data_4CGS
# 
_entry.id   4CGS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4CGS         
PDBE  EBI-59082    
WWPDB D_1290059082 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4CGX unspecified 'CRYSTAL STRUCTURE OF THE N-TERMINAL DOMAIN OF THE PA SUBUNIT OF THOGOTO VIRUS POLYMERASE (FORM 1)' 
PDB 4CHC unspecified 'CRYSTAL STRUCTURE OF THE N-TERMINAL DOMAIN OF THE PA SUBUNIT OF THOGOTO VIRUS POLYMERASE (FORM 2)' 
PDB 4CHD unspecified 
;CRYSTAL STRUCTURE OF THE '627' DOMAIN OF THE PB2 SUBUNIT OF THOGOTO VIRUS POLYMERASE
;
PDB 4CHE unspecified 'CRYSTAL STRUCTURE OF THE PUTATIVE CAP-BINDING DOMAIN OF THE PB2 SUBUNIT OF THOGOTO VIRUS POLYMERASE' 
PDB 4CHF unspecified 
'CRYSTAL STRUCTURE OF THE PUTATIVE CAP-BINDING DOMAIN OF THE PB2 SUBUNIT OF THOGOTO VIRUS POLYMERASE (FORM 2)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4CGS 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-11-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Guilligay, D.'   1 
'Kadlec, J.'      2 
'Crepin, T.'      3 
'Lunardi, T.'     4 
'Bouvier, D.'     5 
'Kochs, G.'       6 
'Ruigrok, R.W.H.' 7 
'Cusack, S.'      8 
# 
_citation.id                        primary 
_citation.title                     
'Comparative Structural and Functional Analysis of Orthomyxovirus Polymerase CAP-Snatching Domains.' 
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            9 
_citation.page_first                84973 
_citation.page_last                 ? 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24454773 
_citation.pdbx_database_id_DOI      10.1371/JOURNAL.PONE.0084973 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Guilligay, D.'   1 
primary 'Kadlec, J.'      2 
primary 'Crepin, T.'      3 
primary 'Lunardi, T.'     4 
primary 'Bouvier, D.'     5 
primary 'Kochs, G.'       6 
primary 'Ruigrok, R.W.H.' 7 
primary 'Cusack, S.'      8 
# 
_cell.entry_id           4CGS 
_cell.length_a           43.910 
_cell.length_b           87.450 
_cell.length_c           56.130 
_cell.angle_alpha        90.00 
_cell.angle_beta         112.98 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4CGS 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'POLYMERASE SUBUNIT PA' 20267.984 2   ? ? 'N-TERMINAL DOMAIN, RESIDUES 1-171' ? 
2 non-polymer syn GLYCEROL                92.094    2   ? ? ?                                   ? 
3 water       nat water                   18.015    472 ? ? ?                                   ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GAMDRHKPKSISSEIWALSETSKEWMSNLRPLEARIVECIKYTVC(CME)HISDMHLHNGVPRYIVNMWTPPEVADQEMK
RQNLIFARPNVPDLLDLKERKGVYVKVYPDNGTPTDYQTAENEIFVRVSLSGQMSPITREYLDEVQRQDVTNFLVTIYNE
SLESNLLERMQELYDTD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMDRHKPKSISSEIWALSETSKEWMSNLRPLEARIVECIKYTVCCHISDMHLHNGVPRYIVNMWTPPEVADQEMKRQNL
IFARPNVPDLLDLKERKGVYVKVYPDNGTPTDYQTAENEIFVRVSLSGQMSPITREYLDEVQRQDVTNFLVTIYNESLES
NLLERMQELYDTD
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ASP n 
1 5   ARG n 
1 6   HIS n 
1 7   LYS n 
1 8   PRO n 
1 9   LYS n 
1 10  SER n 
1 11  ILE n 
1 12  SER n 
1 13  SER n 
1 14  GLU n 
1 15  ILE n 
1 16  TRP n 
1 17  ALA n 
1 18  LEU n 
1 19  SER n 
1 20  GLU n 
1 21  THR n 
1 22  SER n 
1 23  LYS n 
1 24  GLU n 
1 25  TRP n 
1 26  MET n 
1 27  SER n 
1 28  ASN n 
1 29  LEU n 
1 30  ARG n 
1 31  PRO n 
1 32  LEU n 
1 33  GLU n 
1 34  ALA n 
1 35  ARG n 
1 36  ILE n 
1 37  VAL n 
1 38  GLU n 
1 39  CYS n 
1 40  ILE n 
1 41  LYS n 
1 42  TYR n 
1 43  THR n 
1 44  VAL n 
1 45  CYS n 
1 46  CME n 
1 47  HIS n 
1 48  ILE n 
1 49  SER n 
1 50  ASP n 
1 51  MET n 
1 52  HIS n 
1 53  LEU n 
1 54  HIS n 
1 55  ASN n 
1 56  GLY n 
1 57  VAL n 
1 58  PRO n 
1 59  ARG n 
1 60  TYR n 
1 61  ILE n 
1 62  VAL n 
1 63  ASN n 
1 64  MET n 
1 65  TRP n 
1 66  THR n 
1 67  PRO n 
1 68  PRO n 
1 69  GLU n 
1 70  VAL n 
1 71  ALA n 
1 72  ASP n 
1 73  GLN n 
1 74  GLU n 
1 75  MET n 
1 76  LYS n 
1 77  ARG n 
1 78  GLN n 
1 79  ASN n 
1 80  LEU n 
1 81  ILE n 
1 82  PHE n 
1 83  ALA n 
1 84  ARG n 
1 85  PRO n 
1 86  ASN n 
1 87  VAL n 
1 88  PRO n 
1 89  ASP n 
1 90  LEU n 
1 91  LEU n 
1 92  ASP n 
1 93  LEU n 
1 94  LYS n 
1 95  GLU n 
1 96  ARG n 
1 97  LYS n 
1 98  GLY n 
1 99  VAL n 
1 100 TYR n 
1 101 VAL n 
1 102 LYS n 
1 103 VAL n 
1 104 TYR n 
1 105 PRO n 
1 106 ASP n 
1 107 ASN n 
1 108 GLY n 
1 109 THR n 
1 110 PRO n 
1 111 THR n 
1 112 ASP n 
1 113 TYR n 
1 114 GLN n 
1 115 THR n 
1 116 ALA n 
1 117 GLU n 
1 118 ASN n 
1 119 GLU n 
1 120 ILE n 
1 121 PHE n 
1 122 VAL n 
1 123 ARG n 
1 124 VAL n 
1 125 SER n 
1 126 LEU n 
1 127 SER n 
1 128 GLY n 
1 129 GLN n 
1 130 MET n 
1 131 SER n 
1 132 PRO n 
1 133 ILE n 
1 134 THR n 
1 135 ARG n 
1 136 GLU n 
1 137 TYR n 
1 138 LEU n 
1 139 ASP n 
1 140 GLU n 
1 141 VAL n 
1 142 GLN n 
1 143 ARG n 
1 144 GLN n 
1 145 ASP n 
1 146 VAL n 
1 147 THR n 
1 148 ASN n 
1 149 PHE n 
1 150 LEU n 
1 151 VAL n 
1 152 THR n 
1 153 ILE n 
1 154 TYR n 
1 155 ASN n 
1 156 GLU n 
1 157 SER n 
1 158 LEU n 
1 159 GLU n 
1 160 SER n 
1 161 ASN n 
1 162 LEU n 
1 163 LEU n 
1 164 GLU n 
1 165 ARG n 
1 166 MET n 
1 167 GLN n 
1 168 GLU n 
1 169 LEU n 
1 170 TYR n 
1 171 ASP n 
1 172 THR n 
1 173 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'DHORI VIRUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11318 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              'CODON PLUS-RIL' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PET-M11 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    D6PT85_9ORTO 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          D6PT85 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4CGS A 3 ? 173 ? D6PT85 1 ? 171 ? 1 171 
2 1 4CGS B 3 ? 173 ? D6PT85 1 ? 171 ? 1 171 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4CGS GLY A 1 ? UNP D6PT85 ? ? 'expression tag' -1 1 
1 4CGS ALA A 2 ? UNP D6PT85 ? ? 'expression tag' 0  2 
2 4CGS GLY B 1 ? UNP D6PT85 ? ? 'expression tag' -1 3 
2 4CGS ALA B 2 ? UNP D6PT85 ? ? 'expression tag' 0  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                            ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                           ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                         ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                    ?                               'C4 H7 N O4'     133.103 
CME 'L-peptide linking' n 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' ?                               'C5 H11 N O3 S2' 197.276 
CYS 'L-peptide linking' y CYSTEINE                           ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                          ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                    ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                            ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                           'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                          ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                              ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                         ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                            ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                             ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                         ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                      ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                            ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                             ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                          ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                         ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                           ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                             ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4CGS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.55 
_exptl_crystal.density_percent_sol   51.8 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '20MG/ML PROTEIN, 3.2 M NA FORMATE AND 0.1 M HEPES PH 7.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2011-06-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9794 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             0.9794 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4CGS 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            1.30 
_reflns.number_obs                   92519 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.6 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.80 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.41 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.30 
_reflns_shell.d_res_low              1.35 
_reflns_shell.percent_possible_all   94.2 
_reflns_shell.Rmerge_I_obs           0.37 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.30 
_reflns_shell.pdbx_redundancy        3.45 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4CGS 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     87879 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             51.68 
_refine.ls_d_res_high                            1.30 
_refine.ls_percent_reflns_obs                    96.74 
_refine.ls_R_factor_obs                          0.17509 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17280 
_refine.ls_R_factor_R_free                       0.21964 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4640 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.953 
_refine.correlation_coeff_Fo_to_Fc_free          0.926 
_refine.B_iso_mean                               10.817 
_refine.aniso_B[1][1]                            0.03 
_refine.aniso_B[2][2]                            0.17 
_refine.aniso_B[3][3]                            -0.28 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.10 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      NONE 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.056 
_refine.pdbx_overall_ESU_R_Free                  0.058 
_refine.overall_SU_ML                            0.035 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             1.775 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2768 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             472 
_refine_hist.number_atoms_total               3252 
_refine_hist.d_res_high                       1.30 
_refine_hist.d_res_low                        51.68 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.020  0.019  ? 2991 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.005  0.020  ? 2068 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.928  1.966  ? 4072 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.041  3.000  ? 5056 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.080  5.000  ? 367  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.868 24.333 ? 150  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       11.986 15.000 ? 547  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.065 15.000 ? 25   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.121  0.200  ? 444  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.011  0.021  ? 3344 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 589  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           5.607  3.000  ? 5059 'X-RAY DIFFRACTION' ? 
r_sphericity_free            24.785 5.000  ? 121  'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          7.205  5.000  ? 5337 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.300 
_refine_ls_shell.d_res_low                        1.334 
_refine_ls_shell.number_reflns_R_work             6180 
_refine_ls_shell.R_factor_R_work                  0.230 
_refine_ls_shell.percent_reflns_obs               93.59 
_refine_ls_shell.R_factor_R_free                  0.306 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             357 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4CGS 
_struct.title                     'Crystal structure of the N-terminal domain of the PA subunit of Dhori virus polymerase' 
_struct.pdbx_descriptor           'POLYMERASE SUBUNIT PA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4CGS 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET A 3   ? LYS A 7   ? MET A 1   LYS A 5   5 ? 5  
HELX_P HELX_P2  2  SER A 12  ? SER A 19  ? SER A 10  SER A 17  1 ? 8  
HELX_P HELX_P3  3  GLU A 20  ? SER A 22  ? GLU A 18  SER A 20  5 ? 3  
HELX_P HELX_P4  4  GLU A 24  ? ASN A 28  ? GLU A 22  ASN A 26  5 ? 5  
HELX_P HELX_P5  5  ARG A 30  ? ASP A 50  ? ARG A 28  ASP A 48  1 ? 21 
HELX_P HELX_P6  6  PRO A 67  ? ASN A 79  ? PRO A 65  ASN A 77  1 ? 13 
HELX_P HELX_P7  7  SER A 131 ? LEU A 138 ? SER A 129 LEU A 136 1 ? 8  
HELX_P HELX_P8  8  ASP A 139 ? LEU A 158 ? ASP A 137 LEU A 156 1 ? 20 
HELX_P HELX_P9  9  ASN A 161 ? GLN A 167 ? ASN A 159 GLN A 165 1 ? 7  
HELX_P HELX_P10 10 MET B 3   ? LYS B 7   ? MET B 1   LYS B 5   5 ? 5  
HELX_P HELX_P11 11 SER B 12  ? SER B 19  ? SER B 10  SER B 17  1 ? 8  
HELX_P HELX_P12 12 GLU B 20  ? SER B 22  ? GLU B 18  SER B 20  5 ? 3  
HELX_P HELX_P13 13 GLU B 24  ? ASN B 28  ? GLU B 22  ASN B 26  5 ? 5  
HELX_P HELX_P14 14 ARG B 30  ? ASP B 50  ? ARG B 28  ASP B 48  1 ? 21 
HELX_P HELX_P15 15 PRO B 67  ? ASN B 79  ? PRO B 65  ASN B 77  1 ? 13 
HELX_P HELX_P16 16 SER B 131 ? LEU B 138 ? SER B 129 LEU B 136 1 ? 8  
HELX_P HELX_P17 17 ASP B 139 ? LEU B 158 ? ASP B 137 LEU B 156 1 ? 20 
HELX_P HELX_P18 18 ASN B 161 ? TYR B 170 ? ASN B 159 TYR B 168 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A CYS 45 C ? ? ? 1_555 A CME 46 N ? ? A CYS 43 A CME 44 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale2 covale ? ? A CME 46 C ? ? ? 1_555 A HIS 47 N ? ? A CME 44 A HIS 45 1_555 ? ? ? ? ? ? ? 1.341 ? 
covale3 covale ? ? B CYS 45 C ? ? ? 1_555 B CME 46 N ? ? B CYS 43 B CME 44 1_555 ? ? ? ? ? ? ? 1.348 ? 
covale4 covale ? ? B CME 46 C ? ? ? 1_555 B HIS 47 N ? ? B CME 44 B HIS 45 1_555 ? ? ? ? ? ? ? 1.343 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 4 ? 
BA ? 2 ? 
BB ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? parallel      
BA 1 2 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LEU A 53  ? HIS A 54  ? LEU A 51  HIS A 52  
AA 2 VAL A 57  ? PRO A 58  ? VAL A 55  PRO A 56  
AB 1 TYR A 60  ? VAL A 62  ? TYR A 58  VAL A 60  
AB 2 LEU A 90  ? ASP A 92  ? LEU A 88  ASP A 90  
AB 3 LYS A 97  ? TYR A 104 ? LYS A 95  TYR A 102 
AB 4 GLU A 119 ? SER A 125 ? GLU A 117 SER A 123 
BA 1 LEU B 53  ? HIS B 54  ? LEU B 51  HIS B 52  
BA 2 VAL B 57  ? PRO B 58  ? VAL B 55  PRO B 56  
BB 1 TYR B 60  ? VAL B 62  ? TYR B 58  VAL B 60  
BB 2 LEU B 90  ? ASP B 92  ? LEU B 88  ASP B 90  
BB 3 LYS B 97  ? TYR B 104 ? LYS B 95  TYR B 102 
BB 4 GLU B 119 ? SER B 125 ? GLU B 117 SER B 123 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N HIS A 54  ? N HIS A 52 O VAL A 57  ? O VAL A 55  
AB 1 2 N ILE A 61  ? N ILE A 59 O LEU A 91  ? O LEU A 89  
AB 2 3 N ASP A 92  ? N ASP A 90 O LYS A 97  ? O LYS A 95  
AB 3 4 N TYR A 100 ? N TYR A 98 O ILE A 120 ? O ILE A 118 
BA 1 2 N HIS B 54  ? N HIS B 52 O VAL B 57  ? O VAL B 55  
BB 1 2 N ILE B 61  ? N ILE B 59 O LEU B 91  ? O LEU B 89  
BB 2 3 N ASP B 92  ? N ASP B 90 O LYS B 97  ? O LYS B 95  
BB 3 4 N TYR B 100 ? N TYR B 98 O ILE B 120 ? O ILE B 118 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE GOL B 1169' 
AC2 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE GOL A 1168' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 ALA A 17  ? ALA A 15   . ? 1_555 ? 
2  AC1 8 LEU A 18  ? LEU A 16   . ? 1_555 ? 
3  AC1 8 THR A 21  ? THR A 19   . ? 1_555 ? 
4  AC1 8 HOH E .   ? HOH A 2034 . ? 1_555 ? 
5  AC1 8 ALA B 116 ? ALA B 114  . ? 1_555 ? 
6  AC1 8 GLU B 117 ? GLU B 115  . ? 1_555 ? 
7  AC1 8 ASN B 118 ? ASN B 116  . ? 1_555 ? 
8  AC1 8 HOH F .   ? HOH B 2143 . ? 1_555 ? 
9  AC2 9 TYR A 42  ? TYR A 40   . ? 1_555 ? 
10 AC2 9 VAL A 62  ? VAL A 60   . ? 1_555 ? 
11 AC2 9 MET A 64  ? MET A 62   . ? 1_555 ? 
12 AC2 9 THR A 66  ? THR A 64   . ? 1_555 ? 
13 AC2 9 HOH E .   ? HOH A 2124 . ? 1_555 ? 
14 AC2 9 HOH E .   ? HOH A 2241 . ? 1_555 ? 
15 AC2 9 HOH E .   ? HOH A 2243 . ? 1_555 ? 
16 AC2 9 ARG B 84  ? ARG B 82   . ? 1_555 ? 
17 AC2 9 PRO B 85  ? PRO B 83   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4CGS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4CGS 
_atom_sites.fract_transf_matrix[1][1]   0.022774 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.009658 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011435 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019351 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 2   ? 7.998   -1.257 33.828 1.00 29.14 ? 0    ALA A N   1 
ATOM   2    C CA  . ALA A 1 2   ? 8.793   -2.437 34.374 1.00 25.45 ? 0    ALA A CA  1 
ATOM   3    C C   . ALA A 1 2   ? 9.437   -2.132 35.739 1.00 25.35 ? 0    ALA A C   1 
ATOM   4    O O   . ALA A 1 2   ? 9.492   -3.026 36.591 1.00 30.33 ? 0    ALA A O   1 
ATOM   5    C CB  . ALA A 1 2   ? 9.892   -2.855 33.395 1.00 27.88 ? 0    ALA A CB  1 
ATOM   6    N N   . MET A 1 3   ? 9.932   -0.906 35.952 1.00 23.00 ? 1    MET A N   1 
ATOM   7    C CA  . MET A 1 3   ? 10.634  -0.528 37.199 1.00 20.30 ? 1    MET A CA  1 
ATOM   8    C C   . MET A 1 3   ? 9.679   0.072  38.209 1.00 17.16 ? 1    MET A C   1 
ATOM   9    O O   . MET A 1 3   ? 10.118  0.743  39.159 1.00 16.62 ? 1    MET A O   1 
ATOM   10   C CB  . MET A 1 3   ? 11.701  0.504  36.896 1.00 18.14 ? 1    MET A CB  1 
ATOM   11   C CG  . MET A 1 3   ? 12.666  -0.001 35.861 1.00 22.02 ? 1    MET A CG  1 
ATOM   12   S SD  . MET A 1 3   ? 13.733  1.308  35.271 1.00 19.96 ? 1    MET A SD  1 
ATOM   13   C CE  . MET A 1 3   ? 14.335  1.862  36.727 1.00 9.13  ? 1    MET A CE  1 
ATOM   14   N N   . ASP A 1 4   ? 8.400   -0.092 37.983 1.00 18.46 ? 2    ASP A N   1 
ATOM   15   C CA  . ASP A 1 4   ? 7.402   0.671  38.717 1.00 18.51 ? 2    ASP A CA  1 
ATOM   16   C C   . ASP A 1 4   ? 7.438   0.457  40.234 1.00 14.94 ? 2    ASP A C   1 
ATOM   17   O O   . ASP A 1 4   ? 7.130   1.356  40.999 1.00 14.35 ? 2    ASP A O   1 
ATOM   18   C CB  . ASP A 1 4   ? 6.014   0.524  38.074 1.00 23.63 ? 2    ASP A CB  1 
ATOM   19   C CG  . ASP A 1 4   ? 5.946   1.242  36.704 1.00 30.75 ? 2    ASP A CG  1 
ATOM   20   O OD1 . ASP A 1 4   ? 7.008   1.855  36.295 1.00 22.30 ? 2    ASP A OD1 1 
ATOM   21   O OD2 . ASP A 1 4   ? 4.860   1.226  36.077 1.00 32.34 ? 2    ASP A OD2 1 
ATOM   22   N N   . ARG A 1 5   ? 7.870   -0.712 40.684 1.00 16.76 ? 3    ARG A N   1 
ATOM   23   C CA  . ARG A 1 5   ? 7.894   -0.995 42.096 1.00 15.22 ? 3    ARG A CA  1 
ATOM   24   C C   . ARG A 1 5   ? 8.871   -0.072 42.817 1.00 14.59 ? 3    ARG A C   1 
ATOM   25   O O   . ARG A 1 5   ? 8.810   0.146  44.015 1.00 17.44 ? 3    ARG A O   1 
ATOM   26   C CB  . ARG A 1 5   ? 8.186   -2.477 42.384 1.00 18.43 ? 3    ARG A CB  1 
ATOM   27   C CG  . ARG A 1 5   ? 9.599   -2.941 42.088 1.00 21.55 ? 3    ARG A CG  1 
ATOM   28   C CD  . ARG A 1 5   ? 9.823   -4.356 42.633 1.00 28.39 ? 3    ARG A CD  1 
ATOM   29   N NE  . ARG A 1 5   ? 10.178  -4.358 44.078 1.00 39.80 ? 3    ARG A NE  1 
ATOM   30   C CZ  . ARG A 1 5   ? 9.330   -4.553 45.100 1.00 44.81 ? 3    ARG A CZ  1 
ATOM   31   N NH1 . ARG A 1 5   ? 8.020   -4.761 44.892 1.00 42.09 ? 3    ARG A NH1 1 
ATOM   32   N NH2 . ARG A 1 5   ? 9.783   -4.524 46.356 1.00 43.02 ? 3    ARG A NH2 1 
ATOM   33   N N   . HIS A 1 6   ? 9.794   0.448  42.046 1.00 12.71 ? 4    HIS A N   1 
ATOM   34   C CA  . HIS A 1 6   ? 10.879  1.267  42.535 1.00 11.81 ? 4    HIS A CA  1 
ATOM   35   C C   . HIS A 1 6   ? 10.603  2.755  42.568 1.00 11.74 ? 4    HIS A C   1 
ATOM   36   O O   . HIS A 1 6   ? 11.435  3.522  43.073 1.00 12.17 ? 4    HIS A O   1 
ATOM   37   C CB  . HIS A 1 6   ? 12.185  1.009  41.718 1.00 12.61 ? 4    HIS A CB  1 
ATOM   38   C CG  . HIS A 1 6   ? 12.623  -0.442 41.744 1.00 13.83 ? 4    HIS A CG  1 
ATOM   39   N ND1 . HIS A 1 6   ? 12.980  -1.080 42.870 1.00 15.20 ? 4    HIS A ND1 1 
ATOM   40   C CD2 . HIS A 1 6   ? 12.753  -1.344 40.701 1.00 18.59 ? 4    HIS A CD2 1 
ATOM   41   C CE1 . HIS A 1 6   ? 13.350  -2.361 42.546 1.00 17.71 ? 4    HIS A CE1 1 
ATOM   42   N NE2 . HIS A 1 6   ? 13.212  -2.502 41.207 1.00 21.55 ? 4    HIS A NE2 1 
ATOM   43   N N   . LYS A 1 7   ? 9.458   3.191  42.031 1.00 9.74  ? 5    LYS A N   1 
ATOM   44   C CA  . LYS A 1 7   ? 9.118   4.640  42.047 1.00 8.92  ? 5    LYS A CA  1 
ATOM   45   C C   . LYS A 1 7   ? 9.025   5.088  43.477 1.00 8.23  ? 5    LYS A C   1 
ATOM   46   O O   . LYS A 1 7   ? 8.241   4.529  44.227 1.00 9.29  ? 5    LYS A O   1 
ATOM   47   C CB  . LYS A 1 7   ? 7.800   4.872  41.397 1.00 9.31  ? 5    LYS A CB  1 
ATOM   48   C CG  . LYS A 1 7   ? 7.452   6.368  41.273 1.00 7.84  ? 5    LYS A CG  1 
ATOM   49   C CD  . LYS A 1 7   ? 6.056   6.618  40.749 1.00 9.97  ? 5    LYS A CD  1 
ATOM   50   C CE  . LYS A 1 7   ? 4.971   6.308  41.741 1.00 10.03 ? 5    LYS A CE  1 
ATOM   51   N NZ  . LYS A 1 7   ? 5.007   7.165  42.960 1.00 9.53  ? 5    LYS A NZ  1 
ATOM   52   N N   . PRO A 1 8   ? 9.763   6.149  43.878 1.00 8.09  ? 6    PRO A N   1 
ATOM   53   C CA  . PRO A 1 8   ? 9.543   6.737  45.176 1.00 8.87  ? 6    PRO A CA  1 
ATOM   54   C C   . PRO A 1 8   ? 8.104   7.278  45.321 1.00 9.11  ? 6    PRO A C   1 
ATOM   55   O O   . PRO A 1 8   ? 7.502   7.723  44.355 1.00 8.98  ? 6    PRO A O   1 
ATOM   56   C CB  . PRO A 1 8   ? 10.594  7.856  45.233 1.00 8.79  ? 6    PRO A CB  1 
ATOM   57   C CG  . PRO A 1 8   ? 11.615  7.478  44.236 1.00 9.79  ? 6    PRO A CG  1 
ATOM   58   C CD  . PRO A 1 8   ? 10.850  6.823  43.150 1.00 9.88  ? 6    PRO A CD  1 
ATOM   59   N N   . LYS A 1 9   ? 7.577   7.204  46.533 1.00 8.37  ? 7    LYS A N   1 
ATOM   60   C CA  . LYS A 1 9   ? 6.277   7.767  46.803 1.00 9.79  ? 7    LYS A CA  1 
ATOM   61   C C   . LYS A 1 9   ? 6.238   9.253  46.442 1.00 8.73  ? 7    LYS A C   1 
ATOM   62   O O   . LYS A 1 9   ? 5.231   9.770  46.052 1.00 10.80 ? 7    LYS A O   1 
ATOM   63   C CB  . LYS A 1 9   ? 5.923   7.622  48.284 1.00 12.69 ? 7    LYS A CB  1 
ATOM   64   C CG  . LYS A 1 9   ? 4.490   7.939  48.690 1.00 22.01 ? 7    LYS A CG  1 
ATOM   65   C CD  . LYS A 1 9   ? 4.341   7.970  50.216 1.00 24.95 ? 7    LYS A CD  1 
ATOM   66   C CE  . LYS A 1 9   ? 3.129   7.205  50.748 1.00 29.41 ? 7    LYS A CE  1 
ATOM   67   N NZ  . LYS A 1 9   ? 1.903   8.028  50.575 1.00 37.00 ? 7    LYS A NZ  1 
ATOM   68   N N   . SER A 1 10  ? 7.380   9.907  46.623 1.00 7.73  ? 8    SER A N   1 
ATOM   69   C CA  . SER A 1 10  ? 7.466   11.338 46.416 1.00 8.54  ? 8    SER A CA  1 
ATOM   70   C C   . SER A 1 10  ? 7.505   11.810 44.981 1.00 8.61  ? 8    SER A C   1 
ATOM   71   O O   . SER A 1 10  ? 7.533   13.054 44.741 1.00 9.89  ? 8    SER A O   1 
ATOM   72   C CB  . SER A 1 10  ? 8.691   11.903 47.168 1.00 10.78 ? 8    SER A CB  1 
ATOM   73   O OG  . SER A 1 10  ? 8.735   11.600 48.539 1.00 14.68 ? 8    SER A OG  1 
ATOM   74   N N   . ILE A 1 11  ? 7.632   10.874 44.029 1.00 7.21  ? 9    ILE A N   1 
ATOM   75   C CA  . ILE A 1 11  ? 7.602   11.214 42.613 1.00 6.98  ? 9    ILE A CA  1 
ATOM   76   C C   . ILE A 1 11  ? 6.229   10.878 42.105 1.00 7.80  ? 9    ILE A C   1 
ATOM   77   O O   . ILE A 1 11  ? 5.702   9.789  42.347 1.00 7.88  ? 9    ILE A O   1 
ATOM   78   C CB  . ILE A 1 11  ? 8.657   10.421 41.844 1.00 7.46  ? 9    ILE A CB  1 
ATOM   79   C CG1 . ILE A 1 11  ? 10.109  10.758 42.259 1.00 8.78  ? 9    ILE A CG1 1 
ATOM   80   C CG2 . ILE A 1 11  ? 8.510   10.667 40.319 1.00 8.89  ? 9    ILE A CG2 1 
ATOM   81   C CD1 . ILE A 1 11  ? 10.460  12.237 42.157 1.00 9.18  ? 9    ILE A CD1 1 
ATOM   82   N N   . SER A 1 12  ? 5.618   11.820 41.415 1.00 7.33  ? 10   SER A N   1 
ATOM   83   C CA  . SER A 1 12  ? 4.258   11.494 40.889 1.00 7.73  ? 10   SER A CA  1 
ATOM   84   C C   . SER A 1 12  ? 4.268   10.363 39.838 1.00 7.70  ? 10   SER A C   1 
ATOM   85   O O   . SER A 1 12  ? 5.244   10.178 39.091 1.00 7.54  ? 10   SER A O   1 
ATOM   86   C CB  . SER A 1 12  ? 3.590   12.718 40.280 1.00 8.19  ? 10   SER A CB  1 
ATOM   87   O OG  . SER A 1 12  ? 4.184   13.048 39.026 1.00 8.35  ? 10   SER A OG  1 
ATOM   88   N N   . SER A 1 13  ? 3.201   9.591  39.766 1.00 8.76  ? 11   SER A N   1 
ATOM   89   C CA  . SER A 1 13  ? 3.104   8.561  38.811 1.00 8.39  ? 11   SER A CA  1 
ATOM   90   C C   . SER A 1 13  ? 3.259   9.084  37.406 1.00 7.09  ? 11   SER A C   1 
ATOM   91   O O   . SER A 1 13  ? 3.871   8.423  36.577 1.00 9.17  ? 11   SER A O   1 
ATOM   92   C CB  . SER A 1 13  ? 1.769   7.784  38.977 1.00 9.65  ? 11   SER A CB  1 
ATOM   93   O OG  . SER A 1 13  ? 1.678   7.168  40.227 1.00 14.92 ? 11   SER A OG  1 
ATOM   94   N N   . GLU A 1 14  ? 2.717   10.267 37.146 1.00 6.77  ? 12   GLU A N   1 
ATOM   95   C CA  . GLU A 1 14  ? 2.768   10.804 35.743 1.00 7.68  ? 12   GLU A CA  1 
ATOM   96   C C   . GLU A 1 14  ? 4.143   11.278 35.358 1.00 6.65  ? 12   GLU A C   1 
ATOM   97   O O   . GLU A 1 14  ? 4.522   11.091 34.205 1.00 6.96  ? 12   GLU A O   1 
ATOM   98   C CB  . GLU A 1 14  ? 1.669   11.841 35.513 1.00 8.72  ? 12   GLU A CB  1 
ATOM   99   C CG  . GLU A 1 14  ? 1.720   13.082 36.406 1.00 7.33  ? 12   GLU A CG  1 
ATOM   100  C CD  . GLU A 1 14  ? 1.023   13.006 37.764 1.00 10.05 ? 12   GLU A CD  1 
ATOM   101  O OE1 . GLU A 1 14  ? 0.842   11.891 38.288 1.00 10.24 ? 12   GLU A OE1 1 
ATOM   102  O OE2 . GLU A 1 14  ? 0.679   14.124 38.254 1.00 12.04 ? 12   GLU A OE2 1 
ATOM   103  N N   . ILE A 1 15  ? 4.906   11.823 36.290 1.00 6.83  ? 13   ILE A N   1 
ATOM   104  C CA  . ILE A 1 15  ? 6.324   12.168 36.035 1.00 7.20  ? 13   ILE A CA  1 
ATOM   105  C C   . ILE A 1 15  ? 7.168   10.926 35.824 1.00 6.98  ? 13   ILE A C   1 
ATOM   106  O O   . ILE A 1 15  ? 7.958   10.854 34.891 1.00 7.06  ? 13   ILE A O   1 
ATOM   107  C CB  . ILE A 1 15  ? 6.839   13.164 37.085 1.00 7.18  ? 13   ILE A CB  1 
ATOM   108  C CG1 . ILE A 1 15  ? 6.218   14.546 36.856 1.00 8.12  ? 13   ILE A CG1 1 
ATOM   109  C CG2 . ILE A 1 15  ? 8.386   13.133 37.085 1.00 7.35  ? 13   ILE A CG2 1 
ATOM   110  C CD1 . ILE A 1 15  ? 6.565   15.563 37.960 1.00 8.94  ? 13   ILE A CD1 1 
ATOM   111  N N   . TRP A 1 16  ? 6.954   9.894  36.642 1.00 6.31  ? 14   TRP A N   1 
ATOM   112  C CA  . TRP A 1 16  ? 7.638   8.642  36.473 1.00 6.98  ? 14   TRP A CA  1 
ATOM   113  C C   . TRP A 1 16  ? 7.313   8.064  35.130 1.00 7.32  ? 14   TRP A C   1 
ATOM   114  O O   . TRP A 1 16  ? 8.225   7.601  34.393 1.00 7.90  ? 14   TRP A O   1 
ATOM   115  C CB  . TRP A 1 16  ? 7.274   7.709  37.563 1.00 6.50  ? 14   TRP A CB  1 
ATOM   116  C CG  . TRP A 1 16  ? 8.006   6.398  37.612 1.00 7.60  ? 14   TRP A CG  1 
ATOM   117  C CD1 . TRP A 1 16  ? 7.547   5.146  37.240 1.00 9.61  ? 14   TRP A CD1 1 
ATOM   118  C CD2 . TRP A 1 16  ? 9.312   6.188  38.141 1.00 6.95  ? 14   TRP A CD2 1 
ATOM   119  N NE1 . TRP A 1 16  ? 8.452   4.240  37.489 1.00 9.70  ? 14   TRP A NE1 1 
ATOM   120  C CE2 . TRP A 1 16  ? 9.560   4.767  38.042 1.00 7.94  ? 14   TRP A CE2 1 
ATOM   121  C CE3 . TRP A 1 16  ? 10.287  7.005  38.638 1.00 7.58  ? 14   TRP A CE3 1 
ATOM   122  C CZ2 . TRP A 1 16  ? 10.756  4.207  38.459 1.00 9.65  ? 14   TRP A CZ2 1 
ATOM   123  C CZ3 . TRP A 1 16  ? 11.451  6.434  39.105 1.00 8.33  ? 14   TRP A CZ3 1 
ATOM   124  C CH2 . TRP A 1 16  ? 11.670  5.064  39.000 1.00 8.86  ? 14   TRP A CH2 1 
ATOM   125  N N   . ALA A 1 17  ? 6.057   8.065  34.753 1.00 7.53  ? 15   ALA A N   1 
ATOM   126  C CA  . ALA A 1 17  ? 5.708   7.497  33.464 1.00 8.54  ? 15   ALA A CA  1 
ATOM   127  C C   . ALA A 1 17  ? 6.355   8.326  32.298 1.00 7.59  ? 15   ALA A C   1 
ATOM   128  O O   . ALA A 1 17  ? 6.836   7.771  31.281 1.00 8.03  ? 15   ALA A O   1 
ATOM   129  C CB  . ALA A 1 17  ? 4.203   7.422  33.302 1.00 12.14 ? 15   ALA A CB  1 
ATOM   130  N N   . LEU A 1 18  ? 6.294   9.631  32.380 1.00 7.65  ? 16   LEU A N   1 
ATOM   131  C CA  . LEU A 1 18  ? 6.840   10.498 31.365 1.00 8.27  ? 16   LEU A CA  1 
ATOM   132  C C   . LEU A 1 18  ? 8.365   10.234 31.179 1.00 8.47  ? 16   LEU A C   1 
ATOM   133  O O   . LEU A 1 18  ? 8.916   10.335 30.069 1.00 9.09  ? 16   LEU A O   1 
ATOM   134  C CB  . LEU A 1 18  ? 6.532   11.998 31.636 1.00 8.62  ? 16   LEU A CB  1 
ATOM   135  C CG  . LEU A 1 18  ? 6.942   12.930 30.470 1.00 7.16  ? 16   LEU A CG  1 
ATOM   136  C CD1 . LEU A 1 18  ? 6.436   12.452 29.084 1.00 7.86  ? 16   LEU A CD1 1 
ATOM   137  C CD2 . LEU A 1 18  ? 6.579   14.375 30.734 1.00 9.85  ? 16   LEU A CD2 1 
ATOM   138  N N   . SER A 1 19  ? 9.040   9.944  32.272 1.00 7.16  ? 17   SER A N   1 
ATOM   139  C CA  . SER A 1 19  ? 10.461  9.652  32.204 1.00 7.24  ? 17   SER A CA  1 
ATOM   140  C C   . SER A 1 19  ? 10.815  8.469  31.326 1.00 8.43  ? 17   SER A C   1 
ATOM   141  O O   . SER A 1 19  ? 11.979  8.309  30.937 1.00 9.44  ? 17   SER A O   1 
ATOM   142  C CB  . SER A 1 19  ? 11.097  9.478  33.563 1.00 7.03  ? 17   SER A CB  1 
ATOM   143  O OG  . SER A 1 19  ? 10.782  8.271  34.159 1.00 7.54  ? 17   SER A OG  1 
ATOM   144  N N   . GLU A 1 20  ? 9.858   7.616  30.987 1.00 11.20 ? 18   GLU A N   1 
ATOM   145  C CA  . GLU A 1 20  ? 10.180  6.527  29.977 1.00 13.27 ? 18   GLU A CA  1 
ATOM   146  C C   . GLU A 1 20  ? 10.534  7.065  28.588 1.00 10.37 ? 18   GLU A C   1 
ATOM   147  O O   . GLU A 1 20  ? 11.134  6.395  27.722 1.00 14.92 ? 18   GLU A O   1 
ATOM   148  C CB  . GLU A 1 20  ? 8.933   5.747  29.762 1.00 16.63 ? 18   GLU A CB  1 
ATOM   149  C CG  . GLU A 1 20  ? 8.583   4.864  30.940 1.00 16.61 ? 18   GLU A CG  1 
ATOM   150  C CD  . GLU A 1 20  ? 7.315   4.023  30.685 1.00 28.42 ? 18   GLU A CD  1 
ATOM   151  O OE1 . GLU A 1 20  ? 6.542   4.395  29.759 1.00 28.04 ? 18   GLU A OE1 1 
ATOM   152  O OE2 . GLU A 1 20  ? 7.110   3.007  31.396 1.00 29.49 ? 18   GLU A OE2 1 
ATOM   153  N N   . THR A 1 21  ? 10.264  8.367  28.325 1.00 13.30 ? 19   THR A N   1 
ATOM   154  C CA  . THR A 1 21  ? 10.604  8.972  27.004 1.00 12.37 ? 19   THR A CA  1 
ATOM   155  C C   . THR A 1 21  ? 12.064  9.395  26.929 1.00 11.82 ? 19   THR A C   1 
ATOM   156  O O   . THR A 1 21  ? 12.523  9.788  25.861 1.00 13.74 ? 19   THR A O   1 
ATOM   157  C CB  . THR A 1 21  ? 9.760   10.245 26.719 1.00 13.78 ? 19   THR A CB  1 
ATOM   158  O OG1 . THR A 1 21  ? 10.019  11.310 27.670 1.00 15.19 ? 19   THR A OG1 1 
ATOM   159  C CG2 . THR A 1 21  ? 8.219   9.915  26.623 1.00 18.51 ? 19   THR A CG2 1 
ATOM   160  N N   . SER A 1 22  ? 12.764  9.364  28.081 1.00 10.78 ? 20   SER A N   1 
ATOM   161  C CA  . SER A 1 22  ? 14.122  9.722  28.171 1.00 10.00 ? 20   SER A CA  1 
ATOM   162  C C   . SER A 1 22  ? 15.189  8.586  28.181 1.00 9.30  ? 20   SER A C   1 
ATOM   163  O O   . SER A 1 22  ? 15.190  7.681  28.962 1.00 12.18 ? 20   SER A O   1 
ATOM   164  C CB  . SER A 1 22  ? 14.298  10.545 29.420 1.00 10.00 ? 20   SER A CB  1 
ATOM   165  O OG  . SER A 1 22  ? 15.648  10.900 29.494 1.00 9.11  ? 20   SER A OG  1 
ATOM   166  N N   . LYS A 1 23  ? 16.129  8.678  27.227 1.00 8.31  ? 21   LYS A N   1 
ATOM   167  C CA  . LYS A 1 23  ? 17.277  7.786  27.144 1.00 8.98  ? 21   LYS A CA  1 
ATOM   168  C C   . LYS A 1 23  ? 18.386  8.167  28.089 1.00 8.29  ? 21   LYS A C   1 
ATOM   169  O O   . LYS A 1 23  ? 19.342  7.398  28.239 1.00 8.49  ? 21   LYS A O   1 
ATOM   170  C CB  . LYS A 1 23  ? 17.778  7.735  25.726 1.00 11.91 ? 21   LYS A CB  1 
ATOM   171  C CG  . LYS A 1 23  ? 16.732  7.390  24.683 1.00 17.64 ? 21   LYS A CG  1 
ATOM   172  C CD  . LYS A 1 23  ? 17.257  6.387  23.687 1.00 21.63 ? 21   LYS A CD  1 
ATOM   173  C CE  . LYS A 1 23  ? 16.140  5.801  22.823 1.00 24.58 ? 21   LYS A CE  1 
ATOM   174  N NZ  . LYS A 1 23  ? 15.827  6.698  21.662 1.00 30.67 ? 21   LYS A NZ  1 
ATOM   175  N N   . GLU A 1 24  ? 18.251  9.309  28.751 1.00 7.22  ? 22   GLU A N   1 
ATOM   176  C CA  . GLU A 1 24  ? 19.391  9.782  29.613 1.00 7.36  ? 22   GLU A CA  1 
ATOM   177  C C   . GLU A 1 24  ? 19.620  8.840  30.783 1.00 6.91  ? 22   GLU A C   1 
ATOM   178  O O   . GLU A 1 24  ? 20.703  8.296  30.951 1.00 7.02  ? 22   GLU A O   1 
ATOM   179  C CB  . GLU A 1 24  ? 19.150  11.262 30.041 1.00 7.56  ? 22   GLU A CB  1 
ATOM   180  C CG  . GLU A 1 24  ? 19.432  12.185 28.880 1.00 12.97 ? 22   GLU A CG  1 
ATOM   181  C CD  . GLU A 1 24  ? 20.941  12.357 28.617 1.00 14.51 ? 22   GLU A CD  1 
ATOM   182  O OE1 . GLU A 1 24  ? 21.771  11.904 29.477 1.00 19.44 ? 22   GLU A OE1 1 
ATOM   183  O OE2 . GLU A 1 24  ? 21.338  12.988 27.612 1.00 20.83 ? 22   GLU A OE2 1 
ATOM   184  N N   . TRP A 1 25  ? 18.631  8.643  31.660 1.00 6.08  ? 23   TRP A N   1 
ATOM   185  C CA  . TRP A 1 25  ? 18.824  7.754  32.770 1.00 6.20  ? 23   TRP A CA  1 
ATOM   186  C C   . TRP A 1 25  ? 19.191  6.349  32.292 1.00 8.10  ? 23   TRP A C   1 
ATOM   187  O O   . TRP A 1 25  ? 19.929  5.603  32.950 1.00 8.52  ? 23   TRP A O   1 
ATOM   188  C CB  . TRP A 1 25  ? 17.626  7.682  33.727 1.00 6.27  ? 23   TRP A CB  1 
ATOM   189  C CG  . TRP A 1 25  ? 16.327  7.263  33.130 1.00 5.93  ? 23   TRP A CG  1 
ATOM   190  C CD1 . TRP A 1 25  ? 15.330  8.045  32.534 1.00 6.22  ? 23   TRP A CD1 1 
ATOM   191  C CD2 . TRP A 1 25  ? 15.871  5.859  33.012 1.00 7.03  ? 23   TRP A CD2 1 
ATOM   192  N NE1 . TRP A 1 25  ? 14.318  7.214  32.145 1.00 6.92  ? 23   TRP A NE1 1 
ATOM   193  C CE2 . TRP A 1 25  ? 14.599  5.915  32.428 1.00 7.04  ? 23   TRP A CE2 1 
ATOM   194  C CE3 . TRP A 1 25  ? 16.362  4.627  33.437 1.00 7.38  ? 23   TRP A CE3 1 
ATOM   195  C CZ2 . TRP A 1 25  ? 13.856  4.760  32.163 1.00 8.88  ? 23   TRP A CZ2 1 
ATOM   196  C CZ3 . TRP A 1 25  ? 15.630  3.484  33.167 1.00 8.44  ? 23   TRP A CZ3 1 
ATOM   197  C CH2 . TRP A 1 25  ? 14.398  3.548  32.579 1.00 8.69  ? 23   TRP A CH2 1 
ATOM   198  N N   . MET A 1 26  ? 18.647  5.936  31.150 1.00 7.77  ? 24   MET A N   1 
ATOM   199  C CA  . MET A 1 26  ? 18.916  4.596  30.604 1.00 8.54  ? 24   MET A CA  1 
ATOM   200  C C   . MET A 1 26  ? 20.387  4.350  30.235 1.00 8.71  ? 24   MET A C   1 
ATOM   201  O O   . MET A 1 26  ? 20.830  3.209  30.159 1.00 11.19 ? 24   MET A O   1 
ATOM   202  C CB  . MET A 1 26  ? 18.024  4.410  29.387 1.00 8.92  ? 24   MET A CB  1 
ATOM   203  C CG  . MET A 1 26  ? 16.518  4.353  29.644 1.00 12.17 ? 24   MET A CG  1 
ATOM   204  S SD  . MET A 1 26  ? 15.637  4.099  28.085 1.00 15.65 ? 24   MET A SD  1 
ATOM   205  C CE  . MET A 1 26  ? 14.016  4.658  28.477 1.00 24.52 ? 24   MET A CE  1 
ATOM   206  N N   . SER A 1 27  ? 21.085  5.435  29.969 1.00 8.99  ? 25   SER A N   1 
ATOM   207  C CA  . SER A 1 27  ? 22.467  5.382  29.598 1.00 8.60  ? 25   SER A CA  1 
ATOM   208  C C   . SER A 1 27  ? 23.399  5.317  30.797 1.00 9.09  ? 25   SER A C   1 
ATOM   209  O O   . SER A 1 27  ? 24.633  5.067  30.641 1.00 12.15 ? 25   SER A O   1 
ATOM   210  C CB  . SER A 1 27  ? 22.842  6.596  28.744 1.00 10.43 ? 25   SER A CB  1 
ATOM   211  O OG  . SER A 1 27  ? 22.939  7.801  29.498 1.00 9.95  ? 25   SER A OG  1 
ATOM   212  N N   . ASN A 1 28  ? 22.847  5.420  32.002 1.00 8.69  ? 26   ASN A N   1 
ATOM   213  C CA  . ASN A 1 28  ? 23.667  5.457  33.187 1.00 9.89  ? 26   ASN A CA  1 
ATOM   214  C C   . ASN A 1 28  ? 23.926  4.059  33.696 1.00 9.96  ? 26   ASN A C   1 
ATOM   215  O O   . ASN A 1 28  ? 23.037  3.205  33.582 1.00 11.74 ? 26   ASN A O   1 
ATOM   216  C CB  . ASN A 1 28  ? 22.950  6.270  34.265 1.00 11.67 ? 26   ASN A CB  1 
ATOM   217  C CG  . ASN A 1 28  ? 23.876  6.758  35.371 1.00 11.60 ? 26   ASN A CG  1 
ATOM   218  O OD1 . ASN A 1 28  ? 24.316  5.983  36.203 1.00 11.54 ? 26   ASN A OD1 1 
ATOM   219  N ND2 . ASN A 1 28  ? 24.128  8.065  35.380 1.00 11.74 ? 26   ASN A ND2 1 
ATOM   220  N N   . LEU A 1 29  ? 25.121  3.846  34.236 1.00 10.23 ? 27   LEU A N   1 
ATOM   221  C CA  . LEU A 1 29  ? 25.449  2.552  34.828 1.00 10.40 ? 27   LEU A CA  1 
ATOM   222  C C   . LEU A 1 29  ? 24.639  2.232  36.045 1.00 9.99  ? 27   LEU A C   1 
ATOM   223  O O   . LEU A 1 29  ? 24.590  1.090  36.452 1.00 10.16 ? 27   LEU A O   1 
ATOM   224  C CB  . LEU A 1 29  ? 26.956  2.485  35.209 1.00 12.45 ? 27   LEU A CB  1 
ATOM   225  C CG  . LEU A 1 29  ? 27.863  2.488  33.980 1.00 16.10 ? 27   LEU A CG  1 
ATOM   226  C CD1 . LEU A 1 29  ? 29.337  2.430  34.386 1.00 18.66 ? 27   LEU A CD1 1 
ATOM   227  C CD2 . LEU A 1 29  ? 27.532  1.350  32.986 1.00 16.80 ? 27   LEU A CD2 1 
ATOM   228  N N   . ARG A 1 30  ? 23.978  3.229  36.633 1.00 8.75  ? 28   ARG A N   1 
ATOM   229  C CA  . ARG A 1 30  ? 23.064  3.098  37.770 1.00 8.54  ? 28   ARG A CA  1 
ATOM   230  C C   . ARG A 1 30  ? 21.675  3.639  37.349 1.00 7.28  ? 28   ARG A C   1 
ATOM   231  O O   . ARG A 1 30  ? 21.290  4.741  37.701 1.00 7.09  ? 28   ARG A O   1 
ATOM   232  C CB  . ARG A 1 30  ? 23.589  3.850  38.983 1.00 10.62 ? 28   ARG A CB  1 
ATOM   233  C CG  . ARG A 1 30  ? 24.999  3.304  39.325 1.00 12.74 ? 28   ARG A CG  1 
ATOM   234  C CD  . ARG A 1 30  ? 25.294  3.403  40.755 1.00 14.64 ? 28   ARG A CD  1 
ATOM   235  N NE  . ARG A 1 30  ? 26.677  3.181  41.098 1.00 16.00 ? 28   ARG A NE  1 
ATOM   236  C CZ  . ARG A 1 30  ? 27.308  2.023  41.163 1.00 16.08 ? 28   ARG A CZ  1 
ATOM   237  N NH1 . ARG A 1 30  ? 26.724  0.837  40.864 1.00 18.36 ? 28   ARG A NH1 1 
ATOM   238  N NH2 . ARG A 1 30  ? 28.518  2.071  41.664 1.00 19.78 ? 28   ARG A NH2 1 
ATOM   239  N N   . PRO A 1 31  ? 20.947  2.878  36.530 1.00 7.05  ? 29   PRO A N   1 
ATOM   240  C CA  . PRO A 1 31  ? 19.788  3.454  35.883 1.00 7.95  ? 29   PRO A CA  1 
ATOM   241  C C   . PRO A 1 31  ? 18.647  3.838  36.828 1.00 7.26  ? 29   PRO A C   1 
ATOM   242  O O   . PRO A 1 31  ? 17.993  4.862  36.633 1.00 7.42  ? 29   PRO A O   1 
ATOM   243  C CB  . PRO A 1 31  ? 19.364  2.419  34.883 1.00 10.21 ? 29   PRO A CB  1 
ATOM   244  C CG  . PRO A 1 31  ? 19.994  1.121  35.396 1.00 10.40 ? 29   PRO A CG  1 
ATOM   245  C CD  . PRO A 1 31  ? 21.276  1.535  36.001 1.00 8.31  ? 29   PRO A CD  1 
ATOM   246  N N   . LEU A 1 32  ? 18.375  3.031  37.832 1.00 6.85  ? 30   LEU A N   1 
ATOM   247  C CA  . LEU A 1 32  ? 17.270  3.423  38.760 1.00 7.29  ? 30   LEU A CA  1 
ATOM   248  C C   . LEU A 1 32  ? 17.610  4.736  39.478 1.00 6.54  ? 30   LEU A C   1 
ATOM   249  O O   . LEU A 1 32  ? 16.762  5.649  39.551 1.00 6.45  ? 30   LEU A O   1 
ATOM   250  C CB  . LEU A 1 32  ? 16.981  2.266  39.766 1.00 6.45  ? 30   LEU A CB  1 
ATOM   251  C CG  . LEU A 1 32  ? 16.039  2.691  40.878 1.00 8.37  ? 30   LEU A CG  1 
ATOM   252  C CD1 . LEU A 1 32  ? 14.663  3.138  40.370 1.00 9.73  ? 30   LEU A CD1 1 
ATOM   253  C CD2 . LEU A 1 32  ? 15.889  1.563  41.905 1.00 10.17 ? 30   LEU A CD2 1 
ATOM   254  N N   . GLU A 1 33  ? 18.811  4.811  39.992 1.00 6.62  ? 31   GLU A N   1 
ATOM   255  C CA  . GLU A 1 33  ? 19.252  5.988  40.712 1.00 5.99  ? 31   GLU A CA  1 
ATOM   256  C C   . GLU A 1 33  ? 19.186  7.219  39.776 1.00 6.26  ? 31   GLU A C   1 
ATOM   257  O O   . GLU A 1 33  ? 18.728  8.285  40.146 1.00 6.50  ? 31   GLU A O   1 
ATOM   258  C CB  . GLU A 1 33  ? 20.647  5.835  41.246 1.00 8.35  ? 31   GLU A CB  1 
ATOM   259  C CG  . GLU A 1 33  ? 20.894  4.799  42.349 1.00 10.31 ? 31   GLU A CG  1 
ATOM   260  C CD  . GLU A 1 33  ? 21.049  3.351  41.886 1.00 11.12 ? 31   GLU A CD  1 
ATOM   261  O OE1 . GLU A 1 33  ? 20.754  2.997  40.752 1.00 10.70 ? 31   GLU A OE1 1 
ATOM   262  O OE2 . GLU A 1 33  ? 21.583  2.541  42.681 1.00 13.07 ? 31   GLU A OE2 1 
ATOM   263  N N   . ALA A 1 34  ? 19.711  7.054  38.581 1.00 6.67  ? 32   ALA A N   1 
ATOM   264  C CA  . ALA A 1 34  ? 19.681  8.105  37.607 1.00 5.52  ? 32   ALA A CA  1 
ATOM   265  C C   . ALA A 1 34  ? 18.290  8.484  37.217 1.00 5.46  ? 32   ALA A C   1 
ATOM   266  O O   . ALA A 1 34  ? 18.008  9.696  37.046 1.00 5.83  ? 32   ALA A O   1 
ATOM   267  C CB  . ALA A 1 34  ? 20.501  7.744  36.380 1.00 7.91  ? 32   ALA A CB  1 
ATOM   268  N N   . ARG A 1 35  ? 17.371  7.569  37.107 1.00 5.48  ? 33   ARG A N   1 
ATOM   269  C CA  . ARG A 1 35  ? 15.981  7.865  36.738 1.00 5.99  ? 33   ARG A CA  1 
ATOM   270  C C   . ARG A 1 35  ? 15.330  8.681  37.847 1.00 5.62  ? 33   ARG A C   1 
ATOM   271  O O   . ARG A 1 35  ? 14.593  9.644  37.561 1.00 5.53  ? 33   ARG A O   1 
ATOM   272  C CB  . ARG A 1 35  ? 15.200  6.582  36.516 1.00 6.54  ? 33   ARG A CB  1 
ATOM   273  C CG  . ARG A 1 35  ? 13.808  6.753  35.994 1.00 6.77  ? 33   ARG A CG  1 
ATOM   274  C CD  . ARG A 1 35  ? 13.147  5.471  35.608 1.00 6.84  ? 33   ARG A CD  1 
ATOM   275  N NE  . ARG A 1 35  ? 11.808  5.715  35.087 1.00 6.98  ? 33   ARG A NE  1 
ATOM   276  C CZ  . ARG A 1 35  ? 10.960  4.728  34.756 1.00 7.82  ? 33   ARG A CZ  1 
ATOM   277  N NH1 . ARG A 1 35  ? 11.370  3.460  34.912 1.00 9.47  ? 33   ARG A NH1 1 
ATOM   278  N NH2 . ARG A 1 35  ? 9.706   4.994  34.346 1.00 9.30  ? 33   ARG A NH2 1 
ATOM   279  N N   . ILE A 1 36  ? 15.573  8.296  39.118 1.00 6.49  ? 34   ILE A N   1 
ATOM   280  C CA  . ILE A 1 36  ? 15.042  9.073  40.200 1.00 6.70  ? 34   ILE A CA  1 
ATOM   281  C C   . ILE A 1 36  ? 15.562  10.459 40.203 1.00 5.71  ? 34   ILE A C   1 
ATOM   282  O O   . ILE A 1 36  ? 14.792  11.408 40.326 1.00 5.94  ? 34   ILE A O   1 
ATOM   283  C CB  . ILE A 1 36  ? 15.288  8.360  41.558 1.00 6.98  ? 34   ILE A CB  1 
ATOM   284  C CG1 . ILE A 1 36  ? 14.468  7.030  41.604 1.00 6.96  ? 34   ILE A CG1 1 
ATOM   285  C CG2 . ILE A 1 36  ? 14.882  9.264  42.723 1.00 8.45  ? 34   ILE A CG2 1 
ATOM   286  C CD1 . ILE A 1 36  ? 14.808  6.087  42.735 1.00 9.78  ? 34   ILE A CD1 1 
ATOM   287  N N   . VAL A 1 37  ? 16.867  10.638 40.093 1.00 5.74  ? 35   VAL A N   1 
ATOM   288  C CA  . VAL A 1 37  ? 17.444  11.982 39.991 1.00 5.66  ? 35   VAL A CA  1 
ATOM   289  C C   . VAL A 1 37  ? 16.880  12.797 38.828 1.00 5.67  ? 35   VAL A C   1 
ATOM   290  O O   . VAL A 1 37  ? 16.592  13.985 38.990 1.00 5.82  ? 35   VAL A O   1 
ATOM   291  C CB  . VAL A 1 37  ? 18.976  11.964 40.014 1.00 5.90  ? 35   VAL A CB  1 
ATOM   292  C CG1 . VAL A 1 37  ? 19.554  13.350 39.730 1.00 8.75  ? 35   VAL A CG1 1 
ATOM   293  C CG2 . VAL A 1 37  ? 19.468  11.451 41.360 1.00 8.60  ? 35   VAL A CG2 1 
ATOM   294  N N   . GLU A 1 38  ? 16.659  12.136 37.704 1.00 5.73  ? 36   GLU A N   1 
ATOM   295  C CA  . GLU A 1 38  ? 16.122  12.863 36.505 1.00 4.51  ? 36   GLU A CA  1 
ATOM   296  C C   . GLU A 1 38  ? 14.692  13.289 36.763 1.00 5.14  ? 36   GLU A C   1 
ATOM   297  O O   . GLU A 1 38  ? 14.277  14.388 36.399 1.00 5.11  ? 36   GLU A O   1 
ATOM   298  C CB  . GLU A 1 38  ? 16.252  11.972 35.265 1.00 5.53  ? 36   GLU A CB  1 
ATOM   299  C CG  . GLU A 1 38  ? 16.037  12.720 33.957 1.00 6.57  ? 36   GLU A CG  1 
ATOM   300  C CD  . GLU A 1 38  ? 16.304  11.885 32.735 1.00 7.58  ? 36   GLU A CD  1 
ATOM   301  O OE1 . GLU A 1 38  ? 16.980  10.848 32.810 1.00 6.72  ? 36   GLU A OE1 1 
ATOM   302  O OE2 . GLU A 1 38  ? 15.748  12.262 31.669 1.00 8.75  ? 36   GLU A OE2 1 
ATOM   303  N N   . CYS A 1 39  ? 13.934  12.453 37.440 1.00 5.19  ? 37   CYS A N   1 
ATOM   304  C CA  . CYS A 1 39  ? 12.592  12.827 37.827 1.00 5.50  ? 37   CYS A CA  1 
ATOM   305  C C   . CYS A 1 39  ? 12.568  13.918 38.867 1.00 5.30  ? 37   CYS A C   1 
ATOM   306  O O   . CYS A 1 39  ? 11.700  14.782 38.861 1.00 5.42  ? 37   CYS A O   1 
ATOM   307  C CB  . CYS A 1 39  ? 11.779  11.650 38.356 1.00 4.84  ? 37   CYS A CB  1 
ATOM   308  S SG  . CYS A 1 39  ? 11.319  10.392 37.130 1.00 6.64  ? 37   CYS A SG  1 
ATOM   309  N N   . ILE A 1 40  ? 13.534  13.940 39.778 1.00 4.42  ? 38   ILE A N   1 
ATOM   310  C CA  . ILE A 1 40  ? 13.704  15.043 40.729 1.00 5.75  ? 38   ILE A CA  1 
ATOM   311  C C   . ILE A 1 40  ? 13.959  16.329 39.952 1.00 5.54  ? 38   ILE A C   1 
ATOM   312  O O   . ILE A 1 40  ? 13.361  17.375 40.240 1.00 5.39  ? 38   ILE A O   1 
ATOM   313  C CB  . ILE A 1 40  ? 14.818  14.745 41.747 1.00 5.46  ? 38   ILE A CB  1 
ATOM   314  C CG1 . ILE A 1 40  ? 14.390  13.601 42.727 1.00 5.05  ? 38   ILE A CG1 1 
ATOM   315  C CG2 . ILE A 1 40  ? 15.159  16.015 42.570 1.00 8.68  ? 38   ILE A CG2 1 
ATOM   316  C CD1 . ILE A 1 40  ? 15.495  13.150 43.659 1.00 6.20  ? 38   ILE A CD1 1 
ATOM   317  N N   . LYS A 1 41  ? 14.898  16.277 38.981 1.00 5.12  ? 39   LYS A N   1 
ATOM   318  C CA  . LYS A 1 41  ? 15.202  17.439 38.164 1.00 5.84  ? 39   LYS A CA  1 
ATOM   319  C C   . LYS A 1 41  ? 13.960  17.961 37.457 1.00 4.72  ? 39   LYS A C   1 
ATOM   320  O O   . LYS A 1 41  ? 13.702  19.158 37.456 1.00 5.18  ? 39   LYS A O   1 
ATOM   321  C CB  . LYS A 1 41  ? 16.257  17.065 37.173 1.00 6.21  ? 39   LYS A CB  1 
ATOM   322  C CG  . LYS A 1 41  ? 16.658  18.188 36.212 1.00 6.77  ? 39   LYS A CG  1 
ATOM   323  C CD  . LYS A 1 41  ? 17.686  17.666 35.239 1.00 9.26  ? 39   LYS A CD  1 
ATOM   324  C CE  . LYS A 1 41  ? 17.976  18.611 34.110 1.00 8.92  ? 39   LYS A CE  1 
ATOM   325  N NZ  . LYS A 1 41  ? 19.172  18.076 33.332 1.00 12.80 ? 39   LYS A NZ  1 
ATOM   326  N N   . TYR A 1 42  ? 13.159  17.097 36.864 1.00 4.95  ? 40   TYR A N   1 
ATOM   327  C CA  . TYR A 1 42  ? 11.948  17.492 36.186 1.00 4.52  ? 40   TYR A CA  1 
ATOM   328  C C   . TYR A 1 42  ? 10.974  18.148 37.136 1.00 4.27  ? 40   TYR A C   1 
ATOM   329  O O   . TYR A 1 42  ? 10.330  19.167 36.828 1.00 5.37  ? 40   TYR A O   1 
ATOM   330  C CB  . TYR A 1 42  ? 11.341  16.373 35.401 1.00 5.36  ? 40   TYR A CB  1 
ATOM   331  C CG  . TYR A 1 42  ? 10.211  16.780 34.506 1.00 6.90  ? 40   TYR A CG  1 
ATOM   332  C CD1 . TYR A 1 42  ? 10.485  17.487 33.325 1.00 6.23  ? 40   TYR A CD1 1 
ATOM   333  C CD2 . TYR A 1 42  ? 8.884   16.552 34.839 1.00 5.71  ? 40   TYR A CD2 1 
ATOM   334  C CE1 . TYR A 1 42  ? 9.496   17.899 32.462 1.00 5.73  ? 40   TYR A CE1 1 
ATOM   335  C CE2 . TYR A 1 42  ? 7.856   16.960 33.976 1.00 6.52  ? 40   TYR A CE2 1 
ATOM   336  C CZ  . TYR A 1 42  ? 8.159   17.588 32.790 1.00 5.95  ? 40   TYR A CZ  1 
ATOM   337  O OH  . TYR A 1 42  ? 7.154   18.002 31.934 1.00 7.12  ? 40   TYR A OH  1 
ATOM   338  N N   . THR A 1 43  ? 10.772  17.507 38.265 1.00 4.87  ? 41   THR A N   1 
ATOM   339  C CA  . THR A 1 43  ? 9.874   18.001 39.289 1.00 5.61  ? 41   THR A CA  1 
ATOM   340  C C   . THR A 1 43  ? 10.315  19.388 39.763 1.00 5.71  ? 41   THR A C   1 
ATOM   341  O O   . THR A 1 43  ? 9.476   20.291 39.996 1.00 5.82  ? 41   THR A O   1 
ATOM   342  C CB  . THR A 1 43  ? 9.717   17.024 40.483 1.00 5.14  ? 41   THR A CB  1 
ATOM   343  O OG1 . THR A 1 43  ? 9.346   15.740 39.992 1.00 5.69  ? 41   THR A OG1 1 
ATOM   344  C CG2 . THR A 1 43  ? 8.617   17.507 41.414 1.00 6.23  ? 41   THR A CG2 1 
ATOM   345  N N   . VAL A 1 44  ? 11.607  19.635 39.898 1.00 5.15  ? 42   VAL A N   1 
ATOM   346  C CA  . VAL A 1 44  ? 12.129  20.931 40.256 1.00 5.75  ? 42   VAL A CA  1 
ATOM   347  C C   . VAL A 1 44  ? 11.751  21.948 39.169 1.00 5.09  ? 42   VAL A C   1 
ATOM   348  O O   . VAL A 1 44  ? 11.284  23.035 39.477 1.00 6.11  ? 42   VAL A O   1 
ATOM   349  C CB  . VAL A 1 44  ? 13.641  20.876 40.527 1.00 5.32  ? 42   VAL A CB  1 
ATOM   350  C CG1 . VAL A 1 44  ? 14.211  22.325 40.515 1.00 6.30  ? 42   VAL A CG1 1 
ATOM   351  C CG2 . VAL A 1 44  ? 13.906  20.177 41.841 1.00 7.16  ? 42   VAL A CG2 1 
ATOM   352  N N   . CYS A 1 45  ? 11.883  21.595 37.886 1.00 4.96  ? 43   CYS A N   1 
ATOM   353  C CA  . CYS A 1 45  ? 11.475  22.484 36.813 1.00 5.37  ? 43   CYS A CA  1 
ATOM   354  C C   . CYS A 1 45  ? 9.977   22.817 36.962 1.00 6.16  ? 43   CYS A C   1 
ATOM   355  O O   . CYS A 1 45  ? 9.570   23.957 36.736 1.00 6.46  ? 43   CYS A O   1 
ATOM   356  C CB  . CYS A 1 45  ? 11.682  21.835 35.436 1.00 5.69  ? 43   CYS A CB  1 
ATOM   357  S SG  . CYS A 1 45  ? 13.404  21.580 34.963 1.00 6.95  ? 43   CYS A SG  1 
HETATM 358  N N   . CME A 1 46  ? 9.163   21.805 37.282 1.00 6.41  ? 44   CME A N   1 
HETATM 359  C CA  . CME A 1 46  ? 7.708   22.058 37.451 1.00 6.80  ? 44   CME A CA  1 
HETATM 360  C CB  . CME A 1 46  ? 7.044   20.718 37.655 1.00 8.68  ? 44   CME A CB  1 
HETATM 361  S SG  . CME A 1 46  ? 7.095   19.603 36.276 1.00 10.71 ? 44   CME A SG  1 
HETATM 362  S SD  . CME A 1 46  ? 5.662   20.239 35.019 1.00 16.49 ? 44   CME A SD  1 
HETATM 363  C CE  . CME A 1 46  ? 4.095   19.426 35.497 1.00 15.83 ? 44   CME A CE  1 
HETATM 364  C CZ  . CME A 1 46  ? 4.287   17.949 35.890 1.00 15.96 ? 44   CME A CZ  1 
HETATM 365  O OH  . CME A 1 46  ? 3.067   17.284 36.175 1.00 19.47 ? 44   CME A OH  1 
HETATM 366  C C   . CME A 1 46  ? 7.464   23.001 38.608 1.00 7.36  ? 44   CME A C   1 
HETATM 367  O O   . CME A 1 46  ? 6.594   23.870 38.513 1.00 7.88  ? 44   CME A O   1 
ATOM   368  N N   . HIS A 1 47  ? 8.196   22.848 39.721 1.00 5.57  ? 45   HIS A N   1 
ATOM   369  C CA  . HIS A 1 47  ? 7.986   23.763 40.870 1.00 7.51  ? 45   HIS A CA  1 
ATOM   370  C C   . HIS A 1 47  ? 8.430   25.158 40.559 1.00 7.21  ? 45   HIS A C   1 
ATOM   371  O O   . HIS A 1 47  ? 7.803   26.137 40.981 1.00 9.36  ? 45   HIS A O   1 
ATOM   372  C CB  . HIS A 1 47  ? 8.655   23.248 42.164 1.00 7.42  ? 45   HIS A CB  1 
ATOM   373  C CG  . HIS A 1 47  ? 7.915   22.144 42.793 1.00 7.19  ? 45   HIS A CG  1 
ATOM   374  N ND1 . HIS A 1 47  ? 6.628   22.292 43.202 1.00 9.03  ? 45   HIS A ND1 1 
ATOM   375  C CD2 . HIS A 1 47  ? 8.266   20.801 43.056 1.00 8.38  ? 45   HIS A CD2 1 
ATOM   376  C CE1 . HIS A 1 47  ? 6.227   21.109 43.729 1.00 8.75  ? 45   HIS A CE1 1 
ATOM   377  N NE2 . HIS A 1 47  ? 7.244   20.226 43.666 1.00 10.23 ? 45   HIS A NE2 1 
ATOM   378  N N   . ILE A 1 48  ? 9.490   25.325 39.779 1.00 7.04  ? 46   ILE A N   1 
ATOM   379  C CA  . ILE A 1 48  ? 9.945   26.657 39.389 1.00 7.07  ? 46   ILE A CA  1 
ATOM   380  C C   . ILE A 1 48  ? 8.856   27.337 38.556 1.00 6.71  ? 46   ILE A C   1 
ATOM   381  O O   . ILE A 1 48  ? 8.635   28.571 38.704 1.00 6.63  ? 46   ILE A O   1 
ATOM   382  C CB  . ILE A 1 48  ? 11.240  26.579 38.577 1.00 7.54  ? 46   ILE A CB  1 
ATOM   383  C CG1 . ILE A 1 48  ? 12.419  26.149 39.461 1.00 7.05  ? 46   ILE A CG1 1 
ATOM   384  C CG2 . ILE A 1 48  ? 11.598  27.849 37.830 1.00 8.60  ? 46   ILE A CG2 1 
ATOM   385  C CD1 . ILE A 1 48  ? 13.714  25.753 38.755 1.00 7.72  ? 46   ILE A CD1 1 
ATOM   386  N N   A SER A 1 49  ? 8.201   26.591 37.677 0.70 7.17  ? 47   SER A N   1 
ATOM   387  N N   B SER A 1 49  ? 8.220   26.594 37.650 0.30 7.37  ? 47   SER A N   1 
ATOM   388  C CA  A SER A 1 49  ? 7.284   27.170 36.716 0.70 7.91  ? 47   SER A CA  1 
ATOM   389  C CA  B SER A 1 49  ? 7.240   27.157 36.720 0.30 8.15  ? 47   SER A CA  1 
ATOM   390  C C   A SER A 1 49  ? 5.822   27.236 37.146 0.70 9.52  ? 47   SER A C   1 
ATOM   391  C C   B SER A 1 49  ? 5.864   27.363 37.331 0.30 9.39  ? 47   SER A C   1 
ATOM   392  O O   A SER A 1 49  ? 5.081   28.050 36.590 0.70 12.51 ? 47   SER A O   1 
ATOM   393  O O   B SER A 1 49  ? 5.251   28.431 37.170 0.30 11.05 ? 47   SER A O   1 
ATOM   394  C CB  A SER A 1 49  ? 7.439   26.412 35.380 0.70 10.00 ? 47   SER A CB  1 
ATOM   395  C CB  B SER A 1 49  ? 7.082   26.236 35.505 0.30 8.21  ? 47   SER A CB  1 
ATOM   396  O OG  A SER A 1 49  ? 7.291   25.049 35.507 0.70 11.64 ? 47   SER A OG  1 
ATOM   397  O OG  B SER A 1 49  ? 6.053   26.748 34.651 0.30 9.33  ? 47   SER A OG  1 
ATOM   398  N N   . ASP A 1 50  ? 5.399   26.318 38.013 1.00 11.31 ? 48   ASP A N   1 
ATOM   399  C CA  . ASP A 1 50  ? 4.005   26.141 38.514 1.00 17.66 ? 48   ASP A CA  1 
ATOM   400  C C   . ASP A 1 50  ? 3.231   27.398 38.791 1.00 13.95 ? 48   ASP A C   1 
ATOM   401  O O   . ASP A 1 50  ? 3.474   28.005 39.809 1.00 20.22 ? 48   ASP A O   1 
ATOM   402  C CB  . ASP A 1 50  ? 4.036   25.327 39.821 1.00 19.84 ? 48   ASP A CB  1 
ATOM   403  C CG  . ASP A 1 50  ? 2.635   24.914 40.377 1.00 20.63 ? 48   ASP A CG  1 
ATOM   404  O OD1 . ASP A 1 50  ? 1.584   24.871 39.654 1.00 29.79 ? 48   ASP A OD1 1 
ATOM   405  O OD2 . ASP A 1 50  ? 2.596   24.488 41.569 1.00 28.20 ? 48   ASP A OD2 1 
ATOM   406  N N   . MET A 1 51  ? 2.295   27.787 37.916 1.00 18.35 ? 49   MET A N   1 
ATOM   407  C CA  . MET A 1 51  ? 1.347   28.925 38.142 1.00 17.17 ? 49   MET A CA  1 
ATOM   408  C C   . MET A 1 51  ? 2.085   30.259 38.250 1.00 17.27 ? 49   MET A C   1 
ATOM   409  O O   . MET A 1 51  ? 1.488   31.272 38.607 1.00 19.98 ? 49   MET A O   1 
ATOM   410  C CB  . MET A 1 51  ? 0.453   28.687 39.353 1.00 22.04 ? 49   MET A CB  1 
ATOM   411  C CG  . MET A 1 51  ? -0.489  27.499 39.184 1.00 23.49 ? 49   MET A CG  1 
ATOM   412  S SD  . MET A 1 51  ? -1.493  27.014 40.633 1.00 46.86 ? 49   MET A SD  1 
ATOM   413  C CE  . MET A 1 51  ? -0.338  26.556 41.953 1.00 34.97 ? 49   MET A CE  1 
ATOM   414  N N   . HIS A 1 52  ? 3.367   30.336 37.890 1.00 14.09 ? 50   HIS A N   1 
ATOM   415  C CA  . HIS A 1 52  ? 4.072   31.624 37.888 1.00 13.84 ? 50   HIS A CA  1 
ATOM   416  C C   . HIS A 1 52  ? 3.803   32.293 36.552 1.00 11.03 ? 50   HIS A C   1 
ATOM   417  O O   . HIS A 1 52  ? 4.034   31.696 35.509 1.00 14.63 ? 50   HIS A O   1 
ATOM   418  C CB  . HIS A 1 52  ? 5.585   31.440 38.087 1.00 16.35 ? 50   HIS A CB  1 
ATOM   419  C CG  . HIS A 1 52  ? 5.923   31.137 39.472 1.00 18.22 ? 50   HIS A CG  1 
ATOM   420  N ND1 . HIS A 1 52  ? 5.957   32.089 40.445 1.00 23.97 ? 50   HIS A ND1 1 
ATOM   421  C CD2 . HIS A 1 52  ? 6.115   29.922 40.094 1.00 15.45 ? 50   HIS A CD2 1 
ATOM   422  C CE1 . HIS A 1 52  ? 6.187   31.458 41.638 1.00 21.98 ? 50   HIS A CE1 1 
ATOM   423  N NE2 . HIS A 1 52  ? 6.216   30.148 41.425 1.00 13.90 ? 50   HIS A NE2 1 
ATOM   424  N N   . LEU A 1 53  ? 3.318   33.530 36.579 1.00 13.54 ? 51   LEU A N   1 
ATOM   425  C CA  . LEU A 1 53  ? 2.888   34.244 35.360 1.00 13.63 ? 51   LEU A CA  1 
ATOM   426  C C   . LEU A 1 53  ? 3.769   35.450 35.111 1.00 13.72 ? 51   LEU A C   1 
ATOM   427  O O   . LEU A 1 53  ? 4.348   36.054 36.051 1.00 15.83 ? 51   LEU A O   1 
ATOM   428  C CB  . LEU A 1 53  ? 1.423   34.705 35.454 1.00 17.29 ? 51   LEU A CB  1 
ATOM   429  C CG  . LEU A 1 53  ? 0.295   33.688 35.707 1.00 19.67 ? 51   LEU A CG  1 
ATOM   430  C CD1 . LEU A 1 53  ? -0.994  34.495 35.877 1.00 22.98 ? 51   LEU A CD1 1 
ATOM   431  C CD2 . LEU A 1 53  ? 0.170   32.583 34.660 1.00 22.80 ? 51   LEU A CD2 1 
ATOM   432  N N   . HIS A 1 54  ? 3.860   35.808 33.854 1.00 11.41 ? 52   HIS A N   1 
ATOM   433  C CA  . HIS A 1 54  ? 4.466   37.052 33.397 1.00 12.06 ? 52   HIS A CA  1 
ATOM   434  C C   . HIS A 1 54  ? 3.619   37.534 32.235 1.00 11.48 ? 52   HIS A C   1 
ATOM   435  O O   . HIS A 1 54  ? 3.348   36.768 31.339 1.00 9.61  ? 52   HIS A O   1 
ATOM   436  C CB  . HIS A 1 54  ? 5.939   36.827 32.937 1.00 12.00 ? 52   HIS A CB  1 
ATOM   437  C CG  . HIS A 1 54  ? 6.509   37.996 32.126 1.00 12.10 ? 52   HIS A CG  1 
ATOM   438  N ND1 . HIS A 1 54  ? 6.728   39.200 32.695 1.00 17.51 ? 52   HIS A ND1 1 
ATOM   439  C CD2 . HIS A 1 54  ? 6.876   38.083 30.816 1.00 15.03 ? 52   HIS A CD2 1 
ATOM   440  C CE1 . HIS A 1 54  ? 7.201   40.046 31.742 1.00 16.95 ? 52   HIS A CE1 1 
ATOM   441  N NE2 . HIS A 1 54  ? 7.290   39.375 30.589 1.00 17.66 ? 52   HIS A NE2 1 
ATOM   442  N N   . ASN A 1 55  ? 3.098   38.763 32.309 1.00 11.62 ? 53   ASN A N   1 
ATOM   443  C CA  . ASN A 1 55  ? 2.226   39.350 31.315 1.00 14.21 ? 53   ASN A CA  1 
ATOM   444  C C   . ASN A 1 55  ? 1.009   38.453 31.096 1.00 12.40 ? 53   ASN A C   1 
ATOM   445  O O   . ASN A 1 55  ? 0.545   38.271 29.958 1.00 13.13 ? 53   ASN A O   1 
ATOM   446  C CB  . ASN A 1 55  ? 3.003   39.559 30.022 1.00 13.72 ? 53   ASN A CB  1 
ATOM   447  C CG  . ASN A 1 55  ? 2.322   40.487 29.080 1.00 14.12 ? 53   ASN A CG  1 
ATOM   448  O OD1 . ASN A 1 55  ? 1.502   41.289 29.474 1.00 22.17 ? 53   ASN A OD1 1 
ATOM   449  N ND2 . ASN A 1 55  ? 2.646   40.367 27.830 1.00 17.76 ? 53   ASN A ND2 1 
ATOM   450  N N   . GLY A 1 56  ? 0.516   37.853 32.180 1.00 11.14 ? 54   GLY A N   1 
ATOM   451  C CA  . GLY A 1 56  ? -0.759  37.155 32.227 1.00 14.28 ? 54   GLY A CA  1 
ATOM   452  C C   . GLY A 1 56  ? -0.729  35.725 31.803 1.00 12.29 ? 54   GLY A C   1 
ATOM   453  O O   . GLY A 1 56  ? -1.749  35.066 31.837 1.00 14.03 ? 54   GLY A O   1 
ATOM   454  N N   . VAL A 1 57  ? 0.431   35.250 31.433 1.00 11.01 ? 55   VAL A N   1 
ATOM   455  C CA  . VAL A 1 57  ? 0.565   33.893 30.888 1.00 9.92  ? 55   VAL A CA  1 
ATOM   456  C C   . VAL A 1 57  ? 1.790   33.245 31.572 1.00 8.46  ? 55   VAL A C   1 
ATOM   457  O O   . VAL A 1 57  ? 2.554   33.951 32.265 1.00 8.74  ? 55   VAL A O   1 
ATOM   458  C CB  . VAL A 1 57  ? 0.718   33.889 29.359 1.00 9.14  ? 55   VAL A CB  1 
ATOM   459  C CG1 . VAL A 1 57  ? -0.514  34.457 28.721 1.00 11.47 ? 55   VAL A CG1 1 
ATOM   460  C CG2 . VAL A 1 57  ? 1.991   34.605 28.873 1.00 10.07 ? 55   VAL A CG2 1 
ATOM   461  N N   . PRO A 1 58  ? 1.984   31.900 31.406 1.00 8.57  ? 56   PRO A N   1 
ATOM   462  C CA  . PRO A 1 58  ? 3.106   31.281 32.141 1.00 9.27  ? 56   PRO A CA  1 
ATOM   463  C C   . PRO A 1 58  ? 4.424   32.020 31.845 1.00 7.91  ? 56   PRO A C   1 
ATOM   464  O O   . PRO A 1 58  ? 4.751   32.333 30.704 1.00 7.51  ? 56   PRO A O   1 
ATOM   465  C CB  . PRO A 1 58  ? 3.091   29.819 31.567 1.00 11.08 ? 56   PRO A CB  1 
ATOM   466  C CG  . PRO A 1 58  ? 1.638   29.544 31.347 1.00 10.45 ? 56   PRO A CG  1 
ATOM   467  C CD  . PRO A 1 58  ? 1.052   30.862 30.892 1.00 10.23 ? 56   PRO A CD  1 
ATOM   468  N N   . ARG A 1 59  ? 5.165   32.252 32.915 1.00 7.99  ? 57   ARG A N   1 
ATOM   469  C CA  . ARG A 1 59  ? 6.492   32.867 32.834 1.00 7.16  ? 57   ARG A CA  1 
ATOM   470  C C   . ARG A 1 59  ? 7.482   32.001 32.115 1.00 7.26  ? 57   ARG A C   1 
ATOM   471  O O   . ARG A 1 59  ? 8.407   32.485 31.500 1.00 7.98  ? 57   ARG A O   1 
ATOM   472  C CB  . ARG A 1 59  ? 6.951   33.260 34.204 1.00 8.11  ? 57   ARG A CB  1 
ATOM   473  C CG  . ARG A 1 59  ? 8.368   33.790 34.277 1.00 8.39  ? 57   ARG A CG  1 
ATOM   474  C CD  . ARG A 1 59  ? 8.647   34.220 35.700 1.00 8.53  ? 57   ARG A CD  1 
ATOM   475  N NE  . ARG A 1 59  ? 10.076  34.455 35.931 1.00 10.35 ? 57   ARG A NE  1 
ATOM   476  C CZ  . ARG A 1 59  ? 10.660  34.752 37.072 1.00 10.73 ? 57   ARG A CZ  1 
ATOM   477  N NH1 . ARG A 1 59  ? 9.966   34.752 38.172 1.00 12.77 ? 57   ARG A NH1 1 
ATOM   478  N NH2 . ARG A 1 59  ? 11.968  34.877 37.106 1.00 11.82 ? 57   ARG A NH2 1 
ATOM   479  N N   . TYR A 1 60  ? 7.344   30.695 32.261 1.00 6.65  ? 58   TYR A N   1 
ATOM   480  C CA  . TYR A 1 60  ? 8.331   29.741 31.809 1.00 7.94  ? 58   TYR A CA  1 
ATOM   481  C C   . TYR A 1 60  ? 7.818   28.835 30.745 1.00 7.34  ? 58   TYR A C   1 
ATOM   482  O O   . TYR A 1 60  ? 6.624   28.493 30.744 1.00 8.04  ? 58   TYR A O   1 
ATOM   483  C CB  . TYR A 1 60  ? 8.774   28.827 32.969 1.00 8.30  ? 58   TYR A CB  1 
ATOM   484  C CG  . TYR A 1 60  ? 9.528   29.571 34.038 1.00 6.53  ? 58   TYR A CG  1 
ATOM   485  C CD1 . TYR A 1 60  ? 10.909  29.790 33.972 1.00 6.16  ? 58   TYR A CD1 1 
ATOM   486  C CD2 . TYR A 1 60  ? 8.866   30.118 35.145 1.00 7.09  ? 58   TYR A CD2 1 
ATOM   487  C CE1 . TYR A 1 60  ? 11.592  30.456 34.979 1.00 6.33  ? 58   TYR A CE1 1 
ATOM   488  C CE2 . TYR A 1 60  ? 9.533   30.759 36.148 1.00 6.37  ? 58   TYR A CE2 1 
ATOM   489  C CZ  . TYR A 1 60  ? 10.906  30.926 36.079 1.00 6.79  ? 58   TYR A CZ  1 
ATOM   490  O OH  . TYR A 1 60  ? 11.523  31.611 37.127 1.00 6.41  ? 58   TYR A OH  1 
ATOM   491  N N   . ILE A 1 61  ? 8.685   28.481 29.817 1.00 7.43  ? 59   ILE A N   1 
ATOM   492  C CA  . ILE A 1 61  ? 8.516   27.336 28.919 1.00 7.90  ? 59   ILE A CA  1 
ATOM   493  C C   . ILE A 1 61  ? 9.438   26.240 29.389 1.00 7.24  ? 59   ILE A C   1 
ATOM   494  O O   . ILE A 1 61  ? 10.631  26.479 29.551 1.00 8.81  ? 59   ILE A O   1 
ATOM   495  C CB  . ILE A 1 61  ? 8.846   27.720 27.456 1.00 8.25  ? 59   ILE A CB  1 
ATOM   496  C CG1 . ILE A 1 61  ? 7.882   28.844 27.006 1.00 10.78 ? 59   ILE A CG1 1 
ATOM   497  C CG2 . ILE A 1 61  ? 8.752   26.515 26.556 1.00 11.89 ? 59   ILE A CG2 1 
ATOM   498  C CD1 . ILE A 1 61  ? 8.263   29.464 25.637 1.00 16.86 ? 59   ILE A CD1 1 
ATOM   499  N N   . VAL A 1 62  ? 8.924   25.064 29.669 1.00 6.49  ? 60   VAL A N   1 
ATOM   500  C CA  . VAL A 1 62  ? 9.748   23.950 30.080 1.00 6.14  ? 60   VAL A CA  1 
ATOM   501  C C   . VAL A 1 62  ? 10.162  23.185 28.882 1.00 6.77  ? 60   VAL A C   1 
ATOM   502  O O   . VAL A 1 62  ? 9.308   22.614 28.191 1.00 7.36  ? 60   VAL A O   1 
ATOM   503  C CB  . VAL A 1 62  ? 9.003   23.005 31.120 1.00 6.76  ? 60   VAL A CB  1 
ATOM   504  C CG1 . VAL A 1 62  ? 9.872   21.779 31.424 1.00 8.74  ? 60   VAL A CG1 1 
ATOM   505  C CG2 . VAL A 1 62  ? 8.642   23.745 32.419 1.00 7.93  ? 60   VAL A CG2 1 
ATOM   506  N N   . ASN A 1 63  ? 11.469  23.128 28.603 1.00 6.34  ? 61   ASN A N   1 
ATOM   507  C CA  . ASN A 1 63  ? 11.992  22.356 27.465 1.00 6.42  ? 61   ASN A CA  1 
ATOM   508  C C   . ASN A 1 63  ? 12.361  20.925 27.896 1.00 6.97  ? 61   ASN A C   1 
ATOM   509  O O   . ASN A 1 63  ? 12.475  20.056 27.033 1.00 6.57  ? 61   ASN A O   1 
ATOM   510  C CB  . ASN A 1 63  ? 13.270  23.033 26.905 1.00 6.49  ? 61   ASN A CB  1 
ATOM   511  C CG  . ASN A 1 63  ? 13.080  24.323 26.236 1.00 8.33  ? 61   ASN A CG  1 
ATOM   512  O OD1 . ASN A 1 63  ? 13.947  25.194 26.340 1.00 9.73  ? 61   ASN A OD1 1 
ATOM   513  N ND2 . ASN A 1 63  ? 11.958  24.495 25.554 1.00 6.41  ? 61   ASN A ND2 1 
ATOM   514  N N   . MET A 1 64  ? 12.655  20.648 29.159 1.00 5.76  ? 62   MET A N   1 
ATOM   515  C CA  . MET A 1 64  ? 13.035  19.321 29.547 1.00 6.25  ? 62   MET A CA  1 
ATOM   516  C C   . MET A 1 64  ? 11.980  18.320 29.163 1.00 5.57  ? 62   MET A C   1 
ATOM   517  O O   . MET A 1 64  ? 10.775  18.567 29.318 1.00 6.18  ? 62   MET A O   1 
ATOM   518  C CB  . MET A 1 64  ? 13.300  19.243 31.020 1.00 5.90  ? 62   MET A CB  1 
ATOM   519  C CG  . MET A 1 64  ? 13.829  17.936 31.461 1.00 6.10  ? 62   MET A CG  1 
ATOM   520  S SD  . MET A 1 64  ? 14.267  17.922 33.231 1.00 6.26  ? 62   MET A SD  1 
ATOM   521  C CE  . MET A 1 64  ? 14.638  16.187 33.476 1.00 7.00  ? 62   MET A CE  1 
ATOM   522  N N   . TRP A 1 65  ? 12.430  17.221 28.625 1.00 6.52  ? 63   TRP A N   1 
ATOM   523  C CA  . TRP A 1 65  ? 11.592  16.110 28.117 1.00 6.18  ? 63   TRP A CA  1 
ATOM   524  C C   . TRP A 1 65  ? 10.718  16.485 26.918 1.00 7.22  ? 63   TRP A C   1 
ATOM   525  O O   . TRP A 1 65  ? 9.778   15.755 26.616 1.00 7.81  ? 63   TRP A O   1 
ATOM   526  C CB  . TRP A 1 65  ? 10.796  15.454 29.249 1.00 7.78  ? 63   TRP A CB  1 
ATOM   527  C CG  . TRP A 1 65  ? 11.624  14.710 30.237 1.00 5.95  ? 63   TRP A CG  1 
ATOM   528  C CD1 . TRP A 1 65  ? 12.968  14.335 30.204 1.00 6.07  ? 63   TRP A CD1 1 
ATOM   529  C CD2 . TRP A 1 65  ? 11.132  14.219 31.512 1.00 5.97  ? 63   TRP A CD2 1 
ATOM   530  N NE1 . TRP A 1 65  ? 13.291  13.640 31.338 1.00 6.69  ? 63   TRP A NE1 1 
ATOM   531  C CE2 . TRP A 1 65  ? 12.229  13.505 32.137 1.00 5.52  ? 63   TRP A CE2 1 
ATOM   532  C CE3 . TRP A 1 65  ? 9.894   14.213 32.136 1.00 6.00  ? 63   TRP A CE3 1 
