? -40.454 38.662  22.167  1.00 41.63 ? 361  LYS K CB  1 
ATOM   10310 C  CG  . LYS K  2 156 ? -39.799 39.973  22.590  1.00 43.51 ? 361  LYS K CG  1 
ATOM   10311 C  CD  . LYS K  2 156 ? -40.706 41.162  22.290  1.00 45.94 ? 361  LYS K CD  1 
ATOM   10312 C  CE  . LYS K  2 156 ? -39.977 42.494  22.388  1.00 47.81 ? 361  LYS K CE  1 
ATOM   10313 N  NZ  . LYS K  2 156 ? -40.776 43.566  21.721  1.00 50.08 ? 361  LYS K NZ  1 
ATOM   10314 N  N   . GLY K  2 157 ? -38.150 37.454  20.692  1.00 37.86 ? 362  GLY K N   1 
ATOM   10315 C  CA  . GLY K  2 157 ? -36.870 37.601  20.018  1.00 37.49 ? 362  GLY K CA  1 
ATOM   10316 C  C   . GLY K  2 157 ? -36.145 36.291  19.769  1.00 35.47 ? 362  GLY K C   1 
ATOM   10317 O  O   . GLY K  2 157 ? -36.718 35.205  19.899  1.00 34.26 ? 362  GLY K O   1 
ATOM   10318 N  N   . ILE K  2 158 ? -34.877 36.407  19.394  1.00 35.22 ? 363  ILE K N   1 
ATOM   10319 C  CA  . ILE K  2 158 ? -34.063 35.259  19.038  1.00 33.71 ? 363  ILE K CA  1 
ATOM   10320 C  C   . ILE K  2 158 ? -33.165 34.925  20.210  1.00 33.23 ? 363  ILE K C   1 
ATOM   10321 O  O   . ILE K  2 158 ? -32.195 35.626  20.480  1.00 33.71 ? 363  ILE K O   1 
ATOM   10322 C  CB  . ILE K  2 158 ? -33.218 35.536  17.782  1.00 34.15 ? 363  ILE K CB  1 
ATOM   10323 C  CG1 . ILE K  2 158 ? -34.134 35.877  16.606  1.00 34.91 ? 363  ILE K CG1 1 
ATOM   10324 C  CG2 . ILE K  2 158 ? -32.367 34.323  17.445  1.00 32.69 ? 363  ILE K CG2 1 
ATOM   10325 C  CD1 . ILE K  2 158 ? -33.457 36.666  15.514  1.00 36.48 ? 363  ILE K CD1 1 
ATOM   10326 N  N   . TYR K  2 159 ? -33.503 33.845  20.904  1.00 32.14 ? 364  TYR K N   1 
ATOM   10327 C  CA  . TYR K  2 159 ? -32.797 33.450  22.119  1.00 31.96 ? 364  TYR K CA  1 
ATOM   10328 C  C   . TYR K  2 159 ? -31.346 32.972  21.870  1.00 31.73 ? 364  TYR K C   1 
ATOM   10329 O  O   . TYR K  2 159 ? -31.074 32.271  20.902  1.00 30.25 ? 364  TYR K O   1 
ATOM   10330 C  CB  . TYR K  2 159 ? -33.591 32.362  22.857  1.00 30.78 ? 364  TYR K CB  1 
ATOM   10331 C  CG  . TYR K  2 159 ? -32.823 31.778  24.003  1.00 30.42 ? 364  TYR K CG  1 
ATOM   10332 C  CD1 . TYR K  2 159 ? -32.782 32.417  25.236  1.00 31.51 ? 364  TYR K CD1 1 
ATOM   10333 C  CD2 . TYR K  2 159 ? -32.092 30.617  23.842  1.00 29.14 ? 364  TYR K CD2 1 
ATOM   10334 C  CE1 . TYR K  2 159 ? -32.038 31.893  26.282  1.00 31.33 ? 364  TYR K CE1 1 
ATOM   10335 C  CE2 . TYR K  2 159 ? -31.360 30.083  24.880  1.00 29.10 ? 364  TYR K CE2 1 
ATOM   10336 C  CZ  . TYR K  2 159 ? -31.333 30.725  26.095  1.00 30.19 ? 364  TYR K CZ  1 
ATOM   10337 O  OH  . TYR K  2 159 ? -30.601 30.180  27.114  1.00 30.44 ? 364  TYR K OH  1 
ATOM   10338 N  N   . HIS K  2 160 ? -30.444 33.369  22.774  1.00 33.26 ? 365  HIS K N   1 
ATOM   10339 C  CA  . HIS K  2 160 ? -29.033 32.963  22.773  1.00 34.20 ? 365  HIS K CA  1 
ATOM   10340 C  C   . HIS K  2 160 ? -28.520 32.947  24.218  1.00 35.02 ? 365  HIS K C   1 
ATOM   10341 O  O   . HIS K  2 160 ? -28.721 33.906  24.955  1.00 36.55 ? 365  HIS K O   1 
ATOM   10342 C  CB  . HIS K  2 160 ? -28.194 33.945  21.940  1.00 35.92 ? 365  HIS K CB  1 
ATOM   10343 C  CG  . HIS K  2 160 ? -26.715 33.857  22.186  1.00 37.11 ? 365  HIS K CG  1 
ATOM   10344 N  ND1 . HIS K  2 160 ? -26.039 34.754  22.991  1.00 38.50 ? 365  HIS K ND1 1 
ATOM   10345 C  CD2 . HIS K  2 160 ? -25.778 32.989  21.724  1.00 36.72 ? 365  HIS K CD2 1 
ATOM   10346 C  CE1 . HIS K  2 160 ? -24.753 34.441  23.015  1.00 38.77 ? 365  HIS K CE1 1 
ATOM   10347 N  NE2 . HIS K  2 160 ? -24.568 33.373  22.257  1.00 37.83 ? 365  HIS K NE2 1 
ATOM   10348 N  N   . HIS K  2 161 ? -27.851 31.871  24.615  1.00 34.23 ? 366  HIS K N   1 
ATOM   10349 C  CA  . HIS K  2 161 ? -27.377 31.722  25.985  1.00 35.22 ? 366  HIS K CA  1 
ATOM   10350 C  C   . HIS K  2 161 ? -26.132 32.581  26.268  1.00 37.12 ? 366  HIS K C   1 
ATOM   10351 O  O   . HIS K  2 161 ? -25.179 32.603  25.480  1.00 37.03 ? 366  HIS K O   1 
ATOM   10352 C  CB  . HIS K  2 161 ? -27.104 30.245  26.283  1.00 34.08 ? 366  HIS K CB  1 
ATOM   10353 C  CG  . HIS K  2 161 ? -26.524 29.991  27.637  1.00 34.68 ? 366  HIS K CG  1 
ATOM   10354 N  ND1 . HIS K  2 161 ? -27.130 30.413  28.801  1.00 35.69 ? 366  HIS K ND1 1 
ATOM   10355 C  CD2 . HIS K  2 161 ? -25.399 29.341  28.013  1.00 35.02 ? 366  HIS K CD2 1 
ATOM   10356 C  CE1 . HIS K  2 161 ? -26.397 30.048  29.837  1.00 36.19 ? 366  HIS K CE1 1 
ATOM   10357 N  NE2 . HIS K  2 161 ? -25.338 29.398  29.387  1.00 36.10 ? 366  HIS K NE2 1 
ATOM   10358 N  N   . THR K  2 162 ? -26.160 33.284  27.401  1.00 39.04 ? 367  THR K N   1 
ATOM   10359 C  CA  . THR K  2 162 ? -25.068 34.159  27.822  1.00 41.18 ? 367  THR K CA  1 
ATOM   10360 C  C   . THR K  2 162 ? -24.484 33.656  29.129  1.00 41.68 ? 367  THR K C   1 
ATOM   10361 O  O   . THR K  2 162 ? -23.653 32.755  29.120  1.00 42.76 ? 367  THR K O   1 
ATOM   10362 C  CB  . THR K  2 162 ? -25.555 35.603  28.023  1.00 43.04 ? 367  THR K CB  1 
ATOM   10363 O  OG1 . THR K  2 162 ? -26.555 35.630  29.049  1.00 43.67 ? 367  THR K OG1 1 
ATOM   10364 C  CG2 . THR K  2 162 ? -26.157 36.154  26.723  1.00 43.15 ? 367  THR K CG2 1 
ATOM   10365 N  N   . PRO L  3 2   ? -12.139 8.435   21.729  1.00 53.88 ? 372  PRO L N   1 
ATOM   10366 C  CA  . PRO L  3 2   ? -12.215 9.305   20.564  1.00 51.67 ? 372  PRO L CA  1 
ATOM   10367 C  C   . PRO L  3 2   ? -13.593 9.944   20.370  1.00 48.18 ? 372  PRO L C   1 
ATOM   10368 O  O   . PRO L  3 2   ? -13.709 11.170  20.441  1.00 49.06 ? 372  PRO L O   1 
ATOM   10369 C  CB  . PRO L  3 2   ? -11.902 8.354   19.403  1.00 52.97 ? 372  PRO L CB  1 