ATOM   533  C CZ2 . TRP A 1 65  ? 12.067  12.910 33.365 1.00 7.48  ? 63   TRP A CZ2 1 
ATOM   534  C CZ3 . TRP A 1 65  ? 9.767   13.577 33.338 1.00 6.79  ? 63   TRP A CZ3 1 
ATOM   535  C CH2 . TRP A 1 65  ? 10.823  12.962 33.956 1.00 7.17  ? 63   TRP A CH2 1 
ATOM   536  N N   . THR A 1 66  ? 11.114  17.516 26.172 1.00 8.37  ? 64   THR A N   1 
ATOM   537  C CA  . THR A 1 66  ? 10.604  17.817 24.883 1.00 8.83  ? 64   THR A CA  1 
ATOM   538  C C   . THR A 1 66  ? 11.691  17.632 23.844 1.00 9.06  ? 64   THR A C   1 
ATOM   539  O O   . THR A 1 66  ? 12.902  17.645 24.172 1.00 9.80  ? 64   THR A O   1 
ATOM   540  C CB  . THR A 1 66  ? 10.014  19.217 24.760 1.00 11.59 ? 64   THR A CB  1 
ATOM   541  O OG1 . THR A 1 66  ? 11.091  20.188 24.665 1.00 9.55  ? 64   THR A OG1 1 
ATOM   542  C CG2 . THR A 1 66  ? 9.037   19.523 25.958 1.00 10.37 ? 64   THR A CG2 1 
ATOM   543  N N   . PRO A 1 67  ? 11.318  17.334 22.607 1.00 10.43 ? 65   PRO A N   1 
ATOM   544  C CA  . PRO A 1 67  ? 12.352  17.151 21.563 1.00 10.52 ? 65   PRO A CA  1 
ATOM   545  C C   . PRO A 1 67  ? 13.187  18.346 21.339 1.00 10.12 ? 65   PRO A C   1 
ATOM   546  O O   . PRO A 1 67  ? 12.663  19.404 21.436 1.00 11.19 ? 65   PRO A O   1 
ATOM   547  C CB  . PRO A 1 67  ? 11.518  16.794 20.313 1.00 14.21 ? 65   PRO A CB  1 
ATOM   548  C CG  . PRO A 1 67  ? 10.219  16.297 20.822 1.00 13.19 ? 65   PRO A CG  1 
ATOM   549  C CD  . PRO A 1 67  ? 9.954   17.008 22.124 1.00 10.21 ? 65   PRO A CD  1 
ATOM   550  N N   . PRO A 1 68  ? 14.515  18.184 21.129 1.00 12.67 ? 66   PRO A N   1 
ATOM   551  C CA  . PRO A 1 68  ? 15.331  19.413 20.939 1.00 13.72 ? 66   PRO A CA  1 
ATOM   552  C C   . PRO A 1 68  ? 14.888  20.281 19.791 1.00 11.14 ? 66   PRO A C   1 
ATOM   553  O O   . PRO A 1 68  ? 14.988  21.491 19.883 1.00 11.08 ? 66   PRO A O   1 
ATOM   554  C CB  . PRO A 1 68  ? 16.767  18.859 20.764 1.00 17.46 ? 66   PRO A CB  1 
ATOM   555  C CG  . PRO A 1 68  ? 16.719  17.480 21.328 1.00 20.73 ? 66   PRO A CG  1 
ATOM   556  C CD  . PRO A 1 68  ? 15.310  16.954 21.200 1.00 12.49 ? 66   PRO A CD  1 
ATOM   557  N N   . GLU A 1 69  ? 14.281  19.683 18.759 1.00 11.89 ? 67   GLU A N   1 
ATOM   558  C CA  . GLU A 1 69  ? 13.782  20.477 17.654 1.00 12.32 ? 67   GLU A CA  1 
ATOM   559  C C   . GLU A 1 69  ? 12.571  21.320 18.038 1.00 10.61 ? 67   GLU A C   1 
ATOM   560  O O   . GLU A 1 69  ? 12.407  22.400 17.534 1.00 12.74 ? 67   GLU A O   1 
ATOM   561  C CB  . GLU A 1 69  ? 13.382  19.606 16.484 1.00 14.20 ? 67   GLU A CB  1 
ATOM   562  C CG  . GLU A 1 69  ? 14.466  18.699 15.937 1.00 16.03 ? 67   GLU A CG  1 
ATOM   563  C CD  . GLU A 1 69  ? 14.534  17.322 16.589 1.00 18.36 ? 67   GLU A CD  1 
ATOM   564  O OE1 . GLU A 1 69  ? 14.183  17.164 17.776 1.00 20.19 ? 67   GLU A OE1 1 
ATOM   565  O OE2 . GLU A 1 69  ? 14.992  16.355 15.911 1.00 28.83 ? 67   GLU A OE2 1 
ATOM   566  N N   . VAL A 1 70  ? 11.772  20.824 18.994 1.00 11.71 ? 68   VAL A N   1 
ATOM   567  C CA  . VAL A 1 70  ? 10.660  21.570 19.528 1.00 11.94 ? 68   VAL A CA  1 
ATOM   568  C C   . VAL A 1 70  ? 11.164  22.725 20.384 1.00 10.00 ? 68   VAL A C   1 
ATOM   569  O O   . VAL A 1 70  ? 10.761  23.844 20.248 1.00 10.28 ? 68   VAL A O   1 
ATOM   570  C CB  . VAL A 1 70  ? 9.667   20.656 20.280 1.00 12.43 ? 68   VAL A CB  1 
ATOM   571  C CG1 . VAL A 1 70  ? 8.608   21.486 20.977 1.00 19.13 ? 68   VAL A CG1 1 
ATOM   572  C CG2 . VAL A 1 70  ? 8.987   19.704 19.221 1.00 12.35 ? 68   VAL A CG2 1 
ATOM   573  N N   . ALA A 1 71  ? 12.118  22.429 21.245 1.00 11.02 ? 69   ALA A N   1 
ATOM   574  C CA  . ALA A 1 71  ? 12.722  23.483 22.078 1.00 9.90  ? 69   ALA A CA  1 
ATOM   575  C C   . ALA A 1 71  ? 13.338  24.570 21.176 1.00 9.43  ? 69   ALA A C   1 
ATOM   576  O O   . ALA A 1 71  ? 13.247  25.744 21.434 1.00 10.43 ? 69   ALA A O   1 
ATOM   577  C CB  . ALA A 1 71  ? 13.823  22.922 22.943 1.00 10.52 ? 69   ALA A CB  1 
ATOM   578  N N   . ASP A 1 72  ? 13.983  24.118 20.117 1.00 10.25 ? 70   ASP A N   1 
ATOM   579  C CA  . ASP A 1 72  ? 14.494  25.128 19.116 1.00 11.16 ? 70   ASP A CA  1 
ATOM   580  C C   . ASP A 1 72  ? 13.420  25.967 18.502 1.00 10.42 ? 70   ASP A C   1 
ATOM   581  O O   . ASP A 1 72  ? 13.632  27.165 18.398 1.00 12.14 ? 70   ASP A O   1 
ATOM   582  C CB  . ASP A 1 72  ? 15.331  24.424 18.032 1.00 11.93 ? 70   ASP A CB  1 
ATOM   583  C CG  . ASP A 1 72  ? 16.322  25.333 17.384 1.00 16.20 ? 70   ASP A CG  1 
ATOM   584  O OD1 . ASP A 1 72  ? 16.841  26.249 18.043 1.00 19.89 ? 70   ASP A OD1 1 
ATOM   585  O OD2 . ASP A 1 72  ? 16.526  25.150 16.174 1.00 26.66 ? 70   ASP A OD2 1 
ATOM   586  N N   . GLN A 1 73  ? 12.259  25.374 18.156 1.00 11.57 ? 71   GLN A N   1 
ATOM   587  C CA  . GLN A 1 73  ? 11.107  26.160 17.699 1.00 13.06 ? 71   GLN A CA  1 
ATOM   588  C C   . GLN A 1 73  ? 10.731  27.249 18.749 1.00 12.07 ? 71   GLN A C   1 
ATOM   589  O O   . GLN A 1 73  ? 10.498  28.430 18.409 1.00 14.88 ? 71   GLN A O   1 
ATOM   590  C CB  . GLN A 1 73  ? 9.911   25.235 17.470 1.00 15.56 ? 71   GLN A CB  1 
ATOM   591  C CG  . GLN A 1 73  ? 10.003  24.311 16.246 1.00 15.30 ? 71   GLN A CG  1 
ATOM   592  C CD  . GLN A 1 73  ? 8.889   23.254 16.197 1.00 17.88 ? 71   GLN A CD  1 
ATOM   593  O OE1 . GLN A 1 73  ? 7.997   23.206 17.092 1.00 23.37 ? 71   GLN A OE1 1 
ATOM   594  N NE2 . GLN A 1 73  ? 8.987   22.360 15.216 1.00 19.56 ? 71   GLN A NE2 1 
ATOM   595  N N   A GLU A 1 74  ? 10.621  26.825 20.007 0.60 11.72 ? 72   GLU A N   1 
ATOM   596  N N   B GLU A 1 74  ? 10.646  26.831 20.002 0.40 11.90 ? 72   GLU A N   1 
ATOM   597  C CA  A GLU A 1 74  ? 10.276  27.679 21.147 0.60 12.10 ? 72   GLU A CA  1 
ATOM   598  C CA  B GLU A 1 74  ? 10.282  27.730 21.067 0.40 12.72 ? 72   GLU A CA  1 
ATOM   599  C C   A GLU A 1 74  ? 11.299  28.821 21.256 0.60 11.77 ? 72   GLU A C   1 
ATOM   600  C C   B GLU A 1 74  ? 11.309  28.838 21.233 0.40 11.78 ? 72   GLU A C   1 
ATOM   601  O O   A GLU A 1 74  ? 10.916  30.010 21.387 0.60 12.74 ? 72   GLU A O   1 
ATOM   602  O O   B GLU A 1 74  ? 10.936  30.019 21.390 0.40 12.70 ? 72   GLU A O   1 
ATOM   603  C CB  A GLU A 1 74  ? 10.226  26.843 22.457 0.60 13.32 ? 72   GLU A CB  1 
ATOM   604  C CB  B GLU A 1 74  ? 10.118  26.994 22.381 0.40 15.02 ? 72   GLU A CB  1 
ATOM   605  C CG  A GLU A 1 74  ? 9.090   25.807 22.524 0.60 10.87 ? 72   GLU A CG  1 
ATOM   606  C CG  B GLU A 1 74  ? 9.299   27.885 23.286 0.40 19.05 ? 72   GLU A CG  1 
ATOM   607  C CD  A GLU A 1 74  ? 7.641   26.333 22.662 0.60 15.08 ? 72   GLU A CD  1 
ATOM   608  C CD  B GLU A 1 74  ? 8.141   28.540 22.564 0.40 17.99 ? 72   GLU A CD  1 
ATOM   609  O OE1 A GLU A 1 74  ? 7.382   27.556 22.542 0.60 19.00 ? 72   GLU A OE1 1 
ATOM   610  O OE1 B GLU A 1 74  ? 7.261   27.833 22.012 0.40 27.77 ? 72   GLU A OE1 1 
ATOM   611  O OE2 A GLU A 1 74  ? 6.729   25.473 22.897 0.60 16.53 ? 72   GLU A OE2 1 
ATOM   612  O OE2 B GLU A 1 74  ? 8.055   29.777 22.562 0.40 20.19 ? 72   GLU A OE2 1 
ATOM   613  N N   . MET A 1 75  ? 12.594  28.467 21.222 1.00 10.72 ? 73   MET A N   1 
ATOM   614  C CA  . MET A 1 75  ? 13.696  29.479 21.385 1.00 9.79  ? 73   MET A CA  1 
ATOM   615  C C   . MET A 1 75  ? 13.673  30.509 20.249 1.00 9.36  ? 73   MET A C   1 
ATOM   616  O O   . MET A 1 75  ? 13.728  31.667 20.449 1.00 9.64  ? 73   MET A O   1 
ATOM   617  C CB  . MET A 1 75  ? 15.061  28.765 21.444 1.00 8.71  ? 73   MET A CB  1 
ATOM   618  C CG  . MET A 1 75  ? 15.223  28.143 22.838 1.00 8.43  ? 73   MET A CG  1 
ATOM   619  S SD  . MET A 1 75  ? 16.818  27.340 23.086 1.00 10.70 ? 73   MET A SD  1 
ATOM   620  C CE  . MET A 1 75  ? 16.736  25.870 22.051 1.00 13.99 ? 73   MET A CE  1 
ATOM   621  N N   . LYS A 1 76  ? 13.499  30.032 19.015 1.00 10.74 ? 74   LYS A N   1 
ATOM   622  C CA  . LYS A 1 76  ? 13.409  30.905 17.838 1.00 12.39 ? 74   LYS A CA  1 
ATOM   623  C C   . LYS A 1 76  ? 12.178  31.818 17.943 1.00 12.27 ? 74   LYS A C   1 
ATOM   624  O O   . LYS A 1 76  ? 12.297  33.032 17.674 1.00 13.08 ? 74   LYS A O   1 
ATOM   625  C CB  . LYS A 1 76  ? 13.397  30.115 16.546 1.00 13.56 ? 74   LYS A CB  1 
ATOM   626  C CG  . LYS A 1 76  ? 14.752  29.544 16.198 1.00 17.03 ? 74   LYS A CG  1 
ATOM   627  C CD  . LYS A 1 76  ? 14.715  28.759 14.880 1.00 21.03 ? 74   LYS A CD  1 
ATOM   628  C CE  . LYS A 1 76  ? 16.075  28.151 14.549 1.00 24.10 ? 74   LYS A CE  1 
ATOM   629  N NZ  . LYS A 1 76  ? 16.895  28.932 13.569 1.00 33.99 ? 74   LYS A NZ  1 
ATOM   630  N N   . ARG A 1 77  ? 11.036  31.247 18.347 1.00 12.12 ? 75   ARG A N   1 
ATOM   631  C CA  . ARG A 1 77  ? 9.778   32.023 18.469 1.00 14.55 ? 75   ARG A CA  1 
ATOM   632  C C   . ARG A 1 77  ? 9.925   33.142 19.562 1.00 14.11 ? 75   ARG A C   1 
ATOM   633  O O   . ARG A 1 77  ? 9.422   34.266 19.409 1.00 16.99 ? 75   ARG A O   1 
ATOM   634  C CB  . ARG A 1 77  ? 8.608   31.127 18.837 1.00 17.83 ? 75   ARG A CB  1 
ATOM   635  C CG  . ARG A 1 77  ? 7.265   31.862 18.704 1.00 26.25 ? 75   ARG A CG  1 
ATOM   636  C CD  . ARG A 1 77  ? 6.046   30.928 18.689 1.00 31.68 ? 75   ARG A CD  1 
ATOM   637  N NE  . ARG A 1 77  ? 4.810   31.684 18.972 1.00 37.72 ? 75   ARG A NE  1 
ATOM   638  C CZ  . ARG A 1 77  ? 3.965   32.237 18.085 1.00 43.46 ? 75   ARG A CZ  1 
ATOM   639  N NH1 . ARG A 1 77  ? 4.136   32.143 16.761 1.00 35.86 ? 75   ARG A NH1 1 
ATOM   640  N NH2 . ARG A 1 77  ? 2.906   32.887 18.545 1.00 34.56 ? 75   ARG A NH2 1 
ATOM   641  N N   . GLN A 1 78  ? 10.628  32.864 20.651 1.00 13.00 ? 76   GLN A N   1 
ATOM   642  C CA  . GLN A 1 78  ? 10.841  33.832 21.723 1.00 12.39 ? 76   GLN A CA  1 
ATOM   643  C C   . GLN A 1 78  ? 12.058  34.713 21.527 1.00 11.93 ? 76   GLN A C   1 
ATOM   644  O O   . GLN A 1 78  ? 12.345  35.581 22.330 1.00 13.93 ? 76   GLN A O   1 
ATOM   645  C CB  . GLN A 1 78  ? 10.990  33.178 23.096 1.00 13.39 ? 76   GLN A CB  1 
ATOM   646  C CG  . GLN A 1 78  ? 9.702   32.444 23.485 1.00 16.55 ? 76   GLN A CG  1 
ATOM   647  C CD  . GLN A 1 78  ? 8.567   33.366 23.769 1.00 15.45 ? 76   GLN A CD  1 
ATOM   648  O OE1 . GLN A 1 78  ? 8.790   34.524 24.147 1.00 16.65 ? 76   GLN A OE1 1 
ATOM   649  N NE2 . GLN A 1 78  ? 7.354   32.881 23.663 1.00 24.02 ? 76   GLN A NE2 1 
ATOM   650  N N   . ASN A 1 79  ? 12.826  34.447 20.482 1.00 11.18 ? 77   ASN A N   1 
ATOM   651  C CA  . ASN A 1 79  ? 14.117  35.103 20.287 1.00 11.62 ? 77   ASN A CA  1 
ATOM   652  C C   . ASN A 1 79  ? 15.021  35.020 21.513 1.00 12.61 ? 77   ASN A C   1 
ATOM   653  O O   . ASN A 1 79  ? 15.633  35.995 21.879 1.00 12.49 ? 77   ASN A O   1 
ATOM   654  C CB  . ASN A 1 79  ? 13.908  36.568 19.839 1.00 15.00 ? 77   ASN A CB  1 
ATOM   655  C CG  . ASN A 1 79  ? 15.166  37.189 19.257 1.00 17.58 ? 77   ASN A CG  1 
ATOM   656  O OD1 . ASN A 1 79  ? 16.002  36.485 18.616 1.00 24.01 ? 77   ASN A OD1 1 
ATOM   657  N ND2 . ASN A 1 79  ? 15.339  38.492 19.469 1.00 22.56 ? 77   ASN A ND2 1 
ATOM   658  N N   . LEU A 1 80  ? 15.065  33.807 22.083 1.00 10.99 ? 78   LEU A N   1 
ATOM   659  C CA  . LEU A 1 80  ? 15.959  33.483 23.198 1.00 11.62 ? 78   LEU A CA  1 
ATOM   660  C C   . LEU A 1 80  ? 16.830  32.358 22.733 1.00 8.31  ? 78   LEU A C   1 
ATOM   661  O O   . LEU A 1 80  ? 16.436  31.205 22.667 1.00 9.13  ? 78   LEU A O   1 
ATOM   662  C CB  . LEU A 1 80  ? 15.201  33.050 24.436 1.00 11.26 ? 78   LEU A CB  1 
ATOM   663  C CG  . LEU A 1 80  ? 14.403  34.103 25.104 1.00 11.59 ? 78   LEU A CG  1 
ATOM   664  C CD1 . LEU A 1 80  ? 13.445  33.406 26.083 1.00 15.13 ? 78   LEU A CD1 1 
ATOM   665  C CD2 . LEU A 1 80  ? 15.274  35.168 25.781 1.00 14.93 ? 78   LEU A CD2 1 
ATOM   666  N N   . ILE A 1 81  ? 18.035  32.733 22.251 1.00 9.90  ? 79   ILE A N   1 
ATOM   667  C CA  . ILE A 1 81  ? 18.909  31.817 21.502 1.00 9.43  ? 79   ILE A CA  1 
ATOM   668  C C   . ILE A 1 81  ? 20.176  31.570 22.321 1.00 7.47  ? 79   ILE A C   1 
ATOM   669  O O   . ILE A 1 81  ? 20.712  32.475 22.996 1.00 8.47  ? 79   ILE A O   1 
ATOM   670  C CB  . ILE A 1 81  ? 19.331  32.435 20.158 1.00 11.20 ? 79   ILE A CB  1 
ATOM   671  C CG1 . ILE A 1 81  ? 18.115  33.063 19.396 1.00 13.38 ? 79   ILE A CG1 1 
ATOM   672  C CG2 . ILE A 1 81  ? 20.023  31.340 19.296 1.00 13.55 ? 79   ILE A CG2 1 
ATOM   673  C CD1 . ILE A 1 81  ? 16.942  32.138 19.104 1.00 14.24 ? 79   ILE A CD1 1 
ATOM   674  N N   . PHE A 1 82  ? 20.627  30.336 22.332 1.00 8.12  ? 80   PHE A N   1 
ATOM   675  C CA  . PHE A 1 82  ? 21.767  29.871 23.165 1.00 8.16  ? 80   PHE A CA  1 
ATOM   676  C C   . PHE A 1 82  ? 22.681  29.000 22.321 1.00 8.38  ? 80   PHE A C   1 
ATOM   677  O O   . PHE A 1 82  ? 22.312  28.582 21.264 1.00 8.27  ? 80   PHE A O   1 
ATOM   678  C CB  . PHE A 1 82  ? 21.246  29.057 24.317 1.00 7.81  ? 80   PHE A CB  1 
ATOM   679  C CG  . PHE A 1 82  ? 20.256  29.812 25.182 1.00 8.32  ? 80   PHE A CG  1 
ATOM   680  C CD1 . PHE A 1 82  ? 18.902  29.876 24.793 1.00 7.10  ? 80   PHE A CD1 1 
ATOM   681  C CD2 . PHE A 1 82  ? 20.684  30.617 26.261 1.00 9.42  ? 80   PHE A CD2 1 
ATOM   682  C CE1 . PHE A 1 82  ? 17.987  30.609 25.504 1.00 9.34  ? 80   PHE A CE1 1 
ATOM   683  C CE2 . PHE A 1 82  ? 19.714  31.277 26.976 1.00 10.89 ? 80   PHE A CE2 1 
ATOM   684  C CZ  . PHE A 1 82  ? 18.400  31.301 26.552 1.00 9.54  ? 80   PHE A CZ  1 
ATOM   685  N N   . ALA A 1 83  ? 23.894  28.788 22.826 1.00 9.46  ? 81   ALA A N   1 
ATOM   686  C CA  . ALA A 1 83  ? 24.937  28.131 22.004 1.00 7.84  ? 81   ALA A CA  1 
ATOM   687  C C   . ALA A 1 83  ? 25.596  26.991 22.745 1.00 8.55  ? 81   ALA A C   1 
ATOM   688  O O   . ALA A 1 83  ? 26.772  26.656 22.519 1.00 11.37 ? 81   ALA A O   1 
ATOM   689  C CB  . ALA A 1 83  ? 25.964  29.198 21.545 1.00 8.21  ? 81   ALA A CB  1 
ATOM   690  N N   . ARG A 1 84  ? 24.878  26.344 23.654 1.00 8.79  ? 82   ARG A N   1 
ATOM   691  C CA  . ARG A 1 84  ? 25.347  25.138 24.266 1.00 9.89  ? 82   ARG A CA  1 
ATOM   692  C C   . ARG A 1 84  ? 24.850  23.934 23.480 1.00 9.25  ? 82   ARG A C   1 
ATOM   693  O O   . ARG A 1 84  ? 23.829  24.000 22.811 1.00 9.77  ? 82   ARG A O   1 
ATOM   694  C CB  . ARG A 1 84  ? 24.852  25.012 25.713 1.00 11.59 ? 82   ARG A CB  1 
ATOM   695  C CG  . ARG A 1 84  ? 25.144  26.197 26.567 1.00 9.64  ? 82   ARG A CG  1 
ATOM   696  C CD  . ARG A 1 84  ? 26.591  26.519 26.808 1.00 8.68  ? 82   ARG A CD  1 
ATOM   697  N NE  . ARG A 1 84  ? 26.740  27.667 27.716 1.00 9.40  ? 82   ARG A NE  1 
ATOM   698  C CZ  . ARG A 1 84  ? 27.900  28.034 28.222 1.00 7.64  ? 82   ARG A CZ  1 
ATOM   699  N NH1 . ARG A 1 84  ? 29.031  27.443 27.797 1.00 9.63  ? 82   ARG A NH1 1 
ATOM   700  N NH2 . ARG A 1 84  ? 27.912  29.031 29.105 1.00 10.34 ? 82   ARG A NH2 1 
ATOM   701  N N   . PRO A 1 85  ? 25.523  22.768 23.589 1.00 9.78  ? 83   PRO A N   1 
ATOM   702  C CA  . PRO A 1 85  ? 25.021  21.535 22.945 1.00 12.07 ? 83   PRO A CA  1 
ATOM   703  C C   . PRO A 1 85  ? 23.632  21.145 23.426 1.00 9.04  ? 83   PRO A C   1 
ATOM   704  O O   . PRO A 1 85  ? 22.834  20.660 22.658 1.00 13.30 ? 83   PRO A O   1 
ATOM   705  C CB  . PRO A 1 85  ? 26.034  20.456 23.382 1.00 14.02 ? 83   PRO A CB  1 
ATOM   706  C CG  . PRO A 1 85  ? 27.294  21.238 23.655 1.00 15.85 ? 83   PRO A CG  1 
ATOM   707  C CD  . PRO A 1 85  ? 26.873  22.598 24.160 1.00 12.04 ? 83   PRO A CD  1 
ATOM   708  N N   . ASN A 1 86  ? 23.422  21.310 24.736 1.00 9.34  ? 84   ASN A N   1 
ATOM   709  C CA  . ASN A 1 86  ? 22.151  21.004 25.416 1.00 10.05 ? 84   ASN A CA  1 
ATOM   710  C C   . ASN A 1 86  ? 21.300  22.284 25.569 1.00 9.30  ? 84   ASN A C   1 
ATOM   711  O O   . ASN A 1 86  ? 21.795  23.344 25.904 1.00 9.43  ? 84   ASN A O   1 
ATOM   712  C CB  . ASN A 1 86  ? 22.511  20.503 26.867 1.00 13.63 ? 84   ASN A CB  1 
ATOM   713  C CG  . ASN A 1 86  ? 23.547  21.424 27.624 1.00 15.02 ? 84   ASN A CG  1 
ATOM   714  O OD1 . ASN A 1 86  ? 24.698  21.756 27.112 1.00 14.73 ? 84   ASN A OD1 1 
ATOM   715  N ND2 . ASN A 1 86  ? 23.210  21.751 28.878 1.00 16.54 ? 84   ASN A ND2 1 
ATOM   716  N N   . VAL A 1 87  ? 20.004  22.157 25.280 1.00 9.89  ? 85   VAL A N   1 
ATOM   717  C CA  . VAL A 1 87  ? 19.090  23.294 25.358 1.00 8.39  ? 85   VAL A CA  1 
ATOM   718  C C   . VAL A 1 87  ? 18.755  23.591 26.826 1.00 7.12  ? 85   VAL A C   1 
ATOM   719  O O   . VAL A 1 87  ? 18.847  22.767 27.719 1.00 8.40  ? 85   VAL A O   1 
ATOM   720  C CB  . VAL A 1 87  ? 17.760  23.077 24.559 1.00 11.41 ? 85   VAL A CB  1 
ATOM   721  C CG1 . VAL A 1 87  ? 18.055  22.672 23.142 1.00 12.76 ? 85   VAL A CG1 1 
ATOM   722  C CG2 . VAL A 1 87  ? 16.869  22.043 25.223 1.00 12.77 ? 85   VAL A CG2 1 
ATOM   723  N N   . PRO A 1 88  ? 18.461  24.882 27.148 1.00 7.01  ? 86   PRO A N   1 
ATOM   724  C CA  . PRO A 1 88  ? 18.084  25.152 28.549 1.00 6.27  ? 86   PRO A CA  1 
ATOM   725  C C   . PRO A 1 88  ? 16.881  24.332 28.954 1.00 5.98  ? 86   PRO A C   1 
ATOM   726  O O   . PRO A 1 88  ? 15.943  24.131 28.151 1.00 7.34  ? 86   PRO A O   1 
ATOM   727  C CB  . PRO A 1 88  ? 17.814  26.659 28.547 1.00 7.31  ? 86   PRO A CB  1 
ATOM   728  C CG  . PRO A 1 88  ? 18.478  27.173 27.307 1.00 8.44  ? 86   PRO A CG  1 
ATOM   729  C CD  . PRO A 1 88  ? 18.454  26.119 26.336 1.00 8.26  ? 86   PRO A CD  1 
ATOM   730  N N   . ASP A 1 89  ? 16.818  23.955 30.226 1.00 5.01  ? 87   ASP A N   1 
ATOM   731  C CA  . ASP A 1 89  ? 15.676  23.227 30.778 1.00 5.99  ? 87   ASP A CA  1 
ATOM   732  C C   . ASP A 1 89  ? 14.385  24.028 30.826 1.00 4.61  ? 87   ASP A C   1 
ATOM   733  O O   . ASP A 1 89  ? 13.297  23.502 30.618 1.00 5.60  ? 87   ASP A O   1 
ATOM   734  C CB  . ASP A 1 89  ? 16.075  22.665 32.182 1.00 6.06  ? 87   ASP A CB  1 
ATOM   735  C CG  . ASP A 1 89  ? 17.215  21.727 32.099 1.00 6.96  ? 87   ASP A CG  1 
ATOM   736  O OD1 . ASP A 1 89  ? 17.067  20.719 31.306 1.00 8.30  ? 87   ASP A OD1 1 
ATOM   737  O OD2 . ASP A 1 89  ? 18.212  21.906 32.809 1.00 7.58  ? 87   ASP A OD2 1 
ATOM   738  N N   . LEU A 1 90  ? 14.529  25.345 31.048 1.00 5.61  ? 88   LEU A N   1 
ATOM   739  C CA  . LEU A 1 90  ? 13.428  26.253 30.972 1.00 5.35  ? 88   LEU A CA  1 
ATOM   740  C C   . LEU A 1 90  ? 13.841  27.550 30.237 1.00 5.68  ? 88   LEU A C   1 
ATOM   741  O O   . LEU A 1 90  ? 14.998  27.941 30.260 1.00 6.15  ? 88   LEU A O   1 
ATOM   742  C CB  . LEU A 1 90  ? 12.828  26.666 32.343 1.00 5.60  ? 88   LEU A CB  1 
ATOM   743  C CG  . LEU A 1 90  ? 12.517  25.623 33.386 1.00 5.70  ? 88   LEU A CG  1 
ATOM   744  C CD1 . LEU A 1 90  ? 13.736  25.320 34.261 1.00 7.24  ? 88   LEU A CD1 1 
ATOM   745  C CD2 . LEU A 1 90  ? 11.302  26.018 34.220 1.00 7.55  ? 88   LEU A CD2 1 
ATOM   746  N N   . LEU A 1 91  ? 12.881  28.220 29.597 1.00 6.17  ? 89   LEU A N   1 
ATOM   747  C CA  . LEU A 1 91  ? 13.009  29.571 29.163 1.00 6.48  ? 89   LEU A CA  1 
ATOM   748  C C   . LEU A 1 91  ? 12.250  30.471 30.147 1.00 5.89  ? 89   LEU A C   1 
ATOM   749  O O   . LEU A 1 91  ? 11.075  30.221 30.383 1.00 7.48  ? 89   LEU A O   1 
ATOM   750  C CB  . LEU A 1 91  ? 12.520  29.738 27.754 1.00 7.26  ? 89   LEU A CB  1 
ATOM   751  C CG  . LEU A 1 91  ? 13.070  28.872 26.650 1.00 7.08  ? 89   LEU A CG  1 
ATOM   752  C CD1 . LEU A 1 91  ? 12.450  29.254 25.315 1.00 10.56 ? 89   LEU A CD1 1 
ATOM   753  C CD2 . LEU A 1 91  ? 14.603  28.894 26.654 1.00 8.26  ? 89   LEU A CD2 1 
ATOM   754  N N   . ASP A 1 92  ? 12.911  31.502 30.700 1.00 6.91  ? 90   ASP A N   1 
ATOM   755  C CA  . ASP A 1 92  ? 12.306  32.433 31.600 1.00 6.81  ? 90   ASP A CA  1 
ATOM   756  C C   . ASP A 1 92  ? 11.942  33.657 30.747 1.00 6.98  ? 90   ASP A C   1 
ATOM   757  O O   . ASP A 1 92  ? 12.829  34.405 30.319 1.00 8.24  ? 90   ASP A O   1 
ATOM   758  C CB  . ASP A 1 92  ? 13.298  32.806 32.676 1.00 7.57  ? 90   ASP A CB  1 
ATOM   759  C CG  . ASP A 1 92  ? 12.775  33.839 33.643 1.00 9.08  ? 90   ASP A CG  1 
ATOM   760  O OD1 . ASP A 1 92  ? 11.779  34.523 33.384 1.00 9.08  ? 90   ASP A OD1 1 
ATOM   761  O OD2 . ASP A 1 92  ? 13.398  33.982 34.744 1.00 9.97  ? 90   ASP A OD2 1 
ATOM   762  N N   . LEU A 1 93  ? 10.654  33.812 30.446 1.00 7.85  ? 91   LEU A N   1 
ATOM   763  C CA  . LEU A 1 93  ? 10.214  34.858 29.533 1.00 8.45  ? 91   LEU A CA  1 
ATOM   764  C C   . LEU A 1 93  ? 10.176  36.246 30.197 1.00 8.81  ? 91   LEU A C   1 
ATOM   765  O O   . LEU A 1 93  ? 10.089  37.316 29.523 1.00 10.70 ? 91   LEU A O   1 
ATOM   766  C CB  . LEU A 1 93  ? 8.865   34.486 28.965 1.00 7.80  ? 91   LEU A CB  1 
ATOM   767  C CG  . LEU A 1 93  ? 8.746   33.102 28.306 1.00 8.98  ? 91   LEU A CG  1 
ATOM   768  C CD1 . LEU A 1 93  ? 7.372   32.894 27.672 1.00 11.39 ? 91   LEU A CD1 1 
ATOM   769  C CD2 . LEU A 1 93  ? 9.867   32.966 27.272 1.00 10.25 ? 91   LEU A CD2 1 
ATOM   770  N N   . LYS A 1 94  ? 10.224  36.279 31.515 1.00 9.15  ? 92   LYS A N   1 
ATOM   771  C CA  . LYS A 1 94  ? 10.278  37.586 32.272 1.00 10.15 ? 92   LYS A CA  1 
ATOM   772  C C   . LYS A 1 94  ? 11.663  38.123 32.211 1.00 11.49 ? 92   LYS A C   1 
ATOM   773  O O   . LYS A 1 94  ? 11.860  39.284 31.785 1.00 12.51 ? 92   LYS A O   1 
ATOM   774  C CB  . LYS A 1 94  ? 9.769   37.392 33.681 1.00 10.04 ? 92   LYS A CB  1 
ATOM   775  C CG  . LYS A 1 94  ? 9.934   38.620 34.522 1.00 11.43 ? 92   LYS A CG  1 
ATOM   776  C CD  . LYS A 1 94  ? 9.588   38.297 35.961 1.00 16.00 ? 92   LYS A CD  1 
ATOM   777  C CE  . LYS A 1 94  ? 9.785   39.483 36.874 1.00 21.11 ? 92   LYS A CE  1 
ATOM   778  N NZ  . LYS A 1 94  ? 9.564   39.020 38.255 1.00 29.31 ? 92   LYS A NZ  1 
ATOM   779  N N   . GLU A 1 95  ? 12.612  37.336 32.641 1.00 11.31 ? 93   GLU A N   1 
ATOM   780  C CA  . GLU A 1 95  ? 14.020  37.755 32.728 1.00 11.92 ? 93   GLU A CA  1 
ATOM   781  C C   . GLU A 1 95  ? 14.766  37.612 31.391 1.00 11.93 ? 93   GLU A C   1 
ATOM   782  O O   . GLU A 1 95  ? 15.877  38.161 31.247 1.00 13.44 ? 93   GLU A O   1 
ATOM   783  C CB  . GLU A 1 95  ? 14.740  37.005 33.861 1.00 13.93 ? 93   GLU A CB  1 
ATOM   784  C CG  . GLU A 1 95  ? 14.156  37.300 35.230 1.00 15.03 ? 93   GLU A CG  1 
ATOM   785  C CD  . GLU A 1 95  ? 14.202  38.744 35.620 1.00 18.28 ? 93   GLU A CD  1 
ATOM   786  O OE1 . GLU A 1 95  ? 15.088  39.440 35.115 1.00 23.91 ? 93   GLU A OE1 1 
ATOM   787  O OE2 . GLU A 1 95  ? 13.353  39.146 36.437 1.00 21.34 ? 93   GLU A OE2 1 
ATOM   788  N N   . ARG A 1 96  ? 14.179  36.893 30.420 1.00 9.69  ? 94   ARG A N   1 
ATOM   789  C CA  . ARG A 1 96  ? 14.817  36.671 29.116 1.00 10.78 ? 94   ARG A CA  1 
ATOM   790  C C   . ARG A 1 96  ? 16.122  35.878 29.347 1.00 10.77 ? 94   ARG A C   1 
ATOM   791  O O   . ARG A 1 96  ? 17.182  36.279 28.874 1.00 11.14 ? 94   ARG A O   1 
ATOM   792  C CB  . ARG A 1 96  ? 15.069  37.975 28.347 1.00 14.08 ? 94   ARG A CB  1 
ATOM   793  C CG  . ARG A 1 96  ? 13.854  38.869 28.257 1.00 17.42 ? 94   ARG A CG  1 
ATOM   794  C CD  . ARG A 1 96  ? 12.894  38.281 27.202 1.00 17.25 ? 94   ARG A CD  1 
ATOM   795  N NE  . ARG A 1 96  ? 13.587  38.183 25.894 1.00 22.33 ? 94   ARG A NE  1 
ATOM   796  C CZ  . ARG A 1 96  ? 13.108  37.562 24.829 1.00 19.17 ? 94   ARG A CZ  1 
ATOM   797  N NH1 . ARG A 1 96  ? 11.961  36.946 24.922 1.00 18.12 ? 94   ARG A NH1 1 
ATOM   798  N NH2 . ARG A 1 96  ? 13.858  37.453 23.703 1.00 17.26 ? 94   ARG A NH2 1 
ATOM   799  N N   . LYS A 1 97  ? 15.979  34.739 30.011 1.00 11.04 ? 95   LYS A N   1 
ATOM   800  C CA  . LYS A 1 97  ? 17.123  33.902 30.364 1.00 10.66 ? 95   LYS A CA  1 
ATOM   801  C C   . LYS A 1 97  ? 16.777  32.446 30.012 1.00 8.20  ? 95   LYS A C   1 
ATOM   802  O O   . LYS A 1 97  ? 15.581  32.065 30.077 1.00 8.94  ? 95   LYS A O   1 
ATOM   803  C CB  . LYS A 1 97  ? 17.428  33.946 31.852 1.00 13.41 ? 95   LYS A CB  1 
ATOM   804  C CG  . LYS A 1 97  ? 17.709  35.275 32.514 1.00 18.06 ? 95   LYS A CG  1 
ATOM   805  C CD  . LYS A 1 97  ? 19.084  35.795 32.292 1.00 17.65 ? 95   LYS A CD  1 
ATOM   806  C CE  . LYS A 1 97  ? 19.311  37.168 32.864 1.00 19.98 ? 95   LYS A CE  1 
ATOM   807  N NZ  . LYS A 1 97  ? 20.610  37.708 32.436 1.00 26.28 ? 95   LYS A NZ  1 
ATOM   808  N N   . GLY A 1 98  ? 17.808  31.656 29.752 1.00 6.85  ? 96   GLY A N   1 
ATOM   809  C CA  . GLY A 1 98  ? 17.694  30.238 29.697 1.00 8.02  ? 96   GLY A CA  1 
ATOM   810  C C   . GLY A 1 98  ? 18.115  29.691 31.047 1.00 6.34  ? 96   GLY A C   1 
ATOM   811  O O   . GLY A 1 98  ? 19.166  30.082 31.557 1.00 7.42  ? 96   GLY A O   1 
ATOM   812  N N   . VAL A 1 99  ? 17.346  28.788 31.584 1.00 6.36  ? 97   VAL A N   1 
ATOM   813  C CA  . VAL A 1 99  ? 17.575  28.228 32.905 1.00 6.20  ? 97   VAL A CA  1 
ATOM   814  C C   . VAL A 1 99  ? 17.980  26.777 32.762 1.00 5.82  ? 97   VAL A C   1 
ATOM   815  O O   . VAL A 1 99  ? 17.285  25.991 32.168 1.00 6.97  ? 97   VAL A O   1 
ATOM   816  C CB  . VAL A 1 99  ? 16.325  28.367 33.808 1.00 5.69  ? 97   VAL A CB  1 
ATOM   817  C CG1 . VAL A 1 99  ? 16.629  27.817 35.212 1.00 8.03  ? 97   VAL A CG1 1 
ATOM   818  C CG2 . VAL A 1 99  ? 15.835  29.809 33.867 1.00 8.33  ? 97   VAL A CG2 1 
ATOM   819  N N   . TYR A 1 100 ? 19.095  26.409 33.400 1.00 5.20  ? 98   TYR A N   1 
ATOM   820  C CA  . TYR A 1 100 ? 19.556  25.022 33.451 1.00 5.75  ? 98   TYR A CA  1 
ATOM   821  C C   . TYR A 1 100 ? 19.402  24.598 34.915 1.00 6.76  ? 98   TYR A C   1 
ATOM   822  O O   . TYR A 1 100 ? 19.739  25.381 35.805 1.00 9.08  ? 98   TYR A O   1 
ATOM   823  C CB  . TYR A 1 100 ? 20.981  24.907 33.009 1.00 8.15  ? 98   TYR A CB  1 
ATOM   824  C CG  . TYR A 1 100 ? 21.286  25.446 31.608 1.00 7.61  ? 98   TYR A CG  1 
ATOM   825  C CD1 . TYR A 1 100 ? 21.557  26.760 31.460 1.00 10.25 ? 98   TYR A CD1 1 
ATOM   826  C CD2 . TYR A 1 100 ? 21.290  24.621 30.472 1.00 8.83  ? 98   TYR A CD2 1 
ATOM   827  C CE1 . TYR A 1 100 ? 21.844  27.345 30.232 1.00 10.95 ? 98   TYR A CE1 1 
ATOM   828  C CE2 . TYR A 1 100 ? 21.588  25.186 29.192 1.00 9.08  ? 98   TYR A CE2 1 
ATOM   829  C CZ  . TYR A 1 100 ? 21.875  26.533 29.145 1.00 9.34  ? 98   TYR A CZ  1 
ATOM   830  O OH  . TYR A 1 100 ? 22.176  27.156 27.909 1.00 10.98 ? 98   TYR A OH  1 
ATOM   831  N N   . VAL A 1 101 ? 18.922  23.383 35.141 1.00 5.57  ? 99   VAL A N   1 
ATOM   832  C CA  . VAL A 1 101 ? 18.750  22.854 36.518 1.00 6.00  ? 99   VAL A CA  1 
ATOM   833  C C   . VAL A 1 101 ? 19.715  21.700 36.709 1.00 7.14  ? 99   VAL A C   1 
ATOM   834  O O   . VAL A 1 101 ? 19.753  20.767 35.884 1.00 7.85  ? 99   VAL A O   1 
ATOM   835  C CB  . VAL A 1 101 ? 17.322  22.400 36.710 1.00 6.39  ? 99   VAL A CB  1 
ATOM   836  C CG1 . VAL A 1 101 ? 17.115  21.749 38.083 1.00 8.41  ? 99   VAL A CG1 1 
ATOM   837  C CG2 . VAL A 1 101 ? 16.352  23.551 36.546 1.00 7.95  ? 99   VAL A CG2 1 
ATOM   838  N N   . LYS A 1 102 ? 20.441  21.737 37.800 1.00 7.81  ? 100  LYS A N   1 
ATOM   839  C CA  . LYS A 1 102 ? 21.331  20.711 38.216 1.00 9.60  ? 100  LYS A CA  1 
ATOM   840  C C   . LYS A 1 102 ? 21.026  20.261 39.657 1.00 8.67  ? 100  LYS A C   1 
ATOM   841  O O   . LYS A 1 102 ? 20.992  21.102 40.570 1.00 8.70  ? 100  LYS A O   1 
ATOM   842  C CB  . LYS A 1 102 ? 22.833  21.192 38.003 1.00 13.09 ? 100  LYS A CB  1 
ATOM   843  C CG  . LYS A 1 102 ? 23.322  21.451 36.561 1.00 20.25 ? 100  LYS A CG  1 
ATOM   844  C CD  . LYS A 1 102 ? 24.859  21.507 36.436 1.00 26.04 ? 100  LYS A CD  1 
ATOM   845  C CE  . LYS A 1 102 ? 25.371  21.449 34.975 1.00 22.52 ? 100  LYS A CE  1 
ATOM   846  N NZ  . LYS A 1 102 ? 26.861  21.198 34.788 1.00 19.81 ? 100  LYS A NZ  1 
ATOM   847  N N   . VAL A 1 103 ? 20.865  18.969 39.844 1.00 10.22 ? 101  VAL A N   1 
ATOM   848  C CA  . VAL A 1 103 ? 20.632  18.370 41.134 1.00 10.67 ? 101  VAL A CA  1 
ATOM   849  C C   . VAL A 1 103 ? 21.908  17.665 41.603 1.00 11.83 ? 101  VAL A C   1 
ATOM   850  O O   . VAL A 1 103 ? 22.450  16.788 40.950 1.00 16.69 ? 101  VAL A O   1 
ATOM   851  C CB  . VAL A 1 103 ? 19.475  17.339 41.109 1.00 14.03 ? 101  VAL A CB  1 
ATOM   852  C CG1 . VAL A 1 103 ? 19.285  16.703 42.477 1.00 16.10 ? 101  VAL A CG1 1 
ATOM   853  C CG2 . VAL A 1 103 ? 18.217  18.009 40.581 1.00 15.12 ? 101  VAL A CG2 1 
ATOM   854  N N   . TYR A 1 104 ? 22.387  18.052 42.757 1.00 12.76 ? 102  TYR A N   1 
ATOM   855  C CA  . TYR A 1 104 ? 23.568  17.468 43.381 1.00 15.33 ? 102  TYR A CA  1 
ATOM   856  C C   . TYR A 1 104 ? 23.129  16.448 44.464 1.00 17.05 ? 102  TYR A C   1 
ATOM   857  O O   . TYR A 1 104 ? 22.460  16.801 45.297 1.00 13.04 ? 102  TYR A O   1 
ATOM   858  C CB  . TYR A 1 104 ? 24.315  18.656 43.977 1.00 16.93 ? 102  TYR A CB  1 
ATOM   859  C CG  . TYR A 1 104 ? 24.937  19.592 42.990 1.00 14.82 ? 102  TYR A CG  1 
ATOM   860  C CD1 . TYR A 1 104 ? 24.146  20.519 42.288 1.00 16.08 ? 102  TYR A CD1 1 
ATOM   861  C CD2 . TYR A 1 104 ? 26.276  19.534 42.662 1.00 19.39 ? 102  TYR A CD2 1 
ATOM   862  C CE1 . TYR A 1 104 ? 24.667  21.375 41.362 1.00 15.43 ? 102  TYR A CE1 1 
ATOM   863  C CE2 . TYR A 1 104 ? 26.829  20.406 41.729 1.00 20.09 ? 102  TYR A CE2 1 
ATOM   864  C CZ  . TYR A 1 104 ? 26.020  21.306 41.051 1.00 16.13 ? 102  TYR A CZ  1 
ATOM   865  O OH  . TYR A 1 104 ? 26.540  22.199 40.119 1.00 20.48 ? 102  TYR A OH  1 
ATOM   866  N N   . PRO A 1 105 ? 23.315  15.097 44.259 1.00 20.47 ? 103  PRO A N   1 
ATOM   867  C CA  . PRO A 1 105 ? 23.239  14.203 45.423 1.00 23.29 ? 103  PRO A CA  1 
ATOM   868  C C   . PRO A 1 105 ? 24.327  14.741 46.404 1.00 26.96 ? 103  PRO A C   1 
ATOM   869  O O   . PRO A 1 105 ? 25.518  14.660 46.064 1.00 30.88 ? 103  PRO A O   1 
ATOM   870  C CB  . PRO A 1 105 ? 23.574  12.823 44.817 1.00 23.92 ? 103  PRO A CB  1 
ATOM   871  C CG  . PRO A 1 105 ? 23.303  12.915 43.313 1.00 22.92 ? 103  PRO A CG  1 
ATOM   872  C CD  . PRO A 1 105 ? 23.583  14.369 42.996 1.00 22.66 ? 103  PRO A CD  1 
ATOM   873  N N   . ASP A 1 106 ? 23.988  15.282 47.580 1.00 29.86 ? 104  ASP A N   1 
ATOM   874  C CA  . ASP A 1 106 ? 24.894  16.220 48.094 1.00 30.68 ? 104  ASP A CA  1 
ATOM   875  C C   . ASP A 1 106 ? 24.557  16.445 49.507 1.00 29.37 ? 104  ASP A C   1 
ATOM   876  O O   . ASP A 1 106 ? 23.538  17.054 49.837 1.00 48.48 ? 104  ASP A O   1 
ATOM   877  C CB  . ASP A 1 106 ? 24.728  17.504 47.280 1.00 24.19 ? 104  ASP A CB  1 
ATOM   878  C CG  . ASP A 1 106 ? 25.813  18.599 47.585 1.00 35.67 ? 104  ASP A CG  1 
ATOM   879  O OD1 . ASP A 1 106 ? 26.756  18.324 48.361 1.00 48.77 ? 104  ASP A OD1 1 
ATOM   880  O OD2 . ASP A 1 106 ? 25.730  19.713 47.014 1.00 26.26 ? 104  ASP A OD2 1 
ATOM   881  N N   . ASN A 1 107 ? 25.454  16.000 50.374 1.00 22.54 ? 105  ASN A N   1 
ATOM   882  C CA  . ASN A 1 107 ? 25.537  16.686 51.646 1.00 27.34 ? 105  ASN A CA  1 
ATOM   883  C C   . ASN A 1 107 ? 26.345  17.923 51.225 1.00 32.39 ? 105  ASN A C   1 
ATOM   884  O O   . ASN A 1 107 ? 27.502  17.763 50.732 1.00 32.78 ? 105  ASN A O   1 
ATOM   885  C CB  . ASN A 1 107 ? 26.163  15.844 52.777 1.00 34.98 ? 105  ASN A CB  1 
ATOM   886  C CG  . ASN A 1 107 ? 27.611  16.196 53.063 1.00 37.74 ? 105  ASN A CG  1 
ATOM   887  O OD1 . ASN A 1 107 ? 28.525  15.513 52.598 1.00 37.78 ? 105  ASN A OD1 1 
ATOM   888  N ND2 . ASN A 1 107 ? 27.832  17.264 53.846 1.00 35.44 ? 105  ASN A ND2 1 
ATOM   889  N N   . GLY A 1 108 ? 25.726  19.116 51.290 1.00 17.49 ? 106  GLY A N   1 
ATOM   890  C CA  . GLY A 1 108 ? 26.486  20.354 51.009 1.00 21.14 ? 106  GLY A CA  1 
ATOM   891  C C   . GLY A 1 108 ? 25.726  21.307 50.114 1.00 20.06 ? 106  GLY A C   1 
ATOM   892  O O   . GLY A 1 108 ? 24.666  20.942 49.594 1.00 21.37 ? 106  GLY A O   1 
ATOM   893  N N   . THR A 1 109 ? 26.243  22.542 50.020 1.00 16.92 ? 107  THR A N   1 
ATOM   894  C CA  . THR A 1 109 ? 25.696  23.588 49.170 1.00 12.39 ? 107  THR A CA  1 
ATOM   895  C C   . THR A 1 109 ? 26.507  23.694 47.858 1.00 13.96 ? 107  THR A C   1 
ATOM   896  O O   . THR A 1 109 ? 27.709  23.860 47.904 1.00 13.06 ? 107  THR A O   1 
ATOM   897  C CB  . THR A 1 109 ? 25.673  24.971 49.839 1.00 15.00 ? 107  THR A CB  1 
ATOM   898  O OG1 . THR A 1 109 ? 25.042  24.792 51.139 1.00 17.30 ? 107  THR A OG1 1 
ATOM   899  C CG2 . THR A 1 109 ? 24.913  26.050 49.035 1.00 16.13 ? 107  THR A CG2 1 
ATOM   900  N N   . PRO A 1 110 ? 25.821  23.623 46.691 1.00 9.93  ? 108  PRO A N   1 
ATOM   901  C CA  . PRO A 1 110 ? 26.500  23.715 45.423 1.00 10.41 ? 108  PRO A CA  1 
ATOM   902  C C   . PRO A 1 110 ? 27.208  25.054 45.250 1.00 11.12 ? 108  PRO A C   1 
ATOM   903  O O   . PRO A 1 110 ? 26.754  26.133 45.682 1.00 12.15 ? 108  PRO A O   1 
ATOM   904  C CB  . PRO A 1 110 ? 25.388  23.604 44.408 1.00 12.08 ? 108  PRO A CB  1 
ATOM   905  C CG  . PRO A 1 110 ? 24.325  22.810 45.135 1.00 11.87 ? 108  PRO A CG  1 
ATOM   906  C CD  . PRO A 1 110 ? 24.362  23.349 46.508 1.00 10.82 ? 108  PRO A CD  1 
ATOM   907  N N   . THR A 1 111 ? 28.309  24.965 44.534 1.00 13.39 ? 109  THR A N   1 
ATOM   908  C CA  . THR A 1 111 ? 29.111  26.124 44.159 1.00 12.69 ? 109  THR A CA  1 
ATOM   909  C C   . THR A 1 111 ? 28.688  26.697 42.792 1.00 12.17 ? 109  THR A C   1 
ATOM   910  O O   . THR A 1 111 ? 28.455  25.936 41.831 1.00 13.17 ? 109  THR A O   1 
ATOM   911  C CB  . THR A 1 111 ? 30.591  25.718 44.068 1.00 14.30 ? 109  THR A CB  1 
ATOM   912  O OG1 . THR A 1 111 ? 30.998  25.038 45.278 1.00 19.36 ? 109  THR A OG1 1 
ATOM   913  C CG2 . THR A 1 111 ? 31.570  27.004 43.818 1.00 13.82 ? 109  THR A CG2 1 
ATOM   914  N N   . ASP A 1 112 ? 28.612  28.010 42.694 1.00 10.65 ? 110  ASP A N   1 
ATOM   915  C CA  . ASP A 1 112 ? 28.355  28.693 41.438 1.00 10.93 ? 110  ASP A CA  1 
ATOM   916  C C   . ASP A 1 112 ? 29.628  28.884 40.649 1.00 11.59 ? 110  ASP A C   1 
ATOM   917  O O   . ASP A 1 112 ? 30.669  29.276 41.167 1.00 12.63 ? 110  ASP A O   1 
ATOM   918  C CB  . ASP A 1 112 ? 27.645  30.031 41.646 1.00 10.35 ? 110  ASP A CB  1 
ATOM   919  C CG  . ASP A 1 112 ? 26.301  29.854 42.309 1.00 8.89  ? 110  ASP A CG  1 
ATOM   920  O OD1 . ASP A 1 112 ? 25.475  29.075 41.770 1.00 9.60  ? 110  ASP A OD1 1 
ATOM   921  O OD2 . ASP A 1 112 ? 26.076  30.485 43.376 1.00 9.85  ? 110  ASP A OD2 1 
ATOM   922  N N   . TYR A 1 113 ? 29.506  28.644 39.350 1.00 15.19 ? 111  TYR A N   1 
ATOM   923  C CA  . TYR A 1 113 ? 30.568  28.849 38.380 1.00 12.52 ? 111  TYR A CA  1 
ATOM   924  C C   . TYR A 1 113 ? 30.000  29.681 37.256 1.00 15.42 ? 111  TYR A C   1 
ATOM   925  O O   . TYR A 1 113 ? 28.785  29.614 37.005 1.00 19.10 ? 111  TYR A O   1 
ATOM   926  C CB  . TYR A 1 113 ? 31.163  27.526 37.905 1.00 12.63 ? 111  TYR A CB  1 
ATOM   927  C CG  . TYR A 1 113 ? 31.874  26.744 39.001 1.00 13.68 ? 111  TYR A CG  1 
ATOM   928  C CD1 . TYR A 1 113 ? 33.074  27.195 39.543 1.00 13.95 ? 111  TYR A CD1 1 
ATOM   929  C CD2 . TYR A 1 113 ? 31.313  25.551 39.537 1.00 15.13 ? 111  TYR A CD2 1 
ATOM   930  C CE1 . TYR A 1 113 ? 33.673  26.512 40.587 1.00 15.45 ? 111  TYR A CE1 1 
ATOM   931  C CE2 . TYR A 1 113 ? 31.976  24.836 40.535 1.00 16.66 ? 111  TYR A CE2 1 
ATOM   932  C CZ  . TYR A 1 113 ? 33.141  25.360 41.062 1.00 15.42 ? 111  TYR A CZ  1 
ATOM   933  O OH  . TYR A 1 113 ? 33.798  24.727 42.097 1.00 18.40 ? 111  TYR A OH  1 
ATOM   934  N N   . GLN A 1 114 ? 30.857  30.374 36.517 1.00 18.95 ? 112  GLN A N   1 
ATOM   935  C CA  . GLN A 1 114 ? 30.472  31.301 35.432 1.00 18.17 ? 112  GLN A CA  1 
ATOM   936  C C   . GLN A 1 114 ? 29.473  30.700 34.408 1.00 15.67 ? 112  GLN A C   1 
ATOM   937  O O   . GLN A 1 114 ? 29.544  29.510 34.046 1.00 16.01 ? 112  GLN A O   1 
ATOM   938  C CB  . GLN A 1 114 ? 31.746  31.688 34.641 1.00 20.19 ? 112  GLN A CB  1 
ATOM   939  C CG  . GLN A 1 114 ? 31.578  32.829 33.663 1.00 20.03 ? 112  GLN A CG  1 
ATOM   940  C CD  . GLN A 1 114 ? 32.781  33.087 32.679 1.00 24.23 ? 112  GLN A CD  1 
ATOM   941  O OE1 . GLN A 1 114 ? 33.705  32.260 32.468 1.00 26.95 ? 112  GLN A OE1 1 
ATOM   942  N NE2 . GLN A 1 114 ? 32.750  34.240 32.065 1.00 24.55 ? 112  GLN A NE2 1 
ATOM   943  N N   . THR A 1 115 ? 28.506  31.531 34.056 1.00 16.06 ? 113  THR A N   1 
ATOM   944  C CA  . THR A 1 115 ? 27.586  31.263 32.959 1.00 14.26 ? 113  THR A CA  1 
ATOM   945  C C   . THR A 1 115 ? 27.595  32.484 32.027 1.00 11.99 ? 113  THR A C   1 
ATOM   946  O O   . THR A 1 115 ? 28.126  33.521 32.392 1.00 15.92 ? 113  THR A O   1 
ATOM   947  C CB  . THR A 1 115 ? 26.161  30.909 33.495 1.00 15.03 ? 113  THR A CB  1 
ATOM   948  O OG1 . THR A 1 115 ? 25.640  32.047 34.173 1.00 19.50 ? 113  THR A OG1 1 
ATOM   949  C CG2 . THR A 1 115 ? 26.235  29.695 34.456 1.00 21.23 ? 113  THR A CG2 1 
ATOM   950  N N   . ALA A 1 116 ? 26.951  32.385 30.858 1.00 11.52 ? 114  ALA A N   1 
ATOM   951  C CA  . ALA A 1 116 ? 26.759  33.470 29.950 1.00 10.21 ? 114  ALA A CA  1 
ATOM   952  C C   . ALA A 1 116 ? 25.747  34.467 30.521 1.00 10.14 ? 114  ALA A C   1 
ATOM   953  O O   . ALA A 1 116 ? 25.006  34.129 31.437 1.00 9.07  ? 114  ALA A O   1 
ATOM   954  C CB  . ALA A 1 116 ? 26.285  32.929 28.623 1.00 11.49 ? 114  ALA A CB  1 
ATOM   955  N N   . GLU A 1 117 ? 25.691  35.650 29.916 1.00 10.27 ? 115  GLU A N   1 
ATOM   956  C CA  . GLU A 1 117 ? 24.829  36.685 30.448 1.00 13.22 ? 115  GLU A CA  1 
ATOM   957  C C   . GLU A 1 117 ? 23.356  36.329 30.327 1.00 12.25 ? 115  GLU A C   1 
ATOM   958  O O   . GLU A 1 117 ? 22.595  36.777 31.152 1.00 13.42 ? 115  GLU A O   1 
ATOM   959  C CB  . GLU A 1 117 ? 25.116  38.035 29.750 1.00 17.88 ? 115  GLU A CB  1 
ATOM   960  C CG  . GLU A 1 117 ? 24.680  38.114 28.282 1.00 23.45 ? 115  GLU A CG  1 
ATOM   961  C CD  . GLU A 1 117 ? 24.981  39.449 27.573 1.00 40.69 ? 115  GLU A CD  1 
ATOM   962  O OE1 . GLU A 1 117 ? 25.176  40.462 28.294 1.00 44.88 ? 115  GLU A OE1 1 
ATOM   963  O OE2 . GLU A 1 117 ? 25.002  39.487 26.287 1.00 46.01 ? 115  GLU A OE2 1 
ATOM   964  N N   . ASN A 1 118 ? 22.961  35.593 29.312 1.00 9.03  ? 116  ASN A N   1 
ATOM   965  C CA  . ASN A 1 118 ? 21.572  35.199 29.161 1.00 8.28  ? 116  ASN A CA  1 
ATOM   966  C C   . ASN A 1 118 ? 21.194  33.852 29.792 1.00 7.93  ? 116  ASN A C   1 
ATOM   967  O O   . ASN A 1 118 ? 20.109  33.322 29.531 1.00 8.71  ? 116  ASN A O   1 
ATOM   968  C CB  . ASN A 1 118 ? 21.116  35.237 27.688 1.00 10.24 ? 116  ASN A CB  1 
ATOM   969  C CG  . ASN A 1 118 ? 21.717  34.151 26.820 1.00 11.34 ? 116  ASN A CG  1 
ATOM   970  O OD1 . ASN A 1 118 ? 22.621  33.455 27.202 1.00 10.96 ? 116  ASN A OD1 1 
ATOM   971  N ND2 . ASN A 1 118 ? 21.219  34.044 25.597 1.00 13.75 ? 116  ASN A ND2 1 
ATOM   972  N N   . GLU A 1 119 ? 22.066  33.342 30.650 1.00 7.33  ? 117  GLU A N   1 
ATOM   973  C CA  . GLU A 1 119 ? 21.856  32.020 31.296 1.00 6.67  ? 117  GLU A CA  1 
ATOM   974  C C   . GLU A 1 119 ? 21.789  32.128 32.807 1.00 6.20  ? 117  GLU A C   1 
ATOM   975  O O   . GLU A 1 119 ? 22.540  32.918 33.436 1.00 8.41  ? 117  GLU A O   1 
ATOM   976  C CB  . GLU A 1 119 ? 22.996  31.054 30.932 1.00 8.11  ? 117  GLU A CB  1 
ATOM   977  C CG  . GLU A 1 119 ? 23.105  30.722 29.434 1.00 8.30  ? 117  GLU A CG  1 
ATOM   978  C CD  . GLU A 1 119 ? 24.299  29.805 29.117 1.00 7.89  ? 117  GLU A CD  1 
ATOM   979  O OE1 . GLU A 1 119 ? 25.301  29.958 29.836 1.00 10.94 ? 117  GLU A OE1 1 
ATOM   980  O OE2 . GLU A 1 119 ? 24.136  29.026 28.187 1.00 9.97  ? 117  GLU A OE2 1 
ATOM   981  N N   . ILE A 1 120 ? 21.007  31.254 33.405 1.00 7.15  ? 118  ILE A N   1 
ATOM   982  C CA  . ILE A 1 120 ? 20.931  31.048 34.828 1.00 8.34  ? 118  ILE A CA  1 
ATOM   983  C C   . ILE A 1 120 ? 21.073  29.550 35.091 1.00 6.88  ? 118  ILE A C   1 
ATOM   984  O O   . ILE A 1 120 ? 20.359  28.733 34.531 1.00 8.74  ? 118  ILE A O   1 
ATOM   985  C CB  . ILE A 1 120 ? 19.554  31.527 35.416 1.00 11.60 ? 118  ILE A CB  1 
ATOM   986  C CG1 . ILE A 1 120 ? 19.404  33.007 35.242 1.00 15.79 ? 118  ILE A CG1 1 
ATOM   987  C CG2 . ILE A 1 120 ? 19.420  31.010 36.895 1.00 13.13 ? 118  ILE A CG2 1 
ATOM   988  C CD1 . ILE A 1 120 ? 20.307  33.838 36.088 1.00 17.92 ? 118  ILE A CD1 1 
ATOM   989  N N   . PHE A 1 121 ? 21.946  29.156 36.021 1.00 7.91  ? 119  PHE A N   1 
ATOM   990  C CA  . PHE A 1 121 ? 22.096  27.770 36.426 1.00 8.19  ? 119  PHE A CA  1 
ATOM   991  C C   . PHE A 1 121 ? 21.559  27.610 37.867 1.00 8.46  ? 119  PHE A C   1 
ATOM   992  O O   . PHE A 1 121 ? 22.218  27.921 38.816 1.00 10.16 ? 119  PHE A O   1 
ATOM   993  C CB  . PHE A 1 121 ? 23.579  27.355 36.349 1.00 11.33 ? 119  PHE A CB  1 
ATOM   994  C CG  . PHE A 1 121 ? 24.106  27.016 34.937 1.00 14.35 ? 119  PHE A CG  1 
ATOM   995  C CD1 . PHE A 1 121 ? 24.196  28.025 33.993 1.00 19.39 ? 119  PHE A CD1 1 
ATOM   996  C CD2 . PHE A 1 121 ? 24.472  25.720 34.553 1.00 19.33 ? 119  PHE A CD2 1 
ATOM   997  C CE1 . PHE A 1 121 ? 24.684  27.802 32.733 1.00 20.65 ? 119  PHE A CE1 1 
ATOM   998  C CE2 . PHE A 1 121 ? 24.903  25.487 33.261 1.00 18.66 ? 119  PHE A CE2 1 
ATOM   999  C CZ  . PHE A 1 121 ? 25.042  26.545 32.362 1.00 19.61 ? 119  PHE A CZ  1 
ATOM   1000 N N   . VAL A 1 122 ? 20.378  27.018 37.955 1.00 6.74  ? 120  VAL A N   1 
ATOM   1001 C CA  . VAL A 1 122 ? 19.770  26.608 39.244 1.00 6.90  ? 120  VAL A CA  1 
ATOM   1002 C C   . VAL A 1 122 ? 20.495  25.375 39.696 1.00 6.80  ? 120  VAL A C   1 
ATOM   1003 O O   . VAL A 1 122 ? 20.508  24.321 38.987 1.00 8.36  ? 120  VAL A O   1 
ATOM   1004 C CB  . VAL A 1 122 ? 18.253  26.365 39.082 1.00 6.80  ? 120  VAL A CB  1 
ATOM   1005 C CG1 . VAL A 1 122 ? 17.681  25.575 40.232 1.00 8.30  ? 120  VAL A CG1 1 
ATOM   1006 C CG2 . VAL A 1 122 ? 17.528  27.716 38.861 1.00 8.94  ? 120  VAL A CG2 1 
ATOM   1007 N N   A ARG A 1 123 ? 21.056  25.451 40.913 0.60 6.35  ? 121  ARG A N   1 
ATOM   1008 N N   B ARG A 1 123 ? 21.049  25.457 40.912 0.40 6.49  ? 121  ARG A N   1 
ATOM   1009 C CA  A ARG A 1 123 ? 21.921  24.402 41.457 0.60 6.76  ? 121  ARG A CA  1 
ATOM   1010 C CA  B ARG A 1 123 ? 21.913  24.422 41.473 0.40 6.67  ? 121  ARG A CA  1 
ATOM   1011 C C   A ARG A 1 123 ? 21.447  24.081 42.855 0.60 6.05  ? 121  ARG A C   1 
ATOM   1012 C C   B ARG A 1 123 ? 21.406  24.097 42.854 0.40 6.31  ? 121  ARG A C   1 
ATOM   1013 O O   A ARG A 1 123 ? 21.491  24.918 43.755 0.60 8.15  ? 121  ARG A O   1 
ATOM   1014 O O   B ARG A 1 123 ? 21.408  24.946 43.745 0.40 7.93  ? 121  ARG A O   1 
ATOM   1015 C CB  A ARG A 1 123 ? 23.405  24.794 41.489 0.60 7.75  ? 121  ARG A CB  1 
ATOM   1016 C CB  B ARG A 1 123 ? 23.361  24.882 41.580 0.40 7.15  ? 121  ARG A CB  1 
ATOM   1017 C CG  A ARG A 1 123 ? 24.102  24.760 40.102 0.60 9.09  ? 121  ARG A CG  1 
ATOM   1018 C CG  B ARG A 1 123 ? 23.944  25.412 40.269 0.40 7.38  ? 121  ARG A CG  1 
ATOM   1019 C CD  A ARG A 1 123 ? 25.554  25.201 40.250 0.60 10.01 ? 121  ARG A CD  1 
ATOM   1020 C CD  B ARG A 1 123 ? 25.393  25.819 40.512 0.40 8.29  ? 121  ARG A CD  1 
ATOM   1021 N NE  A ARG A 1 123 ? 26.438  24.763 39.140 0.60 10.31 ? 121  ARG A NE  1 
ATOM   1022 N NE  B ARG A 1 123 ? 25.914  26.622 39.419 0.40 8.78  ? 121  ARG A NE  1 
ATOM   1023 C CZ  A ARG A 1 123 ? 27.062  25.561 38.255 0.60 9.51  ? 121  ARG A CZ  1 
ATOM   1024 C CZ  B ARG A 1 123 ? 26.497  26.141 38.341 0.40 9.28  ? 121  ARG A CZ  1 
ATOM   1025 N NH1 A ARG A 1 123 ? 26.891  26.896 38.290 0.60 11.67 ? 121  ARG A NH1 1 
ATOM   1026 N NH1 B ARG A 1 123 ? 26.630  24.845 38.193 0.40 9.25  ? 121  ARG A NH1 1 
ATOM   1027 N NH2 A ARG A 1 123 ? 27.921  25.019 37.356 0.60 10.28 ? 121  ARG A NH2 1 
ATOM   1028 N NH2 B ARG A 1 123 ? 26.883  26.999 37.401 0.40 10.75 ? 121  ARG A NH2 1 
ATOM   1029 N N   . VAL A 1 124 ? 20.882  22.887 43.013 1.00 6.75  ? 122  VAL A N   1 
ATOM   1030 C CA  . VAL A 1 124 ? 20.252  22.478 44.267 1.00 7.00  ? 122  VAL A CA  1 
ATOM   1031 C C   . VAL A 1 124 ? 20.770  21.141 44.675 1.00 7.43  ? 122  VAL A C   1 
ATOM   1032 O O   . VAL A 1 124 ? 21.056  20.264 43.832 1.00 8.82  ? 122  VAL A O   1 
ATOM   1033 C CB  . VAL A 1 124 ? 18.717  22.471 44.142 1.00 6.73  ? 122  VAL A CB  1 
ATOM   1034 C CG1 . VAL A 1 124 ? 18.131  23.846 43.831 1.00 9.75  ? 122  VAL A CG1 1 
ATOM   1035 C CG2 . VAL A 1 124 ? 18.183  21.466 43.136 1.00 9.59  ? 122  VAL A CG2 1 
ATOM   1036 N N   . SER A 1 125 ? 20.809  20.874 45.987 1.00 9.08  ? 123  SER A N   1 
ATOM   1037 C CA  . SER A 1 125 ? 21.221  19.563 46.518 1.00 8.87  ? 123  SER A CA  1 
ATOM   1038 C C   . SER A 1 125 ? 20.032  18.750 46.863 1.00 10.06 ? 123  SER A C   1 
ATOM   1039 O O   . SER A 1 125 ? 18.937  19.242 47.124 1.00 9.77  ? 123  SER A O   1 
ATOM   1040 C CB  . SER A 1 125 ? 22.121  19.693 47.730 1.00 10.04 ? 123  SER A CB  1 
ATOM   1041 O OG  . SER A 1 125 ? 21.356  19.986 48.899 1.00 10.38 ? 123  SER A OG  1 
ATOM   1042 N N   . LEU A 1 126 ? 20.242  17.433 46.949 1.00 10.51 ? 124  LEU A N   1 
ATOM   1043 C CA  . LEU A 1 126 ? 19.172  16.530 47.339 1.00 12.47 ? 124  LEU A CA  1 
ATOM   1044 C C   . LEU A 1 126 ? 18.625  16.869 48.733 1.00 11.02 ? 124  LEU A C   1 
ATOM   1045 O O   . LEU A 1 126 ? 17.460  16.644 49.023 1.00 15.44 ? 124  LEU A O   1 
ATOM   1046 C CB  . LEU A 1 126 ? 19.594  15.026 47.272 1.00 15.38 ? 124  LEU A CB  1 
ATOM   1047 C CG  . LEU A 1 126 ? 19.883  14.323 45.936 1.00 17.37 ? 124  LEU A CG  1 
ATOM   1048 C CD1 . LEU A 1 126 ? 20.489  12.921 46.131 1.00 21.30 ? 124  LEU A CD1 1 
ATOM   1049 C CD2 . LEU A 1 126 ? 18.689  14.292 44.982 1.00 20.74 ? 124  LEU A CD2 1 
ATOM   1050 N N   . SER A 1 127 ? 19.491  17.397 49.604 1.00 9.09  ? 125  SER A N   1 
ATOM   1051 C CA  . SER A 1 127 ? 19.091  17.753 50.977 1.00 9.17  ? 125  SER A CA  1 
ATOM   1052 C C   . SER A 1 127 ? 18.481  19.125 51.049 1.00 7.90  ? 125  SER A C   1 
ATOM   1053 O O   . SER A 1 127 ? 18.229  19.638 52.141 1.00 9.46  ? 125  SER A O   1 
ATOM   1054 C CB  . SER A 1 127 ? 20.296  17.669 51.908 1.00 8.92  ? 125  SER A CB  1 
ATOM   1055 O OG  . SER A 1 127 ? 21.255  18.538 51.480 1.00 12.05 ? 125  SER A OG  1 
ATOM   1056 N N   . GLY A 1 128 ? 18.206  19.754 49.909 1.00 8.76  ? 126  GLY A N   1 
ATOM   1057 C CA  . GLY A 1 128 ? 17.413  20.940 49.905 1.00 8.13  ? 126  GLY A CA  1 
ATOM   1058 C C   . GLY A 1 128 ? 18.197  22.247 49.950 1.00 8.33  ? 126  GLY A C   1 
ATOM   1059 O O   . GLY A 1 128 ? 17.646  23.336 50.187 1.00 9.57  ? 126  GLY A O   1 
ATOM   1060 N N   A GLN A 1 129 ? 19.491  22.143 49.736 0.60 8.05  ? 127  GLN A N   1 
ATOM   1061 N N   B GLN A 1 129 ? 19.492  22.162 49.729 0.40 8.00  ? 127  GLN A N   1 
ATOM   1062 C CA  A GLN A 1 129 ? 20.343  23.339 49.689 0.60 9.10  ? 127  GLN A CA  1 
ATOM   1063 C CA  B GLN A 1 129 ? 20.310  23.375 49.721 0.40 8.54  ? 127  GLN A CA  1 
ATOM   1064 C C   A GLN A 1 129 ? 20.306  24.012 48.307 0.60 7.36  ? 127  GLN A C   1 
ATOM   1065 C C   B GLN A 1 129 ? 20.365  24.009 48.322 0.40 7.62  ? 127  GLN A C   1 
ATOM   1066 O O   A GLN A 1 129 ? 20.136  23.350 47.314 0.60 9.84  ? 127  GLN A O   1 
ATOM   1067 O O   B GLN A 1 129 ? 20.328  23.317 47.333 0.40 9.99  ? 127  GLN A O   1 
ATOM   1068 C CB  A GLN A 1 129 ? 21.810  23.025 50.074 0.60 9.35  ? 127  GLN A CB  1 
ATOM   1069 C CB  B GLN A 1 129 ? 21.721  23.082 50.263 0.40 8.55  ? 127  GLN A CB  1 
ATOM   1070 C CG  A GLN A 1 129 ? 21.901  22.448 51.469 0.60 9.86  ? 127  GLN A CG  1 
ATOM   1071 C CG  B GLN A 1 129 ? 21.611  22.187 51.488 0.40 7.76  ? 127  GLN A CG  1 
ATOM   1072 C CD  A GLN A 1 129 ? 22.221  23.535 52.453 0.60 14.79 ? 127  GLN A CD  1 
ATOM   1073 C CD  B GLN A 1 129 ? 20.890  22.918 52.611 0.40 6.47  ? 127  GLN A CD  1 
ATOM   1074 O OE1 A GLN A 1 129 ? 23.374  23.915 52.608 0.60 26.15 ? 127  GLN A OE1 1 
ATOM   1075 O OE1 B GLN A 1 129 ? 21.335  24.021 52.993 0.40 8.19  ? 127  GLN A OE1 1 
ATOM   1076 N NE2 A GLN A 1 129 ? 21.206  24.079 53.083 0.60 13.50 ? 127  GLN A NE2 1 
ATOM   1077 N NE2 B GLN A 1 129 ? 19.723  22.352 53.100 0.40 5.98  ? 127  GLN A NE2 1 
ATOM   1078 N N   . MET A 1 130 ? 20.494  25.330 48.284 1.00 7.59  ? 128  MET A N   1 
ATOM   1079 C CA  . MET A 1 130 ? 20.482  26.094 47.075 1.00 7.42  ? 128  MET A CA  1 
ATOM   1080 C C   . MET A 1 130 ? 21.771  26.893 46.988 1.00 6.85  ? 128  MET A C   1 
ATOM   1081 O O   . MET A 1 130 ? 22.189  27.527 47.973 1.00 7.56  ? 128  MET A O   1 
ATOM   1082 C CB  . MET A 1 130 ? 19.323  27.095 47.054 1.00 8.50  ? 128  MET A CB  1 
ATOM   1083 C CG  . MET A 1 130 ? 17.968  26.470 47.029 1.00 9.31  ? 128  MET A CG  1 
ATOM   1084 S SD  . MET A 1 130 ? 16.620  27.653 47.392 1.00 14.19 ? 128  MET A SD  1 
ATOM   1085 C CE  . MET A 1 130 ? 16.998  28.135 49.205 1.00 14.99 ? 128  MET A CE  1 
ATOM   1086 N N   . SER A 1 131 ? 22.415  26.961 45.810 1.00 6.46  ? 129  SER A N   1 
ATOM   1087 C CA  . SER A 1 131 ? 23.599  27.815 45.624 1.00 6.84  ? 129  SER A CA  1 
ATOM   1088 C C   . SER A 1 131 ? 23.199  29.265 45.838 1.00 6.90  ? 129  SER A C   1 
ATOM   1089 O O   . SER A 1 131 ? 22.040  29.652 45.716 1.00 6.90  ? 129  SER A O   1 
ATOM   1090 C CB  . SER A 1 131 ? 24.196  27.668 44.263 1.00 6.81  ? 129  SER A CB  1 
ATOM   1091 O OG  . SER A 1 131 ? 23.497  28.377 43.279 1.00 7.87  ? 129  SER A OG  1 
ATOM   1092 N N   . PRO A 1 132 ? 24.205  30.136 46.099 1.00 6.88  ? 130  PRO A N   1 
ATOM   1093 C CA  . PRO A 1 132 ? 23.881  31.561 46.361 1.00 8.11  ? 130  PRO A CA  1 
ATOM   1094 C C   . PRO A 1 132 ? 23.149  32.188 45.162 1.00 7.13  ? 130  PRO A C   1 
ATOM   1095 O O   . PRO A 1 132 ? 22.203  32.975 45.340 1.00 9.15  ? 130  PRO A O   1 
ATOM   1096 C CB  . PRO A 1 132 ? 25.251  32.160 46.572 1.00 9.06  ? 130  PRO A CB  1 
ATOM   1097 C CG  . PRO A 1 132 ? 26.027  31.048 47.239 1.00 10.33 ? 130  PRO A CG  1 
ATOM   1098 C CD  . PRO A 1 132 ? 25.578  29.789 46.555 1.00 7.39  ? 130  PRO A CD  1 
ATOM   1099 N N   . ILE A 1 133 ? 23.610  31.948 43.925 1.00 9.33  ? 131  ILE A N   1 
ATOM   1100 C CA  . ILE A 1 133 ? 22.940  32.508 42.765 1.00 10.67 ? 131  ILE A CA  1 
ATOM   1101 C C   . ILE A 1 133 ? 21.533  31.947 42.564 1.00 7.99  ? 131  ILE A C   1 
ATOM   1102 O O   . ILE A 1 133 ? 20.619  32.671 42.202 1.00 8.01  ? 131  ILE A O   1 
ATOM   1103 C CB  . ILE A 1 133 ? 23.726  32.269 41.472 1.00 12.79 ? 131  ILE A CB  1 
ATOM   1104 C CG1 . ILE A 1 133 ? 24.940  33.243 41.469 1.00 16.53 ? 131  ILE A CG1 1 
ATOM   1105 C CG2 . ILE A 1 133 ? 22.839  32.431 40.186 1.00 16.20 ? 131  ILE A CG2 1 
ATOM   1106 C CD1 . ILE A 1 133 ? 24.582  34.620 40.950 1.00 22.50 ? 131  ILE A CD1 1 
ATOM   1107 N N   . THR A 1 134 ? 21.337  30.681 42.916 1.00 6.13  ? 132  THR A N   1 
ATOM   1108 C CA  . THR A 1 134 ? 20.045  30.067 42.859 1.00 6.80  ? 132  THR A CA  1 
ATOM   1109 C C   . THR A 1 134 ? 19.072  30.764 43.835 1.00 6.83  ? 132  THR A C   1 
ATOM   1110 O O   . THR A 1 134 ? 17.943  31.079 43.488 1.00 7.14  ? 132  THR A O   1 
ATOM   1111 C CB  . THR A 1 134 ? 20.156  28.582 43.176 1.00 6.85  ? 132  THR A CB  1 
ATOM   1112 O OG1 . THR A 1 134 ? 21.033  28.003 42.224 1.00 6.62  ? 132  THR A OG1 1 
ATOM   1113 C CG2 . THR A 1 134 ? 18.828  27.882 43.151 1.00 6.87  ? 132  THR A CG2 1 
ATOM   1114 N N   . ARG A 1 135 ? 19.510  30.958 45.067 1.00 6.69  ? 133  ARG A N   1 
ATOM   1115 C CA  . ARG A 1 135 ? 18.673  31.606 46.087 1.00 9.00  ? 133  ARG A CA  1 
ATOM   1116 C C   . ARG A 1 135 ? 18.288  33.020 45.731 1.00 9.02  ? 133  ARG A C   1 
ATOM   1117 O O   . ARG A 1 135 ? 17.248  33.503 46.152 1.00 9.53  ? 133  ARG A O   1 
ATOM   1118 C CB  . ARG A 1 135 ? 19.418  31.631 47.464 1.00 12.92 ? 133  ARG A CB  1 
ATOM   1119 C CG  . ARG A 1 135 ? 19.826  30.293 47.957 1.00 14.77 ? 133  ARG A CG  1 
ATOM   1120 C CD  . ARG A 1 135 ? 20.446  30.472 49.298 1.00 16.63 ? 133  ARG A CD  1 
ATOM   1121 N NE  . ARG A 1 135 ? 21.655  31.234 49.428 1.00 17.31 ? 133  ARG A NE  1 
ATOM   1122 C CZ  . ARG A 1 135 ? 22.866  30.766 49.773 1.00 13.97 ? 133  ARG A CZ  1 
ATOM   1123 N NH1 . ARG A 1 135 ? 23.207  29.477 49.753 1.00 11.54 ? 133  ARG A NH1 1 
ATOM   1124 N NH2 . ARG A 1 135 ? 23.813  31.681 50.050 1.00 15.29 ? 133  ARG A NH2 1 
ATOM   1125 N N   . GLU A 1 136 ? 19.145  33.719 44.988 1.00 7.72  ? 134  GLU A N   1 
ATOM   1126 C CA  . GLU A 1 136 ? 18.853  35.059 44.606 1.00 9.24  ? 134  GLU A CA  1 
ATOM   1127 C C   . GLU A 1 136 ? 17.945  35.136 43.402 1.00 8.84  ? 134  GLU A C   1 
ATOM   1128 O O   . GLU A 1 136 ? 17.113  36.033 43.301 1.00 11.32 ? 134  GLU A O   1 
ATOM   1129 C CB  . GLU A 1 136 ? 20.169  35.790 44.300 1.00 12.70 ? 134  GLU A CB  1 
ATOM   1130 C CG  . GLU A 1 136 ? 19.996  37.188 43.771 1.00 18.08 ? 134  GLU A CG  1 
ATOM   1131 C CD  . GLU A 1 136 ? 19.420  38.177 44.783 1.00 26.46 ? 134  GLU A CD  1 
ATOM   1132 O OE1 . GLU A 1 136 ? 19.817  38.110 45.977 1.00 28.19 ? 134  GLU A OE1 1 
ATOM   1133 O OE2 . GLU A 1 136 ? 18.569  39.024 44.361 1.00 37.75 ? 134  GLU A OE2 1 
ATOM   1134 N N   . TYR A 1 137 ? 18.109  34.179 42.485 1.00 7.78  ? 135  TYR A N   1 
ATOM   1135 C CA  . TYR A 1 137 ? 17.311  34.115 41.279 1.00 7.72  ? 135  TYR A CA  1 
ATOM   1136 C C   . TYR A 1 137 ? 15.876  33.743 41.601 1.00 6.66  ? 135  TYR A C   1 
ATOM   1137 O O   . TYR A 1 137 ? 14.939  34.358 41.117 1.00 7.87  ? 135  TYR A O   1 
ATOM   1138 C CB  . TYR A 1 137 ? 17.900  33.138 40.260 1.00 7.00  ? 135  TYR A CB  1 
ATOM   1139 C CG  . TYR A 1 137 ? 16.949  32.819 39.158 1.00 7.13  ? 135  TYR A CG  1 
ATOM   1140 C CD1 . TYR A 1 137 ? 16.652  33.764 38.188 1.00 6.52  ? 135  TYR A CD1 1 
ATOM   1141 C CD2 . TYR A 1 137 ? 16.332  31.627 39.080 1.00 6.28  ? 135  TYR A CD2 1 
ATOM   1142 C CE1 . TYR A 1 137 ? 15.770  33.462 37.170 1.00 7.25  ? 135  TYR A CE1 1 
ATOM   1143 C CE2 . TYR A 1 137 ? 15.431  31.322 38.071 1.00 6.63  ? 135  TYR A CE2 1 
ATOM   1144 C CZ  . TYR A 1 137 ? 15.152  32.242 37.125 1.00 6.33  ? 135  TYR A CZ  1 
ATOM   1145 O OH  . TYR A 1 137 ? 14.169  32.016 36.164 1.00 6.92  ? 135  TYR A OH  1 
ATOM   1146 N N   . LEU A 1 138 ? 15.691  32.661 42.363 1.00 6.05  ? 136  LEU A N   1 
ATOM   1147 C CA  . LEU A 1 138 ? 14.360  32.153 42.710 1.00 6.00  ? 136  LEU A CA  1 
ATOM   1148 C C   . LEU A 1 138 ? 13.690  33.094 43.753 1.00 6.32  ? 136  LEU A C   1 
ATOM   1149 O O   . LEU A 1 138 ? 14.351  33.620 44.651 1.00 7.64  ? 136  LEU A O   1 
ATOM   1150 C CB  . LEU A 1 138 ? 14.433  30.716 43.255 1.00 6.16  ? 136  LEU A CB  1 
ATOM   1151 C CG  . LEU A 1 138 ? 14.910  29.659 42.276 1.00 7.30  ? 136  LEU A CG  1 
ATOM   1152 C CD1 . LEU A 1 138 ? 14.963  28.356 43.062 1.00 7.74  ? 136  LEU A CD1 1 
ATOM   1153 C CD2 . LEU A 1 138 ? 13.993  29.514 41.076 1.00 8.22  ? 136  LEU A CD2 1 
ATOM   1154 N N   . ASP A 1 139 ? 12.380  33.287 43.589 1.00 6.41  ? 137  ASP A N   1 
ATOM   1155 C CA  . ASP A 1 139 ? 11.615  34.074 44.546 1.00 6.75  ? 137  ASP A CA  1 
ATOM   1156 C C   . ASP A 1 139 ? 11.270  33.242 45.757 1.00 6.05  ? 137  ASP A C   1 
ATOM   1157 O O   . ASP A 1 139 ? 11.487  32.014 45.765 1.00 7.01  ? 137  ASP A O   1 
ATOM   1158 C CB  . ASP A 1 139 ? 10.469  34.794 43.905 1.00 8.83  ? 137  ASP A CB  1 
ATOM   1159 C CG  . ASP A 1 139 ? 9.302   34.003 43.562 1.00 10.64 ? 137  ASP A CG  1 
ATOM   1160 O OD1 . ASP A 1 139 ? 9.128   32.906 44.034 1.00 11.61 ? 137  ASP A OD1 1 
ATOM   1161 O OD2 . ASP A 1 139 ? 8.455   34.642 42.810 1.00 14.59 ? 137  ASP A OD2 1 
ATOM   1162 N N   . GLU A 1 140 ? 10.672  33.842 46.787 1.00 6.69  ? 138  GLU A N   1 
ATOM   1163 C CA  . GLU A 1 140 ? 10.483  33.113 48.043 1.00 6.94  ? 138  GLU A CA  1 
ATOM   1164 C C   . GLU A 1 140 ? 9.557   31.907 47.826 1.00 7.04  ? 138  GLU A C   1 
ATOM   1165 O O   . GLU A 1 140 ? 9.795   30.841 48.400 1.00 7.48  ? 138  GLU A O   1 
ATOM   1166 C CB  . GLU A 1 140 ? 9.952   34.064 49.104 1.00 7.87  ? 138  GLU A CB  1 
ATOM   1167 C CG  . GLU A 1 140 ? 9.908   33.443 50.473 1.00 8.04  ? 138  GLU A CG  1 
ATOM   1168 C CD  . GLU A 1 140 ? 9.370   34.348 51.583 1.00 6.90  ? 138  GLU A CD  1 
ATOM   1169 O OE1 . GLU A 1 140 ? 8.891   35.417 51.265 1.00 11.91 ? 138  GLU A OE1 1 
ATOM   1170 O OE2 . GLU A 1 140 ? 9.398   33.952 52.757 1.00 8.99  ? 138  GLU A OE2 1 
ATOM   1171 N N   . VAL A 1 141 ? 8.511   32.059 47.044 1.00 7.09  ? 139  VAL A N   1 
ATOM   1172 C CA  . VAL A 1 141 ? 7.559   30.974 46.791 1.00 7.77  ? 139  VAL A CA  1 
ATOM   1173 C C   . VAL A 1 141 ? 8.238   29.852 46.024 1.00 5.78  ? 139  VAL A C   1 
ATOM   1174 O O   . VAL A 1 141 ? 8.097   28.677 46.364 1.00 6.52  ? 139  VAL A O   1 
ATOM   1175 C CB  . VAL A 1 141 ? 6.296   31.498 46.013 1.00 9.50  ? 139  VAL A CB  1 
ATOM   1176 C CG1 . VAL A 1 141 ? 5.444   30.313 45.548 1.00 11.39 ? 139  VAL A CG1 1 
ATOM   1177 C CG2 . VAL A 1 141 ? 5.448   32.441 46.869 1.00 13.08 ? 139  VAL A CG2 1 
ATOM   1178 N N   . GLN A 1 142 ? 9.023   30.186 44.985 1.00 6.55  ? 140  GLN A N   1 
ATOM   1179 C CA  . GLN A 1 142 ? 9.785   29.174 44.304 1.00 6.04  ? 140  GLN A CA  1 
ATOM   1180 C C   . GLN A 1 142 ? 10.776  28.438 45.177 1.00 5.72  ? 140  GLN A C   1 
ATOM   1181 O O   . GLN A 1 142 ? 10.868  27.216 45.130 1.00 6.16  ? 140  GLN A O   1 
ATOM   1182 C CB  . GLN A 1 142 ? 10.529  29.816 43.123 1.00 6.22  ? 140  GLN A CB  1 
ATOM   1183 C CG  . GLN A 1 142 ? 9.633   30.368 42.013 1.00 6.27  ? 140  GLN A CG  1 
ATOM   1184 C CD  . GLN A 1 142 ? 10.417  31.068 40.959 1.00 5.87  ? 140  GLN A CD  1 
ATOM   1185 O OE1 . GLN A 1 142 ? 11.187  31.983 41.313 1.00 7.38  ? 140  GLN A OE1 1 
ATOM   1186 N NE2 . GLN A 1 142 ? 10.241  30.720 39.691 1.00 5.62  ? 140  GLN A NE2 1 
ATOM   1187 N N   . ARG A 1 143 ? 11.494  29.176 46.014 1.00 5.87  ? 141  ARG A N   1 
ATOM   1188 C CA  . ARG A 1 143 ? 12.398  28.519 46.938 1.00 5.74  ? 141  ARG A CA  1 
ATOM   1189 C C   . ARG A 1 143 ? 11.710  27.557 47.895 1.00 6.23  ? 141  ARG A C   1 
ATOM   1190 O O   . ARG A 1 143 ? 12.149  26.440 48.116 1.00 7.05  ? 141  ARG A O   1 
ATOM   1191 C CB  . ARG A 1 143 ? 13.256  29.554 47.763 1.00 6.23  ? 141  ARG A CB  1 
ATOM   1192 C CG  . ARG A 1 143 ? 14.114  30.436 46.924 1.00 6.61  ? 141  ARG A CG  1 
ATOM   1193 C CD  . ARG A 1 143 ? 15.090  31.187 47.720 1.00 6.35  ? 141  ARG A CD  1 
ATOM   1194 N NE  . ARG A 1 143 ? 14.530  32.008 48.771 1.00 6.47  ? 141  ARG A NE  1 
ATOM   1195 C CZ  . ARG A 1 143 ? 14.122  33.255 48.604 1.00 6.30  ? 141  ARG A CZ  1 
ATOM   1196 N NH1 . ARG A 1 143 ? 14.163  33.849 47.419 1.00 7.11  ? 141  ARG A NH1 1 
ATOM   1197 N NH2 . ARG A 1 143 ? 13.630  33.925 49.633 1.00 7.34  ? 141  ARG A NH2 1 
ATOM   1198 N N   . GLN A 1 144 ? 10.567  27.989 48.386 1.00 6.60  ? 142  GLN A N   1 
ATOM   1199 C CA  . GLN A 1 144 ? 9.751   27.135 49.256 1.00 7.80  ? 142  GLN A CA  1 
ATOM   1200 C C   . GLN A 1 144 ? 9.260   25.907 48.547 1.00 6.78  ? 142  GLN A C   1 
ATOM   1201 O O   . GLN A 1 144 ? 9.392   24.824 49.120 1.00 8.28  ? 142  GLN A O   1 
ATOM   1202 C CB  . GLN A 1 144 ? 8.598   27.967 49.844 1.00 7.98  ? 142  GLN A CB  1 
ATOM   1203 C CG  . GLN A 1 144 ? 8.949   28.949 50.962 1.00 9.50  ? 142  GLN A CG  1 
ATOM   1204 C CD  . GLN A 1 144 ? 9.139   28.149 52.245 1.00 13.98 ? 142  GLN A CD  1 
ATOM   1205 O OE1 . GLN A 1 144 ? 8.177   27.874 52.997 1.00 17.53 ? 142  GLN A OE1 1 
ATOM   1206 N NE2 . GLN A 1 144 ? 10.344  27.728 52.462 1.00 13.07 ? 142  GLN A NE2 1 
ATOM   1207 N N   . ASP A 1 145 ? 8.733   26.049 47.346 1.00 7.70  ? 143  ASP A N   1 
ATOM   1208 C CA  . ASP A 1 145 ? 8.170   24.898 46.670 1.00 6.99  ? 143  ASP A CA  1 
ATOM   1209 C C   . ASP A 1 145 ? 9.235   23.910 46.266 1.00 6.96  ? 143  ASP A C   1 
ATOM   1210 O O   . ASP A 1 145 ? 9.081   22.679 46.415 1.00 7.37  ? 143  ASP A O   1 
ATOM   1211 C CB  . ASP A 1 145 ? 7.377   25.328 45.467 1.00 7.06  ? 143  ASP A CB  1 
ATOM   1212 C CG  . ASP A 1 145 ? 6.063   26.007 45.773 1.00 9.24  ? 143  ASP A CG  1 
ATOM   1213 O OD1 . ASP A 1 145 ? 5.607   25.950 46.948 1.00 14.10 ? 143  ASP A OD1 1 
ATOM   1214 O OD2 . ASP A 1 145 ? 5.536   26.664 44.856 1.00 10.07 ? 143  ASP A OD2 1 
ATOM   1215 N N   . VAL A 1 146 ? 10.340  24.409 45.729 1.00 6.52  ? 144  VAL A N   1 
ATOM   1216 C CA  . VAL A 1 146 ? 11.457  23.546 45.328 1.00 5.76  ? 144  VAL A CA  1 
ATOM   1217 C C   . VAL A 1 146 ? 12.073  22.835 46.568 1.00 7.08  ? 144  VAL A C   1 
ATOM   1218 O O   . VAL A 1 146 ? 12.247  21.613 46.543 1.00 7.97  ? 144  VAL A O   1 
ATOM   1219 C CB  . VAL A 1 146 ? 12.523  24.337 44.573 1.00 6.42  ? 144  VAL A CB  1 
ATOM   1220 C CG1 . VAL A 1 146 ? 13.824  23.552 44.439 1.00 8.00  ? 144  VAL A CG1 1 
ATOM   1221 C CG2 . VAL A 1 146 ? 11.986  24.853 43.262 1.00 6.24  ? 144  VAL A CG2 1 
ATOM   1222 N N   . THR A 1 147 ? 12.376  23.558 47.622 1.00 7.55  ? 145  THR A N   1 
ATOM   1223 C CA  . THR A 1 147 ? 13.008  22.987 48.782 1.00 9.90  ? 145  THR A CA  1 
ATOM   1224 C C   . THR A 1 147 ? 12.051  22.058 49.500 1.00 8.32  ? 145  THR A C   1 
ATOM   1225 O O   . THR A 1 147 ? 12.510  20.999 49.977 1.00 11.05 ? 145  THR A O   1 
ATOM   1226 C CB  . THR A 1 147 ? 13.486  24.094 49.758 1.00 11.54 ? 145  THR A CB  1 
ATOM   1227 O OG1 . THR A 1 147 ? 12.357  24.858 50.267 1.00 16.13 ? 145  THR A OG1 1 
ATOM   1228 C CG2 . THR A 1 147 ? 14.483  24.940 49.016 1.00 9.89  ? 145  THR A CG2 1 
ATOM   1229 N N   A ASN A 1 148 ? 10.767  22.363 49.569 0.60 8.88  ? 146  ASN A N   1 
ATOM   1230 N N   B ASN A 1 148 ? 10.754  22.378 49.575 0.40 8.47  ? 146  ASN A N   1 
ATOM   1231 C CA  A ASN A 1 148 ? 9.912   21.439 50.284 0.60 9.66  ? 146  ASN A CA  1 
ATOM   1232 C CA  B ASN A 1 148 ? 9.799   21.464 50.235 0.40 9.00  ? 146  ASN A CA  1 
ATOM   1233 C C   A ASN A 1 148 ? 9.844   20.101 49.548 0.60 9.01  ? 146  ASN A C   1 
ATOM   1234 C C   B ASN A 1 148 ? 9.821   20.111 49.547 0.40 8.74  ? 146  ASN A C   1 
ATOM   1235 O O   A ASN A 1 148 ? 9.771   19.039 50.207 0.60 8.32  ? 146  ASN A O   1 
ATOM   1236 O O   B ASN A 1 148 ? 9.791   19.064 50.219 0.40 8.48  ? 146  ASN A O   1 
ATOM   1237 C CB  A ASN A 1 148 ? 8.509   22.037 50.441 0.60 10.81 ? 146  ASN A CB  1 
ATOM   1238 C CB  B ASN A 1 148 ? 8.367   22.039 50.168 0.40 9.71  ? 146  ASN A CB  1 
ATOM   1239 C CG  A ASN A 1 148 ? 8.470   23.200 51.423 0.60 14.66 ? 146  ASN A CG  1 
ATOM   1240 C CG  B ASN A 1 148 ? 7.286   21.119 50.787 0.40 9.62  ? 146  ASN A CG  1 
ATOM   1241 O OD1 A ASN A 1 148 ? 9.360   23.334 52.235 0.60 19.43 ? 146  ASN A OD1 1 
ATOM   1242 O OD1 B ASN A 1 148 ? 7.137   21.043 52.007 0.40 11.47 ? 146  ASN A OD1 1 
ATOM   1243 N ND2 A ASN A 1 148 ? 7.478   24.093 51.282 0.60 17.23 ? 146  ASN A ND2 1 
ATOM   1244 N ND2 B ASN A 1 148 ? 6.505   20.471 49.924 0.40 9.68  ? 146  ASN A ND2 1 
ATOM   1245 N N   . PHE A 1 149 ? 9.833   20.122 48.224 1.00 7.70  ? 147  PHE A N   1 
ATOM   1246 C CA  . PHE A 1 149 ? 9.865   18.875 47.459 1.00 7.08  ? 147  PHE A CA  1 
ATOM   1247 C C   . PHE A 1 149 ? 11.165  18.129 47.695 1.00 7.31  ? 147  PHE A C   1 
ATOM   1248 O O   . PHE A 1 149 ? 11.147  16.944 48.006 1.00 8.58  ? 147  PHE A O   1 
ATOM   1249 C CB  . PHE A 1 149 ? 9.698   19.156 45.967 1.00 7.68  ? 147  PHE A CB  1 
ATOM   1250 C CG  . PHE A 1 149 ? 10.083  17.994 45.102 1.00 6.48  ? 147  PHE A CG  1 
ATOM   1251 C CD1 . PHE A 1 149 ? 9.439   16.745 45.238 1.00 7.49  ? 147  PHE A CD1 1 
ATOM   1252 C CD2 . PHE A 1 149 ? 11.179  18.087 44.250 1.00 7.49  ? 147  PHE A CD2 1 
ATOM   1253 C CE1 . PHE A 1 149 ? 9.883   15.650 44.483 1.00 7.20  ? 147  PHE A CE1 1 
ATOM   1254 C CE2 . PHE A 1 149 ? 11.580  17.007 43.525 1.00 7.39  ? 147  PHE A CE2 1 
ATOM   1255 C CZ  . PHE A 1 149 ? 10.945  15.803 43.625 1.00 6.11  ? 147  PHE A CZ  1 