ATOM   10370 C  CG  . PRO L  3 2   ? -12.311 6.992   19.885  1.00 53.69 ? 372  PRO L CG  1 
ATOM   10371 C  CD  . PRO L  3 2   ? -12.477 7.044   21.388  1.00 54.16 ? 372  PRO L CD  1 
ATOM   10372 N  N   . PHE L  3 3   ? -14.619 9.124   20.130  1.00 44.02 ? 373  PHE L N   1 
ATOM   10373 C  CA  . PHE L  3 3   ? -15.943 9.610   19.724  1.00 37.94 ? 373  PHE L CA  1 
ATOM   10374 C  C   . PHE L  3 3   ? -16.942 9.469   20.876  1.00 35.30 ? 373  PHE L C   1 
ATOM   10375 O  O   . PHE L  3 3   ? -17.313 8.359   21.250  1.00 33.45 ? 373  PHE L O   1 
ATOM   10376 C  CB  . PHE L  3 3   ? -16.422 8.854   18.475  1.00 36.79 ? 373  PHE L CB  1 
ATOM   10377 C  CG  . PHE L  3 3   ? -17.799 9.245   18.004  1.00 34.53 ? 373  PHE L CG  1 
ATOM   10378 C  CD1 . PHE L  3 3   ? -18.088 10.549  17.644  1.00 33.65 ? 373  PHE L CD1 1 
ATOM   10379 C  CD2 . PHE L  3 3   ? -18.807 8.299   17.912  1.00 34.05 ? 373  PHE L CD2 1 
ATOM   10380 C  CE1 . PHE L  3 3   ? -19.358 10.905  17.213  1.00 32.44 ? 373  PHE L CE1 1 
ATOM   10381 C  CE2 . PHE L  3 3   ? -20.084 8.648   17.487  1.00 32.53 ? 373  PHE L CE2 1 
ATOM   10382 C  CZ  . PHE L  3 3   ? -20.360 9.956   17.138  1.00 31.82 ? 373  PHE L CZ  1 
ATOM   10383 N  N   . ASN L  3 4   ? -17.323 10.609  21.454  1.00 33.19 ? 374  ASN L N   1 
ATOM   10384 C  CA  . ASN L  3 4   ? -18.380 10.705  22.448  1.00 31.11 ? 374  ASN L CA  1 
ATOM   10385 C  C   . ASN L  3 4   ? -19.402 11.744  22.007  1.00 28.70 ? 374  ASN L C   1 
ATOM   10386 O  O   . ASN L  3 4   ? -19.151 12.938  22.142  1.00 28.67 ? 374  ASN L O   1 
ATOM   10387 C  CB  . ASN L  3 4   ? -17.806 11.152  23.781  1.00 32.75 ? 374  ASN L CB  1 
ATOM   10388 C  CG  . ASN L  3 4   ? -18.866 11.248  24.865  1.00 32.82 ? 374  ASN L CG  1 
ATOM   10389 O  OD1 . ASN L  3 4   ? -20.067 11.306  24.581  1.00 31.64 ? 374  ASN L OD1 1 
ATOM   10390 N  ND2 . ASN L  3 4   ? -18.427 11.252  26.120  1.00 34.02 ? 374  ASN L ND2 1 
ATOM   10391 N  N   . PRO L  3 5   ? -20.559 11.305  21.483  1.00 26.05 ? 375  PRO L N   1 
ATOM   10392 C  CA  . PRO L  3 5   ? -21.560 12.241  20.978  1.00 24.42 ? 375  PRO L CA  1 
ATOM   10393 C  C   . PRO L  3 5   ? -22.430 12.999  22.019  1.00 23.25 ? 375  PRO L C   1 
ATOM   10394 O  O   . PRO L  3 5   ? -23.206 13.876  21.628  1.00 22.02 ? 375  PRO L O   1 
ATOM   10395 C  CB  . PRO L  3 5   ? -22.455 11.344  20.115  1.00 23.88 ? 375  PRO L CB  1 
ATOM   10396 C  CG  . PRO L  3 5   ? -22.352 10.007  20.746  1.00 24.71 ? 375  PRO L CG  1 
ATOM   10397 C  CD  . PRO L  3 5   ? -20.929 9.907   21.208  1.00 25.98 ? 375  PRO L CD  1 
ATOM   10398 N  N   . PHE L  3 6   ? -22.309 12.678  23.306  1.00 23.30 ? 376  PHE L N   1 
ATOM   10399 C  CA  . PHE L  3 6   ? -23.149 13.307  24.346  1.00 22.65 ? 376  PHE L CA  1 
ATOM   10400 C  C   . PHE L  3 6   ? -23.135 14.830  24.346  1.00 22.22 ? 376  PHE L C   1 
ATOM   10401 O  O   . PHE L  3 6   ? -22.087 15.432  24.325  1.00 22.69 ? 376  PHE L O   1 
ATOM   10402 C  CB  . PHE L  3 6   ? -22.711 12.846  25.727  1.00 23.69 ? 376  PHE L CB  1 
ATOM   10403 C  CG  . PHE L  3 6   ? -23.580 13.363  26.829  1.00 23.72 ? 376  PHE L CG  1 
ATOM   10404 C  CD1 . PHE L  3 6   ? -24.849 12.837  27.023  1.00 23.09 ? 376  PHE L CD1 1 
ATOM   10405 C  CD2 . PHE L  3 6   ? -23.143 14.391  27.661  1.00 24.26 ? 376  PHE L CD2 1 
ATOM   10406 C  CE1 . PHE L  3 6   ? -25.656 13.301  28.031  1.00 23.20 ? 376  PHE L CE1 1 
ATOM   10407 C  CE2 . PHE L  3 6   ? -23.956 14.867  28.669  1.00 24.50 ? 376  PHE L CE2 1 
ATOM   10408 C  CZ  . PHE L  3 6   ? -25.211 14.320  28.858  1.00 24.11 ? 376  PHE L CZ  1 
ATOM   10409 N  N   . GLU L  3 7   ? -24.314 15.432  24.356  1.00 21.51 ? 377  GLU L N   1 
ATOM   10410 C  CA  . GLU L  3 7   ? -24.486 16.861  24.621  1.00 21.64 ? 377  GLU L CA  1 
ATOM   10411 C  C   . GLU L  3 7   ? -25.657 16.993  25.589  1.00 21.66 ? 377  GLU L C   1 
ATOM   10412 O  O   . GLU L  3 7   ? -26.759 16.493  25.330  1.00 20.91 ? 377  GLU L O   1 
ATOM   10413 C  CB  . GLU L  3 7   ? -24.795 17.651  23.343  1.00 21.07 ? 377  GLU L CB  1 
ATOM   10414 C  CG  . GLU L  3 7   ? -23.639 17.813  22.359  1.00 21.39 ? 377  GLU L CG  1 
ATOM   10415 C  CD  . GLU L  3 7   ? -23.977 18.757  21.198  1.00 21.38 ? 377  GLU L CD  1 
ATOM   10416 O  OE1 . GLU L  3 7   ? -24.643 19.800  21.426  1.00 21.32 ? 377  GLU L OE1 1 
ATOM   10417 O  OE2 . GLU L  3 7   ? -23.607 18.456  20.039  1.00 21.49 ? 377  GLU L OE2 1 
ATOM   10418 N  N   . LEU L  3 8   ? -25.432 17.681  26.693  1.00 22.62 ? 378  LEU L N   1 
ATOM   10419 C  CA  . LEU L  3 8   ? -26.439 17.816  27.725  1.00 23.10 ? 378  LEU L CA  1 
ATOM   10420 C  C   . LEU L  3 8   ? -27.707 18.479  27.178  1.00 22.01 ? 378  LEU L C   1 
ATOM   10421 O  O   . LEU L  3 8   ? -27.626 19.503  26.530  1.00 22.18 ? 378  LEU L O   1 
ATOM   10422 C  CB  . LEU L  3 8   ? -25.866 18.628  28.888  1.00 24.84 ? 378  LEU L CB  1 
ATOM   10423 C  CG  . LEU L  3 8   ? -26.711 18.735  30.150  1.00 25.90 ? 378  LEU L CG  1 
ATOM   10424 C  CD1 . LEU L  3 8   ? -27.028 17.356  30.705  1.00 26.38 ? 378  LEU L CD1 1 
ATOM   10425 C  CD2 . LEU L  3 8   ? -25.980 19.594  31.178  1.00 27.30 ? 378  LEU L CD2 1 
ATOM   10426 N  N   . THR L  3 9   ? -28.864 17.862  27.421  1.00 21.31 ? 379  THR L N   1 
ATOM   10427 C  CA  . THR L  3 9   ? -30.158 18.444  27.105  1.00 20.74 ? 379  THR L CA  1 
ATOM   10428 C  C   . THR L  3 9   ? -31.076 18.084  28.250  1.00 21.29 ? 379  THR L C   1 
ATOM   10429 O  O   . THR L  3 9   ? -30.785 17.144  28.973  1.00 21.56 ? 379  THR L O   1 
ATOM   10430 C  CB  . THR L  3 9   ? -30.798 17.880  25.811  1.00 19.63 ? 379  THR L CB  1 
ATOM   10431 O  OG1 . THR L  3 9   ? -30.971 16.462  25.929  1.00 19.46 ? 379  THR L OG1 1 
ATOM   10432 C  CG2 . THR L  3 9   ? -29.943 18.183  24.585  1.00 19.21 ? 379  THR L CG2 1 
ATOM   10433 N  N   . ASN L  3 10  ? -32.171 18.832  28.394  1.00 21.26 ? 380  ASN L N   1 
ATOM   10434 C  CA  . ASN L  3 10  ? -33.185 18.574  29.423  1.00 22.21 ? 380  ASN L CA  1 
ATOM   10435 C  C   . ASN L  3 10  ? -34.631 18.927  29.031  1.00 22.09 ? 380  ASN L C   1 
ATOM   10436 O  O   . ASN L  3 10  ? -35.535 18.814  29.862  1.00 23.55 ? 380  ASN L O   1 
ATOM   10437 C  CB  . ASN L  3 10  ? -32.826 19.318  30.725  1.00 23.48 ? 380  ASN L CB  1 
ATOM   10438 C  CG  . ASN L  3 10  ? -32.786 20.834  30.559  1.00 23.67 ? 380  ASN L CG  1 
ATOM   10439 O  OD1 . ASN L  3 10  ? -33.260 21.398  29.580  1.00 22.58 ? 380  ASN L OD1 1 
ATOM   10440 N  ND2 . ASN L  3 10  ? -32.210 21.497  31.536  1.00 25.05 ? 380  ASN L ND2 1 
ATOM   10441 N  N   . HIS L  3 11  ? -34.855 19.347  27.787  1.00 21.10 ? 381  HIS L N   1 
ATOM   10442 C  CA  . HIS L  3 11  ? -36.194 19.729  27.355  1.00 21.17 ? 381  HIS L CA  1 
ATOM   10443 C  C   . HIS L  3 11  ? -36.412 19.392  25.883  1.00 19.97 ? 381  HIS L C   1 
ATOM   10444 O  O   . HIS L  3 11  ? -35.595 19.757  25.044  1.00 19.46 ? 381  HIS L O   1 
ATOM   10445 C  CB  . HIS L  3 11  ? -36.414 21.218  27.608  1.00 21.90 ? 381  HIS L CB  1 
ATOM   10446 C  CG  . HIS L  3 11  ? -37.826 21.666  27.399  1.00 22.33 ? 381  HIS L CG  1 
ATOM   10447 N  ND1 . HIS L  3 11  ? -38.900 21.054  28.007  1.00 23.07 ? 381  HIS L ND1 1 
ATOM   10448 C  CD2 . HIS L  3 11  ? -38.340 22.679  26.663  1.00 22.26 ? 381  HIS L CD2 1 
ATOM   10449 C  CE1 . HIS L  3 11  ? -40.014 21.660  27.644  1.00 23.24 ? 381  HIS L CE1 1 
ATOM   10450 N  NE2 . HIS L  3 11  ? -39.702 22.648  26.825  1.00 22.84 ? 381  HIS L NE2 1 
ATOM   10451 N  N   . ALA L  3 12  ? -37.515 18.706  25.583  1.00 19.63 ? 382  ALA L N   1 
ATOM   10452 C  CA  . ALA L  3 12  ? -37.864 18.316  24.221  1.00 18.64 ? 382  ALA L CA  1 
ATOM   10453 C  C   . ALA L  3 12  ? -38.975 19.201  23.659  1.00 18.74 ? 382  ALA L C   1 
ATOM   10454 O  O   . ALA L  3 12  ? -40.004 19.428  24.298  1.00 19.86 ? 382  ALA L O   1 
ATOM   10455 C  CB  . ALA L  3 12  ? -38.300 16.866  24.193  1.00 18.59 ? 382  ALA L CB  1 
ATOM   10456 N  N   . VAL L  3 13  ? -38.766 19.688  22.446  1.00 17.99 ? 383  VAL L N   1 
ATOM   10457 C  CA  . VAL L  3 13  ? -39.665 20.661  21.843  1.00 18.10 ? 383  VAL L CA  1 
ATOM   10458 C  C   . VAL L  3 13  ? -39.835 20.337  20.365  1.00 17.28 ? 383  VAL L C   1 
ATOM   10459 O  O   . VAL L  3 13  ? -39.167 19.442  19.842  1.00 16.53 ? 383  VAL L O   1 
ATOM   10460 C  CB  . VAL L  3 13  ? -39.143 22.105  22.025  1.00 18.55 ? 383  VAL L CB  1 
ATOM   10461 C  CG1 . VAL L  3 13  ? -39.372 22.580  23.447  1.00 19.77 ? 383  VAL L CG1 1 
ATOM   10462 C  CG2 . VAL L  3 13  ? -37.669 22.203  21.692  1.00 18.23 ? 383  VAL L CG2 1 
ATOM   10463 N  N   . LEU L  3 14  ? -40.730 21.062  19.693  1.00 17.42 ? 384  LEU L N   1 
ATOM   10464 C  CA  . LEU L  3 14  ? -41.011 20.784  18.292  1.00 16.87 ? 384  LEU L CA  1 
ATOM   10465 C  C   . LEU L  3 14  ? -40.484 21.850  17.329  1.00 16.96 ? 384  LEU L C   1 
ATOM   10466 O  O   . LEU L  3 14  ? -40.896 23.006  17.366  1.00 17.72 ? 384  LEU L O   1 
ATOM   10467 C  CB  . LEU L  3 14  ? -42.514 20.564  18.099  1.00 17.11 ? 384  LEU L CB  1 
ATOM   10468 C  CG  . LEU L  3 14  ? -42.922 20.156  16.679  1.00 16.78 ? 384  LEU L CG  1 
ATOM   10469 C  CD1 . LEU L  3 14  ? -42.342 18.813  16.304  1.00 16.07 ? 384  LEU L CD1 1 
ATOM   10470 C  CD2 . LEU L  3 14  ? -44.434 20.156  16.558  1.00 17.50 ? 384  LEU L CD2 1 
ATOM   10471 N  N   . LEU L  3 15  ? -39.602 21.433  16.428  1.00 16.56 ? 385  LEU L N   1 
ATOM   10472 C  CA  . LEU L  3 15  ? -39.063 22.317  15.400  1.00 16.83 ? 385  LEU L CA  1 
ATOM   10473 C  C   . LEU L  3 15  ? -40.055 22.449  14.249  1.00 17.10 ? 385  LEU L C   1 
ATOM   10474 O  O   . LEU L  3 15  ? -40.409 21.451  13.632  1.00 16.75 ? 385  LEU L O   1 
ATOM   10475 C  CB  . LEU L  3 15  ? -37.742 21.757  14.883  1.00 16.42 ? 385  LEU L CB  1 
ATOM   10476 C  CG  . LEU L  3 15  ? -36.944 22.608  13.897  1.00 16.87 ? 385  LEU L CG  1 
ATOM   10477 C  CD1 . LEU L  3 15  ? -36.411 23.869  14.549  1.00 17.50 ? 385  LEU L CD1 1 
ATOM   10478 C  CD2 . LEU L  3 15  ? -35.787 21.805  13.340  1.00 16.59 ? 385  LEU L CD2 1 
ATOM   10479 N  N   . VAL L  3 16  ? -40.511 23.673  13.975  1.00 17.90 ? 386  VAL L N   1 
ATOM   10480 C  CA  . VAL L  3 16  ? -41.475 23.901  12.907  1.00 18.42 ? 386  VAL L CA  1 
ATOM   10481 C  C   . VAL L  3 16  ? -40.971 24.749  11.752  1.00 19.03 ? 386  VAL L C   1 
ATOM   10482 O  O   . VAL L  3 16  ? -41.606 24.768  10.709  1.00 19.29 ? 386  VAL L O   1 
ATOM   10483 C  CB  . VAL L  3 16  ? -42.801 24.512  13.412  1.00 19.12 ? 386  VAL L CB  1 
ATOM   10484 C  CG1 . VAL L  3 16  ? -43.411 23.622  14.478  1.00 18.89 ? 386  VAL L CG1 1 
ATOM   10485 C  CG2 . VAL L  3 16  ? -42.616 25.932  13.920  1.00 19.96 ? 386  VAL L CG2 1 
ATOM   10486 N  N   . GLY L  3 17  ? -39.872 25.475  11.928  1.00 19.42 ? 387  GLY L N   1 
ATOM   10487 C  CA  . GLY L  3 17  ? -39.409 26.360  10.869  1.00 20.48 ? 387  GLY L CA  1 
ATOM   10488 C  C   . GLY L  3 17  ? -38.042 26.977  11.077  1.00 21.03 ? 387  GLY L C   1 
ATOM   10489 O  O   . GLY L  3 17  ? -37.361 26.713  12.064  1.00 20.62 ? 387  GLY L O   1 
ATOM   10490 N  N   . TYR L  3 18  ? -37.651 27.823  10.135  1.00 22.37 ? 388  TYR L N   1 