ATOM   1256 N N   . LEU A 1 150 ? 12.305  18.800 47.601 1.00 6.94  ? 148  LEU A N   1 
ATOM   1257 C CA  . LEU A 1 150 ? 13.605  18.116 47.758 1.00 8.58  ? 148  LEU A CA  1 
ATOM   1258 C C   . LEU A 1 150 ? 13.688  17.475 49.142 1.00 9.78  ? 148  LEU A C   1 
ATOM   1259 O O   . LEU A 1 150 ? 14.130  16.352 49.299 1.00 10.49 ? 148  LEU A O   1 
ATOM   1260 C CB  . LEU A 1 150 ? 14.763  19.129 47.564 1.00 7.60  ? 148  LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 150 ? 14.947  19.600 46.093 1.00 7.57  ? 148  LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 150 ? 15.886  20.786 46.071 1.00 8.89  ? 148  LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 150 ? 15.423  18.484 45.182 1.00 9.47  ? 148  LEU A CD2 1 
ATOM   1264 N N   . VAL A 1 151 ? 13.288  18.185 50.183 1.00 9.26  ? 149  VAL A N   1 
ATOM   1265 C CA  . VAL A 1 151 ? 13.333  17.644 51.520 1.00 11.35 ? 149  VAL A CA  1 
ATOM   1266 C C   . VAL A 1 151 ? 12.384  16.475 51.681 1.00 9.83  ? 149  VAL A C   1 
ATOM   1267 O O   . VAL A 1 151 ? 12.706  15.531 52.473 1.00 9.71  ? 149  VAL A O   1 
ATOM   1268 C CB  . VAL A 1 151 ? 12.995  18.766 52.533 1.00 14.80 ? 149  VAL A CB  1 
ATOM   1269 C CG1 . VAL A 1 151 ? 12.473  18.146 53.853 1.00 19.92 ? 149  VAL A CG1 1 
ATOM   1270 C CG2 . VAL A 1 151 ? 14.154  19.797 52.589 1.00 17.85 ? 149  VAL A CG2 1 
ATOM   1271 N N   . THR A 1 152 ? 11.257  16.480 51.041 1.00 9.34  ? 150  THR A N   1 
ATOM   1272 C CA  . THR A 1 152 ? 10.349  15.360 51.087 1.00 8.53  ? 150  THR A CA  1 
ATOM   1273 C C   . THR A 1 152 ? 10.980  14.101 50.478 1.00 9.06  ? 150  THR A C   1 
ATOM   1274 O O   . THR A 1 152 ? 10.984  13.008 51.114 1.00 8.30  ? 150  THR A O   1 
ATOM   1275 C CB  . THR A 1 152 ? 9.021   15.682 50.343 1.00 10.35 ? 150  THR A CB  1 
ATOM   1276 O OG1 . THR A 1 152 ? 8.421   16.806 50.960 1.00 12.41 ? 150  THR A OG1 1 
ATOM   1277 C CG2 . THR A 1 152 ? 8.063   14.538 50.392 1.00 13.28 ? 150  THR A CG2 1 
ATOM   1278 N N   . ILE A 1 153 ? 11.512  14.191 49.277 1.00 7.55  ? 151  ILE A N   1 
ATOM   1279 C CA  . ILE A 1 153 ? 12.143  13.022 48.684 1.00 7.36  ? 151  ILE A CA  1 
ATOM   1280 C C   . ILE A 1 153 ? 13.439  12.610 49.366 1.00 7.00  ? 151  ILE A C   1 
ATOM   1281 O O   . ILE A 1 153 ? 13.717  11.419 49.557 1.00 8.37  ? 151  ILE A O   1 
ATOM   1282 C CB  . ILE A 1 153 ? 12.330  13.147 47.177 1.00 8.65  ? 151  ILE A CB  1 
ATOM   1283 C CG1 . ILE A 1 153 ? 12.705  11.774 46.565 1.00 10.56 ? 151  ILE A CG1 1 
ATOM   1284 C CG2 . ILE A 1 153 ? 13.214  14.289 46.697 1.00 9.10  ? 151  ILE A CG2 1 
ATOM   1285 C CD1 . ILE A 1 153 ? 12.369  11.587 45.108 1.00 13.49 ? 151  ILE A CD1 1 
ATOM   1286 N N   . TYR A 1 154 ? 14.207  13.554 49.887 1.00 7.73  ? 152  TYR A N   1 
ATOM   1287 C CA  . TYR A 1 154 ? 15.402  13.271 50.680 1.00 7.75  ? 152  TYR A CA  1 
ATOM   1288 C C   . TYR A 1 154 ? 15.011  12.456 51.915 1.00 6.64  ? 152  TYR A C   1 
ATOM   1289 O O   . TYR A 1 154 ? 15.612  11.419 52.201 1.00 6.78  ? 152  TYR A O   1 
ATOM   1290 C CB  . TYR A 1 154 ? 16.031  14.567 51.106 1.00 8.59  ? 152  TYR A CB  1 
ATOM   1291 C CG  . TYR A 1 154 ? 17.243  14.438 51.974 1.00 9.22  ? 152  TYR A CG  1 
ATOM   1292 C CD1 . TYR A 1 154 ? 18.417  13.986 51.538 1.00 12.10 ? 152  TYR A CD1 1 
ATOM   1293 C CD2 . TYR A 1 154 ? 17.197  14.918 53.289 1.00 10.00 ? 152  TYR A CD2 1 
ATOM   1294 C CE1 . TYR A 1 154 ? 19.562  13.963 52.349 1.00 13.97 ? 152  TYR A CE1 1 
ATOM   1295 C CE2 . TYR A 1 154 ? 18.297  14.817 54.107 1.00 11.09 ? 152  TYR A CE2 1 
ATOM   1296 C CZ  . TYR A 1 154 ? 19.496  14.340 53.629 1.00 13.26 ? 152  TYR A CZ  1 
ATOM   1297 O OH  . TYR A 1 154 ? 20.602  14.304 54.455 1.00 19.17 ? 152  TYR A OH  1 
ATOM   1298 N N   . ASN A 1 155 ? 14.038  12.942 52.663 1.00 6.59  ? 153  ASN A N   1 
ATOM   1299 C CA  . ASN A 1 155 ? 13.591  12.214 53.859 1.00 6.76  ? 153  ASN A CA  1 
ATOM   1300 C C   . ASN A 1 155 ? 13.004  10.838 53.553 1.00 7.85  ? 153  ASN A C   1 
ATOM   1301 O O   . ASN A 1 155 ? 13.172  9.912  54.341 1.00 8.34  ? 153  ASN A O   1 
ATOM   1302 C CB  . ASN A 1 155 ? 12.712  13.090 54.713 1.00 6.49  ? 153  ASN A CB  1 
ATOM   1303 C CG  . ASN A 1 155 ? 13.534  14.069 55.480 1.00 8.07  ? 153  ASN A CG  1 
ATOM   1304 O OD1 . ASN A 1 155 ? 14.522  13.667 56.118 1.00 8.46  ? 153  ASN A OD1 1 
ATOM   1305 N ND2 . ASN A 1 155 ? 13.112  15.365 55.428 1.00 14.41 ? 153  ASN A ND2 1 
ATOM   1306 N N   . GLU A 1 156 ? 12.340  10.682 52.431 1.00 7.80  ? 154  GLU A N   1 
ATOM   1307 C CA  . GLU A 1 156 ? 11.865  9.342  51.992 1.00 7.72  ? 154  GLU A CA  1 
ATOM   1308 C C   . GLU A 1 156 ? 13.065  8.447  51.686 1.00 8.58  ? 154  GLU A C   1 
ATOM   1309 O O   . GLU A 1 156 ? 13.097  7.278  52.074 1.00 9.41  ? 154  GLU A O   1 
ATOM   1310 C CB  . GLU A 1 156 ? 10.973  9.445  50.741 1.00 7.50  ? 154  GLU A CB  1 
ATOM   1311 C CG  . GLU A 1 156 ? 10.555  8.040  50.300 1.00 9.45  ? 154  GLU A CG  1 
ATOM   1312 C CD  . GLU A 1 156 ? 9.776   8.000  49.011 1.00 10.21 ? 154  GLU A CD  1 
ATOM   1313 O OE1 . GLU A 1 156 ? 9.472   9.069  48.411 1.00 10.33 ? 154  GLU A OE1 1 
ATOM   1314 O OE2 . GLU A 1 156 ? 9.451   6.853  48.611 1.00 11.52 ? 154  GLU A OE2 1 
ATOM   1315 N N   A SER A 1 157 ? 14.062  8.967  50.993 0.60 8.28  ? 155  SER A N   1 
ATOM   1316 N N   B SER A 1 157 ? 14.072  8.979  50.997 0.40 8.35  ? 155  SER A N   1 
ATOM   1317 C CA  A SER A 1 157 ? 15.201  8.200  50.571 0.60 9.50  ? 155  SER A CA  1 
ATOM   1318 C CA  B SER A 1 157 ? 15.243  8.220  50.589 0.40 9.08  ? 155  SER A CA  1 
ATOM   1319 C C   A SER A 1 157 ? 16.030  7.709  51.765 0.60 9.14  ? 155  SER A C   1 
ATOM   1320 C C   B SER A 1 157 ? 16.059  7.716  51.765 0.40 9.27  ? 155  SER A C   1 
ATOM   1321 O O   A SER A 1 157 ? 16.639  6.639  51.645 0.60 11.24 ? 155  SER A O   1 
ATOM   1322 O O   B SER A 1 157 ? 16.708  6.673  51.638 0.40 11.59 ? 155  SER A O   1 
ATOM   1323 C CB  A SER A 1 157 ? 15.980  9.069  49.597 0.60 10.71 ? 155  SER A CB  1 
ATOM   1324 C CB  B SER A 1 157 ? 16.090  9.071  49.641 0.40 9.40  ? 155  SER A CB  1 
ATOM   1325 O OG  A SER A 1 157 ? 15.184  9.437  48.434 0.60 12.11 ? 155  SER A OG  1 
ATOM   1326 O OG  B SER A 1 157 ? 16.980  9.994  50.274 0.40 7.54  ? 155  SER A OG  1 
ATOM   1327 N N   . LEU A 1 158 ? 16.003  8.413  52.887 1.00 9.82  ? 156  LEU A N   1 
ATOM   1328 C CA  . LEU A 1 158 ? 16.780  8.006  54.082 1.00 11.53 ? 156  LEU A CA  1 
ATOM   1329 C C   . LEU A 1 158 ? 16.152  6.784  54.715 1.00 11.50 ? 156  LEU A C   1 
ATOM   1330 O O   . LEU A 1 158 ? 16.800  6.098  55.513 1.00 13.31 ? 156  LEU A O   1 
ATOM   1331 C CB  . LEU A 1 158 ? 16.778  9.129  55.121 1.00 9.49  ? 156  LEU A CB  1 
ATOM   1332 C CG  . LEU A 1 158 ? 17.736  10.308 54.855 1.00 10.10 ? 156  LEU A CG  1 
ATOM   1333 C CD1 . LEU A 1 158 ? 17.364  11.508 55.696 1.00 10.71 ? 156  LEU A CD1 1 
ATOM   1334 C CD2 . LEU A 1 158 ? 19.134  9.832  55.136 1.00 12.91 ? 156  LEU A CD2 1 
ATOM   1335 N N   . GLU A 1 159 ? 14.888  6.489  54.398 1.00 10.74 ? 157  GLU A N   1 
ATOM   1336 C CA  . GLU A 1 159 ? 14.204  5.283  54.984 1.00 11.80 ? 157  GLU A CA  1 
ATOM   1337 C C   . GLU A 1 159 ? 14.603  3.972  54.355 1.00 12.56 ? 157  GLU A C   1 
ATOM   1338 O O   . GLU A 1 159 ? 14.259  2.913  54.912 1.00 16.89 ? 157  GLU A O   1 
ATOM   1339 C CB  . GLU A 1 159 ? 12.726  5.469  54.808 1.00 11.53 ? 157  GLU A CB  1 
ATOM   1340 C CG  . GLU A 1 159 ? 12.166  6.625  55.657 1.00 12.97 ? 157  GLU A CG  1 
ATOM   1341 C CD  . GLU A 1 159 ? 12.375  6.355  57.157 1.00 13.77 ? 157  GLU A CD  1 
ATOM   1342 O OE1 . GLU A 1 159 ? 12.148  5.265  57.686 1.00 20.97 ? 157  GLU A OE1 1 
ATOM   1343 O OE2 . GLU A 1 159 ? 12.742  7.258  57.885 1.00 16.28 ? 157  GLU A OE2 1 
ATOM   1344 N N   . SER A 1 160 ? 15.423  3.999  53.321 1.00 12.35 ? 158  SER A N   1 
ATOM   1345 C CA  . SER A 1 160 ? 15.989  2.792  52.716 1.00 13.12 ? 158  SER A CA  1 
ATOM   1346 C C   . SER A 1 160 ? 17.459  3.006  52.324 1.00 11.33 ? 158  SER A C   1 
ATOM   1347 O O   . SER A 1 160 ? 18.070  3.937  52.830 1.00 13.62 ? 158  SER A O   1 
ATOM   1348 C CB  . SER A 1 160 ? 15.150  2.398  51.506 1.00 15.38 ? 158  SER A CB  1 
ATOM   1349 O OG  . SER A 1 160 ? 15.385  3.278  50.442 1.00 13.82 ? 158  SER A OG  1 
ATOM   1350 N N   . ASN A 1 161 ? 18.029  2.192  51.411 1.00 14.25 ? 159  ASN A N   1 
ATOM   1351 C CA  . ASN A 1 161 ? 19.368  2.454  50.929 1.00 15.83 ? 159  ASN A CA  1 
ATOM   1352 C C   . ASN A 1 161 ? 19.375  3.390  49.745 1.00 14.39 ? 159  ASN A C   1 
ATOM   1353 O O   . ASN A 1 161 ? 20.447  3.666  49.223 1.00 14.97 ? 159  ASN A O   1 
ATOM   1354 C CB  . ASN A 1 161 ? 20.116  1.158  50.618 1.00 16.39 ? 159  ASN A CB  1 
ATOM   1355 C CG  . ASN A 1 161 ? 20.279  0.295  51.817 1.00 17.96 ? 159  ASN A CG  1 
ATOM   1356 O OD1 . ASN A 1 161 ? 19.951  -0.915 51.776 1.00 23.58 ? 159  ASN A OD1 1 
ATOM   1357 N ND2 . ASN A 1 161 ? 20.814  0.891  52.897 1.00 20.54 ? 159  ASN A ND2 1 
ATOM   1358 N N   . LEU A 1 162 ? 18.191  3.940  49.391 1.00 12.74 ? 160  LEU A N   1 
ATOM   1359 C CA  . LEU A 1 162 ? 18.078  4.816  48.258 1.00 11.89 ? 160  LEU A CA  1 
ATOM   1360 C C   . LEU A 1 162 ? 18.993  6.051  48.319 1.00 11.62 ? 160  LEU A C   1 
ATOM   1361 O O   . LEU A 1 162 ? 19.653  6.348  47.319 1.00 11.57 ? 160  LEU A O   1 
ATOM   1362 C CB  . LEU A 1 162 ? 16.636  5.229  48.101 1.00 15.56 ? 160  LEU A CB  1 
ATOM   1363 C CG  . LEU A 1 162 ? 16.343  6.117  46.899 1.00 15.07 ? 160  LEU A CG  1 
ATOM   1364 C CD1 . LEU A 1 162 ? 16.746  5.405  45.629 1.00 15.86 ? 160  LEU A CD1 1 
ATOM   1365 C CD2 . LEU A 1 162 ? 14.870  6.499  46.932 1.00 13.52 ? 160  LEU A CD2 1 
ATOM   1366 N N   . LEU A 1 163 ? 19.004  6.794  49.424 1.00 10.64 ? 161  LEU A N   1 
ATOM   1367 C CA  . LEU A 1 163 ? 19.892  7.987  49.449 1.00 9.93  ? 161  LEU A CA  1 
ATOM   1368 C C   . LEU A 1 163 ? 21.351  7.638  49.228 1.00 11.39 ? 161  LEU A C   1 
ATOM   1369 O O   . LEU A 1 163 ? 22.028  8.250  48.401 1.00 12.28 ? 161  LEU A O   1 
ATOM   1370 C CB  . LEU A 1 163 ? 19.782  8.813  50.741 1.00 13.18 ? 161  LEU A CB  1 
ATOM   1371 C CG  . LEU A 1 163 ? 20.599  10.130 50.838 1.00 14.90 ? 161  LEU A CG  1 
ATOM   1372 C CD1 . LEU A 1 163 ? 20.272  10.993 49.652 1.00 15.41 ? 161  LEU A CD1 1 
ATOM   1373 C CD2 . LEU A 1 163 ? 20.433  10.915 52.127 1.00 16.91 ? 161  LEU A CD2 1 
ATOM   1374 N N   . GLU A 1 164 ? 21.818  6.609  49.924 1.00 13.14 ? 162  GLU A N   1 
ATOM   1375 C CA  . GLU A 1 164 ? 23.177  6.127  49.781 1.00 14.60 ? 162  GLU A CA  1 
ATOM   1376 C C   . GLU A 1 164 ? 23.455  5.698  48.326 1.00 13.15 ? 162  GLU A C   1 
ATOM   1377 O O   . GLU A 1 164 ? 24.469  6.093  47.750 1.00 14.52 ? 162  GLU A O   1 
ATOM   1378 C CB  . GLU A 1 164 ? 23.480  4.979  50.729 1.00 16.26 ? 162  GLU A CB  1 
ATOM   1379 C CG  . GLU A 1 164 ? 24.959  4.563  50.717 1.00 19.57 ? 162  GLU A CG  1 
ATOM   1380 C CD  . GLU A 1 164 ? 25.257  3.170  51.296 1.00 22.07 ? 162  GLU A CD  1 
ATOM   1381 O OE1 . GLU A 1 164 ? 24.376  2.345  51.551 1.00 27.43 ? 162  GLU A OE1 1 
ATOM   1382 O OE2 . GLU A 1 164 ? 26.458  2.893  51.449 1.00 41.90 ? 162  GLU A OE2 1 
ATOM   1383 N N   . ARG A 1 165 ? 22.515  4.970  47.726 1.00 11.88 ? 163  ARG A N   1 
ATOM   1384 C CA  . ARG A 1 165 ? 22.626  4.548  46.338 1.00 12.50 ? 163  ARG A CA  1 
ATOM   1385 C C   . ARG A 1 165 ? 22.715  5.750  45.391 1.00 10.29 ? 163  ARG A C   1 
ATOM   1386 O O   . ARG A 1 165 ? 23.524  5.744  44.442 1.00 12.15 ? 163  ARG A O   1 
ATOM   1387 C CB  . ARG A 1 165 ? 21.474  3.615  45.963 1.00 12.31 ? 163  ARG A CB  1 
ATOM   1388 C CG  . ARG A 1 165 ? 21.668  2.237  46.606 1.00 12.31 ? 163  ARG A CG  1 
ATOM   1389 C CD  . ARG A 1 165 ? 20.570  1.281  46.276 1.00 13.50 ? 163  ARG A CD  1 
ATOM   1390 N NE  . ARG A 1 165 ? 20.439  1.113  44.864 1.00 14.14 ? 163  ARG A NE  1 
ATOM   1391 C CZ  . ARG A 1 165 ? 19.519  0.353  44.293 1.00 13.28 ? 163  ARG A CZ  1 
ATOM   1392 N NH1 . ARG A 1 165 ? 18.716  -0.391 45.052 1.00 17.70 ? 163  ARG A NH1 1 
ATOM   1393 N NH2 . ARG A 1 165 ? 19.421  0.308  42.950 1.00 12.94 ? 163  ARG A NH2 1 
ATOM   1394 N N   A MET A 1 166 ? 21.853  6.761  45.579 0.50 9.80  ? 164  MET A N   1 
ATOM   1395 N N   B MET A 1 166 ? 21.856  6.756  45.595 0.50 10.44 ? 164  MET A N   1 
ATOM   1396 C CA  A MET A 1 166 ? 21.925  7.945  44.733 0.50 11.10 ? 164  MET A CA  1 
ATOM   1397 C CA  B MET A 1 166 ? 21.901  7.952  44.772 0.50 12.40 ? 164  MET A CA  1 
ATOM   1398 C C   A MET A 1 166 ? 23.240  8.716  44.884 0.50 10.21 ? 164  MET A C   1 
ATOM   1399 C C   B MET A 1 166 ? 23.219  8.726  44.896 0.50 10.66 ? 164  MET A C   1 
ATOM   1400 O O   A MET A 1 166 ? 23.746  9.309  43.941 0.50 11.94 ? 164  MET A O   1 
ATOM   1401 O O   B MET A 1 166 ? 23.704  9.326  43.949 0.50 12.78 ? 164  MET A O   1 
ATOM   1402 C CB  A MET A 1 166 ? 20.758  8.901  44.983 0.50 9.42  ? 164  MET A CB  1 
ATOM   1403 C CB  B MET A 1 166 ? 20.727  8.869  45.111 0.50 12.12 ? 164  MET A CB  1 
ATOM   1404 C CG  A MET A 1 166 ? 19.453  8.419  44.341 0.50 9.03  ? 164  MET A CG  1 
ATOM   1405 C CG  B MET A 1 166 ? 19.385  8.204  44.785 0.50 12.51 ? 164  MET A CG  1 
ATOM   1406 S SD  A MET A 1 166 ? 18.120  9.626  44.493 0.50 8.60  ? 164  MET A SD  1 
ATOM   1407 S SD  B MET A 1 166 ? 17.957  9.054  45.475 0.50 16.81 ? 164  MET A SD  1 
ATOM   1408 C CE  A MET A 1 166 ? 17.718  9.505  46.222 0.50 10.39 ? 164  MET A CE  1 
ATOM   1409 C CE  B MET A 1 166 ? 18.130  10.577 44.595 0.50 16.73 ? 164  MET A CE  1 
ATOM   1410 N N   . GLN A 1 167 ? 23.799  8.711  46.088 1.00 11.58 ? 165  GLN A N   1 
ATOM   1411 C CA  . GLN A 1 167 ? 25.113  9.294  46.322 1.00 11.39 ? 165  GLN A CA  1 
ATOM   1412 C C   . GLN A 1 167 ? 26.234  8.524  45.634 1.00 14.50 ? 165  GLN A C   1 
ATOM   1413 O O   . GLN A 1 167 ? 27.350  8.995  45.580 1.00 21.60 ? 165  GLN A O   1 
ATOM   1414 C CB  . GLN A 1 167 ? 25.331  9.509  47.827 1.00 15.45 ? 165  GLN A CB  1 
ATOM   1415 C CG  . GLN A 1 167 ? 24.404  10.617 48.324 1.00 17.04 ? 165  GLN A CG  1 
ATOM   1416 C CD  . GLN A 1 167 ? 24.445  11.029 49.781 1.00 24.26 ? 165  GLN A CD  1 
ATOM   1417 O OE1 . GLN A 1 167 ? 24.767  10.223 50.710 1.00 21.44 ? 165  GLN A OE1 1 
ATOM   1418 N NE2 . GLN A 1 167 ? 24.081  12.327 50.005 1.00 19.79 ? 165  GLN A NE2 1 
ATOM   1419 N N   . GLU A 1 168 ? 25.935  7.298  45.216 1.00 13.78 ? 166  GLU A N   1 
ATOM   1420 C CA  . GLU A 1 168 ? 26.833  6.475  44.433 1.00 13.40 ? 166  GLU A CA  1 
ATOM   1421 C C   . GLU A 1 168 ? 26.728  6.700  42.929 1.00 14.36 ? 166  GLU A C   1 
ATOM   1422 O O   . GLU A 1 168 ? 27.390  6.001  42.153 1.00 21.76 ? 166  GLU A O   1 
ATOM   1423 C CB  . GLU A 1 168 ? 26.701  4.969  44.786 1.00 15.34 ? 166  GLU A CB  1 
ATOM   1424 C CG  . GLU A 1 168 ? 27.063  4.653  46.203 1.00 16.99 ? 166  GLU A CG  1 
ATOM   1425 C CD  . GLU A 1 168 ? 26.716  3.229  46.640 1.00 18.10 ? 166  GLU A CD  1 
ATOM   1426 O OE1 . GLU A 1 168 ? 25.779  2.623  46.101 1.00 18.47 ? 166  GLU A OE1 1 
ATOM   1427 O OE2 . GLU A 1 168 ? 27.318  2.730  47.609 1.00 24.79 ? 166  GLU A OE2 1 
ATOM   1428 N N   . LEU A 1 169 ? 25.882  7.631  42.463 1.00 15.22 ? 167  LEU A N   1 
ATOM   1429 C CA  . LEU A 1 169 ? 25.932  8.107  41.058 1.00 16.46 ? 167  LEU A CA  1 
ATOM   1430 C C   . LEU A 1 169 ? 27.322  8.632  40.679 1.00 20.69 ? 167  LEU A C   1 
ATOM   1431 O O   . LEU A 1 169 ? 27.827  9.561  41.276 1.00 29.58 ? 167  LEU A O   1 
ATOM   1432 C CB  . LEU A 1 169 ? 24.828  9.137  40.787 1.00 14.29 ? 167  LEU A CB  1 
ATOM   1433 C CG  . LEU A 1 169 ? 23.481  8.472  40.535 1.00 13.11 ? 167  LEU A CG  1 
ATOM   1434 C CD1 . LEU A 1 169 ? 22.312  9.391  40.677 1.00 13.65 ? 167  LEU A CD1 1 
ATOM   1435 C CD2 . LEU A 1 169 ? 23.533  7.824  39.122 1.00 13.49 ? 167  LEU A CD2 1 
ATOM   1436 N N   . ALA B 1 2   ? -14.393 44.861 21.178 1.00 47.11 ? 0    ALA B N   1 
ATOM   1437 C CA  . ALA B 1 2   ? -13.451 45.994 20.855 1.00 34.81 ? 0    ALA B CA  1 
ATOM   1438 C C   . ALA B 1 2   ? -12.775 45.766 19.486 1.00 31.29 ? 0    ALA B C   1 
ATOM   1439 O O   . ALA B 1 2   ? -12.565 46.702 18.713 1.00 40.87 ? 0    ALA B O   1 
ATOM   1440 C CB  . ALA B 1 2   ? -12.395 46.122 21.956 1.00 50.67 ? 0    ALA B CB  1 
ATOM   1441 N N   . MET B 1 3   ? -12.428 44.497 19.219 1.00 25.71 ? 1    MET B N   1 
ATOM   1442 C CA  . MET B 1 3   ? -11.674 44.075 18.017 1.00 22.40 ? 1    MET B CA  1 
ATOM   1443 C C   . MET B 1 3   ? -12.601 43.428 17.014 1.00 16.80 ? 1    MET B C   1 
ATOM   1444 O O   . MET B 1 3   ? -12.135 42.731 16.035 1.00 16.12 ? 1    MET B O   1 
ATOM   1445 C CB  . MET B 1 3   ? -10.613 43.032 18.399 1.00 18.29 ? 1    MET B CB  1 
ATOM   1446 C CG  . MET B 1 3   ? -9.469  43.603 19.203 1.00 23.28 ? 1    MET B CG  1 
ATOM   1447 S SD  . MET B 1 3   ? -8.371  42.439 19.985 1.00 22.06 ? 1    MET B SD  1 
ATOM   1448 C CE  . MET B 1 3   ? -7.653  41.706 18.625 1.00 15.46 ? 1    MET B CE  1 
ATOM   1449 N N   . ASP B 1 4   ? -13.905 43.628 17.190 1.00 18.40 ? 2    ASP B N   1 
ATOM   1450 C CA  . ASP B 1 4   ? -14.971 42.939 16.452 1.00 20.80 ? 2    ASP B CA  1 
ATOM   1451 C C   . ASP B 1 4   ? -14.833 43.132 14.943 1.00 16.22 ? 2    ASP B C   1 
ATOM   1452 O O   . ASP B 1 4   ? -15.041 42.195 14.145 1.00 15.77 ? 2    ASP B O   1 
ATOM   1453 C CB  . ASP B 1 4   ? -16.393 43.469 16.864 1.00 25.37 ? 2    ASP B CB  1 
ATOM   1454 C CG  . ASP B 1 4   ? -17.073 42.643 17.963 1.00 24.84 ? 2    ASP B CG  1 
ATOM   1455 O OD1 . ASP B 1 4   ? -16.466 41.681 18.495 1.00 22.15 ? 2    ASP B OD1 1 
ATOM   1456 O OD2 . ASP B 1 4   ? -18.252 42.961 18.289 1.00 34.62 ? 2    ASP B OD2 1 
ATOM   1457 N N   . ARG B 1 5   ? -14.434 44.334 14.533 1.00 14.23 ? 3    ARG B N   1 
ATOM   1458 C CA  . ARG B 1 5   ? -14.372 44.605 13.117 1.00 14.62 ? 3    ARG B CA  1 
ATOM   1459 C C   . ARG B 1 5   ? -13.260 43.836 12.419 1.00 12.80 ? 3    ARG B C   1 
ATOM   1460 O O   . ARG B 1 5   ? -13.218 43.777 11.207 1.00 16.04 ? 3    ARG B O   1 
ATOM   1461 C CB  . ARG B 1 5   ? -14.192 46.072 12.818 1.00 18.52 ? 3    ARG B CB  1 
ATOM   1462 C CG  . ARG B 1 5   ? -13.078 46.688 13.630 1.00 23.54 ? 3    ARG B CG  1 
ATOM   1463 C CD  . ARG B 1 5   ? -12.416 47.945 13.049 1.00 33.02 ? 3    ARG B CD  1 
ATOM   1464 N NE  . ARG B 1 5   ? -13.261 49.126 13.033 1.00 34.06 ? 3    ARG B NE  1 
ATOM   1465 C CZ  . ARG B 1 5   ? -12.831 50.385 12.858 1.00 34.48 ? 3    ARG B CZ  1 
ATOM   1466 N NH1 . ARG B 1 5   ? -11.552 50.686 12.704 1.00 42.15 ? 3    ARG B NH1 1 
ATOM   1467 N NH2 . ARG B 1 5   ? -13.706 51.371 12.860 1.00 43.45 ? 3    ARG B NH2 1 
ATOM   1468 N N   . HIS B 1 6   ? -12.340 43.259 13.231 1.00 10.19 ? 4    HIS B N   1 
ATOM   1469 C CA  . HIS B 1 6   ? -11.198 42.509 12.749 1.00 9.33  ? 4    HIS B CA  1 
ATOM   1470 C C   . HIS B 1 6   ? -11.410 41.029 12.817 1.00 9.65  ? 4    HIS B C   1 
ATOM   1471 O O   . HIS B 1 6   ? -10.515 40.283 12.464 1.00 10.04 ? 4    HIS B O   1 
ATOM   1472 C CB  . HIS B 1 6   ? -9.963  42.876 13.569 1.00 11.39 ? 4    HIS B CB  1 
ATOM   1473 C CG  . HIS B 1 6   ? -9.609  44.352 13.490 1.00 12.30 ? 4    HIS B CG  1 
ATOM   1474 N ND1 . HIS B 1 6   ? -9.121  44.918 12.412 1.00 16.76 ? 4    HIS B ND1 1 
ATOM   1475 C CD2 . HIS B 1 6   ? -9.817  45.362 14.410 1.00 17.94 ? 4    HIS B CD2 1 
ATOM   1476 C CE1 . HIS B 1 6   ? -8.966  46.234 12.630 1.00 16.64 ? 4    HIS B CE1 1 
ATOM   1477 N NE2 . HIS B 1 6   ? -9.388  46.508 13.845 1.00 20.16 ? 4    HIS B NE2 1 
ATOM   1478 N N   . LYS B 1 7   ? -12.569 40.544 13.224 1.00 6.96  ? 5    LYS B N   1 
ATOM   1479 C CA  . LYS B 1 7   ? -12.806 39.083 13.207 1.00 7.80  ? 5    LYS B CA  1 
ATOM   1480 C C   . LYS B 1 7   ? -12.897 38.632 11.752 1.00 6.93  ? 5    LYS B C   1 
ATOM   1481 O O   . LYS B 1 7   ? -13.669 39.180 10.979 1.00 7.86  ? 5    LYS B O   1 
ATOM   1482 C CB  . LYS B 1 7   ? -14.141 38.810 13.888 1.00 7.30  ? 5    LYS B CB  1 
ATOM   1483 C CG  . LYS B 1 7   ? -14.475 37.309 13.944 1.00 7.62  ? 5    LYS B CG  1 
ATOM   1484 C CD  . LYS B 1 7   ? -15.852 36.970 14.478 1.00 9.65  ? 5    LYS B CD  1 
ATOM   1485 C CE  . LYS B 1 7   ? -16.935 37.318 13.475 1.00 9.67  ? 5    LYS B CE  1 
ATOM   1486 N NZ  . LYS B 1 7   ? -16.840 36.530 12.206 1.00 9.27  ? 5    LYS B NZ  1 
ATOM   1487 N N   . PRO B 1 8   ? -12.164 37.591 11.362 1.00 7.55  ? 6    PRO B N   1 
ATOM   1488 C CA  . PRO B 1 8   ? -12.346 37.072 10.001 1.00 6.96  ? 6    PRO B CA  1 
ATOM   1489 C C   . PRO B 1 8   ? -13.772 36.527 9.845  1.00 7.97  ? 6    PRO B C   1 
ATOM   1490 O O   . PRO B 1 8   ? -14.386 35.998 10.775 1.00 7.83  ? 6    PRO B O   1 
ATOM   1491 C CB  . PRO B 1 8   ? -11.323 35.924 9.962  1.00 8.19  ? 6    PRO B CB  1 
ATOM   1492 C CG  . PRO B 1 8   ? -10.254 36.365 10.895 1.00 8.69  ? 6    PRO B CG  1 
ATOM   1493 C CD  . PRO B 1 8   ? -11.008 36.982 12.035 1.00 8.34  ? 6    PRO B CD  1 
ATOM   1494 N N   . LYS B 1 9   ? -14.283 36.573 8.646  1.00 7.27  ? 7    LYS B N   1 
ATOM   1495 C CA  . LYS B 1 9   ? -15.559 35.939 8.387  1.00 7.71  ? 7    LYS B CA  1 
ATOM   1496 C C   . LYS B 1 9   ? -15.596 34.456 8.735  1.00 8.32  ? 7    LYS B C   1 
ATOM   1497 O O   . LYS B 1 9   ? -16.632 33.878 9.124  1.00 8.61  ? 7    LYS B O   1 
ATOM   1498 C CB  . LYS B 1 9   ? -15.891 36.150 6.926  1.00 10.31 ? 7    LYS B CB  1 
ATOM   1499 C CG  . LYS B 1 9   ? -17.267 35.596 6.554  1.00 17.45 ? 7    LYS B CG  1 
ATOM   1500 C CD  . LYS B 1 9   ? -17.512 35.972 5.086  1.00 21.67 ? 7    LYS B CD  1 
ATOM   1501 C CE  . LYS B 1 9   ? -18.889 35.556 4.597  1.00 27.73 ? 7    LYS B CE  1 
ATOM   1502 N NZ  . LYS B 1 9   ? -19.041 35.758 3.131  1.00 34.92 ? 7    LYS B NZ  1 
ATOM   1503 N N   . SER B 1 10  ? -14.443 33.799 8.520  1.00 7.88  ? 8    SER B N   1 
ATOM   1504 C CA  . SER B 1 10  ? -14.350 32.327 8.715  1.00 8.18  ? 8    SER B CA  1 
ATOM   1505 C C   . SER B 1 10  ? -14.311 31.867 10.218 1.00 6.96  ? 8    SER B C   1 
ATOM   1506 O O   . SER B 1 10  ? -14.334 30.678 10.448 1.00 9.46  ? 8    SER B O   1 
ATOM   1507 C CB  . SER B 1 10  ? -13.105 31.829 7.980  1.00 10.39 ? 8    SER B CB  1 
ATOM   1508 O OG  . SER B 1 10  ? -13.150 32.129 6.600  1.00 12.13 ? 8    SER B OG  1 
ATOM   1509 N N   . ILE B 1 11  ? -14.192 32.807 11.145 1.00 7.07  ? 9    ILE B N   1 
ATOM   1510 C CA  . ILE B 1 11  ? -14.296 32.501 12.579 1.00 6.68  ? 9    ILE B CA  1 
ATOM   1511 C C   . ILE B 1 11  ? -15.704 32.825 13.028 1.00 6.66  ? 9    ILE B C   1 
ATOM   1512 O O   . ILE B 1 11  ? -16.213 33.888 12.768 1.00 7.34  ? 9    ILE B O   1 
ATOM   1513 C CB  . ILE B 1 11  ? -13.251 33.257 13.378 1.00 6.66  ? 9    ILE B CB  1 
ATOM   1514 C CG1 . ILE B 1 11  ? -11.812 32.961 12.932 1.00 8.78  ? 9    ILE B CG1 1 
ATOM   1515 C CG2 . ILE B 1 11  ? -13.381 33.082 14.894 1.00 8.13  ? 9    ILE B CG2 1 
ATOM   1516 C CD1 . ILE B 1 11  ? -11.397 31.536 13.085 1.00 9.18  ? 9    ILE B CD1 1 
ATOM   1517 N N   . SER B 1 12  ? -16.309 31.906 13.769 1.00 6.23  ? 10   SER B N   1 
ATOM   1518 C CA  . SER B 1 12  ? -17.635 32.215 14.261 1.00 7.65  ? 10   SER B CA  1 
ATOM   1519 C C   . SER B 1 12  ? -17.621 33.341 15.318 1.00 7.00  ? 10   SER B C   1 
ATOM   1520 O O   . SER B 1 12  ? -16.696 33.462 16.094 1.00 7.26  ? 10   SER B O   1 
ATOM   1521 C CB  . SER B 1 12  ? -18.293 30.951 14.839 1.00 8.79  ? 10   SER B CB  1 
ATOM   1522 O OG  . SER B 1 12  ? -17.760 30.590 16.101 1.00 7.68  ? 10   SER B OG  1 
ATOM   1523 N N   . SER B 1 13  ? -18.705 34.104 15.349 1.00 8.18  ? 11   SER B N   1 
ATOM   1524 C CA  . SER B 1 13  ? -18.859 35.117 16.343 1.00 7.51  ? 11   SER B CA  1 
ATOM   1525 C C   . SER B 1 13  ? -18.716 34.565 17.756 1.00 6.62  ? 11   SER B C   1 
ATOM   1526 O O   . SER B 1 13  ? -18.079 35.194 18.598 1.00 7.19  ? 11   SER B O   1 
ATOM   1527 C CB  . SER B 1 13  ? -20.159 35.867 16.187 1.00 9.38  ? 11   SER B CB  1 
ATOM   1528 O OG  . SER B 1 13  ? -20.209 36.673 15.018 1.00 13.07 ? 11   SER B OG  1 
ATOM   1529 N N   . GLU B 1 14  ? -19.248 33.396 18.023 1.00 6.96  ? 12   GLU B N   1 
ATOM   1530 C CA  . GLU B 1 14  ? -19.245 32.879 19.404 1.00 7.01  ? 12   GLU B CA  1 
ATOM   1531 C C   . GLU B 1 14  ? -17.846 32.378 19.797 1.00 7.24  ? 12   GLU B C   1 
ATOM   1532 O O   . GLU B 1 14  ? -17.474 32.540 20.954 1.00 7.25  ? 12   GLU B O   1 
ATOM   1533 C CB  . GLU B 1 14  ? -20.330 31.812 19.608 1.00 8.53  ? 12   GLU B CB  1 
ATOM   1534 C CG  . GLU B 1 14  ? -20.187 30.579 18.721 1.00 9.30  ? 12   GLU B CG  1 
ATOM   1535 C CD  . GLU B 1 14  ? -20.890 30.608 17.366 1.00 10.24 ? 12   GLU B CD  1 
ATOM   1536 O OE1 . GLU B 1 14  ? -21.077 31.693 16.808 1.00 9.09  ? 12   GLU B OE1 1 
ATOM   1537 O OE2 . GLU B 1 14  ? -21.268 29.543 16.885 1.00 11.85 ? 12   GLU B OE2 1 
ATOM   1538 N N   . ILE B 1 15  ? -17.073 31.836 18.857 1.00 6.12  ? 13   ILE B N   1 
ATOM   1539 C CA  . ILE B 1 15  ? -15.671 31.478 19.158 1.00 5.52  ? 13   ILE B CA  1 
ATOM   1540 C C   . ILE B 1 15  ? -14.846 32.722 19.368 1.00 6.55  ? 13   ILE B C   1 
ATOM   1541 O O   . ILE B 1 15  ? -14.058 32.815 20.332 1.00 6.39  ? 13   ILE B O   1 
ATOM   1542 C CB  . ILE B 1 15  ? -15.088 30.549 18.054 1.00 5.47  ? 13   ILE B CB  1 
ATOM   1543 C CG1 . ILE B 1 15  ? -15.695 29.153 18.264 1.00 6.87  ? 13   ILE B CG1 1 
ATOM   1544 C CG2 . ILE B 1 15  ? -13.565 30.525 18.131 1.00 7.41  ? 13   ILE B CG2 1 
ATOM   1545 C CD1 . ILE B 1 15  ? -15.327 28.060 17.245 1.00 8.68  ? 13   ILE B CD1 1 
ATOM   1546 N N   . TRP B 1 16  ? -15.048 33.749 18.525 1.00 6.74  ? 14   TRP B N   1 
ATOM   1547 C CA  . TRP B 1 16  ? -14.373 35.006 18.728 1.00 7.09  ? 14   TRP B CA  1 
ATOM   1548 C C   . TRP B 1 16  ? -14.672 35.589 20.096 1.00 7.93  ? 14   TRP B C   1 
ATOM   1549 O O   . TRP B 1 16  ? -13.809 36.047 20.842 1.00 7.60  ? 14   TRP B O   1 
ATOM   1550 C CB  . TRP B 1 16  ? -14.765 35.962 17.611 1.00 7.15  ? 14   TRP B CB  1 
ATOM   1551 C CG  . TRP B 1 16  ? -14.005 37.231 17.596 1.00 7.29  ? 14   TRP B CG  1 
ATOM   1552 C CD1 . TRP B 1 16  ? -14.437 38.499 17.978 1.00 8.41  ? 14   TRP B CD1 1 
ATOM   1553 C CD2 . TRP B 1 16  ? -12.653 37.417 17.085 1.00 7.45  ? 14   TRP B CD2 1 
ATOM   1554 N NE1 . TRP B 1 16  ? -13.456 39.427 17.768 1.00 9.16  ? 14   TRP B NE1 1 
ATOM   1555 C CE2 . TRP B 1 16  ? -12.365 38.837 17.208 1.00 7.83  ? 14   TRP B CE2 1 
ATOM   1556 C CE3 . TRP B 1 16  ? -11.708 36.548 16.550 1.00 6.87  ? 14   TRP B CE3 1 
ATOM   1557 C CZ2 . TRP B 1 16  ? -11.162 39.364 16.779 1.00 8.94  ? 14   TRP B CZ2 1 
ATOM   1558 C CZ3 . TRP B 1 16  ? -10.498 37.090 16.146 1.00 7.60  ? 14   TRP B CZ3 1 
ATOM   1559 C CH2 . TRP B 1 16  ? -10.262 38.476 16.233 1.00 8.21  ? 14   TRP B CH2 1 
ATOM   1560 N N   . ALA B 1 17  ? -15.956 35.603 20.462 1.00 6.90  ? 15   ALA B N   1 
ATOM   1561 C CA  . ALA B 1 17  ? -16.349 36.132 21.757 1.00 7.44  ? 15   ALA B CA  1 
ATOM   1562 C C   . ALA B 1 17  ? -15.701 35.303 22.909 1.00 7.76  ? 15   ALA B C   1 
ATOM   1563 O O   . ALA B 1 17  ? -15.227 35.883 23.879 1.00 8.56  ? 15   ALA B O   1 
ATOM   1564 C CB  . ALA B 1 17  ? -17.863 36.123 21.897 1.00 8.44  ? 15   ALA B CB  1 
ATOM   1565 N N   . LEU B 1 18  ? -15.714 33.975 22.820 1.00 7.42  ? 16   LEU B N   1 
ATOM   1566 C CA  . LEU B 1 18  ? -15.153 33.156 23.868 1.00 7.85  ? 16   LEU B CA  1 
ATOM   1567 C C   . LEU B 1 18  ? -13.661 33.359 24.057 1.00 8.36  ? 16   LEU B C   1 
ATOM   1568 O O   . LEU B 1 18  ? -13.162 33.256 25.176 1.00 8.92  ? 16   LEU B O   1 
ATOM   1569 C CB  . LEU B 1 18  ? -15.469 31.666 23.669 1.00 7.23  ? 16   LEU B CB  1 
ATOM   1570 C CG  . LEU B 1 18  ? -15.023 30.676 24.734 1.00 7.75  ? 16   LEU B CG  1 
ATOM   1571 C CD1 . LEU B 1 18  ? -15.566 31.057 26.106 1.00 10.47 ? 16   LEU B CD1 1 
ATOM   1572 C CD2 . LEU B 1 18  ? -15.454 29.254 24.345 1.00 8.58  ? 16   LEU B CD2 1 
ATOM   1573 N N   . SER B 1 19  ? -12.956 33.699 22.967 1.00 7.56  ? 17   SER B N   1 
ATOM   1574 C CA  . SER B 1 19  ? -11.552 33.981 23.055 1.00 8.52  ? 17   SER B CA  1 
ATOM   1575 C C   . SER B 1 19  ? -11.230 35.194 23.912 1.00 8.56  ? 17   SER B C   1 
ATOM   1576 O O   . SER B 1 19  ? -10.044 35.323 24.276 1.00 9.79  ? 17   SER B O   1 
ATOM   1577 C CB  . SER B 1 19  ? -10.876 34.154 21.675 1.00 7.78  ? 17   SER B CB  1 
ATOM   1578 O OG  . SER B 1 19  ? -11.209 35.369 21.077 1.00 6.91  ? 17   SER B OG  1 
ATOM   1579 N N   . GLU B 1 20  ? -12.195 36.061 24.258 1.00 10.58 ? 18   GLU B N   1 
ATOM   1580 C CA  . GLU B 1 20  ? -11.919 37.092 25.336 1.00 13.75 ? 18   GLU B CA  1 
ATOM   1581 C C   . GLU B 1 20  ? -11.489 36.504 26.682 1.00 10.76 ? 18   GLU B C   1 
ATOM   1582 O O   . GLU B 1 20  ? -10.877 37.170 27.546 1.00 15.26 ? 18   GLU B O   1 
ATOM   1583 C CB  . GLU B 1 20  ? -13.138 37.928 25.556 1.00 14.69 ? 18   GLU B CB  1 
ATOM   1584 C CG  . GLU B 1 20  ? -13.518 38.684 24.317 1.00 16.50 ? 18   GLU B CG  1 
ATOM   1585 C CD  . GLU B 1 20  ? -14.872 39.430 24.516 1.00 29.08 ? 18   GLU B CD  1 
ATOM   1586 O OE1 . GLU B 1 20  ? -15.893 38.841 24.969 1.00 31.32 ? 18   GLU B OE1 1 
ATOM   1587 O OE2 . GLU B 1 20  ? -14.928 40.625 24.223 1.00 33.55 ? 18   GLU B OE2 1 
ATOM   1588 N N   . THR B 1 21  ? -11.821 35.218 26.954 1.00 13.16 ? 19   THR B N   1 
ATOM   1589 C CA  . THR B 1 21  ? -11.430 34.588 28.243 1.00 16.14 ? 19   THR B CA  1 
ATOM   1590 C C   . THR B 1 21  ? -9.946  34.265 28.315 1.00 13.41 ? 19   THR B C   1 
ATOM   1591 O O   . THR B 1 21  ? -9.417  33.960 29.393 1.00 13.29 ? 19   THR B O   1 
ATOM   1592 C CB  . THR B 1 21  ? -12.208 33.273 28.489 1.00 13.20 ? 19   THR B CB  1 
ATOM   1593 O OG1 . THR B 1 21  ? -12.164 32.840 29.859 1.00 31.80 ? 19   THR B OG1 1 
ATOM   1594 C CG2 . THR B 1 21  ? -11.841 32.212 27.583 1.00 10.91 ? 19   THR B CG2 1 
ATOM   1595 N N   . SER B 1 22  ? -9.280  34.321 27.144 1.00 13.08 ? 20   SER B N   1 
ATOM   1596 C CA  . SER B 1 22  ? -7.864  34.044 27.079 1.00 10.03 ? 20   SER B CA  1 
ATOM   1597 C C   . SER B 1 22  ? -6.855  35.180 27.084 1.00 9.01  ? 20   SER B C   1 
ATOM   1598 O O   . SER B 1 22  ? -6.867  36.092 26.283 1.00 12.20 ? 20   SER B O   1 
ATOM   1599 C CB  . SER B 1 22  ? -7.624  33.254 25.781 1.00 9.47  ? 20   SER B CB  1 
ATOM   1600 O OG  . SER B 1 22  ? -6.325  32.715 25.794 1.00 9.57  ? 20   SER B OG  1 
ATOM   1601 N N   . LYS B 1 23  ? -5.888  35.045 28.004 1.00 8.92  ? 21   LYS B N   1 
ATOM   1602 C CA  . LYS B 1 23  ? -4.761  35.931 28.108 1.00 9.57  ? 21   LYS B CA  1 
ATOM   1603 C C   . LYS B 1 23  ? -3.644  35.580 27.138 1.00 8.01  ? 21   LYS B C   1 
ATOM   1604 O O   . LYS B 1 23  ? -2.683  36.324 27.023 1.00 8.26  ? 21   LYS B O   1 
ATOM   1605 C CB  . LYS B 1 23  ? -4.248  35.949 29.558 1.00 12.34 ? 21   LYS B CB  1 
ATOM   1606 C CG  . LYS B 1 23  ? -5.289  36.508 30.530 1.00 18.18 ? 21   LYS B CG  1 
ATOM   1607 C CD  . LYS B 1 23  ? -5.121  37.992 30.633 1.00 22.87 ? 21   LYS B CD  1 
ATOM   1608 C CE  . LYS B 1 23  ? -5.913  38.570 31.803 1.00 25.47 ? 21   LYS B CE  1 
ATOM   1609 N NZ  . LYS B 1 23  ? -6.416  39.936 31.457 1.00 31.47 ? 21   LYS B NZ  1 
ATOM   1610 N N   . GLU B 1 24  ? -3.713  34.448 26.480 1.00 7.22  ? 22   GLU B N   1 
ATOM   1611 C CA  . GLU B 1 24  ? -2.580  33.985 25.649 1.00 7.26  ? 22   GLU B CA  1 
ATOM   1612 C C   . GLU B 1 24  ? -2.353  34.887 24.474 1.00 6.03  ? 22   GLU B C   1 
ATOM   1613 O O   . GLU B 1 24  ? -1.282  35.431 24.346 1.00 7.03  ? 22   GLU B O   1 
ATOM   1614 C CB  . GLU B 1 24  ? -2.811  32.540 25.230 1.00 7.99  ? 22   GLU B CB  1 
ATOM   1615 C CG  . GLU B 1 24  ? -2.605  31.522 26.391 1.00 12.71 ? 22   GLU B CG  1 
ATOM   1616 C CD  . GLU B 1 24  ? -1.077  31.319 26.667 1.00 14.76 ? 22   GLU B CD  1 
ATOM   1617 O OE1 . GLU B 1 24  ? -0.221  31.800 25.831 1.00 20.37 ? 22   GLU B OE1 1 
ATOM   1618 O OE2 . GLU B 1 24  ? -0.745  30.758 27.706 1.00 21.99 ? 22   GLU B OE2 1 
ATOM   1619 N N   . TRP B 1 25  ? -3.365  35.124 23.638 1.00 6.65  ? 23   TRP B N   1 
ATOM   1620 C CA  . TRP B 1 25  ? -3.182  36.027 22.491 1.00 6.45  ? 23   TRP B CA  1 
ATOM   1621 C C   . TRP B 1 25  ? -2.837  37.424 22.985 1.00 6.85  ? 23   TRP B C   1 
ATOM   1622 O O   . TRP B 1 25  ? -2.130  38.192 22.302 1.00 7.75  ? 23   TRP B O   1 
ATOM   1623 C CB  . TRP B 1 25  ? -4.425  36.024 21.535 1.00 6.52  ? 23   TRP B CB  1 
ATOM   1624 C CG  . TRP B 1 25  ? -5.684  36.456 22.185 1.00 6.69  ? 23   TRP B CG  1 
ATOM   1625 C CD1 . TRP B 1 25  ? -6.676  35.672 22.684 1.00 6.34  ? 23   TRP B CD1 1 
ATOM   1626 C CD2 . TRP B 1 25  ? -6.188  37.816 22.286 1.00 7.37  ? 23   TRP B CD2 1 
ATOM   1627 N NE1 . TRP B 1 25  ? -7.711  36.440 23.121 1.00 6.39  ? 23   TRP B NE1 1 
ATOM   1628 C CE2 . TRP B 1 25  ? -7.478  37.721 22.912 1.00 6.93  ? 23   TRP B CE2 1 
ATOM   1629 C CE3 . TRP B 1 25  ? -5.710  39.060 21.927 1.00 7.10  ? 23   TRP B CE3 1 
ATOM   1630 C CZ2 . TRP B 1 25  ? -8.246  38.856 23.209 1.00 7.66  ? 23   TRP B CZ2 1 
ATOM   1631 C CZ3 . TRP B 1 25  ? -6.466  40.204 22.204 1.00 8.60  ? 23   TRP B CZ3 1 
ATOM   1632 C CH2 . TRP B 1 25  ? -7.721  40.086 22.833 1.00 8.65  ? 23   TRP B CH2 1 
ATOM   1633 N N   . MET B 1 26  ? -3.376  37.833 24.143 1.00 7.26  ? 24   MET B N   1 
ATOM   1634 C CA  . MET B 1 26  ? -3.178  39.203 24.635 1.00 7.65  ? 24   MET B CA  1 
ATOM   1635 C C   . MET B 1 26  ? -1.731  39.422 25.012 1.00 8.33  ? 24   MET B C   1 
ATOM   1636 O O   . MET B 1 26  ? -1.248  40.561 24.992 1.00 10.87 ? 24   MET B O   1 
ATOM   1637 C CB  . MET B 1 26  ? -3.987  39.404 25.941 1.00 8.64  ? 24   MET B CB  1 
ATOM   1638 C CG  . MET B 1 26  ? -5.502  39.247 25.760 1.00 10.46 ? 24   MET B CG  1 
ATOM   1639 S SD  . MET B 1 26  ? -6.345  39.606 27.273 1.00 14.33 ? 24   MET B SD  1 
ATOM   1640 C CE  . MET B 1 26  ? -8.011  39.242 26.804 1.00 18.86 ? 24   MET B CE  1 
ATOM   1641 N N   . SER B 1 27  ? -0.987  38.383 25.309 1.00 8.11  ? 25   SER B N   1 
ATOM   1642 C CA  . SER B 1 27  ? 0.428   38.482 25.656 1.00 7.69  ? 25   SER B CA  1 
ATOM   1643 C C   . SER B 1 27  ? 1.345   38.602 24.441 1.00 7.30  ? 25   SER B C   1 
ATOM   1644 O O   . SER B 1 27  ? 2.553   38.837 24.610 1.00 10.81 ? 25   SER B O   1 
ATOM   1645 C CB  . SER B 1 27  ? 0.872   37.273 26.448 1.00 9.22  ? 25   SER B CB  1 
ATOM   1646 O OG  . SER B 1 27  ? 0.990   36.117 25.645 1.00 8.61  ? 25   SER B OG  1 
ATOM   1647 N N   . ASN B 1 28  ? 0.811   38.389 23.239 1.00 7.60  ? 26   ASN B N   1 
ATOM   1648 C CA  . ASN B 1 28  ? 1.635   38.468 22.053 1.00 7.82  ? 26   ASN B CA  1 
ATOM   1649 C C   . ASN B 1 28  ? 1.892   39.900 21.585 1.00 9.05  ? 26   ASN B C   1 
ATOM   1650 O O   . ASN B 1 28  ? 1.022   40.766 21.729 1.00 9.93  ? 26   ASN B O   1 
ATOM   1651 C CB  . ASN B 1 28  ? 0.951   37.662 20.931 1.00 7.76  ? 26   ASN B CB  1 
ATOM   1652 C CG  . ASN B 1 28  ? 1.903   37.174 19.853 1.00 9.40  ? 26   ASN B CG  1 
ATOM   1653 O OD1 . ASN B 1 28  ? 2.393   37.934 19.033 1.00 10.10 ? 26   ASN B OD1 1 
ATOM   1654 N ND2 . ASN B 1 28  ? 2.194   35.865 19.931 1.00 10.49 ? 26   ASN B ND2 1 
ATOM   1655 N N   . LEU B 1 29  ? 3.078   40.167 21.026 1.00 8.81  ? 27   LEU B N   1 
ATOM   1656 C CA  . LEU B 1 29  ? 3.392   41.406 20.375 1.00 9.04  ? 27   LEU B CA  1 
ATOM   1657 C C   . LEU B 1 29  ? 2.433   41.722 19.254 1.00 9.28  ? 27   LEU B C   1 
ATOM   1658 O O   . LEU B 1 29  ? 2.225   42.894 18.958 1.00 9.67  ? 27   LEU B O   1 
ATOM   1659 C CB  . LEU B 1 29  ? 4.829   41.278 19.794 1.00 12.51 ? 27   LEU B CB  1 
ATOM   1660 C CG  . LEU B 1 29  ? 5.404   42.443 19.023 1.00 16.29 ? 27   LEU B CG  1 
ATOM   1661 C CD1 . LEU B 1 29  ? 5.512   43.630 19.949 1.00 22.96 ? 27   LEU B CD1 1 
ATOM   1662 C CD2 . LEU B 1 29  ? 6.765   42.122 18.440 1.00 21.24 ? 27   LEU B CD2 1 
ATOM   1663 N N   . ARG B 1 30  ? 1.854   40.689 18.645 1.00 8.97  ? 28   ARG B N   1 
ATOM   1664 C CA  . ARG B 1 30  ? 0.919   40.888 17.533 1.00 8.25  ? 28   ARG B CA  1 
ATOM   1665 C C   . ARG B 1 30  ? -0.436  40.252 17.964 1.00 7.06  ? 28   ARG B C   1 
ATOM   1666 O O   . ARG B 1 30  ? -0.786  39.142 17.561 1.00 8.47  ? 28   ARG B O   1 
ATOM   1667 C CB  . ARG B 1 30  ? 1.427   40.180 16.291 1.00 9.52  ? 28   ARG B CB  1 
ATOM   1668 C CG  . ARG B 1 30  ? 2.681   40.834 15.793 1.00 10.58 ? 28   ARG B CG  1 
ATOM   1669 C CD  . ARG B 1 30  ? 3.242   40.031 14.565 1.00 12.83 ? 28   ARG B CD  1 
ATOM   1670 N NE  . ARG B 1 30  ? 3.992   40.983 13.736 1.00 22.14 ? 28   ARG B NE  1 
ATOM   1671 C CZ  . ARG B 1 30  ? 3.599   41.540 12.546 1.00 17.80 ? 28   ARG B CZ  1 
ATOM   1672 N NH1 . ARG B 1 30  ? 2.465   41.131 11.835 1.00 24.30 ? 28   ARG B NH1 1 
ATOM   1673 N NH2 . ARG B 1 30  ? 4.373   42.540 12.015 1.00 19.51 ? 28   ARG B NH2 1 
ATOM   1674 N N   . PRO B 1 31  ? -1.138  40.920 18.887 1.00 7.35  ? 29   PRO B N   1 
ATOM   1675 C CA  . PRO B 1 31  ? -2.300  40.266 19.504 1.00 7.62  ? 29   PRO B CA  1 
ATOM   1676 C C   . PRO B 1 31  ? -3.425  39.948 18.563 1.00 6.70  ? 29   PRO B C   1 
ATOM   1677 O O   . PRO B 1 31  ? -4.104  38.957 18.802 1.00 7.52  ? 29   PRO B O   1 
ATOM   1678 C CB  . PRO B 1 31  ? -2.708  41.295 20.568 1.00 8.48  ? 29   PRO B CB  1 
ATOM   1679 C CG  . PRO B 1 31  ? -2.212  42.596 20.013 1.00 11.29 ? 29   PRO B CG  1 
ATOM   1680 C CD  . PRO B 1 31  ? -0.904  42.277 19.425 1.00 9.23  ? 29   PRO B CD  1 
ATOM   1681 N N   . LEU B 1 32  ? -3.661  40.764 17.542 1.00 6.95  ? 30   LEU B N   1 
ATOM   1682 C CA  . LEU B 1 32  ? -4.763  40.403 16.627 1.00 7.30  ? 30   LEU B CA  1 
ATOM   1683 C C   . LEU B 1 32  ? -4.488  39.122 15.859 1.00 7.10  ? 30   LEU B C   1 
ATOM   1684 O O   . LEU B 1 32  ? -5.342  38.241 15.775 1.00 6.68  ? 30   LEU B O   1 
ATOM   1685 C CB  . LEU B 1 32  ? -5.013  41.556 15.644 1.00 8.23  ? 30   LEU B CB  1 
ATOM   1686 C CG  . LEU B 1 32  ? -6.044  41.313 14.576 1.00 8.72  ? 30   LEU B CG  1 
ATOM   1687 C CD1 . LEU B 1 32  ? -7.404  40.816 15.079 1.00 9.78  ? 30   LEU B CD1 1 
ATOM   1688 C CD2 . LEU B 1 32  ? -6.231  42.595 13.778 1.00 10.55 ? 30   LEU B CD2 1 
ATOM   1689 N N   . GLU B 1 33  ? -3.321  38.999 15.259 1.00 6.73  ? 31   GLU B N   1 
ATOM   1690 C CA  . GLU B 1 33  ? -3.000  37.771 14.567 1.00 7.19  ? 31   GLU B CA  1 
ATOM   1691 C C   . GLU B 1 33  ? -2.879  36.600 15.512 1.00 5.27  ? 31   GLU B C   1 
ATOM   1692 O O   . GLU B 1 33  ? -3.285  35.515 15.155 1.00 6.43  ? 31   GLU B O   1 
ATOM   1693 C CB  . GLU B 1 33  ? -1.767  37.973 13.738 1.00 9.10  ? 31   GLU B CB  1 
ATOM   1694 C CG  . GLU B 1 33  ? -1.971  38.914 12.546 1.00 10.23 ? 31   GLU B CG  1 
ATOM   1695 C CD  . GLU B 1 33  ? -2.130  40.370 12.946 1.00 9.14  ? 31   GLU B CD  1 
ATOM   1696 O OE1 . GLU B 1 33  ? -1.405  40.776 13.902 1.00 10.06 ? 31   GLU B OE1 1 
ATOM   1697 O OE2 . GLU B 1 33  ? -2.903  41.089 12.298 1.00 12.51 ? 31   GLU B OE2 1 
ATOM   1698 N N   . ALA B 1 34  ? -2.316  36.787 16.690 1.00 6.30  ? 32   ALA B N   1 
ATOM   1699 C CA  . ALA B 1 34  ? -2.316  35.725 17.697 1.00 6.06  ? 32   ALA B CA  1 
ATOM   1700 C C   . ALA B 1 34  ? -3.717  35.323 18.030 1.00 5.59  ? 32   ALA B C   1 
ATOM   1701 O O   . ALA B 1 34  ? -3.958  34.093 18.233 1.00 6.05  ? 32   ALA B O   1 
ATOM   1702 C CB  . ALA B 1 34  ? -1.551  36.145 18.875 1.00 6.56  ? 32   ALA B CB  1 
ATOM   1703 N N   . ARG B 1 35  ? -4.637  36.266 18.170 1.00 5.30  ? 33   ARG B N   1 
ATOM   1704 C CA  . ARG B 1 35  ? -6.020  35.919 18.511 1.00 5.22  ? 33   ARG B CA  1 
ATOM   1705 C C   . ARG B 1 35  ? -6.669  35.090 17.424 1.00 5.03  ? 33   ARG B C   1 
ATOM   1706 O O   . ARG B 1 35  ? -7.353  34.132 17.693 1.00 4.93  ? 33   ARG B O   1 
ATOM   1707 C CB  . ARG B 1 35  ? -6.802  37.176 18.804 1.00 5.52  ? 33   ARG B CB  1 
ATOM   1708 C CG  . ARG B 1 35  ? -8.207  36.888 19.382 1.00 5.21  ? 33   ARG B CG  1 
ATOM   1709 C CD  . ARG B 1 35  ? -8.893  38.193 19.663 1.00 5.48  ? 33   ARG B CD  1 
ATOM   1710 N NE  . ARG B 1 35  ? -10.236 37.913 20.206 1.00 6.83  ? 33   ARG B NE  1 
ATOM   1711 C CZ  . ARG B 1 35  ? -11.093 38.861 20.585 1.00 7.73  ? 33   ARG B CZ  1 
ATOM   1712 N NH1 . ARG B 1 35  ? -10.733 40.125 20.501 1.00 7.11  ? 33   ARG B NH1 1 
ATOM   1713 N NH2 . ARG B 1 35  ? -12.297 38.544 21.061 1.00 9.08  ? 33   ARG B NH2 1 
ATOM   1714 N N   . ILE B 1 36  ? -6.427  35.467 16.174 1.00 5.52  ? 34   ILE B N   1 
ATOM   1715 C CA  . ILE B 1 36  ? -6.946  34.731 15.047 1.00 6.19  ? 34   ILE B CA  1 
ATOM   1716 C C   . ILE B 1 36  ? -6.393  33.311 15.071 1.00 5.68  ? 34   ILE B C   1 
ATOM   1717 O O   . ILE B 1 36  ? -7.133  32.346 14.919 1.00 5.44  ? 34   ILE B O   1 
ATOM   1718 C CB  . ILE B 1 36  ? -6.683  35.448 13.721 1.00 5.96  ? 34   ILE B CB  1 
ATOM   1719 C CG1 . ILE B 1 36  ? -7.496  36.773 13.698 1.00 6.53  ? 34   ILE B CG1 1 
ATOM   1720 C CG2 . ILE B 1 36  ? -6.975  34.549 12.516 1.00 7.18  ? 34   ILE B CG2 1 
ATOM   1721 C CD1 . ILE B 1 36  ? -7.086  37.750 12.609 1.00 9.09  ? 34   ILE B CD1 1 
ATOM   1722 N N   . VAL B 1 37  ? -5.067  33.128 15.217 1.00 5.13  ? 35   VAL B N   1 
ATOM   1723 C CA  . VAL B 1 37  ? -4.490  31.792 15.254 1.00 6.11  ? 35   VAL B CA  1 
ATOM   1724 C C   . VAL B 1 37  ? -5.060  30.980 16.431 1.00 5.39  ? 35   VAL B C   1 
ATOM   1725 O O   . VAL B 1 37  ? -5.355  29.798 16.261 1.00 5.51  ? 35   VAL B O   1 
ATOM   1726 C CB  . VAL B 1 37  ? -2.941  31.857 15.265 1.00 6.54  ? 35   VAL B CB  1 
ATOM   1727 C CG1 . VAL B 1 37  ? -2.354  30.418 15.545 1.00 9.08  ? 35   VAL B CG1 1 
ATOM   1728 C CG2 . VAL B 1 37  ? -2.489  32.392 13.974 1.00 7.55  ? 35   VAL B CG2 1 
ATOM   1729 N N   . GLU B 1 38  ? -5.240  31.610 17.591 1.00 5.66  ? 36   GLU B N   1 
ATOM   1730 C CA  . GLU B 1 38  ? -5.789  30.876 18.725 1.00 5.04  ? 36   GLU B CA  1 
ATOM   1731 C C   . GLU B 1 38  ? -7.231  30.439 18.472 1.00 4.33  ? 36   GLU B C   1 
ATOM   1732 O O   . GLU B 1 38  ? -7.623  29.349 18.824 1.00 5.65  ? 36   GLU B O   1 
ATOM   1733 C CB  . GLU B 1 38  ? -5.701  31.770 19.979 1.00 5.28  ? 36   GLU B CB  1 
ATOM   1734 C CG  . GLU B 1 38  ? -5.891  31.024 21.256 1.00 5.63  ? 36   GLU B CG  1 
ATOM   1735 C CD  . GLU B 1 38  ? -5.670  31.837 22.514 1.00 6.93  ? 36   GLU B CD  1 
ATOM   1736 O OE1 . GLU B 1 38  ? -4.965  32.823 22.487 1.00 7.91  ? 36   GLU B OE1 1 
ATOM   1737 O OE2 . GLU B 1 38  ? -6.160  31.418 23.559 1.00 8.91  ? 36   GLU B OE2 1 
ATOM   1738 N N   . CYS B 1 39  ? -8.020  31.277 17.819 1.00 4.38  ? 37   CYS B N   1 
ATOM   1739 C CA  . CYS B 1 39  ? -9.375  30.909 17.405 1.00 4.71  ? 37   CYS B CA  1 
ATOM   1740 C C   . CYS B 1 39  ? -9.330  29.816 16.334 1.00 4.47  ? 37   CYS B C   1 
ATOM   1741 O O   . CYS B 1 39  ? -10.186 28.922 16.340 1.00 5.30  ? 37   CYS B O   1 
ATOM   1742 C CB  . CYS B 1 39  ? -10.147 32.074 16.842 1.00 5.08  ? 37   CYS B CB  1 
ATOM   1743 S SG  . CYS B 1 39  ? -10.649 33.298 18.112 1.00 6.27  ? 37   CYS B SG  1 
ATOM   1744 N N   . ILE B 1 40  ? -8.355  29.856 15.440 1.00 4.90  ? 38   ILE B N   1 
ATOM   1745 C CA  . ILE B 1 40  ? -8.194  28.717 14.473 1.00 5.60  ? 38   ILE B CA  1 
ATOM   1746 C C   . ILE B 1 40  ? -7.925  27.432 15.239 1.00 4.63  ? 38   ILE B C   1 
ATOM   1747 O O   . ILE B 1 40  ? -8.495  26.369 14.934 1.00 4.89  ? 38   ILE B O   1 
ATOM   1748 C CB  . ILE B 1 40  ? -7.074  29.046 13.460 1.00 5.45  ? 38   ILE B CB  1 
ATOM   1749 C CG1 . ILE B 1 40  ? -7.469  30.184 12.552 1.00 6.30  ? 38   ILE B CG1 1 
ATOM   1750 C CG2 . ILE B 1 40  ? -6.631  27.816 12.690 1.00 8.16  ? 38   ILE B CG2 1 
ATOM   1751 C CD1 . ILE B 1 40  ? -6.365  30.673 11.592 1.00 6.74  ? 38   ILE B CD1 1 
ATOM   1752 N N   . LYS B 1 41  ? -6.995  27.420 16.196 1.00 4.42  ? 39   LYS B N   1 
ATOM   1753 C CA  . LYS B 1 41  ? -6.700  26.261 17.005 1.00 4.37  ? 39   LYS B CA  1 
ATOM   1754 C C   . LYS B 1 41  ? -7.969  25.736 17.714 1.00 4.18  ? 39   LYS B C   1 
ATOM   1755 O O   . LYS B 1 41  ? -8.244  24.557 17.698 1.00 4.94  ? 39   LYS B O   1 
ATOM   1756 C CB  . LYS B 1 41  ? -5.579  26.660 18.012 1.00 4.96  ? 39   LYS B CB  1 
ATOM   1757 C CG  . LYS B 1 41  ? -5.272  25.562 19.020 1.00 6.50  ? 39   LYS B CG  1 
ATOM   1758 C CD  . LYS B 1 41  ? -4.187  26.011 19.990 1.00 8.74  ? 39   LYS B CD  1 
ATOM   1759 C CE  . LYS B 1 41  ? -3.935  25.090 21.107 1.00 8.87  ? 39   LYS B CE  1 
ATOM   1760 N NZ  . LYS B 1 41  ? -2.675  25.595 21.819 1.00 14.16 ? 39   LYS B NZ  1 
ATOM   1761 N N   . TYR B 1 42  ? -8.718  26.624 18.348 1.00 4.59  ? 40   TYR B N   1 
ATOM   1762 C CA  . TYR B 1 42  ? -9.916  26.200 19.024 1.00 4.46  ? 40   TYR B CA  1 
ATOM   1763 C C   . TYR B 1 42  ? -10.941 25.596 18.058 1.00 5.13  ? 40   TYR B C   1 
ATOM   1764 O O   . TYR B 1 42  ? -11.526 24.570 18.339 1.00 5.36  ? 40   TYR B O   1 
ATOM   1765 C CB  . TYR B 1 42  ? -10.568 27.355 19.801 1.00 4.63  ? 40   TYR B CB  1 
ATOM   1766 C CG  . TYR B 1 42  ? -11.714 26.851 20.682 1.00 5.24  ? 40   TYR B CG  1 
ATOM   1767 C CD1 . TYR B 1 42  ? -11.442 26.165 21.874 1.00 4.76  ? 40   TYR B CD1 1 
ATOM   1768 C CD2 . TYR B 1 42  ? -13.056 27.120 20.342 1.00 5.48  ? 40   TYR B CD2 1 
ATOM   1769 C CE1 . TYR B 1 42  ? -12.485 25.796 22.675 1.00 5.83  ? 40   TYR B CE1 1 
ATOM   1770 C CE2 . TYR B 1 42  ? -14.088 26.746 21.195 1.00 5.83  ? 40   TYR B CE2 1 
ATOM   1771 C CZ  . TYR B 1 42  ? -13.806 26.081 22.355 1.00 5.28  ? 40   TYR B CZ  1 
ATOM   1772 O OH  . TYR B 1 42  ? -14.787 25.634 23.233 1.00 6.96  ? 40   TYR B OH  1 
ATOM   1773 N N   . THR B 1 43  ? -11.102 26.199 16.882 1.00 4.51  ? 41   THR B N   1 
ATOM   1774 C CA  . THR B 1 43  ? -12.048 25.706 15.886 1.00 4.18  ? 41   THR B CA  1 
ATOM   1775 C C   . THR B 1 43  ? -11.595 24.325 15.406 1.00 4.86  ? 41   THR B C   1 
ATOM   1776 O O   . THR B 1 43  ? -12.440 23.442 15.228 1.00 5.59  ? 41   THR B O   1 
ATOM   1777 C CB  . THR B 1 43  ? -12.164 26.665 14.714 1.00 5.16  ? 41   THR B CB  1 
ATOM   1778 O OG1 . THR B 1 43  ? -12.580 27.965 15.220 1.00 6.01  ? 41   THR B OG1 1 
ATOM   1779 C CG2 . THR B 1 43  ? -13.235 26.257 13.735 1.00 6.12  ? 41   THR B CG2 1 
ATOM   1780 N N   . VAL B 1 44  ? -10.294 24.111 15.263 1.00 5.02  ? 42   VAL B N   1 
ATOM   1781 C CA  . VAL B 1 44  ? -9.732  22.774 14.944 1.00 5.04  ? 42   VAL B CA  1 
ATOM   1782 C C   . VAL B 1 44  ? -10.167 21.759 16.024 1.00 4.81  ? 42   VAL B C   1 
ATOM   1783 O O   . VAL B 1 44  ? -10.605 20.655 15.704 1.00 5.64  ? 42   VAL B O   1 
ATOM   1784 C CB  . VAL B 1 44  ? -8.226  22.832 14.695 1.00 4.68  ? 42   VAL B CB  1 
ATOM   1785 C CG1 . VAL B 1 44  ? -7.629  21.411 14.646 1.00 5.53  ? 42   VAL B CG1 1 
ATOM   1786 C CG2 . VAL B 1 44  ? -7.911  23.596 13.398 1.00 6.40  ? 42   VAL B CG2 1 
ATOM   1787 N N   . CYS B 1 45  ? -10.003 22.121 17.292 1.00 4.61  ? 43   CYS B N   1 
ATOM   1788 C CA  . CYS B 1 45  ? -10.423 21.243 18.388 1.00 5.55  ? 43   CYS B CA  1 
ATOM   1789 C C   . CYS B 1 45  ? -11.916 20.916 18.211 1.00 5.02  ? 43   CYS B C   1 
ATOM   1790 O O   . CYS B 1 45  ? -12.328 19.773 18.379 1.00 5.72  ? 43   CYS B O   1 
ATOM   1791 C CB  . CYS B 1 45  ? -10.219 21.874 19.747 1.00 6.11  ? 43   CYS B CB  1 
ATOM   1792 S SG  . CYS B 1 45  ? -8.500  22.169 20.215 1.00 7.00  ? 43   CYS B SG  1 
HETATM 1793 N N   . CME B 1 46  ? -12.761 21.914 17.885 1.00 5.95  ? 44   CME B N   1 
HETATM 1794 C CA  . CME B 1 46  ? -14.180 21.691 17.707 1.00 6.81  ? 44   CME B CA  1 
HETATM 1795 C CB  . CME B 1 46  ? -14.896 23.020 17.456 1.00 7.90  ? 44   CME B CB  1 
HETATM 1796 S SG  . CME B 1 46  ? -14.812 24.125 18.881 1.00 10.85 ? 44   CME B SG  1 
HETATM 1797 S SD  . CME B 1 46  ? -16.221 23.507 20.180 1.00 16.73 ? 44   CME B SD  1 
HETATM 1798 C CE  . CME B 1 46  ? -17.753 24.243 19.529 1.00 19.21 ? 44   CME B CE  1 
HETATM 1799 C CZ  . CME B 1 46  ? -17.638 25.779 19.324 1.00 20.62 ? 44   CME B CZ  1 
HETATM 1800 O OH  . CME B 1 46  ? -18.912 26.387 19.019 1.00 16.36 ? 44   CME B OH  1 
HETATM 1801 C C   . CME B 1 46  ? -14.449 20.759 16.560 1.00 7.53  ? 44   CME B C   1 
HETATM 1802 O O   . CME B 1 46  ? -15.320 19.849 16.676 1.00 8.27  ? 44   CME B O   1 
ATOM   1803 N N   . HIS B 1 47  ? -13.734 20.881 15.430 1.00 6.03  ? 45   HIS B N   1 
ATOM   1804 C CA  . HIS B 1 47  ? -13.905 19.950 14.324 1.00 6.56  ? 45   HIS B CA  1 
ATOM   1805 C C   . HIS B 1 47  ? -13.481 18.573 14.625 1.00 7.37  ? 45   HIS B C   1 
ATOM   1806 O O   . HIS B 1 47  ? -14.115 17.590 14.159 1.00 10.32 ? 45   HIS B O   1 
ATOM   1807 C CB  . HIS B 1 47  ? -13.240 20.443 13.029 1.00 6.85  ? 45   HIS B CB  1 
ATOM   1808 C CG  . HIS B 1 47  ? -13.993 21.586 12.380 1.00 6.01  ? 45   HIS B CG  1 
ATOM   1809 N ND1 . HIS B 1 47  ? -15.252 21.455 11.932 1.00 8.83  ? 45   HIS B ND1 1 
ATOM   1810 C CD2 . HIS B 1 47  ? -13.619 22.938 12.145 1.00 7.21  ? 45   HIS B CD2 1 
ATOM   1811 C CE1 . HIS B 1 47  ? -15.672 22.651 11.432 1.00 8.48  ? 45   HIS B CE1 1 
ATOM   1812 N NE2 . HIS B 1 47  ? -14.688 23.591 11.598 1.00 8.02  ? 45   HIS B NE2 1 
ATOM   1813 N N   . ILE B 1 48  ? -12.413 18.407 15.390 1.00 7.02  ? 46   ILE B N   1 
ATOM   1814 C CA  . ILE B 1 48  ? -11.969 17.060 15.759 1.00 7.46  ? 46   ILE B CA  1 
ATOM   1815 C C   . ILE B 1 48  ? -13.080 16.363 16.551 1.00 7.51  ? 46   ILE B C   1 
ATOM   1816 O O   . ILE B 1 48  ? -13.249 15.125 16.448 1.00 8.33  ? 46   ILE B O   1 
ATOM   1817 C CB  . ILE B 1 48  ? -10.677 17.145 16.600 1.00 6.75  ? 46   ILE B CB  1 
ATOM   1818 C CG1 . ILE B 1 48  ? -9.482  17.504 15.712 1.00 6.86  ? 46   ILE B CG1 1 
ATOM   1819 C CG2 . ILE B 1 48  ? -10.332 15.844 17.366 1.00 8.23  ? 46   ILE B CG2 1 
ATOM   1820 C CD1 . ILE B 1 48  ? -8.233  17.926 16.474 1.00 8.46  ? 46   ILE B CD1 1 
ATOM   1821 N N   . SER B 1 49  ? -13.726 17.089 17.443 1.00 7.27  ? 47   SER B N   1 
ATOM   1822 C CA  . SER B 1 49  ? -14.650 16.553 18.411 1.00 7.92  ? 47   SER B CA  1 
ATOM   1823 C C   . SER B 1 49  ? -16.107 16.522 18.082 1.00 10.58 ? 47   SER B C   1 
ATOM   1824 O O   . SER B 1 49  ? -16.771 15.600 18.533 1.00 13.33 ? 47   SER B O   1 
ATOM   1825 C CB  . SER B 1 49  ? -14.433 17.284 19.753 1.00 9.39  ? 47   SER B CB  1 
ATOM   1826 O OG  . SER B 1 49  ? -14.620 18.596 19.677 1.00 13.86 ? 47   SER B OG  1 
ATOM   1827 N N   . ASP B 1 50  ? -16.576 17.426 17.231 1.00 13.15 ? 48   ASP B N   1 
ATOM   1828 C CA  . ASP B 1 50  ? -18.034 17.668 17.200 1.00 19.06 ? 48   ASP B CA  1 
ATOM   1829 C C   . ASP B 1 50  ? -18.797 16.467 16.641 1.00 19.89 ? 48   ASP B C   1 
ATOM   1830 O O   . ASP B 1 50  ? -18.475 15.986 15.583 1.00 21.72 ? 48   ASP B O   1 
ATOM   1831 C CB  . ASP B 1 50  ? -18.323 18.967 16.460 1.00 19.43 ? 48   ASP B CB  1 
ATOM   1832 C CG  . ASP B 1 50  ? -19.742 19.092 15.980 1.00 30.62 ? 48   ASP B CG  1 
ATOM   1833 O OD1 . ASP B 1 50  ? -20.104 18.417 14.988 1.00 27.43 ? 48   ASP B OD1 1 
ATOM   1834 O OD2 . ASP B 1 50  ? -20.470 19.889 16.583 1.00 40.09 ? 48   ASP B OD2 1 
ATOM   1835 N N   . MET B 1 51  ? -19.761 15.960 17.405 1.00 20.12 ? 49   MET B N   1 
ATOM   1836 C CA  . MET B 1 51  ? -20.596 14.781 17.068 1.00 19.43 ? 49   MET B CA  1 
ATOM   1837 C C   . MET B 1 51  ? -19.840 13.462 16.950 1.00 18.43 ? 49   MET B C   1 
ATOM   1838 O O   . MET B 1 51  ? -20.427 12.444 16.597 1.00 21.97 ? 49   MET B O   1 
ATOM   1839 C CB  . MET B 1 51  ? -21.445 15.028 15.801 1.00 21.64 ? 49   MET B CB  1 
ATOM   1840 C CG  . MET B 1 51  ? -22.530 16.086 16.023 1.00 29.74 ? 49   MET B CG  1 
ATOM   1841 S SD  . MET B 1 51  ? -23.604 15.836 17.472 1.00 51.89 ? 49   MET B SD  1 
ATOM   1842 C CE  . MET B 1 51  ? -22.988 17.004 18.701 1.00 34.51 ? 49   MET B CE  1 
ATOM   1843 N N   . HIS B 1 52  ? -18.569 13.389 17.305 1.00 14.46 ? 50   HIS B N   1 
ATOM   1844 C CA  . HIS B 1 52  ? -17.838 12.100 17.283 1.00 13.40 ? 50   HIS B CA  1 
ATOM   1845 C C   . HIS B 1 52  ? -18.088 11.447 18.636 1.00 13.50 ? 50   HIS B C   1 
ATOM   1846 O O   . HIS B 1 52  ? -17.925 12.088 19.681 1.00 13.61 ? 50   HIS B O   1 
ATOM   1847 C CB  . HIS B 1 52  ? -16.367 12.368 17.045 1.00 14.46 ? 50   HIS B CB  1 
ATOM   1848 C CG  . HIS B 1 52  ? -16.084 12.698 15.617 1.00 18.84 ? 50   HIS B CG  1 
ATOM   1849 N ND1 . HIS B 1 52  ? -16.015 11.772 14.667 1.00 23.57 ? 50   HIS B ND1 1 
ATOM   1850 C CD2 . HIS B 1 52  ? -15.926 13.919 14.990 1.00 14.34 ? 50   HIS B CD2 1 
ATOM   1851 C CE1 . HIS B 1 52  ? -15.806 12.389 13.485 1.00 20.07 ? 50   HIS B CE1 1 
ATOM   1852 N NE2 . HIS B 1 52  ? -15.800 13.689 13.680 1.00 15.48 ? 50   HIS B NE2 1 
ATOM   1853 N N   . LEU B 1 53  ? -18.542 10.209 18.564 1.00 15.49 ? 51   LEU B N   1 
ATOM   1854 C CA  . LEU B 1 53  ? -19.006 9.495  19.741 1.00 12.93 ? 51   LEU B CA  1 
ATOM   1855 C C   . LEU B 1 53  ? -18.138 8.304  20.079 1.00 12.53 ? 51   LEU B C   1 
ATOM   1856 O O   . LEU B 1 53  ? -17.546 7.664  19.207 1.00 19.57 ? 51   LEU B O   1 
ATOM   1857 C CB  . LEU B 1 53  ? -20.382 8.980  19.536 1.00 15.95 ? 51   LEU B CB  1 
ATOM   1858 C CG  . LEU B 1 53  ? -21.471 9.967  19.208 1.00 15.62 ? 51   LEU B CG  1 
ATOM   1859 C CD1 . LEU B 1 53  ? -22.779 9.175  18.970 1.00 20.06 ? 51   LEU B CD1 1 
ATOM   1860 C CD2 . LEU B 1 53  ? -21.686 10.964 20.322 1.00 18.92 ? 51   LEU B CD2 1 
ATOM   1861 N N   . HIS B 1 54  ? -18.129 7.957  21.342 1.00 12.03 ? 52   HIS B N   1 
ATOM   1862 C CA  . HIS B 1 54  ? -17.542 6.720  21.816 1.00 13.73 ? 52   HIS B CA  1 
ATOM   1863 C C   . HIS B 1 54  ? -18.391 6.261  22.994 1.00 11.91 ? 52   HIS B C   1 
ATOM   1864 O O   . HIS B 1 54  ? -18.666 7.005  23.887 1.00 10.36 ? 52   HIS B O   1 
ATOM   1865 C CB  . HIS B 1 54  ? -16.056 6.929  22.216 1.00 12.78 ? 52   HIS B CB  1 
ATOM   1866 C CG  . HIS B 1 54  ? -15.482 5.785  23.007 1.00 12.94 ? 52   HIS B CG  1 
ATOM   1867 N ND1 . HIS B 1 54  ? -15.246 4.573  22.462 1.00 16.73 ? 52   HIS B ND1 1 
ATOM   1868 C CD2 . HIS B 1 54  ? -15.104 5.710  24.323 1.00 14.42 ? 52   HIS B CD2 1 
ATOM   1869 C CE1 . HIS B 1 54  ? -14.766 3.755  23.409 1.00 17.19 ? 52   HIS B CE1 1 
ATOM   1870 N NE2 . HIS B 1 54  ? -14.683 4.432  24.552 1.00 18.74 ? 52   HIS B NE2 1 
ATOM   1871 N N   A ASN B 1 55  ? -18.841 5.018  22.951 0.60 12.11 ? 53   ASN B N   1 
ATOM   1872 N N   B ASN B 1 55  ? -18.880 5.036  22.880 0.40 11.68 ? 53   ASN B N   1 
ATOM   1873 C CA  A ASN B 1 55  ? -19.771 4.482  23.929 0.60 11.99 ? 53   ASN B CA  1 
ATOM   1874 C CA  B ASN B 1 55  ? -19.766 4.446  23.853 0.40 11.04 ? 53   ASN B CA  1 
ATOM   1875 C C   A ASN B 1 55  ? -20.998 5.347  24.080 0.60 10.00 ? 53   ASN B C   1 
ATOM   1876 C C   B ASN B 1 55  ? -20.985 5.322  24.067 0.40 10.19 ? 53   ASN B C   1 
ATOM   1877 O O   A ASN B 1 55  ? -21.504 5.515  25.178 0.60 12.42 ? 53   ASN B O   1 
ATOM   1878 O O   B ASN B 1 55  ? -21.457 5.474  25.185 0.40 11.90 ? 53   ASN B O   1 
ATOM   1879 C CB  A ASN B 1 55  ? -19.108 4.306  25.293 0.60 14.66 ? 53   ASN B CB  1 
ATOM   1880 C CB  B ASN B 1 55  ? -19.006 4.213  25.142 0.40 12.32 ? 53   ASN B CB  1 
ATOM   1881 C CG  A ASN B 1 55  ? -18.176 3.130  25.338 0.60 16.57 ? 53   ASN B CG  1 
ATOM   1882 C CG  B ASN B 1 55  ? -19.770 3.391  26.142 0.40 11.95 ? 53   ASN B CG  1 
ATOM   1883 O OD1 A ASN B 1 55  ? -18.340 2.148  24.591 0.60 22.30 ? 53   ASN B OD1 1 
ATOM   1884 O OD1 B ASN B 1 55  ? -20.707 2.681  25.833 0.40 16.66 ? 53   ASN B OD1 1 
ATOM   1885 N ND2 A ASN B 1 55  ? -17.245 3.185  26.262 0.60 18.03 ? 53   ASN B ND2 1 
ATOM   1886 N ND2 B ASN B 1 55  ? -19.336 3.489  27.343 0.40 11.34 ? 53   ASN B ND2 1 
ATOM   1887 N N   . GLY B 1 56  ? -21.470 5.902  22.973 1.00 13.13 ? 54   GLY B N   1 
ATOM   1888 C CA  . GLY B 1 56  ? -22.721 6.676  22.962 1.00 13.41 ? 54   GLY B CA  1 
ATOM   1889 C C   . GLY B 1 56  ? -22.709 8.116  23.398 1.00 11.89 ? 54   GLY B C   1 
ATOM   1890 O O   . GLY B 1 56  ? -23.713 8.743  23.394 1.00 14.44 ? 54   GLY B O   1 
ATOM   1891 N N   . VAL B 1 57  ? -21.538 8.601  23.804 1.00 10.43 ? 55   VAL B N   1 
ATOM   1892 C CA  . VAL B 1 57  ? -21.369 9.940  24.296 1.00 9.39  ? 55   VAL B CA  1 
ATOM   1893 C C   . VAL B 1 57  ? -20.156 10.558 23.642 1.00 8.66  ? 55   VAL B C   1 
ATOM   1894 O O   . VAL B 1 57  ? -19.403 9.879  22.961 1.00 9.32  ? 55   VAL B O   1 
ATOM   1895 C CB  . VAL B 1 57  ? -21.208 9.936  25.833 1.00 9.75  ? 55   VAL B CB  1 
ATOM   1896 C CG1 . VAL B 1 57  ? -22.423 9.346  26.533 1.00 12.18 ? 55   VAL B CG1 1 
ATOM   1897 C CG2 . VAL B 1 57  ? -20.002 9.188  26.246 1.00 11.30 ? 55   VAL B CG2 1 
ATOM   1898 N N   . PRO B 1 58  ? -19.992 11.870 23.771 1.00 8.79  ? 56   PRO B N   1 
ATOM   1899 C CA  . PRO B 1 58  ? -18.849 12.482 23.066 1.00 8.13  ? 56   PRO B CA  1 
ATOM   1900 C C   . PRO B 1 58  ? -17.509 11.750 23.340 1.00 7.15  ? 56   PRO B C   1 
ATOM   1901 O O   . PRO B 1 58  ? -17.196 11.422 24.484 1.00 7.77  ? 56   PRO B O   1 
ATOM   1902 C CB  . PRO B 1 58  ? -18.818 13.929 23.603 1.00 9.75  ? 56   PRO B CB  1 
ATOM   1903 C CG  . PRO B 1 58  ? -20.293 14.241 23.864 1.00 9.67  ? 56   PRO B CG  1 
ATOM   1904 C CD  . PRO B 1 58  ? -20.826 12.900 24.418 1.00 9.90  ? 56   PRO B CD  1 
ATOM   1905 N N   . ARG B 1 59  ? -16.773 11.481 22.235 1.00 7.70  ? 57   ARG B N   1 
ATOM   1906 C CA  . ARG B 1 59  ? -15.476 10.828 22.322 1.00 7.85  ? 57   ARG B CA  1 
ATOM   1907 C C   . ARG B 1 59  ? -14.433 11.705 23.020 1.00 7.23  ? 57   ARG B C   1 
ATOM   1908 O O   . ARG B 1 59  ? -13.514 11.215 23.625 1.00 7.94  ? 57   ARG B O   1 
ATOM   1909 C CB  . ARG B 1 59  ? -14.990 10.483 20.901 1.00 8.67  ? 57   ARG B CB  1 
ATOM   1910 C CG  . ARG B 1 59  ? -13.589 9.945  20.826 1.00 9.09  ? 57   ARG B CG  1 
ATOM   1911 C CD  . ARG B 1 59  ? -13.272 9.468  19.437 1.00 9.10  ? 57   ARG B CD  1 
ATOM   1912 N NE  . ARG B 1 59  ? -11.855 9.196  19.276 1.00 8.65  ? 57   ARG B NE  1 
ATOM   1913 C CZ  . ARG B 1 59  ? -11.288 9.030  18.112 1.00 11.09 ? 57   ARG B CZ  1 
ATOM   1914 N NH1 . ARG B 1 59  ? -12.014 9.039  17.013 1.00 12.54 ? 57   ARG B NH1 1 
ATOM   1915 N NH2 . ARG B 1 59  ? -9.966  8.840  18.070 1.00 10.04 ? 57   ARG B NH2 1 
ATOM   1916 N N   . TYR B 1 60  ? -14.583 12.995 22.856 1.00 8.08  ? 58   TYR B N   1 
ATOM   1917 C CA  . TYR B 1 60  ? -13.597 13.932 23.300 1.00 7.14  ? 58   TYR B CA  1 
ATOM   1918 C C   . TYR B 1 60  ? -14.128 14.844 24.403 1.00 7.46  ? 58   TYR B C   1 
ATOM   1919 O O   . TYR B 1 60  ? -15.276 15.248 24.423 1.00 9.02  ? 58   TYR B O   1 
ATOM   1920 C CB  . TYR B 1 60  ? -13.095 14.861 22.189 1.00 7.13  ? 58   TYR B CB  1 
ATOM   1921 C CG  . TYR B 1 60  ? -12.375 14.127 21.079 1.00 5.98  ? 58   TYR B CG  1 
ATOM   1922 C CD1 . TYR B 1 60  ? -13.053 13.587 19.986 1.00 7.08  ? 58   TYR B CD1 1 
ATOM   1923 C CD2 . TYR B 1 60  ? -10.992 13.917 21.177 1.00 5.71  ? 58   TYR B CD2 1 
ATOM   1924 C CE1 . TYR B 1 60  ? -12.375 12.952 18.958 1.00 5.77  ? 58   TYR B CE1 1 
ATOM   1925 C CE2 . TYR B 1 60  ? -10.319 13.248 20.168 1.00 5.86  ? 58   TYR B CE2 1 
ATOM   1926 C CZ  . TYR B 1 60  ? -11.008 12.755 19.067 1.00 6.04  ? 58   TYR B CZ  1 
ATOM   1927 O OH  . TYR B 1 60  ? -10.396 12.077 18.038 1.00 7.53  ? 58   TYR B OH  1 
ATOM   1928 N N   . ILE B 1 61  ? -13.235 15.198 25.345 1.00 6.35  ? 59   ILE B N   1 
ATOM   1929 C CA  . ILE B 1 61  ? -13.382 16.329 26.250 1.00 6.43  ? 59   ILE B CA  1 
ATOM   1930 C C   . ILE B 1 61  ? -12.468 17.422 25.716 1.00 6.88  ? 59   ILE B C   1 
ATOM   1931 O O   . ILE B 1 61  ? -11.273 17.211 25.578 1.00 7.62  ? 59   ILE B O   1 
ATOM   1932 C CB  . ILE B 1 61  ? -13.068 15.950 27.722 1.00 8.29  ? 59   ILE B CB  1 
ATOM   1933 C CG1 . ILE B 1 61  ? -14.016 14.824 28.161 1.00 10.44 ? 59   ILE B CG1 1 
ATOM   1934 C CG2 . ILE B 1 61  ? -13.124 17.166 28.620 1.00 8.73  ? 59   ILE B CG2 1 
ATOM   1935 C CD1 . ILE B 1 61  ? -15.381 15.215 28.449 1.00 20.12 ? 59   ILE B CD1 1 
ATOM   1936 N N   . VAL B 1 62  ? -13.004 18.612 25.482 1.00 5.79  ? 60   VAL B N   1 
ATOM   1937 C CA  . VAL B 1 62  ? -12.206 19.762 25.068 1.00 5.76  ? 60   VAL B CA  1 
ATOM   1938 C C   . VAL B 1 62  ? -11.799 20.564 26.270 1.00 6.05  ? 60   VAL B C   1 
ATOM   1939 O O   . VAL B 1 62  ? -12.638 21.127 26.965 1.00 7.78  ? 60   VAL B O   1 
ATOM   1940 C CB  . VAL B 1 62  ? -12.963 20.657 24.079 1.00 6.14  ? 60   VAL B CB  1 
ATOM   1941 C CG1 . VAL B 1 62  ? -12.112 21.846 23.731 1.00 8.77  ? 60   VAL B CG1 1 
ATOM   1942 C CG2 . VAL B 1 62  ? -13.316 19.913 22.814 1.00 8.58  ? 60   VAL B CG2 1 
ATOM   1943 N N   . ASN B 1 63  ? -10.484 20.582 26.563 1.00 6.12  ? 61   ASN B N   1 
ATOM   1944 C CA  . ASN B 1 63  ? -9.959  21.370 27.650 1.00 6.47  ? 61   ASN B CA  1 
ATOM   1945 C C   . ASN B 1 63  ? -9.583  22.781 27.304 1.00 5.28  ? 61   ASN B C   1 
ATOM   1946 O O   . ASN B 1 63  ? -9.476  23.633 28.181 1.00 7.35  ? 61   ASN B O   1 
ATOM   1947 C CB  . ASN B 1 63  ? -8.693  20.679 28.227 1.00 6.84  ? 61   ASN B CB  1 
ATOM   1948 C CG  . ASN B 1 63  ? -8.951  19.350 28.901 1.00 7.78  ? 61   ASN B CG  1 
ATOM   1949 O OD1 . ASN B 1 63  ? -9.973  19.160 29.570 1.00 8.03  ? 61   ASN B OD1 1 
ATOM   1950 N ND2 . ASN B 1 63  ? -7.935  18.467 28.828 1.00 7.85  ? 61   ASN B ND2 1 
ATOM   1951 N N   . MET B 1 64  ? -9.286  23.026 26.031 1.00 5.98  ? 62   MET B N   1 
ATOM   1952 C CA  . MET B 1 64  ? -8.886  24.375 25.594 1.00 5.72  ? 62   MET B CA  1 
ATOM   1953 C C   . MET B 1 64  ? -9.954  25.362 26.027 1.00 5.47  ? 62   MET B C   1 
ATOM   1954 O O   . MET B 1 64  ? -11.155 25.097 25.893 1.00 5.56  ? 62   MET B O   1 
ATOM   1955 C CB  . MET B 1 64  ? -8.674  24.441 24.112 1.00 5.05  ? 62   MET B CB  1 
ATOM   1956 C CG  . MET B 1 64  ? -8.184  25.767 23.668 1.00 5.33  ? 62   MET B CG  1 
ATOM   1957 S SD  . MET B 1 64  ? -7.645  25.792 21.959 1.00 6.06  ? 62   MET B SD  1 
ATOM   1958 C CE  . MET B 1 64  ? -7.260  27.563 21.819 1.00 6.46  ? 62   MET B CE  1 
ATOM   1959 N N   . TRP B 1 65  ? -9.504  26.473 26.603 1.00 6.65  ? 63   TRP B N   1 
ATOM   1960 C CA  . TRP B 1 65  ? -10.351 27.581 27.104 1.00 6.47  ? 63   TRP B CA  1 
ATOM   1961 C C   . TRP B 1 65  ? -11.206 27.191 28.280 1.00 7.43  ? 63   TRP B C   1 
ATOM   1962 O O   . TRP B 1 65  ? -12.166 27.901 28.581 1.00 7.36  ? 63   TRP B O   1 
ATOM   1963 C CB  . TRP B 1 65  ? -11.163 28.226 25.997 1.00 7.15  ? 63   TRP B CB  1 
ATOM   1964 C CG  . TRP B 1 65  ? -10.322 28.999 24.971 1.00 5.62  ? 63   TRP B CG  1 
ATOM   1965 C CD1 . TRP B 1 65  ? -9.021  29.377 25.060 1.00 5.70  ? 63   TRP B CD1 1 
ATOM   1966 C CD2 . TRP B 1 65  ? -10.841 29.489 23.717 1.00 5.75  ? 63   TRP B CD2 1 
ATOM   1967 N NE1 . TRP B 1 65  ? -8.660  30.106 23.905 1.00 6.83  ? 63   TRP B NE1 1 
ATOM   1968 C CE2 . TRP B 1 65  ? -9.765  30.198 23.072 1.00 6.64  ? 63   TRP B CE2 1 
ATOM   1969 C CE3 . TRP B 1 65  ? -12.081 29.423 23.092 1.00 5.91  ? 63   TRP B CE3 1 
ATOM   1970 C CZ2 . TRP B 1 65  ? -9.905  30.750 21.811 1.00 5.93  ? 63   TRP B CZ2 1 
ATOM   1971 C CZ3 . TRP B 1 65  ? -12.203 30.078 21.855 1.00 6.60  ? 63   TRP B CZ3 1 
ATOM   1972 C CH2 . TRP B 1 65  ? -11.139 30.735 21.263 1.00 5.99  ? 63   TRP B CH2 1 
ATOM   1973 N N   . THR B 1 66  ? -10.827 26.143 29.008 1.00 8.38  ? 64   THR B N   1 
ATOM   1974 C CA  . THR B 1 66  ? -11.406 25.821 30.308 1.00 8.98  ? 64   THR B CA  1 
ATOM   1975 C C   . THR B 1 66  ? -10.314 26.020 31.351 1.00 9.32  ? 64   THR B C   1 
ATOM   1976 O O   . THR B 1 66  ? -9.125  26.008 31.039 1.00 9.06  ? 64   THR B O   1 
ATOM   1977 C CB  . THR B 1 66  ? -12.002 24.395 30.349 1.00 9.07  ? 64   THR B CB  1 
ATOM   1978 O OG1 . THR B 1 66  ? -10.934 23.432 30.475 1.00 9.28  ? 64   THR B OG1 1 