ATOM   10491 C  CA  . TYR L  3 18  ? -36.432 28.582  10.262  1.00 23.35 ? 388  TYR L CA  1 
ATOM   10492 C  C   . TYR L  3 18  ? -36.484 29.903  9.505   1.00 25.49 ? 388  TYR L C   1 
ATOM   10493 O  O   . TYR L  3 18  ? -37.362 30.129  8.675   1.00 26.75 ? 388  TYR L O   1 
ATOM   10494 C  CB  . TYR L  3 18  ? -35.253 27.739  9.807   1.00 22.72 ? 388  TYR L CB  1 
ATOM   10495 C  CG  . TYR L  3 18  ? -35.284 27.300  8.372   1.00 22.83 ? 388  TYR L CG  1 
ATOM   10496 C  CD1 . TYR L  3 18  ? -34.860 28.148  7.364   1.00 24.25 ? 388  TYR L CD1 1 
ATOM   10497 C  CD2 . TYR L  3 18  ? -35.694 26.022  8.024   1.00 21.99 ? 388  TYR L CD2 1 
ATOM   10498 C  CE1 . TYR L  3 18  ? -34.862 27.749  6.044   1.00 24.82 ? 388  TYR L CE1 1 
ATOM   10499 C  CE2 . TYR L  3 18  ? -35.696 25.602  6.701   1.00 22.40 ? 388  TYR L CE2 1 
ATOM   10500 C  CZ  . TYR L  3 18  ? -35.278 26.470  5.716   1.00 23.86 ? 388  TYR L CZ  1 
ATOM   10501 O  OH  . TYR L  3 18  ? -35.269 26.083  4.397   1.00 24.70 ? 388  TYR L OH  1 
ATOM   10502 N  N   . GLY L  3 19  ? -35.537 30.782  9.809   1.00 27.20 ? 389  GLY L N   1 
ATOM   10503 C  CA  . GLY L  3 19  ? -35.500 32.091  9.185   1.00 29.57 ? 389  GLY L CA  1 
ATOM   10504 C  C   . GLY L  3 19  ? -34.301 32.929  9.585   1.00 31.27 ? 389  GLY L C   1 
ATOM   10505 O  O   . GLY L  3 19  ? -33.378 32.453  10.256  1.00 30.21 ? 389  GLY L O   1 
ATOM   10506 N  N   . THR L  3 20  ? -34.333 34.187  9.151   1.00 34.00 ? 390  THR L N   1 
ATOM   10507 C  CA  . THR L  3 20  ? -33.222 35.111  9.334   1.00 36.24 ? 390  THR L CA  1 
ATOM   10508 C  C   . THR L  3 20  ? -33.766 36.495  9.664   1.00 38.78 ? 390  THR L C   1 
ATOM   10509 O  O   . THR L  3 20  ? -34.534 37.054  8.885   1.00 39.93 ? 390  THR L O   1 
ATOM   10510 C  CB  . THR L  3 20  ? -32.390 35.232  8.045   1.00 37.21 ? 390  THR L CB  1 
ATOM   10511 O  OG1 . THR L  3 20  ? -32.116 33.929  7.526   1.00 35.66 ? 390  THR L OG1 1 
ATOM   10512 C  CG2 . THR L  3 20  ? -31.081 35.958  8.309   1.00 38.71 ? 390  THR L CG2 1 
ATOM   10513 N  N   . ASP L  3 21  ? -33.367 37.037  10.815  1.00 40.50 ? 391  ASP L N   1 
ATOM   10514 C  CA  . ASP L  3 21  ? -33.684 38.422  11.175  1.00 44.84 ? 391  ASP L CA  1 
ATOM   10515 C  C   . ASP L  3 21  ? -33.042 39.352  10.130  1.00 47.99 ? 391  ASP L C   1 
ATOM   10516 O  O   . ASP L  3 21  ? -31.821 39.413  10.026  1.00 49.47 ? 391  ASP L O   1 
ATOM   10517 C  CB  . ASP L  3 21  ? -33.158 38.736  12.587  1.00 45.47 ? 391  ASP L CB  1 
ATOM   10518 C  CG  . ASP L  3 21  ? -33.831 39.950  13.217  1.00 48.01 ? 391  ASP L CG  1 
ATOM   10519 O  OD1 . ASP L  3 21  ? -34.884 39.779  13.877  1.00 47.58 ? 391  ASP L OD1 1 
ATOM   10520 O  OD2 . ASP L  3 21  ? -33.292 41.071  13.070  1.00 50.65 ? 391  ASP L OD2 1 
ATOM   10521 N  N   . SER L  3 22  ? -33.856 40.046  9.335   1.00 51.19 ? 392  SER L N   1 
ATOM   10522 C  CA  . SER L  3 22  ? -33.316 40.863  8.236   1.00 53.99 ? 392  SER L CA  1 
ATOM   10523 C  C   . SER L  3 22  ? -32.438 41.997  8.764   1.00 56.24 ? 392  SER L C   1 
ATOM   10524 O  O   . SER L  3 22  ? -31.415 42.331  8.160   1.00 57.75 ? 392  SER L O   1 
ATOM   10525 C  CB  . SER L  3 22  ? -34.434 41.430  7.361   1.00 55.40 ? 392  SER L CB  1 
ATOM   10526 O  OG  . SER L  3 22  ? -35.083 42.506  8.003   1.00 57.21 ? 392  SER L OG  1 
ATOM   10527 N  N   . ALA L  3 23  ? -32.839 42.576  9.894   1.00 56.71 ? 393  ALA L N   1 
ATOM   10528 C  CA  . ALA L  3 23  ? -32.051 43.618  10.542  1.00 59.11 ? 393  ALA L CA  1 
ATOM   10529 C  C   . ALA L  3 23  ? -30.667 43.089  10.947  1.00 58.74 ? 393  ALA L C   1 
ATOM   10530 O  O   . ALA L  3 23  ? -29.658 43.491  10.365  1.00 60.45 ? 393  ALA L O   1 
ATOM   10531 C  CB  . ALA L  3 23  ? -32.795 44.189  11.748  1.00 59.41 ? 393  ALA L CB  1 
ATOM   10532 N  N   . SER L  3 24  ? -30.620 42.180  11.921  1.00 56.73 ? 394  SER L N   1 
ATOM   10533 C  CA  . SER L  3 24  ? -29.336 41.664  12.429  1.00 56.54 ? 394  SER L CA  1 
ATOM   10534 C  C   . SER L  3 24  ? -28.656 40.612  11.525  1.00 54.93 ? 394  SER L C   1 
ATOM   10535 O  O   . SER L  3 24  ? -27.457 40.365  11.668  1.00 56.04 ? 394  SER L O   1 
ATOM   10536 C  CB  . SER L  3 24  ? -29.494 41.103  13.855  1.00 54.71 ? 394  SER L CB  1 
ATOM   10537 O  OG  . SER L  3 24  ? -30.296 39.938  13.880  1.00 51.55 ? 394  SER L OG  1 
ATOM   10538 N  N   . GLY L  3 25  ? -29.404 40.005  10.604  1.00 52.86 ? 395  GLY L N   1 
ATOM   10539 C  CA  . GLY L  3 25  ? -28.887 38.895  9.795   1.00 51.24 ? 395  GLY L CA  1 
ATOM   10540 C  C   . GLY L  3 25  ? -28.711 37.588  10.575  1.00 48.68 ? 395  GLY L C   1 
ATOM   10541 O  O   . GLY L  3 25  ? -28.043 36.666  10.100  1.00 46.86 ? 395  GLY L O   1 
ATOM   10542 N  N   . MET L  3 26  ? -29.332 37.509  11.757  1.00 46.82 ? 396  MET L N   1 
ATOM   10543 C  CA  . MET L  3 26  ? -29.180 36.386  12.691  1.00 43.13 ? 396  MET L CA  1 
ATOM   10544 C  C   . MET L  3 26  ? -30.069 35.196  12.306  1.00 39.24 ? 396  MET L C   1 
ATOM   10545 O  O   . MET L  3 26  ? -31.299 35.322  12.288  1.00 38.08 ? 396  MET L O   1 
ATOM   10546 C  CB  . MET L  3 26  ? -29.553 36.863  14.101  1.00 43.62 ? 396  MET L CB  1 
ATOM   10547 C  CG  . MET L  3 26  ? -29.334 35.853  15.217  1.00 42.96 ? 396  MET L CG  1 
ATOM   10548 S  SD  . MET L  3 26  ? -27.583 35.494  15.476  1.00 45.13 ? 396  MET L SD  1 
ATOM   10549 C  CE  . MET L  3 26  ? -27.370 33.992  14.513  1.00 41.72 ? 396  MET L CE  1 
ATOM   10550 N  N   . ASP L  3 27  ? -29.455 34.044  12.014  1.00 36.17 ? 397  ASP L N   1 
ATOM   10551 C  CA  . ASP L  3 27  ? -30.211 32.834  11.673  1.00 32.81 ? 397  ASP L CA  1 