ATOM   1979 C CG2 . THR B 1 66  ? -12.997 24.109 29.154 1.00 7.94  ? 64   THR B CG2 1 
ATOM   1980 N N   . PRO B 1 67  ? -10.700 26.235 32.621 1.00 10.11 ? 65   PRO B N   1 
ATOM   1981 C CA  . PRO B 1 67  ? -9.702  26.479 33.642 1.00 10.79 ? 65   PRO B CA  1 
ATOM   1982 C C   . PRO B 1 67  ? -8.809  25.244 33.823 1.00 12.16 ? 65   PRO B C   1 
ATOM   1983 O O   . PRO B 1 67  ? -9.319  24.164 33.781 1.00 10.54 ? 65   PRO B O   1 
ATOM   1984 C CB  . PRO B 1 67  ? -10.515 26.749 34.902 1.00 12.80 ? 65   PRO B CB  1 
ATOM   1985 C CG  . PRO B 1 67  ? -11.846 27.248 34.377 1.00 15.26 ? 65   PRO B CG  1 
ATOM   1986 C CD  . PRO B 1 67  ? -12.063 26.439 33.122 1.00 11.90 ? 65   PRO B CD  1 
ATOM   1987 N N   . PRO B 1 68  ? -7.493  25.419 34.014 1.00 13.95 ? 66   PRO B N   1 
ATOM   1988 C CA  . PRO B 1 68  ? -6.658  24.207 34.209 1.00 15.20 ? 66   PRO B CA  1 
ATOM   1989 C C   . PRO B 1 68  ? -7.089  23.348 35.379 1.00 10.48 ? 66   PRO B C   1 
ATOM   1990 O O   . PRO B 1 68  ? -6.989  22.124 35.308 1.00 11.53 ? 66   PRO B O   1 
ATOM   1991 C CB  . PRO B 1 68  ? -5.263  24.774 34.509 1.00 19.42 ? 66   PRO B CB  1 
ATOM   1992 C CG  . PRO B 1 68  ? -5.389  26.262 34.559 1.00 20.18 ? 66   PRO B CG  1 
ATOM   1993 C CD  . PRO B 1 68  ? -6.708  26.678 34.024 1.00 16.34 ? 66   PRO B CD  1 
ATOM   1994 N N   . GLU B 1 69  ? -7.694  23.946 36.405 1.00 12.20 ? 67   GLU B N   1 
ATOM   1995 C CA  . GLU B 1 69  ? -8.178  23.184 37.534 1.00 12.46 ? 67   GLU B CA  1 
ATOM   1996 C C   . GLU B 1 69  ? -9.381  22.299 37.130 1.00 10.85 ? 67   GLU B C   1 
ATOM   1997 O O   . GLU B 1 69  ? -9.545  21.232 37.697 1.00 11.93 ? 67   GLU B O   1 
ATOM   1998 C CB  . GLU B 1 69  ? -8.605  24.084 38.674 1.00 13.10 ? 67   GLU B CB  1 
ATOM   1999 C CG  . GLU B 1 69  ? -7.526  24.997 39.251 1.00 16.06 ? 67   GLU B CG  1 
ATOM   2000 C CD  . GLU B 1 69  ? -7.379  26.358 38.609 1.00 17.93 ? 67   GLU B CD  1 
ATOM   2001 O OE1 . GLU B 1 69  ? -7.722  26.512 37.415 1.00 16.77 ? 67   GLU B OE1 1 
ATOM   2002 O OE2 . GLU B 1 69  ? -6.814  27.267 39.273 1.00 25.24 ? 67   GLU B OE2 1 
ATOM   2003 N N   . VAL B 1 70  ? -10.217 22.804 36.218 1.00 11.01 ? 68   VAL B N   1 
ATOM   2004 C CA  . VAL B 1 70  ? -11.347 22.045 35.630 1.00 10.62 ? 68   VAL B CA  1 
ATOM   2005 C C   . VAL B 1 70  ? -10.829 20.907 34.764 1.00 11.00 ? 68   VAL B C   1 
ATOM   2006 O O   . VAL B 1 70  ? -11.224 19.762 34.926 1.00 11.28 ? 68   VAL B O   1 
ATOM   2007 C CB  . VAL B 1 70  ? -12.373 22.978 34.915 1.00 11.49 ? 68   VAL B CB  1 
ATOM   2008 C CG1 . VAL B 1 70  ? -13.459 22.155 34.223 1.00 13.06 ? 68   VAL B CG1 1 
ATOM   2009 C CG2 . VAL B 1 70  ? -13.001 23.959 35.934 1.00 12.99 ? 68   VAL B CG2 1 
ATOM   2010 N N   . ALA B 1 71  ? -9.869  21.242 33.894 1.00 9.16  ? 69   ALA B N   1 
ATOM   2011 C CA  . ALA B 1 71  ? -9.251  20.182 33.107 1.00 9.86  ? 69   ALA B CA  1 
ATOM   2012 C C   . ALA B 1 71  ? -8.628  19.093 34.005 1.00 10.11 ? 69   ALA B C   1 
ATOM   2013 O O   . ALA B 1 71  ? -8.729  17.912 33.708 1.00 9.31  ? 69   ALA B O   1 
ATOM   2014 C CB  . ALA B 1 71  ? -8.181  20.758 32.217 1.00 10.64 ? 69   ALA B CB  1 
ATOM   2015 N N   A ASP B 1 72  ? -8.007  19.501 35.111 0.60 9.61  ? 70   ASP B N   1 
ATOM   2016 N N   B ASP B 1 72  ? -8.022  19.497 35.116 0.40 9.43  ? 70   ASP B N   1 
ATOM   2017 C CA  A ASP B 1 72  ? -7.427  18.524 36.069 0.60 11.67 ? 70   ASP B CA  1 
ATOM   2018 C CA  B ASP B 1 72  ? -7.409  18.530 36.044 0.40 10.44 ? 70   ASP B CA  1 
ATOM   2019 C C   A ASP B 1 72  ? -8.509  17.598 36.628 0.60 12.02 ? 70   ASP B C   1 
ATOM   2020 C C   B ASP B 1 72  ? -8.479  17.618 36.685 0.40 11.61 ? 70   ASP B C   1 
ATOM   2021 O O   A ASP B 1 72  ? -8.306  16.408 36.721 0.60 12.67 ? 70   ASP B O   1 
ATOM   2022 O O   B ASP B 1 72  ? -8.249  16.440 36.869 0.40 12.64 ? 70   ASP B O   1 
ATOM   2023 C CB  A ASP B 1 72  ? -6.725  19.190 37.250 0.60 13.30 ? 70   ASP B CB  1 
ATOM   2024 C CB  B ASP B 1 72  ? -6.584  19.252 37.106 0.40 9.67  ? 70   ASP B CB  1 
ATOM   2025 C CG  A ASP B 1 72  ? -5.337  19.633 36.938 0.60 18.47 ? 70   ASP B CG  1 
ATOM   2026 C CG  B ASP B 1 72  ? -5.578  18.364 37.768 0.40 11.18 ? 70   ASP B CG  1 
ATOM   2027 O OD1 A ASP B 1 72  ? -4.735  19.086 35.994 0.60 23.77 ? 70   ASP B OD1 1 
ATOM   2028 O OD1 B ASP B 1 72  ? -4.998  17.535 37.067 0.40 12.86 ? 70   ASP B OD1 1 
ATOM   2029 O OD2 A ASP B 1 72  ? -4.836  20.497 37.660 0.60 23.44 ? 70   ASP B OD2 1 
ATOM   2030 O OD2 B ASP B 1 72  ? -5.364  18.509 38.966 0.40 14.16 ? 70   ASP B OD2 1 
ATOM   2031 N N   . GLN B 1 73  ? -9.640  18.187 37.009 1.00 11.01 ? 71   GLN B N   1 
ATOM   2032 C CA  . GLN B 1 73  ? -10.829 17.420 37.520 1.00 14.40 ? 71   GLN B CA  1 
ATOM   2033 C C   . GLN B 1 73  ? -11.238 16.323 36.503 1.00 11.93 ? 71   GLN B C   1 
ATOM   2034 O O   . GLN B 1 73  ? -11.423 15.175 36.851 1.00 14.14 ? 71   GLN B O   1 
ATOM   2035 C CB  . GLN B 1 73  ? -12.072 18.336 37.699 1.00 14.95 ? 71   GLN B CB  1 
ATOM   2036 C CG  . GLN B 1 73  ? -12.041 19.270 38.945 1.00 15.84 ? 71   GLN B CG  1 
ATOM   2037 C CD  . GLN B 1 73  ? -13.065 20.404 38.924 1.00 17.31 ? 71   GLN B CD  1 
ATOM   2038 O OE1 . GLN B 1 73  ? -13.960 20.397 38.069 1.00 20.90 ? 71   GLN B OE1 1 
ATOM   2039 N NE2 . GLN B 1 73  ? -12.995 21.351 39.915 1.00 21.89 ? 71   GLN B NE2 1 
ATOM   2040 N N   . GLU B 1 74  ? -11.361 16.727 35.247 1.00 12.37 ? 72   GLU B N   1 
ATOM   2041 C CA  . GLU B 1 74  ? -11.734 15.850 34.140 1.00 11.74 ? 72   GLU B CA  1 
ATOM   2042 C C   . GLU B 1 74  ? -10.637 14.745 33.945 1.00 10.55 ? 72   GLU B C   1 
ATOM   2043 O O   . GLU B 1 74  ? -10.952 13.609 33.792 1.00 12.36 ? 72   GLU B O   1 
ATOM   2044 C CB  . GLU B 1 74  ? -11.826 16.689 32.838 1.00 14.72 ? 72   GLU B CB  1 
ATOM   2045 C CG  . GLU B 1 74  ? -12.859 17.780 32.819 1.00 16.59 ? 72   GLU B CG  1 
ATOM   2046 C CD  . GLU B 1 74  ? -14.281 17.308 32.668 1.00 19.68 ? 72   GLU B CD  1 
ATOM   2047 O OE1 . GLU B 1 74  ? -14.568 16.065 32.657 1.00 22.26 ? 72   GLU B OE1 1 
ATOM   2048 O OE2 . GLU B 1 74  ? -15.134 18.219 32.622 1.00 29.83 ? 72   GLU B OE2 1 
ATOM   2049 N N   . MET B 1 75  ? -9.360  15.105 34.022 1.00 10.88 ? 73   MET B N   1 
ATOM   2050 C CA  . MET B 1 75  ? -8.285  14.132 33.849 1.00 8.71  ? 73   MET B CA  1 
ATOM   2051 C C   . MET B 1 75  ? -8.293  13.128 34.983 1.00 9.71  ? 73   MET B C   1 
ATOM   2052 O O   . MET B 1 75  ? -8.159  11.955 34.755 1.00 10.46 ? 73   MET B O   1 
ATOM   2053 C CB  . MET B 1 75  ? -6.895  14.849 33.743 1.00 8.82  ? 73   MET B CB  1 
ATOM   2054 C CG  . MET B 1 75  ? -6.711  15.452 32.368 1.00 9.38  ? 73   MET B CG  1 
ATOM   2055 S SD  . MET B 1 75  ? -5.142  16.266 32.088 1.00 10.74 ? 73   MET B SD  1 
ATOM   2056 C CE  . MET B 1 75  ? -5.255  17.747 33.109 1.00 13.40 ? 73   MET B CE  1 
ATOM   2057 N N   . LYS B 1 76  ? -8.416  13.622 36.209 1.00 11.90 ? 74   LYS B N   1 
ATOM   2058 C CA  . LYS B 1 76  ? -8.521  12.689 37.340 1.00 13.15 ? 74   LYS B CA  1 
ATOM   2059 C C   . LYS B 1 76  ? -9.766  11.761 37.244 1.00 13.03 ? 74   LYS B C   1 
ATOM   2060 O O   . LYS B 1 76  ? -9.630  10.563 37.431 1.00 16.44 ? 74   LYS B O   1 
ATOM   2061 C CB  . LYS B 1 76  ? -8.516  13.493 38.619 1.00 15.14 ? 74   LYS B CB  1 
ATOM   2062 C CG  . LYS B 1 76  ? -7.156  14.123 38.963 1.00 15.61 ? 74   LYS B CG  1 
ATOM   2063 C CD  . LYS B 1 76  ? -7.320  14.964 40.217 1.00 20.94 ? 74   LYS B CD  1 
ATOM   2064 C CE  . LYS B 1 76  ? -5.984  15.503 40.752 1.00 19.47 ? 74   LYS B CE  1 
ATOM   2065 N NZ  . LYS B 1 76  ? -6.158  16.556 41.832 1.00 25.81 ? 74   LYS B NZ  1 
ATOM   2066 N N   . ARG B 1 77  ? -10.921 12.319 36.900 1.00 14.78 ? 75   ARG B N   1 
ATOM   2067 C CA  . ARG B 1 77  ? -12.180 11.530 36.733 1.00 16.04 ? 75   ARG B CA  1 
ATOM   2068 C C   . ARG B 1 77  ? -11.959 10.437 35.702 1.00 13.69 ? 75   ARG B C   1 
ATOM   2069 O O   . ARG B 1 77  ? -12.453 9.282  35.880 1.00 18.32 ? 75   ARG B O   1 
ATOM   2070 C CB  . ARG B 1 77  ? -13.370 12.398 36.301 1.00 17.22 ? 75   ARG B CB  1 
ATOM   2071 C CG  . ARG B 1 77  ? -13.973 13.371 37.323 1.00 21.51 ? 75   ARG B CG  1 
ATOM   2072 C CD  . ARG B 1 77  ? -15.125 14.187 36.711 1.00 25.09 ? 75   ARG B CD  1 
ATOM   2073 N NE  . ARG B 1 77  ? -16.198 13.406 36.066 1.00 36.82 ? 75   ARG B NE  1 
ATOM   2074 C CZ  . ARG B 1 77  ? -17.051 13.864 35.128 1.00 38.16 ? 75   ARG B CZ  1 
ATOM   2075 N NH1 . ARG B 1 77  ? -16.976 15.105 34.638 1.00 40.19 ? 75   ARG B NH1 1 
ATOM   2076 N NH2 . ARG B 1 77  ? -17.998 13.065 34.665 1.00 33.21 ? 75   ARG B NH2 1 
ATOM   2077 N N   . GLN B 1 78  ? -11.259 10.758 34.603 1.00 12.85 ? 76   GLN B N   1 
ATOM   2078 C CA  . GLN B 1 78  ? -11.014 9.785  33.527 1.00 11.91 ? 76   GLN B CA  1 
ATOM   2079 C C   . GLN B 1 78  ? -9.810  8.913  33.691 1.00 12.81 ? 76   GLN B C   1 
ATOM   2080 O O   . GLN B 1 78  ? -9.557  8.050  32.892 1.00 12.53 ? 76   GLN B O   1 
ATOM   2081 C CB  . GLN B 1 78  ? -10.878 10.497 32.193 1.00 14.97 ? 76   GLN B CB  1 
ATOM   2082 C CG  . GLN B 1 78  ? -12.139 11.257 31.764 1.00 14.88 ? 76   GLN B CG  1 
ATOM   2083 C CD  . GLN B 1 78  ? -13.321 10.392 31.477 1.00 14.97 ? 76   GLN B CD  1 
ATOM   2084 O OE1 . GLN B 1 78  ? -13.175 9.203  31.153 1.00 15.86 ? 76   GLN B OE1 1 
ATOM   2085 N NE2 . GLN B 1 78  ? -14.478 10.960 31.650 1.00 22.90 ? 76   GLN B NE2 1 
ATOM   2086 N N   . ASN B 1 79  ? -9.057  9.229  34.718 1.00 13.31 ? 77   ASN B N   1 
ATOM   2087 C CA  . ASN B 1 79  ? -7.745  8.636  34.941 1.00 12.40 ? 77   ASN B CA  1 
ATOM   2088 C C   . ASN B 1 79  ? -6.857  8.701  33.722 1.00 13.13 ? 77   ASN B C   1 
ATOM   2089 O O   . ASN B 1 79  ? -6.226  7.697  33.318 1.00 11.32 ? 77   ASN B O   1 
ATOM   2090 C CB  . ASN B 1 79  ? -7.881  7.149  35.392 1.00 13.54 ? 77   ASN B CB  1 
ATOM   2091 C CG  . ASN B 1 79  ? -6.630  6.672  36.125 1.00 16.84 ? 77   ASN B CG  1 
ATOM   2092 O OD1 . ASN B 1 79  ? -5.890  7.490  36.743 1.00 20.81 ? 77   ASN B OD1 1 
ATOM   2093 N ND2 . ASN B 1 79  ? -6.388  5.389  36.089 1.00 20.14 ? 77   ASN B ND2 1 
ATOM   2094 N N   . LEU B 1 80  ? -6.845  9.874  33.103 1.00 10.54 ? 78   LEU B N   1 
ATOM   2095 C CA  . LEU B 1 80  ? -5.959  10.157 32.002 1.00 9.84  ? 78   LEU B CA  1 
ATOM   2096 C C   . LEU B 1 80  ? -5.082  11.264 32.448 1.00 9.21  ? 78   LEU B C   1 
ATOM   2097 O O   . LEU B 1 80  ? -5.483  12.427 32.409 1.00 8.55  ? 78   LEU B O   1 
ATOM   2098 C CB  . LEU B 1 80  ? -6.798  10.607 30.770 1.00 11.55 ? 78   LEU B CB  1 
ATOM   2099 C CG  . LEU B 1 80  ? -7.610  9.572  30.059 1.00 12.01 ? 78   LEU B CG  1 
ATOM   2100 C CD1 . LEU B 1 80  ? -8.381  10.147 28.884 1.00 16.59 ? 78   LEU B CD1 1 
ATOM   2101 C CD2 . LEU B 1 80  ? -6.601  8.568  29.470 1.00 14.18 ? 78   LEU B CD2 1 
ATOM   2102 N N   . ILE B 1 81  ? -3.899  10.922 32.886 1.00 9.50  ? 79   ILE B N   1 
ATOM   2103 C CA  . ILE B 1 81  ? -3.015  11.842 33.601 1.00 8.82  ? 79   ILE B CA  1 
ATOM   2104 C C   . ILE B 1 81  ? -1.753  12.085 32.791 1.00 8.43  ? 79   ILE B C   1 
ATOM   2105 O O   . ILE B 1 81  ? -1.217  11.198 32.156 1.00 8.98  ? 79   ILE B O   1 
ATOM   2106 C CB  . ILE B 1 81  ? -2.596  11.244 35.004 1.00 10.59 ? 79   ILE B CB  1 
ATOM   2107 C CG1 . ILE B 1 81  ? -3.770  10.579 35.723 1.00 12.14 ? 79   ILE B CG1 1 
ATOM   2108 C CG2 . ILE B 1 81  ? -1.958  12.270 35.931 1.00 12.36 ? 79   ILE B CG2 1 
ATOM   2109 C CD1 . ILE B 1 81  ? -4.908  11.513 36.003 1.00 13.28 ? 79   ILE B CD1 1 
ATOM   2110 N N   . PHE B 1 82  ? -1.293  13.324 32.813 1.00 8.45  ? 80   PHE B N   1 
ATOM   2111 C CA  . PHE B 1 82  ? -0.196  13.791 32.009 1.00 7.14  ? 80   PHE B CA  1 
ATOM   2112 C C   . PHE B 1 82  ? 0.721   14.653 32.844 1.00 8.50  ? 80   PHE B C   1 
ATOM   2113 O O   . PHE B 1 82  ? 0.341   15.100 33.903 1.00 8.54  ? 80   PHE B O   1 
ATOM   2114 C CB  . PHE B 1 82  ? -0.701  14.592 30.800 1.00 7.88  ? 80   PHE B CB  1 
ATOM   2115 C CG  . PHE B 1 82  ? -1.683  13.883 29.963 1.00 7.14  ? 80   PHE B CG  1 
ATOM   2116 C CD1 . PHE B 1 82  ? -3.036  13.835 30.329 1.00 8.63  ? 80   PHE B CD1 1 
ATOM   2117 C CD2 . PHE B 1 82  ? -1.268  13.059 28.918 1.00 9.87  ? 80   PHE B CD2 1 
ATOM   2118 C CE1 . PHE B 1 82  ? -3.942  13.103 29.623 1.00 8.17  ? 80   PHE B CE1 1 
ATOM   2119 C CE2 . PHE B 1 82  ? -2.197  12.321 28.256 1.00 10.96 ? 80   PHE B CE2 1 
ATOM   2120 C CZ  . PHE B 1 82  ? -3.503  12.390 28.585 1.00 10.09 ? 80   PHE B CZ  1 
ATOM   2121 N N   . ALA B 1 83  ? 1.946   14.809 32.393 1.00 8.96  ? 81   ALA B N   1 
ATOM   2122 C CA  . ALA B 1 83  ? 3.004   15.474 33.174 1.00 8.18  ? 81   ALA B CA  1 
ATOM   2123 C C   . ALA B 1 83  ? 3.646   16.635 32.434 1.00 8.03  ? 81   ALA B C   1 
ATOM   2124 O O   . ALA B 1 83  ? 4.805   16.926 32.643 1.00 11.46 ? 81   ALA B O   1 
ATOM   2125 C CB  . ALA B 1 83  ? 4.039   14.482 33.658 1.00 9.88  ? 81   ALA B CB  1 
ATOM   2126 N N   . ARG B 1 84  ? 2.918   17.326 31.573 1.00 8.64  ? 82   ARG B N   1 
ATOM   2127 C CA  . ARG B 1 84  ? 3.383   18.530 30.947 1.00 8.89  ? 82   ARG B CA  1 
ATOM   2128 C C   . ARG B 1 84  ? 2.869   19.756 31.713 1.00 10.59 ? 82   ARG B C   1 
ATOM   2129 O O   . ARG B 1 84  ? 1.873   19.665 32.377 1.00 9.85  ? 82   ARG B O   1 
ATOM   2130 C CB  . ARG B 1 84  ? 2.914   18.661 29.453 1.00 11.08 ? 82   ARG B CB  1 
ATOM   2131 C CG  . ARG B 1 84  ? 3.131   17.427 28.656 1.00 10.23 ? 82   ARG B CG  1 
ATOM   2132 C CD  . ARG B 1 84  ? 4.592   17.131 28.447 1.00 9.24  ? 82   ARG B CD  1 
ATOM   2133 N NE  . ARG B 1 84  ? 4.782   16.002 27.493 1.00 8.52  ? 82   ARG B NE  1 
ATOM   2134 C CZ  . ARG B 1 84  ? 5.959   15.640 26.994 1.00 8.33  ? 82   ARG B CZ  1 
ATOM   2135 N NH1 . ARG B 1 84  ? 7.071   16.245 27.377 1.00 9.43  ? 82   ARG B NH1 1 
ATOM   2136 N NH2 . ARG B 1 84  ? 6.015   14.685 26.094 1.00 8.98  ? 82   ARG B NH2 1 
ATOM   2137 N N   . PRO B 1 85  ? 3.539   20.890 31.603 1.00 10.05 ? 83   PRO B N   1 
ATOM   2138 C CA  . PRO B 1 85  ? 3.037   22.081 32.190 1.00 11.17 ? 83   PRO B CA  1 
ATOM   2139 C C   . PRO B 1 85  ? 1.668   22.504 31.755 1.00 10.15 ? 83   PRO B C   1 
ATOM   2140 O O   . PRO B 1 85  ? 0.916   23.034 32.542 1.00 13.46 ? 83   PRO B O   1 
ATOM   2141 C CB  . PRO B 1 85  ? 4.043   23.150 31.731 1.00 14.36 ? 83   PRO B CB  1 
ATOM   2142 C CG  . PRO B 1 85  ? 5.282   22.415 31.491 1.00 14.28 ? 83   PRO B CG  1 
ATOM   2143 C CD  . PRO B 1 85  ? 4.935   21.026 31.143 1.00 11.90 ? 83   PRO B CD  1 
ATOM   2144 N N   . ASN B 1 86  ? 1.413   22.313 30.496 1.00 9.90  ? 84   ASN B N   1 
ATOM   2145 C CA  . ASN B 1 86  ? 0.126   22.636 29.914 1.00 11.28 ? 84   ASN B CA  1 
ATOM   2146 C C   . ASN B 1 86  ? -0.716  21.365 29.721 1.00 8.74  ? 84   ASN B C   1 
ATOM   2147 O O   . ASN B 1 86  ? -0.194  20.347 29.367 1.00 10.14 ? 84   ASN B O   1 
ATOM   2148 C CB  . ASN B 1 86  ? 0.352   23.351 28.639 1.00 15.33 ? 84   ASN B CB  1 
ATOM   2149 C CG  . ASN B 1 86  ? 1.043   24.692 28.870 1.00 19.10 ? 84   ASN B CG  1 
ATOM   2150 O OD1 . ASN B 1 86  ? 0.775   25.453 29.848 1.00 23.21 ? 84   ASN B OD1 1 
ATOM   2151 N ND2 . ASN B 1 86  ? 1.912   25.011 27.937 1.00 27.69 ? 84   ASN B ND2 1 
ATOM   2152 N N   . VAL B 1 87  ? -2.015  21.492 29.946 1.00 9.09  ? 85   VAL B N   1 
ATOM   2153 C CA  . VAL B 1 87  ? -2.906  20.351 29.819 1.00 8.71  ? 85   VAL B CA  1 
ATOM   2154 C C   . VAL B 1 87  ? -3.159  20.066 28.338 1.00 7.30  ? 85   VAL B C   1 
ATOM   2155 O O   . VAL B 1 87  ? -3.113  20.959 27.501 1.00 7.71  ? 85   VAL B O   1 
ATOM   2156 C CB  . VAL B 1 87  ? -4.217  20.561 30.563 1.00 11.10 ? 85   VAL B CB  1 
ATOM   2157 C CG1 . VAL B 1 87  ? -3.996  20.917 32.043 1.00 12.63 ? 85   VAL B CG1 1 
ATOM   2158 C CG2 . VAL B 1 87  ? -5.099  21.593 29.921 1.00 11.46 ? 85   VAL B CG2 1 
ATOM   2159 N N   . PRO B 1 88  ? -3.478  18.814 27.987 1.00 7.73  ? 86   PRO B N   1 
ATOM   2160 C CA  . PRO B 1 88  ? -3.839  18.542 26.607 1.00 5.93  ? 86   PRO B CA  1 
ATOM   2161 C C   . PRO B 1 88  ? -5.095  19.301 26.185 1.00 5.97  ? 86   PRO B C   1 
ATOM   2162 O O   . PRO B 1 88  ? -5.980  19.545 26.977 1.00 7.15  ? 86   PRO B O   1 
ATOM   2163 C CB  . PRO B 1 88  ? -4.126  16.995 26.640 1.00 7.78  ? 86   PRO B CB  1 
ATOM   2164 C CG  . PRO B 1 88  ? -3.439  16.518 27.867 1.00 10.41 ? 86   PRO B CG  1 
ATOM   2165 C CD  . PRO B 1 88  ? -3.527  17.614 28.868 1.00 9.39  ? 86   PRO B CD  1 
ATOM   2166 N N   . ASP B 1 89  ? -5.096  19.747 24.932 1.00 5.08  ? 87   ASP B N   1 
ATOM   2167 C CA  . ASP B 1 89  ? -6.249  20.484 24.379 1.00 5.46  ? 87   ASP B CA  1 
ATOM   2168 C C   . ASP B 1 89  ? -7.516  19.675 24.337 1.00 5.21  ? 87   ASP B C   1 
ATOM   2169 O O   . ASP B 1 89  ? -8.580  20.203 24.538 1.00 5.43  ? 87   ASP B O   1 
ATOM   2170 C CB  . ASP B 1 89  ? -5.883  21.040 23.005 1.00 6.22  ? 87   ASP B CB  1 
ATOM   2171 C CG  . ASP B 1 89  ? -4.761  22.017 23.086 1.00 6.99  ? 87   ASP B CG  1 
ATOM   2172 O OD1 . ASP B 1 89  ? -4.849  22.965 23.884 1.00 8.86  ? 87   ASP B OD1 1 
ATOM   2173 O OD2 . ASP B 1 89  ? -3.762  21.819 22.372 1.00 7.97  ? 87   ASP B OD2 1 
ATOM   2174 N N   . LEU B 1 90  ? -7.361  18.367 24.107 1.00 4.81  ? 88   LEU B N   1 
ATOM   2175 C CA  . LEU B 1 90  ? -8.475  17.424 24.208 1.00 5.86  ? 88   LEU B CA  1 
ATOM   2176 C C   . LEU B 1 90  ? -8.056  16.169 24.934 1.00 5.81  ? 88   LEU B C   1 
ATOM   2177 O O   . LEU B 1 90  ? -6.883  15.764 24.901 1.00 5.70  ? 88   LEU B O   1 
ATOM   2178 C CB  . LEU B 1 90  ? -9.084  17.005 22.858 1.00 6.13  ? 88   LEU B CB  1 
ATOM   2179 C CG  . LEU B 1 90  ? -9.390  18.035 21.770 1.00 6.48  ? 88   LEU B CG  1 
ATOM   2180 C CD1 . LEU B 1 90  ? -8.190  18.385 20.922 1.00 7.36  ? 88   LEU B CD1 1 
ATOM   2181 C CD2 . LEU B 1 90  ? -10.583 17.738 20.920 1.00 6.29  ? 88   LEU B CD2 1 
ATOM   2182 N N   . LEU B 1 91  ? -9.061  15.492 25.525 1.00 6.17  ? 89   LEU B N   1 
ATOM   2183 C CA  . LEU B 1 91  ? -8.904  14.107 25.970 1.00 5.75  ? 89   LEU B CA  1 
ATOM   2184 C C   . LEU B 1 91  ? -9.678  13.252 25.008 1.00 6.50  ? 89   LEU B C   1 
ATOM   2185 O O   . LEU B 1 91  ? -10.869 13.488 24.784 1.00 7.77  ? 89   LEU B O   1 
ATOM   2186 C CB  . LEU B 1 91  ? -9.409  13.899 27.394 1.00 6.51  ? 89   LEU B CB  1 
ATOM   2187 C CG  . LEU B 1 91  ? -8.853  14.762 28.479 1.00 7.36  ? 89   LEU B CG  1 
ATOM   2188 C CD1 . LEU B 1 91  ? -9.452  14.402 29.852 1.00 9.24  ? 89   LEU B CD1 1 
ATOM   2189 C CD2 . LEU B 1 91  ? -7.338  14.700 28.528 1.00 6.77  ? 89   LEU B CD2 1 
ATOM   2190 N N   . ASP B 1 92  ? -8.999  12.237 24.452 1.00 6.75  ? 90   ASP B N   1 
ATOM   2191 C CA  . ASP B 1 92  ? -9.620  11.251 23.553 1.00 7.58  ? 90   ASP B CA  1 
ATOM   2192 C C   . ASP B 1 92  ? -9.985  10.025 24.382 1.00 7.72  ? 90   ASP B C   1 
ATOM   2193 O O   . ASP B 1 92  ? -9.097  9.304  24.786 1.00 8.42  ? 90   ASP B O   1 
ATOM   2194 C CB  . ASP B 1 92  ? -8.626  10.859 22.446 1.00 7.13  ? 90   ASP B CB  1 
ATOM   2195 C CG  . ASP B 1 92  ? -9.177  9.892  21.465 1.00 8.26  ? 90   ASP B CG  1 
ATOM   2196 O OD1 . ASP B 1 92  ? -10.198 9.244  21.733 1.00 8.59  ? 90   ASP B OD1 1 
ATOM   2197 O OD2 . ASP B 1 92  ? -8.582  9.787  20.332 1.00 10.66 ? 90   ASP B OD2 1 
ATOM   2198 N N   . LEU B 1 93  ? -11.266 9.877  24.676 1.00 8.15  ? 91   LEU B N   1 
ATOM   2199 C CA  . LEU B 1 93  ? -11.706 8.827  25.594 1.00 8.63  ? 91   LEU B CA  1 
ATOM   2200 C C   . LEU B 1 93  ? -11.747 7.432  24.964 1.00 10.80 ? 91   LEU B C   1 
ATOM   2201 O O   . LEU B 1 93  ? -11.774 6.411  25.679 1.00 11.50 ? 91   LEU B O   1 
ATOM   2202 C CB  . LEU B 1 93  ? -13.069 9.209  26.150 1.00 8.57  ? 91   LEU B CB  1 
ATOM   2203 C CG  . LEU B 1 93  ? -13.138 10.582 26.857 1.00 8.05  ? 91   LEU B CG  1 
ATOM   2204 C CD1 . LEU B 1 93  ? -14.514 10.769 27.432 1.00 11.21 ? 91   LEU B CD1 1 
ATOM   2205 C CD2 . LEU B 1 93  ? -12.014 10.694 27.941 1.00 9.63  ? 91   LEU B CD2 1 
ATOM   2206 N N   . LYS B 1 94  ? -11.745 7.409  23.663 1.00 8.35  ? 92   LYS B N   1 
ATOM   2207 C CA  . LYS B 1 94  ? -11.666 6.156  22.915 1.00 10.04 ? 92   LYS B CA  1 
ATOM   2208 C C   . LYS B 1 94  ? -10.284 5.583  22.934 1.00 9.45  ? 92   LYS B C   1 
ATOM   2209 O O   . LYS B 1 94  ? -10.077 4.439  23.329 1.00 12.56 ? 92   LYS B O   1 
ATOM   2210 C CB  . LYS B 1 94  ? -12.172 6.361  21.468 1.00 9.69  ? 92   LYS B CB  1 
ATOM   2211 C CG  . LYS B 1 94  ? -12.095 5.124  20.617 1.00 11.73 ? 92   LYS B CG  1 
ATOM   2212 C CD  . LYS B 1 94  ? -12.402 5.384  19.149 1.00 16.84 ? 92   LYS B CD  1 
ATOM   2213 C CE  . LYS B 1 94  ? -12.494 4.081  18.362 1.00 20.73 ? 92   LYS B CE  1 
ATOM   2214 N NZ  . LYS B 1 94  ? -11.407 3.108  18.690 1.00 27.26 ? 92   LYS B NZ  1 
ATOM   2215 N N   . GLU B 1 95  ? -9.330  6.366  22.468 1.00 10.94 ? 93   GLU B N   1 
ATOM   2216 C CA  . GLU B 1 95  ? -7.948  5.945  22.304 1.00 12.71 ? 93   GLU B CA  1 
ATOM   2217 C C   . GLU B 1 95  ? -7.156  6.117  23.608 1.00 10.94 ? 93   GLU B C   1 
ATOM   2218 O O   . GLU B 1 95  ? -6.019  5.616  23.736 1.00 12.83 ? 93   GLU B O   1 
ATOM   2219 C CB  . GLU B 1 95  ? -7.244  6.664  21.142 1.00 13.08 ? 93   GLU B CB  1 
ATOM   2220 C CG  . GLU B 1 95  ? -7.869  6.367  19.786 1.00 13.00 ? 93   GLU B CG  1 
ATOM   2221 C CD  . GLU B 1 95  ? -7.875  4.890  19.408 1.00 17.45 ? 93   GLU B CD  1 
ATOM   2222 O OE1 . GLU B 1 95  ? -6.990  4.112  19.791 1.00 21.07 ? 93   GLU B OE1 1 
ATOM   2223 O OE2 . GLU B 1 95  ? -8.756  4.477  18.636 1.00 22.38 ? 93   GLU B OE2 1 
ATOM   2224 N N   . ARG B 1 96  ? -7.744  6.802  24.585 1.00 9.73  ? 94   ARG B N   1 
ATOM   2225 C CA  . ARG B 1 96  ? -7.057  7.021  25.886 1.00 10.72 ? 94   ARG B CA  1 
ATOM   2226 C C   . ARG B 1 96  ? -5.803  7.813  25.696 1.00 9.58  ? 94   ARG B C   1 
ATOM   2227 O O   . ARG B 1 96  ? -4.713  7.414  26.138 1.00 11.19 ? 94   ARG B O   1 
ATOM   2228 C CB  . ARG B 1 96  ? -6.788  5.667  26.603 1.00 10.49 ? 94   ARG B CB  1 
ATOM   2229 C CG  . ARG B 1 96  ? -8.066  4.820  26.800 1.00 12.49 ? 94   ARG B CG  1 
ATOM   2230 C CD  . ARG B 1 96  ? -8.997  5.458  27.777 1.00 12.45 ? 94   ARG B CD  1 
ATOM   2231 N NE  . ARG B 1 96  ? -8.359  5.498  29.109 1.00 16.24 ? 94   ARG B NE  1 
ATOM   2232 C CZ  . ARG B 1 96  ? -8.802  6.137  30.190 1.00 18.37 ? 94   ARG B CZ  1 
ATOM   2233 N NH1 . ARG B 1 96  ? -9.958  6.790  30.207 1.00 16.38 ? 94   ARG B NH1 1 
ATOM   2234 N NH2 . ARG B 1 96  ? -8.039  6.130  31.286 1.00 16.35 ? 94   ARG B NH2 1 
ATOM   2235 N N   A LYS B 1 97  ? -5.918  8.965  25.017 0.60 9.00  ? 95   LYS B N   1 
ATOM   2236 N N   B LYS B 1 97  ? -5.950  8.955  24.997 0.40 8.30  ? 95   LYS B N   1 
ATOM   2237 C CA  A LYS B 1 97  ? -4.775  9.829  24.805 0.60 9.49  ? 95   LYS B CA  1 
ATOM   2238 C CA  B LYS B 1 97  ? -4.852  9.844  24.637 0.40 7.88  ? 95   LYS B CA  1 
ATOM   2239 C C   A LYS B 1 97  ? -5.145  11.278 25.062 0.60 7.70  ? 95   LYS B C   1 
ATOM   2240 C C   B LYS B 1 97  ? -5.165  11.278 25.095 0.40 6.79  ? 95   LYS B C   1 
ATOM   2241 O O   A LYS B 1 97  ? -6.323  11.748 24.937 0.60 8.97  ? 95   LYS B O   1 
ATOM   2242 O O   B LYS B 1 97  ? -6.341  11.735 25.153 0.40 7.64  ? 95   LYS B O   1 
ATOM   2243 C CB  A LYS B 1 97  ? -4.220  9.694  23.400 0.60 11.96 ? 95   LYS B CB  1 
ATOM   2244 C CB  B LYS B 1 97  ? -4.624  9.855  23.117 0.40 6.89  ? 95   LYS B CB  1 
ATOM   2245 C CG  A LYS B 1 97  ? -3.610  8.319  23.144 0.60 13.39 ? 95   LYS B CG  1 
ATOM   2246 C CG  B LYS B 1 97  ? -4.274  8.501  22.476 0.40 7.76  ? 95   LYS B CG  1 
ATOM   2247 C CD  A LYS B 1 97  ? -3.087  8.119  21.749 0.60 16.04 ? 95   LYS B CD  1 
ATOM   2248 C CD  B LYS B 1 97  ? -2.949  7.912  23.001 0.40 7.38  ? 95   LYS B CD  1 
ATOM   2249 C CE  A LYS B 1 97  ? -2.726  6.676  21.481 0.60 18.93 ? 95   LYS B CE  1 
ATOM   2250 C CE  B LYS B 1 97  ? -2.679  6.534  22.462 0.40 8.46  ? 95   LYS B CE  1 
ATOM   2251 N NZ  A LYS B 1 97  ? -1.548  6.294  22.294 0.60 19.09 ? 95   LYS B NZ  1 
ATOM   2252 N NZ  B LYS B 1 97  ? -1.491  5.912  23.111 0.40 12.21 ? 95   LYS B NZ  1 
ATOM   2253 N N   . GLY B 1 98  ? -4.095  12.006 25.387 1.00 6.90  ? 96   GLY B N   1 
ATOM   2254 C CA  . GLY B 1 98  ? -4.137  13.476 25.447 1.00 6.31  ? 96   GLY B CA  1 
ATOM   2255 C C   . GLY B 1 98  ? -3.756  14.059 24.096 1.00 6.52  ? 96   GLY B C   1 
ATOM   2256 O O   . GLY B 1 98  ? -2.730  13.682 23.567 1.00 7.34  ? 96   GLY B O   1 
ATOM   2257 N N   . VAL B 1 99  ? -4.586  14.943 23.539 1.00 4.93  ? 97   VAL B N   1 
ATOM   2258 C CA  . VAL B 1 99  ? -4.339  15.465 22.238 1.00 5.35  ? 97   VAL B CA  1 
ATOM   2259 C C   . VAL B 1 99  ? -3.973  16.943 22.338 1.00 6.02  ? 97   VAL B C   1 
ATOM   2260 O O   . VAL B 1 99  ? -4.670  17.738 22.967 1.00 6.02  ? 97   VAL B O   1 
ATOM   2261 C CB  . VAL B 1 99  ? -5.610  15.328 21.332 1.00 5.83  ? 97   VAL B CB  1 
ATOM   2262 C CG1 . VAL B 1 99  ? -5.305  15.827 19.910 1.00 7.72  ? 97   VAL B CG1 1 
ATOM   2263 C CG2 . VAL B 1 99  ? -6.150  13.881 21.315 1.00 8.95  ? 97   VAL B CG2 1 
ATOM   2264 N N   . TYR B 1 100 ? -2.821  17.297 21.759 1.00 5.31  ? 98   TYR B N   1 
ATOM   2265 C CA  . TYR B 1 100 ? -2.347  18.669 21.689 1.00 5.41  ? 98   TYR B CA  1 
ATOM   2266 C C   . TYR B 1 100 ? -2.505  19.127 20.241 1.00 6.69  ? 98   TYR B C   1 
ATOM   2267 O O   . TYR B 1 100 ? -2.201  18.338 19.338 1.00 8.28  ? 98   TYR B O   1 
ATOM   2268 C CB  . TYR B 1 100 ? -0.883  18.786 22.133 1.00 7.30  ? 98   TYR B CB  1 
ATOM   2269 C CG  . TYR B 1 100 ? -0.644  18.242 23.518 1.00 8.21  ? 98   TYR B CG  1 
ATOM   2270 C CD1 . TYR B 1 100 ? -0.385  16.906 23.681 1.00 8.60  ? 98   TYR B CD1 1 
ATOM   2271 C CD2 . TYR B 1 100 ? -0.630  19.074 24.660 1.00 8.32  ? 98   TYR B CD2 1 
ATOM   2272 C CE1 . TYR B 1 100 ? -0.114  16.330 24.921 1.00 12.11 ? 98   TYR B CE1 1 
ATOM   2273 C CE2 . TYR B 1 100 ? -0.296  18.500 25.925 1.00 8.38  ? 98   TYR B CE2 1 
ATOM   2274 C CZ  . TYR B 1 100 ? -0.093  17.131 26.006 1.00 10.34 ? 98   TYR B CZ  1 
ATOM   2275 O OH  . TYR B 1 100 ? 0.255   16.535 27.245 1.00 11.06 ? 98   TYR B OH  1 
ATOM   2276 N N   . VAL B 1 101 ? -3.004  20.357 20.044 1.00 5.63  ? 99   VAL B N   1 
ATOM   2277 C CA  . VAL B 1 101 ? -3.175  20.908 18.684 1.00 6.20  ? 99   VAL B CA  1 
ATOM   2278 C C   . VAL B 1 101 ? -2.209  22.011 18.470 1.00 7.27  ? 99   VAL B C   1 
ATOM   2279 O O   . VAL B 1 101 ? -2.116  22.904 19.287 1.00 7.45  ? 99   VAL B O   1 
ATOM   2280 C CB  . VAL B 1 101 ? -4.615  21.374 18.472 1.00 6.33  ? 99   VAL B CB  1 
ATOM   2281 C CG1 . VAL B 1 101 ? -4.809  22.042 17.073 1.00 9.29  ? 99   VAL B CG1 1 
ATOM   2282 C CG2 . VAL B 1 101 ? -5.514  20.164 18.661 1.00 8.92  ? 99   VAL B CG2 1 
ATOM   2283 N N   A LYS B 1 102 ? -1.509  21.943 17.332 0.60 7.39  ? 100  LYS B N   1 
ATOM   2284 N N   B LYS B 1 102 ? -1.418  21.923 17.399 0.40 7.10  ? 100  LYS B N   1 
ATOM   2285 C CA  A LYS B 1 102 ? -0.484  22.918 16.964 0.60 8.71  ? 100  LYS B CA  1 
ATOM   2286 C CA  B LYS B 1 102 ? -0.603  23.073 17.002 0.40 8.63  ? 100  LYS B CA  1 
ATOM   2287 C C   A LYS B 1 102 ? -0.773  23.396 15.511 0.60 7.72  ? 100  LYS B C   1 
ATOM   2288 C C   B LYS B 1 102 ? -0.839  23.414 15.545 0.40 7.90  ? 100  LYS B C   1 
ATOM   2289 O O   A LYS B 1 102 ? -0.841  22.580 14.612 0.60 7.41  ? 100  LYS B O   1 
ATOM   2290 O O   B LYS B 1 102 ? -0.906  22.548 14.684 0.40 7.45  ? 100  LYS B O   1 
ATOM   2291 C CB  A LYS B 1 102 ? 0.928   22.306 17.066 0.60 11.06 ? 100  LYS B CB  1 
ATOM   2292 C CB  B LYS B 1 102 ? 0.904   22.901 17.206 0.40 9.39  ? 100  LYS B CB  1 
ATOM   2293 C CG  A LYS B 1 102 ? 1.299   21.851 18.464 0.60 12.80 ? 100  LYS B CG  1 
ATOM   2294 C CG  B LYS B 1 102 ? 1.692   24.126 16.752 0.40 8.45  ? 100  LYS B CG  1 
ATOM   2295 C CD  A LYS B 1 102 ? 2.787   21.646 18.784 0.60 17.90 ? 100  LYS B CD  1 
ATOM   2296 C CD  B LYS B 1 102 ? 3.106   24.095 17.279 0.40 9.38  ? 100  LYS B CD  1 
ATOM   2297 C CE  A LYS B 1 102 ? 2.930   21.817 20.309 0.60 18.00 ? 100  LYS B CE  1 
ATOM   2298 C CE  B LYS B 1 102 ? 4.012   25.038 16.519 0.40 11.50 ? 100  LYS B CE  1 
ATOM   2299 N NZ  A LYS B 1 102 ? 1.914   20.950 20.963 0.60 21.55 ? 100  LYS B NZ  1 
ATOM   2300 N NZ  B LYS B 1 102 ? 3.239   26.218 16.098 0.40 15.06 ? 100  LYS B NZ  1 
ATOM   2301 N N   . VAL B 1 103 ? -0.949  24.716 15.326 1.00 9.14  ? 101  VAL B N   1 
ATOM   2302 C CA  . VAL B 1 103 ? -1.161  25.303 14.005 1.00 9.69  ? 101  VAL B CA  1 
ATOM   2303 C C   . VAL B 1 103 ? 0.170   25.956 13.549 1.00 10.01 ? 101  VAL B C   1 
ATOM   2304 O O   . VAL B 1 103 ? 0.750   26.850 14.190 1.00 12.72 ? 101  VAL B O   1 
ATOM   2305 C CB  . VAL B 1 103 ? -2.269  26.357 14.080 1.00 12.00 ? 101  VAL B CB  1 
ATOM   2306 C CG1 . VAL B 1 103 ? -2.449  27.047 12.740 1.00 14.41 ? 101  VAL B CG1 1 
ATOM   2307 C CG2 . VAL B 1 103 ? -3.565  25.699 14.594 1.00 12.84 ? 101  VAL B CG2 1 
ATOM   2308 N N   . TYR B 1 104 ? 0.631   25.505 12.413 1.00 9.68  ? 102  TYR B N   1 
ATOM   2309 C CA  . TYR B 1 104 ? 1.920   25.890 11.790 1.00 10.04 ? 102  TYR B CA  1 
ATOM   2310 C C   . TYR B 1 104 ? 1.693   26.892 10.685 1.00 9.68  ? 102  TYR B C   1 
ATOM   2311 O O   . TYR B 1 104 ? 0.576   27.024 10.131 1.00 8.46  ? 102  TYR B O   1 
ATOM   2312 C CB  . TYR B 1 104 ? 2.601   24.629 11.241 1.00 11.15 ? 102  TYR B CB  1 
ATOM   2313 C CG  . TYR B 1 104 ? 3.140   23.773 12.334 1.00 10.76 ? 102  TYR B CG  1 
ATOM   2314 C CD1 . TYR B 1 104 ? 2.362   22.911 13.054 1.00 11.17 ? 102  TYR B CD1 1 
ATOM   2315 C CD2 . TYR B 1 104 ? 4.466   23.768 12.606 1.00 12.76 ? 102  TYR B CD2 1 
ATOM   2316 C CE1 . TYR B 1 104 ? 2.897   22.093 14.046 1.00 11.33 ? 102  TYR B CE1 1 
ATOM   2317 C CE2 . TYR B 1 104 ? 5.014   22.996 13.586 1.00 14.27 ? 102  TYR B CE2 1 
ATOM   2318 C CZ  . TYR B 1 104 ? 4.252   22.132 14.305 1.00 12.93 ? 102  TYR B CZ  1 
ATOM   2319 O OH  . TYR B 1 104 ? 4.815   21.351 15.261 1.00 16.16 ? 102  TYR B OH  1 
ATOM   2320 N N   . PRO B 1 105 ? 2.805   27.473 10.212 1.00 10.47 ? 103  PRO B N   1 
ATOM   2321 C CA  . PRO B 1 105 ? 2.669   28.439 9.091  1.00 10.17 ? 103  PRO B CA  1 
ATOM   2322 C C   . PRO B 1 105 ? 2.189   27.796 7.783  1.00 10.45 ? 103  PRO B C   1 
ATOM   2323 O O   . PRO B 1 105 ? 2.298   26.598 7.612  1.00 12.39 ? 103  PRO B O   1 
ATOM   2324 C CB  . PRO B 1 105 ? 4.097   29.059 8.984  1.00 14.24 ? 103  PRO B CB  1 
ATOM   2325 C CG  . PRO B 1 105 ? 4.976   28.398 9.955  1.00 16.82 ? 103  PRO B CG  1 
ATOM   2326 C CD  . PRO B 1 105 ? 4.183   27.441 10.765 1.00 11.20 ? 103  PRO B CD  1 
ATOM   2327 N N   . ASP B 1 106 ? 1.671   28.593 6.877  1.00 12.11 ? 104  ASP B N   1 
ATOM   2328 C CA  . ASP B 1 106 ? 1.178   28.144 5.580  1.00 14.02 ? 104  ASP B CA  1 
ATOM   2329 C C   . ASP B 1 106 ? 2.250   27.501 4.781  1.00 12.36 ? 104  ASP B C   1 
ATOM   2330 O O   . ASP B 1 106 ? 3.434   27.774 4.960  1.00 11.43 ? 104  ASP B O   1 
ATOM   2331 C CB  . ASP B 1 106 ? 0.604   29.288 4.765  1.00 12.46 ? 104  ASP B CB  1 
ATOM   2332 C CG  . ASP B 1 106 ? 1.624   30.342 4.455  1.00 13.81 ? 104  ASP B CG  1 
ATOM   2333 O OD1 . ASP B 1 106 ? 1.965   31.085 5.378  1.00 14.62 ? 104  ASP B OD1 1 
ATOM   2334 O OD2 . ASP B 1 106 ? 2.054   30.490 3.293  1.00 14.70 ? 104  ASP B OD2 1 
ATOM   2335 N N   . ASN B 1 107 ? 1.830   26.528 3.961  1.00 12.89 ? 105  ASN B N   1 
ATOM   2336 C CA  . ASN B 1 107 ? 2.683   25.998 2.904  1.00 12.73 ? 105  ASN B CA  1 
ATOM   2337 C C   . ASN B 1 107 ? 3.923   25.347 3.462  1.00 13.66 ? 105  ASN B C   1 
ATOM   2338 O O   . ASN B 1 107 ? 5.064   25.761 3.137  1.00 14.00 ? 105  ASN B O   1 
ATOM   2339 C CB  . ASN B 1 107 ? 2.931   27.106 1.873  1.00 16.34 ? 105  ASN B CB  1 
ATOM   2340 C CG  . ASN B 1 107 ? 1.681   27.403 1.075  1.00 14.16 ? 105  ASN B CG  1 
ATOM   2341 O OD1 . ASN B 1 107 ? 1.231   26.593 0.303  1.00 13.54 ? 105  ASN B OD1 1 
ATOM   2342 N ND2 . ASN B 1 107 ? 1.076   28.546 1.335  1.00 15.20 ? 105  ASN B ND2 1 
ATOM   2343 N N   . GLY B 1 108 ? 3.725   24.386 4.332  1.00 13.61 ? 106  GLY B N   1 
ATOM   2344 C CA  . GLY B 1 108 ? 4.770   23.440 4.643  1.00 15.23 ? 106  GLY B CA  1 
ATOM   2345 C C   . GLY B 1 108 ? 4.229   22.339 5.532  1.00 14.61 ? 106  GLY B C   1 
ATOM   2346 O O   . GLY B 1 108 ? 3.624   22.589 6.565  1.00 15.64 ? 106  GLY B O   1 
ATOM   2347 N N   . THR B 1 109 ? 4.490   21.093 5.164  1.00 12.69 ? 107  THR B N   1 
ATOM   2348 C CA  . THR B 1 109 ? 3.897   20.008 5.969  1.00 11.43 ? 107  THR B CA  1 
ATOM   2349 C C   . THR B 1 109 ? 4.647   19.935 7.302  1.00 9.68  ? 107  THR B C   1 
ATOM   2350 O O   . THR B 1 109 ? 5.892   19.836 7.314  1.00 10.44 ? 107  THR B O   1 
ATOM   2351 C CB  . THR B 1 109 ? 3.953   18.646 5.292  1.00 14.20 ? 107  THR B CB  1 
ATOM   2352 O OG1 . THR B 1 109 ? 3.305   18.766 4.029  1.00 18.49 ? 107  THR B OG1 1 
ATOM   2353 C CG2 . THR B 1 109 ? 3.250   17.546 6.128  1.00 17.72 ? 107  THR B CG2 1 
ATOM   2354 N N   . PRO B 1 110 ? 3.916   19.995 8.420  1.00 10.43 ? 108  PRO B N   1 
ATOM   2355 C CA  . PRO B 1 110 ? 4.657   19.968 9.697  1.00 10.21 ? 108  PRO B CA  1 
ATOM   2356 C C   . PRO B 1 110 ? 5.352   18.651 9.916  1.00 10.41 ? 108  PRO B C   1 
ATOM   2357 O O   . PRO B 1 110 ? 4.892   17.619 9.487  1.00 9.63  ? 108  PRO B O   1 
ATOM   2358 C CB  . PRO B 1 110 ? 3.545   20.112 10.710 1.00 10.67 ? 108  PRO B CB  1 
ATOM   2359 C CG  . PRO B 1 110 ? 2.425   20.880 9.980  1.00 9.63  ? 108  PRO B CG  1 
ATOM   2360 C CD  . PRO B 1 110 ? 2.480   20.280 8.601  1.00 10.84 ? 108  PRO B CD  1 
ATOM   2361 N N   . THR B 1 111 ? 6.444   18.729 10.631 1.00 10.31 ? 109  THR B N   1 
ATOM   2362 C CA  . THR B 1 111 ? 7.252   17.560 11.045 1.00 10.89 ? 109  THR B CA  1 
ATOM   2363 C C   . THR B 1 111 ? 6.798   16.994 12.412 1.00 9.26  ? 109  THR B C   1 
ATOM   2364 O O   . THR B 1 111 ? 6.515   17.738 13.342 1.00 11.32 ? 109  THR B O   1 
ATOM   2365 C CB  . THR B 1 111 ? 8.736   17.982 11.126 1.00 12.89 ? 109  THR B CB  1 
ATOM   2366 O OG1 . THR B 1 111 ? 9.103   18.638 9.868  1.00 16.23 ? 109  THR B OG1 1 
ATOM   2367 C CG2 . THR B 1 111 ? 9.651   16.778 11.464 1.00 12.18 ? 109  THR B CG2 1 
ATOM   2368 N N   . ASP B 1 112 ? 6.663   15.683 12.472 1.00 9.61  ? 110  ASP B N   1 
ATOM   2369 C CA  . ASP B 1 112 ? 6.379   14.964 13.714 1.00 10.72 ? 110  ASP B CA  1 
ATOM   2370 C C   . ASP B 1 112 ? 7.672   14.680 14.513 1.00 10.54 ? 110  ASP B C   1 
ATOM   2371 O O   . ASP B 1 112 ? 8.702   14.343 13.947 1.00 12.65 ? 110  ASP B O   1 
ATOM   2372 C CB  . ASP B 1 112 ? 5.680   13.637 13.430 1.00 10.17 ? 110  ASP B CB  1 
ATOM   2373 C CG  . ASP B 1 112 ? 4.350   13.817 12.766 1.00 10.49 ? 110  ASP B CG  1 
ATOM   2374 O OD1 . ASP B 1 112 ? 3.559   14.604 13.327 1.00 10.84 ? 110  ASP B OD1 1 
ATOM   2375 O OD2 . ASP B 1 112 ? 4.117   13.188 11.705 1.00 9.65  ? 110  ASP B OD2 1 
ATOM   2376 N N   . TYR B 1 113 ? 7.600   14.960 15.800 1.00 12.08 ? 111  TYR B N   1 
ATOM   2377 C CA  . TYR B 1 113 ? 8.660   14.682 16.720 1.00 13.39 ? 111  TYR B CA  1 
ATOM   2378 C C   . TYR B 1 113 ? 8.051   13.845 17.854 1.00 16.19 ? 111  TYR B C   1 
ATOM   2379 O O   . TYR B 1 113 ? 6.797   13.844 18.016 1.00 19.12 ? 111  TYR B O   1 
ATOM   2380 C CB  . TYR B 1 113 ? 9.291   16.038 17.224 1.00 12.66 ? 111  TYR B CB  1 
ATOM   2381 C CG  . TYR B 1 113 ? 9.957   16.845 16.171 1.00 14.56 ? 111  TYR B CG  1 
ATOM   2382 C CD1 . TYR B 1 113 ? 11.154  16.406 15.634 1.00 15.86 ? 111  TYR B CD1 1 
ATOM   2383 C CD2 . TYR B 1 113 ? 9.415   18.039 15.661 1.00 13.91 ? 111  TYR B CD2 1 
ATOM   2384 C CE1 . TYR B 1 113 ? 11.825  17.123 14.651 1.00 13.08 ? 111  TYR B CE1 1 
ATOM   2385 C CE2 . TYR B 1 113 ? 10.066  18.762 14.647 1.00 16.40 ? 111  TYR B CE2 1 
ATOM   2386 C CZ  . TYR B 1 113 ? 11.274  18.280 14.138 1.00 15.03 ? 111  TYR B CZ  1 
ATOM   2387 O OH  . TYR B 1 113 ? 11.915  18.973 13.113 1.00 17.45 ? 111  TYR B OH  1 
ATOM   2388 N N   . GLN B 1 114 ? 8.902   13.240 18.673 1.00 18.76 ? 112  GLN B N   1 
ATOM   2389 C CA  . GLN B 1 114 ? 8.545   12.343 19.768 1.00 20.99 ? 112  GLN B CA  1 
ATOM   2390 C C   . GLN B 1 114 ? 7.566   12.951 20.772 1.00 17.13 ? 112  GLN B C   1 
ATOM   2391 O O   . GLN B 1 114 ? 7.598   14.132 21.079 1.00 16.69 ? 112  GLN B O   1 
ATOM   2392 C CB  . GLN B 1 114 ? 9.827   11.876 20.490 1.00 19.43 ? 112  GLN B CB  1 
ATOM   2393 C CG  . GLN B 1 114 ? 9.511   10.975 21.653 1.00 17.92 ? 112  GLN B CG  1 
ATOM   2394 C CD  . GLN B 1 114 ? 10.689  10.643 22.560 1.00 23.64 ? 112  GLN B CD  1 
ATOM   2395 O OE1 . GLN B 1 114 ? 11.681  11.366 22.641 1.00 28.83 ? 112  GLN B OE1 1 
ATOM   2396 N NE2 . GLN B 1 114 ? 10.548  9.548  23.279 1.00 22.96 ? 112  GLN B NE2 1 
ATOM   2397 N N   . THR B 1 115 ? 6.593   12.111 21.156 1.00 17.02 ? 113  THR B N   1 
ATOM   2398 C CA  . THR B 1 115 ? 5.679   12.413 22.226 1.00 13.07 ? 113  THR B CA  1 
ATOM   2399 C C   . THR B 1 115 ? 5.586   11.155 23.119 1.00 11.30 ? 113  THR B C   1 
ATOM   2400 O O   . THR B 1 115 ? 6.125   10.093 22.786 1.00 14.30 ? 113  THR B O   1 
ATOM   2401 C CB  . THR B 1 115 ? 4.249   12.753 21.727 1.00 15.33 ? 113  THR B CB  1 
ATOM   2402 O OG1 . THR B 1 115 ? 3.736   11.656 20.991 1.00 19.99 ? 113  THR B OG1 1 
ATOM   2403 C CG2 . THR B 1 115 ? 4.247   13.939 20.785 1.00 19.51 ? 113  THR B CG2 1 
ATOM   2404 N N   . ALA B 1 116 ? 4.981   11.292 24.287 1.00 11.54 ? 114  ALA B N   1 
ATOM   2405 C CA  . ALA B 1 116 ? 4.828   10.219 25.188 1.00 10.68 ? 114  ALA B CA  1 
ATOM   2406 C C   . ALA B 1 116 ? 3.816   9.223  24.609 1.00 11.74 ? 114  ALA B C   1 
ATOM   2407 O O   . ALA B 1 116 ? 3.043   9.557  23.648 1.00 10.04 ? 114  ALA B O   1 
ATOM   2408 C CB  . ALA B 1 116 ? 4.400   10.775 26.567 1.00 13.28 ? 114  ALA B CB  1 
ATOM   2409 N N   . GLU B 1 117 ? 3.773   8.033  25.214 1.00 12.37 ? 115  GLU B N   1 
ATOM   2410 C CA  . GLU B 1 117 ? 2.919   6.989  24.647 1.00 13.54 ? 115  GLU B CA  1 
ATOM   2411 C C   . GLU B 1 117 ? 1.421   7.349  24.749 1.00 11.18 ? 115  GLU B C   1 
ATOM   2412 O O   . GLU B 1 117 ? 0.638   6.875  23.993 1.00 14.42 ? 115  GLU B O   1 
ATOM   2413 C CB  . GLU B 1 117 ? 3.281   5.582  25.222 1.00 17.61 ? 115  GLU B CB  1 
ATOM   2414 C CG  . GLU B 1 117 ? 4.640   5.079  24.738 1.00 23.56 ? 115  GLU B CG  1 
ATOM   2415 C CD  . GLU B 1 117 ? 4.704   5.016  23.207 1.00 25.41 ? 115  GLU B CD  1 
ATOM   2416 O OE1 . GLU B 1 117 ? 3.936   4.223  22.639 1.00 42.99 ? 115  GLU B OE1 1 
ATOM   2417 O OE2 . GLU B 1 117 ? 5.484   5.806  22.580 1.00 37.45 ? 115  GLU B OE2 1 
ATOM   2418 N N   . ASN B 1 118 ? 1.050   8.112  25.746 1.00 9.79  ? 116  ASN B N   1 
ATOM   2419 C CA  . ASN B 1 118 ? -0.349  8.509  25.914 1.00 9.35  ? 116  ASN B CA  1 
ATOM   2420 C C   . ASN B 1 118 ? -0.698  9.865  25.268 1.00 7.64  ? 116  ASN B C   1 
ATOM   2421 O O   . ASN B 1 118 ? -1.777  10.384 25.532 1.00 8.99  ? 116  ASN B O   1 
ATOM   2422 C CB  . ASN B 1 118 ? -0.797  8.442  27.381 1.00 11.06 ? 116  ASN B CB  1 
ATOM   2423 C CG  . ASN B 1 118 ? -0.187  9.542  28.273 1.00 12.60 ? 116  ASN B CG  1 
ATOM   2424 O OD1 . ASN B 1 118 ? 0.746   10.251 27.901 1.00 11.95 ? 116  ASN B OD1 1 
ATOM   2425 N ND2 . ASN B 1 118 ? -0.703  9.640  29.509 1.00 14.97 ? 116  ASN B ND2 1 
ATOM   2426 N N   . GLU B 1 119 ? 0.159   10.387 24.405 1.00 7.82  ? 117  GLU B N   1 
ATOM   2427 C CA  . GLU B 1 119 ? -0.066  11.704 23.828 1.00 6.61  ? 117  GLU B CA  1 
ATOM   2428 C C   . GLU B 1 119 ? -0.128  11.590 22.307 1.00 7.47  ? 117  GLU B C   1 
ATOM   2429 O O   . GLU B 1 119 ? 0.573   10.778 21.716 1.00 8.26  ? 117  GLU B O   1 
ATOM   2430 C CB  . GLU B 1 119 ? 1.096   12.668 24.165 1.00 7.85  ? 117  GLU B CB  1 
ATOM   2431 C CG  . GLU B 1 119 ? 1.182   12.997 25.654 1.00 7.74  ? 117  GLU B CG  1 
ATOM   2432 C CD  . GLU B 1 119 ? 2.387   13.848 26.014 1.00 11.26 ? 117  GLU B CD  1 
ATOM   2433 O OE1 . GLU B 1 119 ? 3.362   13.745 25.290 1.00 11.86 ? 117  GLU B OE1 1 
ATOM   2434 O OE2 . GLU B 1 119 ? 2.234   14.655 26.968 1.00 10.81 ? 117  GLU B OE2 1 
ATOM   2435 N N   A ILE B 1 120 ? -0.909  12.501 21.698 0.60 6.65  ? 118  ILE B N   1 
ATOM   2436 N N   B ILE B 1 120 ? -0.894  12.495 21.691 0.40 7.14  ? 118  ILE B N   1 
ATOM   2437 C CA  A ILE B 1 120 ? -0.983  12.696 20.255 0.60 7.39  ? 118  ILE B CA  1 
ATOM   2438 C CA  B ILE B 1 120 ? -0.917  12.636 20.252 0.40 7.85  ? 118  ILE B CA  1 
ATOM   2439 C C   A ILE B 1 120 ? -0.836  14.186 20.008 0.60 7.23  ? 118  ILE B C   1 
ATOM   2440 C C   B ILE B 1 120 ? -0.903  14.134 19.927 0.40 7.57  ? 118  ILE B C   1 
ATOM   2441 O O   A ILE B 1 120 ? -1.474  15.011 20.644 0.60 7.22  ? 118  ILE B O   1 
ATOM   2442 O O   B ILE B 1 120 ? -1.686  14.909 20.448 0.40 8.09  ? 118  ILE B O   1 
ATOM   2443 C CB  A ILE B 1 120 ? -2.381  12.288 19.724 0.60 8.19  ? 118  ILE B CB  1 
ATOM   2444 C CB  B ILE B 1 120 ? -2.139  11.898 19.636 0.40 11.42 ? 118  ILE B CB  1 
ATOM   2445 C CG1 A ILE B 1 120 ? -2.533  10.786 19.946 0.60 8.13  ? 118  ILE B CG1 1 
ATOM   2446 C CG1 B ILE B 1 120 ? -2.301  12.292 18.162 0.40 13.41 ? 118  ILE B CG1 1 
ATOM   2447 C CG2 A ILE B 1 120 ? -2.563  12.780 18.238 0.60 11.68 ? 118  ILE B CG2 1 
ATOM   2448 C CG2 B ILE B 1 120 ? -3.439  12.184 20.367 0.40 14.20 ? 118  ILE B CG2 1 
ATOM   2449 C CD1 A ILE B 1 120 ? -1.752  9.982  18.940 0.60 10.01 ? 118  ILE B CD1 1 
ATOM   2450 C CD1 B ILE B 1 120 ? -1.096  11.931 17.387 0.40 14.75 ? 118  ILE B CD1 1 
ATOM   2451 N N   . PHE B 1 121 ? 0.010   14.532 19.043 1.00 7.56  ? 119  PHE B N   1 
ATOM   2452 C CA  . PHE B 1 121 ? 0.159   15.917 18.610 1.00 9.07  ? 119  PHE B CA  1 
ATOM   2453 C C   . PHE B 1 121 ? -0.376  16.117 17.247 1.00 8.45  ? 119  PHE B C   1 
ATOM   2454 O O   . PHE B 1 121 ? 0.232   15.655 16.278 1.00 10.51 ? 119  PHE B O   1 
ATOM   2455 C CB  . PHE B 1 121 ? 1.649   16.327 18.703 1.00 10.94 ? 119  PHE B CB  1 
ATOM   2456 C CG  . PHE B 1 121 ? 2.121   16.661 20.029 1.00 15.79 ? 119  PHE B CG  1 
ATOM   2457 C CD1 . PHE B 1 121 ? 2.230   15.708 20.989 1.00 21.54 ? 119  PHE B CD1 1 
ATOM   2458 C CD2 . PHE B 1 121 ? 2.494   17.958 20.324 1.00 20.01 ? 119  PHE B CD2 1 
ATOM   2459 C CE1 . PHE B 1 121 ? 2.683   16.022 22.256 1.00 22.83 ? 119  PHE B CE1 1 
ATOM   2460 C CE2 . PHE B 1 121 ? 2.965   18.280 21.596 1.00 23.24 ? 119  PHE B CE2 1 
ATOM   2461 C CZ  . PHE B 1 121 ? 3.025   17.304 22.545 1.00 18.82 ? 119  PHE B CZ  1 
ATOM   2462 N N   . VAL B 1 122 ? -1.569  16.732 17.161 1.00 6.54  ? 120  VAL B N   1 
ATOM   2463 C CA  . VAL B 1 122 ? -2.147  17.141 15.918 1.00 6.97  ? 120  VAL B CA  1 
ATOM   2464 C C   . VAL B 1 122 ? -1.409  18.381 15.392 1.00 6.54  ? 120  VAL B C   1 
ATOM   2465 O O   . VAL B 1 122 ? -1.451  19.386 16.056 1.00 9.29  ? 120  VAL B O   1 
ATOM   2466 C CB  . VAL B 1 122 ? -3.702  17.346 16.046 1.00 8.27  ? 120  VAL B CB  1 
ATOM   2467 C CG1 . VAL B 1 122 ? -4.272  18.168 14.883 1.00 9.75  ? 120  VAL B CG1 1 
ATOM   2468 C CG2 . VAL B 1 122 ? -4.429  16.002 16.252 1.00 8.51  ? 120  VAL B CG2 1 
ATOM   2469 N N   A ARG B 1 123 ? -0.812  18.259 14.224 0.60 6.57  ? 121  ARG B N   1 
ATOM   2470 N N   B ARG B 1 123 ? -0.817  18.248 14.215 0.40 6.67  ? 121  ARG B N   1 
ATOM   2471 C CA  A ARG B 1 123 ? 0.020   19.259 13.656 0.60 6.20  ? 121  ARG B CA  1 
ATOM   2472 C CA  B ARG B 1 123 ? 0.003   19.249 13.612 0.40 6.35  ? 121  ARG B CA  1 
ATOM   2473 C C   A ARG B 1 123 ? -0.478  19.610 12.272 0.60 5.97  ? 121  ARG B C   1 
ATOM   2474 C C   B ARG B 1 123 ? -0.548  19.589 12.259 0.40 6.42  ? 121  ARG B C   1 
ATOM   2475 O O   A ARG B 1 123 ? -0.374  18.772 11.318 0.60 7.75  ? 121  ARG B O   1 
ATOM   2476 O O   B ARG B 1 123 ? -0.549  18.739 11.329 0.40 8.21  ? 121  ARG B O   1 
ATOM   2477 C CB  A ARG B 1 123 ? 1.532   18.829 13.653 0.60 7.54  ? 121  ARG B CB  1 
ATOM   2478 C CB  B ARG B 1 123 ? 1.460   18.771 13.462 0.40 7.76  ? 121  ARG B CB  1 
ATOM   2479 C CG  A ARG B 1 123 ? 2.195   18.788 15.046 0.60 7.87  ? 121  ARG B CG  1 
ATOM   2480 C CG  B ARG B 1 123 ? 2.002   18.120 14.696 0.40 7.80  ? 121  ARG B CG  1 
ATOM   2481 C CD  A ARG B 1 123 ? 3.647   18.368 14.923 0.60 9.57  ? 121  ARG B CD  1 
ATOM   2482 C CD  B ARG B 1 123 ? 3.447   17.765 14.531 0.40 9.49  ? 121  ARG B CD  1 
ATOM   2483 N NE  A ARG B 1 123 ? 4.504   18.779 16.049 0.60 11.88 ? 121  ARG B NE  1 
ATOM   2484 N NE  B ARG B 1 123 ? 3.962   16.989 15.647 0.40 11.84 ? 121  ARG B NE  1 
ATOM   2485 C CZ  A ARG B 1 123 ? 5.061   17.965 16.926 0.60 10.22 ? 121  ARG B CZ  1 
ATOM   2486 C CZ  B ARG B 1 123 ? 4.496   17.483 16.753 0.40 10.99 ? 121  ARG B CZ  1 
ATOM   2487 N NH1 A ARG B 1 123 ? 4.858   16.621 16.853 0.60 12.46 ? 121  ARG B NH1 1 
ATOM   2488 N NH1 B ARG B 1 123 ? 4.588   18.793 16.926 0.40 8.80  ? 121  ARG B NH1 1 
ATOM   2489 N NH2 A ARG B 1 123 ? 5.886   18.499 17.828 0.60 11.90 ? 121  ARG B NH2 1 
ATOM   2490 N NH2 B ARG B 1 123 ? 4.962   16.637 17.684 0.40 10.92 ? 121  ARG B NH2 1 
ATOM   2491 N N   . VAL B 1 124 ? -1.029  20.819 12.125 1.00 7.36  ? 122  VAL B N   1 
ATOM   2492 C CA  . VAL B 1 124 ? -1.680  21.253 10.891 1.00 7.31  ? 122  VAL B CA  1 
ATOM   2493 C C   . VAL B 1 124 ? -1.141  22.565 10.447 1.00 7.66  ? 122  VAL B C   1 
ATOM   2494 O O   . VAL B 1 124 ? -0.855  23.411 11.314 1.00 9.14  ? 122  VAL B O   1 
ATOM   2495 C CB  . VAL B 1 124 ? -3.206  21.310 11.084 1.00 7.18  ? 122  VAL B CB  1 
ATOM   2496 C CG1 . VAL B 1 124 ? -3.702  19.901 11.357 1.00 8.91  ? 122  VAL B CG1 1 
ATOM   2497 C CG2 . VAL B 1 124 ? -3.680  22.303 12.120 1.00 9.51  ? 122  VAL B CG2 1 
ATOM   2498 N N   . SER B 1 125 ? -1.047  22.840 9.140  1.00 7.32  ? 123  SER B N   1 
ATOM   2499 C CA  . SER B 1 125 ? -0.611  24.106 8.633  1.00 6.90  ? 123  SER B CA  1 
ATOM   2500 C C   . SER B 1 125 ? -1.783  24.980 8.317  1.00 7.19  ? 123  SER B C   1 
ATOM   2501 O O   . SER B 1 125 ? -2.921  24.512 8.033  1.00 8.58  ? 123  SER B O   1 
ATOM   2502 C CB  . SER B 1 125 ? 0.254   23.993 7.380  1.00 7.42  ? 123  SER B CB  1 
ATOM   2503 O OG  . SER B 1 125 ? -0.562  23.787 6.265  1.00 7.65  ? 123  SER B OG  1 
ATOM   2504 N N   . LEU B 1 126 ? -1.558  26.300 8.303  1.00 8.05  ? 124  LEU B N   1 
ATOM   2505 C CA  . LEU B 1 126 ? -2.621  27.229 7.952  1.00 9.47  ? 124  LEU B CA  1 
ATOM   2506 C C   . LEU B 1 126 ? -3.220  26.906 6.577  1.00 9.39  ? 124  LEU B C   1 
ATOM   2507 O O   . LEU B 1 126 ? -4.397  27.189 6.342  1.00 11.71 ? 124  LEU B O   1 
ATOM   2508 C CB  . LEU B 1 126 ? -2.058  28.649 8.009  1.00 11.40 ? 124  LEU B CB  1 
ATOM   2509 C CG  . LEU B 1 126 ? -1.729  29.371 9.300  1.00 14.48 ? 124  LEU B CG  1 
ATOM   2510 C CD1 . LEU B 1 126 ? -1.038  30.717 9.085  1.00 19.39 ? 124  LEU B CD1 1 
ATOM   2511 C CD2 . LEU B 1 126 ? -3.008  29.462 10.164 1.00 17.90 ? 124  LEU B CD2 1 
ATOM   2512 N N   . SER B 1 127 ? -2.441  26.419 5.631  1.00 8.00  ? 125  SER B N   1 
ATOM   2513 C CA  . SER B 1 127 ? -2.950  26.067 4.327  1.00 8.03  ? 125  SER B CA  1 
ATOM   2514 C C   . SER B 1 127 ? -3.499  24.686 4.162  1.00 8.06  ? 125  SER B C   1 
ATOM   2515 O O   . SER B 1 127 ? -3.808  24.270 3.027  1.00 8.15  ? 125  SER B O   1 
ATOM   2516 C CB  . SER B 1 127 ? -1.858  26.297 3.281  1.00 8.83  ? 125  SER B CB  1 
ATOM   2517 O OG  . SER B 1 127 ? -0.769  25.515 3.562  1.00 9.44  ? 125  SER B OG  1 
ATOM   2518 N N   . GLY B 1 128 ? -3.715  24.007 5.263  1.00 7.55  ? 126  GLY B N   1 
ATOM   2519 C CA  . GLY B 1 128 ? -4.493  22.796 5.233  1.00 8.87  ? 126  GLY B CA  1 
ATOM   2520 C C   . GLY B 1 128 ? -3.715  21.501 5.263  1.00 6.81  ? 126  GLY B C   1 
ATOM   2521 O O   . GLY B 1 128 ? -4.297  20.433 4.990  1.00 8.73  ? 126  GLY B O   1 
ATOM   2522 N N   . GLN B 1 129 ? -2.399  21.567 5.469  1.00 7.24  ? 127  GLN B N   1 
ATOM   2523 C CA  . GLN B 1 129 ? -1.577  20.389 5.465  1.00 7.34  ? 127  GLN B CA  1 
ATOM   2524 C C   . GLN B 1 129 ? -1.663  19.741 6.839  1.00 6.83  ? 127  GLN B C   1 
ATOM   2525 O O   . GLN B 1 129 ? -1.765  20.440 7.875  1.00 9.65  ? 127  GLN B O   1 
ATOM   2526 C CB  . GLN B 1 129 ? -0.154  20.656 5.043  1.00 8.40  ? 127  GLN B CB  1 
ATOM   2527 C CG  . GLN B 1 129 ? -0.069  21.332 3.686  1.00 10.25 ? 127  GLN B CG  1 
ATOM   2528 C CD  . GLN B 1 129 ? 1.135   22.159 3.553  1.00 10.16 ? 127  GLN B CD  1 
ATOM   2529 O OE1 . GLN B 1 129 ? 1.214   23.184 4.167  1.00 12.46 ? 127  GLN B OE1 1 
ATOM   2530 N NE2 . GLN B 1 129 ? 2.065   21.729 2.682  1.00 11.93 ? 127  GLN B NE2 1 
ATOM   2531 N N   . MET B 1 130 ? -1.492  18.396 6.882  1.00 6.71  ? 128  MET B N   1 
ATOM   2532 C CA  . MET B 1 130 ? -1.479  17.628 8.088  1.00 6.90  ? 128  MET B CA  1 
ATOM   2533 C C   . MET B 1 130 ? -0.171  16.845 8.137  1.00 6.89  ? 128  MET B C   1 
ATOM   2534 O O   . MET B 1 130 ? 0.276   16.270 7.125  1.00 7.30  ? 128  MET B O   1 
ATOM   2535 C CB  . MET B 1 130 ? -2.596  16.633 8.074  1.00 7.34  ? 128  MET B CB  1 
ATOM   2536 C CG  . MET B 1 130 ? -3.994  17.217 8.217  1.00 9.39  ? 128  MET B CG  1 
ATOM   2537 S SD  . MET B 1 130 ? -5.295  15.999 7.802  1.00 12.53 ? 128  MET B SD  1 
ATOM   2538 C CE  . MET B 1 130 ? -4.967  15.644 6.041  1.00 13.81 ? 128  MET B CE  1 
ATOM   2539 N N   . SER B 1 131 ? 0.482   16.777 9.282  1.00 7.08  ? 129  SER B N   1 
ATOM   2540 C CA  . SER B 1 131 ? 1.634   15.905 9.455  1.00 7.01  ? 129  SER B CA  1 
ATOM   2541 C C   . SER B 1 131 ? 1.293   14.458 9.244  1.00 7.38  ? 129  SER B C   1 
ATOM   2542 O O   . SER B 1 131 ? 0.121   14.051 9.385  1.00 7.28  ? 129  SER B O   1 
ATOM   2543 C CB  . SER B 1 131 ? 2.321   16.080 10.800 1.00 8.66  ? 129  SER B CB  1 
ATOM   2544 O OG  . SER B 1 131 ? 1.593   15.378 11.834 1.00 7.85  ? 129  SER B OG  1 
ATOM   2545 N N   . PRO B 1 132 ? 2.285   13.624 8.934  1.00 8.69  ? 130  PRO B N   1 
ATOM   2546 C CA  . PRO B 1 132 ? 1.952   12.155 8.716  1.00 8.60  ? 130  PRO B CA  1 
ATOM   2547 C C   . PRO B 1 132 ? 1.265   11.498 9.929  1.00 8.88  ? 130  PRO B C   1 
ATOM   2548 O O   . PRO B 1 132 ? 0.296   10.754 9.760  1.00 10.31 ? 130  PRO B O   1 
ATOM   2549 C CB  . PRO B 1 132 ? 3.312   11.538 8.470  1.00 10.51 ? 130  PRO B CB  1 
ATOM   2550 C CG  . PRO B 1 132 ? 4.056   12.671 7.750  1.00 11.62 ? 130  PRO B CG  1 
ATOM   2551 C CD  . PRO B 1 132 ? 3.670   13.894 8.527  1.00 7.55  ? 130  PRO B CD  1 
ATOM   2552 N N   . ILE B 1 133 ? 1.660   11.798 11.169 1.00 9.33  ? 131  ILE B N   1 
ATOM   2553 C CA  . ILE B 1 133 ? 1.018   11.192 12.303 1.00 10.83 ? 131  ILE B CA  1 
ATOM   2554 C C   . ILE B 1 133 ? -0.420  11.733 12.468 1.00 9.88  ? 131  ILE B C   1 
ATOM   2555 O O   . ILE B 1 133 ? -1.321  11.000 12.855 1.00 10.52 ? 131  ILE B O   1 
ATOM   2556 C CB  . ILE B 1 133 ? 1.783   11.510 13.611 1.00 13.30 ? 131  ILE B CB  1 
ATOM   2557 C CG1 . ILE B 1 133 ? 3.087   10.724 13.722 1.00 19.75 ? 131  ILE B CG1 1 
ATOM   2558 C CG2 . ILE B 1 133 ? 0.908   11.206 14.871 1.00 16.49 ? 131  ILE B CG2 1 
ATOM   2559 C CD1 . ILE B 1 133 ? 2.803   9.318  14.084 1.00 23.00 ? 131  ILE B CD1 1 
ATOM   2560 N N   . THR B 1 134 ? -0.619  12.982 12.148 1.00 7.19  ? 132  THR B N   1 
ATOM   2561 C CA  . THR B 1 134 ? -1.913  13.628 12.193 1.00 7.25  ? 132  THR B CA  1 
ATOM   2562 C C   . THR B 1 134 ? -2.876  12.929 11.271 1.00 6.66  ? 132  THR B C   1 
ATOM   2563 O O   . THR B 1 134 ? -4.021  12.640 11.632 1.00 7.67  ? 132  THR B O   1 
ATOM   2564 C CB  . THR B 1 134 ? -1.782  15.137 11.889 1.00 7.55  ? 132  THR B CB  1 
ATOM   2565 O OG1 . THR B 1 134 ? -0.908  15.704 12.890 1.00 8.02  ? 132  THR B OG1 1 
ATOM   2566 C CG2 . THR B 1 134 ? -3.144  15.837 11.961 1.00 8.48  ? 132  THR B CG2 1 
ATOM   2567 N N   A ARG B 1 135 ? -2.436  12.743 10.034 0.60 7.20  ? 133  ARG B N   1 
ATOM   2568 N N   B ARG B 1 135 ? -2.477  12.729 10.034 0.40 7.28  ? 133  ARG B N   1 
ATOM   2569 C CA  A ARG B 1 135 ? -3.229  12.073 8.992  0.60 8.01  ? 133  ARG B CA  1 
ATOM   2570 C CA  B ARG B 1 135 ? -3.414  12.173 9.081  0.40 7.61  ? 133  ARG B CA  1 
ATOM   2571 C C   A ARG B 1 135 ? -3.681  10.693 9.424  0.60 8.23  ? 133  ARG B C   1 
ATOM   2572 C C   B ARG B 1 135 ? -3.664  10.656 9.338  0.40 8.48  ? 133  ARG B C   1 
ATOM   2573 O O   A ARG B 1 135 ? -4.815  10.308 9.107  0.60 10.05 ? 133  ARG B O   1 
ATOM   2574 O O   B ARG B 1 135 ? -4.673  10.146 8.850  0.40 9.97  ? 133  ARG B O   1 
ATOM   2575 C CB  A ARG B 1 135 ? -2.398  11.894 7.663  0.60 8.42  ? 133  ARG B CB  1 
ATOM   2576 C CB  B ARG B 1 135 ? -2.954  12.491 7.634  0.40 8.72  ? 133  ARG B CB  1 
ATOM   2577 C CG  A ARG B 1 135 ? -1.970  13.221 7.100  0.60 10.41 ? 133  ARG B CG  1 
ATOM   2578 C CG  B ARG B 1 135 ? -1.714  11.714 7.210  0.40 9.04  ? 133  ARG B CG  1 
ATOM   2579 C CD  A ARG B 1 135 ? -1.455  13.099 5.696  0.60 9.88  ? 133  ARG B CD  1 
ATOM   2580 C CD  B ARG B 1 135 ? -1.184  11.955 5.788  0.40 11.75 ? 133  ARG B CD  1 
ATOM   2581 N NE  A ARG B 1 135 ? -0.252  12.293 5.524  0.60 12.10 ? 133  ARG B NE  1 
ATOM   2582 N NE  B ARG B 1 135 ? -0.396  13.179 5.692  0.40 13.08 ? 133  ARG B NE  1 
ATOM   2583 C CZ  A ARG B 1 135 ? 0.950   12.857 5.336  0.60 14.83 ? 133  ARG B CZ  1 
ATOM   2584 C CZ  B ARG B 1 135 ? 0.835   13.264 5.177  0.40 16.08 ? 133  ARG B CZ  1 
ATOM   2585 N NH1 A ARG B 1 135 ? 1.108   14.177 5.344  0.60 16.18 ? 133  ARG B NH1 1 
ATOM   2586 N NH1 B ARG B 1 135 ? 1.440   12.185 4.635  0.40 12.43 ? 133  ARG B NH1 1 
ATOM   2587 N NH2 A ARG B 1 135 ? 1.993   12.108 5.072  0.60 16.39 ? 133  ARG B NH2 1 
ATOM   2588 N NH2 B ARG B 1 135 ? 1.453   14.447 5.172  0.40 14.55 ? 133  ARG B NH2 1 
ATOM   2589 N N   . GLU B 1 136 ? -2.797  9.959  10.091 1.00 9.04  ? 134  GLU B N   1 
ATOM   2590 C CA  . GLU B 1 136 ? -3.051  8.590  10.502 1.00 9.56  ? 134  GLU B CA  1 
ATOM   2591 C C   . GLU B 1 136 ? -4.004  8.600  11.714 1.00 9.95  ? 134  GLU B C   1 
ATOM   2592 O O   . GLU B 1 136 ? -4.847  7.729  11.869 1.00 13.50 ? 134  GLU B O   1 
ATOM   2593 C CB  . GLU B 1 136 ? -1.721  7.915  10.825 1.00 13.22 ? 134  GLU B CB  1 
ATOM   2594 C CG  . GLU B 1 136 ? -0.791  7.705  9.640  1.00 18.26 ? 134  GLU B CG  1 
ATOM   2595 C CD  . GLU B 1 136 ? 0.643   7.286  10.122 1.00 25.79 ? 134  GLU B CD  1 
ATOM   2596 O OE1 . GLU B 1 136 ? 0.770   6.578  11.160 1.00 32.95 ? 134  GLU B OE1 1 
ATOM   2597 O OE2 . GLU B 1 136 ? 1.673   7.671  9.504  1.00 37.08 ? 134  GLU B OE2 1 
ATOM   2598 N N   . TYR B 1 137 ? -3.849  9.562  12.622 1.00 7.28  ? 135  TYR B N   1 
ATOM   2599 C CA  . TYR B 1 137 ? -4.674  9.596  13.829 1.00 7.20  ? 135  TYR B CA  1 
ATOM   2600 C C   . TYR B 1 137 ? -6.112  9.981  13.520 1.00 6.52  ? 135  TYR B C   1 
ATOM   2601 O O   . TYR B 1 137 ? -7.038  9.376  14.021 1.00 7.47  ? 135  TYR B O   1 
ATOM   2602 C CB  . TYR B 1 137 ? -4.035  10.580 14.832 1.00 7.14  ? 135  TYR B CB  1 
ATOM   2603 C CG  . TYR B 1 137 ? -4.945  10.919 15.964 1.00 7.20  ? 135  TYR B CG  1 
ATOM   2604 C CD1 . TYR B 1 137 ? -5.261  9.929  16.940 1.00 5.92  ? 135  TYR B CD1 1 
ATOM   2605 C CD2 . TYR B 1 137 ? -5.578  12.127 16.046 1.00 7.07  ? 135  TYR B CD2 1 
ATOM   2606 C CE1 . TYR B 1 137 ? -6.207  10.199 17.927 1.00 8.35  ? 135  TYR B CE1 1 
ATOM   2607 C CE2 . TYR B 1 137 ? -6.497  12.405 17.048 1.00 6.92  ? 135  TYR B CE2 1 
ATOM   2608 C CZ  . TYR B 1 137 ? -6.777  11.478 17.997 1.00 6.22  ? 135  TYR B CZ  1 
ATOM   2609 O OH  . TYR B 1 137 ? -7.760  11.755 18.977 1.00 6.97  ? 135  TYR B OH  1 
ATOM   2610 N N   . LEU B 1 138 ? -6.296  11.064 12.760 1.00 6.23  ? 136  LEU B N   1 
ATOM   2611 C CA  . LEU B 1 138 ? -7.631  11.542 12.379 1.00 5.62  ? 136  LEU B CA  1 
ATOM   2612 C C   . LEU B 1 138 ? -8.273  10.605 11.405 1.00 6.51  ? 136  LEU B C   1 
ATOM   2613 O O   . LEU B 1 138 ? -7.642  10.114 10.483 1.00 7.82  ? 136  LEU B O   1 
ATOM   2614 C CB  . LEU B 1 138 ? -7.525  12.963 11.851 1.00 7.05  ? 136  LEU B CB  1 
ATOM   2615 C CG  . LEU B 1 138 ? -7.024  14.074 12.786 1.00 7.92  ? 136  LEU B CG  1 
ATOM   2616 C CD1 . LEU B 1 138 ? -6.923  15.377 12.037 1.00 8.92  ? 136  LEU B CD1 1 
ATOM   2617 C CD2 . LEU B 1 138 ? -7.884  14.231 14.041 1.00 7.47  ? 136  LEU B CD2 1 
ATOM   2618 N N   . ASP B 1 139 ? -9.556  10.449 11.578 1.00 5.86  ? 137  ASP B N   1 
ATOM   2619 C CA  . ASP B 1 139 ? -10.332 9.673  10.595 1.00 7.07  ? 137  ASP B CA  1 
ATOM   2620 C C   . ASP B 1 139 ? -10.726 10.535 9.389  1.00 6.31  ? 137  ASP B C   1 
ATOM   2621 O O   . ASP B 1 139 ? -10.437 11.702 9.333  1.00 6.85  ? 137  ASP B O   1 
ATOM   2622 C CB  . ASP B 1 139 ? -11.495 8.954  11.256 1.00 8.38  ? 137  ASP B CB  1 
ATOM   2623 C CG  . ASP B 1 139 ? -12.643 9.781  11.586 1.00 12.14 ? 137  ASP B CG  1 
ATOM   2624 O OD1 . ASP B 1 139 ? -12.819 10.886 11.121 1.00 11.26 ? 137  ASP B OD1 1 
ATOM   2625 O OD2 . ASP B 1 139 ? -13.503 9.266  12.348 1.00 17.58 ? 137  ASP B OD2 1 
ATOM   2626 N N   . GLU B 1 140 ? -11.340 9.935  8.377  1.00 6.80  ? 138  GLU B N   1 
ATOM   2627 C CA  . GLU B 1 140 ? -11.522 10.646 7.097  1.00 7.35  ? 138  GLU B CA  1 
ATOM   2628 C C   . GLU B 1 140 ? -12.432 11.837 7.289  1.00 7.34  ? 138  GLU B C   1 
ATOM   2629 O O   . GLU B 1 140 ? -12.184 12.933 6.747  1.00 8.14  ? 138  GLU B O   1 
ATOM   2630 C CB  . GLU B 1 140 ? -12.068 9.712  6.054  1.00 8.51  ? 138  GLU B CB  1 
ATOM   2631 C CG  . GLU B 1 140 ? -12.217 10.336 4.679  1.00 9.49  ? 138  GLU B CG  1 
ATOM   2632 C CD  . GLU B 1 140 ? -12.691 9.378  3.598  1.00 10.56 ? 138  GLU B CD  1 
ATOM   2633 O OE1 . GLU B 1 140 ? -13.109 8.292  3.912  1.00 13.28 ? 138  GLU B OE1 1 
ATOM   2634 O OE2 . GLU B 1 140 ? -12.658 9.777  2.424  1.00 11.54 ? 138  GLU B OE2 1 
ATOM   2635 N N   . VAL B 1 141 ? -13.454 11.707 8.142  1.00 6.93  ? 139  VAL B N   1 
ATOM   2636 C CA  . VAL B 1 141 ? -14.397 12.796 8.386  1.00 7.69  ? 139  VAL B CA  1 
ATOM   2637 C C   . VAL B 1 141 ? -13.702 13.923 9.131  1.00 7.23  ? 139  VAL B C   1 
ATOM   2638 O O   . VAL B 1 141 ? -13.829 15.112 8.837  1.00 7.03  ? 139  VAL B O   1 
ATOM   2639 C CB  . VAL B 1 141 ? -15.654 12.294 9.167  1.00 9.09  ? 139  VAL B CB  1 
ATOM   2640 C CG1 . VAL B 1 141 ? -16.489 13.457 9.689  1.00 13.38 ? 139  VAL B CG1 1 
ATOM   2641 C CG2 . VAL B 1 141 ? -16.489 11.456 8.218  1.00 13.28 ? 139  VAL B CG2 1 
ATOM   2642 N N   . GLN B 1 142 ? -12.919 13.605 10.140 1.00 5.97  ? 140  GLN B N   1 
ATOM   2643 C CA  . GLN B 1 142 ? -12.167 14.639 10.880 1.00 6.27  ? 140  GLN B CA  1 
ATOM   2644 C C   . GLN B 1 142 ? -11.130 15.320 9.987  1.00 6.12  ? 140  GLN B C   1 
ATOM   2645 O O   . GLN B 1 142 ? -11.003 16.562 10.064 1.00 6.45  ? 140  GLN B O   1 
ATOM   2646 C CB  . GLN B 1 142 ? -11.415 13.986 12.027 1.00 6.47  ? 140  GLN B CB  1 
ATOM   2647 C CG  . GLN B 1 142 ? -12.319 13.449 13.094 1.00 6.98  ? 140  GLN B CG  1 
ATOM   2648 C CD  . GLN B 1 142 ? -11.532 12.645 14.175 1.00 6.95  ? 140  GLN B CD  1 
ATOM   2649 O OE1 . GLN B 1 142 ? -10.745 11.756 13.844 1.00 7.59  ? 140  GLN B OE1 1 
ATOM   2650 N NE2 . GLN B 1 142 ? -11.671 13.005 15.473 1.00 6.43  ? 140  GLN B NE2 1 
ATOM   2651 N N   . ARG B 1 143 ? -10.439 14.584 9.112  1.00 6.45  ? 141  ARG B N   1 
ATOM   2652 C CA  . ARG B 1 143 ? -9.475  15.231 8.261  1.00 6.97  ? 141  ARG B CA  1 
ATOM   2653 C C   . ARG B 1 143 ? -10.197 16.184 7.302  1.00 6.36  ? 141  ARG B C   1 
ATOM   2654 O O   . ARG B 1 143 ? -9.720  17.323 7.087  1.00 7.58  ? 141  ARG B O   1 
ATOM   2655 C CB  . ARG B 1 143 ? -8.680  14.194 7.430  1.00 6.82  ? 141  ARG B CB  1 
ATOM   2656 C CG  . ARG B 1 143 ? -7.771  13.345 8.229  1.00 7.02  ? 141  ARG B CG  1 
ATOM   2657 C CD  . ARG B 1 143 ? -6.850  12.507 7.414  1.00 7.07  ? 141  ARG B CD  1 
ATOM   2658 N NE  . ARG B 1 143 ? -7.478  11.668 6.365  1.00 8.14  ? 141  ARG B NE  1 
ATOM   2659 C CZ  . ARG B 1 143 ? -7.941  10.448 6.555  1.00 8.18  ? 141  ARG B CZ  1 
ATOM   2660 N NH1 . ARG B 1 143 ? -7.821  9.862  7.728  1.00 7.91  ? 141  ARG B NH1 1 
ATOM   2661 N NH2 . ARG B 1 143 ? -8.377  9.734  5.525  1.00 7.37  ? 141  ARG B NH2 1 
ATOM   2662 N N   A GLN B 1 144 ? -11.335 15.778 6.764  0.70 7.48  ? 142  GLN B N   1 
ATOM   2663 N N   B GLN B 1 144 ? -11.329 15.764 6.751  0.30 7.39  ? 142  GLN B N   1 
ATOM   2664 C CA  A GLN B 1 144 ? -12.104 16.642 5.884  0.70 7.74  ? 142  GLN B CA  1 
ATOM   2665 C CA  B GLN B 1 144 ? -12.123 16.641 5.899  0.30 7.80  ? 142  GLN B CA  1 
ATOM   2666 C C   A GLN B 1 144 ? -12.583 17.915 6.631  0.70 7.30  ? 142  GLN B C   1 
ATOM   2667 C C   B GLN B 1 144 ? -12.540 17.921 6.637  0.30 7.38  ? 142  GLN B C   1 
ATOM   2668 O O   A GLN B 1 144 ? -12.481 19.012 6.103  0.70 8.53  ? 142  GLN B O   1 
ATOM   2669 O O   B GLN B 1 144 ? -12.352 19.017 6.130  0.30 8.50  ? 142  GLN B O   1 
ATOM   2670 C CB  A GLN B 1 144 ? -13.353 15.929 5.313  0.70 9.00  ? 142  GLN B CB  1 
ATOM   2671 C CB  B GLN B 1 144 ? -13.418 15.968 5.445  0.30 8.88  ? 142  GLN B CB  1 
ATOM   2672 C CG  A GLN B 1 144 ? -12.998 14.893 4.284  0.70 9.27  ? 142  GLN B CG  1 
ATOM   2673 C CG  B GLN B 1 144 ? -13.295 14.978 4.320  0.30 9.66  ? 142  GLN B CG  1 
ATOM   2674 C CD  A GLN B 1 144 ? -12.752 15.584 2.986  0.70 10.94 ? 142  GLN B CD  1 
ATOM   2675 C CD  B GLN B 1 144 ? -14.664 14.633 3.797  0.30 9.91  ? 142  GLN B CD  1 
ATOM   2676 O OE1 A GLN B 1 144 ? -11.633 16.056 2.744  0.70 12.35 ? 142  GLN B OE1 1 
ATOM   2677 O OE1 B GLN B 1 144 ? -15.649 14.573 4.559  0.30 12.71 ? 142  GLN B OE1 1 
ATOM   2678 N NE2 A GLN B 1 144 ? -13.757 15.553 2.093  0.70 15.18 ? 142  GLN B NE2 1 
ATOM   2679 N NE2 B GLN B 1 144 ? -14.753 14.452 2.520  0.30 12.19 ? 142  GLN B NE2 1 
ATOM   2680 N N   . ASP B 1 145 ? -13.137 17.783 7.808  1.00 8.10  ? 143  ASP B N   1 
ATOM   2681 C CA  . ASP B 1 145 ? -13.706 18.923 8.503  1.00 7.16  ? 143  ASP B CA  1 
ATOM   2682 C C   . ASP B 1 145 ? -12.601 19.909 8.924  1.00 6.13  ? 143  ASP B C   1 
ATOM   2683 O O   . ASP B 1 145 ? -12.768 21.139 8.812  1.00 7.86  ? 143  ASP B O   1 
ATOM   2684 C CB  . ASP B 1 145 ? -14.528 18.486 9.763  1.00 6.90  ? 143  ASP B CB  1 
ATOM   2685 C CG  . ASP B 1 145 ? -15.823 17.775 9.423  1.00 10.02 ? 143  ASP B CG  1 
ATOM   2686 O OD1 . ASP B 1 145 ? -16.259 17.887 8.263  1.00 13.16 ? 143  ASP B OD1 1 
ATOM   2687 O OD2 . ASP B 1 145 ? -16.390 17.157 10.286 1.00 10.01 ? 143  ASP B OD2 1 
ATOM   2688 N N   . VAL B 1 146 ? -11.507 19.369 9.483  1.00 6.03  ? 144  VAL B N   1 
ATOM   2689 C CA  . VAL B 1 146 ? -10.395 20.203 9.918  1.00 6.13  ? 144  VAL B CA  1 
ATOM   2690 C C   . VAL B 1 146 ? -9.811  20.931 8.671  1.00 7.23  ? 144  VAL B C   1 
ATOM   2691 O O   . VAL B 1 146 ? -9.639  22.125 8.691  1.00 6.15  ? 144  VAL B O   1 
ATOM   2692 C CB  . VAL B 1 146 ? -9.335  19.363 10.649 1.00 6.32  ? 144  VAL B CB  1 
ATOM   2693 C CG1 . VAL B 1 146 ? -8.010  20.116 10.828 1.00 7.59  ? 144  VAL B CG1 1 
ATOM   2694 C CG2 . VAL B 1 146 ? -9.857  18.910 11.992 1.00 5.83  ? 144  VAL B CG2 1 
ATOM   2695 N N   . THR B 1 147 ? -9.457  20.183 7.640  1.00 7.18  ? 145  THR B N   1 
ATOM   2696 C CA  . THR B 1 147 ? -8.849  20.726 6.439  1.00 8.65  ? 145  THR B CA  1 
ATOM   2697 C C   . THR B 1 147 ? -9.742  21.712 5.710  1.00 7.95  ? 145  THR B C   1 
ATOM   2698 O O   . THR B 1 147 ? -9.238  22.812 5.253  1.00 9.19  ? 145  THR B O   1 
ATOM   2699 C CB  . THR B 1 147 ? -8.395  19.622 5.416  1.00 10.90 ? 145  THR B CB  1 
ATOM   2700 O OG1 . THR B 1 147 ? -9.534  18.886 4.879  1.00 17.03 ? 145  THR B OG1 1 
ATOM   2701 C CG2 . THR B 1 147 ? -7.373  18.744 6.092  1.00 12.53 ? 145  THR B CG2 1 
ATOM   2702 N N   . ASN B 1 148 ? -11.035 21.428 5.619  1.00 8.23  ? 146  ASN B N   1 
ATOM   2703 C CA  . ASN B 1 148 ? -11.961 22.352 4.949  1.00 10.30 ? 146  ASN B CA  1 
ATOM   2704 C C   . ASN B 1 148 ? -11.931 23.688 5.652  1.00 8.11  ? 146  ASN B C   1 
ATOM   2705 O O   . ASN B 1 148 ? -11.977 24.729 5.044  1.00 7.98  ? 146  ASN B O   1 
ATOM   2706 C CB  . ASN B 1 148 ? -13.415 21.814 4.883  1.00 11.12 ? 146  ASN B CB  1 
ATOM   2707 C CG  . ASN B 1 148 ? -14.493 22.856 4.446  1.00 18.08 ? 146  ASN B CG  1 
ATOM   2708 O OD1 . ASN B 1 148 ? -14.546 23.212 3.287  1.00 27.31 ? 146  ASN B OD1 1 
ATOM   2709 N ND2 . ASN B 1 148 ? -15.416 23.207 5.349  1.00 20.28 ? 146  ASN B ND2 1 
ATOM   2710 N N   . PHE B 1 149 ? -11.931 23.652 6.975  1.00 7.18  ? 147  PHE B N   1 
ATOM   2711 C CA  . PHE B 1 149 ? -11.930 24.886 7.740  1.00 6.63  ? 147  PHE B CA  1 
ATOM   2712 C C   . PHE B 1 149 ? -10.646 25.674 7.514  1.00 5.80  ? 147  PHE B C   1 
ATOM   2713 O O   . PHE B 1 149 ? -10.642 26.856 7.228  1.00 6.69  ? 147  PHE B O   1 
ATOM   2714 C CB  . PHE B 1 149 ? -12.138 24.616 9.244  1.00 6.37  ? 147  PHE B CB  1 
ATOM   2715 C CG  . PHE B 1 149 ? -11.751 25.796 10.089 1.00 5.99  ? 147  PHE B CG  1 
ATOM   2716 C CD1 . PHE B 1 149 ? -12.433 26.992 9.977  1.00 6.69  ? 147  PHE B CD1 1 
ATOM   2717 C CD2 . PHE B 1 149 ? -10.695 25.671 10.978 1.00 6.09  ? 147  PHE B CD2 1 
ATOM   2718 C CE1 . PHE B 1 149 ? -11.992 28.085 10.693 1.00 6.74  ? 147  PHE B CE1 1 
ATOM   2719 C CE2 . PHE B 1 149 ? -10.265 26.718 11.740 1.00 6.41  ? 147  PHE B CE2 1 
ATOM   2720 C CZ  . PHE B 1 149 ? -10.917 27.952 11.599 1.00 7.46  ? 147  PHE B CZ  1 
ATOM   2721 N N   . LEU B 1 150 ? -9.526  24.969 7.594  1.00 7.54  ? 148  LEU B N   1 
ATOM   2722 C CA  . LEU B 1 150 ? -8.199  25.635 7.440  1.00 8.03  ? 148  LEU B CA  1 
ATOM   2723 C C   . LEU B 1 150 ? -8.091  26.271 6.054  1.00 8.09  ? 148  LEU B C   1 
ATOM   2724 O O   . LEU B 1 150 ? -7.691  27.427 5.933  1.00 7.79  ? 148  LEU B O   1 
ATOM   2725 C CB  . LEU B 1 150 ? -7.095  24.629 7.660  1.00 6.62  ? 148  LEU B CB  1 
ATOM   2726 C CG  . LEU B 1 150 ? -6.904  24.196 9.114  1.00 6.10  ? 148  LEU B CG  1 
ATOM   2727 C CD1 . LEU B 1 150 ? -5.975  22.973 9.144  1.00 7.22  ? 148  LEU B CD1 1 
ATOM   2728 C CD2 . LEU B 1 150 ? -6.380  25.277 10.078 1.00 8.62  ? 148  LEU B CD2 1 
ATOM   2729 N N   . VAL B 1 151 ? -8.486  25.563 5.014  1.00 7.67  ? 149  VAL B N   1 
ATOM   2730 C CA  . VAL B 1 151 ? -8.383  26.078 3.672  1.00 8.48  ? 149  VAL B CA  1 
ATOM   2731 C C   . VAL B 1 151 ? -9.361  27.264 3.512  1.00 8.14  ? 149  VAL B C   1 
ATOM   2732 O O   . VAL B 1 151 ? -9.026  28.235 2.785  1.00 8.33  ? 149  VAL B O   1 
ATOM   2733 C CB  . VAL B 1 151 ? -8.568  24.983 2.603  1.00 12.03 ? 149  VAL B CB  1 
ATOM   2734 C CG1 . VAL B 1 151 ? -8.814  25.581 1.214  1.00 20.48 ? 149  VAL B CG1 1 
ATOM   2735 C CG2 . VAL B 1 151 ? -7.410  23.977 2.612  1.00 12.17 ? 149  VAL B CG2 1 
ATOM   2736 N N   . THR B 1 152 ? -10.508 27.230 4.205  1.00 7.04  ? 150  THR B N   1 
ATOM   2737 C CA  . THR B 1 152 ? -11.431 28.331 4.145  1.00 7.77  ? 150  THR B CA  1 
ATOM   2738 C C   . THR B 1 152 ? -10.884 29.646 4.731  1.00 7.60  ? 150  THR B C   1 
ATOM   2739 O O   . THR B 1 152 ? -10.859 30.692 4.057  1.00 7.48  ? 150  THR B O   1 
ATOM   2740 C CB  . THR B 1 152 ? -12.776 28.009 4.816  1.00 8.68  ? 150  THR B CB  1 
ATOM   2741 O OG1 . THR B 1 152 ? -13.390 26.923 4.134  1.00 10.51 ? 150  THR B OG1 1 
ATOM   2742 C CG2 . THR B 1 152 ? -13.767 29.147 4.782  1.00 10.64 ? 150  THR B CG2 1 
ATOM   2743 N N   . ILE B 1 153 ? -10.329 29.573 5.906  1.00 7.04  ? 151  ILE B N   1 
ATOM   2744 C CA  . ILE B 1 153 ? -9.716  30.768 6.503  1.00 6.40  ? 151  ILE B CA  1 
ATOM   2745 C C   . ILE B 1 153 ? -8.429  31.198 5.796  1.00 6.18  ? 151  ILE B C   1 
ATOM   2746 O O   . ILE B 1 153 ? -8.150  32.405 5.632  1.00 6.30  ? 151  ILE B O   1 
ATOM   2747 C CB  . ILE B 1 153 ? -9.586  30.658 8.021  1.00 7.17  ? 151  ILE B CB  1 
ATOM   2748 C CG1 . ILE B 1 153 ? -9.195  32.001 8.619  1.00 8.36  ? 151  ILE B CG1 1 
ATOM   2749 C CG2 . ILE B 1 153 ? -8.598  29.589 8.449  1.00 6.82  ? 151  ILE B CG2 1 
ATOM   2750 C CD1 . ILE B 1 153 ? -9.707  32.149 9.998  1.00 9.79  ? 151  ILE B CD1 1 
ATOM   2751 N N   . TYR B 1 154 ? -7.679  30.227 5.307  1.00 5.62  ? 152  TYR B N   1 
ATOM   2752 C CA  . TYR B 1 154 ? -6.502  30.562 4.510  1.00 5.45  ? 152  TYR B CA  1 
ATOM   2753 C C   . TYR B 1 154 ? -6.897  31.349 3.241  1.00 6.25  ? 152  TYR B C   1 
ATOM   2754 O O   . TYR B 1 154 ? -6.302  32.376 2.940  1.00 6.21  ? 152  TYR B O   1 
ATOM   2755 C CB  . TYR B 1 154 ? -5.792  29.225 4.144  1.00 7.34  ? 152  TYR B CB  1 
ATOM   2756 C CG  . TYR B 1 154 ? -4.578  29.416 3.213  1.00 7.83  ? 152  TYR B CG  1 
ATOM   2757 C CD1 . TYR B 1 154 ? -3.494  30.121 3.614  1.00 10.84 ? 152  TYR B CD1 1 
ATOM   2758 C CD2 . TYR B 1 154 ? -4.566  28.847 1.942  1.00 10.17 ? 152  TYR B CD2 1 
ATOM   2759 C CE1 . TYR B 1 154 ? -2.365  30.284 2.786  1.00 13.01 ? 152  TYR B CE1 1 
ATOM   2760 C CE2 . TYR B 1 154 ? -3.486  29.018 1.077  1.00 10.52 ? 152  TYR B CE2 1 
ATOM   2761 C CZ  . TYR B 1 154 ? -2.381  29.727 1.513  1.00 11.75 ? 152  TYR B CZ  1 
ATOM   2762 O OH  . TYR B 1 154 ? -1.323  29.939 0.675  1.00 17.07 ? 152  TYR B OH  1 
ATOM   2763 N N   . ASN B 1 155 ? -7.884  30.853 2.524  1.00 6.39  ? 153  ASN B N   1 
ATOM   2764 C CA  . ASN B 1 155 ? -8.344  31.521 1.332  1.00 6.25  ? 153  ASN B CA  1 
ATOM   2765 C C   . ASN B 1 155 ? -8.927  32.889 1.622  1.00 6.17  ? 153  ASN B C   1 
ATOM   2766 O O   . ASN B 1 155 ? -8.709  33.799 0.856  1.00 7.15  ? 153  ASN B O   1 
ATOM   2767 C CB  . ASN B 1 155 ? -9.280  30.629 0.529  1.00 6.58  ? 153  ASN B CB  1 
ATOM   2768 C CG  . ASN B 1 155 ? -8.481  29.628 -0.303 1.00 6.76  ? 153  ASN B CG  1 
ATOM   2769 O OD1 . ASN B 1 155 ? -7.474  29.992 -0.942 1.00 8.32  ? 153  ASN B OD1 1 
ATOM   2770 N ND2 . ASN B 1 155 ? -9.009  28.388 -0.348 1.00 10.84 ? 153  ASN B ND2 1 
ATOM   2771 N N   . GLU B 1 156 ? -9.560  33.081 2.761  1.00 6.47  ? 154  GLU B N   1 
ATOM   2772 C CA  . GLU B 1 156 ? -9.996  34.422 3.164  1.00 6.61  ? 154  GLU B CA  1 
ATOM   2773 C C   . GLU B 1 156 ? -8.789  35.276 3.430  1.00 6.76  ? 154  GLU B C   1 
ATOM   2774 O O   . GLU B 1 156 ? -8.758  36.447 3.028  1.00 7.09  ? 154  GLU B O   1 
ATOM   2775 C CB  . GLU B 1 156 ? -10.880 34.295 4.431  1.00 7.12  ? 154  GLU B CB  1 
ATOM   2776 C CG  . GLU B 1 156 ? -11.318 35.707 4.891  1.00 7.67  ? 154  GLU B CG  1 
ATOM   2777 C CD  . GLU B 1 156 ? -12.111 35.765 6.172  1.00 8.18  ? 154  GLU B CD  1 
ATOM   2778 O OE1 . GLU B 1 156 ? -12.373 34.705 6.768  1.00 8.76  ? 154  GLU B OE1 1 
ATOM   2779 O OE2 . GLU B 1 156 ? -12.444 36.913 6.562  1.00 10.18 ? 154  GLU B OE2 1 
ATOM   2780 N N   . SER B 1 157 ? -7.784  34.775 4.133  1.00 7.37  ? 155  SER B N   1 
ATOM   2781 C CA  . SER B 1 157 ? -6.627  35.565 4.522  1.00 7.11  ? 155  SER B CA  1 
ATOM   2782 C C   . SER B 1 157 ? -5.852  36.100 3.318  1.00 7.58  ? 155  SER B C   1 
ATOM   2783 O O   . SER B 1 157 ? -5.201  37.135 3.432  1.00 9.27  ? 155  SER B O   1 
ATOM   2784 C CB  . SER B 1 157 ? -5.684  34.763 5.425  1.00 7.80  ? 155  SER B CB  1 
ATOM   2785 O OG  . SER B 1 157 ? -4.889  33.806 4.776  1.00 9.96  ? 155  SER B OG  1 
ATOM   2786 N N   . LEU B 1 158 ? -5.900  35.401 2.192  1.00 7.31  ? 156  LEU B N   1 
ATOM   2787 C CA  . LEU B 1 158 ? -5.250  35.809 0.965  1.00 8.57  ? 156  LEU B CA  1 
ATOM   2788 C C   . LEU B 1 158 ? -5.885  37.077 0.393  1.00 8.69  ? 156  LEU B C   1 
ATOM   2789 O O   . LEU B 1 158 ? -5.294  37.683 -0.504 1.00 10.95 ? 156  LEU B O   1 
ATOM   2790 C CB  . LEU B 1 158 ? -5.242  34.636 -0.046 1.00 8.86  ? 156  LEU B CB  1 
ATOM   2791 C CG  . LEU B 1 158 ? -4.242  33.514 0.176  1.00 9.11  ? 156  LEU B CG  1 
ATOM   2792 C CD1 . LEU B 1 158 ? -4.577  32.283 -0.617 1.00 9.91  ? 156  LEU B CD1 1 
ATOM   2793 C CD2 . LEU B 1 158 ? -2.842  34.002 -0.242 1.00 12.39 ? 156  LEU B CD2 1 
ATOM   2794 N N   . GLU B 1 159 ? -7.138  37.368 0.729  1.00 7.91  ? 157  GLU B N   1 
ATOM   2795 C CA  . GLU B 1 159 ? -7.879  38.478 0.136  1.00 9.39  ? 157  GLU B CA  1 
ATOM   2796 C C   . GLU B 1 159 ? -7.515  39.806 0.752  1.00 10.08 ? 157  GLU B C   1 
ATOM   2797 O O   . GLU B 1 159 ? -8.014  40.856 0.296  1.00 12.60 ? 157  GLU B O   1 
ATOM   2798 C CB  . GLU B 1 159 ? -9.321  38.220 0.265  1.00 10.50 ? 157  GLU B CB  1 
ATOM   2799 C CG  . GLU B 1 159 ? -9.853  37.075 -0.574 1.00 11.26 ? 157  GLU B CG  1 
ATOM   2800 C CD  . GLU B 1 159 ? -9.644  37.358 -2.051 1.00 12.99 ? 157  GLU B CD  1 
ATOM   2801 O OE1 . GLU B 1 159 ? -9.968  38.480 -2.523 1.00 20.17 ? 157  GLU B OE1 1 
ATOM   2802 O OE2 . GLU B 1 159 ? -9.097  36.506 -2.767 1.00 14.95 ? 157  GLU B OE2 1 
ATOM   2803 N N   . SER B 1 160 ? -6.670  39.809 1.764  1.00 9.18  ? 158  SER B N   1 
ATOM   2804 C CA  . SER B 1 160 ? -6.193  41.063 2.372  1.00 11.13 ? 158  SER B CA  1 
ATOM   2805 C C   . SER B 1 160 ? -4.727  40.891 2.763  1.00 9.99  ? 158  SER B C   1 
ATOM   2806 O O   . SER B 1 160 ? -4.087  39.935 2.351  1.00 11.12 ? 158  SER B O   1 
ATOM   2807 C CB  . SER B 1 160 ? -7.102  41.419 3.586  1.00 9.18  ? 158  SER B CB  1 
ATOM   2808 O OG  . SER B 1 160 ? -6.860  40.503 4.657  1.00 10.40 ? 158  SER B OG  1 
ATOM   2809 N N   . ASN B 1 161 ? -4.230  41.779 3.643  1.00 10.94 ? 159  ASN B N   1 
ATOM   2810 C CA  . ASN B 1 161 ? -2.923  41.616 4.220  1.00 10.86 ? 159  ASN B CA  1 
ATOM   2811 C C   . ASN B 1 161 ? -2.887  40.746 5.438  1.00 10.37 ? 159  ASN B C   1 
ATOM   2812 O O   . ASN B 1 161 ? -1.827  40.579 5.998  1.00 11.13 ? 159  ASN B O   1 
ATOM   2813 C CB  . ASN B 1 161 ? -2.314  43.031 4.502  1.00 12.74 ? 159  ASN B CB  1 
ATOM   2814 C CG  . ASN B 1 161 ? -2.136  43.853 3.223  1.00 14.21 ? 159  ASN B CG  1 
ATOM   2815 O OD1 . ASN B 1 161 ? -2.573  45.035 3.118  1.00 18.87 ? 159  ASN B OD1 1 
ATOM   2816 N ND2 . ASN B 1 161 ? -1.455  43.244 2.253  1.00 14.55 ? 159  ASN B ND2 1 
ATOM   2817 N N   . LEU B 1 162 ? -4.007  40.034 5.702  1.00 10.21 ? 160  LEU B N   1 
ATOM   2818 C CA  . LEU B 1 162 ? -4.056  39.164 6.859  1.00 8.27  ? 160  LEU B CA  1 
ATOM   2819 C C   . LEU B 1 162 ? -3.058  38.017 6.804  1.00 9.70  ? 160  LEU B C   1 
ATOM   2820 O O   . LEU B 1 162 ? -2.379  37.749 7.746  1.00 9.97  ? 160  LEU B O   1 
ATOM   2821 C CB  . LEU B 1 162 ? -5.486  38.667 7.096  1.00 8.37  ? 160  LEU B CB  1 
ATOM   2822 C CG  . LEU B 1 162 ? -5.587  37.721 8.262  1.00 7.60  ? 160  LEU B CG  1 
ATOM   2823 C CD1 . LEU B 1 162 ? -5.233  38.263 9.600  1.00 10.11 ? 160  LEU B CD1 1 
ATOM   2824 C CD2 . LEU B 1 162 ? -7.035  37.124 8.281  1.00 9.36  ? 160  LEU B CD2 1 
ATOM   2825 N N   . LEU B 1 163 ? -2.987  37.339 5.654  1.00 9.18  ? 161  LEU B N   1 
ATOM   2826 C CA  . LEU B 1 163 ? -2.020  36.230 5.565  1.00 10.78 ? 161  LEU B CA  1 
ATOM   2827 C C   . LEU B 1 163 ? -0.580  36.682 5.854  1.00 9.71  ? 161  LEU B C   1 
ATOM   2828 O O   . LEU B 1 163 ? 0.102   36.104 6.698  1.00 11.56 ? 161  LEU B O   1 
ATOM   2829 C CB  . LEU B 1 163 ? -2.096  35.507 4.199  1.00 10.83 ? 161  LEU B CB  1 
ATOM   2830 C CG  . LEU B 1 163 ? -1.091  34.389 4.028  1.00 14.24 ? 161  LEU B CG  1 
ATOM   2831 C CD1 . LEU B 1 163 ? -1.355  33.355 5.096  1.00 14.16 ? 161  LEU B CD1 1 
ATOM   2832 C CD2 . LEU B 1 163 ? -1.162  33.809 2.628  1.00 17.39 ? 161  LEU B CD2 1 
ATOM   2833 N N   . GLU B 1 164 ? -0.190  37.797 5.242  1.00 10.58 ? 162  GLU B N   1 
ATOM   2834 C CA  . GLU B 1 164 ? 1.183   38.379 5.421  1.00 11.16 ? 162  GLU B CA  1 
ATOM   2835 C C   . GLU B 1 164 ? 1.399   38.669 6.922  1.00 11.28 ? 162  GLU B C   1 
ATOM   2836 O O   . GLU B 1 164 ? 2.441   38.382 7.464  1.00 12.57 ? 162  GLU B O   1 
ATOM   2837 C CB  . GLU B 1 164 ? 1.342   39.635 4.555  1.00 14.65 ? 162  GLU B CB  1 
ATOM   2838 C CG  . GLU B 1 164 ? 2.664   40.400 4.604  1.00 17.92 ? 162  GLU B CG  1 
ATOM   2839 C CD  . GLU B 1 164 ? 2.705   41.553 3.607  1.00 17.69 ? 162  GLU B CD  1 
ATOM   2840 O OE1 . GLU B 1 164 ? 2.377   41.315 2.441  1.00 20.18 ? 162  GLU B OE1 1 
ATOM   2841 O OE2 . GLU B 1 164 ? 3.156   42.722 3.946  1.00 17.46 ? 162  GLU B OE2 1 
ATOM   2842 N N   . ARG B 1 165 ? 0.394   39.276 7.542  1.00 9.67  ? 163  ARG B N   1 
ATOM   2843 C CA  . ARG B 1 165 ? 0.481   39.568 8.968  1.00 8.91  ? 163  ARG B CA  1 
ATOM   2844 C C   . ARG B 1 165 ? 0.584   38.297 9.831  1.00 8.62  ? 163  ARG B C   1 
ATOM   2845 O O   . ARG B 1 165 ? 1.391   38.244 10.789 1.00 10.61 ? 163  ARG B O   1 
ATOM   2846 C CB  . ARG B 1 165 ? -0.637  40.476 9.422  1.00 9.47  ? 163  ARG B CB  1 
ATOM   2847 C CG  . ARG B 1 165 ? -0.641  41.892 8.785  1.00 9.35  ? 163  ARG B CG  1 
ATOM   2848 C CD  . ARG B 1 165 ? -1.835  42.736 9.289  1.00 11.64 ? 163  ARG B CD  1 
ATOM   2849 N NE  . ARG B 1 165 ? -1.668  44.157 8.927  1.00 13.06 ? 163  ARG B NE  1 
ATOM   2850 C CZ  . ARG B 1 165 ? -2.464  44.825 8.100  1.00 13.55 ? 163  ARG B CZ  1 
ATOM   2851 N NH1 . ARG B 1 165 ? -3.562  44.244 7.603  1.00 15.28 ? 163  ARG B NH1 1 
ATOM   2852 N NH2 . ARG B 1 165 ? -2.221  46.091 7.750  1.00 15.38 ? 163  ARG B NH2 1 
ATOM   2853 N N   A MET B 1 166 ? -0.216  37.282 9.492  0.60 8.69  ? 164  MET B N   1 
ATOM   2854 N N   B MET B 1 166 ? -0.198  37.280 9.489  0.40 9.62  ? 164  MET B N   1 
ATOM   2855 C CA  A MET B 1 166 ? -0.119  36.044 10.267 0.60 9.16  ? 164  MET B CA  1 
ATOM   2856 C CA  B MET B 1 166 ? -0.125  36.041 10.248 0.40 10.86 ? 164  MET B CA  1 
ATOM   2857 C C   A MET B 1 166 ? 1.254   35.385 10.081 0.60 10.52 ? 164  MET B C   1 
ATOM   2858 C C   B MET B 1 166 ? 1.227   35.346 10.069 0.40 11.42 ? 164  MET B C   1 
ATOM   2859 O O   A MET B 1 166 ? 1.824   34.787 10.994 0.60 12.15 ? 164  MET B O   1 
ATOM   2860 O O   B MET B 1 166 ? 1.761   34.720 10.985 0.40 13.24 ? 164  MET B O   1 
ATOM   2861 C CB  A MET B 1 166 ? -1.248  35.085 9.902  0.60 9.61  ? 164  MET B CB  1 
ATOM   2862 C CB  B MET B 1 166 ? -1.293  35.182 9.824  0.40 13.91 ? 164  MET B CB  1 
ATOM   2863 C CG  A MET B 1 166 ? -2.596  35.644 10.300 0.60 6.73  ? 164  MET B CG  1 
ATOM   2864 C CG  B MET B 1 166 ? -2.526  36.054 9.879  0.40 16.65 ? 164  MET B CG  1 
ATOM   2865 S SD  A MET B 1 166 ? -3.942  34.691 9.507  0.60 10.87 ? 164  MET B SD  1 
ATOM   2866 S SD  B MET B 1 166 ? -3.620  35.638 11.214 0.40 26.14 ? 164  MET B SD  1 
ATOM   2867 C CE  A MET B 1 166 ? -3.779  33.464 10.630 0.60 10.82 ? 164  MET B CE  1 
ATOM   2868 C CE  B MET B 1 166 ? -3.874  33.994 10.706 0.40 4.98  ? 164  MET B CE  1 
ATOM   2869 N N   . GLN B 1 167 ? 1.788   35.453 8.876  1.00 11.54 ? 165  GLN B N   1 
ATOM   2870 C CA  . GLN B 1 167 ? 3.125   34.905 8.576  1.00 12.88 ? 165  GLN B CA  1 
ATOM   2871 C C   . GLN B 1 167 ? 4.178   35.552 9.451  1.00 11.16 ? 165  GLN B C   1 
ATOM   2872 O O   . GLN B 1 167 ? 5.217   34.926 9.791  1.00 16.04 ? 165  GLN B O   1 
ATOM   2873 C CB  . GLN B 1 167 ? 3.492   35.119 7.083  1.00 13.75 ? 165  GLN B CB  1 
ATOM   2874 C CG  . GLN B 1 167 ? 2.755   34.191 6.125  1.00 13.84 ? 165  GLN B CG  1 
ATOM   2875 C CD  . GLN B 1 167 ? 2.919   34.537 4.667  1.00 16.19 ? 165  GLN B CD  1 
ATOM   2876 O OE1 . GLN B 1 167 ? 3.268   35.694 4.276  1.00 19.67 ? 165  GLN B OE1 1 
ATOM   2877 N NE2 . GLN B 1 167 ? 2.723   33.520 3.855  1.00 19.02 ? 165  GLN B NE2 1 
ATOM   2878 N N   . GLU B 1 168 ? 3.982   36.808 9.834  1.00 12.78 ? 166  GLU B N   1 
ATOM   2879 C CA  . GLU B 1 168 ? 4.934   37.542 10.705 1.00 12.06 ? 166  GLU B CA  1 
ATOM   2880 C C   . GLU B 1 168 ? 4.929   37.103 12.121 1.00 13.12 ? 166  GLU B C   1 
ATOM   2881 O O   . GLU B 1 168 ? 5.877   37.374 12.826 1.00 14.87 ? 166  GLU B O   1 
ATOM   2882 C CB  . GLU B 1 168 ? 4.750   39.066 10.550 1.00 14.46 ? 166  GLU B CB  1 
ATOM   2883 C CG  . GLU B 1 168 ? 5.106   39.506 9.111  1.00 15.45 ? 166  GLU B CG  1 
ATOM   2884 C CD  . GLU B 1 168 ? 4.679   40.943 8.799  1.00 14.18 ? 166  GLU B CD  1 
ATOM   2885 O OE1 . GLU B 1 168 ? 3.985   41.627 9.625  1.00 16.73 ? 166  GLU B OE1 1 
ATOM   2886 O OE2 . GLU B 1 168 ? 5.106   41.466 7.738  1.00 16.48 ? 166  GLU B OE2 1 
ATOM   2887 N N   . LEU B 1 169 ? 3.870   36.423 12.583 1.00 14.32 ? 167  LEU B N   1 
ATOM   2888 C CA  . LEU B 1 169 ? 3.935   35.726 13.905 1.00 16.15 ? 167  LEU B CA  1 
ATOM   2889 C C   . LEU B 1 169 ? 4.997   34.689 13.966 1.00 18.87 ? 167  LEU B C   1 
ATOM   2890 O O   . LEU B 1 169 ? 5.508   34.459 15.027 1.00 24.00 ? 167  LEU B O   1 
ATOM   2891 C CB  . LEU B 1 169 ? 2.715   34.882 14.234 1.00 15.40 ? 167  LEU B CB  1 
ATOM   2892 C CG  . LEU B 1 169 ? 1.477   35.597 14.662 1.00 15.42 ? 167  LEU B CG  1 
ATOM   2893 C CD1 . LEU B 1 169 ? 0.341   34.585 14.623 1.00 13.41 ? 167  LEU B CD1 1 
ATOM   2894 C CD2 . LEU B 1 169 ? 1.572   36.199 16.064 1.00 15.57 ? 167  LEU B CD2 1 
ATOM   2895 N N   . TYR B 1 170 ? 5.223   33.985 12.836 1.00 20.59 ? 168  TYR B N   1 
ATOM   2896 C CA  . TYR B 1 170 ? 6.075   32.777 12.832 1.00 27.16 ? 168  TYR B CA  1 
ATOM   2897 C C   . TYR B 1 170 ? 7.450   33.174 12.352 1.00 28.11 ? 168  TYR B C   1 
ATOM   2898 O O   . TYR B 1 170 ? 7.628   34.338 11.959 1.00 23.62 ? 168  TYR B O   1 
ATOM   2899 C CB  . TYR B 1 170 ? 5.468   31.671 11.950 1.00 22.53 ? 168  TYR B CB  1 
ATOM   2900 C CG  . TYR B 1 170 ? 4.116   31.114 12.420 1.00 24.12 ? 168  TYR B CG  1 
ATOM   2901 C CD1 . TYR B 1 170 ? 4.051   30.059 13.315 1.00 23.26 ? 168  TYR B CD1 1 
ATOM   2902 C CD2 . TYR B 1 170 ? 2.923   31.583 11.898 1.00 16.88 ? 168  TYR B CD2 1 
ATOM   2903 C CE1 . TYR B 1 170 ? 2.815   29.544 13.718 1.00 24.29 ? 168  TYR B CE1 1 
ATOM   2904 C CE2 . TYR B 1 170 ? 1.691   31.083 12.308 1.00 22.04 ? 168  TYR B CE2 1 
ATOM   2905 C CZ  . TYR B 1 170 ? 1.639   30.041 13.213 1.00 20.65 ? 168  TYR B CZ  1 
ATOM   2906 O OH  . TYR B 1 170 ? 0.442   29.468 13.642 1.00 24.78 ? 168  TYR B OH  1 
HETATM 2907 C C1  . GOL C 2 .   ? 7.156   19.402 29.379 1.00 13.36 ? 1168 GOL A C1  1 
HETATM 2908 O O1  . GOL C 2 .   ? 7.935   18.267 29.239 1.00 8.23  ? 1168 GOL A O1  1 
HETATM 2909 C C2  . GOL C 2 .   ? 7.241   20.459 28.380 1.00 17.71 ? 1168 GOL A C2  1 
HETATM 2910 O O2  . GOL C 2 .   ? 6.855   21.603 28.915 1.00 24.88 ? 1168 GOL A O2  1 
HETATM 2911 C C3  . GOL C 2 .   ? 6.214   20.117 27.345 1.00 13.92 ? 1168 GOL A C3  1 
HETATM 2912 O O3  . GOL C 2 .   ? 4.935   20.841 27.112 1.00 20.68 ? 1168 GOL A O3  1 
HETATM 2913 C C1  . GOL D 2 .   ? 5.399   8.480  28.743 1.00 23.52 ? 1169 GOL B C1  1 
HETATM 2914 O O1  . GOL D 2 .   ? 5.519   7.674  27.564 1.00 24.54 ? 1169 GOL B O1  1 
HETATM 2915 C C2  . GOL D 2 .   ? 3.996   8.663  29.432 1.00 19.56 ? 1169 GOL B C2  1 
HETATM 2916 O O2  . GOL D 2 .   ? 2.887   8.086  28.685 1.00 26.08 ? 1169 GOL B O2  1 
HETATM 2917 C C3  . GOL D 2 .   ? 3.884   10.187 29.608 1.00 22.93 ? 1169 GOL B C3  1 
HETATM 2918 O O3  . GOL D 2 .   ? 2.622   10.771 29.651 1.00 19.24 ? 1169 GOL B O3  1 
HETATM 2919 O O   . HOH E 3 .   ? 6.795   18.504 22.030 1.00 37.44 ? 2001 HOH A O   1 
HETATM 2920 O O   . HOH E 3 .   ? 15.564  1.773  46.133 1.00 35.42 ? 2002 HOH A O   1 
HETATM 2921 O O   . HOH E 3 .   ? 4.851   2.898  40.833 1.00 27.02 ? 2003 HOH A O   1 
HETATM 2922 O O   . HOH E 3 .   ? 7.597   3.229  33.799 1.00 28.92 ? 2004 HOH A O   1 
HETATM 2923 O O   . HOH E 3 .   ? 4.930   4.091  34.728 1.00 21.84 ? 2005 HOH A O   1 
HETATM 2924 O O   . HOH E 3 .   ? 3.856   14.192 43.970 1.00 23.27 ? 2006 HOH A O   1 
HETATM 2925 O O   . HOH E 3 .   ? 6.556   17.041 47.315 1.00 22.72 ? 2007 HOH A O   1 
HETATM 2926 O O   . HOH E 3 .   ? 8.937   2.534  45.973 1.00 31.63 ? 2008 HOH A O   1 
HETATM 2927 O O   . HOH E 3 .   ? 8.185   -1.387 46.532 1.00 37.70 ? 2009 HOH A O   1 
HETATM 2928 O O   . HOH E 3 .   ? 10.138  -7.393 42.777 1.00 50.88 ? 2010 HOH A O   1 
HETATM 2929 O O   . HOH E 3 .   ? 3.839   16.894 40.825 1.00 25.81 ? 2011 HOH A O   1 
HETATM 2930 O O   . HOH E 3 .   ? 1.324   5.583  35.591 1.00 19.56 ? 2012 HOH A O   1 
HETATM 2931 O O   . HOH E 3 .   ? -1.526  8.280  37.564 1.00 26.27 ? 2013 HOH A O   1 
HETATM 2932 O O   . HOH E 3 .   ? -3.460  13.185 39.169 1.00 24.94 ? 2014 HOH A O   1 
HETATM 2933 O O   . HOH E 3 .   ? -0.924  18.257 37.655 1.00 14.58 ? 2015 HOH A O   1 
HETATM 2934 O O   . HOH E 3 .   ? 13.471  0.221  45.070 1.00 28.27 ? 2016 HOH A O   1 
HETATM 2935 O O   . HOH E 3 .   ? 13.661  -4.921 39.883 1.00 22.23 ? 2017 HOH A O   1 
HETATM 2936 O O   . HOH E 3 .   ? 13.214  -3.051 37.739 1.00 30.86 ? 2018 HOH A O   1 
HETATM 2937 O O   . HOH E 3 .   ? 5.514   4.827  44.645 1.00 17.91 ? 2019 HOH A O   1 
HETATM 2938 O O   . HOH E 3 .   ? 2.401   7.311  43.865 1.00 34.99 ? 2020 HOH A O   1 
HETATM 2939 O O   . HOH E 3 .   ? 27.269  7.793  27.756 1.00 14.37 ? 2021 HOH A O   1 
HETATM 2940 O O   . HOH E 3 .   ? 28.481  6.177  35.604 1.00 28.14 ? 2022 HOH A O   1 
HETATM 2941 O O   . HOH E 3 .   ? 6.332   15.175 43.501 1.00 14.47 ? 2023 HOH A O   1 
HETATM 2942 O O   . HOH E 3 .   ? 6.217   14.477 47.064 1.00 23.66 ? 2024 HOH A O   1 
HETATM 2943 O O   . HOH E 3 .   ? 6.587   11.267 50.269 1.00 26.09 ? 2025 HOH A O   1 
HETATM 2944 O O   . HOH E 3 .   ? 7.207   14.307 41.163 1.00 9.73  ? 2026 HOH A O   1 
HETATM 2945 O O   . HOH E 3 .   ? 3.139   15.611 38.431 1.00 13.43 ? 2027 HOH A O   1 
HETATM 2946 O O   . HOH E 3 .   ? 19.146  14.189 35.807 1.00 15.22 ? 2028 HOH A O   1 
HETATM 2947 O O   . HOH E 3 .   ? 22.446  11.645 37.435 1.00 29.08 ? 2029 HOH A O   1 
HETATM 2948 O O   . HOH E 3 .   ? 1.241   10.011 41.969 1.00 27.38 ? 2030 HOH A O   1 
HETATM 2949 O O   . HOH E 3 .   ? 0.414   8.086  35.542 1.00 17.59 ? 2031 HOH A O   1 
HETATM 2950 O O   . HOH E 3 .   ? 3.923   5.685  36.615 1.00 13.83 ? 2032 HOH A O   1 
HETATM 2951 O O   . HOH E 3 .   ? 3.543   4.610  39.106 1.00 23.34 ? 2033 HOH A O   1 
HETATM 2952 O O   . HOH E 3 .   ? 2.636   10.894 32.173 1.00 14.06 ? 2034 HOH A O   1 
HETATM 2953 O O   . HOH E 3 .   ? -1.152  10.747 39.583 1.00 26.36 ? 2035 HOH A O   1 
HETATM 2954 O O   . HOH E 3 .   ? -0.999  15.955 36.967 1.00 13.74 ? 2036 HOH A O   1 
HETATM 2955 O O   . HOH E 3 .   ? 0.303   15.158 40.595 1.00 25.27 ? 2037 HOH A O   1 
HETATM 2956 O O   . HOH E 3 .   ? -1.489  18.032 32.627 1.00 16.21 ? 2038 HOH A O   1 
HETATM 2957 O O   . HOH E 3 .   ? 11.276  10.514 29.891 1.00 14.98 ? 2039 HOH A O   1 
HETATM 2958 O O   . HOH E 3 .   ? 5.281   35.953 27.452 1.00 13.43 ? 2040 HOH A O   1 
HETATM 2959 O O   . HOH E 3 .   ? 13.319  6.934  26.377 1.00 34.10 ? 2041 HOH A O   1 
HETATM 2960 O O   . HOH E 3 .   ? 2.845   4.479  30.188 1.00 34.84 ? 2042 HOH A O   1 
HETATM 2961 O O   . HOH E 3 .   ? 13.278  7.802  23.556 1.00 24.78 ? 2043 HOH A O   1 
HETATM 2962 O O   . HOH E 3 .   ? 11.964  12.946 26.589 1.00 21.19 ? 2044 HOH A O   1 
HETATM 2963 O O   . HOH E 3 .   ? 8.763   13.272 26.043 1.00 24.05 ? 2045 HOH A O   1 
HETATM 2964 O O   . HOH E 3 .   ? 15.667  12.873 27.472 1.00 25.10 ? 2046 HOH A O   1 
HETATM 2965 O O   . HOH E 3 .   ? 16.931  18.415 24.567 1.00 30.04 ? 2047 HOH A O   1 
HETATM 2966 O O   . HOH E 3 .   ? 16.378  10.930 25.478 1.00 22.90 ? 2048 HOH A O   1 
HETATM 2967 O O   . HOH E 3 .   ? 15.773  3.938  20.525 1.00 27.45 ? 2049 HOH A O   1 
HETATM 2968 O O   . HOH E 3 .   ? 17.175  15.868 24.596 1.00 27.17 ? 2050 HOH A O   1 
HETATM 2969 O O   . HOH E 3 .   ? 22.255  9.612  33.416 1.00 20.87 ? 2051 HOH A O   1 
HETATM 2970 O O   . HOH E 3 .   ? 24.360  11.604 30.430 1.00 30.10 ? 2052 HOH A O   1 
HETATM 2971 O O   . HOH E 3 .   ? 19.469  12.807 25.491 1.00 36.01 ? 2053 HOH A O   1 
HETATM 2972 O O   . HOH E 3 .   ? 13.275  25.616 14.413 1.00 26.39 ? 2054 HOH A O   1 
HETATM 2973 O O   . HOH E 3 .   ? 20.994  25.357 17.534 1.00 14.68 ? 2055 HOH A O   1 
HETATM 2974 O O   . HOH E 3 .   ? 20.689  22.469 17.918 1.00 30.41 ? 2056 HOH A O   1 
HETATM 2975 O O   . HOH E 3 .   ? 20.498  25.665 22.554 1.00 20.50 ? 2057 HOH A O   1 
HETATM 2976 O O   . HOH E 3 .   ? 14.645  25.287 11.800 1.00 32.68 ? 2058 HOH A O   1 
HETATM 2977 O O   . HOH E 3 .   ? 19.710  10.935 33.760 1.00 12.69 ? 2059 HOH A O   1 
HETATM 2978 O O   . HOH E 3 .   ? 5.262   23.185 20.023 1.00 30.52 ? 2060 HOH A O   1 
HETATM 2979 O O   . HOH E 3 .   ? 5.510   21.283 22.964 1.00 25.09 ? 2061 HOH A O   1 
HETATM 2980 O O   . HOH E 3 .   ? 19.367  1.129  31.003 1.00 27.70 ? 2062 HOH A O   1 
HETATM 2981 O O   . HOH E 3 .   ? 22.991  1.842  31.312 1.00 25.98 ? 2063 HOH A O   1 
HETATM 2982 O O   . HOH E 3 .   ? 15.896  36.103 14.363 1.00 33.87 ? 2064 HOH A O   1 
HETATM 2983 O O   . HOH E 3 .   ? 5.083   35.969 23.354 1.00 51.59 ? 2065 HOH A O   1 
HETATM 2984 O O   . HOH E 3 .   ? 16.422  2.827  24.467 1.00 38.02 ? 2066 HOH A O   1 
HETATM 2985 O O   . HOH E 3 .   ? 25.402  9.074  29.550 1.00 26.28 ? 2067 HOH A O   1 
HETATM 2986 O O   . HOH E 3 .   ? 19.588  36.761 20.186 1.00 27.49 ? 2068 HOH A O   1 
HETATM 2987 O O   . HOH E 3 .   ? 20.840  34.803 17.885 1.00 32.86 ? 2069 HOH A O   1 
HETATM 2988 O O   . HOH E 3 .   ? 26.734  6.234  37.598 1.00 20.23 ? 2070 HOH A O   1 
HETATM 2989 O O   . HOH E 3 .   ? 26.304  10.026 36.919 1.00 27.12 ? 2071 HOH A O   1 
HETATM 2990 O O   . HOH E 3 .   ? 28.945  26.285 31.375 1.00 23.61 ? 2072 HOH A O   1 
HETATM 2991 O O   . HOH E 3 .   ? 27.097  5.988  33.322 1.00 30.23 ? 2073 HOH A O   1 
HETATM 2992 O O   . HOH E 3 .   ? 23.719  -1.289 35.588 1.00 12.18 ? 2074 HOH A O   1 
HETATM 2993 O O   . HOH E 3 .   ? 26.177  17.113 28.585 1.00 26.09 ? 2075 HOH A O   1 
HETATM 2994 O O   . HOH E 3 .   ? 27.172  24.885 30.108 1.00 27.38 ? 2076 HOH A O   1 
HETATM 2995 O O   . HOH E 3 .   ? 19.864  0.810  38.989 1.00 13.80 ? 2077 HOH A O   1 
HETATM 2996 O O   . HOH E 3 .   ? 18.928  2.728  42.785 1.00 25.80 ? 2078 HOH A O   1 
HETATM 2997 O O   . HOH E 3 .   ? 19.936  11.557 36.325 1.00 9.59  ? 2079 HOH A O   1 
HETATM 2998 O O   . HOH E 3 .   ? 28.472  24.787 33.603 1.00 39.52 ? 2080 HOH A O   1 
HETATM 2999 O O   . HOH E 3 .   ? 25.509  18.935 38.450 1.00 31.91 ? 2081 HOH A O   1 
HETATM 3000 O O   . HOH E 3 .   ? 26.664  14.141 41.556 1.00 29.89 ? 2082 HOH A O   1 
HETATM 3001 O O   . HOH E 3 .   ? 29.079  17.824 44.266 1.00 34.95 ? 2083 HOH A O   1 
HETATM 3002 O O   . HOH E 3 .   ? 17.081  14.850 30.620 1.00 27.40 ? 2084 HOH A O   1 
HETATM 3003 O O   . HOH E 3 .   ? 28.635  33.306 46.775 1.00 27.62 ? 2085 HOH A O   1 
HETATM 3004 O O   . HOH E 3 .   ? 29.370  33.605 42.330 1.00 31.31 ? 2086 HOH A O   1 
HETATM 3005 O O   . HOH E 3 .   ? 27.071  33.873 37.444 1.00 40.24 ? 2087 HOH A O   1 
HETATM 3006 O O   . HOH E 3 .   ? 22.196  35.490 37.943 1.00 28.85 ? 2088 HOH A O   1 
HETATM 3007 O O   . HOH E 3 .   ? 22.900  38.871 21.893 1.00 28.94 ? 2089 HOH A O   1 
HETATM 3008 O O   . HOH E 3 .   ? 18.955  15.050 33.037 1.00 21.57 ? 2090 HOH A O   1 
HETATM 3009 O O   . HOH E 3 .   ? 20.835  20.956 32.760 1.00 24.32 ? 2091 HOH A O   1 
HETATM 3010 O O   . HOH E 3 .   ? 18.565  18.708 30.698 1.00 22.86 ? 2092 HOH A O   1 
HETATM 3011 O O   . HOH E 3 .   ? 21.255  18.512 35.224 1.00 19.26 ? 2093 HOH A O   1 
HETATM 3012 O O   . HOH E 3 .   ? 22.800  36.910 41.875 1.00 28.37 ? 2094 HOH A O   1 
HETATM 3013 O O   . HOH E 3 .   ? 0.665   18.325 35.400 1.00 20.00 ? 2095 HOH A O   1 
HETATM 3014 O O   . HOH E 3 .   ? 4.181   22.008 40.237 1.00 31.64 ? 2096 HOH A O   1 
HETATM 3015 O O   . HOH E 3 .   ? 12.222  37.961 44.641 1.00 32.22 ? 2097 HOH A O   1 
HETATM 3016 O O   . HOH E 3 .   ? 4.175   35.278 46.274 1.00 32.69 ? 2098 HOH A O   1 
HETATM 3017 O O   . HOH E 3 .   ? 6.963   27.962 42.850 1.00 9.40  ? 2099 HOH A O   1 
HETATM 3018 O O   . HOH E 3 .   ? 4.692   24.263 43.215 1.00 18.76 ? 2100 HOH A O   1 
HETATM 3019 O O   . HOH E 3 .   ? 6.165   17.777 44.447 1.00 12.91 ? 2101 HOH A O   1 
HETATM 3020 O O   . HOH E 3 .   ? 6.760   31.342 53.837 1.00 22.92 ? 2102 HOH A O   1 
HETATM 3021 O O   . HOH E 3 .   ? 7.387   37.300 54.863 1.00 33.90 ? 2103 HOH A O   1 
HETATM 3022 O O   . HOH E 3 .   ? 2.397   26.870 34.497 1.00 29.40 ? 2104 HOH A O   1 
HETATM 3023 O O   . HOH E 3 .   ? 5.469   29.369 34.183 1.00 12.63 ? 2105 HOH A O   1 
HETATM 3024 O O   . HOH E 3 .   ? 4.803   24.763 34.497 1.00 24.11 ? 2106 HOH A O   1 
HETATM 3025 O O   . HOH E 3 .   ? 5.368   26.422 31.913 1.00 22.29 ? 2107 HOH A O   1 
HETATM 3026 O O   . HOH E 3 .   ? 1.765   29.530 35.080 1.00 27.38 ? 2108 HOH A O   1 
HETATM 3027 O O   . HOH E 3 .   ? 2.225   34.692 38.941 1.00 30.78 ? 2109 HOH A O   1 
HETATM 3028 O O   . HOH E 3 .   ? 19.745  7.770  58.605 1.00 23.43 ? 2110 HOH A O   1 
HETATM 3029 O O   . HOH E 3 .   ? 7.330   34.128 38.798 1.00 24.98 ? 2111 HOH A O   1 
HETATM 3030 O O   . HOH E 3 .   ? 5.204   35.038 30.049 1.00 9.32  ? 2112 HOH A O   1 
HETATM 3031 O O   . HOH E 3 .   ? 6.396   39.947 35.420 1.00 28.30 ? 2113 HOH A O   1 
HETATM 3032 O O   . HOH E 3 .   ? 1.190   38.462 35.130 1.00 22.15 ? 2114 HOH A O   1 
HETATM 3033 O O   . HOH E 3 .   ? 3.701   40.514 34.578 1.00 28.66 ? 2115 HOH A O   1 
HETATM 3034 O O   . HOH E 3 .   ? -1.789  38.554 28.550 1.00 12.66 ? 2116 HOH A O   1 
HETATM 3035 O O   . HOH E 3 .   ? 4.571   38.605 26.909 1.00 19.86 ? 2117 HOH A O   1 
HETATM 3036 O O   . HOH E 3 .   ? -3.252  32.732 31.147 1.00 24.57 ? 2118 HOH A O   1 
HETATM 3037 O O   . HOH E 3 .   ? 4.003   31.329 28.269 1.00 15.73 ? 2119 HOH A O   1 
HETATM 3038 O O   . HOH E 3 .   ? 12.239  34.220 40.122 1.00 13.29 ? 2120 HOH A O   1 
HETATM 3039 O O   . HOH E 3 .   ? 14.329  36.181 38.848 1.00 25.11 ? 2121 HOH A O   1 
HETATM 3040 O O   . HOH E 3 .   ? 4.722   28.320 28.816 1.00 17.75 ? 2122 HOH A O   1 
HETATM 3041 O O   . HOH E 3 .   ? 6.130   24.965 29.539 1.00 16.88 ? 2123 HOH A O   1 
HETATM 3042 O O   . HOH E 3 .   ? 7.018   22.802 26.784 1.00 21.62 ? 2124 HOH A O   1 
HETATM 3043 O O   . HOH E 3 .   ? 14.470  19.786 24.707 1.00 18.64 ? 2125 HOH A O   1 
HETATM 3044 O O   . HOH E 3 .   ? 14.763  25.349 24.027 1.00 22.68 ? 2126 HOH A O   1 
HETATM 3045 O O   . HOH E 3 .   ? 12.729  26.569 24.191 1.00 21.39 ? 2127 HOH A O   1 
HETATM 3046 O O   . HOH E 3 .   ? 10.196  22.811 24.224 1.00 12.17 ? 2128 HOH A O   1 
HETATM 3047 O O   . HOH E 3 .   ? 15.230  16.821 27.964 1.00 17.11 ? 2129 HOH A O   1 
HETATM 3048 O O   . HOH E 3 .   ? 8.212   14.630 23.913 1.00 21.49 ? 2130 HOH A O   1 
HETATM 3049 O O   . HOH E 3 .   ? 11.010  14.244 24.180 1.00 29.51 ? 2131 HOH A O   1 
HETATM 3050 O O   . HOH E 3 .   ? 14.396  15.982 25.517 1.00 22.26 ? 2132 HOH A O   1 
HETATM 3051 O O   . HOH E 3 .   ? 13.343  23.030 14.917 1.00 18.02 ? 2133 HOH A O   1 
HETATM 3052 O O   . HOH E 3 .   ? 19.286  25.293 19.355 1.00 19.06 ? 2134 HOH A O   1 
HETATM 3053 O O   . HOH E 3 .   ? 18.189  28.549 18.227 1.00 17.52 ? 2135 HOH A O   1 
HETATM 3054 O O   . HOH E 3 .   ? 16.090  22.417 15.116 1.00 31.98 ? 2136 HOH A O   1 
HETATM 3055 O O   . HOH E 3 .   ? 5.976   21.664 17.686 1.00 22.83 ? 2137 HOH A O   1 
HETATM 3056 O O   . HOH E 3 .   ? 7.035   20.386 14.145 1.00 14.19 ? 2138 HOH A O   1 
HETATM 3057 O O   . HOH E 3 .   ? 7.472   23.080 24.048 1.00 18.85 ? 2139 HOH A O   1 
HETATM 3058 O O   . HOH E 3 .   ? 18.999  28.411 20.870 1.00 10.73 ? 2140 HOH A O   1 
HETATM 3059 O O   . HOH E 3 .   ? 14.761  34.181 16.715 1.00 28.14 ? 2141 HOH A O   1 
HETATM 3060 O O   . HOH E 3 .   ? 19.190  28.357 14.127 1.00 25.73 ? 2142 HOH A O   1 
HETATM 3061 O O   . HOH E 3 .   ? 8.085   34.641 16.808 1.00 34.35 ? 2143 HOH A O   1 
HETATM 3062 O O   . HOH E 3 .   ? 0.368   31.728 17.950 1.00 32.25 ? 2144 HOH A O   1 
HETATM 3063 O O   . HOH E 3 .   ? 9.322   36.892 22.934 1.00 28.20 ? 2145 HOH A O   1 
HETATM 3064 O O   . HOH E 3 .   ? 10.821  38.531 21.239 1.00 32.48 ? 2146 HOH A O   1 
HETATM 3065 O O   . HOH E 3 .   ? 7.529   36.370 25.882 1.00 14.64 ? 2147 HOH A O   1 
HETATM 3066 O O   . HOH E 3 .   ? 18.468  35.734 22.286 1.00 14.55 ? 2148 HOH A O   1 
HETATM 3067 O O   . HOH E 3 .   ? 18.474  36.274 17.541 1.00 32.91 ? 2149 HOH A O   1 
HETATM 3068 O O   . HOH E 3 .   ? 22.441  34.393 22.144 1.00 12.50 ? 2150 HOH A O   1 
HETATM 3069 O O   . HOH E 3 .   ? 20.905  26.893 20.483 1.00 7.52  ? 2151 HOH A O   1 
HETATM 3070 O O   . HOH E 3 .   ? 22.569  25.335 19.660 1.00 18.61 ? 2152 HOH A O   1 
HETATM 3071 O O   . HOH E 3 .   ? 24.601  29.895 25.406 1.00 11.22 ? 2153 HOH A O   1 
HETATM 3072 O O   . HOH E 3 .   ? 21.825  25.973 25.236 1.00 15.09 ? 2154 HOH A O   1 
HETATM 3073 O O   . HOH E 3 .   ? 21.153  23.299 21.709 1.00 22.76 ? 2155 HOH A O   1 
HETATM 3074 O O   . HOH E 3 .   ? 30.196  29.079 31.330 1.00 23.71 ? 2156 HOH A O   1 
HETATM 3075 O O   . HOH E 3 .   ? 22.726  18.154 24.978 1.00 25.44 ? 2157 HOH A O   1 
HETATM 3076 O O   . HOH E 3 .   ? 26.860  19.652 27.399 1.00 29.92 ? 2158 HOH A O   1 
HETATM 3077 O O   . HOH E 3 .   ? 26.877  22.771 28.288 1.00 20.33 ? 2159 HOH A O   1 
HETATM 3078 O O   . HOH E 3 .   ? 20.319  21.094 29.324 1.00 16.42 ? 2160 HOH A O   1 
HETATM 3079 O O   . HOH E 3 .   ? 24.698  23.171 30.641 1.00 23.43 ? 2161 HOH A O   1 
HETATM 3080 O O   . HOH E 3 .   ? 19.393  19.399 24.276 1.00 23.35 ? 2162 HOH A O   1 
HETATM 3081 O O   . HOH E 3 .   ? 16.786  20.711 28.563 1.00 16.46 ? 2163 HOH A O   1 
HETATM 3082 O O   . HOH E 3 .   ? 9.844   37.461 26.781 1.00 17.38 ? 2164 HOH A O   1 
HETATM 3083 O O   . HOH E 3 .   ? 18.289  37.470 26.732 1.00 19.24 ? 2165 HOH A O   1 
HETATM 3084 O O   . HOH E 3 .   ? 19.571  37.964 29.485 1.00 29.06 ? 2166 HOH A O   1 
HETATM 3085 O O   . HOH E 3 .   ? 16.657  39.666 25.489 1.00 40.87 ? 2167 HOH A O   1 
HETATM 3086 O O   . HOH E 3 .   ? 22.970  35.923 34.045 1.00 22.87 ? 2168 HOH A O   1 
HETATM 3087 O O   . HOH E 3 .   ? 22.561  24.777 36.507 1.00 26.60 ? 2169 HOH A O   1 
HETATM 3088 O O   . HOH E 3 .   ? 25.802  18.493 34.284 1.00 32.50 ? 2170 HOH A O   1 
HETATM 3089 O O   . HOH E 3 .   ? 27.516  22.368 32.140 1.00 24.22 ? 2171 HOH A O   1 
HETATM 3090 O O   . HOH E 3 .   ? 20.779  16.895 37.526 1.00 18.28 ? 2172 HOH A O   1 
HETATM 3091 O O   . HOH E 3 .   ? 24.827  17.076 40.381 1.00 30.75 ? 2173 HOH A O   1 
HETATM 3092 O O   . HOH E 3 .   ? 28.893  23.204 41.122 1.00 17.11 ? 2174 HOH A O   1 
HETATM 3093 O O   . HOH E 3 .   ? 26.434  16.204 44.283 1.00 26.81 ? 2175 HOH A O   1 
HETATM 3094 O O   . HOH E 3 .   ? 28.271  20.204 45.866 1.00 40.95 ? 2176 HOH A O   1 
HETATM 3095 O O   . HOH E 3 .   ? 27.635  13.360 49.905 1.00 36.54 ? 2177 HOH A O   1 
HETATM 3096 O O   . HOH E 3 .   ? 30.419  16.912 50.640 1.00 43.16 ? 2178 HOH A O   1 
HETATM 3097 O O   . HOH E 3 .   ? 23.618  19.099 52.932 1.00 26.18 ? 2179 HOH A O   1 
HETATM 3098 O O   . HOH E 3 .   ? 26.120  23.271 53.085 1.00 18.19 ? 2180 HOH A O   1 
HETATM 3099 O O   . HOH E 3 .   ? 30.148  23.032 46.930 1.00 27.34 ? 2181 HOH A O   1 
HETATM 3100 O O   . HOH E 3 .   ? 28.308  27.909 47.103 1.00 21.65 ? 2182 HOH A O   1 
HETATM 3101 O O   . HOH E 3 .   ? 29.403  22.326 43.786 1.00 19.66 ? 2183 HOH A O   1 
HETATM 3102 O O   . HOH E 3 .   ? 32.549  22.757 43.345 1.00 27.96 ? 2184 HOH A O   1 
HETATM 3103 O O   . HOH E 3 .   ? 29.288  29.674 44.930 1.00 17.11 ? 2185 HOH A O   1 
HETATM 3104 O O   . HOH E 3 .   ? 33.153  29.911 42.099 1.00 30.82 ? 2186 HOH A O   1 
HETATM 3105 O O   . HOH E 3 .   ? 24.750  28.871 39.268 1.00 17.37 ? 2187 HOH A O   1 
HETATM 3106 O O   . HOH E 3 .   ? 28.039  32.209 44.257 1.00 16.94 ? 2188 HOH A O   1 
HETATM 3107 O O   . HOH E 3 .   ? 26.308  30.337 38.208 1.00 23.01 ? 2189 HOH A O   1 
HETATM 3108 O O   . HOH E 3 .   ? 28.312  26.614 35.194 1.00 21.91 ? 2190 HOH A O   1 
HETATM 3109 O O   . HOH E 3 .   ? 33.520  30.338 37.385 1.00 24.00 ? 2191 HOH A O   1 
HETATM 3110 O O   . HOH E 3 .   ? 35.131  29.898 33.662 1.00 32.71 ? 2192 HOH A O   1 
HETATM 3111 O O   . HOH E 3 .   ? 35.400  36.037 31.763 1.00 26.88 ? 2193 HOH A O   1 
HETATM 3112 O O   . HOH E 3 .   ? 28.503  33.978 35.665 1.00 23.98 ? 2194 HOH A O   1 
HETATM 3113 O O   . HOH E 3 .   ? 26.493  35.412 34.159 1.00 23.84 ? 2195 HOH A O   1 
HETATM 3114 O O   . HOH E 3 .   ? 24.042  31.088 36.817 1.00 18.82 ? 2196 HOH A O   1 
HETATM 3115 O O   . HOH E 3 .   ? 24.077  33.840 36.535 1.00 18.32 ? 2197 HOH A O   1 
HETATM 3116 O O   . HOH E 3 .   ? 24.467  34.082 33.915 1.00 11.17 ? 2198 HOH A O   1 
HETATM 3117 O O   . HOH E 3 .   ? 24.950  35.389 26.402 1.00 29.33 ? 2199 HOH A O   1 
HETATM 3118 O O   . HOH E 3 .   ? 27.752  36.323 28.213 1.00 25.07 ? 2200 HOH A O   1 
HETATM 3119 O O   . HOH E 3 .   ? 24.705  32.802 25.560 1.00 21.32 ? 2201 HOH A O   1 
HETATM 3120 O O   . HOH E 3 .   ? 19.546  36.175 24.726 1.00 21.93 ? 2202 HOH A O   1 
HETATM 3121 O O   . HOH E 3 .   ? 22.510  36.672 23.846 1.00 23.83 ? 2203 HOH A O   1 
HETATM 3122 O O   . HOH E 3 .   ? 16.312  14.976 47.249 1.00 28.82 ? 2204 HOH A O   1 
HETATM 3123 O O   . HOH E 3 .   ? 18.113  25.355 52.005 1.00 9.53  ? 2205 HOH A O   1 
HETATM 3124 O O   . HOH E 3 .   ? 20.476  26.579 50.894 1.00 9.66  ? 2206 HOH A O   1 
HETATM 3125 O O   . HOH E 3 .   ? 15.784  26.562 50.660 1.00 23.25 ? 2207 HOH A O   1 
HETATM 3126 O O   . HOH E 3 .   ? 22.243  34.697 47.508 1.00 27.21 ? 2208 HOH A O   1 
HETATM 3127 O O   . HOH E 3 .   ? 20.862  35.227 40.711 1.00 19.43 ? 2209 HOH A O   1 
HETATM 3128 O O   . HOH E 3 .   ? 17.103  35.531 48.111 1.00 23.76 ? 2210 HOH A O   1 
HETATM 3129 O O   . HOH E 3 .   ? 26.090  28.969 50.477 1.00 43.43 ? 2211 HOH A O   1 
HETATM 3130 O O   . HOH E 3 .   ? 14.928  36.291 44.763 1.00 13.63 ? 2212 HOH A O   1 
HETATM 3131 O O   . HOH E 3 .   ? 13.746  36.580 42.737 1.00 20.63 ? 2213 HOH A O   1 
HETATM 3132 O O   . HOH E 3 .   ? 19.900  36.210 48.118 1.00 22.82 ? 2214 HOH A O   1 
HETATM 3133 O O   . HOH E 3 .   ? 7.497   34.909 46.392 1.00 17.39 ? 2215 HOH A O   1 
HETATM 3134 O O   . HOH E 3 .   ? 10.422  36.728 46.780 1.00 21.41 ? 2216 HOH A O   1 
HETATM 3135 O O   . HOH E 3 .   ? 8.572   37.353 49.407 1.00 23.60 ? 2217 HOH A O   1 
HETATM 3136 O O   . HOH E 3 .   ? 7.676   34.724 54.624 1.00 16.79 ? 2218 HOH A O   1 
HETATM 3137 O O   . HOH E 3 .   ? 9.454   31.269 53.460 1.00 11.51 ? 2219 HOH A O   1 
HETATM 3138 O O   . HOH E 3 .   ? 5.764   24.769 49.384 1.00 30.66 ? 2220 HOH A O   1 
HETATM 3139 O O   . HOH E 3 .   ? 6.586   21.551 47.156 1.00 14.22 ? 2221 HOH A O   1 
HETATM 3140 O O   . HOH E 3 .   ? 5.192   28.151 48.555 1.00 26.47 ? 2222 HOH A O   1 
HETATM 3141 O O   . HOH E 3 .   ? 3.003   27.718 44.699 1.00 27.19 ? 2223 HOH A O   1 
HETATM 3142 O O   . HOH E 3 .   ? 9.412   20.984 53.932 1.00 21.34 ? 2224 HOH A O   1 
HETATM 3143 O O   . HOH E 3 .   ? 9.502   12.482 53.414 1.00 12.42 ? 2225 HOH A O   1 
HETATM 3144 O O   . HOH E 3 .   ? 5.363   16.908 51.214 1.00 24.88 ? 2226 HOH A O   1 
HETATM 3145 O O   . HOH E 3 .   ? 13.247  5.025  50.466 1.00 15.24 ? 2227 HOH A O   1 
HETATM 3146 O O   . HOH E 3 .   ? 8.953   4.753  50.256 1.00 25.08 ? 2228 HOH A O   1 
HETATM 3147 O O   . HOH E 3 .   ? 11.945  5.573  48.068 1.00 21.22 ? 2229 HOH A O   1 
HETATM 3148 O O   . HOH E 3 .   ? 17.849  3.336  55.977 1.00 27.86 ? 2230 HOH A O   1 
HETATM 3149 O O   . HOH E 3 .   ? 19.493  6.189  56.321 1.00 23.16 ? 2231 HOH A O   1 
HETATM 3150 O O   . HOH E 3 .   ? 9.277   4.088  56.136 1.00 42.06 ? 2232 HOH A O   1 
HETATM 3151 O O   . HOH E 3 .   ? 20.328  5.564  52.250 1.00 19.40 ? 2233 HOH A O   1 
HETATM 3152 O O   . HOH E 3 .   ? 17.008  -0.492 53.336 1.00 31.33 ? 2234 HOH A O   1 
HETATM 3153 O O   . HOH E 3 .   ? 26.914  6.731  49.039 1.00 22.02 ? 2235 HOH A O   1 
HETATM 3154 O O   . HOH E 3 .   ? 28.330  4.502  49.410 1.00 30.88 ? 2236 HOH A O   1 
HETATM 3155 O O   . HOH E 3 .   ? 27.062  12.206 42.688 1.00 56.08 ? 2237 HOH A O   1 
HETATM 3156 O O   . HOH E 3 .   ? 30.653  8.333  39.518 1.00 34.02 ? 2238 HOH A O   1 
HETATM 3157 O O   . HOH E 3 .   ? 30.148  11.105 42.734 1.00 34.69 ? 2239 HOH A O   1 
HETATM 3158 O O   . HOH E 3 .   ? 4.817   24.030 27.822 1.00 25.10 ? 2240 HOH A O   1 
HETATM 3159 O O   . HOH E 3 .   ? 2.826   21.852 27.997 1.00 14.54 ? 2241 HOH A O   1 
HETATM 3160 O O   . HOH E 3 .   ? 3.018   20.613 24.390 1.00 25.68 ? 2242 HOH A O   1 
HETATM 3161 O O   . HOH E 3 .   ? 5.304   18.847 24.857 1.00 23.73 ? 2243 HOH A O   1 
HETATM 3162 O O   . HOH F 3 .   ? -14.193 41.810 19.318 1.00 25.11 ? 2001 HOH B O   1 
HETATM 3163 O O   . HOH F 3 .   ? -12.118 42.342 21.553 1.00 25.77 ? 2002 HOH B O   1 
HETATM 3164 O O   . HOH F 3 .   ? -14.532 46.676 16.561 1.00 31.05 ? 2003 HOH B O   1 
HETATM 3165 O O   . HOH F 3 .   ? -11.516 47.808 16.327 1.00 48.15 ? 2004 HOH B O   1 
HETATM 3166 O O   . HOH F 3 .   ? -11.691 43.377 5.985  1.00 53.49 ? 2005 HOH B O   1 
HETATM 3167 O O   . HOH F 3 .   ? -9.154  45.867 7.267  1.00 30.53 ? 2006 HOH B O   1 
HETATM 3168 O O   . HOH F 3 .   ? -9.520  40.419 8.502  1.00 23.84 ? 2007 HOH B O   1 
HETATM 3169 O O   . HOH F 3 .   ? -17.281 40.749 14.325 1.00 26.92 ? 2008 HOH B O   1 
HETATM 3170 O O   . HOH F 3 .   ? -17.127 39.771 20.330 1.00 20.77 ? 2009 HOH B O   1 
HETATM 3171 O O   . HOH F 3 .   ? -18.212 29.405 11.408 1.00 20.84 ? 2010 HOH B O   1 
HETATM 3172 O O   . HOH F 3 .   ? -15.122 26.567 7.691  1.00 20.71 ? 2011 HOH B O   1 
HETATM 3173 O O   . HOH F 3 .   ? -10.767 44.173 8.956  1.00 29.50 ? 2012 HOH B O   1 
HETATM 3174 O O   . HOH F 3 .   ? -12.689 41.376 9.416  1.00 32.51 ? 2013 HOH B O   1 
HETATM 3175 O O   . HOH F 3 .   ? -14.674 53.775 10.379 1.00 34.72 ? 2014 HOH B O   1 
HETATM 3176 O O   . HOH F 3 .   ? -14.862 53.447 13.145 1.00 31.00 ? 2015 HOH B O   1 
HETATM 3177 O O   . HOH F 3 .   ? -17.512 26.412 14.480 1.00 35.15 ? 2016 HOH B O   1 
HETATM 3178 O O   . HOH F 3 .   ? -20.777 37.975 19.476 1.00 19.97 ? 2017 HOH B O   1 
HETATM 3179 O O   . HOH F 3 .   ? -26.165 32.343 15.247 1.00 66.91 ? 2018 HOH B O   1 
HETATM 3180 O O   . HOH F 3 .   ? -8.123  40.763 10.888 1.00 16.68 ? 2019 HOH B O   1 
HETATM 3181 O O   . HOH F 3 .   ? -8.490  43.544 10.211 1.00 18.57 ? 2020 HOH B O   1 
HETATM 3182 O O   . HOH F 3 .   ? -16.383 38.864 10.509 1.00 20.01 ? 2021 HOH B O   1 
HETATM 3183 O O   . HOH F 3 .   ? -18.781 34.353 10.831 1.00 30.36 ? 2022 HOH B O   1 
HETATM 3184 O O   . HOH F 3 .   ? -17.009 32.084 6.841  1.00 29.65 ? 2023 HOH B O   1 
HETATM 3185 O O   . HOH F 3 .   ? 6.727   38.182 19.243 1.00 28.04 ? 2024 HOH B O   1 
HETATM 3186 O O   . HOH F 3 .   ? -15.612 28.680 11.578 1.00 12.68 ? 2025 HOH B O   1 
HETATM 3187 O O   . HOH F 3 .   ? -15.435 29.039 8.269  1.00 24.19 ? 2026 HOH B O   1 
HETATM 3188 O O   . HOH F 3 .   ? -14.885 32.634 4.877  1.00 25.62 ? 2027 HOH B O   1 
HETATM 3189 O O   . HOH F 3 .   ? -14.738 29.419 14.027 1.00 9.45  ? 2028 HOH B O   1 
HETATM 3190 O O   . HOH F 3 .   ? -18.732 28.116 16.712 1.00 13.66 ? 2029 HOH B O   1 
HETATM 3191 O O   . HOH F 3 .   ? -2.812  29.649 19.621 1.00 14.56 ? 2030 HOH B O   1 
HETATM 3192 O O   . HOH F 3 .   ? -20.630 33.739 13.096 1.00 21.50 ? 2031 HOH B O   1 
HETATM 3193 O O   . HOH F 3 .   ? -18.000 38.009 18.607 1.00 13.48 ? 2032 HOH B O   1 
HETATM 3194 O O   . HOH F 3 .   ? -21.515 36.136 12.950 1.00 26.11 ? 2033 HOH B O   1 
HETATM 3195 O O   . HOH F 3 .   ? -18.547 39.066 15.940 1.00 22.02 ? 2034 HOH B O   1 
HETATM 3196 O O   . HOH F 3 .   ? -21.602 35.467 19.581 1.00 19.47 ? 2035 HOH B O   1 
HETATM 3197 O O   . HOH F 3 .   ? -19.434 32.680 22.996 1.00 11.85 ? 2036 HOH B O   1 
HETATM 3198 O O   . HOH F 3 .   ? -23.152 32.502 15.612 1.00 24.83 ? 2037 HOH B O   1 
HETATM 3199 O O   . HOH F 3 .   ? -22.935 27.712 18.163 1.00 12.11 ? 2038 HOH B O   1 
HETATM 3200 O O   . HOH F 3 .   ? -21.717 28.743 14.480 1.00 24.24 ? 2039 HOH B O   1 
HETATM 3201 O O   . HOH F 3 .   ? -18.249 24.963 10.522 1.00 26.45 ? 2040 HOH B O   1 
HETATM 3202 O O   . HOH F 3 .   ? -17.495 16.990 22.009 1.00 26.92 ? 2041 HOH B O   1 
HETATM 3203 O O   . HOH F 3 .   ? -14.242 34.713 27.358 1.00 24.73 ? 2042 HOH B O   1 
HETATM 3204 O O   . HOH F 3 .   ? -21.963 7.951  16.231 1.00 50.93 ? 2043 HOH B O   1 
HETATM 3205 O O   . HOH F 3 .   ? -8.712  36.448 28.997 1.00 25.03 ? 2044 HOH B O   1 
HETATM 3206 O O   . HOH F 3 .   ? -14.656 40.100 21.573 1.00 22.68 ? 2045 HOH B O   1 
HETATM 3207 O O   . HOH F 3 .   ? -23.829 5.421  19.427 1.00 32.97 ? 2046 HOH B O   1 
HETATM 3208 O O   . HOH F 3 .   ? -25.292 4.265  22.188 1.00 36.42 ? 2047 HOH B O   1 
HETATM 3209 O O   . HOH F 3 .   ? -5.094  6.603  17.864 1.00 29.23 ? 2048 HOH B O   1 
HETATM 3210 O O   . HOH F 3 .   ? -13.579 30.463 29.561 1.00 22.14 ? 2049 HOH B O   1 
HETATM 3211 O O   . HOH F 3 .   ? -10.863 30.315 28.967 1.00 24.12 ? 2050 HOH B O   1 
HETATM 3212 O O   . HOH F 3 .   ? -6.326  30.834 27.717 1.00 25.11 ? 2051 HOH B O   1 
HETATM 3213 O O   . HOH F 3 .   ? -5.047  25.183 27.645 1.00 28.55 ? 2052 HOH B O   1 
HETATM 3214 O O   . HOH F 3 .   ? -5.969  32.766 30.019 1.00 21.88 ? 2053 HOH B O   1 
HETATM 3215 O O   . HOH F 3 .   ? 0.385   34.141 21.758 1.00 21.22 ? 2054 HOH B O   1 
HETATM 3216 O O   . HOH F 3 .   ? 2.131   32.009 24.289 1.00 31.26 ? 2055 HOH B O   1 
HETATM 3217 O O   . HOH F 3 .   ? -2.442  30.765 29.620 1.00 30.35 ? 2056 HOH B O   1 
HETATM 3218 O O   . HOH F 3 .   ? -2.252  32.948 21.605 1.00 13.31 ? 2057 HOH B O   1 
HETATM 3219 O O   . HOH F 3 .   ? -14.950 17.606 40.573 1.00 49.47 ? 2058 HOH B O   1 
HETATM 3220 O O   . HOH F 3 .   ? -2.799  42.837 24.800 1.00 30.01 ? 2059 HOH B O   1 
HETATM 3221 O O   . HOH F 3 .   ? 3.409   34.915 25.718 1.00 22.63 ? 2060 HOH B O   1 
HETATM 3222 O O   . HOH F 3 .   ? 4.612   37.864 17.333 1.00 17.62 ? 2061 HOH B O   1 
HETATM 3223 O O   . HOH F 3 .   ? 5.096   37.995 21.330 1.00 23.27 ? 2062 HOH B O   1 
HETATM 3224 O O   . HOH F 3 .   ? 5.886   39.894 15.457 1.00 20.17 ? 2063 HOH B O   1 
HETATM 3225 O O   . HOH F 3 .   ? 6.599   41.404 13.719 1.00 22.87 ? 2064 HOH B O   1 
HETATM 3226 O O   . HOH F 3 .   ? 0.651   42.555 13.268 1.00 24.85 ? 2065 HOH B O   1 
HETATM 3227 O O   . HOH F 3 .   ? -4.517  2.690  27.477 1.00 39.70 ? 2066 HOH B O   1 
HETATM 3228 O O   . HOH F 3 .   ? -2.583  43.771 12.554 1.00 10.48 ? 2067 HOH B O   1 
HETATM 3229 O O   . HOH F 3 .   ? -5.445  41.624 10.941 1.00 16.65 ? 2068 HOH B O   1 
HETATM 3230 O O   . HOH F 3 .   ? -2.050  32.173 18.992 1.00 10.51 ? 2069 HOH B O   1 
HETATM 3231 O O   . HOH F 3 .   ? 6.259   15.023 5.477  1.00 23.00 ? 2070 HOH B O   1 
HETATM 3232 O O   . HOH F 3 .   ? -4.840  28.945 24.268 1.00 29.23 ? 2071 HOH B O   1 
HETATM 3233 O O   . HOH F 3 .   ? 6.537   9.944  8.550  1.00 28.11 ? 2072 HOH B O   1 
HETATM 3234 O O   . HOH F 3 .   ? 7.312   9.875  12.740 1.00 36.46 ? 2073 HOH B O   1 
HETATM 3235 O O   . HOH F 3 .   ? 0.157   8.269  16.983 1.00 28.71 ? 2074 HOH B O   1 
HETATM 3236 O O   . HOH F 3 .   ? 1.139   4.996  32.943 1.00 22.28 ? 2075 HOH B O   1 
HETATM 3237 O O   . HOH F 3 .   ? -3.160  24.828 24.507 1.00 25.19 ? 2076 HOH B O   1 
HETATM 3238 O O   . HOH F 3 .   ? -0.557  25.182 19.988 1.00 15.65 ? 2077 HOH B O   1 
HETATM 3239 O O   . HOH F 3 .   ? -1.434  22.972 23.053 1.00 20.51 ? 2078 HOH B O   1 
HETATM 3240 O O   . HOH F 3 .   ? -2.760  28.607 22.256 1.00 20.87 ? 2079 HOH B O   1 
HETATM 3241 O O   . HOH F 3 .   ? -14.023 25.357 25.916 1.00 7.54  ? 2080 HOH B O   1 
HETATM 3242 O O   . HOH F 3 .   ? -14.982 15.825 12.268 1.00 10.22 ? 2081 HOH B O   1 
HETATM 3243 O O   . HOH F 3 .   ? -17.276 19.585 12.103 1.00 15.91 ? 2082 HOH B O   1 
HETATM 3244 O O   . HOH F 3 .   ? -15.670 25.968 10.656 1.00 12.92 ? 2083 HOH B O   1 
HETATM 3245 O O   . HOH F 3 .   ? -16.471 14.385 20.993 1.00 11.95 ? 2084 HOH B O   1 
HETATM 3246 O O   . HOH F 3 .   ? -17.116 19.354 20.625 1.00 26.00 ? 2085 HOH B O   1 
HETATM 3247 O O   . HOH F 3 .   ? -22.732 19.832 14.716 1.00 38.19 ? 2086 HOH B O   1 
HETATM 3248 O O   . HOH F 3 .   ? -20.014 14.256 20.124 1.00 28.99 ? 2087 HOH B O   1 
HETATM 3249 O O   . HOH F 3 .   ? -19.472 9.328  15.991 1.00 31.39 ? 2088 HOH B O   1 
HETATM 3250 O O   . HOH F 3 .   ? -19.431 11.197 14.003 1.00 37.22 ? 2089 HOH B O   1 
HETATM 3251 O O   . HOH F 3 .   ? -10.991 40.238 3.665  1.00 27.28 ? 2090 HOH B O   1 
HETATM 3252 O O   . HOH F 3 .   ? -2.010  40.100 -1.757 1.00 35.69 ? 2091 HOH B O   1 
HETATM 3253 O O   . HOH F 3 .   ? -3.134  42.009 -3.470 1.00 41.55 ? 2092 HOH B O   1 
HETATM 3254 O O   . HOH F 3 .   ? -12.189 43.644 3.600  1.00 65.84 ? 2093 HOH B O   1 
HETATM 3255 O O   . HOH F 3 .   ? -14.587 9.613  15.951 1.00 29.03 ? 2094 HOH B O   1 
HETATM 3256 O O   . HOH F 3 .   ? -16.742 8.711  25.145 1.00 9.32  ? 2095 HOH B O   1 
HETATM 3257 O O   . HOH F 3 .   ? -15.677 3.886  19.874 1.00 26.20 ? 2096 HOH B O   1 
HETATM 3258 O O   . HOH F 3 .   ? 1.654   37.827 0.549  1.00 48.94 ? 2097 HOH B O   1 
HETATM 3259 O O   . HOH F 3 .   ? -18.421 3.234  20.683 1.00 35.76 ? 2098 HOH B O   1 
HETATM 3260 O O   . HOH F 3 .   ? -23.765 5.242  26.649 1.00 15.66 ? 2099 HOH B O   1 
HETATM 3261 O O   . HOH F 3 .   ? -17.560 5.255  28.311 1.00 20.10 ? 2100 HOH B O   1 
HETATM 3262 O O   . HOH F 3 .   ? -18.943 2.194  29.564 1.00 55.07 ? 2101 HOH B O   1 
HETATM 3263 O O   . HOH F 3 .   ? -21.588 2.762  21.342 1.00 34.87 ? 2102 HOH B O   1 
HETATM 3264 O O   . HOH F 3 .   ? -23.311 2.842  23.401 1.00 31.51 ? 2103 HOH B O   1 
HETATM 3265 O O   . HOH F 3 .   ? -21.055 5.401  20.150 1.00 23.13 ? 2104 HOH B O   1 
HETATM 3266 O O   . HOH F 3 .   ? -24.694 11.201 23.122 1.00 24.80 ? 2105 HOH B O   1 
HETATM 3267 O O   . HOH F 3 .   ? -18.032 12.612 26.895 1.00 16.61 ? 2106 HOH B O   1 
HETATM 3268 O O   . HOH F 3 .   ? -9.740  9.520  14.961 1.00 13.85 ? 2107 HOH B O   1 
HETATM 3269 O O   . HOH F 3 .   ? -12.573 7.571  14.227 1.00 29.20 ? 2108 HOH B O   1 
HETATM 3270 O O   . HOH F 3 .   ? -9.581  5.849  16.107 1.00 35.33 ? 2109 HOH B O   1 
HETATM 3271 O O   . HOH F 3 .   ? -7.627  7.601  16.159 1.00 21.09 ? 2110 HOH B O   1 
HETATM 3272 O O   . HOH F 3 .   ? -17.207 15.397 26.378 1.00 18.98 ? 2111 HOH B O   1 
HETATM 3273 O O   . HOH F 3 .   ? -15.784 18.685 25.683 1.00 18.00 ? 2112 HOH B O   1 
HETATM 3274 O O   . HOH F 3 .   ? -14.923 20.837 28.208 1.00 20.86 ? 2113 HOH B O   1 
HETATM 3275 O O   . HOH F 3 .   ? -14.878 22.842 26.532 1.00 13.82 ? 2114 HOH B O   1 
HETATM 3276 O O   . HOH F 3 .   ? -6.801  22.556 28.290 1.00 23.62 ? 2115 HOH B O   1 
HETATM 3277 O O   . HOH F 3 .   ? -7.403  23.860 30.565 1.00 16.66 ? 2116 HOH B O   1 
HETATM 3278 O O   . HOH F 3 .   ? -11.755 20.766 30.955 1.00 11.06 ? 2117 HOH B O   1 
HETATM 3279 O O   . HOH F 3 .   ? -9.480  17.014 31.031 1.00 17.06 ? 2118 HOH B O   1 
HETATM 3280 O O   . HOH F 3 .   ? -6.757  26.902 27.241 1.00 13.15 ? 2119 HOH B O   1 
HETATM 3281 O O   . HOH F 3 .   ? -10.931 29.270 31.291 1.00 25.32 ? 2120 HOH B O   1 
HETATM 3282 O O   . HOH F 3 .   ? -7.579  27.847 29.782 1.00 24.82 ? 2121 HOH B O   1 
HETATM 3283 O O   . HOH F 3 .   ? -4.132  21.376 35.276 1.00 25.48 ? 2122 HOH B O   1 
HETATM 3284 O O   . HOH F 3 .   ? -8.658  20.568 40.126 1.00 22.55 ? 2123 HOH B O   1 
HETATM 3285 O O   . HOH F 3 .   ? -8.192  29.146 36.438 1.00 24.73 ? 2124 HOH B O   1 
HETATM 3286 O O   . HOH F 3 .   ? -5.428  26.726 41.685 1.00 33.31 ? 2125 HOH B O   1 
HETATM 3287 O O   . HOH F 3 .   ? -2.639  18.403 35.742 1.00 18.54 ? 2126 HOH B O   1 
HETATM 3288 O O   . HOH F 3 .   ? -6.034  21.463 40.036 1.00 32.80 ? 2127 HOH B O   1 
HETATM 3289 O O   . HOH F 3 .   ? -3.823  15.152 36.915 1.00 18.16 ? 2128 HOH B O   1 
HETATM 3290 O O   . HOH F 3 .   ? -2.739  17.796 39.474 1.00 26.47 ? 2129 HOH B O   1 
HETATM 3291 O O   . HOH F 3 .   ? -14.522 15.621 38.629 1.00 28.92 ? 2130 HOH B O   1 
HETATM 3292 O O   . HOH F 3 .   ? -16.017 22.174 37.302 1.00 24.67 ? 2131 HOH B O   1 
HETATM 3293 O O   . HOH F 3 .   ? -14.682 16.854 36.185 1.00 37.88 ? 2132 HOH B O   1 
HETATM 3294 O O   . HOH F 3 .   ? -14.259 13.562 32.701 1.00 27.95 ? 2133 HOH B O   1 
HETATM 3295 O O   . HOH F 3 .   ? -14.506 20.329 31.042 1.00 20.23 ? 2134 HOH B O   1 
HETATM 3296 O O   . HOH F 3 .   ? -2.964  15.279 34.251 1.00 10.99 ? 2135 HOH B O   1 
HETATM 3297 O O   . HOH F 3 .   ? -17.091 13.607 31.322 1.00 37.79 ? 2136 HOH B O   1 
HETATM 3298 O O   . HOH F 3 .   ? -14.386 7.327  29.425 1.00 13.82 ? 2137 HOH B O   1 
HETATM 3299 O O   . HOH F 3 .   ? -17.176 8.663  32.060 1.00 45.26 ? 2138 HOH B O   1 
HETATM 3300 O O   . HOH F 3 .   ? -3.505  7.930  32.861 1.00 15.22 ? 2139 HOH B O   1 
HETATM 3301 O O   . HOH F 3 .   ? -2.603  7.371  35.300 1.00 35.52 ? 2140 HOH B O   1 
HETATM 3302 O O   . HOH F 3 .   ? 0.525   9.276  33.049 1.00 11.68 ? 2141 HOH B O   1 
HETATM 3303 O O   . HOH F 3 .   ? -1.057  16.764 34.638 1.00 6.76  ? 2142 HOH B O   1 
HETATM 3304 O O   . HOH F 3 .   ? 2.704   13.758 29.759 1.00 12.61 ? 2143 HOH B O   1 
HETATM 3305 O O   . HOH F 3 .   ? -0.206  17.676 29.926 1.00 14.72 ? 2144 HOH B O   1 
HETATM 3306 O O   . HOH F 3 .   ? -0.675  20.387 33.587 1.00 22.10 ? 2145 HOH B O   1 
HETATM 3307 O O   . HOH F 3 .   ? 3.203   17.153 25.394 1.00 25.98 ? 2146 HOH B O   1 
HETATM 3308 O O   . HOH F 3 .   ? 7.138   17.149 24.021 1.00 26.10 ? 2147 HOH B O   1 
HETATM 3309 O O   . HOH F 3 .   ? -2.027  22.760 34.103 1.00 20.12 ? 2148 HOH B O   1 
HETATM 3310 O O   . HOH F 3 .   ? 2.536   23.308 35.363 1.00 30.16 ? 2149 HOH B O   1 
HETATM 3311 O O   . HOH F 3 .   ? 3.321   26.236 30.527 1.00 29.55 ? 2150 HOH B O   1 
HETATM 3312 O O   . HOH F 3 .   ? 1.346   22.455 25.568 1.00 31.73 ? 2151 HOH B O   1 
HETATM 3313 O O   . HOH F 3 .   ? 4.426   26.460 26.491 1.00 26.35 ? 2152 HOH B O   1 
HETATM 3314 O O   . HOH F 3 .   ? -2.700  24.146 31.288 1.00 22.35 ? 2153 HOH B O   1 
HETATM 3315 O O   . HOH F 3 .   ? -4.971  22.986 26.598 1.00 18.09 ? 2154 HOH B O   1 
HETATM 3316 O O   . HOH F 3 .   ? -1.408  22.558 25.830 1.00 20.49 ? 2155 HOH B O   1 
HETATM 3317 O O   . HOH F 3 .   ? -11.260 3.085  25.408 1.00 27.45 ? 2156 HOH B O   1 
HETATM 3318 O O   . HOH F 3 .   ? -12.039 6.269  28.404 1.00 15.40 ? 2157 HOH B O   1 
HETATM 3319 O O   . HOH F 3 .   ? -5.204  3.536  22.194 1.00 27.39 ? 2158 HOH B O   1 
HETATM 3320 O O   . HOH F 3 .   ? -5.518  2.381  25.071 1.00 40.08 ? 2159 HOH B O   1 
HETATM 3321 O O   . HOH F 3 .   ? -3.569  6.215  28.302 1.00 18.57 ? 2160 HOH B O   1 
HETATM 3322 O O   . HOH F 3 .   ? -5.583  4.433  29.809 1.00 38.70 ? 2161 HOH B O   1 
HETATM 3323 O O   . HOH F 3 .   ? 0.717   7.789  21.172 1.00 23.42 ? 2162 HOH B O   1 
HETATM 3324 O O   . HOH F 3 .   ? -1.365  13.453 25.973 1.00 22.06 ? 2163 HOH B O   1 
HETATM 3325 O O   . HOH F 3 .   ? -0.843  26.643 17.613 1.00 17.00 ? 2164 HOH B O   1 
HETATM 3326 O O   . HOH F 3 .   ? 4.204   24.697 8.160  1.00 15.58 ? 2165 HOH B O   1 
HETATM 3327 O O   . HOH F 3 .   ? 1.866   31.427 7.598  1.00 24.48 ? 2166 HOH B O   1 
HETATM 3328 O O   . HOH F 3 .   ? 4.930   31.320 5.773  1.00 26.72 ? 2167 HOH B O   1 
HETATM 3329 O O   . HOH F 3 .   ? 0.737   31.984 1.326  1.00 27.99 ? 2168 HOH B O   1 
HETATM 3330 O O   . HOH F 3 .   ? 6.484   20.787 3.039  1.00 38.65 ? 2169 HOH B O   1 
HETATM 3331 O O   . HOH F 3 .   ? 4.226   20.438 2.265  1.00 27.19 ? 2170 HOH B O   1 
HETATM 3332 O O   . HOH F 3 .   ? 7.823   21.735 7.973  1.00 33.09 ? 2171 HOH B O   1 
HETATM 3333 O O   . HOH F 3 .   ? 1.235   17.370 3.096  1.00 21.68 ? 2172 HOH B O   1 
HETATM 3334 O O   . HOH F 3 .   ? 6.340   15.812 8.062  1.00 17.69 ? 2173 HOH B O   1 
HETATM 3335 O O   . HOH F 3 .   ? 7.499   21.379 11.486 1.00 19.81 ? 2174 HOH B O   1 
HETATM 3336 O O   . HOH F 3 .   ? 11.009  21.000 11.908 1.00 24.89 ? 2175 HOH B O   1 
HETATM 3337 O O   . HOH F 3 .   ? 7.361   14.089 10.079 1.00 15.93 ? 2176 HOH B O   1 
HETATM 3338 O O   . HOH F 3 .   ? 2.865   14.850 15.914 1.00 15.75 ? 2177 HOH B O   1 
HETATM 3339 O O   . HOH F 3 .   ? 6.089   11.581 10.833 1.00 19.80 ? 2178 HOH B O   1 
HETATM 3340 O O   . HOH F 3 .   ? 4.435   13.353 16.989 1.00 23.02 ? 2179 HOH B O   1 
HETATM 3341 O O   . HOH F 3 .   ? 5.156   10.677 17.288 1.00 50.22 ? 2180 HOH B O   1 
HETATM 3342 O O   . HOH F 3 .   ? 6.519   16.812 20.001 1.00 22.31 ? 2181 HOH B O   1 
HETATM 3343 O O   . HOH F 3 .   ? 11.584  13.150 17.787 1.00 20.59 ? 2182 HOH B O   1 
HETATM 3344 O O   . HOH F 3 .   ? 8.105   10.595 24.236 1.00 28.70 ? 2183 HOH B O   1 
HETATM 3345 O O   . HOH F 3 .   ? 6.431   9.587  19.709 1.00 24.76 ? 2184 HOH B O   1 
HETATM 3346 O O   . HOH F 3 .   ? 4.442   8.225  21.133 1.00 24.57 ? 2185 HOH B O   1 
HETATM 3347 O O   . HOH F 3 .   ? 2.479   9.540  21.231 1.00 12.77 ? 2186 HOH B O   1 
HETATM 3348 O O   . HOH F 3 .   ? 1.932   9.830  18.654 1.00 21.29 ? 2187 HOH B O   1 
HETATM 3349 O O   . HOH F 3 .   ? 2.016   12.557 18.336 1.00 18.61 ? 2188 HOH B O   1 
HETATM 3350 O O   . HOH F 3 .   ? 0.656   4.948  26.972 1.00 35.13 ? 2189 HOH B O   1 
HETATM 3351 O O   . HOH F 3 .   ? -2.429  7.338  30.418 1.00 17.22 ? 2190 HOH B O   1 
HETATM 3352 O O   . HOH F 3 .   ? 0.191   6.998  31.540 1.00 22.36 ? 2191 HOH B O   1 
HETATM 3353 O O   . HOH F 3 .   ? 5.450   20.087 19.724 1.00 32.20 ? 2192 HOH B O   1 
HETATM 3354 O O   . HOH F 3 .   ? -3.938  18.520 3.114  1.00 10.39 ? 2193 HOH B O   1 
HETATM 3355 O O   . HOH F 3 .   ? -1.696  17.125 4.276  1.00 10.62 ? 2194 HOH B O   1 
HETATM 3356 O O   . HOH F 3 .   ? 0.450   9.238  6.668  1.00 28.99 ? 2195 HOH B O   1 
HETATM 3357 O O   . HOH F 3 .   ? -1.009  8.513  14.271 1.00 19.96 ? 2196 HOH B O   1 
HETATM 3358 O O   . HOH F 3 .   ? -4.906  8.327  7.068  1.00 22.36 ? 2197 HOH B O   1 
HETATM 3359 O O   . HOH F 3 .   ? 3.998   13.763 4.301  1.00 27.02 ? 2198 HOH B O   1 
HETATM 3360 O O   . HOH F 3 .   ? 4.835   8.782  6.525  1.00 34.59 ? 2199 HOH B O   1 
HETATM 3361 O O   . HOH F 3 .   ? -7.021  7.487  10.337 1.00 15.11 ? 2200 HOH B O   1 
HETATM 3362 O O   . HOH F 3 .   ? -8.232  7.146  12.352 1.00 25.03 ? 2201 HOH B O   1 
HETATM 3363 O O   . HOH F 3 .   ? -2.963  6.708  14.768 1.00 25.37 ? 2202 HOH B O   1 
HETATM 3364 O O   . HOH F 3 .   ? -6.153  5.940  13.823 1.00 32.90 ? 2203 HOH B O   1 
HETATM 3365 O O   . HOH F 3 .   ? -16.025 9.433  11.722 1.00 31.99 ? 2204 HOH B O   1 
HETATM 3366 O O   . HOH F 3 .   ? -14.471 8.847  8.843  1.00 18.09 ? 2205 HOH B O   1 
HETATM 3367 O O   . HOH F 3 .   ? -11.811 7.109  8.395  1.00 21.28 ? 2206 HOH B O   1 
HETATM 3368 O O   . HOH F 3 .   ? -14.496 8.932  0.604  1.00 20.22 ? 2207 HOH B O   1 
HETATM 3369 O O   . HOH F 3 .   ? -13.311 6.447  5.944  1.00 23.07 ? 2208 HOH B O   1 
HETATM 3370 O O   . HOH F 3 .   ? -15.289 12.316 1.367  1.00 25.53 ? 2209 HOH B O   1 
HETATM 3371 O O   . HOH F 3 .   ? -15.230 22.203 8.072  1.00 13.70 ? 2210 HOH B O   1 
HETATM 3372 O O   . HOH F 3 .   ? -16.211 19.922 6.069  1.00 28.92 ? 2211 HOH B O   1 
HETATM 3373 O O   . HOH F 3 .   ? -18.587 15.752 10.993 1.00 29.51 ? 2212 HOH B O   1 
HETATM 3374 O O   . HOH F 3 .   ? -6.539  17.319 3.657  1.00 23.49 ? 2213 HOH B O   1 
HETATM 3375 O O   . HOH F 3 .   ? -18.395 24.372 5.947  1.00 42.03 ? 2214 HOH B O   1 
HETATM 3376 O O   . HOH F 3 .   ? -7.058  27.552 9.237  1.00 25.68 ? 2215 HOH B O   1 
HETATM 3377 O O   . HOH F 3 .   ? -8.840  38.756 4.563  1.00 12.37 ? 2216 HOH B O   1 
HETATM 3378 O O   . HOH F 3 .   ? -13.162 38.986 5.070  1.00 22.71 ? 2217 HOH B O   1 
HETATM 3379 O O   . HOH F 3 .   ? -10.171 38.422 6.982  1.00 18.83 ? 2218 HOH B O   1 
HETATM 3380 O O   . HOH F 3 .   ? -6.556  40.407 -2.571 1.00 37.15 ? 2219 HOH B O   1 
HETATM 3381 O O   . HOH F 3 .   ? -2.591  37.640 -1.193 1.00 18.30 ? 2220 HOH B O   1 
HETATM 3382 O O   . HOH F 3 .   ? -1.631  38.753 2.776  1.00 13.38 ? 2221 HOH B O   1 
HETATM 3383 O O   . HOH F 3 .   ? -7.538  42.016 6.818  1.00 18.41 ? 2222 HOH B O   1 
HETATM 3384 O O   . HOH F 3 .   ? -0.312  41.133 1.720  1.00 21.06 ? 2223 HOH B O   1 
HETATM 3385 O O   . HOH F 3 .   ? -5.114  41.891 8.212  1.00 15.75 ? 2224 HOH B O   1 
HETATM 3386 O O   . HOH F 3 .   ? 4.728   43.979 2.152  1.00 47.03 ? 2225 HOH B O   1 
HETATM 3387 O O   . HOH F 3 .   ? 6.033   32.447 8.357  1.00 28.72 ? 2226 HOH B O   1 
HETATM 3388 O O   . HOH F 3 .   ? 1.765   35.180 2.047  1.00 33.80 ? 2227 HOH B O   1 
HETATM 3389 O O   . HOH F 3 .   ? 6.143   39.828 5.931  1.00 20.69 ? 2228 HOH B O   1 
HETATM 3390 O O   . HOH F 3 .   ? 9.919   34.804 12.973 1.00 32.42 ? 2229 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ALA A 2   ? 0.4101 0.2553 0.4414 -0.1559 -0.1607 -0.0440 0    ALA A N   
2    C CA  . ALA A 2   ? 0.4283 0.2825 0.2560 -0.0031 0.0455  -0.0852 0    ALA A CA  
3    C C   . ALA A 2   ? 0.4321 0.2021 0.3287 -0.0424 -0.0345 -0.0449 0    ALA A C   
4    O O   . ALA A 2   ? 0.5629 0.2885 0.3009 -0.0511 0.0356  0.0125  0    ALA A O   
5    C CB  . ALA A 2   ? 0.3848 0.3984 0.2758 0.1231  -0.0057 -0.0353 0    ALA A CB  
6    N N   . MET A 3   ? 0.3834 0.2324 0.2578 -0.0790 0.0030  0.0251  1    MET A N   
7    C CA  . MET A 3   ? 0.3251 0.1751 0.2709 -0.0589 0.0540  -0.0223 1    MET A CA  
8    C C   . MET A 3   ? 0.2640 0.1494 0.2385 -0.0537 0.0319  -0.0298 1    MET A C   
9    O O   . MET A 3   ? 0.2823 0.1448 0.2041 -0.1254 0.0378  0.0063  1    MET A O   
10   C CB  . MET A 3   ? 0.2772 0.1585 0.2532 -0.0400 0.0309  -0.0485 1    MET A CB  
11   C CG  . MET A 3   ? 0.2416 0.3435 0.2514 -0.0052 0.0341  0.0511  1    MET A CG  
12   S SD  . MET A 3   ? 0.2605 0.2235 0.2743 0.0237  0.0008  -0.0173 1    MET A SD  
13   C CE  . MET A 3   ? 0.1310 0.0637 0.1519 -0.0441 0.0086  0.0466  1    MET A CE  
14   N N   . ASP A 4   ? 0.3014 0.1732 0.2266 -0.0610 -0.0194 -0.0414 2    ASP A N   
15   C CA  . ASP A 4   ? 0.2577 0.2165 0.2291 -0.0330 0.0095  -0.0009 2    ASP A CA  
16   C C   . ASP A 4   ? 0.2026 0.1567 0.2081 -0.0599 0.0243  -0.0265 2    ASP A C   
17   O O   . ASP A 4   ? 0.1947 0.1439 0.2066 -0.0177 0.0354  -0.0093 2    ASP A O   
18   C CB  . ASP A 4   ? 0.3298 0.2218 0.3459 -0.0514 -0.0475 -0.0356 2    ASP A CB  
19   C CG  . ASP A 4   ? 0.3981 0.3756 0.3944 -0.0898 -0.0304 0.0275  2    ASP A CG  
20   O OD1 . ASP A 4   ? 0.3844 0.2293 0.2332 -0.0252 -0.0815 -0.0380 2    ASP A OD1 
21   O OD2 . ASP A 4   ? 0.5136 0.3173 0.3976 -0.0807 -0.0802 0.0020  2    ASP A OD2 
22   N N   . ARG A 5   ? 0.1797 0.2089 0.2479 -0.0255 0.0683  -0.0250 3    ARG A N   
23   C CA  . ARG A 5   ? 0.1318 0.1944 0.2521 -0.0224 0.0071  0.0152  3    ARG A CA  
24   C C   . ARG A 5   ? 0.2008 0.1391 0.2143 -0.0355 0.0390  -0.0119 3    ARG A C   
25   O O   . ARG A 5   ? 0.2157 0.2158 0.2311 -0.0876 0.0338  0.0121  3    ARG A O   
26   C CB  . ARG A 5   ? 0.2054 0.1754 0.3194 -0.0723 0.0560  0.0168  3    ARG A CB  
27   C CG  . ARG A 5   ? 0.2522 0.1744 0.3920 -0.0161 0.0985  0.0133  3    ARG A CG  
28   C CD  . ARG A 5   ? 0.3643 0.2589 0.4552 0.0465  0.0577  0.0927  3    ARG A CD  
29   N NE  . ARG A 5   ? 0.4937 0.5438 0.4744 0.0121  0.0634  -0.0571 3    ARG A NE  
30   C CZ  . ARG A 5   ? 0.5248 0.6948 0.4830 -0.0695 0.0120  0.0072  3    ARG A CZ  
31   N NH1 . ARG A 5   ? 0.5541 0.5156 0.5295 -0.1482 -0.0773 0.0171  3    ARG A NH1 
32   N NH2 . ARG A 5   ? 0.5407 0.5883 0.5053 -0.2055 -0.0470 -0.1974 3    ARG A NH2 
33   N N   . HIS A 6   ? 0.1538 0.1288 0.2000 -0.0270 0.0189  0.0012  4    HIS A N   
34   C CA  . HIS A 6   ? 0.1333 0.1420 0.1734 -0.0144 0.0042  -0.0085 4    HIS A CA  