ATOM   10552 C  C   . ASP L  3 27  ? -30.905 32.253  12.889  1.00 29.93 ? 397  ASP L C   1 
ATOM   10553 O  O   . ASP L  3 27  ? -30.307 32.155  13.953  1.00 29.37 ? 397  ASP L O   1 
ATOM   10554 C  CB  . ASP L  3 27  ? -29.299 31.771  11.064  1.00 32.62 ? 397  ASP L CB  1 
ATOM   10555 C  CG  . ASP L  3 27  ? -28.894 32.090  9.639   1.00 34.33 ? 397  ASP L CG  1 
ATOM   10556 O  OD1 . ASP L  3 27  ? -29.522 32.975  9.010   1.00 35.80 ? 397  ASP L OD1 1 
ATOM   10557 O  OD2 . ASP L  3 27  ? -27.943 31.450  9.137   1.00 34.96 ? 397  ASP L OD2 1 
ATOM   10558 N  N   . TYR L  3 28  ? -32.164 31.852  12.724  1.00 27.74 ? 398  TYR L N   1 
ATOM   10559 C  CA  . TYR L  3 28  ? -32.909 31.232  13.821  1.00 25.93 ? 398  TYR L CA  1 
ATOM   10560 C  C   . TYR L  3 28  ? -33.720 30.000  13.434  1.00 23.88 ? 398  TYR L C   1 
ATOM   10561 O  O   . TYR L  3 28  ? -34.006 29.745  12.264  1.00 23.56 ? 398  TYR L O   1 
ATOM   10562 C  CB  . TYR L  3 28  ? -33.824 32.255  14.489  1.00 26.74 ? 398  TYR L CB  1 
ATOM   10563 C  CG  . TYR L  3 28  ? -34.833 32.878  13.563  1.00 27.58 ? 398  TYR L CG  1 
ATOM   10564 C  CD1 . TYR L  3 28  ? -36.029 32.227  13.255  1.00 26.91 ? 398  TYR L CD1 1 
ATOM   10565 C  CD2 . TYR L  3 28  ? -34.597 34.117  12.989  1.00 29.39 ? 398  TYR L CD2 1 
ATOM   10566 C  CE1 . TYR L  3 28  ? -36.955 32.793  12.400  1.00 27.77 ? 398  TYR L CE1 1 
ATOM   10567 C  CE2 . TYR L  3 28  ? -35.521 34.694  12.137  1.00 30.47 ? 398  TYR L CE2 1 
ATOM   10568 C  CZ  . TYR L  3 28  ? -36.692 34.023  11.850  1.00 29.63 ? 398  TYR L CZ  1 
ATOM   10569 O  OH  . TYR L  3 28  ? -37.594 34.601  11.008  1.00 31.04 ? 398  TYR L OH  1 
ATOM   10570 N  N   . TRP L  3 29  ? -34.072 29.230  14.450  1.00 22.36 ? 399  TRP L N   1 
ATOM   10571 C  CA  . TRP L  3 29  ? -35.037 28.157  14.314  1.00 21.18 ? 399  TRP L CA  1 
ATOM   10572 C  C   . TRP L  3 29  ? -36.350 28.695  14.846  1.00 21.58 ? 399  TRP L C   1 
ATOM   10573 O  O   . TRP L  3 29  ? -36.334 29.577  15.702  1.00 22.33 ? 399  TRP L O   1 
ATOM   10574 C  CB  . TRP L  3 29  ? -34.643 26.953  15.168  1.00 19.91 ? 399  TRP L CB  1 
ATOM   10575 C  CG  . TRP L  3 29  ? -33.427 26.206  14.733  1.00 19.31 ? 399  TRP L CG  1 
ATOM   10576 C  CD1 . TRP L  3 29  ? -32.254 26.086  15.420  1.00 19.29 ? 399  TRP L CD1 1 
ATOM   10577 C  CD2 . TRP L  3 29  ? -33.281 25.414  13.550  1.00 18.81 ? 399  TRP L CD2 1 
ATOM   10578 N  NE1 . TRP L  3 29  ? -31.379 25.285  14.728  1.00 18.97 ? 399  TRP L NE1 1 
ATOM   10579 C  CE2 . TRP L  3 29  ? -31.986 24.859  13.577  1.00 18.65 ? 399  TRP L CE2 1 
ATOM   10580 C  CE3 . TRP L  3 29  ? -34.113 25.129  12.465  1.00 18.68 ? 399  TRP L CE3 1 
ATOM   10581 C  CZ2 . TRP L  3 29  ? -31.502 24.056  12.559  1.00 18.33 ? 399  TRP L CZ2 1 
ATOM   10582 C  CZ3 . TRP L  3 29  ? -33.630 24.323  11.452  1.00 18.40 ? 399  TRP L CZ3 1 
ATOM   10583 C  CH2 . TRP L  3 29  ? -32.334 23.792  11.510  1.00 18.31 ? 399  TRP L CH2 1 
ATOM   10584 N  N   . ILE L  3 30  ? -37.473 28.173  14.344  1.00 21.13 ? 400  ILE L N   1 
ATOM   10585 C  CA  . ILE L  3 30  ? -38.791 28.430  14.931  1.00 21.28 ? 400  ILE L CA  1 
ATOM   10586 C  C   . ILE L  3 30  ? -39.218 27.165  15.671  1.00 20.16 ? 400  ILE L C   1 
ATOM   10587 O  O   . ILE L  3 30  ? -39.363 26.110  15.077  1.00 19.06 ? 400  ILE L O   1 
ATOM   10588 C  CB  . ILE L  3 30  ? -39.849 28.796  13.865  1.00 21.96 ? 400  ILE L CB  1 
ATOM   10589 C  CG1 . ILE L  3 30  ? -39.420 30.032  13.071  1.00 23.12 ? 400  ILE L CG1 1 
ATOM   10590 C  CG2 . ILE L  3 30  ? -41.205 29.072  14.521  1.00 22.53 ? 400  ILE L CG2 1 
ATOM   10591 C  CD1 . ILE L  3 30  ? -40.190 30.241  11.784  1.00 23.74 ? 400  ILE L CD1 1 
ATOM   10592 N  N   . VAL L  3 31  ? -39.427 27.288  16.977  1.00 20.54 ? 401  VAL L N   1 
ATOM   10593 C  CA  . VAL L  3 31  ? -39.651 26.136  17.834  1.00 19.92 ? 401  VAL L CA  1 
ATOM   10594 C  C   . VAL L  3 31  ? -40.938 26.262  18.628  1.00 20.69 ? 401  VAL L C   1 
ATOM   10595 O  O   . VAL L  3 31  ? -41.235 27.312  19.190  1.00 22.03 ? 401  VAL L O   1 
ATOM   10596 C  CB  . VAL L  3 31  ? -38.481 25.947  18.810  1.00 19.65 ? 401  VAL L CB  1 
ATOM   10597 C  CG1 . VAL L  3 31  ? -38.660 24.668  19.617  1.00 19.06 ? 401  VAL L CG1 1 
ATOM   10598 C  CG2 . VAL L  3 31  ? -37.171 25.915  18.049  1.00 19.35 ? 401  VAL L CG2 1 
ATOM   10599 N  N   . LYS L  3 32  ? -41.678 25.164  18.694  1.00 20.41 ? 402  LYS L N   1 
ATOM   10600 C  CA  . LYS L  3 32  ? -42.947 25.120  19.389  1.00 21.53 ? 402  LYS L CA  1 
ATOM   10601 C  C   . LYS L  3 32  ? -42.739 24.523  20.771  1.00 21.80 ? 402  LYS L C   1 
ATOM   10602 O  O   . LYS L  3 32  ? -42.251 23.407  20.899  1.00 21.33 ? 402  LYS L O   1 
ATOM   10603 C  CB  . LYS L  3 32  ? -43.933 24.257  18.600  1.00 21.36 ? 402  LYS L CB  1 
ATOM   10604 C  CG  . LYS L  3 32  ? -45.336 24.207  19.175  1.00 22.39 ? 402  LYS L CG  1 
ATOM   10605 C  CD  . LYS L  3 32  ? -46.144 23.155  18.427  1.00 22.20 ? 402  LYS L CD  1 
ATOM   10606 C  CE  . LYS L  3 32  ? -47.473 22.887  19.080  1.00 23.09 ? 402  LYS L CE  1 
ATOM   10607 N  NZ  . LYS L  3 32  ? -48.004 21.595  18.588  1.00 22.95 ? 402  LYS L NZ  1 
ATOM   10608 N  N   . ASN L  3 33  ? -43.132 25.263  21.797  1.00 23.06 ? 403  ASN L N   1 
ATOM   10609 C  CA  . ASN L  3 33  ? -42.984 24.810  23.176  1.00 23.82 ? 403  ASN L CA  1 
ATOM   10610 C  C   . ASN L  3 33  ? -44.302 24.217  23.712  1.00 24.64 ? 403  ASN L C   1 
ATOM   10611 O  O   . ASN L  3 33  ? -45.336 24.248  23.034  1.00 24.82 ? 403  ASN L O   1 