35   C C   . HIS A 6   ? 0.1285 0.1305 0.1868 -0.0259 -0.0065 0.0328  4    HIS A C   
36   O O   . HIS A 6   ? 0.1457 0.1312 0.1855 -0.0158 -0.0254 0.0155  4    HIS A O   
37   C CB  . HIS A 6   ? 0.1292 0.1334 0.2164 0.0020  0.0160  -0.0036 4    HIS A CB  
38   C CG  . HIS A 6   ? 0.1488 0.1540 0.2226 0.0053  0.0068  0.0231  4    HIS A CG  
39   N ND1 . HIS A 6   ? 0.1970 0.1742 0.2064 0.0026  -0.0017 0.0112  4    HIS A ND1 
40   C CD2 . HIS A 6   ? 0.2255 0.2173 0.2634 0.0003  0.0503  -0.0299 4    HIS A CD2 
41   C CE1 . HIS A 6   ? 0.1922 0.2125 0.2682 0.0822  0.0076  0.0405  4    HIS A CE1 
42   N NE2 . HIS A 6   ? 0.2542 0.2486 0.3159 -0.0369 0.0199  0.0276  4    HIS A NE2 
43   N N   . LYS A 7   ? 0.1199 0.1016 0.1483 -0.0165 0.0087  0.0134  5    LYS A N   
44   C CA  . LYS A 7   ? 0.1100 0.1036 0.1252 -0.0256 0.0122  -0.0029 5    LYS A CA  
45   C C   . LYS A 7   ? 0.0949 0.1078 0.1100 -0.0202 0.0109  0.0073  5    LYS A C   
46   O O   . LYS A 7   ? 0.1210 0.1347 0.0970 -0.0351 0.0201  0.0017  5    LYS A O   
47   C CB  . LYS A 7   ? 0.1294 0.1064 0.1178 -0.0085 0.0069  0.0000  5    LYS A CB  
48   C CG  . LYS A 7   ? 0.0983 0.1098 0.0895 -0.0119 0.0053  0.0037  5    LYS A CG  
49   C CD  . LYS A 7   ? 0.1206 0.1297 0.1284 0.0253  0.0025  0.0193  5    LYS A CD  
50   C CE  . LYS A 7   ? 0.1364 0.1206 0.1237 -0.0152 -0.0023 -0.0021 5    LYS A CE  
51   N NZ  . LYS A 7   ? 0.1134 0.1351 0.1133 -0.0246 0.0249  -0.0005 5    LYS A NZ  
52   N N   . PRO A 8   ? 0.0867 0.1248 0.0956 -0.0193 0.0102  0.0062  6    PRO A N   
53   C CA  . PRO A 8   ? 0.1178 0.1150 0.1040 -0.0214 0.0001  0.0125  6    PRO A CA  
54   C C   . PRO A 8   ? 0.1117 0.1321 0.1024 -0.0203 -0.0045 0.0134  6    PRO A C   
55   O O   . PRO A 8   ? 0.1210 0.1285 0.0916 0.0019  0.0022  -0.0027 6    PRO A O   
56   C CB  . PRO A 8   ? 0.1167 0.1240 0.0932 -0.0271 -0.0074 -0.0142 6    PRO A CB  
57   C CG  . PRO A 8   ? 0.1122 0.1305 0.1291 -0.0221 0.0097  0.0056  6    PRO A CG  
58   C CD  . PRO A 8   ? 0.0790 0.1602 0.1360 -0.0290 0.0004  0.0220  6    PRO A CD  
59   N N   . LYS A 9   ? 0.1174 0.1006 0.0999 -0.0308 0.0142  0.0229  7    LYS A N   
60   C CA  . LYS A 9   ? 0.1376 0.1394 0.0947 -0.0032 0.0106  -0.0009 7    LYS A CA  
61   C C   . LYS A 9   ? 0.0993 0.1282 0.1039 -0.0119 0.0129  -0.0032 7    LYS A C   
62   O O   . LYS A 9   ? 0.1280 0.1618 0.1205 0.0175  0.0130  -0.0155 7    LYS A O   
63   C CB  . LYS A 9   ? 0.2197 0.1656 0.0968 -0.0214 0.0238  0.0141  7    LYS A CB  
64   C CG  . LYS A 9   ? 0.2676 0.3102 0.2581 -0.0055 0.0490  -0.0023 7    LYS A CG  
65   C CD  . LYS A 9   ? 0.3168 0.3487 0.2824 0.0287  0.0342  -0.0025 7    LYS A CD  
66   C CE  . LYS A 9   ? 0.3998 0.3410 0.3764 -0.0319 -0.0304 0.0205  7    LYS A CE  
67   N NZ  . LYS A 9   ? 0.4258 0.5371 0.4427 0.0205  -0.1381 0.0769  7    LYS A NZ  
68   N N   . SER A 10  ? 0.1047 0.1078 0.0811 -0.0161 -0.0031 0.0166  8    SER A N   
69   C CA  . SER A 10  ? 0.1093 0.1043 0.1109 -0.0066 0.0229  0.0022  8    SER A CA  
70   C C   . SER A 10  ? 0.1100 0.1130 0.1040 -0.0057 0.0133  -0.0145 8    SER A C   
71   O O   . SER A 10  ? 0.1696 0.1066 0.0993 0.0093  0.0060  -0.0053 8    SER A O   
72   C CB  . SER A 10  ? 0.1498 0.1377 0.1219 -0.0264 0.0096  -0.0211 8    SER A CB  
73   O OG  . SER A 10  ? 0.2458 0.1787 0.1333 0.0058  -0.0141 -0.0306 8    SER A OG  
74   N N   . ILE A 11  ? 0.0936 0.0898 0.0902 0.0111  0.0128  0.0019  9    ILE A N   
75   C CA  . ILE A 11  ? 0.0821 0.0870 0.0961 -0.0118 0.0094  0.0046  9    ILE A CA  
76   C C   . ILE A 11  ? 0.0837 0.0985 0.1140 -0.0137 0.0121  0.0152  9    ILE A C   
77   O O   . ILE A 11  ? 0.0774 0.1061 0.1160 -0.0295 0.0018  0.0165  9    ILE A O   
78   C CB  . ILE A 11  ? 0.0791 0.1107 0.0936 -0.0107 -0.0002 -0.0278 9    ILE A CB  
79   C CG1 . ILE A 11  ? 0.0920 0.1307 0.1106 -0.0241 -0.0028 0.0095  9    ILE A CG1 
80   C CG2 . ILE A 11  ? 0.0945 0.1475 0.0955 -0.0033 0.0199  -0.0181 9    ILE A CG2 
81   C CD1 . ILE A 11  ? 0.1102 0.1080 0.1305 -0.0128 0.0047  0.0034  9    ILE A CD1 
82   N N   . SER A 12  ? 0.0870 0.0916 0.0998 0.0003  0.0068  -0.0109 10   SER A N   
83   C CA  . SER A 12  ? 0.0784 0.1238 0.0914 -0.0074 0.0104  -0.0024 10   SER A CA  
84   C C   . SER A 12  ? 0.0695 0.1216 0.1012 -0.0104 -0.0082 -0.0160 10   SER A C   
85   O O   . SER A 12  ? 0.0684 0.1205 0.0973 -0.0175 0.0000  0.0138  10   SER A O   
86   C CB  . SER A 12  ? 0.1097 0.1200 0.0815 -0.0041 0.0056  0.0101  10   SER A CB  
87   O OG  . SER A 12  ? 0.0898 0.1349 0.0923 0.0058  0.0046  0.0121  10   SER A OG  
88   N N   . SER A 13  ? 0.0902 0.1391 0.1034 -0.0196 0.0133  0.0101  11   SER A N   
89   C CA  . SER A 13  ? 0.0950 0.1256 0.0979 -0.0175 0.0085  0.0138  11   SER A CA  
90   C C   . SER A 13  ? 0.0524 0.1128 0.1043 -0.0161 0.0108  0.0211  11   SER A C   
91   O O   . SER A 13  ? 0.1028 0.1137 0.1319 -0.0182 0.0091  -0.0115 11   SER A O   
92   C CB  . SER A 13  ? 0.0956 0.1571 0.1138 -0.0225 -0.0004 0.0136  11   SER A CB  
93   O OG  . SER A 13  ? 0.1828 0.2311 0.1530 -0.0614 -0.0067 0.0703  11   SER A OG  
94   N N   . GLU A 14  ? 0.0616 0.1070 0.0885 -0.0211 0.0096  0.0100  12   GLU A N   
95   C CA  . GLU A 14  ? 0.0830 0.1225 0.0864 -0.0094 0.0136  -0.0003 12   GLU A CA  
96   C C   . GLU A 14  ? 0.0616 0.1180 0.0727 0.0052  -0.0078 0.0066  12   GLU A C   
97   O O   . GLU A 14  ? 0.0564 0.1313 0.0764 -0.0020 0.0053  -0.0127 12   GLU A O   
98   C CB  . GLU A 14  ? 0.0997 0.1363 0.0953 -0.0072 0.0011  0.0083  12   GLU A CB  
99   C CG  . GLU A 14  ? 0.0791 0.1127 0.0865 0.0064  -0.0184 0.0226  12   GLU A CG  
100  C CD  . GLU A 14  ? 0.1027 0.1508 0.1281 0.0076  0.0097  0.0010  12   GLU A CD  
101  O OE1 . GLU A 14  ? 0.1017 0.1544 0.1328 0.0184  0.0084  0.0020  12   GLU A OE1 
102  O OE2 . GLU A 14  ? 0.1625 0.1633 0.1316 0.0219  0.0113  0.0055  12   GLU A OE2 
103  N N   . ILE A 15  ? 0.0634 0.1223 0.0737 -0.0070 -0.0010 0.0135  13   ILE A N   
104  C CA  . ILE A 15  ? 0.0788 0.1123 0.0825 -0.0090 0.0188  0.0107  13   ILE A CA  
105  C C   . ILE A 15  ? 0.0657 0.1139 0.0856 -0.0093 0.0018  0.0151  13   ILE A C   
106  O O   . ILE A 15  ? 0.0803 0.1024 0.0854 -0.0140 0.0072  0.0112  13   ILE A O   
107  C CB  . ILE A 15  ? 0.0652 0.1114 0.0959 -0.0031 0.0014  0.0176  13   ILE A CB  
108  C CG1 . ILE A 15  ? 0.0874 0.1313 0.0898 0.0246  0.0027  -0.0103 13   ILE A CG1 
109  C CG2 . ILE A 15  ? 0.0618 0.1362 0.0810 0.0040  -0.0012 -0.0071 13   ILE A CG2 
110  C CD1 . ILE A 15  ? 0.0986 0.1336 0.1072 0.0106  0.0027  -0.0141 13   ILE A CD1 
111  N N   . TRP A 16  ? 0.0498 0.0975 0.0923 -0.0025 -0.0062 0.0066  14   TRP A N   
112  C CA  . TRP A 16  ? 0.0772 0.0901 0.0977 -0.0037 -0.0086 0.0028  14   TRP A CA  
113  C C   . TRP A 16  ? 0.0908 0.0893 0.0981 -0.0142 -0.0010 -0.0020 14   TRP A C   
114  O O   . TRP A 16  ? 0.0687 0.1094 0.1221 0.0012  -0.0021 -0.0043 14   TRP A O   
115  C CB  . TRP A 16  ? 0.0707 0.0949 0.0812 -0.0016 -0.0084 -0.0028 14   TRP A CB  
116  C CG  . TRP A 16  ? 0.0914 0.0938 0.1033 -0.0070 0.0033  0.0081  14   TRP A CG  
117  C CD1 . TRP A 16  ? 0.1290 0.1188 0.1172 -0.0210 -0.0148 -0.0124 14   TRP A CD1 
118  C CD2 . TRP A 16  ? 0.0877 0.0995 0.0768 0.0170  0.0179  -0.0113 14   TRP A CD2 
119  N NE1 . TRP A 16  ? 0.1360 0.0929 0.1397 0.0012  0.0040  -0.0327 14   TRP A NE1 
120  C CE2 . TRP A 16  ? 0.0939 0.0911 0.1165 0.0010  0.0304  0.0113  14   TRP A CE2 
121  C CE3 . TRP A 16  ? 0.0892 0.1023 0.0965 0.0149  0.0101  -0.0150 14   TRP A CE3 
122  C CZ2 . TRP A 16  ? 0.1177 0.1548 0.0941 0.0148  0.0315  -0.0035 14   TRP A CZ2 
123  C CZ3 . TRP A 16  ? 0.0782 0.1285 0.1097 -0.0073 0.0000  0.0069  14   TRP A CZ3 
124  C CH2 . TRP A 16  ? 0.0836 0.1459 0.1071 0.0178  0.0138  0.0075  14   TRP A CH2 
125  N N   . ALA A 17  ? 0.0799 0.0936 0.1126 -0.0082 0.0229  0.0042  15   ALA A N   
126  C CA  . ALA A 17  ? 0.0857 0.1183 0.1204 -0.0227 0.0046  0.0017  15   ALA A CA  
127  C C   . ALA A 17  ? 0.0619 0.1251 0.1011 -0.0190 0.0019  -0.0095 15   ALA A C   
128  O O   . ALA A 17  ? 0.0815 0.1124 0.1110 0.0005  -0.0102 -0.0120 15   ALA A O   
129  C CB  . ALA A 17  ? 0.0877 0.2052 0.1682 -0.0368 -0.0066 0.0147  15   ALA A CB  
130  N N   . LEU A 18  ? 0.0841 0.1266 0.0796 -0.0168 0.0192  -0.0124 16   LEU A N   
131  C CA  . LEU A 18  ? 0.0903 0.1223 0.1015 -0.0329 -0.0031 0.0011  16   LEU A CA  
132  C C   . LEU A 18  ? 0.1033 0.1300 0.0884 -0.0035 0.0144  -0.0205 16   LEU A C   
133  O O   . LEU A 18  ? 0.1165 0.1428 0.0861 0.0007  0.0212  -0.0106 16   LEU A O   
134  C CB  . LEU A 18  ? 0.0956 0.1315 0.1003 -0.0145 -0.0027 -0.0001 16   LEU A CB  
135  C CG  . LEU A 18  ? 0.0588 0.1044 0.1089 -0.0221 0.0154  -0.0200 16   LEU A CG  
136  C CD1 . LEU A 18  ? 0.0918 0.1235 0.0832 0.0124  -0.0022 0.0181  16   LEU A CD1 
137  C CD2 . LEU A 18  ? 0.0890 0.1088 0.1764 -0.0055 0.0319  -0.0007 16   LEU A CD2 
138  N N   . SER A 19  ? 0.0620 0.1188 0.0910 -0.0202 0.0047  -0.0043 17   SER A N   
139  C CA  . SER A 19  ? 0.0734 0.0972 0.1044 -0.0009 -0.0025 -0.0130 17   SER A CA  
140  C C   . SER A 19  ? 0.1022 0.1101 0.1080 0.0016  0.0012  -0.0219 17   SER A C   
141  O O   . SER A 19  ? 0.0897 0.1615 0.1072 0.0096  -0.0147 -0.0366 17   SER A O   
142  C CB  . SER A 19  ? 0.0837 0.0883 0.0952 0.0058  0.0013  -0.0047 17   SER A CB  
143  O OG  . SER A 19  ? 0.0913 0.0980 0.0971 -0.0023 -0.0089 0.0031  17   SER A OG  
144  N N   . GLU A 20  ? 0.1197 0.1436 0.1621 -0.0192 -0.0071 -0.0291 18   GLU A N   
145  C CA  . GLU A 20  ? 0.1602 0.1678 0.1761 -0.0299 -0.0260 -0.0256 18   GLU A CA  
146  C C   . GLU A 20  ? 0.1091 0.1561 0.1285 -0.0174 -0.0188 -0.0226 18   GLU A C   
147  O O   . GLU A 20  ? 0.1954 0.2234 0.1480 -0.0555 0.0301  -0.0623 18   GLU A O   
148  C CB  . GLU A 20  ? 0.1863 0.1940 0.2514 -0.0659 0.0144  -0.0064 18   GLU A CB  
149  C CG  . GLU A 20  ? 0.2228 0.1519 0.2564 0.0090  0.0147  0.0121  18   GLU A CG  
150  C CD  . GLU A 20  ? 0.3017 0.3845 0.3935 -0.0809 -0.0604 0.0063  18   GLU A CD  
151  O OE1 . GLU A 20  ? 0.2714 0.4393 0.3547 -0.0992 -0.0303 0.0255  18   GLU A OE1 
152  O OE2 . GLU A 20  ? 0.3659 0.3768 0.3775 -0.1346 -0.0226 -0.0252 18   GLU A OE2 
153  N N   . THR A 21  ? 0.1584 0.1691 0.1775 -0.0263 -0.0055 -0.0364 19   THR A N   
154  C CA  . THR A 21  ? 0.1070 0.2268 0.1359 0.0220  0.0087  -0.0463 19   THR A CA  
155  C C   . THR A 21  ? 0.1348 0.1864 0.1279 -0.0055 0.0059  -0.0201 19   THR A C   
156  O O   . THR A 21  ? 0.1427 0.2430 0.1364 0.0366  -0.0006 -0.0014 19   THR A O   
157  C CB  . THR A 21  ? 0.1683 0.2147 0.1404 0.0235  0.0086  -0.0123 19   THR A CB  
158  O OG1 . THR A 21  ? 0.1711 0.2402 0.1655 0.0554  0.0168  -0.0235 19   THR A OG1 
159  C CG2 . THR A 21  ? 0.1653 0.2969 0.2411 0.0025  0.0131  -0.0069 19   THR A CG2 
160  N N   . SER A 22  ? 0.1307 0.1666 0.1120 -0.0317 0.0035  -0.0318 20   SER A N   
161  C CA  . SER A 22  ? 0.1044 0.1689 0.1063 -0.0036 -0.0085 -0.0346 20   SER A CA  
162  C C   . SER A 22  ? 0.1183 0.1342 0.1007 -0.0254 -0.0015 -0.0138 20   SER A C   
163  O O   . SER A 22  ? 0.1584 0.1505 0.1538 -0.0106 0.0452  0.0104  20   SER A O   
164  C CB  . SER A 22  ? 0.0969 0.1805 0.1024 0.0085  -0.0151 -0.0366 20   SER A CB  
165  O OG  . SER A 22  ? 0.0986 0.1335 0.1138 -0.0030 0.0038  -0.0309 20   SER A OG  
166  N N   . LYS A 23  ? 0.0944 0.1110 0.1100 0.0064  0.0095  0.0019  21   LYS A N   
167  C CA  . LYS A 23  ? 0.0873 0.1129 0.1409 0.0054  0.0029  0.0033  21   LYS A CA  
168  C C   . LYS A 23  ? 0.1043 0.1038 0.1068 -0.0062 0.0233  0.0213  21   LYS A C   
169  O O   . LYS A 23  ? 0.0931 0.1223 0.1072 -0.0092 0.0191  -0.0015 21   LYS A O   
170  C CB  . LYS A 23  ? 0.1293 0.1667 0.1565 -0.0021 0.0153  -0.0168 21   LYS A CB  
171  C CG  . LYS A 23  ? 0.1988 0.2868 0.1846 0.0309  -0.0325 -0.0350 21   LYS A CG  
172  C CD  . LYS A 23  ? 0.2720 0.3338 0.2160 0.0110  -0.0198 -0.0742 21   LYS A CD  
173  C CE  . LYS A 23  ? 0.2665 0.3766 0.2905 0.0008  -0.0893 -0.0289 21   LYS A CE  
174  N NZ  . LYS A 23  ? 0.4018 0.4670 0.2965 -0.1002 -0.1940 -0.0069 21   LYS A NZ  
175  N N   . GLU A 24  ? 0.0739 0.0901 0.1100 0.0083  -0.0011 0.0257  22   GLU A N   
176  C CA  . GLU A 24  ? 0.0950 0.0844 0.0999 -0.0120 0.0020  0.0107  22   GLU A CA  
177  C C   . GLU A 24  ? 0.0688 0.1017 0.0920 0.0053  0.0206  0.0124  22   GLU A C   
178  O O   . GLU A 24  ? 0.0660 0.1004 0.1003 0.0045  0.0299  0.0098  22   GLU A O   
179  C CB  . GLU A 24  ? 0.0767 0.0919 0.1184 0.0093  -0.0116 0.0036  22   GLU A CB  
180  C CG  . GLU A 24  ? 0.2062 0.1606 0.1259 -0.0297 0.0250  0.0072  22   GLU A CG  
181  C CD  . GLU A 24  ? 0.1853 0.1937 0.1724 0.0053  0.0040  -0.0071 22   GLU A CD  
182  O OE1 . GLU A 24  ? 0.2276 0.2459 0.2651 -0.0354 -0.0175 -0.0096 22   GLU A OE1 
183  O OE2 . GLU A 24  ? 0.2419 0.3118 0.2374 -0.0363 0.0065  0.0524  22   GLU A OE2 
184  N N   . TRP A 25  ? 0.0721 0.0832 0.0757 0.0100  0.0164  0.0158  23   TRP A N   
185  C CA  . TRP A 25  ? 0.0514 0.1269 0.0570 -0.0115 -0.0007 0.0224  23   TRP A CA  
186  C C   . TRP A 25  ? 0.0812 0.1282 0.0983 -0.0060 0.0060  0.0201  23   TRP A C   
187  O O   . TRP A 25  ? 0.1005 0.1045 0.1187 0.0176  0.0143  0.0176  23   TRP A O   
188  C CB  . TRP A 25  ? 0.0593 0.0941 0.0848 0.0141  0.0139  -0.0072 23   TRP A CB  
189  C CG  . TRP A 25  ? 0.0761 0.0829 0.0662 0.0007  0.0089  0.0229  23   TRP A CG  
190  C CD1 . TRP A 25  ? 0.0632 0.0701 0.1030 0.0065  0.0096  -0.0038 23   TRP A CD1 
191  C CD2 . TRP A 25  ? 0.0708 0.0854 0.1107 0.0003  0.0117  -0.0118 23   TRP A CD2 
192  N NE1 . TRP A 25  ? 0.0560 0.0996 0.1072 -0.0009 0.0001  0.0043  23   TRP A NE1 
193  C CE2 . TRP A 25  ? 0.0739 0.1066 0.0869 0.0060  0.0226  -0.0061 23   TRP A CE2 
194  C CE3 . TRP A 25  ? 0.0848 0.0996 0.0957 0.0086  0.0072  -0.0075 23   TRP A CE3 
195  C CZ2 . TRP A 25  ? 0.0862 0.1246 0.1266 -0.0173 0.0280  -0.0102 23   TRP A CZ2 
196  C CZ3 . TRP A 25  ? 0.1059 0.1096 0.1049 -0.0049 -0.0022 -0.0113 23   TRP A CZ3 
197  C CH2 . TRP A 25  ? 0.0655 0.1200 0.1447 -0.0117 0.0269  -0.0257 23   TRP A CH2 
198  N N   . MET A 26  ? 0.1000 0.0866 0.1086 -0.0162 0.0112  -0.0038 24   MET A N   
199  C CA  . MET A 26  ? 0.1067 0.1105 0.1071 0.0078  0.0173  -0.0092 24   MET A CA  
200  C C   . MET A 26  ? 0.1376 0.0860 0.1073 0.0252  0.0491  -0.0108 24   MET A C   
201  O O   . MET A 26  ? 0.1524 0.0759 0.1965 0.0263  0.0562  0.0381  24   MET A O   
202  C CB  . MET A 26  ? 0.1383 0.1088 0.0915 -0.0114 0.0209  -0.0419 24   MET A CB  
203  C CG  . MET A 26  ? 0.1386 0.1670 0.1566 -0.0226 0.0229  -0.0403 24   MET A CG  
204  S SD  . MET A 26  ? 0.2040 0.1854 0.2050 -0.0504 -0.0272 -0.0278 24   MET A SD  
205  C CE  . MET A 26  ? 0.1905 0.4743 0.2666 -0.0690 -0.0173 -0.0463 24   MET A CE  
206  N N   . SER A 27  ? 0.1092 0.1314 0.1008 0.0004  0.0367  -0.0021 25   SER A N   
207  C CA  . SER A 27  ? 0.1031 0.0990 0.1245 0.0208  0.0303  0.0050  25   SER A CA  
208  C C   . SER A 27  ? 0.1025 0.1261 0.1165 0.0227  0.0287  0.0201  25   SER A C   
209  O O   . SER A 27  ? 0.1086 0.1795 0.1733 0.0196  0.0617  0.0517  25   SER A O   
210  C CB  . SER A 27  ? 0.1234 0.1216 0.1510 -0.0010 0.0250  0.0338  25   SER A CB  
211  O OG  . SER A 27  ? 0.1174 0.1395 0.1211 0.0100  0.0396  0.0212  25   SER A OG  
212  N N   . ASN A 28  ? 0.1086 0.1009 0.1204 0.0349  0.0360  0.0225  26   ASN A N   
213  C CA  . ASN A 28  ? 0.1044 0.1223 0.1490 0.0137  0.0134  0.0030  26   ASN A CA  
214  C C   . ASN A 28  ? 0.1069 0.1495 0.1220 0.0278  0.0041  0.0017  26   ASN A C   
215  O O   . ASN A 28  ? 0.1567 0.1461 0.1431 0.0163  0.0012  0.0145  26   ASN A O   
216  C CB  . ASN A 28  ? 0.1446 0.1535 0.1453 0.0178  0.0343  0.0195  26   ASN A CB  
217  C CG  . ASN A 28  ? 0.0996 0.1439 0.1971 0.0248  0.0254  -0.0065 26   ASN A CG  
218  O OD1 . ASN A 28  ? 0.1265 0.1326 0.1794 0.0110  -0.0155 -0.0105 26   ASN A OD1 
219  N ND2 . ASN A 28  ? 0.1140 0.1406 0.1915 -0.0016 0.0178  0.0299  26   ASN A ND2 
220  N N   . LEU A 29  ? 0.0965 0.1370 0.1549 0.0173  0.0058  0.0395  27   LEU A N   
221  C CA  . LEU A 29  ? 0.1279 0.1151 0.1518 0.0366  -0.0037 0.0032  27   LEU A CA  
222  C C   . LEU A 29  ? 0.1181 0.1208 0.1407 0.0281  -0.0079 0.0098  27   LEU A C   
223  O O   . LEU A 29  ? 0.1200 0.1222 0.1438 0.0374  0.0144  0.0092  27   LEU A O   
224  C CB  . LEU A 29  ? 0.1237 0.1803 0.1689 0.0555  0.0317  0.0758  27   LEU A CB  
225  C CG  . LEU A 29  ? 0.1266 0.2398 0.2453 0.0090  0.0759  0.0050  27   LEU A CG  
226  C CD1 . LEU A 29  ? 0.1580 0.2833 0.2676 0.0549  0.0061  0.0504  27   LEU A CD1 
227  C CD2 . LEU A 29  ? 0.2096 0.2309 0.1978 0.0712  0.0216  0.0244  27   LEU A CD2 
228  N N   . ARG A 30  ? 0.1060 0.1057 0.1206 0.0222  0.0123  0.0162  28   ARG A N   
229  C CA  . ARG A 30  ? 0.0945 0.0871 0.1428 0.0305  0.0201  0.0170  28   ARG A CA  
230  C C   . ARG A 30  ? 0.0956 0.0905 0.0903 0.0246  -0.0017 -0.0037 28   ARG A C   
231  O O   . ARG A 30  ? 0.0913 0.0789 0.0991 0.0149  0.0126  0.0034  28   ARG A O   
232  C CB  . ARG A 30  ? 0.1217 0.1547 0.1270 0.0286  -0.0251 0.0373  28   ARG A CB  
233  C CG  . ARG A 30  ? 0.1294 0.1570 0.1974 0.0421  -0.0031 0.0085  28   ARG A CG  
234  C CD  . ARG A 30  ? 0.1665 0.1914 0.1980 -0.0026 0.0175  0.0237  28   ARG A CD  
235  N NE  . ARG A 30  ? 0.1828 0.1951 0.2299 -0.0262 -0.0778 0.0492  28   ARG A NE  
236  C CZ  . ARG A 30  ? 0.1390 0.2282 0.2437 -0.0172 0.0138  -0.0207 28   ARG A CZ  
237  N NH1 . ARG A 30  ? 0.2041 0.2414 0.2519 0.0084  -0.0579 -0.0018 28   ARG A NH1 
238  N NH2 . ARG A 30  ? 0.1723 0.2654 0.3136 0.0432  -0.0412 -0.0015 28   ARG A NH2 
239  N N   . PRO A 31  ? 0.1020 0.0752 0.0906 0.0178  0.0059  -0.0039 29   PRO A N   
240  C CA  . PRO A 31  ? 0.0863 0.1005 0.1152 0.0251  0.0173  0.0119  29   PRO A CA  
241  C C   . PRO A 31  ? 0.0856 0.0693 0.1206 -0.0005 0.0214  0.0061  29   PRO A C   
242  O O   . PRO A 31  ? 0.0962 0.0869 0.0985 0.0255  0.0062  0.0031  29   PRO A O   
243  C CB  . PRO A 31  ? 0.0992 0.1496 0.1392 0.0294  -0.0014 -0.0025 29   PRO A CB  
244  C CG  . PRO A 31  ? 0.1126 0.1256 0.1567 0.0275  0.0164  -0.0245 29   PRO A CG  
245  C CD  . PRO A 31  ? 0.1375 0.0700 0.1080 -0.0015 0.0137  -0.0068 29   PRO A CD  
246  N N   . LEU A 32  ? 0.0836 0.0805 0.0960 0.0065  0.0129  0.0101  30   LEU A N   
247  C CA  . LEU A 32  ? 0.0945 0.0817 0.1006 0.0151  -0.0007 -0.0055 30   LEU A CA  
248  C C   . LEU A 32  ? 0.0839 0.0649 0.0995 0.0085  0.0029  0.0164  30   LEU A C   
249  O O   . LEU A 32  ? 0.0658 0.0680 0.1111 0.0102  0.0081  0.0288  30   LEU A O   
250  C CB  . LEU A 32  ? 0.0719 0.0703 0.1026 0.0061  -0.0117 -0.0011 30   LEU A CB  
251  C CG  . LEU A 32  ? 0.0927 0.1011 0.1240 0.0034  0.0138  0.0218  30   LEU A CG  
252  C CD1 . LEU A 32  ? 0.1028 0.1288 0.1381 -0.0022 0.0071  0.0596  30   LEU A CD1 
253  C CD2 . LEU A 32  ? 0.0940 0.1513 0.1409 0.0150  0.0232  0.0590  30   LEU A CD2 
254  N N   . GLU A 33  ? 0.0764 0.0860 0.0890 0.0207  0.0159  -0.0096 31   GLU A N   
255  C CA  . GLU A 33  ? 0.0819 0.0622 0.0834 0.0009  0.0163  0.0054  31   GLU A CA  
256  C C   . GLU A 33  ? 0.0822 0.0667 0.0889 0.0119  0.0107  0.0071  31   GLU A C   
257  O O   . GLU A 33  ? 0.0936 0.0672 0.0859 0.0294  -0.0029 0.0127  31   GLU A O   
258  C CB  . GLU A 33  ? 0.1381 0.0879 0.0912 0.0104  -0.0308 -0.0293 31   GLU A CB  
259  C CG  . GLU A 33  ? 0.1707 0.1016 0.1193 -0.0075 -0.0232 0.0051  31   GLU A CG  
260  C CD  . GLU A 33  ? 0.1985 0.1042 0.1198 0.0459  -0.0100 0.0164  31   GLU A CD  
261  O OE1 . GLU A 33  ? 0.1518 0.1103 0.1445 0.0402  -0.0074 -0.0020 31   GLU A OE1 
262  O OE2 . GLU A 33  ? 0.1923 0.1350 0.1690 0.0662  -0.0333 0.0189  31   GLU A OE2 
263  N N   . ALA A 34  ? 0.0876 0.0846 0.0810 0.0141  0.0084  0.0139  32   ALA A N   
264  C CA  . ALA A 34  ? 0.0660 0.0592 0.0844 -0.0016 0.0004  0.0044  32   ALA A CA  
265  C C   . ALA A 34  ? 0.0673 0.0688 0.0713 -0.0039 0.0017  -0.0041 32   ALA A C   
266  O O   . ALA A 34  ? 0.0727 0.0657 0.0830 0.0041  0.0025  0.0048  32   ALA A O   
267  C CB  . ALA A 34  ? 0.0930 0.0969 0.1106 0.0139  0.0220  -0.0058 32   ALA A CB  
268  N N   . ARG A 35  ? 0.0641 0.0607 0.0831 0.0036  0.0060  -0.0021 33   ARG A N   
269  C CA  . ARG A 35  ? 0.0611 0.0799 0.0864 0.0094  0.0163  0.0058  33   ARG A CA  
270  C C   . ARG A 35  ? 0.0611 0.0720 0.0804 -0.0023 0.0066  0.0016  33   ARG A C   
271  O O   . ARG A 35  ? 0.0579 0.0722 0.0797 0.0025  0.0012  -0.0059 33   ARG A O   
272  C CB  . ARG A 35  ? 0.0726 0.0822 0.0935 0.0104  0.0063  0.0023  33   ARG A CB  
273  C CG  . ARG A 35  ? 0.0715 0.1019 0.0836 -0.0066 0.0107  -0.0065 33   ARG A CG  
274  C CD  . ARG A 35  ? 0.0897 0.0786 0.0917 0.0095  0.0000  -0.0103 33   ARG A CD  
275  N NE  . ARG A 35  ? 0.0807 0.0864 0.0979 -0.0138 0.0079  -0.0007 33   ARG A NE  
276  C CZ  . ARG A 35  ? 0.0950 0.0884 0.1136 -0.0109 -0.0091 -0.0254 33   ARG A CZ  
277  N NH1 . ARG A 35  ? 0.0963 0.0837 0.1798 -0.0211 0.0055  -0.0104 33   ARG A NH1 
278  N NH2 . ARG A 35  ? 0.1129 0.0973 0.1431 0.0002  -0.0263 -0.0417 33   ARG A NH2 
279  N N   . ILE A 36  ? 0.0896 0.0772 0.0797 0.0084  0.0080  0.0003  34   ILE A N   
280  C CA  . ILE A 36  ? 0.0826 0.0849 0.0870 0.0147  0.0081  -0.0010 34   ILE A CA  
281  C C   . ILE A 36  ? 0.0643 0.0786 0.0741 0.0097  0.0088  -0.0079 34   ILE A C   
282  O O   . ILE A 36  ? 0.0634 0.0854 0.0766 0.0221  0.0093  -0.0111 34   ILE A O   
283  C CB  . ILE A 36  ? 0.0775 0.1155 0.0720 -0.0044 -0.0060 -0.0040 34   ILE A CB  
284  C CG1 . ILE A 36  ? 0.0804 0.0778 0.1060 0.0280  0.0274  -0.0012 34   ILE A CG1 
285  C CG2 . ILE A 36  ? 0.1269 0.1010 0.0931 -0.0036 0.0008  -0.0150 34   ILE A CG2 
286  C CD1 . ILE A 36  ? 0.1259 0.1456 0.1000 0.0243  0.0026  0.0249  34   ILE A CD1 
287  N N   . VAL A 37  ? 0.0673 0.0772 0.0735 0.0012  -0.0128 0.0095  35   VAL A N   
288  C CA  . VAL A 37  ? 0.0587 0.0763 0.0797 -0.0016 -0.0058 -0.0015 35   VAL A CA  
289  C C   . VAL A 37  ? 0.0507 0.0765 0.0882 0.0111  0.0066  0.0003  35   VAL A C   
290  O O   . VAL A 37  ? 0.0762 0.0687 0.0761 0.0079  -0.0018 -0.0055 35   VAL A O   
291  C CB  . VAL A 37  ? 0.0557 0.0698 0.0986 0.0153  0.0084  -0.0051 35   VAL A CB  
292  C CG1 . VAL A 37  ? 0.0763 0.0916 0.1645 -0.0202 -0.0009 -0.0015 35   VAL A CG1 
293  C CG2 . VAL A 37  ? 0.1157 0.1068 0.1042 0.0106  -0.0147 -0.0066 35   VAL A CG2 
294  N N   . GLU A 38  ? 0.0673 0.0717 0.0784 0.0189  0.0006  0.0212  36   GLU A N   
295  C CA  . GLU A 38  ? 0.0554 0.0555 0.0601 0.0025  -0.0032 0.0005  36   GLU A CA  
296  C C   . GLU A 38  ? 0.0504 0.0577 0.0871 -0.0022 -0.0005 -0.0072 36   GLU A C   
297  O O   . GLU A 38  ? 0.0589 0.0648 0.0705 0.0034  0.0015  0.0008  36   GLU A O   
298  C CB  . GLU A 38  ? 0.0711 0.0727 0.0663 0.0063  0.0190  -0.0001 36   GLU A CB  
299  C CG  . GLU A 38  ? 0.0775 0.0877 0.0841 -0.0002 -0.0039 0.0014  36   GLU A CG  
300  C CD  . GLU A 38  ? 0.1113 0.0925 0.0841 0.0272  0.0134  0.0068  36   GLU A CD  
301  O OE1 . GLU A 38  ? 0.0894 0.0993 0.0666 0.0261  0.0004  -0.0097 36   GLU A OE1 
302  O OE2 . GLU A 38  ? 0.1083 0.1249 0.0991 0.0514  -0.0146 -0.0135 36   GLU A OE2 
303  N N   . CYS A 39  ? 0.0702 0.0524 0.0743 0.0080  0.0070  -0.0018 37   CYS A N   
304  C CA  . CYS A 39  ? 0.0680 0.0679 0.0729 0.0038  0.0054  0.0118  37   CYS A CA  
305  C C   . CYS A 39  ? 0.0532 0.0777 0.0703 0.0002  0.0078  0.0019  37   CYS A C   
306  O O   . CYS A 39  ? 0.0676 0.0720 0.0661 0.0104  -0.0097 0.0040  37   CYS A O   
307  C CB  . CYS A 39  ? 0.0487 0.0675 0.0677 -0.0005 -0.0115 0.0087  37   CYS A CB  
308  S SG  . CYS A 39  ? 0.0760 0.0832 0.0930 -0.0090 -0.0008 -0.0129 37   CYS A SG  
309  N N   . ILE A 40  ? 0.0569 0.0573 0.0536 0.0021  0.0055  0.0019  38   ILE A N   
310  C CA  . ILE A 40  ? 0.0619 0.0712 0.0852 0.0009  0.0001  -0.0151 38   ILE A CA  
311  C C   . ILE A 40  ? 0.0669 0.0728 0.0707 0.0110  0.0062  -0.0085 38   ILE A C   
312  O O   . ILE A 40  ? 0.0604 0.0679 0.0763 0.0162  0.0010  0.0098  38   ILE A O   
313  C CB  . ILE A 40  ? 0.0786 0.0544 0.0743 0.0166  -0.0009 -0.0184 38   ILE A CB  
314  C CG1 . ILE A 40  ? 0.0650 0.0730 0.0535 0.0152  -0.0030 -0.0187 38   ILE A CG1 
315  C CG2 . ILE A 40  ? 0.1396 0.0774 0.1125 -0.0114 0.0065  -0.0409 38   ILE A CG2 
316  C CD1 . ILE A 40  ? 0.0776 0.0982 0.0596 0.0127  -0.0187 -0.0171 38   ILE A CD1 
317  N N   . LYS A 41  ? 0.0553 0.0711 0.0681 0.0103  0.0023  -0.0032 39   LYS A N   
318  C CA  . LYS A 41  ? 0.0683 0.0745 0.0791 0.0091  0.0012  -0.0020 39   LYS A CA  
319  C C   . LYS A 41  ? 0.0538 0.0646 0.0607 -0.0013 0.0112  -0.0102 39   LYS A C   
320  O O   . LYS A 41  ? 0.0610 0.0638 0.0718 0.0040  0.0016  -0.0089 39   LYS A O   
321  C CB  . LYS A 41  ? 0.0733 0.0861 0.0765 0.0017  -0.0008 -0.0072 39   LYS A CB  
322  C CG  . LYS A 41  ? 0.0819 0.0865 0.0888 -0.0112 -0.0052 0.0013  39   LYS A CG  
323  C CD  . LYS A 41  ? 0.0836 0.1358 0.1323 -0.0047 0.0127  0.0024  39   LYS A CD  
324  C CE  . LYS A 41  ? 0.1049 0.1319 0.1020 -0.0197 0.0006  -0.0197 39   LYS A CE  
325  N NZ  . LYS A 41  ? 0.1549 0.1909 0.1405 -0.0117 0.0347  -0.0572 39   LYS A NZ  
326  N N   . TYR A 42  ? 0.0444 0.0616 0.0818 0.0063  -0.0026 -0.0045 40   TYR A N   
327  C CA  . TYR A 42  ? 0.0556 0.0535 0.0625 0.0091  -0.0039 -0.0012 40   TYR A CA  
328  C C   . TYR A 42  ? 0.0494 0.0550 0.0577 -0.0026 -0.0055 -0.0076 40   TYR A C   
329  O O   . TYR A 42  ? 0.0729 0.0536 0.0775 -0.0007 0.0056  0.0043  40   TYR A O   
330  C CB  . TYR A 42  ? 0.0610 0.0724 0.0700 -0.0105 0.0048  -0.0010 40   TYR A CB  
331  C CG  . TYR A 42  ? 0.0756 0.0973 0.0891 -0.0116 -0.0039 -0.0137 40   TYR A CG  
332  C CD1 . TYR A 42  ? 0.0725 0.0882 0.0760 0.0174  0.0150  -0.0119 40   TYR A CD1 
333  C CD2 . TYR A 42  ? 0.0773 0.0786 0.0610 -0.0007 0.0063  -0.0128 40   TYR A CD2 
334  C CE1 . TYR A 42  ? 0.0812 0.0785 0.0577 -0.0270 -0.0013 -0.0136 40   TYR A CE1 
335  C CE2 . TYR A 42  ? 0.0654 0.1029 0.0792 0.0109  0.0125  -0.0010 40   TYR A CE2 
336  C CZ  . TYR A 42  ? 0.0721 0.0871 0.0665 -0.0103 -0.0119 -0.0083 40   TYR A CZ  
337  O OH  . TYR A 42  ? 0.0688 0.1221 0.0796 -0.0003 0.0031  0.0206  40   TYR A OH  
338  N N   . THR A 43  ? 0.0524 0.0717 0.0607 -0.0046 0.0109  -0.0092 41   THR A N   
339  C CA  . THR A 43  ? 0.0680 0.0767 0.0684 0.0058  0.0139  -0.0177 41   THR A CA  
340  C C   . THR A 43  ? 0.0621 0.0770 0.0779 0.0047  0.0052  -0.0179 41   THR A C   
341  O O   . THR A 43  ? 0.0597 0.0693 0.0919 0.0102  0.0072  -0.0002 41   THR A O   
342  C CB  . THR A 43  ? 0.0522 0.0507 0.0923 -0.0038 0.0095  -0.0060 41   THR A CB  
343  O OG1 . THR A 43  ? 0.0660 0.0594 0.0906 -0.0214 0.0053  0.0027  41   THR A OG1 
344  C CG2 . THR A 43  ? 0.0699 0.0791 0.0878 0.0000  0.0221  0.0003  41   THR A CG2 
345  N N   . VAL A 44  ? 0.0641 0.0701 0.0612 0.0091  -0.0091 -0.0154 42   VAL A N   
346  C CA  . VAL A 44  ? 0.0617 0.0668 0.0898 0.0029  0.0111  -0.0019 42   VAL A CA  
347  C C   . VAL A 44  ? 0.0689 0.0660 0.0584 -0.0024 0.0036  -0.0129 42   VAL A C   
348  O O   . VAL A 44  ? 0.0814 0.0594 0.0911 0.0037  -0.0089 -0.0019 42   VAL A O   
349  C CB  . VAL A 44  ? 0.0659 0.0647 0.0714 0.0059  -0.0004 -0.0037 42   VAL A CB  
350  C CG1 . VAL A 44  ? 0.0732 0.0684 0.0977 -0.0111 -0.0009 -0.0128 42   VAL A CG1 
351  C CG2 . VAL A 44  ? 0.0995 0.0881 0.0845 -0.0010 -0.0211 0.0091  42   VAL A CG2 
352  N N   . CYS A 45  ? 0.0674 0.0550 0.0658 0.0001  0.0060  -0.0162 43   CYS A N   
353  C CA  . CYS A 45  ? 0.0682 0.0669 0.0689 -0.0074 0.0115  -0.0066 43   CYS A CA  
354  C C   . CYS A 45  ? 0.0815 0.0673 0.0853 0.0098  0.0173  -0.0050 43   CYS A C   
355  O O   . CYS A 45  ? 0.0742 0.0707 0.1004 0.0146  -0.0006 -0.0127 43   CYS A O   
356  C CB  . CYS A 45  ? 0.0866 0.0647 0.0649 0.0114  0.0000  0.0036  43   CYS A CB  
357  S SG  . CYS A 45  ? 0.0890 0.0818 0.0931 0.0071  0.0227  -0.0001 43   CYS A SG  
358  N N   . CME A 46  ? 0.0701 0.0978 0.0755 -0.0167 0.0025  -0.0103 44   CME A N   
359  C CA  . CME A 46  ? 0.0714 0.0880 0.0988 -0.0001 0.0001  -0.0141 44   CME A CA  
360  C CB  . CME A 46  ? 0.0887 0.1045 0.1365 -0.0175 -0.0040 -0.0133 44   CME A CB  
361  S SG  . CME A 46  ? 0.0905 0.1448 0.1713 0.0011  0.0047  -0.0293 44   CME A SG  
362  S SD  . CME A 46  ? 0.1752 0.2644 0.1866 0.0176  -0.0121 -0.0141 44   CME A SD  
363  C CE  . CME A 46  ? 0.0912 0.2787 0.2313 0.0422  -0.0046 -0.0396 44   CME A CE  
364  C CZ  . CME A 46  ? 0.1610 0.2614 0.1839 -0.0246 -0.0075 -0.0141 44   CME A CZ  
365  O OH  . CME A 46  ? 0.1777 0.3311 0.2308 -0.0549 -0.0211 0.0583  44   CME A OH  
366  C C   . CME A 46  ? 0.0854 0.1073 0.0866 0.0289  0.0066  0.0022  44   CME A C   
367  O O   . CME A 46  ? 0.0592 0.1168 0.1232 0.0186  0.0030  -0.0059 44   CME A O   
368  N N   . HIS A 47  ? 0.0703 0.0515 0.0896 -0.0018 0.0149  0.0101  45   HIS A N   
369  C CA  . HIS A 47  ? 0.1005 0.0947 0.0902 0.0202  0.0018  -0.0145 45   HIS A CA  
370  C C   . HIS A 47  ? 0.0905 0.1023 0.0812 0.0275  0.0105  0.0041  45   HIS A C   
371  O O   . HIS A 47  ? 0.1244 0.0976 0.1333 0.0179  0.0403  -0.0109 45   HIS A O   
372  C CB  . HIS A 47  ? 0.1041 0.0828 0.0949 0.0042  0.0168  0.0053  45   HIS A CB  
373  C CG  . HIS A 47  ? 0.0863 0.0941 0.0927 0.0067  0.0154  0.0075  45   HIS A CG  
374  N ND1 . HIS A 47  ? 0.1103 0.0995 0.1330 -0.0013 0.0489  -0.0096 45   HIS A ND1 
375  C CD2 . HIS A 47  ? 0.1298 0.0941 0.0944 0.0099  0.0206  -0.0016 45   HIS A CD2 
376  C CE1 . HIS A 47  ? 0.1146 0.1171 0.1006 -0.0058 0.0196  0.0117  45   HIS A CE1 
377  N NE2 . HIS A 47  ? 0.1368 0.1415 0.1102 0.0053  0.0284  -0.0136 45   HIS A NE2 
378  N N   . ILE A 48  ? 0.0929 0.0891 0.0854 0.0030  0.0095  -0.0031 46   ILE A N   
379  C CA  . ILE A 48  ? 0.1087 0.0865 0.0733 0.0200  0.0110  -0.0046 46   ILE A CA  
380  C C   . ILE A 48  ? 0.0882 0.0806 0.0862 0.0088  0.0057  -0.0017 46   ILE A C   
381  O O   . ILE A 48  ? 0.0805 0.0760 0.0953 0.0073  0.0013  -0.0029 46   ILE A O   
382  C CB  . ILE A 48  ? 0.0922 0.0918 0.1024 0.0020  0.0113  -0.0164 46   ILE A CB  
383  C CG1 . ILE A 48  ? 0.0871 0.0837 0.0968 -0.0069 0.0078  -0.0089 46   ILE A CG1 
384  C CG2 . ILE A 48  ? 0.1174 0.1149 0.0944 0.0110  0.0096  0.0121  46   ILE A CG2 
385  C CD1 . ILE A 48  ? 0.0661 0.0967 0.1304 -0.0206 0.0055  0.0043  46   ILE A CD1 
386  N N   A SER A 49  ? 0.0645 0.0808 0.1269 0.0087  0.0021  -0.0173 47   SER A N   
387  N N   B SER A 49  ? 0.0725 0.0868 0.1205 0.0042  0.0008  -0.0119 47   SER A N   
388  C CA  A SER A 49  ? 0.0845 0.0889 0.1271 0.0102  0.0086  -0.0018 47   SER A CA  
389  C CA  B SER A 49  ? 0.0911 0.0956 0.1228 0.0058  0.0007  0.0022  47   SER A CA  
390  C C   A SER A 49  ? 0.0905 0.1191 0.1521 0.0381  0.0069  0.0023  47   SER A C   
391  C C   B SER A 49  ? 0.1017 0.1207 0.1344 0.0135  0.0043  -0.0107 47   SER A C   
392  O O   A SER A 49  ? 0.1151 0.1874 0.1727 0.0781  0.0347  0.0599  47   SER A O   
393  O O   B SER A 49  ? 0.1189 0.1274 0.1736 0.0206  -0.0336 -0.0165 47   SER A O   
394  C CB  A SER A 49  ? 0.1229 0.1415 0.1155 0.0220  -0.0118 0.0082  47   SER A CB  
395  C CB  B SER A 49  ? 0.1052 0.1053 0.1014 0.0099  -0.0182 0.0213  47   SER A CB  
396  O OG  A SER A 49  ? 0.1756 0.1402 0.1264 0.0376  0.0055  0.0158  47   SER A OG  
397  O OG  B SER A 49  ? 0.1144 0.1627 0.0773 0.0292  -0.0089 0.0323  47   SER A OG  
398  N N   . ASP A 50  ? 0.1212 0.1270 0.1812 0.0239  0.0177  0.0170  48   ASP A N   
399  C CA  . ASP A 50  ? 0.1449 0.2248 0.3011 0.0450  0.0575  0.0348  48   ASP A CA  
400  C C   . ASP A 50  ? 0.1221 0.1368 0.2710 -0.0139 0.0264  0.0594  48   ASP A C   
401  O O   . ASP A 50  ? 0.2076 0.3216 0.2391 0.0421  0.0434  0.0300  48   ASP A O   
402  C CB  . ASP A 50  ? 0.2367 0.2904 0.2266 0.0425  0.0324  -0.0178 48   ASP A CB  
403  C CG  . ASP A 50  ? 0.2461 0.2963 0.2412 -0.0254 0.0091  -0.0228 48   ASP A CG  
404  O OD1 . ASP A 50  ? 0.1807 0.5241 0.4270 -0.0036 -0.0117 0.1083  48   ASP A OD1 
405  O OD2 . ASP A 50  ? 0.3715 0.3908 0.3091 -0.0085 0.0310  0.0139  48   ASP A OD2 
406  N N   . MET A 51  ? 0.1897 0.2248 0.2828 0.0127  0.0245  0.0882  49   MET A N   
407  C CA  . MET A 51  ? 0.1524 0.2835 0.2162 0.0697  -0.0206 0.0767  49   MET A CA  
408  C C   . MET A 51  ? 0.1582 0.2448 0.2528 0.0872  -0.0200 0.0443  49   MET A C   
409  O O   . MET A 51  ? 0.1987 0.2665 0.2940 0.1120  0.0586  0.0439  49   MET A O   
410  C CB  . MET A 51  ? 0.2312 0.2983 0.3078 0.0533  0.0501  0.0745  49   MET A CB  
411  C CG  . MET A 51  ? 0.2571 0.2715 0.3638 0.0653  -0.0409 -0.0411 49   MET A CG  
412  S SD  . MET A 51  ? 0.5714 0.5590 0.6501 0.0889  0.0216  0.1363  49   MET A SD  
413  C CE  . MET A 51  ? 0.5721 0.3548 0.4015 0.0679  0.0451  0.1375  49   MET A CE  
414  N N   . HIS A 52  ? 0.1790 0.1966 0.1595 0.0863  0.0339  0.0294  50   HIS A N   
415  C CA  . HIS A 52  ? 0.2126 0.2056 0.1077 0.0582  0.0413  0.0312  50   HIS A CA  
416  C C   . HIS A 52  ? 0.1465 0.1686 0.1039 0.0512  0.0375  0.0247  50   HIS A C   
417  O O   . HIS A 52  ? 0.2629 0.1902 0.1027 0.0560  0.0262  0.0241  50   HIS A O   
418  C CB  . HIS A 52  ? 0.2254 0.2394 0.1563 0.0890  0.0124  0.0032  50   HIS A CB  
419  C CG  . HIS A 52  ? 0.2843 0.2486 0.1594 0.1131  -0.0006 -0.0278 50   HIS A CG  
420  N ND1 . HIS A 52  ? 0.4507 0.2317 0.2282 0.0606  -0.0412 -0.0593 50   HIS A ND1 
421  C CD2 . HIS A 52  ? 0.1819 0.2302 0.1747 0.1035  -0.0234 -0.0188 50   HIS A CD2 
422  C CE1 . HIS A 52  ? 0.3320 0.2490 0.2539 0.0989  -0.1166 -0.0555 50   HIS A CE1 
423  N NE2 . HIS A 52  ? 0.1376 0.2286 0.1619 0.0412  -0.0198 -0.0339 50   HIS A NE2 
424  N N   . LEU A 53  ? 0.2556 0.1566 0.1023 0.0465  0.0301  0.0015  51   LEU A N   
425  C CA  . LEU A 53  ? 0.1896 0.1960 0.1320 0.0447  0.0014  0.0133  51   LEU A CA  
426  C C   . LEU A 53  ? 0.2238 0.1616 0.1359 0.0351  -0.0034 -0.0394 51   LEU A C   
427  O O   . LEU A 53  ? 0.3028 0.1505 0.1478 0.0262  -0.0530 -0.0140 51   LEU A O   
428  C CB  . LEU A 53  ? 0.1835 0.2502 0.2232 0.0521  -0.0090 -0.0020 51   LEU A CB  
429  C CG  . LEU A 53  ? 0.2607 0.2315 0.2549 0.0824  0.0858  0.0333  51   LEU A CG  
430  C CD1 . LEU A 53  ? 0.2051 0.3392 0.3287 0.0662  0.1589  0.0861  51   LEU A CD1 
431  C CD2 . LEU A 53  ? 0.2549 0.3099 0.3013 0.0360  0.1363  -0.0260 51   LEU A CD2 
432  N N   . HIS A 54  ? 0.1582 0.1462 0.1288 0.0355  -0.0120 -0.0164 52   HIS A N   
433  C CA  . HIS A 54  ? 0.1368 0.1708 0.1504 0.0212  -0.0448 -0.0260 52   HIS A CA  
434  C C   . HIS A 54  ? 0.1519 0.1304 0.1539 0.0282  -0.0322 -0.0126 52   HIS A C   
435  O O   . HIS A 54  ? 0.1148 0.1267 0.1235 0.0266  -0.0376 0.0116  52   HIS A O   
436  C CB  . HIS A 54  ? 0.1399 0.1557 0.1602 -0.0024 -0.0526 -0.0047 52   HIS A CB  
437  C CG  . HIS A 54  ? 0.1159 0.1422 0.2015 0.0127  -0.0695 0.0157  52   HIS A CG  
438  N ND1 . HIS A 54  ? 0.1800 0.1789 0.3063 -0.0056 -0.0780 -0.0123 52   HIS A ND1 
439  C CD2 . HIS A 54  ? 0.1654 0.1618 0.2438 0.0278  -0.0440 0.0079  52   HIS A CD2 
440  C CE1 . HIS A 54  ? 0.2120 0.1580 0.2740 0.0479  -0.0604 0.0456  52   HIS A CE1 
441  N NE2 . HIS A 54  ? 0.2113 0.1828 0.2767 0.0079  -0.0261 0.0504  52   HIS A NE2 
442  N N   . ASN A 55  ? 0.1182 0.1345 0.1886 0.0142  -0.0389 -0.0227 53   ASN A N   
443  C CA  . ASN A 55  ? 0.1844 0.1535 0.2019 0.0146  -0.0475 -0.0016 53   ASN A CA  
444  C C   . ASN A 55  ? 0.1478 0.1575 0.1656 0.0209  -0.0391 -0.0217 53   ASN A C   
445  O O   . ASN A 55  ? 0.1994 0.1280 0.1715 0.0364  -0.0596 -0.0073 53   ASN A O   
446  C CB  . ASN A 55  ? 0.1507 0.1638 0.2068 0.0295  -0.0447 -0.0089 53   ASN A CB  
447  C CG  . ASN A 55  ? 0.1411 0.1864 0.2089 0.0188  -0.0453 0.0018  53   ASN A CG  
448  O OD1 . ASN A 55  ? 0.2643 0.2693 0.3088 0.0816  -0.0100 -0.0406 53   ASN A OD1 
449  N ND2 . ASN A 55  ? 0.2083 0.2410 0.2252 -0.0200 -0.0525 0.0134  53   ASN A ND2 
450  N N   . GLY A 56  ? 0.1293 0.1211 0.1728 0.0346  -0.0355 -0.0117 54   GLY A N   
451  C CA  . GLY A 56  ? 0.1665 0.1742 0.2018 0.0116  0.0192  0.0106  54   GLY A CA  
452  C C   . GLY A 56  ? 0.1334 0.1707 0.1626 0.0267  -0.0172 0.0285  54   GLY A C   
453  O O   . GLY A 56  ? 0.1128 0.1842 0.2358 0.0367  0.0024  0.0406  54   GLY A O   
454  N N   . VAL A 57  ? 0.1223 0.1377 0.1580 0.0252  -0.0271 -0.0049 55   VAL A N   
455  C CA  . VAL A 57  ? 0.0942 0.1412 0.1416 0.0049  -0.0234 -0.0011 55   VAL A CA  
456  C C   . VAL A 57  ? 0.1051 0.1041 0.1119 0.0055  -0.0127 0.0105  55   VAL A C   
457  O O   . VAL A 57  ? 0.0830 0.1236 0.1253 0.0237  -0.0140 0.0071  55   VAL A O   
458  C CB  . VAL A 57  ? 0.0690 0.1461 0.1318 0.0204  -0.0279 -0.0338 55   VAL A CB  
459  C CG1 . VAL A 57  ? 0.1109 0.1635 0.1612 0.0178  -0.0670 -0.0108 55   VAL A CG1 
460  C CG2 . VAL A 57  ? 0.1094 0.1414 0.1318 0.0000  -0.0384 0.0255  55   VAL A CG2 
461  N N   . PRO A 58  ? 0.0932 0.1104 0.1219 0.0224  -0.0152 -0.0028 56   PRO A N   
462  C CA  . PRO A 58  ? 0.1055 0.1262 0.1203 0.0304  -0.0132 0.0107  56   PRO A CA  
463  C C   . PRO A 58  ? 0.1006 0.1006 0.0992 0.0398  0.0076  0.0030  56   PRO A C   
464  O O   . PRO A 58  ? 0.0836 0.1160 0.0855 0.0225  -0.0080 -0.0033 56   PRO A O   
465  C CB  . PRO A 58  ? 0.1310 0.1237 0.1661 0.0018  -0.0318 0.0000  56   PRO A CB  
466  C CG  . PRO A 58  ? 0.1230 0.1039 0.1700 0.0030  -0.0206 0.0069  56   PRO A CG  
467  C CD  . PRO A 58  ? 0.0944 0.1256 0.1684 0.0176  -0.0134 0.0034  56   PRO A CD  
468  N N   . ARG A 59  ? 0.0882 0.1064 0.1088 0.0142  0.0112  0.0192  57   ARG A N   
469  C CA  . ARG A 59  ? 0.0896 0.1007 0.0816 0.0167  0.0064  0.0036  57   ARG A CA  
470  C C   . ARG A 59  ? 0.0955 0.0813 0.0991 0.0184  -0.0044 -0.0006 57   ARG A C   
471  O O   . ARG A 59  ? 0.0985 0.0908 0.1136 0.0170  -0.0091 0.0175  57   ARG A O   
472  C CB  . ARG A 59  ? 0.1185 0.0905 0.0991 0.0279  0.0004  -0.0155 57   ARG A CB  
473  C CG  . ARG A 59  ? 0.1254 0.0824 0.1109 0.0279  -0.0350 -0.0036 57   ARG A CG  
474  C CD  . ARG A 59  ? 0.1398 0.0938 0.0904 0.0236  -0.0101 0.0011  57   ARG A CD  
475  N NE  . ARG A 59  ? 0.1480 0.1160 0.1291 0.0233  -0.0363 -0.0181 57   ARG A NE  
476  C CZ  . ARG A 59  ? 0.1803 0.1056 0.1216 0.0342  -0.0192 -0.0157 57   ARG A CZ  
477  N NH1 . ARG A 59  ? 0.1698 0.1575 0.1576 0.0616  -0.0031 -0.0346 57   ARG A NH1 
478  N NH2 . ARG A 59  ? 0.1940 0.1241 0.1308 0.0343  -0.0258 -0.0347 57   ARG A NH2 
479  N N   . TYR A 60  ? 0.0809 0.0859 0.0858 0.0170  -0.0058 0.0045  58   TYR A N   
480  C CA  . TYR A 60  ? 0.0754 0.1115 0.1149 0.0175  0.0100  -0.0018 58   TYR A CA  
481  C C   . TYR A 60  ? 0.0829 0.0928 0.1030 0.0125  0.0106  0.0124  58   TYR A C   
482  O O   . TYR A 60  ? 0.0768 0.1244 0.1041 0.0080  -0.0061 -0.0088 58   TYR A O   
483  C CB  . TYR A 60  ? 0.0789 0.0835 0.1528 -0.0006 -0.0051 0.0141  58   TYR A CB  
484  C CG  . TYR A 60  ? 0.0757 0.0693 0.1030 0.0381  0.0065  0.0151  58   TYR A CG  
485  C CD1 . TYR A 60  ? 0.0710 0.0646 0.0984 0.0358  -0.0011 -0.0015 58   TYR A CD1 
486  C CD2 . TYR A 60  ? 0.0847 0.0945 0.0901 0.0248  0.0083  0.0121  58   TYR A CD2 
487  C CE1 . TYR A 60  ? 0.0668 0.0828 0.0907 0.0339  0.0043  -0.0006 58   TYR A CE1 
488  C CE2 . TYR A 60  ? 0.0862 0.0712 0.0844 0.0474  0.0232  -0.0004 58   TYR A CE2 
489  C CZ  . TYR A 60  ? 0.0907 0.0909 0.0764 0.0241  0.0032  -0.0061 58   TYR A CZ  
490  O OH  . TYR A 60  ? 0.0875 0.0861 0.0697 0.0053  0.0082  -0.0008 58   TYR A OH  
491  N N   . ILE A 61  ? 0.0803 0.0879 0.1139 0.0071  0.0168  0.0128  59   ILE A N   
492  C CA  . ILE A 61  ? 0.0946 0.1043 0.1012 -0.0036 0.0034  0.0151  59   ILE A CA  
493  C C   . ILE A 61  ? 0.0554 0.1009 0.1185 -0.0113 0.0114  -0.0054 59   ILE A C   
494  O O   . ILE A 61  ? 0.0692 0.0871 0.1784 -0.0158 -0.0160 -0.0031 59   ILE A O   
495  C CB  . ILE A 61  ? 0.0915 0.1123 0.1096 -0.0055 0.0147  0.0152  59   ILE A CB  
496  C CG1 . ILE A 61  ? 0.1392 0.1279 0.1423 0.0158  0.0101  0.0050  59   ILE A CG1 
497  C CG2 . ILE A 61  ? 0.1721 0.1254 0.1542 -0.0030 0.0355  -0.0048 59   ILE A CG2 
498  C CD1 . ILE A 61  ? 0.2166 0.2679 0.1561 -0.0370 0.0115  0.0048  59   ILE A CD1 
499  N N   . VAL A 62  ? 0.0520 0.0922 0.1020 0.0021  0.0053  -0.0016 60   VAL A N   
500  C CA  . VAL A 62  ? 0.0560 0.0852 0.0919 0.0030  0.0101  0.0021  60   VAL A CA  
501  C C   . VAL A 62  ? 0.0559 0.0984 0.1028 -0.0042 -0.0052 -0.0051 60   VAL A C   
502  O O   . VAL A 62  ? 0.0591 0.1179 0.1026 0.0125  -0.0110 -0.0256 60   VAL A O   
503  C CB  . VAL A 62  ? 0.0649 0.1124 0.0796 -0.0052 0.0143  0.0017  60   VAL A CB  
504  C CG1 . VAL A 62  ? 0.1008 0.1129 0.1182 0.0011  0.0164  0.0176  60   VAL A CG1 
505  C CG2 . VAL A 62  ? 0.0830 0.1421 0.0759 0.0280  0.0004  -0.0045 60   VAL A CG2 
506  N N   . ASN A 63  ? 0.0610 0.1052 0.0744 -0.0063 -0.0013 0.0058  61   ASN A N   
507  C CA  . ASN A 63  ? 0.0506 0.1079 0.0853 0.0148  -0.0129 0.0004  61   ASN A CA  
508  C C   . ASN A 63  ? 0.0896 0.1058 0.0693 0.0139  -0.0080 -0.0078 61   ASN A C   
509  O O   . ASN A 63  ? 0.0837 0.0860 0.0799 -0.0039 -0.0056 -0.0160 61   ASN A O   
510  C CB  . ASN A 63  ? 0.0834 0.1056 0.0576 0.0109  0.0107  0.0070  61   ASN A CB  
511  C CG  . ASN A 63  ? 0.0929 0.1187 0.1046 -0.0061 -0.0139 0.0068  61   ASN A CG  
512  O OD1 . ASN A 63  ? 0.0991 0.1235 0.1469 -0.0149 -0.0143 0.0108  61   ASN A OD1 
513  N ND2 . ASN A 63  ? 0.0684 0.1024 0.0725 0.0070  0.0141  0.0230  61   ASN A ND2 
514  N N   . MET A 64  ? 0.0652 0.0969 0.0568 -0.0065 0.0189  0.0023  62   MET A N   
515  C CA  . MET A 64  ? 0.0745 0.0857 0.0771 -0.0152 0.0126  -0.0061 62   MET A CA  
516  C C   . MET A 64  ? 0.0578 0.0739 0.0797 0.0046  -0.0096 0.0117  62   MET A C   
517  O O   . MET A 64  ? 0.0447 0.1132 0.0767 -0.0254 -0.0021 0.0126  62   MET A O   
518  C CB  . MET A 64  ? 0.0587 0.0792 0.0862 0.0024  0.0033  -0.0015 62   MET A CB  
519  C CG  . MET A 64  ? 0.0657 0.0761 0.0897 0.0046  -0.0183 -0.0155 62   MET A CG  
520  S SD  . MET A 64  ? 0.0730 0.0873 0.0774 0.0094  -0.0047 -0.0046 62   MET A SD  
521  C CE  . MET A 64  ? 0.0804 0.0844 0.1011 0.0099  0.0268  0.0028  62   MET A CE  
522  N N   . TRP A 65  ? 0.0678 0.0825 0.0974 -0.0088 -0.0028 -0.0089 63   TRP A N   
523  C CA  . TRP A 65  ? 0.0842 0.0680 0.0826 -0.0095 -0.0035 0.0054  63   TRP A CA  
524  C C   . TRP A 65  ? 0.0890 0.0867 0.0984 -0.0146 -0.0144 0.0045  63   TRP A C   
525  O O   . TRP A 65  ? 0.0958 0.1059 0.0949 -0.0315 0.0029  -0.0135 63   TRP A O   
526  C CB  . TRP A 65  ? 0.0835 0.1167 0.0954 -0.0046 0.0114  0.0048  63   TRP A CB  
527  C CG  . TRP A 65  ? 0.0733 0.0580 0.0946 -0.0039 0.0027  -0.0173 63   TRP A CG  
528  C CD1 . TRP A 65  ? 0.0671 0.0788 0.0844 -0.0182 0.0026  -0.0007 63   TRP A CD1 
529  C CD2 . TRP A 65  ? 0.0693 0.0839 0.0735 0.0216  0.0057  -0.0214 63   TRP A CD2 
530  N NE1 . TRP A 65  ? 0.0672 0.0923 0.0947 0.0162  0.0135  0.0111  63   TRP A NE1 
531  C CE2 . TRP A 65  ? 0.0698 0.0801 0.0597 0.0216  0.0098  -0.0176 63   TRP A CE2 
532  C CE3 . TRP A 65  ? 0.0674 0.0786 0.0818 0.0245  0.0078  -0.0199 63   TRP A CE3 
533  C CZ2 . TRP A 65  ? 0.0856 0.1035 0.0951 0.0029  -0.0036 0.0106  63   TRP A CZ2 
534  C CZ3 . TRP A 65  ? 0.0786 0.0889 0.0902 -0.0150 0.0045  -0.0126 63   TRP A CZ3 
535  C CH2 . TRP A 65  ? 0.0944 0.0912 0.0866 -0.0089 -0.0064 -0.0245 63   TRP A CH2 
536  N N   . THR A 66  ? 0.1110 0.1209 0.0861 -0.0321 -0.0014 0.0001  64   THR A N   
537  C CA  . THR A 66  ? 0.1069 0.1410 0.0873 -0.0349 -0.0092 0.0001  64   THR A CA  
538  C C   . THR A 66  ? 0.1316 0.1184 0.0939 -0.0288 -0.0019 -0.0459 64   THR A C   
539  O O   . THR A 66  ? 0.1311 0.1401 0.1008 -0.0040 0.0139  0.0018  64   THR A O   
540  C CB  . THR A 66  ? 0.1367 0.1732 0.1305 -0.0373 0.0026  -0.0119 64   THR A CB  
541  O OG1 . THR A 66  ? 0.1229 0.1370 0.1028 -0.0280 -0.0202 0.0092  64   THR A OG1 
542  C CG2 . THR A 66  ? 0.1409 0.1746 0.0783 -0.0214 -0.0109 -0.0089 64   THR A CG2 
543  N N   . PRO A 67  ? 0.1297 0.1789 0.0876 -0.0430 -0.0077 -0.0170 65   PRO A N   
544  C CA  . PRO A 67  ? 0.1496 0.1489 0.1009 -0.0184 0.0100  -0.0067 65   PRO A CA  
545  C C   . PRO A 67  ? 0.1282 0.1710 0.0852 -0.0162 -0.0127 -0.0136 65   PRO A C   
546  O O   . PRO A 67  ? 0.1361 0.1722 0.1166 -0.0296 0.0198  0.0084  65   PRO A O   
547  C CB  . PRO A 67  ? 0.1986 0.2001 0.1411 -0.0794 0.0074  -0.0431 65   PRO A CB  
548  C CG  . PRO A 67  ? 0.1948 0.1717 0.1344 -0.0668 0.0066  -0.0195 65   PRO A CG  
549  C CD  . PRO A 67  ? 0.1522 0.1360 0.0994 -0.0604 -0.0339 -0.0078 65   PRO A CD  
550  N N   . PRO A 68  ? 0.1515 0.1616 0.1682 -0.0212 0.0181  0.0154  66   PRO A N   
551  C CA  . PRO A 68  ? 0.1602 0.1754 0.1857 -0.0294 -0.0109 0.0161  66   PRO A CA  
552  C C   . PRO A 68  ? 0.1138 0.1691 0.1401 -0.0118 0.0123  -0.0120 66   PRO A C   
553  O O   . PRO A 68  ? 0.1252 0.1783 0.1171 -0.0306 -0.0093 0.0092  66   PRO A O   
554  C CB  . PRO A 68  ? 0.1615 0.2745 0.2273 -0.0284 -0.0012 0.0459  66   PRO A CB  
555  C CG  . PRO A 68  ? 0.1676 0.2686 0.3514 -0.0188 0.0389  0.0366  66   PRO A CG  
556  C CD  . PRO A 68  ? 0.1527 0.1575 0.1641 -0.0124 0.0324  0.0566  66   PRO A CD  
557  N N   . GLU A 69  ? 0.1290 0.1676 0.1550 -0.0403 -0.0008 0.0140  67   GLU A N   
558  C CA  . GLU A 69  ? 0.1658 0.1537 0.1483 -0.0264 -0.0288 -0.0132 67   GLU A CA  
559  C C   . GLU A 69  ? 0.1070 0.1604 0.1356 -0.0451 -0.0289 0.0228  67   GLU A C   
560  O O   . GLU A 69  ? 0.1806 0.2002 0.1033 -0.0164 -0.0091 0.0337  67   GLU A O   
561  C CB  . GLU A 69  ? 0.1842 0.2034 0.1517 -0.0428 -0.0039 -0.0314 67   GLU A CB  
562  C CG  . GLU A 69  ? 0.1939 0.2372 0.1777 0.0031  0.0116  -0.0225 67   GLU A CG  
563  C CD  . GLU A 69  ? 0.2160 0.2552 0.2261 0.0431  -0.0053 -0.0084 67   GLU A CD  
564  O OE1 . GLU A 69  ? 0.2150 0.3155 0.2366 -0.0216 0.0550  -0.0018 67   GLU A OE1 
565  O OE2 . GLU A 69  ? 0.4361 0.3668 0.2924 0.0877  0.0468  -0.1103 67   GLU A OE2 
566  N N   . VAL A 70  ? 0.1439 0.1828 0.1181 -0.0337 0.0028  0.0001  68   VAL A N   
567  C CA  . VAL A 70  ? 0.1274 0.2077 0.1186 -0.0441 -0.0169 0.0010  68   VAL A CA  
568  C C   . VAL A 70  ? 0.1194 0.1530 0.1075 -0.0154 0.0273  0.0142  68   VAL A C   
569  O O   . VAL A 70  ? 0.0889 0.1752 0.1262 -0.0019 -0.0097 0.0119  68   VAL A O   
570  C CB  . VAL A 70  ? 0.1267 0.2016 0.1438 -0.0486 -0.0273 -0.0020 68   VAL A CB  
571  C CG1 . VAL A 70  ? 0.1649 0.3481 0.2137 0.0379  0.0115  0.0030  68   VAL A CG1 
572  C CG2 . VAL A 70  ? 0.1027 0.2135 0.1529 -0.0618 -0.0100 -0.0228 68   VAL A CG2 
573  N N   . ALA A 71  ? 0.1186 0.1770 0.1230 -0.0240 0.0042  0.0115  69   ALA A N   
574  C CA  . ALA A 71  ? 0.1198 0.1583 0.0977 -0.0231 0.0000  0.0155  69   ALA A CA  
575  C C   . ALA A 71  ? 0.1201 0.1486 0.0896 -0.0265 -0.0124 0.0152  69   ALA A C   
576  O O   . ALA A 71  ? 0.1201 0.1684 0.1077 -0.0395 -0.0214 0.0276  69   ALA A O   
577  C CB  . ALA A 71  ? 0.1267 0.1721 0.1008 -0.0598 -0.0401 0.0286  69   ALA A CB  
578  N N   . ASP A 72  ? 0.1087 0.1672 0.1133 -0.0368 0.0023  0.0074  70   ASP A N   
579  C CA  . ASP A 72  ? 0.1546 0.1502 0.1190 -0.0332 -0.0049 0.0277  70   ASP A CA  
580  C C   . ASP A 72  ? 0.1620 0.1392 0.0947 -0.0329 -0.0032 0.0162  70   ASP A C   
581  O O   . ASP A 72  ? 0.1808 0.1578 0.1224 -0.0340 0.0231  0.0430  70   ASP A O   
582  C CB  . ASP A 72  ? 0.1289 0.1690 0.1550 0.0082  -0.0111 0.0350  70   ASP A CB  
583  C CG  . ASP A 72  ? 0.1561 0.2195 0.2399 -0.0317 -0.0335 0.0249  70   ASP A CG  
584  O OD1 . ASP A 72  ? 0.2987 0.2049 0.2520 -0.0641 -0.0126 0.0144  70   ASP A OD1 
585  O OD2 . ASP A 72  ? 0.3935 0.3423 0.2772 -0.0990 0.1172  0.0097  70   ASP A OD2 
586  N N   . GLN A 73  ? 0.1479 0.1940 0.0974 0.0120  -0.0362 -0.0038 71   GLN A N   
587  C CA  . GLN A 73  ? 0.1651 0.1767 0.1544 0.0062  -0.0278 0.0389  71   GLN A CA  
588  C C   . GLN A 73  ? 0.1283 0.1851 0.1451 -0.0292 -0.0182 0.0248  71   GLN A C   
589  O O   . GLN A 73  ? 0.1714 0.2250 0.1690 -0.0197 -0.0855 -0.0014 71   GLN A O   
590  C CB  . GLN A 73  ? 0.1895 0.2179 0.1838 -0.0032 -0.0543 0.0281  71   GLN A CB  
591  C CG  . GLN A 73  ? 0.1785 0.2229 0.1797 -0.0079 0.0049  0.0462  71   GLN A CG  
592  C CD  . GLN A 73  ? 0.2162 0.2315 0.2314 -0.0298 -0.0248 -0.0273 71   GLN A CD  
593  O OE1 . GLN A 73  ? 0.2982 0.3312 0.2586 -0.0938 0.0293  0.0034  71   GLN A OE1 
594  N NE2 . GLN A 73  ? 0.2687 0.2526 0.2216 -0.0839 -0.0060 -0.0199 71   GLN A NE2 
595  N N   A GLU A 74  ? 0.1279 0.1674 0.1497 -0.0350 -0.0224 0.0206  72   GLU A N   
596  N N   B GLU A 74  ? 0.1348 0.1686 0.1485 -0.0358 -0.0192 0.0209  72   GLU A N   
597  C CA  A GLU A 74  ? 0.1292 0.1953 0.1351 -0.0062 -0.0083 0.0253  72   GLU A CA  
598  C CA  B GLU A 74  ? 0.1343 0.2030 0.1460 -0.0138 -0.0048 0.0171  72   GLU A CA  
599  C C   A GLU A 74  ? 0.1137 0.1765 0.1569 0.0054  0.0053  0.0045  72   GLU A C   
600  C C   B GLU A 74  ? 0.1160 0.1788 0.1527 0.0025  0.0050  0.0081  72   GLU A C   
601  O O   A GLU A 74  ? 0.1116 0.2005 0.1719 0.0092  -0.0225 -0.0061 72   GLU A O   
602  O O   B GLU A 74  ? 0.1107 0.1995 0.1724 0.0107  -0.0189 -0.0020 72   GLU A O   
603  C CB  A GLU A 74  ? 0.1831 0.1921 0.1309 -0.0031 0.0025  0.0242  72   GLU A CB  
604  C CB  B GLU A 74  ? 0.2031 0.2119 0.1554 -0.0373 0.0184  0.0200  72   GLU A CB  
605  C CG  A GLU A 74  ? 0.1075 0.1942 0.1110 0.0446  -0.0280 0.0128  72   GLU A CG  
606  C CG  B GLU A 74  ? 0.2456 0.2948 0.1832 -0.0456 0.0118  -0.0614 72   GLU A CG  
607  C CD  A GLU A 74  ? 0.1091 0.2444 0.2193 0.0289  0.0361  -0.0229 72   GLU A CD  
608  C CD  B GLU A 74  ? 0.2948 0.2010 0.1874 -0.0432 0.0313  0.0034  72   GLU A CD  
609  O OE1 A GLU A 74  ? 0.2470 0.2451 0.2296 -0.0247 -0.0104 -0.0705 72   GLU A OE1 
610  O OE1 B GLU A 74  ? 0.2154 0.4704 0.3691 -0.0482 -0.0258 -0.1015 72   GLU A OE1 
611  O OE2 A GLU A 74  ? 0.1279 0.2117 0.2885 0.0665  0.0258  0.0701  72   GLU A OE2 
612  O OE2 B GLU A 74  ? 0.2195 0.2261 0.3213 0.0605  -0.0293 -0.1257 72   GLU A OE2 
613  N N   . MET A 75  ? 0.1111 0.1815 0.1146 -0.0104 0.0095  0.0121  73   MET A N   
614  C CA  . MET A 75  ? 0.1121 0.1423 0.1173 -0.0091 0.0106  0.0276  73   MET A CA  
615  C C   . MET A 75  ? 0.0913 0.1432 0.1209 0.0254  0.0161  0.0161  73   MET A C   
616  O O   . MET A 75  ? 0.1128 0.1385 0.1151 0.0246  -0.0109 0.0211  73   MET A O   
617  C CB  . MET A 75  ? 0.1134 0.1307 0.0866 -0.0070 -0.0035 0.0080  73   MET A CB  
618  C CG  . MET A 75  ? 0.0953 0.1340 0.0907 -0.0086 -0.0059 0.0080  73   MET A CG  
619  S SD  . MET A 75  ? 0.0969 0.1812 0.1283 -0.0214 -0.0132 0.0312  73   MET A SD  
620  C CE  . MET A 75  ? 0.1220 0.1918 0.2177 -0.0287 -0.0002 -0.0156 73   MET A CE  
621  N N   . LYS A 76  ? 0.1448 0.1332 0.1300 -0.0038 0.0045  0.0030  74   LYS A N   
622  C CA  . LYS A 76  ? 0.1822 0.1774 0.1109 0.0147  0.0099  0.0192  74   LYS A CA  
623  C C   . LYS A 76  ? 0.1658 0.1850 0.1153 0.0012  0.0015  0.0235  74   LYS A C   
624  O O   . LYS A 76  ? 0.1898 0.1846 0.1225 0.0422  -0.0119 0.0375  74   LYS A O   
625  C CB  . LYS A 76  ? 0.2142 0.1789 0.1220 0.0101  -0.0267 0.0218  74   LYS A CB  
626  C CG  . LYS A 76  ? 0.2337 0.2548 0.1584 0.0125  0.0308  0.0423  74   LYS A CG  
627  C CD  . LYS A 76  ? 0.2898 0.2552 0.2541 -0.0069 0.0499  -0.0219 74   LYS A CD  
628  C CE  . LYS A 76  ? 0.2869 0.3410 0.2877 0.0087  0.0082  0.0230  74   LYS A CE  
629  N NZ  . LYS A 76  ? 0.4379 0.2995 0.5538 -0.1280 0.1315  -0.0161 74   LYS A NZ  
630  N N   . ARG A 77  ? 0.1390 0.2005 0.1208 0.0235  -0.0062 0.0218  75   ARG A N   
631  C CA  . ARG A 77  ? 0.1676 0.2233 0.1619 0.0461  -0.0140 0.0278  75   ARG A CA  
632  C C   . ARG A 77  ? 0.1715 0.1933 0.1710 0.0542  -0.0007 0.0074  75   ARG A C   
633  O O   . ARG A 77  ? 0.1883 0.2034 0.2534 0.0472  -0.0191 0.0022  75   ARG A O   
634  C CB  . ARG A 77  ? 0.2082 0.2841 0.1849 -0.0112 -0.0122 0.0066  75   ARG A CB  
635  C CG  . ARG A 77  ? 0.2613 0.3547 0.3811 0.0120  0.0809  0.0190  75   ARG A CG  
636  C CD  . ARG A 77  ? 0.3016 0.4831 0.4188 -0.0686 -0.0371 -0.0498 75   ARG A CD  
637  N NE  . ARG A 77  ? 0.3561 0.6324 0.4446 -0.0063 0.0611  0.0744  75   ARG A NE  
638  C CZ  . ARG A 77  ? 0.5012 0.6786 0.4714 0.0770  0.0638  0.0412  75   ARG A CZ  
639  N NH1 . ARG A 77  ? 0.5439 0.5050 0.3134 0.0265  -0.1944 -0.0434 75   ARG A NH1 
640  N NH2 . ARG A 77  ? 0.4286 0.5703 0.3142 0.3525  -0.1520 0.1012  75   ARG A NH2 
641  N N   . GLN A 78  ? 0.0988 0.1996 0.1954 0.0312  -0.0024 -0.0075 76   GLN A N   
642  C CA  . GLN A 78  ? 0.1337 0.1713 0.1655 0.0438  0.0062  0.0123  76   GLN A CA  
643  C C   . GLN A 78  ? 0.1293 0.1611 0.1628 0.0360  0.0026  0.0221  76   GLN A C   
644  O O   . GLN A 78  ? 0.1664 0.1780 0.1848 0.0534  0.0152  0.0114  76   GLN A O   
645  C CB  . GLN A 78  ? 0.1251 0.2573 0.1261 0.0236  -0.0260 0.0162  76   GLN A CB  
646  C CG  . GLN A 78  ? 0.1728 0.2769 0.1790 -0.0159 0.0151  -0.0412 76   GLN A CG  
647  C CD  . GLN A 78  ? 0.1759 0.2733 0.1378 -0.0026 -0.0097 -0.0367 76   GLN A CD  
648  O OE1 . GLN A 78  ? 0.2074 0.2435 0.1815 0.0331  0.0266  -0.0069 76   GLN A OE1 
649  N NE2 . GLN A 78  ? 0.2154 0.3477 0.3494 -0.0568 0.0172  0.0129  76   GLN A NE2 
650  N N   . ASN A 79  ? 0.0939 0.1808 0.1499 0.0266  -0.0117 0.0199  77   ASN A N   
651  C CA  . ASN A 79  ? 0.1094 0.1776 0.1543 0.0122  0.0032  0.0251  77   ASN A CA  
652  C C   . ASN A 79  ? 0.1609 0.1584 0.1597 0.0406  -0.0030 -0.0168 77   ASN A C   
653  O O   . ASN A 79  ? 0.1428 0.1475 0.1841 0.0030  0.0082  0.0274  77   ASN A O   
654  C CB  . ASN A 79  ? 0.2131 0.1908 0.1657 0.0470  -0.0166 0.0248  77   ASN A CB  
655  C CG  . ASN A 79  ? 0.1977 0.2257 0.2445 0.0198  -0.0127 0.0209  77   ASN A CG  
656  O OD1 . ASN A 79  ? 0.2849 0.3274 0.3000 -0.0352 0.1268  0.0200  77   ASN A OD1 
657  N ND2 . ASN A 79  ? 0.2880 0.2428 0.3261 -0.0124 0.0036  0.0354  77   ASN A ND2 
658  N N   . LEU A 80  ? 0.0968 0.1597 0.1611 0.0104  0.0210  -0.0080 78   LEU A N   
659  C CA  . LEU A 80  ? 0.1275 0.1720 0.1418 0.0092  0.0171  0.0149  78   LEU A CA  
660  C C   . LEU A 80  ? 0.0907 0.1063 0.1184 -0.0114 0.0147  0.0475  78   LEU A C   
661  O O   . LEU A 80  ? 0.0776 0.1414 0.1276 -0.0031 0.0063  0.0386  78   LEU A O   
662  C CB  . LEU A 80  ? 0.1087 0.1448 0.1741 -0.0098 0.0325  0.0197  78   LEU A CB  
663  C CG  . LEU A 80  ? 0.1111 0.1607 0.1684 0.0024  0.0327  0.0279  78   LEU A CG  
664  C CD1 . LEU A 80  ? 0.1843 0.2383 0.1523 0.0167  0.0403  0.0900  78   LEU A CD1 
665  C CD2 . LEU A 80  ? 0.1821 0.1665 0.2184 0.0130  -0.0078 -0.0193 78   LEU A CD2 
666  N N   . ILE A 81  ? 0.0862 0.1383 0.1517 0.0102  0.0413  0.0311  79   ILE A N   
667  C CA  . ILE A 81  ? 0.0575 0.1628 0.1376 -0.0032 0.0132  0.0102  79   ILE A CA  
668  C C   . ILE A 81  ? 0.0821 0.1027 0.0988 0.0123  0.0024  0.0096  79   ILE A C   
669  O O   . ILE A 81  ? 0.0517 0.1298 0.1402 -0.0127 -0.0072 0.0193  79   ILE A O   
670  C CB  . ILE A 81  ? 0.1084 0.1904 0.1267 -0.0034 -0.0099 0.0153  79   ILE A CB  
671  C CG1 . ILE A 81  ? 0.1400 0.1860 0.1822 0.0337  -0.0091 0.0027  79   ILE A CG1 
672  C CG2 . ILE A 81  ? 0.1321 0.1837 0.1989 -0.0328 0.0330  -0.0082 79   ILE A CG2 
673  C CD1 . ILE A 81  ? 0.1045 0.2400 0.1965 0.0218  -0.0188 0.0197  79   ILE A CD1 
674  N N   . PHE A 82  ? 0.0881 0.1090 0.1111 0.0021  0.0103  0.0182  80   PHE A N   
675  C CA  . PHE A 82  ? 0.0690 0.1245 0.1162 0.0053  0.0223  0.0146  80   PHE A CA  
676  C C   . PHE A 82  ? 0.0979 0.1038 0.1165 0.0035  0.0167  0.0043  80   PHE A C   
677  O O   . PHE A 82  ? 0.0706 0.1107 0.1325 -0.0004 -0.0004 0.0117  80   PHE A O   
678  C CB  . PHE A 82  ? 0.0896 0.1062 0.1006 0.0013  0.0123  0.0182  80   PHE A CB  
679  C CG  . PHE A 82  ? 0.0824 0.1109 0.1225 -0.0176 0.0351  0.0159  80   PHE A CG  
680  C CD1 . PHE A 82  ? 0.0940 0.0908 0.0847 -0.0056 0.0134  0.0063  80   PHE A CD1 
681  C CD2 . PHE A 82  ? 0.0830 0.1504 0.1242 -0.0018 -0.0006 0.0170  80   PHE A CD2 
682  C CE1 . PHE A 82  ? 0.0844 0.1365 0.1337 0.0085  0.0287  0.0070  80   PHE A CE1 
683  C CE2 . PHE A 82  ? 0.1236 0.2043 0.0856 -0.0042 0.0216  0.0040  80   PHE A CE2 
684  C CZ  . PHE A 82  ? 0.1162 0.1298 0.1164 -0.0136 0.0261  0.0264  80   PHE A CZ  
685  N N   . ALA A 83  ? 0.0963 0.1450 0.1179 0.0105  0.0165  0.0102  81   ALA A N   
686  C CA  . ALA A 83  ? 0.0700 0.1324 0.0956 0.0036  -0.0078 0.0091  81   ALA A CA  
687  C C   . ALA A 83  ? 0.0955 0.1103 0.1188 0.0140  0.0289  0.0123  81   ALA A C   
688  O O   . ALA A 83  ? 0.0938 0.1735 0.1647 0.0092  0.0330  0.0307  81   ALA A O   
689  C CB  . ALA A 83  ? 0.0671 0.1219 0.1226 0.0131  0.0125  0.0180  81   ALA A CB  
690  N N   . ARG A 84  ? 0.0625 0.1520 0.1192 -0.0189 0.0064  0.0195  82   ARG A N   
691  C CA  . ARG A 84  ? 0.0870 0.1500 0.1384 -0.0017 0.0218  0.0054  82   ARG A CA  
692  C C   . ARG A 84  ? 0.0953 0.1177 0.1385 0.0043  0.0260  -0.0049 82   ARG A C   
693  O O   . ARG A 84  ? 0.1063 0.1108 0.1541 0.0080  0.0051  0.0119  82   ARG A O   
694  C CB  . ARG A 84  ? 0.1608 0.1445 0.1348 -0.0246 0.0207  0.0095  82   ARG A CB  
695  C CG  . ARG A 84  ? 0.0919 0.1400 0.1343 -0.0194 0.0463  -0.0043 82   ARG A CG  
696  C CD  . ARG A 84  ? 0.0910 0.0963 0.1425 -0.0114 0.0273  0.0252  82   ARG A CD  
697  N NE  . ARG A 84  ? 0.0876 0.1230 0.1466 -0.0015 0.0208  0.0083  82   ARG A NE  
698  C CZ  . ARG A 84  ? 0.0976 0.1037 0.0888 -0.0001 0.0282  0.0197  82   ARG A CZ  
699  N NH1 . ARG A 84  ? 0.0926 0.1317 0.1415 0.0064  0.0176  -0.0001 82   ARG A NH1 
700  N NH2 . ARG A 84  ? 0.1063 0.1193 0.1670 0.0008  0.0304  -0.0098 82   ARG A NH2 
701  N N   . PRO A 85  ? 0.0631 0.1276 0.1810 0.0119  0.0350  0.0088  83   PRO A N   
702  C CA  . PRO A 85  ? 0.1100 0.1591 0.1895 0.0219  0.0626  -0.0142 83   PRO A CA  
703  C C   . PRO A 85  ? 0.0809 0.1104 0.1521 0.0016  -0.0015 0.0024  83   PRO A C   
704  O O   . PRO A 85  ? 0.1413 0.1811 0.1829 -0.0387 0.0026  -0.0369 83   PRO A O   
705  C CB  . PRO A 85  ? 0.1206 0.1435 0.2683 0.0411  0.0792  -0.0219 83   PRO A CB  
706  C CG  . PRO A 85  ? 0.1445 0.1791 0.2784 0.0202  0.0078  -0.0204 83   PRO A CG  
707  C CD  . PRO A 85  ? 0.0980 0.1728 0.1866 -0.0017 0.0315  0.0141  83   PRO A CD  
708  N N   . ASN A 86  ? 0.0763 0.1184 0.1599 -0.0062 0.0209  0.0100  84   ASN A N   
709  C CA  . ASN A 86  ? 0.0952 0.1153 0.1714 -0.0282 0.0363  -0.0221 84   ASN A CA  
710  C C   . ASN A 86  ? 0.1136 0.1209 0.1185 -0.0152 0.0336  -0.0096 84   ASN A C   
711  O O   . ASN A 86  ? 0.0965 0.1012 0.1604 -0.0020 0.0215  -0.0073 84   ASN A O   
712  C CB  . ASN A 86  ? 0.1816 0.1414 0.1947 0.0407  0.0320  0.0174  84   ASN A CB  
713  C CG  . ASN A 86  ? 0.1826 0.2006 0.1872 0.0084  0.0468  -0.0077 84   ASN A CG  
714  O OD1 . ASN A 86  ? 0.1761 0.2226 0.1610 0.0101  0.0190  0.0120  84   ASN A OD1 
715  N ND2 . ASN A 86  ? 0.2183 0.2026 0.2074 -0.0044 0.0683  0.0052  84   ASN A ND2 
716  N N   . VAL A 87  ? 0.1169 0.1055 0.1535 -0.0064 0.0388  -0.0261 85   VAL A N   
717  C CA  . VAL A 87  ? 0.0813 0.1311 0.1062 0.0052  0.0162  -0.0057 85   VAL A CA  
718  C C   . VAL A 87  ? 0.0572 0.1026 0.1106 -0.0131 0.0193  0.0025  85   VAL A C   
719  O O   . VAL A 87  ? 0.0891 0.1117 0.1181 0.0196  0.0055  0.0154  85   VAL A O   
720  C CB  . VAL A 87  ? 0.1157 0.1784 0.1394 0.0107  -0.0203 0.0037  85   VAL A CB  
721  C CG1 . VAL A 87  ? 0.1573 0.1945 0.1329 0.0143  0.0129  0.0000  85   VAL A CG1 
722  C CG2 . VAL A 87  ? 0.1739 0.1903 0.1208 -0.0499 0.0076  -0.0317 85   VAL A CG2 
723  N N   . PRO A 88  ? 0.0649 0.0995 0.1020 -0.0008 0.0137  0.0013  86   PRO A N   
724  C CA  . PRO A 88  ? 0.0431 0.1083 0.0866 0.0011  -0.0028 0.0026  86   PRO A CA  
725  C C   . PRO A 88  ? 0.0710 0.0928 0.0632 0.0007  0.0076  0.0000  86   PRO A C   
726  O O   . PRO A 88  ? 0.0679 0.1277 0.0829 -0.0200 0.0037  0.0126  86   PRO A O   
727  C CB  . PRO A 88  ? 0.0830 0.1122 0.0824 0.0007  -0.0024 0.0137  86   PRO A CB  
728  C CG  . PRO A 88  ? 0.1164 0.1091 0.0949 -0.0234 0.0144  0.0097  86   PRO A CG  
729  C CD  . PRO A 88  ? 0.1050 0.1026 0.1060 0.0121  0.0325  0.0080  86   PRO A CD  
730  N N   . ASP A 89  ? 0.0539 0.0742 0.0620 0.0045  -0.0081 0.0089  87   ASP A N   
731  C CA  . ASP A 89  ? 0.0654 0.0761 0.0859 -0.0019 -0.0038 0.0152  87   ASP A CA  
732  C C   . ASP A 89  ? 0.0573 0.0769 0.0410 -0.0043 -0.0061 0.0101  87   ASP A C   
733  O O   . ASP A 89  ? 0.0570 0.0926 0.0630 -0.0068 0.0040  0.0024  87   ASP A O   
734  C CB  . ASP A 89  ? 0.0590 0.1003 0.0709 0.0064  0.0163  -0.0009 87   ASP A CB  
735  C CG  . ASP A 89  ? 0.0829 0.0792 0.1021 0.0128  0.0048  0.0009  87   ASP A CG  
736  O OD1 . ASP A 89  ? 0.1145 0.1060 0.0947 0.0143  0.0041  -0.0161 87   ASP A OD1 
737  O OD2 . ASP A 89  ? 0.1040 0.1059 0.0777 0.0223  -0.0011 -0.0187 87   ASP A OD2 
738  N N   . LEU A 90  ? 0.0480 0.0816 0.0833 -0.0074 0.0028  0.0126  88   LEU A N   
739  C CA  . LEU A 90  ? 0.0433 0.0837 0.0759 -0.0074 0.0017  0.0120  88   LEU A CA  
740  C C   . LEU A 90  ? 0.0582 0.0796 0.0780 -0.0069 0.0053  0.0121  88   LEU A C   
741  O O   . LEU A 90  ? 0.0594 0.0880 0.0860 -0.0126 -0.0086 0.0118  88   LEU A O   
742  C CB  . LEU A 90  ? 0.0495 0.0882 0.0749 0.0131  -0.0089 0.0068  88   LEU A CB  
743  C CG  . LEU A 90  ? 0.0551 0.0755 0.0857 -0.0064 0.0142  -0.0050 88   LEU A CG  
744  C CD1 . LEU A 90  ? 0.0662 0.1068 0.1018 -0.0002 -0.0011 0.0153  88   LEU A CD1 
745  C CD2 . LEU A 90  ? 0.0715 0.1106 0.1046 -0.0002 0.0299  -0.0081 88   LEU A CD2 
746  N N   . LEU A 91  ? 0.0580 0.0815 0.0948 0.0015  0.0025  0.0021  89   LEU A N   
747  C CA  . LEU A 91  ? 0.0698 0.0876 0.0885 0.0090  0.0012  0.0061  89   LEU A CA  
748  C C   . LEU A 91  ? 0.0453 0.0983 0.0802 0.0069  -0.0222 0.0007  89   LEU A C   
749  O O   . LEU A 91  ? 0.0601 0.1025 0.1215 -0.0087 0.0049  -0.0190 89   LEU A O   
750  C CB  . LEU A 91  ? 0.0867 0.1018 0.0873 -0.0025 0.0051  0.0196  89   LEU A CB  
751  C CG  . LEU A 91  ? 0.0794 0.0948 0.0946 -0.0203 0.0031  0.0118  89   LEU A CG  
752  C CD1 . LEU A 91  ? 0.1220 0.1796 0.0994 -0.0044 -0.0041 0.0250  89   LEU A CD1 
753  C CD2 . LEU A 91  ? 0.0781 0.1162 0.1193 0.0094  0.0225  0.0271  89   LEU A CD2 
754  N N   . ASP A 92  ? 0.0817 0.0679 0.1129 -0.0129 0.0160  0.0033  90   ASP A N   
755  C CA  . ASP A 92  ? 0.0798 0.0843 0.0945 -0.0007 -0.0074 -0.0020 90   ASP A CA  
756  C C   . ASP A 92  ? 0.0917 0.0887 0.0847 0.0001  -0.0030 0.0009  90   ASP A C   
757  O O   . ASP A 92  ? 0.0929 0.1074 0.1125 -0.0063 0.0055  0.0029  90   ASP A O   
758  C CB  . ASP A 92  ? 0.0903 0.0965 0.1009 -0.0009 -0.0181 0.0005  90   ASP A CB  
759  C CG  . ASP A 92  ? 0.1170 0.1057 0.1223 0.0078  -0.0091 0.0043  90   ASP A CG  
760  O OD1 . ASP A 92  ? 0.1391 0.0787 0.1272 0.0183  -0.0244 -0.0005 90   ASP A OD1 
761  O OD2 . ASP A 92  ? 0.1615 0.1020 0.1152 0.0117  -0.0326 -0.0142 90   ASP A OD2 
762  N N   . LEU A 93  ? 0.0917 0.1032 0.1033 -0.0012 0.0030  0.0315  91   LEU A N   
763  C CA  . LEU A 93  ? 0.0984 0.0885 0.1341 0.0129  -0.0107 0.0219  91   LEU A CA  
764  C C   . LEU A 93  ? 0.1134 0.0902 0.1311 0.0246  0.0000  0.0183  91   LEU A C   
765  O O   . LEU A 93  ? 0.1672 0.0924 0.1469 0.0217  -0.0295 0.0195  91   LEU A O   