ATOM   10612 C  CB  . ASN L  3 33  ? -42.480 25.971  24.045  1.00 24.75 ? 403  ASN L CB  1 
ATOM   10613 C  CG  . ASN L  3 33  ? -41.686 25.513  25.250  1.00 24.99 ? 403  ASN L CG  1 
ATOM   10614 O  OD1 . ASN L  3 33  ? -41.639 24.331  25.571  1.00 24.53 ? 403  ASN L OD1 1 
ATOM   10615 N  ND2 . ASN L  3 33  ? -41.062 26.461  25.934  1.00 25.88 ? 403  ASN L ND2 1 
ATOM   10616 N  N   . SER L  3 34  ? -44.244 23.637  24.909  1.00 25.38 ? 404  SER L N   1 
ATOM   10617 C  CA  . SER L  3 34  ? -45.416 23.030  25.536  1.00 26.42 ? 404  SER L CA  1 
ATOM   10618 C  C   . SER L  3 34  ? -45.689 23.674  26.892  1.00 27.92 ? 404  SER L C   1 
ATOM   10619 O  O   . SER L  3 34  ? -46.012 22.988  27.869  1.00 28.70 ? 404  SER L O   1 
ATOM   10620 C  CB  . SER L  3 34  ? -45.237 21.510  25.665  1.00 26.16 ? 404  SER L CB  1 
ATOM   10621 O  OG  . SER L  3 34  ? -43.999 21.180  26.261  1.00 26.04 ? 404  SER L OG  1 
ATOM   10622 N  N   . TRP L  3 35  ? -45.571 25.002  26.936  1.00 28.43 ? 405  TRP L N   1 
ATOM   10623 C  CA  . TRP L  3 35  ? -45.814 25.761  28.162  1.00 30.08 ? 405  TRP L CA  1 
ATOM   10624 C  C   . TRP L  3 35  ? -47.012 26.720  28.033  1.00 31.17 ? 405  TRP L C   1 
ATOM   10625 O  O   . TRP L  3 35  ? -47.086 27.732  28.746  1.00 32.46 ? 405  TRP L O   1 
ATOM   10626 C  CB  . TRP L  3 35  ? -44.548 26.539  28.543  1.00 30.27 ? 405  TRP L CB  1 
ATOM   10627 C  CG  . TRP L  3 35  ? -43.375 25.689  28.927  1.00 29.47 ? 405  TRP L CG  1 
ATOM   10628 C  CD1 . TRP L  3 35  ? -43.374 24.351  29.205  1.00 29.07 ? 405  TRP L CD1 1 
ATOM   10629 C  CD2 . TRP L  3 35  ? -42.036 26.140  29.134  1.00 29.42 ? 405  TRP L CD2 1 
ATOM   10630 N  NE1 . TRP L  3 35  ? -42.105 23.939  29.542  1.00 28.74 ? 405  TRP L NE1 1 
ATOM   10631 C  CE2 . TRP L  3 35  ? -41.268 25.023  29.513  1.00 28.81 ? 405  TRP L CE2 1 
ATOM   10632 C  CE3 . TRP L  3 35  ? -41.407 27.384  29.031  1.00 30.05 ? 405  TRP L CE3 1 
ATOM   10633 C  CZ2 . TRP L  3 35  ? -39.907 25.112  29.788  1.00 28.71 ? 405  TRP L CZ2 1 
ATOM   10634 C  CZ3 . TRP L  3 35  ? -40.042 27.469  29.302  1.00 29.82 ? 405  TRP L CZ3 1 
ATOM   10635 C  CH2 . TRP L  3 35  ? -39.313 26.338  29.674  1.00 29.15 ? 405  TRP L CH2 1 
ATOM   10636 N  N   . GLY L  3 36  ? -47.941 26.398  27.130  1.00 30.55 ? 406  GLY L N   1 
ATOM   10637 C  CA  . GLY L  3 36  ? -49.147 27.204  26.914  1.00 31.70 ? 406  GLY L CA  1 
ATOM   10638 C  C   . GLY L  3 36  ? -48.930 28.357  25.947  1.00 31.67 ? 406  GLY L C   1 
ATOM   10639 O  O   . GLY L  3 36  ? -47.786 28.725  25.655  1.00 31.37 ? 406  GLY L O   1 
ATOM   10640 N  N   . THR L  3 37  ? -50.030 28.929  25.462  1.00 32.44 ? 407  THR L N   1 
ATOM   10641 C  CA  . THR L  3 37  ? -50.005 30.085  24.554  1.00 32.80 ? 407  THR L CA  1 
ATOM   10642 C  C   . THR L  3 37  ? -49.585 31.393  25.243  1.00 34.32 ? 407  THR L C   1 
ATOM   10643 O  O   . THR L  3 37  ? -49.120 32.323  24.580  1.00 34.64 ? 407  THR L O   1 
ATOM   10644 C  CB  . THR L  3 37  ? -51.371 30.282  23.851  1.00 33.45 ? 407  THR L CB  1 
ATOM   10645 O  OG1 . THR L  3 37  ? -52.434 29.979  24.761  1.00 34.80 ? 407  THR L OG1 1 
ATOM   10646 C  CG2 . THR L  3 37  ? -51.508 29.356  22.652  1.00 31.96 ? 407  THR L CG2 1 
ATOM   10647 N  N   . GLY L  3 38  ? -49.727 31.458  26.567  1.00 35.52 ? 408  GLY L N   1 
ATOM   10648 C  CA  . GLY L  3 38  ? -49.297 32.629  27.340  1.00 36.87 ? 408  GLY L CA  1 
ATOM   10649 C  C   . GLY L  3 38  ? -47.790 32.841  27.383  1.00 36.05 ? 408  GLY L C   1 
ATOM   10650 O  O   . GLY L  3 38  ? -47.314 33.956  27.603  1.00 36.92 ? 408  GLY L O   1 
ATOM   10651 N  N   . TRP L  3 39  ? -47.031 31.773  27.172  1.00 34.34 ? 409  TRP L N   1 
ATOM   10652 C  CA  . TRP L  3 39  ? -45.582 31.845  27.266  1.00 33.68 ? 409  TRP L CA  1 
ATOM   10653 C  C   . TRP L  3 39  ? -44.945 32.219  25.929  1.00 32.87 ? 409  TRP L C   1 
ATOM   10654 O  O   . TRP L  3 39  ? -45.366 31.732  24.890  1.00 31.82 ? 409  TRP L O   1 
ATOM   10655 C  CB  . TRP L  3 39  ? -45.031 30.507  27.735  1.00 32.44 ? 409  TRP L CB  1 
ATOM   10656 C  CG  . TRP L  3 39  ? -43.569 30.526  27.811  1.00 31.78 ? 409  TRP L CG  1 
ATOM   10657 C  CD1 . TRP L  3 39  ? -42.811 30.881  28.887  1.00 32.70 ? 409  TRP L CD1 1 
ATOM   10658 C  CD2 . TRP L  3 39  ? -42.660 30.229  26.752  1.00 30.10 ? 409  TRP L CD2 1 
ATOM   10659 N  NE1 . TRP L  3 39  ? -41.480 30.798  28.567  1.00 31.86 ? 409  TRP L NE1 1 
ATOM   10660 C  CE2 . TRP L  3 39  ? -41.359 30.399  27.262  1.00 30.19 ? 409  TRP L CE2 1 
ATOM   10661 C  CE3 . TRP L  3 39  ? -42.818 29.813  25.423  1.00 28.85 ? 409  TRP L CE3 1 
ATOM   10662 C  CZ2 . TRP L  3 39  ? -40.215 30.169  26.491  1.00 29.05 ? 409  TRP L CZ2 1 
ATOM   10663 C  CZ3 . TRP L  3 39  ? -41.684 29.596  24.650  1.00 27.56 ? 409  TRP L CZ3 1 
ATOM   10664 C  CH2 . TRP L  3 39  ? -40.398 29.770  25.188  1.00 27.66 ? 409  TRP L CH2 1 
ATOM   10665 N  N   . GLY L  3 40  ? -43.923 33.075  25.967  1.00 33.48 ? 410  GLY L N   1 
ATOM   10666 C  CA  . GLY L  3 40  ? -43.178 33.467  24.768  1.00 33.24 ? 410  GLY L CA  1 
ATOM   10667 C  C   . GLY L  3 40  ? -44.043 33.971  23.615  1.00 33.87 ? 410  GLY L C   1 
ATOM   10668 O  O   . GLY L  3 40  ? -45.073 34.594  23.837  1.00 35.11 ? 410  GLY L O   1 
ATOM   10669 N  N   . GLU L  3 41  ? -43.636 33.679  22.381  1.00 33.18 ? 411  GLU L N   1 
ATOM   10670 C  CA  . GLU L  3 41  ? -44.346 34.168  21.186  1.00 33.55 ? 411  GLU L CA  1 
ATOM   10671 C  C   . GLU L  3 41  ? -45.533 33.266  20.834  1.00 32.82 ? 411  GLU L C   1 
ATOM   10672 O  O   . GLU L  3 41  ? -45.462 32.442  19.926  1.00 31.57 ? 411  GLU L O   1 