766  C CB  . LEU A 93  ? 0.1059 0.0907 0.0998 0.0171  -0.0220 0.0109  91   LEU A CB  
767  C CG  . LEU A 93  ? 0.1231 0.0895 0.1283 -0.0035 0.0162  0.0098  91   LEU A CG  
768  C CD1 . LEU A 93  ? 0.1153 0.1829 0.1344 0.0294  -0.0048 -0.0032 91   LEU A CD1 
769  C CD2 . LEU A 93  ? 0.1345 0.0875 0.1674 -0.0031 0.0261  -0.0163 91   LEU A CD2 
770  N N   . LYS A 94  ? 0.1237 0.0896 0.1343 0.0368  -0.0116 0.0159  92   LYS A N   
771  C CA  . LYS A 94  ? 0.1279 0.1074 0.1503 0.0326  0.0082  0.0107  92   LYS A CA  
772  C C   . LYS A 94  ? 0.1515 0.1316 0.1534 -0.0053 -0.0179 -0.0009 92   LYS A C   
773  O O   . LYS A 94  ? 0.1596 0.1112 0.2043 -0.0015 -0.0385 0.0046  92   LYS A O   
774  C CB  . LYS A 94  ? 0.1178 0.1112 0.1522 0.0204  -0.0270 0.0039  92   LYS A CB  
775  C CG  . LYS A 94  ? 0.1362 0.1359 0.1621 0.0322  -0.0165 -0.0297 92   LYS A CG  
776  C CD  . LYS A 94  ? 0.2240 0.2018 0.1817 0.0052  0.0296  -0.0295 92   LYS A CD  
777  C CE  . LYS A 94  ? 0.2899 0.2425 0.2697 -0.0107 -0.0417 -0.0616 92   LYS A CE  
778  N NZ  . LYS A 94  ? 0.4035 0.4297 0.2801 -0.0602 -0.0200 -0.0951 92   LYS A NZ  
779  N N   . GLU A 95  ? 0.1372 0.1157 0.1767 -0.0115 0.0050  -0.0051 93   GLU A N   
780  C CA  . GLU A 95  ? 0.1537 0.1096 0.1895 -0.0242 -0.0236 -0.0143 93   GLU A CA  
781  C C   . GLU A 95  ? 0.1480 0.1123 0.1930 -0.0088 -0.0085 -0.0154 93   GLU A C   
782  O O   . GLU A 95  ? 0.1342 0.1471 0.2290 0.0074  -0.0064 -0.0146 93   GLU A O   
783  C CB  . GLU A 95  ? 0.1579 0.1586 0.2127 -0.0139 -0.0331 0.0035  93   GLU A CB  
784  C CG  . GLU A 95  ? 0.1889 0.2037 0.1781 -0.0325 -0.0718 -0.0172 93   GLU A CG  
785  C CD  . GLU A 95  ? 0.2262 0.1799 0.2882 -0.0020 0.0241  0.0214  93   GLU A CD  
786  O OE1 . GLU A 95  ? 0.3346 0.2571 0.3167 -0.0873 0.0781  -0.0027 93   GLU A OE1 
787  O OE2 . GLU A 95  ? 0.2740 0.2199 0.3169 -0.0336 -0.0163 -0.0458 93   GLU A OE2 
788  N N   . ARG A 96  ? 0.0962 0.1039 0.1678 0.0079  0.0032  -0.0045 94   ARG A N   
789  C CA  . ARG A 96  ? 0.1132 0.1463 0.1499 -0.0198 -0.0055 0.0070  94   ARG A CA  
790  C C   . ARG A 96  ? 0.1118 0.1343 0.1630 -0.0019 0.0032  0.0004  94   ARG A C   
791  O O   . ARG A 96  ? 0.1276 0.1166 0.1789 -0.0088 0.0089  0.0301  94   ARG A O   
792  C CB  . ARG A 96  ? 0.1922 0.1361 0.2066 0.0100  -0.0013 0.0277  94   ARG A CB  
793  C CG  . ARG A 96  ? 0.2300 0.1940 0.2379 0.0302  0.0040  0.0463  94   ARG A CG  
794  C CD  . ARG A 96  ? 0.2173 0.1647 0.2731 0.0523  -0.0218 0.0169  94   ARG A CD  
795  N NE  . ARG A 96  ? 0.2748 0.2987 0.2748 0.0134  -0.0242 -0.0289 94   ARG A NE  
796  C CZ  . ARG A 96  ? 0.1744 0.2866 0.2671 0.0716  -0.0030 -0.0213 94   ARG A CZ  
797  N NH1 . ARG A 96  ? 0.1710 0.2078 0.3097 0.0564  0.0168  -0.0035 94   ARG A NH1 
798  N NH2 . ARG A 96  ? 0.1966 0.2192 0.2397 0.0298  0.0362  0.0284  94   ARG A NH2 
799  N N   . LYS A 97  ? 0.0876 0.1697 0.1620 0.0039  -0.0148 0.0176  95   LYS A N   
800  C CA  . LYS A 97  ? 0.1124 0.1177 0.1747 0.0038  -0.0048 0.0134  95   LYS A CA  
801  C C   . LYS A 97  ? 0.0745 0.1239 0.1129 0.0063  -0.0005 0.0023  95   LYS A C   
802  O O   . LYS A 97  ? 0.0823 0.1157 0.1415 -0.0074 0.0020  -0.0141 95   LYS A O   
803  C CB  . LYS A 97  ? 0.1574 0.1772 0.1747 0.0190  -0.0043 -0.0055 95   LYS A CB  
804  C CG  . LYS A 97  ? 0.2224 0.1888 0.2747 0.0255  -0.0349 -0.0208 95   LYS A CG  
805  C CD  . LYS A 97  ? 0.2043 0.1693 0.2969 0.0581  0.0223  -0.0242 95   LYS A CD  
806  C CE  . LYS A 97  ? 0.2550 0.2041 0.3000 0.0484  -0.0072 -0.0460 95   LYS A CE  
807  N NZ  . LYS A 97  ? 0.3658 0.2830 0.3496 -0.0600 -0.0198 -0.0453 95   LYS A NZ  
808  N N   . GLY A 98  ? 0.0875 0.0880 0.0846 0.0031  0.0008  0.0153  96   GLY A N   
809  C CA  . GLY A 98  ? 0.1073 0.0939 0.1034 0.0010  -0.0009 0.0141  96   GLY A CA  
810  C C   . GLY A 98  ? 0.0777 0.0859 0.0773 -0.0152 0.0070  0.0001  96   GLY A C   
811  O O   . GLY A 98  ? 0.0862 0.1231 0.0724 -0.0131 -0.0103 0.0118  96   GLY A O   
812  N N   . VAL A 99  ? 0.0799 0.0892 0.0723 -0.0173 0.0008  -0.0072 97   VAL A N   
813  C CA  . VAL A 99  ? 0.0624 0.0918 0.0811 -0.0022 0.0004  0.0062  97   VAL A CA  
814  C C   . VAL A 99  ? 0.0621 0.0866 0.0721 -0.0069 -0.0044 0.0166  97   VAL A C   
815  O O   . VAL A 99  ? 0.0675 0.0810 0.1163 -0.0027 -0.0047 0.0110  97   VAL A O   
816  C CB  . VAL A 99  ? 0.0684 0.0665 0.0813 -0.0034 0.0025  -0.0011 97   VAL A CB  
817  C CG1 . VAL A 99  ? 0.0816 0.1496 0.0736 -0.0147 0.0026  0.0046  97   VAL A CG1 
818  C CG2 . VAL A 99  ? 0.1002 0.0836 0.1326 0.0260  0.0035  -0.0179 97   VAL A CG2 
819  N N   . TYR A 100 ? 0.0548 0.0745 0.0681 -0.0073 -0.0016 -0.0013 98   TYR A N   
820  C CA  . TYR A 100 ? 0.0531 0.0886 0.0768 0.0128  -0.0106 -0.0045 98   TYR A CA  
821  C C   . TYR A 100 ? 0.0879 0.0887 0.0803 -0.0181 0.0014  0.0011  98   TYR A C   
822  O O   . TYR A 100 ? 0.1567 0.1093 0.0788 -0.0121 -0.0187 -0.0020 98   TYR A O   
823  C CB  . TYR A 100 ? 0.0631 0.1170 0.1295 0.0086  0.0206  0.0180  98   TYR A CB  
824  C CG  . TYR A 100 ? 0.0636 0.1326 0.0930 0.0327  -0.0072 -0.0144 98   TYR A CG  
825  C CD1 . TYR A 100 ? 0.1390 0.1315 0.1187 -0.0138 0.0230  -0.0274 98   TYR A CD1 
826  C CD2 . TYR A 100 ? 0.1099 0.1069 0.1186 0.0057  -0.0008 -0.0187 98   TYR A CD2 
827  C CE1 . TYR A 100 ? 0.1416 0.1446 0.1297 -0.0209 -0.0117 -0.0094 98   TYR A CE1 
828  C CE2 . TYR A 100 ? 0.0963 0.1474 0.1011 0.0448  -0.0006 -0.0078 98   TYR A CE2 
829  C CZ  . TYR A 100 ? 0.0930 0.1603 0.1015 0.0163  0.0137  -0.0091 98   TYR A CZ  
830  O OH  . TYR A 100 ? 0.1156 0.1774 0.1242 -0.0224 0.0402  0.0058  98   TYR A OH  
831  N N   . VAL A 101 ? 0.0678 0.0902 0.0533 -0.0075 -0.0049 -0.0054 99   VAL A N   
832  C CA  . VAL A 101 ? 0.0702 0.0996 0.0583 -0.0088 0.0107  -0.0076 99   VAL A CA  
833  C C   . VAL A 101 ? 0.0829 0.1163 0.0720 0.0087  0.0061  0.0005  99   VAL A C   
834  O O   . VAL A 101 ? 0.1162 0.1008 0.0810 0.0131  -0.0255 -0.0042 99   VAL A O   
835  C CB  . VAL A 101 ? 0.0711 0.0882 0.0831 -0.0164 0.0105  -0.0084 99   VAL A CB  
836  C CG1 . VAL A 101 ? 0.1052 0.1323 0.0817 -0.0315 0.0236  -0.0044 99   VAL A CG1 
837  C CG2 . VAL A 101 ? 0.0747 0.1211 0.1061 0.0066  0.0031  -0.0147 99   VAL A CG2 
838  N N   . LYS A 102 ? 0.0940 0.1266 0.0760 0.0055  0.0019  -0.0332 100  LYS A N   
839  C CA  . LYS A 102 ? 0.1335 0.1338 0.0973 0.0212  0.0004  -0.0106 100  LYS A CA  
840  C C   . LYS A 102 ? 0.1077 0.1309 0.0906 -0.0008 -0.0182 -0.0177 100  LYS A C   
841  O O   . LYS A 102 ? 0.1268 0.1234 0.0802 0.0052  -0.0133 0.0019  100  LYS A O   
842  C CB  . LYS A 102 ? 0.1047 0.2441 0.1483 0.0431  -0.0165 -0.0102 100  LYS A CB  
843  C CG  . LYS A 102 ? 0.2158 0.3335 0.2200 0.0104  0.0056  0.0503  100  LYS A CG  
844  C CD  . LYS A 102 ? 0.2436 0.3848 0.3609 -0.0311 0.0555  0.0172  100  LYS A CD  
845  C CE  . LYS A 102 ? 0.2301 0.2532 0.3722 0.0171  0.1011  -0.0130 100  LYS A CE  
846  N NZ  . LYS A 102 ? 0.2149 0.3354 0.2023 0.0188  0.0835  -0.0347 100  LYS A NZ  
847  N N   . VAL A 103 ? 0.1851 0.1192 0.0839 0.0392  -0.0142 -0.0180 101  VAL A N   
848  C CA  . VAL A 103 ? 0.1667 0.1341 0.1042 0.0384  -0.0368 -0.0105 101  VAL A CA  
849  C C   . VAL A 103 ? 0.1726 0.1713 0.1055 0.0653  -0.0299 -0.0176 101  VAL A C   
850  O O   . VAL A 103 ? 0.3120 0.1524 0.1694 0.1316  -0.0646 -0.0298 101  VAL A O   
851  C CB  . VAL A 103 ? 0.2069 0.1389 0.1870 0.0154  -0.0144 0.0228  101  VAL A CB  
852  C CG1 . VAL A 103 ? 0.2419 0.1757 0.1938 0.0633  -0.0471 0.0405  101  VAL A CG1 
853  C CG2 . VAL A 103 ? 0.1755 0.1861 0.2126 -0.0368 -0.0578 0.0210  101  VAL A CG2 
854  N N   . TYR A 104 ? 0.1704 0.1924 0.1221 0.0683  -0.0298 -0.0563 102  TYR A N   
855  C CA  . TYR A 104 ? 0.1711 0.2054 0.2059 0.1007  0.0106  -0.0272 102  TYR A CA  
856  C C   . TYR A 104 ? 0.2120 0.2379 0.1977 0.0952  -0.0637 -0.0260 102  TYR A C   
857  O O   . TYR A 104 ? 0.1673 0.1037 0.2242 0.0410  -0.0660 -0.0366 102  TYR A O   
858  C CB  . TYR A 104 ? 0.1460 0.3166 0.1804 0.0719  -0.0308 0.0000  102  TYR A CB  
859  C CG  . TYR A 104 ? 0.1262 0.2273 0.2093 0.0035  0.0166  -0.0735 102  TYR A CG  
860  C CD1 . TYR A 104 ? 0.1850 0.2343 0.1915 0.0183  -0.0169 -0.0802 102  TYR A CD1 
861  C CD2 . TYR A 104 ? 0.1301 0.3329 0.2736 0.0997  0.0099  -0.0021 102  TYR A CD2 
862  C CE1 . TYR A 104 ? 0.1456 0.2458 0.1947 -0.0076 -0.0542 -0.0913 102  TYR A CE1 
863  C CE2 . TYR A 104 ? 0.1895 0.3225 0.2512 0.0543  -0.0268 -0.0134 102  TYR A CE2 
864  C CZ  . TYR A 104 ? 0.1873 0.2331 0.1924 0.0459  0.0121  -0.0525 102  TYR A CZ  
865  O OH  . TYR A 104 ? 0.2398 0.2593 0.2788 0.0045  0.0013  -0.0179 102  TYR A OH  
866  N N   . PRO A 105 ? 0.2603 0.1893 0.3280 -0.0550 -0.0566 -0.0108 103  PRO A N   
867  C CA  . PRO A 105 ? 0.3351 0.2473 0.3025 -0.0161 -0.0379 -0.0448 103  PRO A CA  
868  C C   . PRO A 105 ? 0.3980 0.2952 0.3309 0.0877  -0.0923 -0.2152 103  PRO A C   
869  O O   . PRO A 105 ? 0.4811 0.3598 0.3321 -0.0607 -0.0711 0.0070  103  PRO A O   
870  C CB  . PRO A 105 ? 0.3455 0.3047 0.2588 0.0643  -0.0881 -0.0882 103  PRO A CB  
871  C CG  . PRO A 105 ? 0.3321 0.2185 0.3200 -0.0066 -0.2216 -0.0428 103  PRO A CG  
872  C CD  . PRO A 105 ? 0.2920 0.1950 0.3736 0.0168  -0.1254 -0.0723 103  PRO A CD  
873  N N   . ASP A 106 ? 0.2496 0.5082 0.3765 0.1179  -0.1833 -0.1569 104  ASP A N   
874  C CA  . ASP A 106 ? 0.4061 0.4256 0.3339 -0.0634 -0.0739 -0.0470 104  ASP A CA  
875  C C   . ASP A 106 ? 0.4275 0.2929 0.3953 -0.0025 -0.1053 -0.1830 104  ASP A C   
876  O O   . ASP A 106 ? 0.4556 0.6556 0.7307 -0.0089 0.1792  -0.0258 104  ASP A O   
877  C CB  . ASP A 106 ? 0.3089 0.3167 0.2936 -0.0164 -0.0952 -0.1002 104  ASP A CB  
878  C CG  . ASP A 106 ? 0.4396 0.3762 0.5392 -0.1102 -0.1625 -0.1255 104  ASP A CG  
879  O OD1 . ASP A 106 ? 0.7042 0.6814 0.4674 -0.0503 -0.2148 -0.1706 104  ASP A OD1 
880  O OD2 . ASP A 106 ? 0.3786 0.4005 0.2185 0.1388  -0.1289 -0.1391 104  ASP A OD2 
881  N N   . ASN A 107 ? 0.2302 0.3211 0.3048 -0.1146 0.0102  0.0937  105  ASN A N   
882  C CA  . ASN A 107 ? 0.2187 0.3305 0.4895 0.0041  -0.1178 -0.0400 105  ASN A CA  
883  C C   . ASN A 107 ? 0.3467 0.2514 0.6323 0.0556  0.0901  -0.0148 105  ASN A C   
884  O O   . ASN A 107 ? 0.2941 0.3176 0.6338 -0.0188 0.0566  -0.0813 105  ASN A O   
885  C CB  . ASN A 107 ? 0.4419 0.3681 0.5190 0.0569  -0.0557 0.0342  105  ASN A CB  
886  C CG  . ASN A 107 ? 0.5058 0.3309 0.5971 -0.0878 -0.0235 -0.0812 105  ASN A CG  
887  O OD1 . ASN A 107 ? 0.5938 0.3764 0.4651 -0.1631 0.1228  -0.1149 105  ASN A OD1 
888  N ND2 . ASN A 107 ? 0.6229 0.4072 0.3162 -0.0084 -0.0104 -0.0968 105  ASN A ND2 
889  N N   . GLY A 108 ? 0.1708 0.2677 0.2260 0.0182  0.0224  -0.0883 106  GLY A N   
890  C CA  . GLY A 108 ? 0.3246 0.2167 0.2616 0.0357  -0.0178 0.0318  106  GLY A CA  
891  C C   . GLY A 108 ? 0.2218 0.2572 0.2830 0.0404  -0.0881 -0.0156 106  GLY A C   
892  O O   . GLY A 108 ? 0.3185 0.1915 0.3020 0.0505  -0.1035 -0.0684 106  GLY A O   
893  N N   . THR A 109 ? 0.2551 0.2419 0.1458 0.0650  -0.0196 0.0118  107  THR A N   
894  C CA  . THR A 109 ? 0.1564 0.1994 0.1147 0.0637  -0.0228 -0.0156 107  THR A CA  
895  C C   . THR A 109 ? 0.1483 0.2366 0.1455 0.0335  -0.0169 -0.0042 107  THR A C   
896  O O   . THR A 109 ? 0.1477 0.2055 0.1429 0.0188  -0.0380 -0.0259 107  THR A O   
897  C CB  . THR A 109 ? 0.2174 0.2109 0.1414 0.0750  -0.0087 -0.0075 107  THR A CB  
898  O OG1 . THR A 109 ? 0.2409 0.2607 0.1555 0.0901  0.0070  -0.0258 107  THR A OG1 
899  C CG2 . THR A 109 ? 0.2995 0.2072 0.1061 0.1151  0.0242  -0.0193 107  THR A CG2 
900  N N   . PRO A 110 ? 0.1070 0.1506 0.1195 0.0251  0.0008  -0.0113 108  PRO A N   
901  C CA  . PRO A 110 ? 0.1265 0.1557 0.1132 0.0126  0.0008  -0.0209 108  PRO A CA  
902  C C   . PRO A 110 ? 0.1220 0.1577 0.1426 0.0093  -0.0049 -0.0398 108  PRO A C   
903  O O   . PRO A 110 ? 0.1154 0.1889 0.1572 0.0309  -0.0179 -0.0466 108  PRO A O   
904  C CB  . PRO A 110 ? 0.1490 0.1601 0.1496 0.0129  -0.0253 -0.0206 108  PRO A CB  
905  C CG  . PRO A 110 ? 0.1303 0.1879 0.1325 0.0399  -0.0028 -0.0156 108  PRO A CG  
906  C CD  . PRO A 110 ? 0.1220 0.1518 0.1372 0.0319  -0.0018 -0.0066 108  PRO A CD  
907  N N   . THR A 111 ? 0.1328 0.2336 0.1423 -0.0036 0.0210  -0.0345 109  THR A N   
908  C CA  . THR A 111 ? 0.1462 0.1902 0.1457 0.0280  0.0026  -0.0107 109  THR A CA  
909  C C   . THR A 111 ? 0.1382 0.2166 0.1074 -0.0213 0.0289  -0.0131 109  THR A C   
910  O O   . THR A 111 ? 0.1311 0.2326 0.1366 -0.0179 0.0011  -0.0325 109  THR A O   
911  C CB  . THR A 111 ? 0.1275 0.2461 0.1697 0.0083  -0.0233 -0.0297 109  THR A CB  
912  O OG1 . THR A 111 ? 0.2017 0.3009 0.2329 0.0260  0.0284  0.0629  109  THR A OG1 
913  C CG2 . THR A 111 ? 0.0967 0.2203 0.2079 0.0266  -0.0121 -0.0352 109  THR A CG2 
914  N N   . ASP A 112 ? 0.1029 0.2048 0.0968 0.0114  0.0075  -0.0286 110  ASP A N   
915  C CA  . ASP A 112 ? 0.1016 0.1870 0.1264 -0.0015 0.0257  -0.0135 110  ASP A CA  
916  C C   . ASP A 112 ? 0.0852 0.2221 0.1329 0.0030  0.0188  -0.0377 110  ASP A C   
917  O O   . ASP A 112 ? 0.1121 0.2259 0.1420 -0.0188 0.0228  -0.0337 110  ASP A O   
918  C CB  . ASP A 112 ? 0.0915 0.1874 0.1143 0.0002  0.0296  -0.0019 110  ASP A CB  
919  C CG  . ASP A 112 ? 0.0921 0.1615 0.0842 -0.0181 0.0168  -0.0083 110  ASP A CG  
920  O OD1 . ASP A 112 ? 0.0979 0.1725 0.0941 -0.0120 0.0163  -0.0104 110  ASP A OD1 
921  O OD2 . ASP A 112 ? 0.1081 0.1840 0.0819 -0.0288 0.0275  -0.0171 110  ASP A OD2 
922  N N   . TYR A 113 ? 0.1230 0.3153 0.1388 -0.0380 0.0168  -0.0602 111  TYR A N   
923  C CA  . TYR A 113 ? 0.1210 0.1718 0.1828 -0.0024 0.0278  0.0034  111  TYR A CA  
924  C C   . TYR A 113 ? 0.1411 0.2555 0.1892 0.0482  0.0109  0.0170  111  TYR A C   
925  O O   . TYR A 113 ? 0.1410 0.3759 0.2086 0.0430  -0.0080 0.0114  111  TYR A O   
926  C CB  . TYR A 113 ? 0.1214 0.2239 0.1346 0.0284  0.0400  -0.0466 111  TYR A CB  
927  C CG  . TYR A 113 ? 0.1627 0.2428 0.1140 0.0148  0.0467  -0.0382 111  TYR A CG  
928  C CD1 . TYR A 113 ? 0.1765 0.2246 0.1287 -0.0046 0.0258  -0.0103 111  TYR A CD1 
929  C CD2 . TYR A 113 ? 0.2145 0.2200 0.1404 0.0045  0.0498  -0.0284 111  TYR A CD2 
930  C CE1 . TYR A 113 ? 0.2223 0.1915 0.1730 0.0170  0.0198  0.0165  111  TYR A CE1 
931  C CE2 . TYR A 113 ? 0.1968 0.2835 0.1527 0.0183  0.0638  -0.0311 111  TYR A CE2 
932  C CZ  . TYR A 113 ? 0.2371 0.1964 0.1521 0.0087  0.0186  -0.0255 111  TYR A CZ  
933  O OH  . TYR A 113 ? 0.2479 0.2400 0.2110 0.0783  -0.0083 -0.0197 111  TYR A OH  
934  N N   . GLN A 114 ? 0.1714 0.3519 0.1967 0.0438  0.0507  0.0135  112  GLN A N   
935  C CA  . GLN A 114 ? 0.2081 0.3026 0.1796 0.0528  0.0214  -0.0181 112  GLN A CA  
936  C C   . GLN A 114 ? 0.1867 0.2073 0.2011 0.0185  0.0279  0.0369  112  GLN A C   
937  O O   . GLN A 114 ? 0.1883 0.2142 0.2057 0.0052  0.0213  0.0467  112  GLN A O   
938  C CB  . GLN A 114 ? 0.1551 0.3119 0.2998 0.0483  -0.0164 0.0311  112  GLN A CB  
939  C CG  . GLN A 114 ? 0.2084 0.2518 0.3006 -0.0159 0.0176  0.0350  112  GLN A CG  
940  C CD  . GLN A 114 ? 0.2763 0.2880 0.3564 0.0315  0.0837  0.0091  112  GLN A CD  
941  O OE1 . GLN A 114 ? 0.2915 0.3233 0.4091 0.0470  0.1549  -0.0279 112  GLN A OE1 
942  N NE2 . GLN A 114 ? 0.3474 0.3850 0.2001 -0.0520 0.0354  0.0603  112  GLN A NE2 
943  N N   . THR A 115 ? 0.1718 0.2720 0.1662 0.0514  0.0518  -0.0072 113  THR A N   
944  C CA  . THR A 115 ? 0.1479 0.2163 0.1775 0.0269  0.0357  0.0536  113  THR A CA  
945  C C   . THR A 115 ? 0.1224 0.2015 0.1313 0.0072  0.0187  0.0254  113  THR A C   
946  O O   . THR A 115 ? 0.1841 0.2026 0.2181 0.0208  -0.0309 -0.0006 113  THR A O   
947  C CB  . THR A 115 ? 0.1250 0.2427 0.2033 0.0146  0.0077  0.0499  113  THR A CB  
948  O OG1 . THR A 115 ? 0.1606 0.3281 0.2520 0.0649  0.0456  0.0320  113  THR A OG1 
949  C CG2 . THR A 115 ? 0.2616 0.3147 0.2300 0.0492  0.0507  0.0951  113  THR A CG2 
950  N N   . ALA A 116 ? 0.1604 0.1398 0.1374 0.0190  0.0151  0.0148  114  ALA A N   
951  C CA  . ALA A 116 ? 0.1036 0.1210 0.1630 -0.0111 0.0304  0.0079  114  ALA A CA  
952  C C   . ALA A 116 ? 0.0925 0.1528 0.1396 0.0049  0.0165  0.0229  114  ALA A C   
953  O O   . ALA A 116 ? 0.1170 0.1227 0.1046 -0.0054 0.0088  -0.0104 114  ALA A O   
954  C CB  . ALA A 116 ? 0.1383 0.1705 0.1274 0.0005  0.0359  0.0040  114  ALA A CB  
955  N N   . GLU A 117 ? 0.0683 0.1532 0.1687 -0.0051 0.0130  0.0118  115  GLU A N   
956  C CA  . GLU A 117 ? 0.1178 0.1726 0.2116 -0.0140 0.0292  -0.0082 115  GLU A CA  
957  C C   . GLU A 117 ? 0.1248 0.1749 0.1657 -0.0209 -0.0195 -0.0097 115  GLU A C   
958  O O   . GLU A 117 ? 0.1469 0.1726 0.1904 -0.0078 0.0001  -0.0214 115  GLU A O   
959  C CB  . GLU A 117 ? 0.1692 0.1849 0.3252 -0.0470 0.0226  0.0294  115  GLU A CB  
960  C CG  . GLU A 117 ? 0.2717 0.3013 0.3179 -0.0551 0.0196  -0.0171 115  GLU A CG  
961  C CD  . GLU A 117 ? 0.6663 0.3726 0.5068 -0.1242 0.0613  0.0244  115  GLU A CD  
962  O OE1 . GLU A 117 ? 0.6808 0.4200 0.6044 -0.2398 0.0966  -0.0332 115  GLU A OE1 
963  O OE2 . GLU A 117 ? 0.6846 0.5384 0.5249 -0.1623 -0.1148 0.0858  115  GLU A OE2 
964  N N   . ASN A 118 ? 0.0948 0.1240 0.1241 -0.0114 0.0211  0.0230  116  ASN A N   
965  C CA  . ASN A 118 ? 0.0935 0.0853 0.1359 -0.0078 0.0018  0.0213  116  ASN A CA  
966  C C   . ASN A 118 ? 0.0906 0.0826 0.1280 -0.0226 0.0035  0.0052  116  ASN A C   
967  O O   . ASN A 118 ? 0.0845 0.1218 0.1243 -0.0264 0.0065  0.0069  116  ASN A O   
968  C CB  . ASN A 118 ? 0.1300 0.1214 0.1377 -0.0124 0.0188  0.0394  116  ASN A CB  
969  C CG  . ASN A 118 ? 0.1422 0.1352 0.1534 -0.0100 0.0129  0.0422  116  ASN A CG  
970  O OD1 . ASN A 118 ? 0.1184 0.1448 0.1531 0.0182  0.0332  0.0208  116  ASN A OD1 
971  N ND2 . ASN A 118 ? 0.2001 0.1814 0.1408 -0.0503 -0.0112 0.0649  116  ASN A ND2 
972  N N   . GLU A 119 ? 0.0882 0.0818 0.1083 -0.0090 0.0142  -0.0013 117  GLU A N   
973  C CA  . GLU A 119 ? 0.0894 0.0809 0.0829 0.0066  0.0151  -0.0014 117  GLU A CA  
974  C C   . GLU A 119 ? 0.0731 0.0721 0.0903 -0.0021 0.0132  -0.0005 117  GLU A C   
975  O O   . GLU A 119 ? 0.1183 0.0983 0.1030 -0.0324 0.0159  -0.0173 117  GLU A O   
976  C CB  . GLU A 119 ? 0.0894 0.1169 0.1018 0.0112  0.0134  -0.0002 117  GLU A CB  
977  C CG  . GLU A 119 ? 0.0941 0.1116 0.1097 -0.0016 0.0353  0.0035  117  GLU A CG  
978  C CD  . GLU A 119 ? 0.0893 0.1085 0.1020 -0.0062 0.0282  -0.0087 117  GLU A CD  
979  O OE1 . GLU A 119 ? 0.1112 0.2045 0.0998 0.0193  0.0086  -0.0007 117  GLU A OE1 
980  O OE2 . GLU A 119 ? 0.1344 0.1262 0.1180 -0.0008 0.0485  -0.0031 117  GLU A OE2 
981  N N   . ILE A 120 ? 0.0901 0.0907 0.0907 -0.0136 0.0182  0.0033  118  ILE A N   
982  C CA  . ILE A 120 ? 0.1326 0.0917 0.0925 -0.0001 0.0329  -0.0149 118  ILE A CA  
983  C C   . ILE A 120 ? 0.0836 0.0942 0.0832 -0.0157 0.0082  0.0038  118  ILE A C   
984  O O   . ILE A 120 ? 0.0872 0.1161 0.1288 -0.0318 0.0094  -0.0208 118  ILE A O   
985  C CB  . ILE A 120 ? 0.1718 0.1535 0.1154 0.0459  0.0268  -0.0046 118  ILE A CB  
986  C CG1 . ILE A 120 ? 0.2454 0.1747 0.1797 0.0132  0.0345  -0.0036 118  ILE A CG1 
987  C CG2 . ILE A 120 ? 0.1511 0.1975 0.1503 0.0174  0.0413  0.0198  118  ILE A CG2 
988  C CD1 . ILE A 120 ? 0.1965 0.2460 0.2383 -0.0258 0.0455  -0.0155 118  ILE A CD1 
989  N N   . PHE A 121 ? 0.0713 0.1197 0.1094 -0.0201 -0.0095 -0.0077 119  PHE A N   
990  C CA  . PHE A 121 ? 0.0691 0.1309 0.1112 -0.0180 -0.0160 -0.0001 119  PHE A CA  
991  C C   . PHE A 121 ? 0.0872 0.1343 0.0998 -0.0211 -0.0202 -0.0100 119  PHE A C   
992  O O   . PHE A 121 ? 0.1176 0.1874 0.0809 -0.0662 -0.0032 -0.0002 119  PHE A O   
993  C CB  . PHE A 121 ? 0.0777 0.1948 0.1577 0.0027  -0.0325 -0.0032 119  PHE A CB  
994  C CG  . PHE A 121 ? 0.1112 0.2209 0.2131 0.0339  -0.0333 -0.0192 119  PHE A CG  
995  C CD1 . PHE A 121 ? 0.2510 0.2526 0.2331 0.0542  0.0373  0.0125  119  PHE A CD1 
996  C CD2 . PHE A 121 ? 0.2854 0.2476 0.2013 0.0697  0.0350  -0.0483 119  PHE A CD2 
997  C CE1 . PHE A 121 ? 0.2831 0.2643 0.2372 0.0420  0.0818  0.0087  119  PHE A CE1 
998  C CE2 . PHE A 121 ? 0.3061 0.2077 0.1950 0.0701  0.0353  -0.0412 119  PHE A CE2 
999  C CZ  . PHE A 121 ? 0.2815 0.2344 0.2289 0.0615  -0.0596 -0.0280 119  PHE A CZ  
1000 N N   . VAL A 122 ? 0.0774 0.0983 0.0804 -0.0048 -0.0054 -0.0041 120  VAL A N   
1001 C CA  . VAL A 122 ? 0.0877 0.0809 0.0934 -0.0271 -0.0027 -0.0058 120  VAL A CA  
1002 C C   . VAL A 122 ? 0.0907 0.0904 0.0771 -0.0213 -0.0078 -0.0070 120  VAL A C   
1003 O O   . VAL A 122 ? 0.1310 0.0925 0.0939 -0.0084 -0.0470 -0.0127 120  VAL A O   
1004 C CB  . VAL A 122 ? 0.0894 0.0922 0.0765 -0.0121 -0.0155 -0.0011 120  VAL A CB  
1005 C CG1 . VAL A 122 ? 0.1036 0.1202 0.0913 -0.0332 -0.0044 0.0084  120  VAL A CG1 
1006 C CG2 . VAL A 122 ? 0.1078 0.1374 0.0943 0.0314  -0.0010 0.0433  120  VAL A CG2 
1007 N N   A ARG A 123 ? 0.1084 0.0770 0.0557 -0.0097 0.0033  -0.0086 121  ARG A N   
1008 N N   B ARG A 123 ? 0.1081 0.0787 0.0598 -0.0094 0.0014  -0.0079 121  ARG A N   
1009 C CA  A ARG A 123 ? 0.0881 0.0938 0.0746 -0.0061 0.0052  -0.0042 121  ARG A CA  
1010 C CA  B ARG A 123 ? 0.0854 0.0915 0.0762 -0.0078 0.0045  -0.0048 121  ARG A CA  
1011 C C   A ARG A 123 ? 0.0712 0.0893 0.0691 0.0051  -0.0011 -0.0123 121  ARG A C   
1012 C C   B ARG A 123 ? 0.0807 0.0869 0.0719 0.0047  0.0020  -0.0102 121  ARG A C   
1013 O O   A ARG A 123 ? 0.1142 0.1144 0.0811 -0.0016 0.0038  -0.0326 121  ARG A O   
1014 O O   B ARG A 123 ? 0.1107 0.1079 0.0825 0.0006  0.0010  -0.0271 121  ARG A O   
1015 C CB  A ARG A 123 ? 0.0923 0.1203 0.0818 -0.0095 -0.0041 -0.0112 121  ARG A CB  
1016 C CB  B ARG A 123 ? 0.0843 0.1102 0.0770 -0.0072 0.0019  -0.0068 121  ARG A CB  
1017 C CG  A ARG A 123 ? 0.1071 0.1384 0.0999 -0.0044 0.0179  -0.0099 121  ARG A CG  
1018 C CG  B ARG A 123 ? 0.0912 0.0916 0.0974 -0.0196 0.0099  0.0042  121  ARG A CG  
1019 C CD  A ARG A 123 ? 0.1147 0.1476 0.1178 -0.0028 0.0000  -0.0285 121  ARG A CD  
1020 C CD  B ARG A 123 ? 0.0893 0.1082 0.1173 -0.0217 0.0104  -0.0085 121  ARG A CD  
1021 N NE  A ARG A 123 ? 0.0933 0.1629 0.1352 -0.0150 0.0181  -0.0130 121  ARG A NE  
1022 N NE  B ARG A 123 ? 0.0766 0.1249 0.1319 -0.0298 -0.0019 0.0065  121  ARG A NE  
1023 C CZ  A ARG A 123 ? 0.1025 0.1507 0.1081 -0.0230 -0.0086 -0.0163 121  ARG A CZ  
1024 C CZ  B ARG A 123 ? 0.0784 0.1331 0.1410 -0.0228 -0.0052 0.0090  121  ARG A CZ  
1025 N NH1 A ARG A 123 ? 0.1140 0.1972 0.1319 0.0051  0.0092  -0.0131 121  ARG A NH1 
1026 N NH1 B ARG A 123 ? 0.0891 0.1411 0.1211 -0.0420 -0.0045 -0.0253 121  ARG A NH1 
1027 N NH2 A ARG A 123 ? 0.1101 0.1317 0.1487 -0.0164 0.0219  0.0105  121  ARG A NH2 
1028 N NH2 B ARG A 123 ? 0.0751 0.2061 0.1272 -0.0138 0.0259  0.0253  121  ARG A NH2 
1029 N N   . VAL A 124 ? 0.1102 0.0823 0.0636 -0.0051 0.0169  -0.0237 122  VAL A N   
1030 C CA  . VAL A 124 ? 0.1008 0.1037 0.0614 0.0048  0.0011  0.0038  122  VAL A CA  
1031 C C   . VAL A 124 ? 0.0866 0.1137 0.0816 0.0195  -0.0244 -0.0100 122  VAL A C   
1032 O O   . VAL A 124 ? 0.1446 0.1193 0.0710 0.0361  -0.0177 -0.0092 122  VAL A O   
1033 C CB  . VAL A 124 ? 0.0996 0.0865 0.0696 0.0024  0.0276  0.0137  122  VAL A CB  
1034 C CG1 . VAL A 124 ? 0.1274 0.0903 0.1527 0.0352  0.0204  0.0075  122  VAL A CG1 
1035 C CG2 . VAL A 124 ? 0.0984 0.1227 0.1431 0.0365  -0.0125 -0.0351 122  VAL A CG2 
1036 N N   . SER A 125 ? 0.1563 0.1067 0.0820 0.0330  0.0071  -0.0117 123  SER A N   
1037 C CA  . SER A 125 ? 0.1353 0.0994 0.1022 0.0162  -0.0102 0.0091  123  SER A CA  
1038 C C   . SER A 125 ? 0.1456 0.1066 0.1297 0.0160  -0.0168 0.0061  123  SER A C   
1039 O O   . SER A 125 ? 0.1337 0.1235 0.1139 0.0145  -0.0249 0.0082  123  SER A O   
1040 C CB  . SER A 125 ? 0.1390 0.0973 0.1450 0.0339  -0.0261 0.0107  123  SER A CB  
1041 O OG  . SER A 125 ? 0.1425 0.1268 0.1248 0.0064  -0.0173 0.0226  123  SER A OG  
1042 N N   . LEU A 126 ? 0.1772 0.1041 0.1180 0.0278  -0.0285 -0.0059 124  LEU A N   
1043 C CA  . LEU A 126 ? 0.1800 0.1478 0.1459 0.0090  -0.0397 0.0278  124  LEU A CA  
1044 C C   . LEU A 126 ? 0.1442 0.1383 0.1362 0.0080  -0.0527 0.0408  124  LEU A C   
1045 O O   . LEU A 126 ? 0.1934 0.2297 0.1635 -0.0808 -0.0628 0.0612  124  LEU A O   
1046 C CB  . LEU A 126 ? 0.2945 0.1492 0.1405 0.0187  -0.0068 0.0236  124  LEU A CB  
1047 C CG  . LEU A 126 ? 0.3009 0.1857 0.1732 0.0236  -0.0240 0.0048  124  LEU A CG  
1048 C CD1 . LEU A 126 ? 0.3610 0.1702 0.2780 0.0362  -0.0335 -0.0545 124  LEU A CD1 
1049 C CD2 . LEU A 126 ? 0.2952 0.2291 0.2634 0.0358  -0.0548 -0.0029 124  LEU A CD2 
1050 N N   . SER A 127 ? 0.1545 0.0823 0.1085 -0.0135 -0.0217 0.0102  125  SER A N   
1051 C CA  . SER A 127 ? 0.1200 0.1099 0.1182 0.0028  -0.0148 0.0271  125  SER A CA  
1052 C C   . SER A 127 ? 0.0976 0.0983 0.1042 -0.0095 -0.0296 0.0161  125  SER A C   
1053 O O   . SER A 127 ? 0.1120 0.1259 0.1213 0.0018  -0.0164 0.0127  125  SER A O   
1054 C CB  . SER A 127 ? 0.1267 0.1115 0.1004 0.0422  -0.0036 -0.0048 125  SER A CB  
1055 O OG  . SER A 127 ? 0.1685 0.1630 0.1262 -0.0121 -0.0039 -0.0128 125  SER A OG  
1056 N N   . GLY A 128 ? 0.1423 0.1008 0.0897 -0.0168 -0.0211 0.0021  126  GLY A N   
1057 C CA  . GLY A 128 ? 0.1001 0.1207 0.0879 -0.0015 -0.0076 0.0107  126  GLY A CA  
1058 C C   . GLY A 128 ? 0.1266 0.1039 0.0856 -0.0065 -0.0046 0.0252  126  GLY A C   
1059 O O   . GLY A 128 ? 0.1370 0.1173 0.1091 0.0301  -0.0169 0.0189  126  GLY A O   
1060 N N   A GLN A 129 ? 0.1260 0.0978 0.0819 0.0152  -0.0070 -0.0143 127  GLN A N   
1061 N N   B GLN A 129 ? 0.1255 0.0975 0.0808 0.0125  -0.0097 -0.0109 127  GLN A N   
1062 C CA  A GLN A 129 ? 0.1469 0.1060 0.0926 -0.0037 -0.0146 0.0052  127  GLN A CA  
1063 C CA  B GLN A 129 ? 0.1302 0.1068 0.0874 0.0000  -0.0137 0.0048  127  GLN A CA  
1064 C C   A GLN A 129 ? 0.1204 0.0942 0.0649 0.0148  0.0176  -0.0160 127  GLN A C   
1065 C C   B GLN A 129 ? 0.1256 0.0941 0.0695 0.0141  0.0077  -0.0136 127  GLN A C   
1066 O O   A GLN A 129 ? 0.1742 0.0965 0.1028 0.0138  0.0003  -0.0335 127  GLN A O   
1067 O O   B GLN A 129 ? 0.1991 0.0890 0.0912 0.0155  -0.0113 -0.0227 127  GLN A O   
1068 C CB  A GLN A 129 ? 0.1380 0.1258 0.0914 0.0024  -0.0068 0.0024  127  GLN A CB  
1069 C CB  B GLN A 129 ? 0.1301 0.1148 0.0798 -0.0018 -0.0244 0.0033  127  GLN A CB  
1070 C CG  A GLN A 129 ? 0.1358 0.1273 0.1115 0.0145  0.0153  0.0298  127  GLN A CG  
1071 C CG  B GLN A 129 ? 0.0927 0.1273 0.0746 0.0284  0.0038  0.0046  127  GLN A CG  
1072 C CD  A GLN A 129 ? 0.1967 0.2010 0.1640 -0.0303 0.0040  -0.0143 127  GLN A CD  
1073 C CD  B GLN A 129 ? 0.0824 0.0828 0.0804 0.0180  -0.0087 -0.0043 127  GLN A CD  
1074 O OE1 A GLN A 129 ? 0.2095 0.3755 0.4083 -0.0406 -0.0273 -0.0381 127  GLN A OE1 
1075 O OE1 B GLN A 129 ? 0.1188 0.1199 0.0725 -0.0301 0.0054  -0.0013 127  GLN A OE1 
1076 N NE2 A GLN A 129 ? 0.1840 0.2002 0.1285 -0.0358 0.0136  0.0507  127  GLN A NE2 
1077 N NE2 B GLN A 129 ? 0.0689 0.0911 0.0669 0.0121  -0.0204 -0.0504 127  GLN A NE2 
1078 N N   . MET A 130 ? 0.1175 0.0985 0.0721 -0.0161 -0.0061 -0.0028 128  MET A N   
1079 C CA  . MET A 130 ? 0.0833 0.1123 0.0860 -0.0125 0.0028  0.0060  128  MET A CA  
1080 C C   . MET A 130 ? 0.0885 0.0971 0.0747 -0.0120 0.0022  0.0047  128  MET A C   
1081 O O   . MET A 130 ? 0.0917 0.1095 0.0860 -0.0098 -0.0099 -0.0010 128  MET A O   
1082 C CB  . MET A 130 ? 0.0958 0.1339 0.0933 0.0125  0.0162  0.0193  128  MET A CB  
1083 C CG  . MET A 130 ? 0.1102 0.1339 0.1096 0.0212  -0.0476 -0.0003 128  MET A CG  
1084 S SD  . MET A 130 ? 0.1184 0.1650 0.2554 0.0144  0.0046  0.0388  128  MET A SD  
1085 C CE  . MET A 130 ? 0.1496 0.2854 0.1343 0.0205  0.0309  0.0714  128  MET A CE  
1086 N N   . SER A 131 ? 0.0800 0.0941 0.0710 -0.0122 0.0051  -0.0141 129  SER A N   
1087 C CA  . SER A 131 ? 0.0778 0.1103 0.0716 -0.0135 -0.0078 -0.0050 129  SER A CA  
1088 C C   . SER A 131 ? 0.0752 0.1096 0.0773 -0.0139 0.0011  -0.0034 129  SER A C   
1089 O O   . SER A 131 ? 0.0845 0.0876 0.0897 -0.0038 -0.0020 -0.0115 129  SER A O   
1090 C CB  . SER A 131 ? 0.0587 0.1022 0.0977 0.0061  0.0126  -0.0094 129  SER A CB  
1091 O OG  . SER A 131 ? 0.0919 0.1350 0.0719 0.0025  0.0064  -0.0191 129  SER A OG  
1092 N N   . PRO A 132 ? 0.0792 0.0980 0.0842 -0.0133 0.0001  -0.0144 130  PRO A N   
1093 C CA  . PRO A 132 ? 0.0869 0.0995 0.1218 -0.0217 0.0040  -0.0052 130  PRO A CA  
1094 C C   . PRO A 132 ? 0.0855 0.1026 0.0828 -0.0193 0.0101  -0.0113 130  PRO A C   
1095 O O   . PRO A 132 ? 0.1075 0.1075 0.1324 -0.0133 0.0194  0.0116  130  PRO A O   
1096 C CB  . PRO A 132 ? 0.0966 0.1176 0.1299 -0.0320 0.0074  -0.0213 130  PRO A CB  
1097 C CG  . PRO A 132 ? 0.1213 0.1456 0.1254 -0.0204 0.0037  -0.0187 130  PRO A CG  
1098 C CD  . PRO A 132 ? 0.0901 0.1098 0.0809 0.0085  0.0092  0.0026  130  PRO A CD  
1099 N N   . ILE A 133 ? 0.1155 0.1349 0.1040 -0.0209 0.0289  -0.0201 131  ILE A N   
1100 C CA  . ILE A 133 ? 0.1094 0.1418 0.1539 -0.0136 0.0204  0.0265  131  ILE A CA  
1101 C C   . ILE A 133 ? 0.1073 0.0981 0.0981 0.0044  0.0014  -0.0015 131  ILE A C   
1102 O O   . ILE A 133 ? 0.1109 0.0810 0.1124 0.0003  0.0087  0.0038  131  ILE A O   
1103 C CB  . ILE A 133 ? 0.1435 0.2136 0.1286 -0.0128 0.0069  0.0223  131  ILE A CB  
1104 C CG1 . ILE A 133 ? 0.1337 0.2767 0.2174 -0.0214 0.0033  0.0383  131  ILE A CG1 
1105 C CG2 . ILE A 133 ? 0.1603 0.3040 0.1511 0.0072  -0.0019 0.0708  131  ILE A CG2 
1106 C CD1 . ILE A 133 ? 0.2357 0.2500 0.3692 -0.0628 0.0427  0.0478  131  ILE A CD1 
1107 N N   . THR A 134 ? 0.0814 0.0961 0.0551 -0.0086 0.0044  -0.0189 132  THR A N   
1108 C CA  . THR A 134 ? 0.0684 0.1087 0.0811 0.0029  0.0014  -0.0100 132  THR A CA  
1109 C C   . THR A 134 ? 0.0793 0.0900 0.0902 -0.0043 0.0077  -0.0123 132  THR A C   
1110 O O   . THR A 134 ? 0.0841 0.0850 0.1020 0.0147  0.0051  -0.0075 132  THR A O   
1111 C CB  . THR A 134 ? 0.0730 0.0965 0.0906 0.0060  0.0011  -0.0280 132  THR A CB  
1112 O OG1 . THR A 134 ? 0.0894 0.0904 0.0718 -0.0036 0.0092  -0.0146 132  THR A OG1 
1113 C CG2 . THR A 134 ? 0.0988 0.0626 0.0993 -0.0152 0.0082  -0.0005 132  THR A CG2 
1114 N N   . ARG A 135 ? 0.0834 0.0938 0.0768 0.0100  0.0049  -0.0032 133  ARG A N   
1115 C CA  . ARG A 135 ? 0.0964 0.1133 0.1321 0.0220  0.0337  -0.0113 133  ARG A CA  
1116 C C   . ARG A 135 ? 0.1061 0.1175 0.1190 0.0079  0.0095  0.0003  133  ARG A C   
1117 O O   . ARG A 135 ? 0.0915 0.1076 0.1630 0.0023  0.0090  -0.0138 133  ARG A O   
1118 C CB  . ARG A 135 ? 0.1905 0.1891 0.1110 0.0783  0.0528  -0.0250 133  ARG A CB  
1119 C CG  . ARG A 135 ? 0.1925 0.1937 0.1749 -0.0045 0.0466  -0.0057 133  ARG A CG  
1120 C CD  . ARG A 135 ? 0.1962 0.2454 0.1903 0.0322  0.0014  -0.0179 133  ARG A CD  
1121 N NE  . ARG A 135 ? 0.2273 0.2882 0.1419 -0.0115 0.0305  0.0513  133  ARG A NE  
1122 C CZ  . ARG A 135 ? 0.2208 0.1493 0.1606 -0.0083 0.0094  -0.0052 133  ARG A CZ  
1123 N NH1 . ARG A 135 ? 0.1595 0.1408 0.1378 -0.0268 -0.0561 0.0011  133  ARG A NH1 
1124 N NH2 . ARG A 135 ? 0.1369 0.1934 0.2507 0.0216  -0.0372 -0.0182 133  ARG A NH2 
1125 N N   . GLU A 136 ? 0.1146 0.0950 0.0835 -0.0032 0.0003  -0.0092 134  GLU A N   
1126 C CA  . GLU A 136 ? 0.1499 0.0855 0.1155 -0.0016 -0.0291 -0.0176 134  GLU A CA  
1127 C C   . GLU A 136 ? 0.1447 0.0915 0.0995 0.0041  -0.0138 0.0097  134  GLU A C   
1128 O O   . GLU A 136 ? 0.1763 0.1191 0.1345 0.0281  -0.0223 -0.0390 134  GLU A O   
1129 C CB  . GLU A 136 ? 0.2040 0.1217 0.1569 -0.0364 -0.0163 -0.0028 134  GLU A CB  
1130 C CG  . GLU A 136 ? 0.2719 0.1605 0.2543 -0.0041 -0.0477 0.0402  134  GLU A CG  
1131 C CD  . GLU A 136 ? 0.3633 0.2810 0.3610 0.0687  -0.0291 -0.0158 134  GLU A CD  
1132 O OE1 . GLU A 136 ? 0.4010 0.2856 0.3842 -0.0066 -0.0655 -0.0629 134  GLU A OE1 
1133 O OE2 . GLU A 136 ? 0.5071 0.3383 0.5888 0.1567  -0.0878 0.0103  134  GLU A OE2 
1134 N N   . TYR A 137 ? 0.0973 0.0831 0.1152 -0.0042 -0.0038 0.0007  135  TYR A N   
1135 C CA  . TYR A 137 ? 0.1075 0.0865 0.0993 -0.0149 0.0110  0.0289  135  TYR A CA  
1136 C C   . TYR A 137 ? 0.0941 0.0775 0.0813 0.0053  0.0168  0.0036  135  TYR A C   
1137 O O   . TYR A 137 ? 0.1066 0.0875 0.1048 0.0010  0.0013  0.0238  135  TYR A O   
1138 C CB  . TYR A 137 ? 0.0818 0.1008 0.0834 -0.0102 0.0051  0.0225  135  TYR A CB  
1139 C CG  . TYR A 137 ? 0.0857 0.1050 0.0799 -0.0014 0.0039  0.0063  135  TYR A CG  
1140 C CD1 . TYR A 137 ? 0.0799 0.0631 0.1046 0.0044  0.0042  -0.0078 135  TYR A CD1 
1141 C CD2 . TYR A 137 ? 0.0742 0.0964 0.0677 0.0136  0.0181  -0.0054 135  TYR A CD2 
1142 C CE1 . TYR A 137 ? 0.1017 0.0879 0.0858 0.0008  -0.0044 0.0139  135  TYR A CE1 
1143 C CE2 . TYR A 137 ? 0.0780 0.1011 0.0727 -0.0086 0.0123  0.0158  135  TYR A CE2 
1144 C CZ  . TYR A 137 ? 0.0851 0.0802 0.0751 0.0116  0.0023  -0.0034 135  TYR A CZ  
1145 O OH  . TYR A 137 ? 0.0851 0.0974 0.0804 0.0117  -0.0047 -0.0010 135  TYR A OH  
1146 N N   . LEU A 138 ? 0.0776 0.0748 0.0775 -0.0009 0.0051  0.0023  136  LEU A N   
1147 C CA  . LEU A 138 ? 0.0782 0.0792 0.0705 -0.0041 0.0105  0.0000  136  LEU A CA  
1148 C C   . LEU A 138 ? 0.0897 0.0907 0.0594 -0.0051 0.0105  0.0008  136  LEU A C   
1149 O O   . LEU A 138 ? 0.0976 0.1127 0.0798 0.0043  -0.0026 -0.0184 136  LEU A O   
1150 C CB  . LEU A 138 ? 0.0731 0.0797 0.0811 -0.0238 0.0098  -0.0062 136  LEU A CB  
1151 C CG  . LEU A 138 ? 0.1051 0.0696 0.1024 -0.0060 0.0331  0.0009  136  LEU A CG  
1152 C CD1 . LEU A 138 ? 0.1157 0.0628 0.1155 -0.0203 0.0327  0.0030  136  LEU A CD1 
1153 C CD2 . LEU A 138 ? 0.1090 0.0846 0.1188 -0.0023 0.0148  -0.0214 136  LEU A CD2 
1154 N N   . ASP A 139 ? 0.0941 0.0873 0.0619 0.0078  0.0105  0.0126  137  ASP A N   
1155 C CA  . ASP A 139 ? 0.1037 0.0717 0.0809 -0.0059 0.0069  -0.0043 137  ASP A CA  
1156 C C   . ASP A 139 ? 0.0865 0.0762 0.0669 0.0015  0.0026  0.0001  137  ASP A C   
1157 O O   . ASP A 139 ? 0.1006 0.0763 0.0894 0.0149  0.0062  0.0082  137  ASP A O   
1158 C CB  . ASP A 139 ? 0.1133 0.1138 0.1082 0.0128  0.0073  0.0151  137  ASP A CB  
1159 C CG  . ASP A 139 ? 0.1342 0.1382 0.1315 -0.0004 -0.0099 0.0053  137  ASP A CG  
1160 O OD1 . ASP A 139 ? 0.1603 0.1374 0.1434 -0.0001 -0.0191 -0.0130 137  ASP A OD1 
1161 O OD2 . ASP A 139 ? 0.1952 0.1681 0.1907 0.0198  -0.0404 0.0072  137  ASP A OD2 
1162 N N   . GLU A 140 ? 0.1200 0.0484 0.0859 0.0123  0.0106  -0.0011 138  GLU A N   
1163 C CA  . GLU A 140 ? 0.0864 0.0887 0.0883 0.0066  0.0187  0.0013  138  GLU A CA  
1164 C C   . GLU A 140 ? 0.0995 0.0908 0.0772 0.0080  0.0090  -0.0143 138  GLU A C   
1165 O O   . GLU A 140 ? 0.1085 0.0927 0.0828 0.0085  0.0202  -0.0018 138  GLU A O   
1166 C CB  . GLU A 140 ? 0.1024 0.1243 0.0723 0.0293  -0.0012 -0.0151 138  GLU A CB  
1167 C CG  . GLU A 140 ? 0.1030 0.1281 0.0744 0.0067  0.0164  -0.0145 138  GLU A CG  
1168 C CD  . GLU A 140 ? 0.0832 0.1025 0.0763 0.0199  0.0099  -0.0033 138  GLU A CD  
1169 O OE1 . GLU A 140 ? 0.2262 0.1168 0.1094 0.0440  0.0198  -0.0010 138  GLU A OE1 
1170 O OE2 . GLU A 140 ? 0.1446 0.1217 0.0752 0.0097  0.0173  -0.0108 138  GLU A OE2 
1171 N N   . VAL A 141 ? 0.1052 0.0808 0.0833 0.0239  0.0141  0.0000  139  VAL A N   
1172 C CA  . VAL A 141 ? 0.0933 0.1063 0.0954 0.0207  0.0118  -0.0071 139  VAL A CA  
1173 C C   . VAL A 141 ? 0.0597 0.0750 0.0848 -0.0070 -0.0016 -0.0010 139  VAL A C   
1174 O O   . VAL A 141 ? 0.0880 0.0808 0.0787 0.0055  0.0096  0.0092  139  VAL A O   
1175 C CB  . VAL A 141 ? 0.0861 0.1117 0.1631 0.0402  -0.0029 -0.0267 139  VAL A CB  
1176 C CG1 . VAL A 141 ? 0.1462 0.1326 0.1536 0.0031  -0.0098 -0.0186 139  VAL A CG1 
1177 C CG2 . VAL A 141 ? 0.1563 0.1206 0.2199 0.0596  0.0364  -0.0304 139  VAL A CG2 
1178 N N   . GLN A 142 ? 0.0838 0.0755 0.0895 0.0061  0.0139  -0.0020 140  GLN A N   
1179 C CA  . GLN A 142 ? 0.0924 0.0675 0.0695 0.0065  0.0123  0.0016  140  GLN A CA  
1180 C C   . GLN A 142 ? 0.0870 0.0687 0.0614 -0.0080 0.0019  -0.0003 140  GLN A C   
1181 O O   . GLN A 142 ? 0.0883 0.0656 0.0800 -0.0085 -0.0044 -0.0039 140  GLN A O   
1182 C CB  . GLN A 142 ? 0.0763 0.0822 0.0777 0.0194  0.0200  0.0078  140  GLN A CB  
1183 C CG  . GLN A 142 ? 0.0771 0.0796 0.0812 0.0084  -0.0040 -0.0204 140  GLN A CG  
1184 C CD  . GLN A 142 ? 0.0827 0.0609 0.0791 0.0239  0.0014  -0.0076 140  GLN A CD  
1185 O OE1 . GLN A 142 ? 0.0934 0.1052 0.0818 -0.0176 0.0056  0.0022  140  GLN A OE1 
1186 N NE2 . GLN A 142 ? 0.0743 0.0702 0.0689 0.0131  0.0085  0.0037  140  GLN A NE2 
1187 N N   . ARG A 143 ? 0.0871 0.0839 0.0520 0.0014  0.0020  -0.0153 141  ARG A N   
1188 C CA  . ARG A 143 ? 0.0639 0.0683 0.0858 0.0169  0.0112  -0.0176 141  ARG A CA  
1189 C C   . ARG A 143 ? 0.0872 0.0578 0.0916 -0.0064 -0.0127 -0.0309 141  ARG A C   
1190 O O   . ARG A 143 ? 0.1226 0.0772 0.0679 -0.0049 0.0022  0.0019  141  ARG A O   
1191 C CB  . ARG A 143 ? 0.0938 0.0586 0.0840 0.0054  0.0180  -0.0065 141  ARG A CB  
1192 C CG  . ARG A 143 ? 0.0917 0.0776 0.0817 0.0026  0.0027  0.0186  141  ARG A CG  
1193 C CD  . ARG A 143 ? 0.0884 0.0748 0.0778 -0.0033 0.0094  0.0075  141  ARG A CD  
1194 N NE  . ARG A 143 ? 0.0914 0.0901 0.0644 -0.0050 0.0139  0.0023  141  ARG A NE  
1195 C CZ  . ARG A 143 ? 0.0875 0.0888 0.0630 -0.0062 0.0162  0.0022  141  ARG A CZ  
1196 N NH1 . ARG A 143 ? 0.1241 0.0793 0.0665 0.0010  0.0074  0.0010  141  ARG A NH1 
1197 N NH2 . ARG A 143 ? 0.1110 0.0892 0.0785 0.0126  0.0175  -0.0059 141  ARG A NH2 
1198 N N   . GLN A 144 ? 0.1079 0.0767 0.0661 -0.0190 0.0236  -0.0132 142  GLN A N   
1199 C CA  . GLN A 144 ? 0.1140 0.0969 0.0852 -0.0218 0.0105  0.0030  142  GLN A CA  
1200 C C   . GLN A 144 ? 0.1062 0.0810 0.0703 -0.0090 0.0291  0.0052  142  GLN A C   
1201 O O   . GLN A 144 ? 0.1683 0.0717 0.0744 -0.0079 0.0135  0.0045  142  GLN A O   
1202 C CB  . GLN A 144 ? 0.1046 0.1213 0.0772 -0.0169 0.0008  -0.0033 142  GLN A CB  
1203 C CG  . GLN A 144 ? 0.1363 0.1160 0.1085 -0.0102 0.0058  -0.0288 142  GLN A CG  
1204 C CD  . GLN A 144 ? 0.2038 0.1902 0.1371 -0.0006 0.0262  0.0091  142  GLN A CD  
1205 O OE1 . GLN A 144 ? 0.2054 0.2902 0.1704 -0.0137 0.0680  -0.0261 142  GLN A OE1 
1206 N NE2 . GLN A 144 ? 0.1636 0.2164 0.1166 -0.0214 0.0261  0.0187  142  GLN A NE2 
1207 N N   . ASP A 145 ? 0.1211 0.0775 0.0939 -0.0217 0.0106  0.0030  143  ASP A N   
1208 C CA  . ASP A 145 ? 0.0993 0.0843 0.0817 -0.0137 0.0214  0.0000  143  ASP A CA  
1209 C C   . ASP A 145 ? 0.1197 0.0746 0.0701 -0.0074 0.0069  -0.0033 143  ASP A C   
1210 O O   . ASP A 145 ? 0.1105 0.0783 0.0911 -0.0164 -0.0083 0.0141  143  ASP A O   
1211 C CB  . ASP A 145 ? 0.0923 0.0957 0.0803 -0.0214 0.0148  -0.0032 143  ASP A CB  
1212 C CG  . ASP A 145 ? 0.1123 0.1085 0.1303 0.0027  0.0106  0.0078  143  ASP A CG  
1213 O OD1 . ASP A 145 ? 0.1489 0.2176 0.1692 -0.0116 0.0589  -0.0067 143  ASP A OD1 
1214 O OD2 . ASP A 145 ? 0.1116 0.1348 0.1361 0.0255  0.0125  -0.0132 143  ASP A OD2 
1215 N N   . VAL A 146 ? 0.1010 0.0786 0.0678 0.0058  0.0073  0.0010  144  VAL A N   
1216 C CA  . VAL A 146 ? 0.0733 0.0767 0.0689 -0.0069 -0.0107 -0.0065 144  VAL A CA  
1217 C C   . VAL A 146 ? 0.1168 0.0764 0.0758 0.0196  -0.0042 -0.0008 144  VAL A C   
1218 O O   . VAL A 146 ? 0.1335 0.0679 0.1012 0.0053  -0.0049 0.0052  144  VAL A O   
1219 C CB  . VAL A 146 ? 0.0820 0.0895 0.0722 -0.0148 -0.0130 -0.0038 144  VAL A CB  
1220 C CG1 . VAL A 146 ? 0.1059 0.1016 0.0963 0.0124  0.0035  0.0179  144  VAL A CG1 
1221 C CG2 . VAL A 146 ? 0.0924 0.0751 0.0695 0.0008  -0.0057 0.0008  144  VAL A CG2 
1222 N N   . THR A 147 ? 0.1170 0.0839 0.0857 0.0002  -0.0005 -0.0089 145  THR A N   
1223 C CA  . THR A 147 ? 0.1392 0.1142 0.1224 -0.0003 -0.0119 0.0273  145  THR A CA  
1224 C C   . THR A 147 ? 0.1468 0.0871 0.0820 0.0114  -0.0006 -0.0088 145  THR A C   
1225 O O   . THR A 147 ? 0.2203 0.0966 0.1026 0.0273  -0.0300 0.0011  145  THR A O   
1226 C CB  . THR A 147 ? 0.1705 0.1266 0.1413 0.0116  -0.0462 0.0281  145  THR A CB  
1227 O OG1 . THR A 147 ? 0.2419 0.2095 0.1614 -0.0034 -0.0434 -0.0314 145  THR A OG1 
1228 C CG2 . THR A 147 ? 0.1384 0.1325 0.1048 -0.0048 -0.0221 -0.0259 145  THR A CG2 
1229 N N   A ASN A 148 ? 0.1601 0.0966 0.0805 -0.0047 0.0216  -0.0086 146  ASN A N   
1230 N N   B ASN A 148 ? 0.1530 0.0880 0.0807 -0.0034 0.0186  -0.0024 146  ASN A N   
1231 C CA  A ASN A 148 ? 0.1746 0.0964 0.0961 -0.0219 0.0092  -0.0067 146  ASN A CA  
1232 C CA  B ASN A 148 ? 0.1523 0.0923 0.0971 -0.0149 0.0110  -0.0058 146  ASN A CA  
1233 C C   A ASN A 148 ? 0.1706 0.0874 0.0842 -0.0184 0.0166  0.0064  146  ASN A C   
1234 C C   B ASN A 148 ? 0.1657 0.0825 0.0838 -0.0139 0.0127  0.0074  146  ASN A C   
1235 O O   A ASN A 148 ? 0.1696 0.0710 0.0753 -0.0037 -0.0195 0.0015  146  ASN A O   
1236 O O   B ASN A 148 ? 0.1772 0.0709 0.0740 -0.0008 -0.0181 0.0019  146  ASN A O   
1237 C CB  A ASN A 148 ? 0.1608 0.1238 0.1259 -0.0160 0.0509  0.0449  146  ASN A CB  
1238 C CB  B ASN A 148 ? 0.1419 0.0982 0.1285 -0.0121 0.0263  0.0243  146  ASN A CB  
1239 C CG  A ASN A 148 ? 0.2283 0.1893 0.1392 -0.0166 0.0214  0.0134  146  ASN A CG  
1240 C CG  B ASN A 148 ? 0.1067 0.1521 0.1066 -0.0295 0.0188  -0.0072 146  ASN A CG  
1241 O OD1 A ASN A 148 ? 0.2064 0.3092 0.2224 -0.0274 0.0400  -0.1371 146  ASN A OD1 
1242 O OD1 B ASN A 148 ? 0.1140 0.2116 0.1101 -0.0752 -0.0180 0.0458  146  ASN A OD1 
1243 N ND2 A ASN A 148 ? 0.2433 0.2433 0.1680 -0.0083 0.0268  0.0817  146  ASN A ND2 
1244 N ND2 B ASN A 148 ? 0.1295 0.0737 0.1645 -0.0708 0.0504  -0.0302 146  ASN A ND2 
1245 N N   . PHE A 149 ? 0.1487 0.0619 0.0819 0.0081  0.0170  -0.0046 147  PHE A N   
1246 C CA  . PHE A 149 ? 0.1271 0.0819 0.0598 0.0053  0.0154  -0.0131 147  PHE A CA  
1247 C C   . PHE A 149 ? 0.1160 0.0809 0.0806 -0.0113 -0.0005 0.0066  147  PHE A C   
1248 O O   . PHE A 149 ? 0.1588 0.0754 0.0916 -0.0019 -0.0056 0.0170  147  PHE A O   
1249 C CB  . PHE A 149 ? 0.1382 0.0922 0.0614 0.0073  0.0091  -0.0109 147  PHE A CB  
1250 C CG  . PHE A 149 ? 0.0855 0.0877 0.0729 -0.0008 -0.0023 -0.0182 147  PHE A CG  
1251 C CD1 . PHE A 149 ? 0.1092 0.0952 0.0799 -0.0001 0.0149  -0.0091 147  PHE A CD1 
1252 C CD2 . PHE A 149 ? 0.1141 0.0793 0.0909 -0.0224 0.0177  0.0140  147  PHE A CD2 
1253 C CE1 . PHE A 149 ? 0.1185 0.0644 0.0905 -0.0125 0.0111  -0.0097 147  PHE A CE1 
1254 C CE2 . PHE A 149 ? 0.0900 0.1096 0.0809 -0.0059 -0.0013 -0.0175 147  PHE A CE2 
1255 C CZ  . PHE A 149 ? 0.0994 0.0826 0.0500 0.0142  -0.0096 -0.0089 147  PHE A CZ  
1256 N N   . LEU A 150 ? 0.1123 0.0830 0.0684 -0.0102 -0.0135 0.0042  148  LEU A N   
1257 C CA  . LEU A 150 ? 0.1169 0.0925 0.1163 0.0002  0.0001  0.0094  148  LEU A CA  
1258 C C   . LEU A 150 ? 0.1600 0.1061 0.1054 0.0088  -0.0431 -0.0077 148  LEU A C   
1259 O O   . LEU A 150 ? 0.1619 0.0885 0.1481 -0.0170 -0.0518 0.0074  148  LEU A O   
1260 C CB  . LEU A 150 ? 0.0955 0.0853 0.1079 0.0062  -0.0309 0.0023  148  LEU A CB  
1261 C CG  . LEU A 150 ? 0.0961 0.0836 0.1077 0.0171  -0.0070 -0.0003 148  LEU A CG  
1262 C CD1 . LEU A 150 ? 0.1088 0.0953 0.1336 -0.0016 -0.0035 -0.0161 148  LEU A CD1 
1263 C CD2 . LEU A 150 ? 0.1658 0.0871 0.1070 0.0175  -0.0154 -0.0127 148  LEU A CD2 
1264 N N   . VAL A 151 ? 0.1881 0.0748 0.0889 -0.0128 -0.0387 0.0033  149  VAL A N   
1265 C CA  . VAL A 151 ? 0.2372 0.1007 0.0931 0.0170  -0.0393 0.0050  149  VAL A CA  
1266 C C   . VAL A 151 ? 0.1972 0.0980 0.0780 0.0309  -0.0071 -0.0110 149  VAL A C   
1267 O O   . VAL A 151 ? 0.2190 0.0813 0.0684 0.0205  -0.0208 -0.0079 149  VAL A O   
1268 C CB  . VAL A 151 ? 0.3457 0.1153 0.1013 -0.0137 -0.0808 -0.0245 149  VAL A CB  
1269 C CG1 . VAL A 151 ? 0.4384 0.2231 0.0952 -0.0087 -0.0132 -0.0619 149  VAL A CG1 
1270 C CG2 . VAL A 151 ? 0.3390 0.1803 0.1589 -0.0358 -0.0870 0.0180  149  VAL A CG2 
1271 N N   . THR A 152 ? 0.1773 0.0968 0.0807 0.0409  0.0224  -0.0008 150  THR A N   
1272 C CA  . THR A 152 ? 0.1357 0.1070 0.0813 0.0508  0.0250  0.0514  150  THR A CA  
1273 C C   . THR A 152 ? 0.1660 0.0950 0.0830 0.0104  0.0217  0.0140  150  THR A C   
1274 O O   . THR A 152 ? 0.1410 0.0871 0.0870 0.0074  0.0182  0.0129  150  THR A O   
1275 C CB  . THR A 152 ? 0.1349 0.1709 0.0874 0.0531  0.0225  0.0100  150  THR A CB  
1276 O OG1 . THR A 152 ? 0.1831 0.1473 0.1410 0.0577  0.0554  0.0247  150  THR A OG1 
1277 C CG2 . THR A 152 ? 0.2090 0.1776 0.1180 -0.0017 0.0327  0.0042  150  THR A CG2 
1278 N N   . ILE A 153 ? 0.1307 0.0835 0.0725 0.0146  0.0009  0.0160  151  ILE A N   
1279 C CA  . ILE A 153 ? 0.1036 0.0813 0.0946 -0.0115 0.0254  0.0067  151  ILE A CA  
1280 C C   . ILE A 153 ? 0.1208 0.0969 0.0480 -0.0128 0.0030  0.0147  151  ILE A C   
1281 O O   . ILE A 153 ? 0.1366 0.0882 0.0932 -0.0043 0.0011  0.0078  151  ILE A O   
1282 C CB  . ILE A 153 ? 0.1412 0.1107 0.0766 -0.0138 0.0057  -0.0044 151  ILE A CB  
1283 C CG1 . ILE A 153 ? 0.1527 0.1513 0.0973 0.0197  -0.0056 0.0060  151  ILE A CG1 
1284 C CG2 . ILE A 153 ? 0.1338 0.1071 0.1049 -0.0033 -0.0045 0.0144  151  ILE A CG2 
1285 C CD1 . ILE A 153 ? 0.1964 0.2136 0.1022 0.0106  -0.0048 -0.0246 151  ILE A CD1 
1286 N N   . TYR A 154 ? 0.1135 0.0558 0.1243 0.0027  -0.0040 0.0036  152  TYR A N   
1287 C CA  . TYR A 154 ? 0.1143 0.0863 0.0937 -0.0171 0.0063  -0.0005 152  TYR A CA  
1288 C C   . TYR A 154 ? 0.0938 0.0681 0.0904 -0.0042 -0.0002 0.0042  152  TYR A C   
1289 O O   . TYR A 154 ? 0.1098 0.0750 0.0726 0.0024  -0.0055 0.0028  152  TYR A O   
1290 C CB  . TYR A 154 ? 0.1320 0.0802 0.1141 -0.0183 0.0061  -0.0104 152  TYR A CB  
1291 C CG  . TYR A 154 ? 0.1443 0.0916 0.1144 -0.0236 0.0051  0.0081  152  TYR A CG  
1292 C CD1 . TYR A 154 ? 0.1486 0.1629 0.1482 -0.0025 -0.0216 0.0242  152  TYR A CD1 
1293 C CD2 . TYR A 154 ? 0.1558 0.1070 0.1168 -0.0047 -0.0031 -0.0024 152  TYR A CD2 
1294 C CE1 . TYR A 154 ? 0.1537 0.2188 0.1580 -0.0124 -0.0300 -0.0128 152  TYR A CE1 
1295 C CE2 . TYR A 154 ? 0.1522 0.1473 0.1218 -0.0545 -0.0105 -0.0028 152  TYR A CE2 
1296 C CZ  . TYR A 154 ? 0.1611 0.1885 0.1541 -0.0312 0.0002  -0.0013 152  TYR A CZ  
1297 O OH  . TYR A 154 ? 0.2078 0.3015 0.2191 -0.0832 -0.0532 0.0108  152  TYR A OH  
1298 N N   . ASN A 155 ? 0.0967 0.0857 0.0681 -0.0077 -0.0071 0.0107  153  ASN A N   
1299 C CA  . ASN A 155 ? 0.1122 0.0926 0.0520 -0.0071 0.0000  -0.0070 153  ASN A CA  
1300 C C   . ASN A 155 ? 0.1229 0.0821 0.0930 -0.0104 -0.0082 0.0073  153  ASN A C   
1301 O O   . ASN A 155 ? 0.1522 0.0905 0.0739 -0.0073 -0.0173 0.0037  153  ASN A O   
1302 C CB  . ASN A 155 ? 0.0947 0.0779 0.0739 0.0041  -0.0115 0.0009  153  ASN A CB  
1303 C CG  . ASN A 155 ? 0.1256 0.0985 0.0823 -0.0151 -0.0059 -0.0005 153  ASN A CG  
1304 O OD1 . ASN A 155 ? 0.1179 0.1174 0.0858 -0.0062 -0.0024 -0.0213 153  ASN A OD1 
1305 N ND2 . ASN A 155 ? 0.2781 0.0906 0.1787 -0.0032 -0.0779 0.0341  153  ASN A ND2 
1306 N N   . GLU A 156 ? 0.1145 0.0932 0.0884 -0.0080 -0.0005 0.0110  154  GLU A N   
1307 C CA  . GLU A 156 ? 0.1208 0.0969 0.0755 -0.0147 0.0011  0.0049  154  GLU A CA  
1308 C C   . GLU A 156 ? 0.1167 0.0791 0.1302 -0.0185 -0.0016 0.0005  154  GLU A C   
1309 O O   . GLU A 156 ? 0.1499 0.0794 0.1282 -0.0136 0.0019  0.0101  154  GLU A O   
1310 C CB  . GLU A 156 ? 0.1276 0.0830 0.0742 -0.0060 -0.0059 -0.0043 154  GLU A CB  
1311 C CG  . GLU A 156 ? 0.1528 0.0935 0.1125 -0.0160 -0.0227 -0.0025 154  GLU A CG  
1312 C CD  . GLU A 156 ? 0.1727 0.1257 0.0895 -0.0305 -0.0123 0.0012  154  GLU A CD  
1313 O OE1 . GLU A 156 ? 0.1629 0.1273 0.1021 -0.0300 -0.0233 0.0014  154  GLU A OE1 
1314 O OE2 . GLU A 156 ? 0.1820 0.1449 0.1107 -0.0283 -0.0257 -0.0023 154  GLU A OE2 
1315 N N   A SER A 157 ? 0.1414 0.0750 0.0980 -0.0201 0.0105  -0.0177 155  SER A N   
1316 N N   B SER A 157 ? 0.1383 0.0781 0.1006 -0.0182 0.0091  -0.0134 155  SER A N   
1317 C CA  A SER A 157 ? 0.1552 0.0798 0.1260 0.0088  -0.0099 -0.0071 155  SER A CA  
1318 C CA  B SER A 157 ? 0.1463 0.0795 0.1191 0.0016  -0.0082 -0.0063 155  SER A CA  
1319 C C   A SER A 157 ? 0.1421 0.0959 0.1090 -0.0123 0.0001  0.0021  155  SER A C   
1320 C C   B SER A 157 ? 0.1450 0.0948 0.1122 -0.0114 -0.0044 0.0034  155  SER A C   
1321 O O   A SER A 157 ? 0.1818 0.1176 0.1274 0.0239  -0.0006 0.0290  155  SER A O   
1322 O O   B SER A 157 ? 0.1830 0.1231 0.1340 0.0266  -0.0027 0.0230  155  SER A O   
1323 C CB  A SER A 157 ? 0.1348 0.1332 0.1386 0.0002  0.0065  -0.0089 155  SER A CB  
1324 C CB  B SER A 157 ? 0.1273 0.1095 0.1200 -0.0056 -0.0021 -0.0158 155  SER A CB  
1325 O OG  A SER A 157 ? 0.1896 0.1151 0.1554 0.0462  0.0027  0.0139  155  SER A OG  
1326 O OG  B SER A 157 ? 0.1269 0.0803 0.0791 0.0071  0.0097  -0.0147 155  SER A OG  
1327 N N   . LEU A 158 ? 0.1553 0.0951 0.1226 -0.0270 -0.0009 0.0017  156  LEU A N   
1328 C CA  . LEU A 158 ? 0.1684 0.1206 0.1489 -0.0131 0.0006  -0.0002 156  LEU A CA  
1329 C C   . LEU A 158 ? 0.1651 0.1357 0.1361 -0.0172 0.0000  0.0218  156  LEU A C   
1330 O O   . LEU A 158 ? 0.1917 0.1259 0.1879 -0.0404 -0.0527 0.0389  156  LEU A O   
1331 C CB  . LEU A 158 ? 0.1312 0.1067 0.1227 -0.0028 -0.0189 0.0172  156  LEU A CB  
1332 C CG  . LEU A 158 ? 0.1036 0.1258 0.1543 -0.0165 -0.0065 -0.0242 156  LEU A CG  
1333 C CD1 . LEU A 158 ? 0.1242 0.1364 0.1462 0.0288  -0.0085 -0.0010 156  LEU A CD1 
1334 C CD2 . LEU A 158 ? 0.0908 0.1530 0.2468 -0.0073 -0.0047 -0.0371 156  LEU A CD2 
1335 N N   . GLU A 159 ? 0.1594 0.1143 0.1344 -0.0240 -0.0225 0.0351  157  GLU A N   
1336 C CA  . GLU A 159 ? 0.2271 0.1022 0.1188 -0.0302 0.0106  0.0085  157  GLU A CA  
1337 C C   . GLU A 159 ? 0.2266 0.0985 0.1519 0.0158  -0.0244 0.0453  157  GLU A C   
1338 O O   . GLU A 159 ? 0.3040 0.1173 0.2203 -0.0296 -0.0017 0.0639  157  GLU A O   
1339 C CB  . GLU A 159 ? 0.2019 0.1168 0.1193 -0.0184 0.0241  0.0085  157  GLU A CB  
1340 C CG  . GLU A 159 ? 0.2107 0.1508 0.1313 -0.0315 0.0205  -0.0094 157  GLU A CG  
1341 C CD  . GLU A 159 ? 0.2342 0.1526 0.1362 -0.0256 0.0325  0.0394  157  GLU A CD  
1342 O OE1 . GLU A 159 ? 0.4052 0.1658 0.2258 -0.0953 0.0914  0.0126  157  GLU A OE1 
1343 O OE2 . GLU A 159 ? 0.2998 0.1362 0.1826 -0.0287 0.0270  0.0335  157  GLU A OE2 
1344 N N   . SER A 160 ? 0.1990 0.0876 0.1823 0.0048  -0.0163 0.0463  158  SER A N   
1345 C CA  . SER A 160 ? 0.1838 0.1317 0.1830 0.0046  0.0102  0.0111  158  SER A CA  
1346 C C   . SER A 160 ? 0.1660 0.1241 0.1401 0.0026  -0.0197 0.0101  158  SER A C   
1347 O O   . SER A 160 ? 0.1964 0.1251 0.1958 -0.0211 -0.0220 0.0110  158  SER A O   
1348 C CB  . SER A 160 ? 0.1791 0.1894 0.2157 0.0085  -0.0111 -0.0110 158  SER A CB  
1349 O OG  . SER A 160 ? 0.1793 0.1148 0.2307 0.0287  -0.0230 -0.0094 158  SER A OG  
1350 N N   . ASN A 161 ? 0.2101 0.1336 0.1975 0.0342  0.0036  0.0339  159  ASN A N   
1351 C CA  . ASN A 161 ? 0.2235 0.1644 0.2135 0.0082  0.0046  -0.0023 159  ASN A CA  
1352 C C   . ASN A 161 ? 0.1630 0.1586 0.2250 0.0384  -0.0035 -0.0008 159  ASN A C   
1353 O O   . ASN A 161 ? 0.1751 0.1877 0.2058 0.0710  -0.0184 0.0184  159  ASN A O   
1354 C CB  . ASN A 161 ? 0.2050 0.2179 0.1996 0.0547  -0.0217 0.0366  159  ASN A CB  
1355 C CG  . ASN A 161 ? 0.2339 0.2359 0.2123 0.0492  -0.0393 0.0458  159  ASN A CG  
1356 O OD1 . ASN A 161 ? 0.3456 0.2125 0.3376 0.0559  -0.0324 0.0165  159  ASN A OD1 
1357 N ND2 . ASN A 161 ? 0.2953 0.2619 0.2231 0.0205  -0.0443 0.0542  159  ASN A ND2 
1358 N N   . LEU A 162 ? 0.1587 0.1433 0.1818 0.0150  -0.0103 0.0020  160  LEU A N   
1359 C CA  . LEU A 162 ? 0.1595 0.1442 0.1481 0.0136  -0.0430 -0.0361 160  LEU A CA  
1360 C C   . LEU A 162 ? 0.1187 0.1678 0.1549 0.0113  -0.0193 -0.0150 160  LEU A C   
1361 O O   . LEU A 162 ? 0.1238 0.1698 0.1460 0.0042  0.0020  -0.0349 160  LEU A O   
1362 C CB  . LEU A 162 ? 0.1585 0.1753 0.2573 0.0354  -0.0387 0.0016  160  LEU A CB  
1363 C CG  . LEU A 162 ? 0.1497 0.2355 0.1873 -0.0185 0.0083  -0.0093 160  LEU A CG  
1364 C CD1 . LEU A 162 ? 0.2203 0.1735 0.2086 0.0185  -0.0393 -0.0364 160  LEU A CD1 
1365 C CD2 . LEU A 162 ? 0.1491 0.2079 0.1566 -0.0228 -0.0146 -0.0440 160  LEU A CD2 
1366 N N   . LEU A 163 ? 0.1141 0.1508 0.1394 -0.0103 -0.0236 -0.0172 161  LEU A N   
1367 C CA  . LEU A 163 ? 0.1234 0.1422 0.1115 -0.0072 -0.0006 -0.0010 161  LEU A CA  
1368 C C   . LEU A 163 ? 0.1328 0.1590 0.1409 -0.0150 -0.0039 -0.0283 161  LEU A C   
1369 O O   . LEU A 163 ? 0.1424 0.1745 0.1495 -0.0130 0.0190  -0.0230 161  LEU A O   
1370 C CB  . LEU A 163 ? 0.1742 0.1943 0.1319 -0.0296 0.0110  -0.0278 161  LEU A CB  
1371 C CG  . LEU A 163 ? 0.2061 0.1531 0.2069 -0.0112 0.0346  -0.0478 161  LEU A CG  
1372 C CD1 . LEU A 163 ? 0.2179 0.1821 0.1855 0.0043  0.0305  -0.0664 161  LEU A CD1 
1373 C CD2 . LEU A 163 ? 0.2791 0.2004 0.1629 -0.0517 -0.0202 -0.0430 161  LEU A CD2 
1374 N N   . GLU A 164 ? 0.1599 0.1778 0.1615 -0.0111 -0.0139 -0.0032 162  GLU A N   
1375 C CA  . GLU A 164 ? 0.1733 0.2017 0.1796 0.0228  -0.0486 -0.0241 162  GLU A CA  
1376 C C   . GLU A 164 ? 0.1619 0.1906 0.1472 -0.0129 -0.0409 0.0024  162  GLU A C   
1377 O O   . GLU A 164 ? 0.1427 0.2606 0.1481 0.0477  -0.0161 -0.0146 162  GLU A O   
1378 C CB  . GLU A 164 ? 0.2151 0.2175 0.1849 -0.0200 -0.0066 0.0051  162  GLU A CB  
1379 C CG  . GLU A 164 ? 0.2437 0.2838 0.2160 0.0389  -0.0188 -0.0247 162  GLU A CG  
1380 C CD  . GLU A 164 ? 0.2869 0.3221 0.2294 0.0335  -0.0381 0.0260  162  GLU A CD  
1381 O OE1 . GLU A 164 ? 0.4305 0.3869 0.2246 -0.0181 -0.0097 0.0425  162  GLU A OE1 
1382 O OE2 . GLU A 164 ? 0.3468 0.6109 0.6343 0.0491  -0.1568 -0.1057 162  GLU A OE2 
1383 N N   . ARG A 165 ? 0.1445 0.1753 0.1313 0.0142  -0.0229 0.0032  163  ARG A N   
1384 C CA  . ARG A 165 ? 0.1434 0.1951 0.1364 0.0457  -0.0356 0.0092  163  ARG A CA  
1385 C C   . ARG A 165 ? 0.1261 0.1166 0.1484 0.0225  -0.0033 -0.0205 163  ARG A C   
1386 O O   . ARG A 165 ? 0.1602 0.1682 0.1332 0.0428  0.0029  -0.0007 163  ARG A O   
1387 C CB  . ARG A 165 ? 0.1681 0.1531 0.1464 0.0211  0.0047  0.0288  163  ARG A CB  
1388 C CG  . ARG A 165 ? 0.1764 0.1212 0.1701 0.0354  -0.0087 -0.0013 163  ARG A CG  
1389 C CD  . ARG A 165 ? 0.1646 0.1677 0.1804 0.0263  0.0023  0.0278  163  ARG A CD  
1390 N NE  . ARG A 165 ? 0.1796 0.1734 0.1841 0.0116  -0.0090 0.0039  163  ARG A NE  
1391 C CZ  . ARG A 165 ? 0.1344 0.1708 0.1993 0.0395  -0.0254 -0.0009 163  ARG A CZ  
1392 N NH1 . ARG A 165 ? 0.2529 0.2101 0.2093 -0.0044 -0.0021 -0.0111 163  ARG A NH1 
1393 N NH2 . ARG A 165 ? 0.1191 0.1763 0.1960 0.0321  -0.0066 0.0421  163  ARG A NH2 
1394 N N   A MET A 166 ? 0.0934 0.1418 0.1369 0.0186  -0.0175 -0.0443 164  MET A N   
1395 N N   B MET A 166 ? 0.0982 0.1499 0.1483 0.0227  -0.0186 -0.0506 164  MET A N   
1396 C CA  A MET A 166 ? 0.1004 0.1476 0.1735 0.0207  -0.0037 -0.0212 164  MET A CA  
1397 C CA  B MET A 166 ? 0.1157 0.1661 0.1892 0.0113  -0.0050 -0.0217 164  MET A CA  
1398 C C   A MET A 166 ? 0.1245 0.1103 0.1529 0.0182  -0.0100 -0.0265 164  MET A C   
1399 C C   B MET A 166 ? 0.1332 0.1151 0.1565 0.0179  -0.0140 -0.0282 164  MET A C   
1400 O O   A MET A 166 ? 0.1243 0.1354 0.1938 0.0191  -0.0077 0.0000  164  MET A O   
1401 O O   B MET A 166 ? 0.1452 0.1437 0.1966 0.0119  -0.0121 -0.0022 164  MET A O   
1402 C CB  A MET A 166 ? 0.1002 0.1111 0.1465 0.0074  -0.0019 -0.0170 164  MET A CB  
1403 C CB  B MET A 166 ? 0.1287 0.1384 0.1933 0.0056  0.0010  -0.0266 164  MET A CB  
1404 C CG  A MET A 166 ? 0.0999 0.1158 0.1272 0.0130  -0.0142 0.0054  164  MET A CG  
1405 C CG  B MET A 166 ? 0.1601 0.1481 0.1671 -0.0251 -0.0229 -0.0085 164  MET A CG  
1406 S SD  A MET A 166 ? 0.1052 0.1177 0.1040 0.0208  -0.0079 0.0422  164  MET A SD  
1407 S SD  B MET A 166 ? 0.1884 0.2135 0.2366 0.0007  0.0059  -0.0050 164  MET A SD  
1408 C CE  A MET A 166 ? 0.1325 0.1561 0.1058 0.0024  0.0184  -0.0012 164  MET A CE  
1409 C CE  B MET A 166 ? 0.1661 0.1968 0.2727 0.0287  -0.0819 0.0096  164  MET A CE  
1410 N N   . GLN A 167 ? 0.1244 0.1655 0.1498 0.0172  -0.0086 -0.0396 165  GLN A N   
1411 C CA  . GLN A 167 ? 0.1376 0.1340 0.1609 0.0042  -0.0317 -0.0117 165  GLN A CA  
1412 C C   . GLN A 167 ? 0.1891 0.1901 0.1716 -0.0070 0.0000  -0.0421 165  GLN A C   
1413 O O   . GLN A 167 ? 0.2079 0.2945 0.3180 -0.0531 0.0236  -0.1039 165  GLN A O   
1414 C CB  . GLN A 167 ? 0.1983 0.2096 0.1790 -0.0252 0.0065  -0.0493 165  GLN A CB  
1415 C CG  . GLN A 167 ? 0.2039 0.2046 0.2387 -0.0159 0.0290  -0.0302 165  GLN A CG  
1416 C CD  . GLN A 167 ? 0.3873 0.2946 0.2398 0.0659  -0.0248 -0.0165 165  GLN A CD  
1417 O OE1 . GLN A 167 ? 0.2763 0.2707 0.2676 -0.0354 -0.0273 0.0391  165  GLN A OE1 
1418 N NE2 . GLN A 167 ? 0.3019 0.3027 0.1472 0.0302  0.0113  -0.0790 165  GLN A NE2 
1419 N N   . GLU A 168 ? 0.1462 0.1783 0.1990 0.0084  0.0113  -0.0398 166  GLU A N   
1420 C CA  . GLU A 168 ? 0.1374 0.1743 0.1972 0.0261  0.0087  -0.0286 166  GLU A CA  
1421 C C   . GLU A 168 ? 0.1841 0.1844 0.1771 0.0511  0.0511  -0.0082 166  GLU A C   
1422 O O   . GLU A 168 ? 0.2447 0.3071 0.2749 0.1333  0.0676  -0.0512 166  GLU A O   
1423 C CB  . GLU A 168 ? 0.1691 0.1800 0.2338 0.0573  -0.0044 -0.0342 166  GLU A CB  
1424 C CG  . GLU A 168 ? 0.1782 0.2543 0.2129 0.0254  0.0229  -0.0260 166  GLU A CG  
1425 C CD  . GLU A 168 ? 0.2243 0.2213 0.2421 0.0903  -0.0237 -0.0041 166  GLU A CD  
1426 O OE1 . GLU A 168 ? 0.2436 0.2305 0.2277 0.0442  -0.0258 0.0190  166  GLU A OE1 
1427 O OE2 . GLU A 168 ? 0.2315 0.3628 0.3476 0.1276  -0.0774 0.0400  166  GLU A OE2 
1428 N N   . LEU A 169 ? 0.1786 0.2118 0.1878 0.0637  -0.0027 -0.0454 167  LEU A N   
1429 C CA  . LEU A 169 ? 0.2016 0.2331 0.1907 0.0492  0.0031  -0.0097 167  LEU A CA  
1430 C C   . LEU A 169 ? 0.2007 0.3266 0.2586 0.0303  0.0010  -0.0338 167  LEU A C   
1431 O O   . LEU A 169 ? 0.3677 0.3441 0.4120 -0.0885 -0.1137 0.0651  167  LEU A O   
1432 C CB  . LEU A 169 ? 0.1527 0.2104 0.1797 0.0005  0.0356  0.0031  167  LEU A CB  
1433 C CG  . LEU A 169 ? 0.1364 0.1617 0.1998 0.0046  0.0576  -0.0185 167  LEU A CG  
1434 C CD1 . LEU A 169 ? 0.1010 0.1809 0.2364 0.0147  0.0236  0.0184  167  LEU A CD1 
1435 C CD2 . LEU A 169 ? 0.1559 0.1923 0.1643 -0.0398 0.0174  -0.0223 167  LEU A CD2 
1436 N N   . ALA B 2   ? 0.6244 0.4534 0.7122 -0.0428 -0.0276 0.0293  0    ALA B N   
1437 C CA  . ALA B 2   ? 0.4286 0.3924 0.5014 0.0642  0.0544  -0.0914 0    ALA B CA  
1438 C C   . ALA B 2   ? 0.6206 0.2089 0.3594 0.1097  0.0199  -0.1131 0    ALA B C   
1439 O O   . ALA B 2   ? 0.6548 0.3202 0.5775 0.0146  0.0651  0.0051  0    ALA B O   
1440 C CB  . ALA B 2   ? 0.5427 0.4820 0.9003 0.0800  -0.1022 -0.0521 0    ALA B CB  
1441 N N   . MET B 3   ? 0.5315 0.1872 0.2582 0.0800  -0.0042 -0.0502 1    MET B N   
1442 C CA  . MET B 3   ? 0.3983 0.2189 0.2335 0.0428  -0.0047 0.0283  1    MET B CA  
1443 C C   . MET B 3   ? 0.2966 0.1669 0.1747 0.0263  0.0189  -0.0109 1    MET B C   
1444 O O   . MET B 3   ? 0.3136 0.1428 0.1558 0.0804  0.0142  0.0111  1    MET B O   
1445 C CB  . MET B 3   ? 0.2863 0.1619 0.2466 -0.0052 0.0042  -0.0045 1    MET B CB  
1446 C CG  . MET B 3   ? 0.3918 0.2348 0.2578 -0.0728 -0.0184 -0.0019 1    MET B CG  
1447 S SD  . MET B 3   ? 0.2596 0.2330 0.3456 -0.0929 0.0521  -0.0275 1    MET B SD  
1448 C CE  . MET B 3   ? 0.2052 0.1587 0.2232 -0.0608 -0.0210 -0.0321 1    MET B CE  
1449 N N   . ASP B 4   ? 0.3535 0.1768 0.1687 0.0758  0.0998  -0.0727 2    ASP B N   
1450 C CA  . ASP B 4   ? 0.2808 0.2570 0.2522 0.0875  0.0196  0.0318  2    ASP B CA  
1451 C C   . ASP B 4   ? 0.2272 0.1636 0.2252 0.0518  0.0352  -0.0052 2    ASP B C   
1452 O O   . ASP B 4   ? 0.1251 0.2009 0.2731 0.0321  0.0079  -0.0132 2    ASP B O   
1453 C CB  . ASP B 4   ? 0.3019 0.3434 0.3185 0.0602  0.0958  -0.0077 2    ASP B CB  
1454 C CG  . ASP B 4   ? 0.2716 0.2440 0.4279 0.0309  0.0741  0.0129  2    ASP B CG  
1455 O OD1 . ASP B 4   ? 0.3443 0.2809 0.2164 0.0340  0.0631  -0.0291 2    ASP B OD1 
1456 O OD2 . ASP B 4   ? 0.2799 0.4567 0.5786 0.0489  0.1144  -0.0324 2    ASP B OD2 
1457 N N   . ARG B 5   ? 0.1880 0.1485 0.2041 0.0889  0.0105  -0.0077 3    ARG B N   
1458 C CA  . ARG B 5   ? 0.1685 0.1806 0.2062 0.0488  0.0165  0.0087  3    ARG B CA  
1459 C C   . ARG B 5   ? 0.1735 0.1333 0.1794 0.0547  -0.0126 0.0152  3    ARG B C   
1460 O O   . ARG B 5   ? 0.2301 0.2044 0.1749 0.0305  -0.0440 0.0322  3    ARG B O   
1461 C CB  . ARG B 5   ? 0.2700 0.1479 0.2855 0.1022  0.0220  0.0383  3    ARG B CB  
1462 C CG  . ARG B 5   ? 0.3433 0.2552 0.2959 0.0560  -0.0006 -0.0267 3    ARG B CG  
1463 C CD  . ARG B 5   ? 0.4504 0.4031 0.4011 -0.0020 0.0189  0.0933  3    ARG B CD  
1464 N NE  . ARG B 5   ? 0.4762 0.3508 0.4670 -0.0354 0.1769  0.0154  3    ARG B NE  
1465 C CZ  . ARG B 5   ? 0.4717 0.3258 0.5126 -0.0082 0.1726  -0.0429 3    ARG B CZ  
1466 N NH1 . ARG B 5   ? 0.4560 0.4025 0.7431 0.0270  0.0512  0.1476  3    ARG B NH1 
1467 N NH2 . ARG B 5   ? 0.5669 0.4055 0.6784 0.0154  0.0519  0.1370  3    ARG B NH2 
1468 N N   . HIS B 6   ? 0.1412 0.1050 0.1407 0.0269  -0.0179 -0.0104 4    HIS B N   
1469 C CA  . HIS B 6   ? 0.1098 0.1071 0.1376 0.0042  0.0087  0.0124  4    HIS B CA  
1470 C C   . HIS B 6   ? 0.1109 0.1076 0.1479 0.0017  0.0204  0.0090  4    HIS B C   
1471 O O   . HIS B 6   ? 0.1186 0.0961 0.1667 0.0032  0.0505  0.0114  4    HIS B O   
1472 C CB  . HIS B 6   ? 0.1229 0.1282 0.1816 0.0228  -0.0055 -0.0053 4    HIS B CB  
1473 C CG  . HIS B 6   ? 0.1395 0.1339 0.1938 0.0283  -0.0034 -0.0138 4    HIS B CG  
1474 N ND1 . HIS B 6   ? 0.2444 0.1452 0.2471 -0.0703 0.0116  -0.0313 4    HIS B ND1 
1475 C CD2 . HIS B 6   ? 0.2759 0.1613 0.2442 -0.0468 0.0307  -0.0519 4    HIS B CD2 
1476 C CE1 . HIS B 6   ? 0.2406 0.1462 0.2453 -0.0730 0.0056  -0.0280 4    HIS B CE1 
1477 N NE2 . HIS B 6   ? 0.2982 0.2073 0.2603 -0.0647 0.0325  0.0152  4    HIS B NE2 
1478 N N   . LYS B 7   ? 0.0916 0.0710 0.1015 0.0194  0.0109  -0.0093 5    LYS B N   
1479 C CA  . LYS B 7   ? 0.1270 0.0804 0.0891 -0.0007 0.0157  -0.0059 5    LYS B CA  
1480 C C   . LYS B 7   ? 0.0817 0.0960 0.0854 0.0111  0.0045  0.0007  5    LYS B C   
1481 O O   . LYS B 7   ? 0.0998 0.1072 0.0914 0.0331  -0.0219 -0.0123 5    LYS B O   
1482 C CB  . LYS B 7   ? 0.0907 0.0918 0.0948 0.0239  -0.0078 -0.0068 5    LYS B CB  
1483 C CG  . LYS B 7   ? 0.1086 0.0880 0.0929 0.0124  -0.0007 -0.0130 5    LYS B CG  
1484 C CD  . LYS B 7   ? 0.1253 0.1303 0.1110 0.0073  0.0132  0.0018  5    LYS B CD  
1485 C CE  . LYS B 7   ? 0.1026 0.1334 0.1313 0.0225  0.0081  0.0031  5    LYS B CE  
1486 N NZ  . LYS B 7   ? 0.0892 0.1263 0.1367 0.0386  -0.0243 -0.0134 5    LYS B NZ  
1487 N N   . PRO B 8   ? 0.0967 0.1009 0.0892 0.0160  -0.0080 -0.0125 6    PRO B N   
1488 C CA  . PRO B 8   ? 0.1108 0.0787 0.0749 0.0045  0.0010  0.0114  6    PRO B CA  
1489 C C   . PRO B 8   ? 0.0972 0.1098 0.0959 0.0300  -0.0034 -0.0038 6    PRO B C   
1490 O O   . PRO B 8   ? 0.0926 0.1049 0.0997 0.0080  0.0082  -0.0054 6    PRO B O   
1491 C CB  . PRO B 8   ? 0.0924 0.1069 0.1119 0.0117  0.0219  -0.0073 6    PRO B CB  
1492 C CG  . PRO B 8   ? 0.1174 0.1092 0.1033 0.0207  0.0146  -0.0038 6    PRO B CG  
1493 C CD  . PRO B 8   ? 0.1095 0.1239 0.0833 0.0242  -0.0060 -0.0062 6    PRO B CD  
1494 N N   . LYS B 9   ? 0.1030 0.0858 0.0871 0.0146  0.0080  -0.0001 7    LYS B N   
1495 C CA  . LYS B 9   ? 0.0978 0.1252 0.0697 0.0123  -0.0085 -0.0277 7    LYS B CA  
1496 C C   . LYS B 9   ? 0.0963 0.1197 0.1000 -0.0012 0.0008  0.0054  7    LYS B C   
1497 O O   . LYS B 9   ? 0.0707 0.1411 0.1151 0.0239  0.0296  -0.0210 7    LYS B O   