ATOM   10673 C  CB  . GLU L  3 41  ? -43.367 34.298  20.006  1.00 33.19 ? 411  GLU L CB  1 
ATOM   10674 C  CG  . GLU L  3 41  ? -42.227 35.276  20.298  1.00 34.54 ? 411  GLU L CG  1 
ATOM   10675 C  CD  . GLU L  3 41  ? -41.155 35.337  19.218  1.00 34.53 ? 411  GLU L CD  1 
ATOM   10676 O  OE1 . GLU L  3 41  ? -40.997 34.361  18.449  1.00 33.75 ? 411  GLU L OE1 1 
ATOM   10677 O  OE2 . GLU L  3 41  ? -40.452 36.378  19.148  1.00 36.31 ? 411  GLU L OE2 1 
ATOM   10678 N  N   . ASN L  3 42  ? -46.629 33.451  21.563  1.00 34.05 ? 412  ASN L N   1 
ATOM   10679 C  CA  . ASN L  3 42  ? -47.833 32.633  21.421  1.00 33.87 ? 412  ASN L CA  1 
ATOM   10680 C  C   . ASN L  3 42  ? -47.489 31.168  21.499  1.00 32.01 ? 412  ASN L C   1 
ATOM   10681 O  O   . ASN L  3 42  ? -47.928 30.362  20.675  1.00 31.43 ? 412  ASN L O   1 
ATOM   10682 C  CB  . ASN L  3 42  ? -48.569 32.937  20.120  1.00 34.29 ? 412  ASN L CB  1 
ATOM   10683 C  CG  . ASN L  3 42  ? -49.244 34.287  20.143  1.00 36.59 ? 412  ASN L CG  1 
ATOM   10684 O  OD1 . ASN L  3 42  ? -50.059 34.576  21.026  1.00 37.65 ? 412  ASN L OD1 1 
ATOM   10685 N  ND2 . ASN L  3 42  ? -48.920 35.123  19.164  1.00 37.34 ? 412  ASN L ND2 1 
ATOM   10686 N  N   . GLY L  3 43  ? -46.667 30.843  22.490  1.00 31.47 ? 413  GLY L N   1 
ATOM   10687 C  CA  . GLY L  3 43  ? -46.256 29.472  22.750  1.00 30.00 ? 413  GLY L CA  1 
ATOM   10688 C  C   . GLY L  3 43  ? -45.026 29.013  21.999  1.00 28.03 ? 413  GLY L C   1 
ATOM   10689 O  O   . GLY L  3 43  ? -44.509 27.937  22.287  1.00 26.94 ? 413  GLY L O   1 
ATOM   10690 N  N   . TYR L  3 44  ? -44.570 29.807  21.033  1.00 27.75 ? 414  TYR L N   1 
ATOM   10691 C  CA  . TYR L  3 44  ? -43.372 29.469  20.267  1.00 26.66 ? 414  TYR L CA  1 
ATOM   10692 C  C   . TYR L  3 44  ? -42.167 30.266  20.760  1.00 26.98 ? 414  TYR L C   1 
ATOM   10693 O  O   . TYR L  3 44  ? -42.320 31.222  21.534  1.00 28.29 ? 414  TYR L O   1 
ATOM   10694 C  CB  . TYR L  3 44  ? -43.589 29.757  18.780  1.00 26.51 ? 414  TYR L CB  1 
ATOM   10695 C  CG  . TYR L  3 44  ? -44.553 28.808  18.129  1.00 25.87 ? 414  TYR L CG  1 
ATOM   10696 C  CD1 . TYR L  3 44  ? -45.914 28.938  18.324  1.00 26.68 ? 414  TYR L CD1 1 
ATOM   10697 C  CD2 . TYR L  3 44  ? -44.097 27.764  17.333  1.00 24.67 ? 414  TYR L CD2 1 
ATOM   10698 C  CE1 . TYR L  3 44  ? -46.808 28.061  17.734  1.00 26.45 ? 414  TYR L CE1 1 
ATOM   10699 C  CE2 . TYR L  3 44  ? -44.978 26.874  16.747  1.00 24.24 ? 414  TYR L CE2 1 
ATOM   10700 C  CZ  . TYR L  3 44  ? -46.333 27.028  16.952  1.00 25.19 ? 414  TYR L CZ  1 
ATOM   10701 O  OH  . TYR L  3 44  ? -47.214 26.152  16.352  1.00 25.39 ? 414  TYR L OH  1 
ATOM   10702 N  N   . PHE L  3 45  ? -40.980 29.890  20.289  1.00 25.48 ? 415  PHE L N   1 
ATOM   10703 C  CA  . PHE L  3 45  ? -39.808 30.733  20.456  1.00 25.85 ? 415  PHE L CA  1 
ATOM   10704 C  C   . PHE L  3 45  ? -38.815 30.539  19.324  1.00 25.08 ? 415  PHE L C   1 
ATOM   10705 O  O   . PHE L  3 45  ? -38.850 29.548  18.608  1.00 23.82 ? 415  PHE L O   1 
ATOM   10706 C  CB  . PHE L  3 45  ? -39.123 30.483  21.806  1.00 25.97 ? 415  PHE L CB  1 
ATOM   10707 C  CG  . PHE L  3 45  ? -38.431 29.160  21.907  1.00 24.47 ? 415  PHE L CG  1 
ATOM   10708 C  CD1 . PHE L  3 45  ? -39.130 28.029  22.254  1.00 23.79 ? 415  PHE L CD1 1 
ATOM   10709 C  CD2 . PHE L  3 45  ? -37.071 29.050  21.668  1.00 24.13 ? 415  PHE L CD2 1 
ATOM   10710 C  CE1 . PHE L  3 45  ? -38.495 26.805  22.349  1.00 22.77 ? 415  PHE L CE1 1 
ATOM   10711 C  CE2 . PHE L  3 45  ? -36.431 27.833  21.768  1.00 22.94 ? 415  PHE L CE2 1 
ATOM   10712 C  CZ  . PHE L  3 45  ? -37.148 26.709  22.109  1.00 22.33 ? 415  PHE L CZ  1 
ATOM   10713 N  N   . ARG L  3 46  ? -37.928 31.513  19.179  1.00 25.92 ? 416  ARG L N   1 
ATOM   10714 C  CA  . ARG L  3 46  ? -36.873 31.442  18.201  1.00 25.46 ? 416  ARG L CA  1 
ATOM   10715 C  C   . ARG L  3 46  ? -35.552 31.431  18.928  1.00 25.70 ? 416  ARG L C   1 
ATOM   10716 O  O   . ARG L  3 46  ? -35.390 32.063  19.965  1.00 26.85 ? 416  ARG L O   1 
ATOM   10717 C  CB  . ARG L  3 46  ? -36.947 32.619  17.235  1.00 26.70 ? 416  ARG L CB  1 
ATOM   10718 C  CG  . ARG L  3 46  ? -38.170 32.616  16.339  1.00 26.69 ? 416  ARG L CG  1 
ATOM   10719 C  CD  . ARG L  3 46  ? -38.222 33.886  15.508  1.00 28.42 ? 416  ARG L CD  1 
ATOM   10720 N  NE  . ARG L  3 46  ? -38.733 35.014  16.286  1.00 30.06 ? 416  ARG L NE  1 
ATOM   10721 C  CZ  . ARG L  3 46  ? -38.320 36.273  16.173  1.00 31.80 ? 416  ARG L CZ  1 
ATOM   10722 N  NH1 . ARG L  3 46  ? -37.366 36.605  15.310  1.00 32.28 ? 416  ARG L NH1 1 
ATOM   10723 N  NH2 . ARG L  3 46  ? -38.856 37.209  16.944  1.00 33.28 ? 416  ARG L NH2 1 
ATOM   10724 N  N   . ILE L  3 47  ? -34.603 30.715  18.355  1.00 25.11 ? 417  ILE L N   1 
ATOM   10725 C  CA  . ILE L  3 47  ? -33.345 30.431  18.996  1.00 25.19 ? 417  ILE L CA  1 
ATOM   10726 C  C   . ILE L  3 47  ? -32.312 30.391  17.891  1.00 25.45 ? 417  ILE L C   1 
ATOM   10727 O  O   . ILE L  3 47  ? -32.622 29.940  16.784  1.00 24.79 ? 417  ILE L O   1 
ATOM   10728 C  CB  . ILE L  3 47  ? -33.425 29.098  19.758  1.00 24.12 ? 417  ILE L CB  1 
ATOM   10729 C  CG1 . ILE L  3 47  ? -32.082 28.739  20.399  1.00 24.27 ? 417  ILE L CG1 1 
ATOM   10730 C  CG2 . ILE L  3 47  ? -33.894 27.976  18.850  1.00 23.06 ? 417  ILE L CG2 1 
ATOM   10731 C  CD1 . ILE L  3 47  ? -32.207 27.688  21.485  1.00 23.68 ? 417  ILE L CD1 1 
ATOM   10732 N  N   . ARG L  3 48  ? -31.104 30.888  18.170  1.00 26.76 ? 418  ARG L N   1 
ATOM   10733 C  CA  . ARG L  3 48  ? -30.066 30.958  17.143  1.00 27.45 ? 418  ARG L CA  1 
ATOM   10734 C  C   . ARG L  3 48  ? -29.868 29.621  16.478  1.00 25.75 ? 418  ARG L C   1 
ATOM   10735 O  O   . ARG L  3 48  ? -29.924 28.571  17.124  1.00 24.66 ? 418  ARG L O   1 
ATOM   10736 C  CB  . ARG L  3 48  ? -28.725 31.427  17.691  1.00 29.27 ? 418  ARG L CB  1 
ATOM   10737 C  CG  . ARG L  3 48  ? -28.678 32.920  17.898  1.00 31.85 ? 418  ARG L CG  1 
ATOM   10738 C  CD  . ARG L  3 48  ? -27.275 33.386  18.198  1.00 33.81 ? 418  ARG L CD  1 
ATOM   10739 N  NE  . ARG L  3 48  ? -27.277 34.771  18.668  1.00 35.54 ? 418  ARG L NE  1 
ATOM   10740 C  CZ  . ARG L  3 48  ? -26.175 35.458  18.949  1.00 37.23 ? 418  ARG L CZ  1 
ATOM   10741 N  NH1 . ARG L  3 48  ? -24.969 34.897  18.797  1.00 37.33 ? 418  ARG L NH1 1 
ATOM   10742 N  NH2 . ARG L  3 48  ? -26.271 36.711  19.385  1.00 38.95 ? 418  ARG L NH2 1 
ATOM   10743 N  N   . ARG L  3 49  ? -29.642 29.693  15.172  1.00 25.64 ? 419  ARG L N   1 
ATOM   10744 C  CA  . ARG L  3 49  ? -29.452 28.524  14.334  1.00 24.35 ? 419  ARG L CA  1 
ATOM   10745 C  C   . ARG L  3 49  ? -28.061 28.581  13.741  1.00 24.95 ? 419  ARG L C   1 
ATOM   10746 O  O   . ARG L  3 49  ? -27.602 29.634  13.310  1.00 26.28 ? 419  ARG L O   1 
ATOM   10747 C  CB  . ARG L  3 49  ? -30.501 28.505  13.220  1.00 23.56 ? 419  ARG L CB  1 
ATOM   10748 C  CG  . ARG L  3 49  ? -30.190 27.568  12.066  1.00 22.88 ? 419  ARG L CG  1 
ATOM   10749 C  CD  . ARG L  3 49  ? -31.401 27.380  11.179  1.00 22.46 ? 419  ARG L CD  1 
ATOM   10750 N  NE  . ARG L  3 49  ? -31.793 28.634  10.548  1.00 23.64 ? 419  ARG L NE  1 
ATOM   10751 C  CZ  . ARG L  3 49  ? -31.368 29.054  9.361   1.00 24.67 ? 419  ARG L CZ  1 
ATOM   10752 N  NH1 . ARG L  3 49  ? -30.530 28.322  8.633   1.00 24.61 ? 419  ARG L NH1 1 
ATOM   10753 N  NH2 . ARG L  3 49  ? -31.792 30.220  8.892   1.00 26.02 ? 419  ARG L NH2 1 
ATOM   10754 N  N   . GLY L  3 50  ? -27.398 27.435  13.728  1.00 24.66 ? 420  GLY L N   1 
ATOM   10755 C  CA  . GLY L  3 50  ? -26.141 27.259  12.998  1.00 25.47 ? 420  GLY L CA  1 
ATOM   10756 C  C   . GLY L  3 50  ? -24.928 27.138  13.888  1.00 25.75 ? 420  GLY L C   1 
ATOM   10757 O  O   . GLY L  3 50  ? -23.849 26.849  13.396  1.00 26.36 ? 420  GLY L O   1 
ATOM   10758 N  N   . THR L  3 51  ? -25.098 27.366  15.190  1.00 25.67 ? 421  THR L N   1 
ATOM   10759 C  CA  . THR L  3 51  ? -23.988 27.281  16.141  1.00 26.37 ? 421  THR L CA  1 
ATOM   10760 C  C   . THR L  3 51  ? -24.284 26.330  17.302  1.00 25.54 ? 421  THR L C   1 
ATOM   10761 O  O   . THR L  3 51  ? -23.764 26.504  18.405  1.00 25.86 ? 421  THR L O   1 
ATOM   10762 C  CB  . THR L  3 51  ? -23.639 28.678  16.690  1.00 27.64 ? 421  THR L CB  1 
ATOM   10763 O  OG1 . THR L  3 51  ? -24.780 29.243  17.341  1.00 27.30 ? 421  THR L OG1 1 
ATOM   10764 C  CG2 . THR L  3 51  ? -23.206 29.585  15.552  1.00 28.86 ? 421  THR L CG2 1 
ATOM   10765 N  N   . ASP L  3 52  ? -25.118 25.328  17.036  1.00 24.47 ? 422  ASP L N   1 
ATOM   10766 C  CA  . ASP L  3 52  ? -25.536 24.357  18.043  1.00 24.10 ? 422  ASP L CA  1 
ATOM   10767 C  C   . ASP L  3 52  ? -25.959 25.019  19.381  1.00 24.78 ? 422  ASP L C   1 
ATOM   10768 O  O   . ASP L  3 52  ? -25.562 24.584  20.463  1.00 24.46 ? 422  ASP L O   1 
ATOM   10769 C  CB  . ASP L  3 52  ? -24.412 23.348  18.262  1.00 24.35 ? 422  ASP L CB  1 
ATOM   10770 C  CG  . ASP L  3 52  ? -24.891 22.071  18.962  1.00 24.17 ? 422  ASP L CG  1 
ATOM   10771 O  OD1 . ASP L  3 52  ? -26.129 21.802  18.990  1.00 22.86 ? 422  ASP L OD1 1 
ATOM   10772 O  OD2 . ASP L  3 52  ? -24.008 21.344  19.491  1.00 24.21 ? 422  ASP L OD2 1 
ATOM   10773 N  N   . GLU L  3 53  ? -26.777 26.068  19.281  1.00 25.62 ? 423  GLU L N   1 
ATOM   10774 C  CA  . GLU L  3 53  ? -27.209 26.843  20.449  1.00 26.39 ? 423  GLU L CA  1 
ATOM   10775 C  C   . GLU L  3 53  ? -27.904 25.966  21.495  1.00 24.84 ? 423  GLU L C   1 
ATOM   10776 O  O   . GLU L  3 53  ? -28.962 25.404  21.229  1.00 23.42 ? 423  GLU L O   1 
ATOM   10777 C  CB  . GLU L  3 53  ? -28.169 27.945  20.007  1.00 27.64 ? 423  GLU L CB  1 
ATOM   10778 C  CG  . GLU L  3 53  ? -28.537 28.935  21.102  1.00 29.04 ? 423  GLU L CG  1 
ATOM   10779 C  CD  . GLU L  3 53  ? -27.331 29.671  21.642  1.00 30.53 ? 423  GLU L CD  1 
ATOM   10780 O  OE1 . GLU L  3 53  ? -26.395 29.931  20.851  1.00 31.22 ? 423  GLU L OE1 1 
ATOM   10781 O  OE2 . GLU L  3 53  ? -27.315 29.981  22.857  1.00 31.99 ? 423  GLU L OE2 1 
ATOM   10782 N  N   . CYS L  3 54  ? -27.287 25.858  22.673  1.00 24.89 ? 424  CYS L N   1 
ATOM   10783 C  CA  . CYS L  3 54  ? -27.814 25.070  23.794  1.00 24.19 ? 424  CYS L CA  1 
ATOM   10784 C  C   . CYS L  3 54  ? -28.079 23.618  23.448  1.00 22.43 ? 424  CYS L C   1 
ATOM   10785 O  O   . CYS L  3 54  ? -29.012 23.016  23.980  1.00 21.91 ? 424  CYS L O   1 
ATOM   10786 C  CB  . CYS L  3 54  ? -29.084 25.715  24.352  1.00 24.58 ? 424  CYS L CB  1 
ATOM   10787 S  SG  . CYS L  3 54  ? -28.726 27.255  25.195  1.00 26.98 ? 424  CYS L SG  1 
ATOM   10788 N  N   . ALA L  3 55  ? -27.241 23.059  22.579  1.00 21.60 ? 425  ALA L N   1 
ATOM   10789 C  CA  . ALA L  3 55  ? -27.389 21.685  22.092  1.00 20.41 ? 425  ALA L CA  1 
ATOM   10790 C  C   . ALA L  3 55  ? -28.621 21.382  21.194  1.00 19.17 ? 425  ALA L C   1 
ATOM   10791 O  O   . ALA L  3 55  ? -28.943 20.206  20.961  1.00 18.42 ? 425  ALA L O   1 
ATOM   10792 C  CB  . ALA L  3 55  ? -27.320 20.709  23.256  1.00 20.62 ? 425  ALA L CB  1 
ATOM   10793 N  N   . ILE L  3 56  ? -29.263 22.407  20.638  1.00 18.99 ? 426  ILE L N   1 
ATOM   10794 C  CA  . ILE