1498 C CB  . LYS B 9   ? 0.1750 0.1429 0.0736 0.0123  0.0045  0.0157  7    LYS B CB  
1499 C CG  . LYS B 9   ? 0.2251 0.2252 0.2126 0.0254  -0.0319 -0.0194 7    LYS B CG  
1500 C CD  . LYS B 9   ? 0.3176 0.2702 0.2354 -0.0281 -0.0194 0.0605  7    LYS B CD  
1501 C CE  . LYS B 9   ? 0.3088 0.3923 0.3524 0.0589  -0.1012 0.0464  7    LYS B CE  
1502 N NZ  . LYS B 9   ? 0.4918 0.4932 0.3416 0.0111  -0.0270 0.0409  7    LYS B NZ  
1503 N N   . SER B 10  ? 0.0991 0.1170 0.0833 0.0109  -0.0074 0.0066  8    SER B N   
1504 C CA  . SER B 10  ? 0.1120 0.1044 0.0944 -0.0280 -0.0082 -0.0098 8    SER B CA  
1505 C C   . SER B 10  ? 0.0836 0.0804 0.1003 -0.0004 0.0119  -0.0020 8    SER B C   
1506 O O   . SER B 10  ? 0.1684 0.0742 0.1166 -0.0092 0.0339  -0.0025 8    SER B O   
1507 C CB  . SER B 10  ? 0.1495 0.1315 0.1136 -0.0058 0.0133  -0.0029 8    SER B CB  
1508 O OG  . SER B 10  ? 0.1885 0.1523 0.1200 -0.0054 0.0354  -0.0292 8    SER B OG  
1509 N N   . ILE B 11  ? 0.0965 0.0907 0.0812 -0.0097 0.0028  0.0064  9    ILE B N   
1510 C CA  . ILE B 11  ? 0.0706 0.0866 0.0965 0.0040  0.0150  0.0206  9    ILE B CA  
1511 C C   . ILE B 11  ? 0.0733 0.0870 0.0925 0.0114  0.0130  0.0090  9    ILE B C   
1512 O O   . ILE B 11  ? 0.0897 0.0910 0.0980 0.0137  0.0088  0.0248  9    ILE B O   
1513 C CB  . ILE B 11  ? 0.0744 0.0947 0.0840 0.0146  -0.0029 0.0314  9    ILE B CB  
1514 C CG1 . ILE B 11  ? 0.0923 0.1409 0.1002 0.0104  0.0200  -0.0073 9    ILE B CG1 
1515 C CG2 . ILE B 11  ? 0.1070 0.1225 0.0793 0.0059  -0.0085 0.0334  9    ILE B CG2 
1516 C CD1 . ILE B 11  ? 0.0849 0.1297 0.1339 0.0121  0.0097  -0.0324 9    ILE B CD1 
1517 N N   . SER B 12  ? 0.0752 0.0744 0.0868 0.0087  0.0007  0.0041  10   SER B N   
1518 C CA  . SER B 12  ? 0.0730 0.1281 0.0893 0.0141  0.0009  -0.0150 10   SER B CA  
1519 C C   . SER B 12  ? 0.0738 0.1203 0.0719 0.0052  0.0098  0.0028  10   SER B C   
1520 O O   . SER B 12  ? 0.0749 0.0992 0.1017 0.0028  -0.0058 0.0077  10   SER B O   
1521 C CB  . SER B 12  ? 0.0871 0.1447 0.1021 0.0024  -0.0064 0.0147  10   SER B CB  
1522 O OG  . SER B 12  ? 0.0691 0.1175 0.1052 -0.0156 -0.0058 0.0134  10   SER B OG  
1523 N N   . SER B 13  ? 0.0726 0.1236 0.1145 -0.0039 0.0122  0.0035  11   SER B N   
1524 C CA  . SER B 13  ? 0.0933 0.0967 0.0953 0.0130  0.0028  0.0161  11   SER B CA  
1525 C C   . SER B 13  ? 0.0541 0.1037 0.0935 0.0243  0.0220  0.0052  11   SER B C   
1526 O O   . SER B 13  ? 0.0613 0.1153 0.0964 0.0136  0.0050  0.0059  11   SER B O   
1527 C CB  . SER B 13  ? 0.0935 0.1430 0.1198 0.0219  0.0028  0.0046  11   SER B CB  
1528 O OG  . SER B 13  ? 0.1520 0.1988 0.1456 0.0564  0.0083  0.0227  11   SER B OG  
1529 N N   . GLU B 14  ? 0.0501 0.1313 0.0828 0.0006  0.0203  -0.0069 12   GLU B N   
1530 C CA  . GLU B 14  ? 0.0653 0.1128 0.0881 0.0263  0.0287  -0.0045 12   GLU B CA  
1531 C C   . GLU B 14  ? 0.0619 0.1216 0.0914 0.0041  0.0090  -0.0064 12   GLU B C   
1532 O O   . GLU B 14  ? 0.0730 0.1134 0.0891 -0.0046 0.0077  0.0046  12   GLU B O   
1533 C CB  . GLU B 14  ? 0.0799 0.1444 0.0995 0.0094  0.0242  0.0117  12   GLU B CB  
1534 C CG  . GLU B 14  ? 0.0866 0.1364 0.1302 -0.0272 0.0209  0.0024  12   GLU B CG  
1535 C CD  . GLU B 14  ? 0.1031 0.1397 0.1462 0.0006  0.0123  0.0108  12   GLU B CD  
1536 O OE1 . GLU B 14  ? 0.0832 0.1492 0.1128 0.0056  -0.0002 0.0205  12   GLU B OE1 
1537 O OE2 . GLU B 14  ? 0.1450 0.1702 0.1347 -0.0266 0.0007  -0.0079 12   GLU B OE2 
1538 N N   . ILE B 15  ? 0.0542 0.1066 0.0715 -0.0065 0.0066  0.0043  13   ILE B N   
1539 C CA  . ILE B 15  ? 0.0585 0.0916 0.0594 0.0000  0.0084  -0.0018 13   ILE B CA  
1540 C C   . ILE B 15  ? 0.0640 0.0975 0.0872 0.0057  0.0086  0.0075  13   ILE B C   
1541 O O   . ILE B 15  ? 0.0490 0.1023 0.0914 0.0005  0.0093  0.0070  13   ILE B O   
1542 C CB  . ILE B 15  ? 0.0517 0.0909 0.0652 -0.0007 -0.0096 -0.0149 13   ILE B CB  
1543 C CG1 . ILE B 15  ? 0.0626 0.1143 0.0842 -0.0139 0.0099  0.0001  13   ILE B CG1 
1544 C CG2 . ILE B 15  ? 0.0541 0.1481 0.0791 0.0079  0.0035  -0.0051 13   ILE B CG2 
1545 C CD1 . ILE B 15  ? 0.1124 0.1097 0.1078 0.0071  0.0034  -0.0001 13   ILE B CD1 
1546 N N   . TRP B 16  ? 0.0688 0.0999 0.0872 -0.0021 0.0024  0.0097  14   TRP B N   
1547 C CA  . TRP B 16  ? 0.0757 0.0997 0.0938 -0.0042 -0.0017 0.0012  14   TRP B CA  
1548 C C   . TRP B 16  ? 0.0831 0.1245 0.0937 -0.0081 0.0132  0.0002  14   TRP B C   
1549 O O   . TRP B 16  ? 0.0762 0.0987 0.1139 0.0045  0.0136  0.0013  14   TRP B O   
1550 C CB  . TRP B 16  ? 0.0749 0.0868 0.1100 -0.0102 0.0216  0.0052  14   TRP B CB  
1551 C CG  . TRP B 16  ? 0.0724 0.0968 0.1077 -0.0141 -0.0088 0.0067  14   TRP B CG  
1552 C CD1 . TRP B 16  ? 0.0998 0.1177 0.1017 0.0186  0.0045  -0.0067 14   TRP B CD1 
1553 C CD2 . TRP B 16  ? 0.0677 0.1056 0.1095 0.0066  -0.0127 -0.0003 14   TRP B CD2 
1554 N NE1 . TRP B 16  ? 0.1037 0.1045 0.1395 0.0247  0.0123  0.0095  14   TRP B NE1 
1555 C CE2 . TRP B 16  ? 0.0857 0.1016 0.1099 0.0130  -0.0039 -0.0026 14   TRP B CE2 
1556 C CE3 . TRP B 16  ? 0.0506 0.1049 0.1053 -0.0011 -0.0117 -0.0071 14   TRP B CE3 
1557 C CZ2 . TRP B 16  ? 0.1041 0.1060 0.1295 -0.0181 -0.0139 0.0038  14   TRP B CZ2 
1558 C CZ3 . TRP B 16  ? 0.0683 0.1034 0.1168 0.0004  0.0017  0.0056  14   TRP B CZ3 
1559 C CH2 . TRP B 16  ? 0.0793 0.1113 0.1214 -0.0128 -0.0182 0.0079  14   TRP B CH2 
1560 N N   . ALA B 17  ? 0.0727 0.1006 0.0886 0.0061  0.0000  -0.0057 15   ALA B N   
1561 C CA  . ALA B 17  ? 0.0748 0.1073 0.1005 0.0326  0.0042  -0.0039 15   ALA B CA  
1562 C C   . ALA B 17  ? 0.0747 0.1205 0.0994 0.0077  -0.0048 0.0028  15   ALA B C   
1563 O O   . ALA B 17  ? 0.0960 0.1185 0.1106 0.0033  0.0231  -0.0278 15   ALA B O   
1564 C CB  . ALA B 17  ? 0.0693 0.1193 0.1320 0.0363  -0.0008 -0.0363 15   ALA B CB  
1565 N N   . LEU B 18  ? 0.0611 0.1158 0.1048 -0.0003 0.0100  -0.0078 16   LEU B N   
1566 C CA  . LEU B 18  ? 0.0700 0.1209 0.1073 -0.0060 0.0112  -0.0070 16   LEU B CA  
1567 C C   . LEU B 18  ? 0.0737 0.1273 0.1163 -0.0039 0.0108  0.0109  16   LEU B C   
1568 O O   . LEU B 18  ? 0.0883 0.1382 0.1124 -0.0092 0.0101  -0.0046 16   LEU B O   
1569 C CB  . LEU B 18  ? 0.0648 0.1087 0.1011 0.0047  0.0128  -0.0026 16   LEU B CB  
1570 C CG  . LEU B 18  ? 0.0709 0.1088 0.1146 -0.0055 0.0120  0.0142  16   LEU B CG  
1571 C CD1 . LEU B 18  ? 0.1102 0.1603 0.1270 -0.0013 0.0338  0.0158  16   LEU B CD1 
1572 C CD2 . LEU B 18  ? 0.0785 0.1101 0.1374 -0.0104 0.0166  0.0120  16   LEU B CD2 
1573 N N   . SER B 19  ? 0.0952 0.1092 0.0828 0.0150  0.0109  -0.0022 17   SER B N   
1574 C CA  . SER B 19  ? 0.1033 0.1137 0.1065 -0.0008 0.0198  -0.0282 17   SER B CA  
1575 C C   . SER B 19  ? 0.0949 0.1315 0.0988 -0.0160 0.0206  -0.0263 17   SER B C   
1576 O O   . SER B 19  ? 0.0809 0.1676 0.1233 -0.0337 0.0287  -0.0323 17   SER B O   
1577 C CB  . SER B 19  ? 0.0904 0.1023 0.1029 0.0027  0.0156  -0.0246 17   SER B CB  
1578 O OG  . SER B 19  ? 0.0747 0.0971 0.0905 -0.0142 0.0277  -0.0097 17   SER B OG  
1579 N N   . GLU B 20  ? 0.0948 0.1599 0.1470 -0.0093 0.0369  -0.0012 18   GLU B N   
1580 C CA  . GLU B 20  ? 0.1637 0.1745 0.1841 0.0185  0.0690  -0.0188 18   GLU B CA  
1581 C C   . GLU B 20  ? 0.0980 0.1683 0.1423 0.0036  0.0521  -0.0421 18   GLU B C   
1582 O O   . GLU B 20  ? 0.1553 0.2221 0.2023 0.0054  0.0317  -0.0709 18   GLU B O   
1583 C CB  . GLU B 20  ? 0.1716 0.1871 0.1992 0.0183  -0.0096 -0.0345 18   GLU B CB  
1584 C CG  . GLU B 20  ? 0.2230 0.2407 0.1632 -0.0117 0.0539  0.0107  18   GLU B CG  
1585 C CD  . GLU B 20  ? 0.3019 0.4189 0.3839 0.0786  0.0345  -0.0090 18   GLU B CD  
1586 O OE1 . GLU B 20  ? 0.3113 0.4208 0.4577 0.1264  0.0515  -0.0359 18   GLU B OE1 
1587 O OE2 . GLU B 20  ? 0.4282 0.3872 0.4594 0.0944  0.0649  -0.0497 18   GLU B OE2 
1588 N N   . THR B 21  ? 0.1523 0.1914 0.1563 -0.0093 -0.0012 -0.0303 19   THR B N   
1589 C CA  . THR B 21  ? 0.1860 0.1950 0.2321 -0.0134 -0.0533 0.0315  19   THR B CA  
1590 C C   . THR B 21  ? 0.1878 0.1955 0.1262 0.0194  0.0167  -0.0444 19   THR B C   
1591 O O   . THR B 21  ? 0.1144 0.2196 0.1707 -0.0334 0.0124  -0.0117 19   THR B O   
1592 C CB  . THR B 21  ? 0.1236 0.1985 0.1795 -0.0113 -0.0021 -0.0376 19   THR B CB  
1593 O OG1 . THR B 21  ? 0.4312 0.4849 0.2922 -0.0615 -0.0238 0.1276  19   THR B OG1 
1594 C CG2 . THR B 21  ? 0.1426 0.1992 0.0724 -0.0418 -0.0121 -0.0210 19   THR B CG2 
1595 N N   . SER B 22  ? 0.1166 0.2518 0.1285 0.0158  0.0109  -0.0454 20   SER B N   
1596 C CA  . SER B 22  ? 0.1167 0.1730 0.0912 0.0161  0.0175  -0.0221 20   SER B CA  
1597 C C   . SER B 22  ? 0.1018 0.1292 0.1111 0.0470  -0.0051 -0.0115 20   SER B C   
1598 O O   . SER B 22  ? 0.1755 0.1595 0.1285 0.0327  -0.0318 -0.0085 20   SER B O   
1599 C CB  . SER B 22  ? 0.0931 0.1913 0.0752 -0.0372 0.0163  -0.0260 20   SER B CB  
1600 O OG  . SER B 22  ? 0.0971 0.1519 0.1146 -0.0338 -0.0046 0.0032  20   SER B OG  
1601 N N   . LYS B 23  ? 0.1015 0.1377 0.0996 0.0089  -0.0012 0.0065  21   LYS B N   
1602 C CA  . LYS B 23  ? 0.1187 0.1295 0.1153 0.0043  -0.0118 -0.0244 21   LYS B CA  
1603 C C   . LYS B 23  ? 0.0891 0.1074 0.1078 0.0023  -0.0228 -0.0004 21   LYS B C   
1604 O O   . LYS B 23  ? 0.0927 0.1096 0.1116 -0.0046 -0.0015 -0.0021 21   LYS B O   
1605 C CB  . LYS B 23  ? 0.1352 0.2116 0.1218 -0.0037 -0.0175 -0.0174 21   LYS B CB  
1606 C CG  . LYS B 23  ? 0.1960 0.2958 0.1986 -0.0002 -0.0019 -0.0668 21   LYS B CG  
1607 C CD  . LYS B 23  ? 0.2672 0.2817 0.3197 0.0934  -0.0272 -0.0149 21   LYS B CD  
1608 C CE  . LYS B 23  ? 0.3255 0.3317 0.3104 0.0427  -0.0303 -0.1027 21   LYS B CE  
1609 N NZ  . LYS B 23  ? 0.3747 0.4091 0.4117 0.0996  -0.0876 -0.0751 21   LYS B NZ  
1610 N N   . GLU B 24  ? 0.0670 0.1072 0.0999 0.0021  -0.0051 0.0015  22   GLU B N   
1611 C CA  . GLU B 24  ? 0.0774 0.0975 0.1006 0.0021  0.0054  0.0129  22   GLU B CA  
1612 C C   . GLU B 24  ? 0.0604 0.0933 0.0754 -0.0054 0.0068  -0.0075 22   GLU B C   
1613 O O   . GLU B 24  ? 0.0650 0.0923 0.1096 -0.0117 -0.0059 0.0165  22   GLU B O   
1614 C CB  . GLU B 24  ? 0.0933 0.0985 0.1118 -0.0069 0.0027  0.0001  22   GLU B CB  
1615 C CG  . GLU B 24  ? 0.1685 0.1656 0.1488 0.0075  0.0373  0.0424  22   GLU B CG  
1616 C CD  . GLU B 24  ? 0.1936 0.1801 0.1870 0.0510  -0.0086 0.0145  22   GLU B CD  
1617 O OE1 . GLU B 24  ? 0.2367 0.2698 0.2674 0.0198  -0.0014 0.0034  22   GLU B OE1 
1618 O OE2 . GLU B 24  ? 0.3039 0.2935 0.2380 -0.0155 -0.0731 0.0744  22   GLU B OE2 
1619 N N   . TRP B 25  ? 0.0767 0.0987 0.0772 0.0017  0.0080  0.0054  23   TRP B N   
1620 C CA  . TRP B 25  ? 0.0714 0.0915 0.0821 0.0042  0.0051  0.0061  23   TRP B CA  
1621 C C   . TRP B 25  ? 0.0612 0.0983 0.1006 0.0019  0.0025  0.0014  23   TRP B C   
1622 O O   . TRP B 25  ? 0.0800 0.1008 0.1135 -0.0203 -0.0075 0.0043  23   TRP B O   
1623 C CB  . TRP B 25  ? 0.0587 0.0788 0.1101 -0.0043 0.0041  0.0093  23   TRP B CB  
1624 C CG  . TRP B 25  ? 0.0723 0.0931 0.0887 0.0072  -0.0010 0.0102  23   TRP B CG  
1625 C CD1 . TRP B 25  ? 0.0838 0.0734 0.0837 0.0061  -0.0044 0.0075  23   TRP B CD1 
1626 C CD2 . TRP B 25  ? 0.0733 0.0978 0.1086 0.0038  -0.0033 -0.0123 23   TRP B CD2 
1627 N NE1 . TRP B 25  ? 0.0648 0.0928 0.0850 -0.0027 0.0033  -0.0038 23   TRP B NE1 
1628 C CE2 . TRP B 25  ? 0.0767 0.0974 0.0891 0.0081  -0.0075 -0.0032 23   TRP B CE2 
1629 C CE3 . TRP B 25  ? 0.0925 0.0937 0.0835 -0.0001 -0.0082 -0.0089 23   TRP B CE3 
1630 C CZ2 . TRP B 25  ? 0.0740 0.1039 0.1129 0.0189  -0.0123 -0.0199 23   TRP B CZ2 
1631 C CZ3 . TRP B 25  ? 0.1061 0.0936 0.1270 0.0116  -0.0212 -0.0083 23   TRP B CZ3 
1632 C CH2 . TRP B 25  ? 0.1014 0.1124 0.1148 0.0024  -0.0328 -0.0324 23   TRP B CH2 
1633 N N   . MET B 26  ? 0.0928 0.0957 0.0871 -0.0001 -0.0112 0.0004  24   MET B N   
1634 C CA  . MET B 26  ? 0.0890 0.0970 0.1044 0.0160  -0.0170 -0.0021 24   MET B CA  
1635 C C   . MET B 26  ? 0.0941 0.1128 0.1095 -0.0080 -0.0172 0.0131  24   MET B C   
1636 O O   . MET B 26  ? 0.1441 0.0925 0.1762 -0.0039 -0.0249 -0.0171 24   MET B O   
1637 C CB  . MET B 26  ? 0.1111 0.1005 0.1164 0.0263  -0.0033 -0.0230 24   MET B CB  
1638 C CG  . MET B 26  ? 0.1113 0.1552 0.1307 0.0700  -0.0124 -0.0106 24   MET B CG  
1639 S SD  . MET B 26  ? 0.1867 0.1757 0.1818 0.0427  0.0307  -0.0273 24   MET B SD  
1640 C CE  . MET B 26  ? 0.1826 0.2956 0.2382 0.0525  0.0345  -0.0313 24   MET B CE  
1641 N N   . SER B 27  ? 0.0817 0.0958 0.1306 -0.0125 -0.0039 0.0088  25   SER B N   
1642 C CA  . SER B 27  ? 0.0900 0.1038 0.0983 -0.0204 -0.0183 -0.0032 25   SER B CA  
1643 C C   . SER B 27  ? 0.0787 0.0947 0.1039 0.0240  -0.0115 0.0212  25   SER B C   
1644 O O   . SER B 27  ? 0.1100 0.1549 0.1457 -0.0427 -0.0101 0.0033  25   SER B O   
1645 C CB  . SER B 27  ? 0.1122 0.1378 0.1001 -0.0134 -0.0248 0.0244  25   SER B CB  
1646 O OG  . SER B 27  ? 0.0798 0.1128 0.1346 -0.0002 -0.0070 0.0264  25   SER B OG  
1647 N N   . ASN B 28  ? 0.0852 0.0888 0.1144 0.0021  -0.0043 0.0098  26   ASN B N   
1648 C CA  . ASN B 28  ? 0.1016 0.1085 0.0867 0.0054  -0.0193 0.0187  26   ASN B CA  
1649 C C   . ASN B 28  ? 0.0924 0.1249 0.1265 -0.0172 -0.0026 0.0119  26   ASN B C   
1650 O O   . ASN B 28  ? 0.1081 0.1276 0.1413 -0.0029 0.0061  0.0310  26   ASN B O   
1651 C CB  . ASN B 28  ? 0.0891 0.0938 0.1118 -0.0076 -0.0057 0.0223  26   ASN B CB  
1652 C CG  . ASN B 28  ? 0.1211 0.1138 0.1220 -0.0036 -0.0024 0.0033  26   ASN B CG  
1653 O OD1 . ASN B 28  ? 0.0971 0.1406 0.1462 0.0019  0.0129  0.0126  26   ASN B OD1 
1654 N ND2 . ASN B 28  ? 0.1252 0.1151 0.1581 0.0237  -0.0312 0.0017  26   ASN B ND2 
1655 N N   . LEU B 29  ? 0.0909 0.1249 0.1190 -0.0026 -0.0137 0.0338  27   LEU B N   
1656 C CA  . LEU B 29  ? 0.1161 0.1086 0.1186 -0.0133 0.0000  0.0126  27   LEU B CA  
1657 C C   . LEU B 29  ? 0.1145 0.1037 0.1343 -0.0256 -0.0104 0.0238  27   LEU B C   
1658 O O   . LEU B 29  ? 0.1355 0.0909 0.1407 -0.0323 -0.0098 0.0164  27   LEU B O   
1659 C CB  . LEU B 29  ? 0.1174 0.1750 0.1829 -0.0035 -0.0025 0.0197  27   LEU B CB  
1660 C CG  . LEU B 29  ? 0.1926 0.2539 0.1723 -0.0436 -0.0004 0.0500  27   LEU B CG  
1661 C CD1 . LEU B 29  ? 0.2971 0.2218 0.3534 -0.1212 0.0396  0.0046  27   LEU B CD1 
1662 C CD2 . LEU B 29  ? 0.1836 0.3055 0.3179 -0.0415 0.0473  0.0785  27   LEU B CD2 
1663 N N   . ARG B 30  ? 0.1044 0.1066 0.1298 -0.0221 -0.0036 0.0043  28   ARG B N   
1664 C CA  . ARG B 30  ? 0.0956 0.0949 0.1226 -0.0163 0.0040  0.0083  28   ARG B CA  
1665 C C   . ARG B 30  ? 0.0895 0.0955 0.0831 -0.0130 -0.0012 0.0113  28   ARG B C   
1666 O O   . ARG B 30  ? 0.0883 0.1065 0.1271 -0.0048 0.0021  -0.0118 28   ARG B O   
1667 C CB  . ARG B 30  ? 0.1209 0.1325 0.1081 -0.0164 0.0097  0.0257  28   ARG B CB  
1668 C CG  . ARG B 30  ? 0.0974 0.1579 0.1466 -0.0157 0.0083  0.0003  28   ARG B CG  
1669 C CD  . ARG B 30  ? 0.1567 0.1279 0.2026 0.0087  0.0579  -0.0052 28   ARG B CD  
1670 N NE  . ARG B 30  ? 0.3150 0.2870 0.2390 -0.0947 0.1063  0.0161  28   ARG B NE  
1671 C CZ  . ARG B 30  ? 0.2603 0.1966 0.2192 -0.0385 0.0583  -0.0204 28   ARG B CZ  
1672 N NH1 . ARG B 30  ? 0.2734 0.3751 0.2747 0.0893  0.0716  -0.0188 28   ARG B NH1 
1673 N NH2 . ARG B 30  ? 0.2287 0.2637 0.2487 -0.0399 0.0670  0.0120  28   ARG B NH2 
1674 N N   . PRO B 31  ? 0.0923 0.0730 0.1137 -0.0106 -0.0022 0.0078  29   PRO B N   
1675 C CA  . PRO B 31  ? 0.0987 0.0700 0.1207 -0.0037 -0.0031 0.0072  29   PRO B CA  
1676 C C   . PRO B 31  ? 0.0838 0.0793 0.0912 0.0053  0.0127  0.0177  29   PRO B C   
1677 O O   . PRO B 31  ? 0.0994 0.0819 0.1041 -0.0123 0.0155  0.0014  29   PRO B O   
1678 C CB  . PRO B 31  ? 0.1071 0.1031 0.1117 -0.0242 0.0103  -0.0107 29   PRO B CB  
1679 C CG  . PRO B 31  ? 0.1484 0.1129 0.1677 -0.0434 0.0099  -0.0115 29   PRO B CG  
1680 C CD  . PRO B 31  ? 0.1301 0.0834 0.1372 -0.0243 -0.0115 0.0020  29   PRO B CD  
1681 N N   . LEU B 32  ? 0.0984 0.0585 0.1072 0.0006  -0.0090 0.0167  30   LEU B N   
1682 C CA  . LEU B 32  ? 0.0940 0.0812 0.1019 -0.0019 0.0051  0.0116  30   LEU B CA  
1683 C C   . LEU B 32  ? 0.0832 0.0757 0.1105 0.0031  0.0232  0.0148  30   LEU B C   
1684 O O   . LEU B 32  ? 0.0775 0.0856 0.0903 0.0011  0.0057  0.0090  30   LEU B O   
1685 C CB  . LEU B 32  ? 0.1089 0.0981 0.1056 0.0047  0.0070  0.0253  30   LEU B CB  
1686 C CG  . LEU B 32  ? 0.0839 0.1238 0.1237 0.0118  -0.0012 0.0422  30   LEU B CG  
1687 C CD1 . LEU B 32  ? 0.0853 0.1305 0.1556 -0.0233 -0.0098 0.0122  30   LEU B CD1 
1688 C CD2 . LEU B 32  ? 0.1109 0.1284 0.1614 0.0162  -0.0039 0.0540  30   LEU B CD2 
1689 N N   . GLU B 33  ? 0.0724 0.0776 0.1056 -0.0059 0.0039  0.0035  31   GLU B N   
1690 C CA  . GLU B 33  ? 0.1044 0.0675 0.1011 -0.0092 0.0069  0.0159  31   GLU B CA  
1691 C C   . GLU B 33  ? 0.0619 0.0721 0.0662 -0.0058 0.0143  0.0112  31   GLU B C   
1692 O O   . GLU B 33  ? 0.0891 0.0713 0.0837 -0.0058 0.0133  -0.0074 31   GLU B O   
1693 C CB  . GLU B 33  ? 0.1161 0.0879 0.1414 0.0317  0.0354  -0.0064 31   GLU B CB  
1694 C CG  . GLU B 33  ? 0.1443 0.0972 0.1472 -0.0052 0.0418  0.0167  31   GLU B CG  
1695 C CD  . GLU B 33  ? 0.0754 0.1064 0.1654 -0.0358 0.0238  0.0030  31   GLU B CD  
1696 O OE1 . GLU B 33  ? 0.1160 0.1000 0.1661 -0.0344 -0.0195 0.0222  31   GLU B OE1 
1697 O OE2 . GLU B 33  ? 0.1371 0.1648 0.1733 -0.0284 -0.0093 0.0045  31   GLU B OE2 
1698 N N   . ALA B 34  ? 0.0812 0.0763 0.0815 -0.0152 0.0068  0.0140  32   ALA B N   
1699 C CA  . ALA B 34  ? 0.0692 0.0783 0.0828 0.0023  -0.0019 0.0122  32   ALA B CA  
1700 C C   . ALA B 34  ? 0.0688 0.0674 0.0762 0.0092  0.0189  0.0122  32   ALA B C   
1701 O O   . ALA B 34  ? 0.0688 0.0530 0.1079 0.0140  0.0200  0.0007  32   ALA B O   
1702 C CB  . ALA B 34  ? 0.0934 0.0703 0.0853 0.0113  -0.0156 -0.0002 32   ALA B CB  
1703 N N   . ARG B 35  ? 0.0677 0.0602 0.0733 -0.0015 0.0084  -0.0030 33   ARG B N   
1704 C CA  . ARG B 35  ? 0.0642 0.0615 0.0723 0.0000  0.0007  0.0032  33   ARG B CA  
1705 C C   . ARG B 35  ? 0.0458 0.0720 0.0732 0.0064  0.0113  -0.0008 33   ARG B C   
1706 O O   . ARG B 35  ? 0.0584 0.0606 0.0680 0.0056  0.0010  0.0002  33   ARG B O   
1707 C CB  . ARG B 35  ? 0.0660 0.0852 0.0583 0.0117  0.0075  -0.0015 33   ARG B CB  
1708 C CG  . ARG B 35  ? 0.0654 0.0704 0.0622 0.0107  0.0097  -0.0056 33   ARG B CG  
1709 C CD  . ARG B 35  ? 0.0742 0.0649 0.0691 0.0053  0.0068  -0.0177 33   ARG B CD  
1710 N NE  . ARG B 35  ? 0.0689 0.1002 0.0901 0.0139  0.0067  -0.0241 33   ARG B NE  
1711 C CZ  . ARG B 35  ? 0.0957 0.0896 0.1084 0.0225  0.0109  -0.0040 33   ARG B CZ  
1712 N NH1 . ARG B 35  ? 0.0658 0.0866 0.1176 0.0208  0.0094  -0.0172 33   ARG B NH1 
1713 N NH2 . ARG B 35  ? 0.0863 0.1129 0.1456 0.0225  0.0101  -0.0206 33   ARG B NH2 
1714 N N   . ILE B 36  ? 0.0630 0.0783 0.0683 -0.0153 0.0151  -0.0012 34   ILE B N   
1715 C CA  . ILE B 36  ? 0.0682 0.0854 0.0814 -0.0034 0.0062  -0.0006 34   ILE B CA  
1716 C C   . ILE B 36  ? 0.0775 0.0722 0.0662 -0.0031 0.0066  0.0012  34   ILE B C   
1717 O O   . ILE B 36  ? 0.0441 0.0892 0.0732 0.0000  -0.0010 -0.0102 34   ILE B O   
1718 C CB  . ILE B 36  ? 0.0690 0.0842 0.0733 -0.0128 0.0046  -0.0060 34   ILE B CB  
1719 C CG1 . ILE B 36  ? 0.0892 0.0783 0.0804 -0.0028 0.0059  0.0037  34   ILE B CG1 
1720 C CG2 . ILE B 36  ? 0.0902 0.0900 0.0925 0.0069  -0.0038 -0.0276 34   ILE B CG2 
1721 C CD1 . ILE B 36  ? 0.1128 0.1095 0.1228 -0.0196 0.0204  0.0368  34   ILE B CD1 
1722 N N   . VAL B 37  ? 0.0699 0.0548 0.0700 -0.0085 0.0094  -0.0035 35   VAL B N   
1723 C CA  . VAL B 37  ? 0.0673 0.0845 0.0802 0.0004  0.0251  -0.0143 35   VAL B CA  
1724 C C   . VAL B 37  ? 0.0550 0.0731 0.0766 -0.0123 0.0070  -0.0069 35   VAL B C   
1725 O O   . VAL B 37  ? 0.0590 0.0679 0.0825 -0.0034 0.0019  -0.0125 35   VAL B O   
1726 C CB  . VAL B 37  ? 0.0610 0.0765 0.1108 -0.0060 0.0193  -0.0081 35   VAL B CB  
1727 C CG1 . VAL B 37  ? 0.1055 0.0776 0.1617 0.0160  0.0359  -0.0060 35   VAL B CG1 
1728 C CG2 . VAL B 37  ? 0.0951 0.0866 0.1051 0.0135  0.0159  0.0048  35   VAL B CG2 
1729 N N   . GLU B 38  ? 0.0661 0.0635 0.0853 0.0076  0.0198  -0.0039 36   GLU B N   
1730 C CA  . GLU B 38  ? 0.0641 0.0548 0.0726 0.0038  0.0000  0.0037  36   GLU B CA  
1731 C C   . GLU B 38  ? 0.0515 0.0591 0.0535 0.0067  0.0264  -0.0002 36   GLU B C   
1732 O O   . GLU B 38  ? 0.0758 0.0670 0.0717 -0.0060 0.0161  -0.0071 36   GLU B O   
1733 C CB  . GLU B 38  ? 0.0689 0.0569 0.0746 0.0056  -0.0084 0.0115  36   GLU B CB  
1734 C CG  . GLU B 38  ? 0.0681 0.0729 0.0727 -0.0036 0.0184  -0.0073 36   GLU B CG  
1735 C CD  . GLU B 38  ? 0.0938 0.0960 0.0735 -0.0318 -0.0051 -0.0052 36   GLU B CD  
1736 O OE1 . GLU B 38  ? 0.1068 0.0842 0.1095 -0.0303 -0.0063 -0.0106 36   GLU B OE1 
1737 O OE2 . GLU B 38  ? 0.1089 0.1473 0.0823 -0.0448 0.0177  -0.0079 36   GLU B OE2 
1738 N N   . CYS B 39  ? 0.0517 0.0474 0.0673 -0.0084 0.0074  -0.0081 37   CYS B N   
1739 C CA  . CYS B 39  ? 0.0539 0.0695 0.0554 -0.0081 -0.0001 0.0069  37   CYS B CA  
1740 C C   . CYS B 39  ? 0.0621 0.0466 0.0610 -0.0051 0.0124  0.0138  37   CYS B C   
1741 O O   . CYS B 39  ? 0.0623 0.0724 0.0667 -0.0192 0.0182  0.0097  37   CYS B O   
1742 C CB  . CYS B 39  ? 0.0612 0.0545 0.0772 -0.0021 0.0185  0.0120  37   CYS B CB  
1743 S SG  . CYS B 39  ? 0.0721 0.0834 0.0824 0.0000  0.0126  -0.0121 37   CYS B SG  
1744 N N   . ILE B 40  ? 0.0567 0.0623 0.0669 -0.0035 0.0059  0.0043  38   ILE B N   
1745 C CA  . ILE B 40  ? 0.0804 0.0611 0.0713 -0.0095 -0.0003 0.0029  38   ILE B CA  
1746 C C   . ILE B 40  ? 0.0670 0.0365 0.0724 -0.0007 -0.0068 -0.0191 38   ILE B C   
1747 O O   . ILE B 40  ? 0.0701 0.0748 0.0408 -0.0470 0.0037  -0.0044 38   ILE B O   
1748 C CB  . ILE B 40  ? 0.0876 0.0518 0.0674 -0.0177 0.0022  -0.0099 38   ILE B CB  
1749 C CG1 . ILE B 40  ? 0.0744 0.0857 0.0793 -0.0080 0.0090  0.0096  38   ILE B CG1 
1750 C CG2 . ILE B 40  ? 0.1348 0.0832 0.0920 -0.0018 0.0161  -0.0310 38   ILE B CG2 
1751 C CD1 . ILE B 40  ? 0.1183 0.0732 0.0646 -0.0114 0.0304  0.0078  38   ILE B CD1 
1752 N N   . LYS B 41  ? 0.0371 0.0651 0.0656 -0.0128 0.0046  0.0022  39   LYS B N   
1753 C CA  . LYS B 41  ? 0.0428 0.0624 0.0607 -0.0086 0.0064  -0.0033 39   LYS B CA  
1754 C C   . LYS B 41  ? 0.0421 0.0487 0.0677 -0.0013 0.0057  0.0111  39   LYS B C   
1755 O O   . LYS B 41  ? 0.0663 0.0521 0.0690 -0.0081 0.0180  0.0200  39   LYS B O   
1756 C CB  . LYS B 41  ? 0.0359 0.0775 0.0748 -0.0018 0.0033  0.0048  39   LYS B CB  
1757 C CG  . LYS B 41  ? 0.0838 0.0877 0.0753 0.0074  -0.0001 0.0051  39   LYS B CG  
1758 C CD  . LYS B 41  ? 0.1058 0.1237 0.1024 0.0184  -0.0212 -0.0163 39   LYS B CD  
1759 C CE  . LYS B 41  ? 0.1165 0.1025 0.1180 0.0055  0.0268  -0.0048 39   LYS B CE  
1760 N NZ  . LYS B 41  ? 0.1635 0.2117 0.1628 0.0405  -0.0400 -0.0354 39   LYS B NZ  
1761 N N   . TYR B 42  ? 0.0524 0.0559 0.0658 -0.0032 0.0104  0.0069  40   TYR B N   
1762 C CA  . TYR B 42  ? 0.0525 0.0516 0.0651 0.0127  0.0144  0.0133  40   TYR B CA  
1763 C C   . TYR B 42  ? 0.0581 0.0530 0.0837 0.0068  0.0054  0.0041  40   TYR B C   
1764 O O   . TYR B 42  ? 0.0633 0.0653 0.0751 -0.0008 0.0134  0.0127  40   TYR B O   
1765 C CB  . TYR B 42  ? 0.0602 0.0584 0.0570 0.0024  0.0104  0.0009  40   TYR B CB  
1766 C CG  . TYR B 42  ? 0.0628 0.0735 0.0627 0.0065  0.0186  0.0021  40   TYR B CG  
1767 C CD1 . TYR B 42  ? 0.0652 0.0543 0.0614 0.0245  0.0130  -0.0113 40   TYR B CD1 
1768 C CD2 . TYR B 42  ? 0.0700 0.0738 0.0642 0.0171  0.0200  0.0080  40   TYR B CD2 
1769 C CE1 . TYR B 42  ? 0.0760 0.0859 0.0595 0.0180  0.0126  0.0000  40   TYR B CE1 
1770 C CE2 . TYR B 42  ? 0.0545 0.0943 0.0727 -0.0052 0.0093  0.0041  40   TYR B CE2 
1771 C CZ  . TYR B 42  ? 0.0676 0.0671 0.0656 0.0077  0.0209  0.0002  40   TYR B CZ  
1772 O OH  . TYR B 42  ? 0.0616 0.1134 0.0892 -0.0043 0.0235  -0.0006 40   TYR B OH  
1773 N N   . THR B 43  ? 0.0492 0.0623 0.0598 -0.0089 0.0067  -0.0066 41   THR B N   
1774 C CA  . THR B 43  ? 0.0508 0.0552 0.0528 -0.0123 0.0114  -0.0073 41   THR B CA  
1775 C C   . THR B 43  ? 0.0588 0.0663 0.0596 0.0046  0.0084  -0.0071 41   THR B C   
1776 O O   . THR B 43  ? 0.0724 0.0678 0.0721 -0.0069 0.0236  -0.0186 41   THR B O   
1777 C CB  . THR B 43  ? 0.0717 0.0592 0.0649 -0.0171 -0.0074 -0.0095 41   THR B CB  
1778 O OG1 . THR B 43  ? 0.0762 0.0693 0.0826 0.0115  0.0028  -0.0032 41   THR B OG1 
1779 C CG2 . THR B 43  ? 0.0621 0.1010 0.0691 -0.0149 -0.0081 -0.0250 41   THR B CG2 
1780 N N   . VAL B 44  ? 0.0566 0.0715 0.0626 -0.0050 0.0002  -0.0072 42   VAL B N   
1781 C CA  . VAL B 44  ? 0.0683 0.0678 0.0552 0.0010  0.0064  0.0024  42   VAL B CA  
1782 C C   . VAL B 44  ? 0.0568 0.0740 0.0519 -0.0113 0.0115  -0.0043 42   VAL B C   
1783 O O   . VAL B 44  ? 0.0677 0.0709 0.0757 -0.0119 0.0117  0.0003  42   VAL B O   
1784 C CB  . VAL B 44  ? 0.0668 0.0650 0.0458 -0.0014 -0.0053 -0.0135 42   VAL B CB  
1785 C CG1 . VAL B 44  ? 0.0752 0.0668 0.0681 0.0135  -0.0209 0.0085  42   VAL B CG1 
1786 C CG2 . VAL B 44  ? 0.0858 0.0823 0.0751 -0.0297 0.0054  0.0036  42   VAL B CG2 
1787 N N   . CYS B 45  ? 0.0409 0.0815 0.0527 -0.0017 0.0020  -0.0027 43   CYS B N   
1788 C CA  . CYS B 45  ? 0.0695 0.0603 0.0808 -0.0208 0.0162  -0.0033 43   CYS B CA  
1789 C C   . CYS B 45  ? 0.0597 0.0690 0.0619 -0.0014 0.0142  -0.0099 43   CYS B C   
1790 O O   . CYS B 45  ? 0.0645 0.0635 0.0891 -0.0014 -0.0070 -0.0038 43   CYS B O   
1791 C CB  . CYS B 45  ? 0.0806 0.0732 0.0782 -0.0051 0.0317  -0.0059 43   CYS B CB  
1792 S SG  . CYS B 45  ? 0.0891 0.0795 0.0972 -0.0034 -0.0079 0.0100  43   CYS B SG  
1793 N N   . CME B 46  ? 0.0680 0.0925 0.0656 0.0101  0.0099  -0.0005 44   CME B N   
1794 C CA  . CME B 46  ? 0.0652 0.1007 0.0927 -0.0018 0.0174  -0.0059 44   CME B CA  
1795 C CB  . CME B 46  ? 0.0711 0.1425 0.0866 0.0335  0.0271  0.0053  44   CME B CB  
1796 S SG  . CME B 46  ? 0.0954 0.1431 0.1737 0.0134  0.0179  -0.0296 44   CME B SG  
1797 S SD  . CME B 46  ? 0.2083 0.2580 0.1693 -0.0142 0.0472  0.0063  44   CME B SD  
1798 C CE  . CME B 46  ? 0.1620 0.2752 0.2925 0.0126  0.0346  0.0072  44   CME B CE  
1799 C CZ  . CME B 46  ? 0.2322 0.2508 0.3006 0.0822  0.0201  -0.0027 44   CME B CZ  
1800 O OH  . CME B 46  ? 0.1478 0.1973 0.2764 -0.0099 0.0351  0.0256  44   CME B OH  
1801 C C   . CME B 46  ? 0.0875 0.1072 0.0911 -0.0285 0.0204  0.0059  44   CME B C   
1802 O O   . CME B 46  ? 0.0729 0.1246 0.1167 -0.0314 0.0244  -0.0046 44   CME B O   
1803 N N   . HIS B 47  ? 0.0597 0.0862 0.0832 -0.0195 0.0036  0.0003  45   HIS B N   
1804 C CA  . HIS B 47  ? 0.0813 0.0861 0.0816 -0.0103 -0.0015 -0.0090 45   HIS B CA  
1805 C C   . HIS B 47  ? 0.1009 0.0926 0.0863 -0.0083 -0.0111 -0.0077 45   HIS B C   
1806 O O   . HIS B 47  ? 0.1399 0.1041 0.1481 -0.0285 -0.0341 -0.0089 45   HIS B O   
1807 C CB  . HIS B 47  ? 0.0890 0.0879 0.0831 0.0038  -0.0039 -0.0109 45   HIS B CB  
1808 C CG  . HIS B 47  ? 0.0767 0.0851 0.0664 -0.0031 -0.0044 -0.0107 45   HIS B CG  
1809 N ND1 . HIS B 47  ? 0.0922 0.1180 0.1252 0.0023  -0.0293 -0.0067 45   HIS B ND1 
1810 C CD2 . HIS B 47  ? 0.0996 0.0883 0.0861 -0.0088 -0.0124 -0.0163 45   HIS B CD2 
1811 C CE1 . HIS B 47  ? 0.1197 0.0935 0.1088 -0.0161 -0.0354 -0.0127 45   HIS B CE1 
1812 N NE2 . HIS B 47  ? 0.0891 0.1344 0.0812 -0.0323 -0.0184 0.0376  45   HIS B NE2 
1813 N N   . ILE B 48  ? 0.0754 0.0938 0.0974 -0.0251 0.0000  0.0028  46   ILE B N   
1814 C CA  . ILE B 48  ? 0.0998 0.0884 0.0953 -0.0076 -0.0031 -0.0059 46   ILE B CA  
1815 C C   . ILE B 48  ? 0.0881 0.0877 0.1095 -0.0060 -0.0036 0.0000  46   ILE B C   
1816 O O   . ILE B 48  ? 0.1057 0.0880 0.1226 -0.0229 -0.0032 0.0106  46   ILE B O   
1817 C CB  . ILE B 48  ? 0.0859 0.0780 0.0925 -0.0148 0.0044  -0.0008 46   ILE B CB  
1818 C CG1 . ILE B 48  ? 0.0725 0.1011 0.0870 -0.0194 -0.0001 -0.0098 46   ILE B CG1 
1819 C CG2 . ILE B 48  ? 0.1094 0.0932 0.1100 0.0066  0.0111  0.0171  46   ILE B CG2 
1820 C CD1 . ILE B 48  ? 0.0845 0.1198 0.1171 -0.0188 -0.0221 -0.0101 46   ILE B CD1 
1821 N N   . SER B 49  ? 0.0957 0.0881 0.0925 -0.0197 0.0028  0.0206  47   SER B N   
1822 C CA  . SER B 49  ? 0.1011 0.0993 0.1005 -0.0241 0.0226  0.0055  47   SER B CA  
1823 C C   . SER B 49  ? 0.1094 0.1266 0.1659 -0.0261 0.0154  0.0318  47   SER B C   
1824 O O   . SER B 49  ? 0.1041 0.1575 0.2446 -0.0464 -0.0326 0.0784  47   SER B O   
1825 C CB  . SER B 49  ? 0.1320 0.1530 0.0718 -0.0597 0.0272  0.0220  47   SER B CB  
1826 O OG  . SER B 49  ? 0.2040 0.1805 0.1420 -0.0230 0.0239  0.0103  47   SER B OG  
1827 N N   . ASP B 50  ? 0.1130 0.1725 0.2140 -0.0613 0.0284  0.0882  48   ASP B N   
1828 C CA  . ASP B 50  ? 0.1421 0.2376 0.3441 0.0107  -0.0438 0.0314  48   ASP B CA  
1829 C C   . ASP B 50  ? 0.1757 0.2671 0.3127 -0.0432 -0.0677 0.0819  48   ASP B C   
1830 O O   . ASP B 50  ? 0.2131 0.3289 0.2833 -0.0529 -0.0665 0.0513  48   ASP B O   
1831 C CB  . ASP B 50  ? 0.2054 0.2689 0.2638 -0.0490 -0.0070 0.0630  48   ASP B CB  
1832 C CG  . ASP B 50  ? 0.2892 0.4421 0.4319 0.0307  -0.0846 -0.0592 48   ASP B CG  
1833 O OD1 . ASP B 50  ? 0.3934 0.3194 0.3292 -0.0663 -0.1638 0.0970  48   ASP B OD1 
1834 O OD2 . ASP B 50  ? 0.3501 0.5176 0.6553 0.0572  0.0371  -0.1371 48   ASP B OD2 
1835 N N   . MET B 51  ? 0.1991 0.2596 0.3054 -0.0262 -0.0296 0.0258  49   MET B N   
1836 C CA  . MET B 51  ? 0.1403 0.3050 0.2927 -0.1034 -0.0255 0.1161  49   MET B CA  
1837 C C   . MET B 51  ? 0.1989 0.2509 0.2504 -0.1068 -0.0069 0.0301  49   MET B C   
1838 O O   . MET B 51  ? 0.2249 0.2480 0.3615 -0.1298 -0.1351 0.0812  49   MET B O   
1839 C CB  . MET B 51  ? 0.1813 0.3521 0.2886 -0.0779 -0.0586 0.0419  49   MET B CB  
1840 C CG  . MET B 51  ? 0.3743 0.3091 0.4466 -0.0040 -0.0653 0.0723  49   MET B CG  
1841 S SD  . MET B 51  ? 0.6547 0.7690 0.5478 -0.1157 0.0562  -0.1003 49   MET B SD  
1842 C CE  . MET B 51  ? 0.5306 0.3889 0.3916 -0.0521 0.1927  0.0322  49   MET B CE  
1843 N N   . HIS B 52  ? 0.1939 0.1989 0.1564 -0.1005 -0.0063 0.0549  50   HIS B N   
1844 C CA  . HIS B 52  ? 0.1935 0.1999 0.1155 -0.1097 -0.0172 0.0182  50   HIS B CA  
1845 C C   . HIS B 52  ? 0.2440 0.1611 0.1076 -0.0376 0.0140  0.0059  50   HIS B C   
1846 O O   . HIS B 52  ? 0.2369 0.1818 0.0984 -0.0543 -0.0054 0.0186  50   HIS B O   
1847 C CB  . HIS B 52  ? 0.1743 0.2180 0.1571 -0.0557 -0.0236 0.0171  50   HIS B CB  
1848 C CG  . HIS B 52  ? 0.2890 0.2478 0.1791 -0.0780 0.0403  -0.0146 50   HIS B CG  
1849 N ND1 . HIS B 52  ? 0.3762 0.2992 0.2198 -0.0102 0.0813  -0.0631 50   HIS B ND1 
1850 C CD2 . HIS B 52  ? 0.1838 0.2002 0.1606 -0.0816 0.0958  -0.0142 50   HIS B CD2 
1851 C CE1 . HIS B 52  ? 0.2772 0.2674 0.2178 -0.0461 0.0856  -0.0629 50   HIS B CE1 
1852 N NE2 . HIS B 52  ? 0.2109 0.2352 0.1420 -0.0730 0.0508  0.0026  50   HIS B NE2 
1853 N N   . LEU B 53  ? 0.2823 0.1979 0.1081 -0.0662 0.0066  0.0243  51   LEU B N   
1854 C CA  . LEU B 53  ? 0.2190 0.1505 0.1216 -0.0478 0.0100  0.0131  51   LEU B CA  
1855 C C   . LEU B 53  ? 0.2006 0.1226 0.1526 -0.0577 0.0480  0.0049  51   LEU B C   
1856 O O   . LEU B 53  ? 0.3401 0.2365 0.1668 -0.0536 0.1098  -0.0460 51   LEU B O   
1857 C CB  . LEU B 53  ? 0.1915 0.2333 0.1811 -0.0410 -0.0311 0.0178  51   LEU B CB  
1858 C CG  . LEU B 53  ? 0.1451 0.2502 0.1981 -0.0557 -0.0786 0.0184  51   LEU B CG  
1859 C CD1 . LEU B 53  ? 0.1449 0.3096 0.3077 -0.0651 -0.1014 0.0342  51   LEU B CD1 
1860 C CD2 . LEU B 53  ? 0.1924 0.2117 0.3147 0.0586  -0.0565 0.0288  51   LEU B CD2 
1861 N N   . HIS B 54  ? 0.1565 0.1714 0.1289 -0.0239 0.0353  0.0021  52   HIS B N   
1862 C CA  . HIS B 54  ? 0.1794 0.1592 0.1830 -0.0267 0.0453  0.0064  52   HIS B CA  
1863 C C   . HIS B 54  ? 0.1443 0.1314 0.1767 -0.0537 0.0285  -0.0199 52   HIS B C   
1864 O O   . HIS B 54  ? 0.1081 0.1139 0.1714 -0.0318 0.0550  0.0091  52   HIS B O   
1865 C CB  . HIS B 54  ? 0.1786 0.1477 0.1593 -0.0106 0.0278  -0.0054 52   HIS B CB  
1866 C CG  . HIS B 54  ? 0.1300 0.1502 0.2111 0.0059  0.0562  -0.0115 52   HIS B CG  
1867 N ND1 . HIS B 54  ? 0.1726 0.1594 0.3036 -0.0164 0.0728  -0.0400 52   HIS B ND1 
1868 C CD2 . HIS B 54  ? 0.1811 0.1616 0.2050 -0.0083 0.0546  0.0422  52   HIS B CD2 
1869 C CE1 . HIS B 54  ? 0.2142 0.1913 0.2475 0.0430  0.0618  -0.0148 52   HIS B CE1 
1870 N NE2 . HIS B 54  ? 0.2660 0.1602 0.2857 -0.0044 0.0881  0.0199  52   HIS B NE2 
1871 N N   A ASN B 55  ? 0.1599 0.1176 0.1824 -0.0434 0.0491  -0.0344 53   ASN B N   
1872 N N   B ASN B 55  ? 0.1490 0.1144 0.1803 -0.0367 0.0445  -0.0262 53   ASN B N   
1873 C CA  A ASN B 55  ? 0.1540 0.1262 0.1753 -0.0449 0.0493  -0.0415 53   ASN B CA  
1874 C CA  B ASN B 55  ? 0.1447 0.1175 0.1572 -0.0376 0.0371  -0.0332 53   ASN B CA  
1875 C C   A ASN B 55  ? 0.1117 0.1052 0.1629 -0.0641 0.0106  -0.0250 53   ASN B C   
1876 C C   B ASN B 55  ? 0.1126 0.1088 0.1655 -0.0530 0.0183  -0.0231 53   ASN B C   
1877 O O   A ASN B 55  ? 0.1760 0.1322 0.1637 -0.0336 0.0331  -0.0009 53   ASN B O   
1878 O O   B ASN B 55  ? 0.1651 0.1254 0.1613 -0.0324 0.0332  0.0008  53   ASN B O   
1879 C CB  A ASN B 55  ? 0.1888 0.1511 0.2171 -0.0311 0.0371  0.0369  53   ASN B CB  
1880 C CB  B ASN B 55  ? 0.1592 0.1162 0.1924 -0.0267 0.0265  0.0287  53   ASN B CB  
1881 C CG  A ASN B 55  ? 0.2243 0.1688 0.2361 -0.0020 0.0569  0.0252  53   ASN B CG  
1882 C CG  B ASN B 55  ? 0.1545 0.1355 0.1639 -0.0253 0.0114  0.0361  53   ASN B CG  
1883 O OD1 A ASN B 55  ? 0.3414 0.2244 0.2814 -0.0125 0.0732  -0.0187 53   ASN B OD1 
1884 O OD1 B ASN B 55  ? 0.2107 0.1533 0.2690 -0.0584 -0.0297 0.0626  53   ASN B OD1 
1885 N ND2 A ASN B 55  ? 0.1454 0.2379 0.3014 0.0108  0.0790  0.0633  53   ASN B ND2 
1886 N ND2 B ASN B 55  ? 0.2117 0.0529 0.1662 0.0127  -0.0116 0.0116  53   ASN B ND2 
1887 N N   . GLY B 56  ? 0.1212 0.1791 0.1984 -0.0480 0.0239  0.0063  54   GLY B N   
1888 C CA  . GLY B 56  ? 0.1477 0.1637 0.1979 -0.0346 -0.0027 -0.0310 54   GLY B CA  
1889 C C   . GLY B 56  ? 0.1270 0.1548 0.1696 -0.0404 -0.0046 -0.0036 54   GLY B C   
1890 O O   . GLY B 56  ? 0.1199 0.1831 0.2455 -0.0609 -0.0082 -0.0005 54   GLY B O   
1891 N N   . VAL B 57  ? 0.1080 0.1381 0.1500 -0.0464 0.0103  0.0244  55   VAL B N   
1892 C CA  . VAL B 57  ? 0.0904 0.1377 0.1284 -0.0114 0.0273  0.0218  55   VAL B CA  
1893 C C   . VAL B 57  ? 0.1006 0.1053 0.1230 -0.0171 0.0267  0.0102  55   VAL B C   
1894 O O   . VAL B 57  ? 0.0931 0.1313 0.1296 -0.0265 0.0219  0.0074  55   VAL B O   
1895 C CB  . VAL B 57  ? 0.1163 0.1261 0.1280 -0.0180 0.0278  0.0057  55   VAL B CB  
1896 C CG1 . VAL B 57  ? 0.1111 0.1616 0.1898 -0.0177 0.0293  0.0401  55   VAL B CG1 
1897 C CG2 . VAL B 57  ? 0.1374 0.1411 0.1508 -0.0112 0.0093  0.0450  55   VAL B CG2 
1898 N N   . PRO B 58  ? 0.1011 0.1156 0.1171 -0.0232 0.0270  -0.0046 56   PRO B N   
1899 C CA  . PRO B 58  ? 0.0909 0.1264 0.0913 -0.0168 0.0242  0.0082  56   PRO B CA  
1900 C C   . PRO B 58  ? 0.0990 0.0897 0.0830 -0.0353 0.0070  0.0071  56   PRO B C   
1901 O O   . PRO B 58  ? 0.1131 0.0898 0.0921 -0.0245 0.0181  0.0065  56   PRO B O   
1902 C CB  . PRO B 58  ? 0.1155 0.1231 0.1316 -0.0016 0.0268  0.0078  56   PRO B CB  
1903 C CG  . PRO B 58  ? 0.1148 0.1102 0.1422 -0.0119 0.0289  -0.0100 56   PRO B CG  
1904 C CD  . PRO B 58  ? 0.1174 0.1252 0.1334 0.0154  0.0349  0.0208  56   PRO B CD  
1905 N N   . ARG B 59  ? 0.0912 0.1032 0.0980 -0.0188 0.0179  0.0293  57   ARG B N   
1906 C CA  . ARG B 59  ? 0.0795 0.1197 0.0987 -0.0232 0.0016  0.0071  57   ARG B CA  
1907 C C   . ARG B 59  ? 0.0968 0.0934 0.0844 -0.0232 0.0116  0.0011  57   ARG B C   
1908 O O   . ARG B 59  ? 0.0942 0.0976 0.1096 -0.0183 0.0245  0.0205  57   ARG B O   
1909 C CB  . ARG B 59  ? 0.1075 0.1079 0.1138 -0.0218 0.0216  -0.0137 57   ARG B CB  
1910 C CG  . ARG B 59  ? 0.1240 0.1042 0.1169 -0.0170 0.0232  0.0203  57   ARG B CG  
1911 C CD  . ARG B 59  ? 0.1091 0.1109 0.1258 -0.0133 0.0288  0.0173  57   ARG B CD  
1912 N NE  . ARG B 59  ? 0.1191 0.0918 0.1178 -0.0235 0.0350  0.0290  57   ARG B NE  
1913 C CZ  . ARG B 59  ? 0.1661 0.1389 0.1161 -0.0041 0.0326  -0.0201 57   ARG B CZ  
1914 N NH1 . ARG B 59  ? 0.1412 0.1792 0.1560 0.0086  0.0391  -0.0235 57   ARG B NH1 
1915 N NH2 . ARG B 59  ? 0.1713 0.0976 0.1125 0.0145  0.0243  0.0030  57   ARG B NH2 
1916 N N   . TYR B 60  ? 0.1082 0.0914 0.1073 -0.0467 0.0091  0.0154  58   TYR B N   
1917 C CA  . TYR B 60  ? 0.0841 0.0779 0.1091 -0.0239 0.0028  0.0081  58   TYR B CA  
1918 C C   . TYR B 60  ? 0.0844 0.0980 0.1007 -0.0144 0.0000  0.0015  58   TYR B C   
1919 O O   . TYR B 60  ? 0.0881 0.1330 0.1215 -0.0234 0.0053  -0.0013 58   TYR B O   
1920 C CB  . TYR B 60  ? 0.0739 0.1035 0.0932 -0.0051 0.0222  0.0086  58   TYR B CB  
1921 C CG  . TYR B 60  ? 0.0801 0.0790 0.0680 -0.0196 0.0224  0.0250  58   TYR B CG  
1922 C CD1 . TYR B 60  ? 0.0703 0.0995 0.0992 -0.0261 0.0184  0.0207  58   TYR B CD1 
1923 C CD2 . TYR B 60  ? 0.0711 0.0540 0.0917 -0.0335 0.0091  0.0042  58   TYR B CD2 
1924 C CE1 . TYR B 60  ? 0.0653 0.0892 0.0644 -0.0323 -0.0067 0.0139  58   TYR B CE1 
1925 C CE2 . TYR B 60  ? 0.0700 0.0697 0.0829 -0.0262 0.0130  0.0046  58   TYR B CE2 
1926 C CZ  . TYR B 60  ? 0.0655 0.0692 0.0945 -0.0234 0.0049  0.0024  58   TYR B CZ  
1927 O OH  . TYR B 60  ? 0.0874 0.0986 0.1000 -0.0151 0.0174  0.0034  58   TYR B OH  
1928 N N   . ILE B 61  ? 0.0747 0.0886 0.0777 -0.0151 0.0184  0.0038  59   ILE B N   
1929 C CA  . ILE B 61  ? 0.0703 0.0765 0.0975 -0.0064 0.0227  0.0038  59   ILE B CA  
1930 C C   . ILE B 61  ? 0.0626 0.0893 0.1094 -0.0044 0.0160  0.0220  59   ILE B C   
1931 O O   . ILE B 61  ? 0.0716 0.0729 0.1448 0.0142  0.0250  0.0218  59   ILE B O   
1932 C CB  . ILE B 61  ? 0.1108 0.0950 0.1090 -0.0075 0.0131  -0.0025 59   ILE B CB  
1933 C CG1 . ILE B 61  ? 0.1817 0.1264 0.0886 -0.0384 0.0074  0.0055  59   ILE B CG1 
1934 C CG2 . ILE B 61  ? 0.1388 0.0960 0.0967 -0.0286 0.0203  -0.0039 59   ILE B CG2 
1935 C CD1 . ILE B 61  ? 0.2035 0.3080 0.2529 -0.0015 -0.0106 0.0276  59   ILE B CD1 
1936 N N   . VAL B 62  ? 0.0519 0.0786 0.0894 0.0038  0.0211  0.0088  60   VAL B N   
1937 C CA  . VAL B 62  ? 0.0681 0.0719 0.0787 0.0109  0.0146  -0.0006 60   VAL B CA  
1938 C C   . VAL B 62  ? 0.0704 0.0932 0.0663 -0.0054 0.0084  0.0044  60   VAL B C   
1939 O O   . VAL B 62  ? 0.0723 0.1148 0.1083 0.0006  0.0170  0.0015  60   VAL B O   
1940 C CB  . VAL B 62  ? 0.0772 0.0864 0.0697 0.0222  0.0149  -0.0004 60   VAL B CB  
1941 C CG1 . VAL B 62  ? 0.1010 0.1266 0.1055 -0.0007 0.0295  0.0085  60   VAL B CG1 
1942 C CG2 . VAL B 62  ? 0.1003 0.1381 0.0876 0.0104  0.0024  -0.0185 60   VAL B CG2 
1943 N N   . ASN B 63  ? 0.0663 0.0896 0.0766 0.0078  0.0207  -0.0001 61   ASN B N   
1944 C CA  . ASN B 63  ? 0.0923 0.0791 0.0742 0.0037  0.0148  0.0080  61   ASN B CA  
1945 C C   . ASN B 63  ? 0.0423 0.0855 0.0725 0.0040  0.0166  -0.0003 61   ASN B C   
1946 O O   . ASN B 63  ? 0.0931 0.1040 0.0822 0.0034  0.0067  -0.0122 61   ASN B O   
1947 C CB  . ASN B 63  ? 0.0825 0.0857 0.0917 -0.0012 0.0138  -0.0048 61   ASN B CB  
1948 C CG  . ASN B 63  ? 0.1009 0.0958 0.0987 0.0001  0.0249  0.0047  61   ASN B CG  
1949 O OD1 . ASN B 63  ? 0.0818 0.1342 0.0892 0.0050  0.0135  -0.0048 61   ASN B OD1 
1950 N ND2 . ASN B 63  ? 0.1007 0.1063 0.0911 0.0159  0.0208  0.0065  61   ASN B ND2 
1951 N N   . MET B 64  ? 0.0679 0.0903 0.0687 -0.0010 0.0085  0.0096  62   MET B N   
1952 C CA  . MET B 64  ? 0.0666 0.0827 0.0679 0.0039  -0.0108 -0.0045 62   MET B CA  
1953 C C   . MET B 64  ? 0.0637 0.0876 0.0564 0.0024  0.0158  0.0204  62   MET B C   
1954 O O   . MET B 64  ? 0.0601 0.0821 0.0688 0.0076  0.0149  0.0033  62   MET B O   
1955 C CB  . MET B 64  ? 0.0613 0.0600 0.0704 0.0026  0.0029  -0.0069 62   MET B CB  
1956 C CG  . MET B 64  ? 0.0610 0.0729 0.0683 -0.0028 0.0164  -0.0064 62   MET B CG  
1957 S SD  . MET B 64  ? 0.0664 0.0931 0.0707 0.0008  0.0129  0.0042  62   MET B SD  
1958 C CE  . MET B 64  ? 0.0974 0.0824 0.0655 -0.0124 -0.0082 0.0281  62   MET B CE  
1959 N N   . TRP B 65  ? 0.0746 0.0966 0.0815 0.0225  0.0021  -0.0071 63   TRP B N   
1960 C CA  . TRP B 65  ? 0.0685 0.1025 0.0746 0.0052  0.0069  -0.0187 63   TRP B CA  
1961 C C   . TRP B 65  ? 0.1051 0.0946 0.0825 0.0149  0.0209  -0.0088 63   TRP B C   
1962 O O   . TRP B 65  ? 0.0885 0.1083 0.0828 0.0157  0.0296  0.0005  63   TRP B O   
1963 C CB  . TRP B 65  ? 0.0693 0.1191 0.0830 -0.0044 0.0135  0.0147  63   TRP B CB  
1964 C CG  . TRP B 65  ? 0.0628 0.0627 0.0880 0.0071  0.0055  0.0070  63   TRP B CG  
1965 C CD1 . TRP B 65  ? 0.0724 0.0675 0.0767 0.0052  -0.0014 -0.0102 63   TRP B CD1 
1966 C CD2 . TRP B 65  ? 0.0786 0.0646 0.0751 0.0104  0.0038  -0.0077 63   TRP B CD2 
1967 N NE1 . TRP B 65  ? 0.0759 0.0874 0.0962 -0.0057 0.0048  -0.0001 63   TRP B NE1 
1968 C CE2 . TRP B 65  ? 0.0831 0.0959 0.0733 0.0077  0.0064  0.0029  63   TRP B CE2 
1969 C CE3 . TRP B 65  ? 0.0684 0.0741 0.0818 -0.0117 0.0100  -0.0112 63   TRP B CE3 
1970 C CZ2 . TRP B 65  ? 0.0768 0.0750 0.0732 0.0016  0.0067  -0.0101 63   TRP B CZ2 
1971 C CZ3 . TRP B 65  ? 0.0799 0.0905 0.0801 0.0026  0.0212  -0.0068 63   TRP B CZ3 
1972 C CH2 . TRP B 65  ? 0.0794 0.0794 0.0688 -0.0048 0.0027  -0.0028 63   TRP B CH2 
1973 N N   . THR B 66  ? 0.1327 0.1063 0.0793 0.0348  0.0295  -0.0020 64   THR B N   
1974 C CA  . THR B 66  ? 0.1077 0.1491 0.0842 0.0171  0.0343  -0.0107 64   THR B CA  
1975 C C   . THR B 66  ? 0.1223 0.1176 0.1140 0.0435  0.0215  -0.0154 64   THR B C   
1976 O O   . THR B 66  ? 0.1324 0.1291 0.0828 0.0218  0.0225  -0.0199 64   THR B O   
1977 C CB  . THR B 66  ? 0.0899 0.1589 0.0956 0.0107  0.0131  -0.0010 64   THR B CB  
1978 O OG1 . THR B 66  ? 0.1380 0.1254 0.0892 0.0243  0.0158  0.0081  64   THR B OG1 
1979 C CG2 . THR B 66  ? 0.0808 0.1430 0.0777 0.0134  0.0231  -0.0105 64   THR B CG2 
1980 N N   . PRO B 67  ? 0.1284 0.1505 0.1052 0.0598  0.0086  -0.0013 65   PRO B N   
1981 C CA  . PRO B 67  ? 0.1543 0.1416 0.1139 0.0273  -0.0035 -0.0385 65   PRO B CA  
1982 C C   . PRO B 67  ? 0.1694 0.1657 0.1265 0.0294  0.0062  -0.0107 65   PRO B C   
1983 O O   . PRO B 67  ? 0.1417 0.1506 0.1079 0.0465  -0.0020 -0.0151 65   PRO B O   
1984 C CB  . PRO B 67  ? 0.1990 0.1909 0.0963 0.0643  -0.0024 -0.0158 65   PRO B CB  
1985 C CG  . PRO B 67  ? 0.2001 0.2133 0.1662 0.1030  0.0062  -0.0366 65   PRO B CG  
1986 C CD  . PRO B 67  ? 0.1425 0.1771 0.1325 0.0762  0.0276  0.0139  65   PRO B CD  
1987 N N   . PRO B 68  ? 0.1760 0.1873 0.1665 0.0208  0.0157  -0.0155 66   PRO B N   
1988 C CA  . PRO B 68  ? 0.1769 0.1951 0.2056 0.0103  0.0242  0.0354  66   PRO B CA  
1989 C C   . PRO B 68  ? 0.0828 0.1545 0.1606 0.0326  -0.0011 0.0057  66   PRO B C   
1990 O O   . PRO B 68  ? 0.1288 0.1607 0.1486 0.0471  0.0066  0.0187  66   PRO B O   
1991 C CB  . PRO B 68  ? 0.1860 0.2572 0.2946 -0.0191 -0.0350 0.0848  66   PRO B CB  
1992 C CG  . PRO B 68  ? 0.2165 0.2607 0.2894 -0.0340 -0.0442 0.0182  66   PRO B CG  
1993 C CD  . PRO B 68  ? 0.2166 0.1865 0.2176 0.0276  0.0109  0.0305  66   PRO B CD  
1994 N N   . GLU B 69  ? 0.1460 0.1904 0.1271 0.0294  -0.0147 0.0049  67   GLU B N   
1995 C CA  . GLU B 69  ? 0.1551 0.1796 0.1385 0.0102  0.0046  -0.0014 67   GLU B CA  
1996 C C   . GLU B 69  ? 0.1494 0.1626 0.1002 0.0177  0.0448  -0.0136 67   GLU B C   
1997 O O   . GLU B 69  ? 0.1397 0.1683 0.1449 -0.0022 0.0255  0.0041  67   GLU B O   
1998 C CB  . GLU B 69  ? 0.1600 0.1870 0.1504 0.0401  -0.0132 -0.0009 67   GLU B CB  
1999 C CG  . GLU B 69  ? 0.1970 0.2202 0.1929 0.0045  -0.0514 -0.0116 67   GLU B CG  
2000 C CD  . GLU B 69  ? 0.2383 0.2470 0.1957 -0.0276 -0.0546 -0.0102 67   GLU B CD  
2001 O OE1 . GLU B 69  ? 0.2143 0.2514 0.1713 0.0486  -0.0369 0.0022  67   GLU B OE1 
2002 O OE2 . GLU B 69  ? 0.4027 0.2624 0.2939 -0.0547 -0.0504 -0.0784 67   GLU B OE2 
2003 N N   . VAL B 70  ? 0.1143 0.1768 0.1270 0.0250  0.0280  -0.0002 68   VAL B N   
2004 C CA  . VAL B 70  ? 0.1156 0.1753 0.1124 0.0449  0.0301  -0.0038 68   VAL B CA  
2005 C C   . VAL B 70  ? 0.1508 0.1536 0.1134 -0.0035 0.0165  -0.0183 68   VAL B C   
2006 O O   . VAL B 70  ? 0.1189 0.1712 0.1384 0.0181  0.0309  0.0093  68   VAL B O   
2007 C CB  . VAL B 70  ? 0.1141 0.2053 0.1172 0.0420  -0.0069 -0.0412 68   VAL B CB  
2008 C CG1 . VAL B 70  ? 0.1473 0.1816 0.1670 0.0054  -0.0135 -0.0593 68   VAL B CG1 
2009 C CG2 . VAL B 70  ? 0.1397 0.2132 0.1406 0.0647  0.0471  -0.0081 68   VAL B CG2 
2010 N N   . ALA B 71  ? 0.1034 0.1450 0.0994 0.0087  0.0024  -0.0046 69   ALA B N   
2011 C CA  . ALA B 71  ? 0.0889 0.1496 0.1359 0.0081  -0.0021 -0.0159 69   ALA B CA  
2012 C C   . ALA B 71  ? 0.1022 0.1615 0.1203 -0.0028 0.0406  -0.0043 69   ALA B C   
2013 O O   . ALA B 71  ? 0.1080 0.1444 0.1012 0.0166  0.0134  0.0166  69   ALA B O   
2014 C CB  . ALA B 71  ? 0.1332 0.1667 0.1042 0.0060  0.0138  0.0060  69   ALA B CB  
2015 N N   A ASP B 72  ? 0.0922 0.1570 0.1157 0.0178  0.0265  -0.0002 70   ASP B N   
2016 N N   B ASP B 72  ? 0.0929 0.1488 0.1164 0.0144  0.0256  0.0043  70   ASP B N   
2017 C CA  A ASP B 72  ? 0.1409 0.1455 0.1568 -0.0019 0.0175  0.0311  70   ASP B CA  
2018 C CA  B ASP B 72  ? 0.1220 0.1378 0.1368 -0.0017 0.0154  0.0215  70   ASP B CA  
2019 C C   A ASP B 72  ? 0.1302 0.1705 0.1560 -0.0210 -0.0009 0.0213  70   ASP B C   
2020 C C   B ASP B 72  ? 0.1344 0.1654 0.1411 -0.0256 0.0070  0.0190  70   ASP B C   
2021 O O   A ASP B 72  ? 0.1639 0.1868 0.1306 -0.0251 -0.0089 0.0306  70   ASP B O   
2022 O O   B ASP B 72  ? 0.1625 0.1762 0.1413 -0.0181 -0.0146 0.0092  70   ASP B O   
2023 C CB  A ASP B 72  ? 0.1895 0.1590 0.1569 0.0299  -0.0095 0.0270  70   ASP B CB  
2024 C CB  B ASP B 72  ? 0.1029 0.1396 0.1249 0.0052  0.0291  0.0179  70   ASP B CB  
2025 C CG  A ASP B 72  ? 0.2040 0.2449 0.2529 0.0450  0.0135  -0.0397 70   ASP B CG  
2026 C CG  B ASP B 72  ? 0.1177 0.1910 0.1160 0.0052  0.0289  0.0491  70   ASP B CG  
2027 O OD1 A ASP B 72  ? 0.2571 0.2900 0.3558 0.0425  0.0989  -0.0642 70   ASP B OD1 
2028 O OD1 B ASP B 72  ? 0.1500 0.2070 0.1316 0.0504  -0.0449 0.0209  70   ASP B OD1 
2029 O OD2 A ASP B 72  ? 0.2143 0.2663 0.4098 -0.0346 -0.0180 -0.0051 70   ASP B OD2 
2030 O OD2 B ASP B 72  ? 0.1765 0.1873 0.1738 0.0165  -0.0841 -0.0002 70   ASP B OD2 
2031 N N   . GLN B 73  ? 0.1634 0.1593 0.0954 -0.0264 0.0396  0.0007  71   GLN B N   
2032 C CA  . GLN B 73  ? 0.1838 0.2063 0.1571 -0.0437 0.0726  0.0052  71   GLN B CA  
2033 C C   . GLN B 73  ? 0.1279 0.1840 0.1414 0.0000  0.0189  0.0005  71   GLN B C   
2034 O O   . GLN B 73  ? 0.2047 0.1960 0.1363 -0.0095 0.0569  -0.0072 71   GLN B O   
2035 C CB  . GLN B 73  ? 0.1866 0.2199 0.1614 -0.0272 0.0443  0.0110  71   GLN B CB  
2036 C CG  . GLN B 73  ? 0.2194 0.1502 0.2320 -0.0037 -0.0008 0.0079  71   GLN B CG  
2037 C CD  . GLN B 73  ? 0.2211 0.2133 0.2233 0.0276  0.0147  -0.0038 71   GLN B CD  
2038 O OE1 . GLN B 73  ? 0.2211 0.2943 0.2784 0.0693  -0.0258 0.0159  71   GLN B OE1 
2039 N NE2 . GLN B 73  ? 0.3258 0.2952 0.2105 0.0217  -0.0040 -0.0155 71   GLN B NE2 
2040 N N   . GLU B 74  ? 0.1340 0.1816 0.1542 0.0094  0.0346  -0.0030 72   GLU B N   
2041 C CA  . GLU B 74  ? 0.0794 0.2203 0.1461 0.0104  0.0192  -0.0384 72   GLU B CA  
2042 C C   . GLU B 74  ? 0.1255 0.1585 0.1168 -0.0056 0.0110  -0.0320 72   GLU B C   
2043 O O   . GLU B 74  ? 0.1044 0.1747 0.1905 -0.0240 0.0242  -0.0404 72   GLU B O   
2044 C CB  . GLU B 74  ? 0.1273 0.2376 0.1941 0.0155  0.0341  0.0047  72   GLU B CB  
2045 C CG  . GLU B 74  ? 0.2139 0.1968 0.2194 0.0161  0.0188  0.0228  72   GLU B CG  
2046 C CD  . GLU B 74  ? 0.1891 0.2819 0.2767 0.0385  -0.0442 -0.0780 72   GLU B CD  
2047 O OE1 . GLU B 74  ? 0.2025 0.3122 0.3309 0.0298  -0.0054 -0.0856 72   GLU B OE1 
2048 O OE2 . GLU B 74  ? 0.2432 0.3992 0.4907 0.1133  -0.0131 -0.0213 72   GLU B OE2 
2049 N N   . MET B 75  ? 0.1151 0.1604 0.1377 0.0027  0.0216  0.0199  73   MET B N   
2050 C CA  . MET B 75  ? 0.0847 0.1436 0.1027 -0.0111 -0.0050 0.0134  73   MET B CA  
2051 C C   . MET B 75  ? 0.0940 0.1498 0.1251 -0.0187 0.0229  0.0114  73   MET B C   
2052 O O   . MET B 75  ? 0.1134 0.1397 0.1442 -0.0304 0.0242  0.0115  73   MET B O   
2053 C CB  . MET B 75  ? 0.0883 0.1421 0.1044 0.0008  0.0313  0.0155  73   MET B CB  
2054 C CG  . MET B 75  ? 0.1103 0.1567 0.0894 0.0098  0.0320  -0.0009 73   MET B CG  
2055 S SD  . MET B 75  ? 0.0962 0.1783 0.1335 0.0165  0.0226  0.0514  73   MET B SD  
2056 C CE  . MET B 75  ? 0.1376 0.1579 0.2133 -0.0094 0.0229  0.0276  73   MET B CE  
2057 N N   . LYS B 76  ? 0.1662 0.1575 0.1281 -0.0205 0.0394  0.0281  74   LYS B N   
2058 C CA  . LYS B 76  ? 0.1913 0.1670 0.1413 -0.0412 0.0125  0.0445  74   LYS B CA  
2059 C C   . LYS B 76  ? 0.1749 0.1887 0.1314 -0.0324 0.0251  -0.0025 74   LYS B C   
2060 O O   . LYS B 76  ? 0.1987 0.2203 0.2053 -0.0452 0.0211  0.0527  74   LYS B O   
2061 C CB  . LYS B 76  ? 0.2349 0.2160 0.1242 -0.0358 -0.0013 0.0387  74   LYS B CB  
2062 C CG  . LYS B 76  ? 0.2106 0.1942 0.1880 0.0032  0.0109  0.0587  74   LYS B CG  
2063 C CD  . LYS B 76  ? 0.2564 0.3190 0.2201 -0.0225 -0.0464 -0.0142 74   LYS B CD  
2064 C CE  . LYS B 76  ? 0.2292 0.2638 0.2465 -0.0193 -0.0184 -0.0726 74   LYS B CE  
2065 N NZ  . LYS B 76  ? 0.3930 0.2800 0.3075 0.0279  0.0026  -0.0931 74   LYS B NZ  
2066 N N   . ARG B 77  ? 0.1843 0.2149 0.1621 -0.0351 0.0506  0.0069  75   ARG B N   
2067 C CA  . ARG B 77  ? 0.1958 0.2214 0.1921 -0.0394 -0.0076 -0.0095 75   ARG B CA  
2068 C C   . ARG B 77  ? 0.1654 0.2209 0.1337 -0.0795 0.0451  0.0087  75   ARG B C   
2069 O O   . ARG B 77  ? 0.2238 0.2396 0.2324 -0.1033 0.0264  0.0402  75   ARG B O   
2070 C CB  . ARG B 77  ? 0.1811 0.2984 0.1747 -0.0073 0.0435  0.0066  75   ARG B CB  
2071 C CG  . ARG B 77  ? 0.3245 0.2384 0.2542 -0.0134 0.0556  -0.0126 75   ARG B CG  
2072 C CD  . ARG B 77  ? 0.2967 0.3852 0.2711 0.0582  0.1028  -0.0324 75   ARG B CD  
2073 N NE  . ARG B 77  ? 0.3144 0.5901 0.4946 0.0276  -0.0202 -0.0185 75   ARG B NE  
2074 C CZ  . ARG B 77  ? 0.4701 0.4473 0.5323 0.0815  -0.0738 -0.0713 75   ARG B CZ  
2075 N NH1 . ARG B 77  ? 0.4432 0.5734 0.5103 0.0575  0.1186  0.0518  75   ARG B NH1 
2076 N NH2 . ARG B 77  ? 0.2619 0.5027 0.4971 0.0880  -0.0074 -0.0155 75   ARG B NH2 
2077 N N   . GLN B 78  ? 0.1352 0.2030 0.1500 -0.0565 0.0500  0.0215  76   GLN B N   
2078 C CA  . GLN B 78  ? 0.0951 0.1808 0.1764 -0.0452 0.0047  0.0195  76   GLN B CA  
2079 C C   . GLN B 78  ? 0.1204 0.1680 0.1983 -0.0510 0.0254  0.0005  76   GLN B C   
2080 O O   . GLN B 78  ? 0.1292 0.1872 0.1594 -0.0536 0.0209  -0.0031 76   GLN B O   
2081 C CB  . GLN B 78  ? 0.1786 0.2307 0.1595 -0.0369 0.0416  0.0198  76   GLN B CB  
2082 C CG  . GLN B 78  ? 0.1682 0.2071 0.1900 -0.0422 0.0426  -0.0043 76   GLN B CG  
2083 C CD  . GLN B 78  ? 0.2085 0.1833 0.1768 -0.0528 -0.0088 0.0102  76   GLN B CD  
2084 O OE1 . GLN B 78  ? 0.2113 0.2117 0.1795 -0.0744 0.0027  -0.0065 76   GLN B OE1 
2085 N NE2 . GLN B 78  ? 0.2634 0.2908 0.3157 0.0023  -0.0254 0.0069  76   GLN B NE2 
2086 N N   . ASN B 79  ? 0.1367 0.2340 0.1347 -0.0383 0.0284  0.0290  77   ASN B N   
2087 C CA  . ASN B 79  ? 0.1272 0.1684 0.1752 -0.0466 -0.0059 0.0448  77   ASN B CA  
2088 C C   . ASN B 79  ? 0.1685 0.1669 0.1636 -0.0314 -0.0151 0.0188  77   ASN B C   
2089 O O   . ASN B 79  ? 0.1374 0.1297 0.1629 -0.0471 -0.0030 0.0228  77   ASN B O   
2090 C CB  . ASN B 79  ? 0.1876 0.1777 0.1490 0.0040  0.0269  0.0573  77   ASN B CB  
2091 C CG  . ASN B 79  ? 0.1973 0.1934 0.2490 -0.0121 -0.0361 0.0625  77   ASN B CG  
2092 O OD1 . ASN B 79  ? 0.2542 0.2536 0.2830 -0.0530 -0.0666 0.0488  77   ASN B OD1 
2093 N ND2 . ASN B 79  ? 0.1844 0.2117 0.3691 0.0449  0.0000  0.0814  77   ASN B ND2 
2094 N N   . LEU B 80  ? 0.1142 0.1304 0.1559 -0.0367 0.0112  0.0077  78   LEU B N   
2095 C CA  . LEU B 80  ? 0.0915 0.1453 0.1369 -0.0020 -0.0001 0.0234  78   LEU B CA  
2096 C C   . LEU B 80  ? 0.1162 0.0922 0.1414 -0.0017 0.0038  0.0417  78   LEU B C   
2097 O O   . LEU B 80  ? 0.0818 0.1004 0.1425 0.0076  -0.0095 0.0329  78   LEU B O   
2098 C CB  . LEU B 80  ? 0.1172 0.1852 0.1362 0.0307  0.0005  0.0116  78   LEU B CB  
2099 C CG  . LEU B 80  ? 0.1328 0.1382 0.1851 -0.0041 0.0136  0.0320  78   LEU B CG  
2100 C CD1 . LEU B 80  ? 0.2557 0.1895 0.1851 0.0460  -0.0286 0.0395  78   LEU B CD1 
2101 C CD2 . LEU B 80  ? 0.1847 0.1132 0.2407 0.0024  0.0028  -0.0166 78   LEU B CD2 
2102 N N   . ILE B 81  ? 0.1049 0.1013 0.1545 -0.0106 -0.0077 0.0287  79   ILE B N   
2103 C CA  . ILE B 81  ? 0.0726 0.1203 0.1419 0.0024  0.0129  0.0244  79   ILE B CA  
2104 C C   . ILE B 81  ? 0.1043 0.1092 0.1067 -0.0103 0.0261  0.0264  79   ILE B C   
2105 O O   . ILE B 81  ? 0.0687 0.1255 0.1470 -0.0053 0.0156  0.0239  79   ILE B O   
2106 C CB  . ILE B 81  ? 0.1455 0.1446 0.1121 0.0097  0.0258  0.0154  79   ILE B CB  
2107 C CG1 . ILE B 81  ? 0.1588 0.1364 0.1660 -0.0126 0.0071  0.0054  79   ILE B CG1 
2108 C CG2 . ILE B 81  ? 0.1035 0.2058 0.1602 0.0006  0.0026  0.0028  79   ILE B CG2 
2109 C CD1 . ILE B 81  ? 0.1213 0.1786 0.2047 -0.0038 0.0066  -0.0040 79   ILE B CD1 
2110 N N   . PHE B 82  ? 0.0816 0.1050 0.1343 0.0113  0.0130  0.0164  80   PHE B N   
2111 C CA  . PHE B 82  ? 0.0621 0.1067 0.1024 0.0004  -0.0074 0.0133  80   PHE B CA  
2112 C C   . PHE B 82  ? 0.0698 0.1381 0.1150 0.0027  -0.0219 0.0130  80   PHE B C   
2113 O O   . PHE B 82  ? 0.0624 0.1311 0.1306 -0.0152 -0.0086 0.0168  80   PHE B O   
2114 C CB  . PHE B 82  ? 0.0897 0.0891 0.1205 -0.0243 -0.0099 0.0349  80   PHE B CB  
2115 C CG  . PHE B 82  ? 0.0680 0.0811 0.1220 0.0160  -0.0035 0.0119  80   PHE B CG  
2116 C CD1 . PHE B 82  ? 0.0767 0.1271 0.1238 0.0025  0.0095  0.0196  80   PHE B CD1 
2117 C CD2 . PHE B 82  ? 0.1145 0.1570 0.1033 0.0301  0.0114  -0.0026 80   PHE B CD2 
2118 C CE1 . PHE B 82  ? 0.0893 0.1342 0.0866 0.0016  -0.0119 0.0350  80   PHE B CE1 
2119 C CE2 . PHE B 82  ? 0.1253 0.1799 0.1112 0.0331  -0.0138 -0.0023 80   PHE B CE2 
2120 C CZ  . PHE B 82  ? 0.1164 0.1450 0.1217 -0.0082 -0.0253 0.0018  80   PHE B CZ  
2121 N N   . ALA B 83  ? 0.0885 0.1512 0.1006 -0.0096 -0.0067 0.0117  81   ALA B N   
2122 C CA  . ALA B 83  ? 0.0751 0.1281 0.1074 -0.0094 -0.0062 0.0193  81   ALA B CA  
2123 C C   . ALA B 83  ? 0.0821 0.1081 0.1147 -0.0092 -0.0057 0.0130  81   ALA B C   
2124 O O   . ALA B 83  ? 0.0913 0.2073 0.1367 -0.0168 -0.0287 0.0472  81   ALA B O   
2125 C CB  . ALA B 83  ? 0.1160 0.1115 0.1477 -0.0075 -0.0140 0.0413  81   ALA B CB  
2126 N N   . ARG B 84  ? 0.0692 0.1083 0.1506 0.0060  0.0025  0.0288  82   ARG B N   
2127 C CA  . ARG B 84  ? 0.0670 0.1223 0.1481 -0.0204 -0.0277 0.0183  82   ARG B CA  
2128 C C   . ARG B 84  ? 0.0890 0.1348 0.1785 -0.0141 -0.0173 -0.0013 82   ARG B C   
2129 O O   . ARG B 84  ? 0.1059 0.1017 0.1665 -0.0080 0.0060  0.0105  82   ARG B O   
2130 C CB  . ARG B 84  ? 0.1044 0.1741 0.1423 -0.0082 -0.0166 0.0031  82   ARG B CB  
2131 C CG  . ARG B 84  ? 0.0828 0.1570 0.1488 0.0020  -0.0181 0.0186  82   ARG B CG  
2132 C CD  . ARG B 84  ? 0.0787 0.1078 0.1643 -0.0058 -0.0132 0.0115  82   ARG B CD  
2133 N NE  . ARG B 84  ? 0.0702 0.1002 0.1531 0.0034  -0.0037 0.0123  82   ARG B NE  
2134 C CZ  . ARG B 84  ? 0.0896 0.1155 0.1112 -0.0140 0.0134  0.0098  82   ARG B CZ  
2135 N NH1 . ARG B 84  ? 0.1024 0.1192 0.1365 -0.0184 -0.0071 0.0014  82   ARG B NH1 
2136 N NH2 . ARG B 84  ? 0.0987 0.1093 0.1329 0.0132  -0.0062 -0.0066 82   ARG B NH2 
2137 N N   . PRO B 85  ? 0.0787 0.1212 0.1817 -0.0004 -0.0061 0.0116  83   PRO B N   
2138 C CA  . PRO B 85  ? 0.1145 0.1217 0.1881 -0.0268 -0.0560 -0.0106 83   PRO B CA  
2139 C C   . PRO B 85  ? 0.0898 0.1161 0.1796 -0.0230 -0.0063 -0.0070 83   PRO B C   
2140 O O   . PRO B 85  ? 0.1278 0.1793 0.2042 0.0104  0.0109  -0.0219 83   PRO B O   
2141 C CB  . PRO B 85  ? 0.0997 0.1699 0.2757 -0.0476 -0.0383 -0.0091 83   PRO B CB  
2142 C CG  . PRO B 85  ? 0.1415 0.1725 0.2286 -0.0070 0.0120  -0.0100 83   PRO B CG  
2143 C CD  . PRO B 85  ? 0.1036 0.1595 0.1889 0.0012  0.0064  0.0295  83   PRO B CD  
2144 N N   . ASN B 86  ? 0.0899 0.1213 0.1648 0.0044  0.0128  0.0184  84   ASN B N   
2145 C CA  . ASN B 86  ? 0.1130 0.1176 0.1977 -0.0126 -0.0243 0.0285  84   ASN B CA  
2146 C C   . ASN B 86  ? 0.0954 0.1228 0.1137 0.0028  -0.0112 0.0011  84   ASN B C   
2147 O O   . ASN B 86  ? 0.0871 0.1229 0.1750 -0.0015 -0.0017 0.0031  84   ASN B O   
2148 C CB  . ASN B 86  ? 0.2015 0.1669 0.2139 -0.0259 -0.0350 0.0500  84   ASN B CB  
2149 C CG  . ASN B 86  ? 0.2397 0.2112 0.2747 -0.0613 -0.0167 -0.0018 84   ASN B CG  
2150 O OD1 . ASN B 86  ? 0.3224 0.1978 0.3616 -0.0505 -0.0082 -0.0042 84   ASN B OD1 
2151 N ND2 . ASN B 86  ? 0.2707 0.3777 0.4036 -0.0479 0.0581  0.0731  84   ASN B ND2 
2152 N N   . VAL B 87  ? 0.0972 0.1103 0.1376 -0.0012 -0.0121 -0.0055 85   VAL B N   
2153 C CA  . VAL B 87  ? 0.1053 0.1285 0.0968 -0.0181 0.0138  -0.0146 85   VAL B CA  
2154 C C   . VAL B 87  ? 0.0640 0.1095 0.1038 -0.0034 -0.0117 0.0018  85   VAL B C   
2155 O O   . VAL B 87  ? 0.0987 0.1033 0.0906 0.0016  0.0264  -0.0054 85   VAL B O   
2156 C CB  . VAL B 87  ? 0.1031 0.1928 0.1258 -0.0061 0.0111  -0.0049 85   VAL B CB  
2157 C CG1 . VAL B 87  ? 0.1548 0.1973 0.1274 -0.0136 0.0093  -0.0301 85   VAL B CG1 
2158 C CG2 . VAL B 87  ? 0.1470 0.1666 0.1216 0.0131  0.0055  0.0030  85   VAL B CG2 
2159 N N   . PRO B 88  ? 0.1030 0.0977 0.0927 -0.0049 -0.0057 0.0105  86   PRO B N   
2160 C CA  . PRO B 88  ? 0.0680 0.0891 0.0679 0.0075  0.0102  0.0271  86   PRO B CA  
2161 C C   . PRO B 88  ? 0.0756 0.0730 0.0779 0.0044  0.0113  0.0103  86   PRO B C   
2162 O O   . PRO B 88  ? 0.0856 0.1090 0.0769 0.0127  0.0111  0.0061  86   PRO B O   
2163 C CB  . PRO B 88  ? 0.0907 0.1046 0.1000 -0.0070 -0.0127 0.0101  86   PRO B CB  
2164 C CG  . PRO B 88  ? 0.1183 0.1482 0.1287 0.0091  -0.0360 0.0204  86   PRO B CG  
2165 C CD  . PRO B 88  ? 0.1108 0.1138 0.1320 -0.0274 -0.0258 0.0339  86   PRO B CD  
2166 N N   . ASP B 89  ? 0.0500 0.0750 0.0677 0.0017  0.0176  0.0126  87   ASP B N   
2167 C CA  . ASP B 89  ? 0.0676 0.0635 0.0764 0.0020  -0.0016 0.0054  87   ASP B CA  
2168 C C   . ASP B 89  ? 0.0605 0.0696 0.0675 0.0028  0.0149  0.0019  87   ASP B C   
2169 O O   . ASP B 89  ? 0.0601 0.0767 0.0694 0.0119  0.0022  0.0231  87   ASP B O   
2170 C CB  . ASP B 89  ? 0.0748 0.0948 0.0667 0.0042  -0.0040 -0.0017 87   ASP B CB  
2171 C CG  . ASP B 89  ? 0.1015 0.0677 0.0962 -0.0058 0.0124  0.0023  87   ASP B CG  
2172 O OD1 . ASP B 89  ? 0.1513 0.1046 0.0807 -0.0250 0.0216  0.0010  87   ASP B OD1 
2173 O OD2 . ASP B 89  ? 0.1165 0.0956 0.0905 -0.0239 0.0208  0.0128  87   ASP B OD2 
2174 N N   . LEU B 90  ? 0.0528 0.0666 0.0632 -0.0007 0.0004  0.0044  88   LEU B N   
2175 C CA  . LEU B 90  ? 0.0622 0.0917 0.0686 -0.0085 0.0086  0.0275  88   LEU B CA  
2176 C C   . LEU B 90  ? 0.0578 0.0851 0.0777 -0.0031 0.0079  0.0172  88   LEU B C   
2177 O O   . LEU B 90  ? 0.0503 0.0901 0.0760 0.0000  0.0202  0.0193  88   LEU B O   
2178 C CB  . LEU B 90  ? 0.0651 0.0887 0.0790 -0.0110 0.0107  0.0034  88   LEU B CB  
2179 C CG  . LEU B 90  ? 0.0773 0.0686 0.1003 -0.0037 0.0144  0.0066  88   LEU B CG  
2180 C CD1 . LEU B 90  ? 0.0707 0.1038 0.1048 -0.0063 0.0076  0.0374  88   LEU B CD1 
2181 C CD2 . LEU B 90  ? 0.0761 0.0780 0.0847 -0.0105 0.0119  0.0143  88   LEU B CD2 
2182 N N   . LEU B 91  ? 0.0639 0.0734 0.0969 0.0024  0.0278  0.0071  89   LEU B N   
2183 C CA  . LEU B 91  ? 0.0615 0.0690 0.0876 -0.0148 0.0016  0.0087  89   LEU B CA  
2184 C C   . LEU B 91  ? 0.0650 0.1031 0.0787 -0.0138 -0.0045 0.0042  89   LEU B C   
2185 O O   . LEU B 91  ? 0.0801 0.1128 0.1023 0.0033  -0.0176 0.0034  89   LEU B O   
2186 C CB  . LEU B 91  ? 0.0561 0.0923 0.0988 -0.0073 -0.0073 0.0341  89   LEU B CB  
2187 C CG  . LEU B 91  ? 0.0704 0.1130 0.0962 0.0095  0.0143  0.0046  89   LEU B CG  
2188 C CD1 . LEU B 91  ? 0.0705 0.1964 0.0841 -0.0095 0.0037  0.0218  89   LEU B CD1 
2189 C CD2 . LEU B 91  ? 0.0604 0.1028 0.0938 -0.0071 0.0161  0.0075  89   LEU B CD2 
2190 N N   . ASP B 92  ? 0.0803 0.0783 0.0975 -0.0066 0.0024  0.0133  90   ASP B N   
2191 C CA  . ASP B 92  ? 0.0868 0.0877 0.1132 -0.0211 0.0103  0.0069  90   ASP B CA  
2192 C C   . ASP B 92  ? 0.0977 0.0857 0.1099 -0.0089 0.0207  0.0109  90   ASP B C   
2193 O O   . ASP B 92  ? 0.1065 0.0862 0.1271 -0.0125 0.0165  0.0119  90   ASP B O   
2194 C CB  . ASP B 92  ? 0.1093 0.0653 0.0961 0.0084  0.0124  0.0176  90   ASP B CB  
2195 C CG  . ASP B 92  ? 0.1369 0.0813 0.0957 -0.0081 0.0245  0.0200  90   ASP B CG  
2196 O OD1 . ASP B 92  ? 0.1133 0.0968 0.1162 -0.0193 0.0129  0.0057  90   ASP B OD1 
2197 O OD2 . ASP B 92  ? 0.1837 0.0918 0.1293 0.0046  0.0542  -0.0117 90   ASP B OD2 
2198 N N   . LEU B 93  ? 0.0949 0.0952 0.1193 -0.0144 0.0148  0.0223  91   LEU B N   
2199 C CA  . LEU B 93  ? 0.1119 0.1059 0.1100 -0.0066 0.0139  0.0193  91   LEU B CA  
2200 C C   . LEU B 93  ? 0.1713 0.1060 0.1329 0.0003  0.0188  0.0116  91   LEU B C   
2201 O O   . LEU B 93  ? 0.1699 0.1082 0.1586 -0.0343 0.0296  0.0263  91   LEU B O   
2202 C CB  . LEU B 93  ? 0.1090 0.0905 0.1259 -0.0088 0.0094  0.0043  91   LEU B CB  
2203 C CG  . LEU B 93  ? 0.1164 0.0914 0.0978 -0.0088 0.0084  0.0026  91   LEU B CG  
2204 C CD1 . LEU B 93  ? 0.1119 0.1321 0.1819 0.0042  0.0150  0.0152  91   LEU B CD1 
2205 C CD2 . LEU B 93  ? 0.1461 0.1082 0.1114 -0.0267 -0.0157 -0.0127 91   LEU B CD2 
2206 N N   . LYS B 94  ? 0.1110 0.0869 0.1193 -0.0013 0.0038  0.0107  92   LYS B N   
2207 C CA  . LYS B 94  ? 0.1501 0.0779 0.1532 -0.0094 0.0195  0.0099  92   LYS B CA  
2208 C C   . LYS B 94  ? 0.1459 0.0849 0.1278 -0.0073 0.0435  -0.0041 92   LYS B C   
2209 O O   . LYS B 94  ? 0.1836 0.0917 0.2019 -0.0120 0.0565  0.0229  92   LYS B O   
2210 C CB  . LYS B 94  ? 0.1325 0.0935 0.1421 -0.0160 0.0217  0.0068  92   LYS B CB  
2211 C CG  . LYS B 94  ? 0.1688 0.0909 0.1860 -0.0081 0.0264  -0.0019 92   LYS B CG  
2212 C CD  . LYS B 94  ? 0.2369 0.2105 0.1924 0.0031  0.0076  -0.0397 92   LYS B CD  
2213 C CE  . LYS B 94  ? 0.2746 0.2577 0.2552 -0.0315 -0.0431 -0.0770 92   LYS B CE  
2214 N NZ  . LYS B 94  ? 0.3571 0.3443 0.3342 0.0432  0.0483  0.0173  92   LYS B NZ  
2215 N N   . GLU B 95  ? 0.1351 0.1118 0.1687 -0.0276 0.0218  0.0159  93   GLU B N   
2216 C CA  . GLU B 95  ? 0.1718 0.1241 0.1870 -0.0061 0.0126  -0.0151 93   GLU B CA  
2217 C C   . GLU B 95  ? 0.1546 0.1013 0.1595 -0.0029 0.0254  0.0164  93   GLU B C   
2218 O O   . GLU B 95  ? 0.1696 0.1187 0.1990 0.0184  0.0320  -0.0059 93   GLU B O   
2219 C CB  . GLU B 95  ? 0.1669 0.1451 0.1847 0.0017  0.0068  -0.0155 93   GLU B CB  
2220 C CG  . GLU B 95  ? 0.1491 0.1760 0.1688 -0.0066 0.0239  -0.0182 93   GLU B CG  
2221 C CD  . GLU B 95  ? 0.2437 0.1848 0.2343 0.0254  0.0180  -0.0214 93   GLU B CD  
2222 O OE1 . GLU B 95  ? 0.3107 0.2340 0.2558 0.0789  -0.0102 -0.0574 93   GLU B OE1 
2223 O OE2 . GLU B 95  ? 0.2479 0.2867 0.3156 -0.0024 -0.0093 0.0072  93   GLU B OE2 
2224 N N   . ARG B 96  ? 0.0943 0.1073 0.1681 -0.0076 0.0149  -0.0029 94   ARG B N   
2225 C CA  . ARG B 96  ? 0.1366 0.1067 0.1638 -0.0009 0.0120  0.0141  94   ARG B CA  
2226 C C   . ARG B 96  ? 0.1167 0.1028 0.1441 0.0102  0.0031  0.0169  94   ARG B C   
2227 O O   . ARG B 96  ? 0.1312 0.1177 0.1760 0.0250  0.0117  0.0260  94   ARG B O   
2228 C CB  . ARG B 96  ? 0.1218 0.1138 0.1627 0.0153  -0.0187 0.0171  94   ARG B CB  
2229 C CG  . ARG B 96  ? 0.1920 0.0994 0.1832 -0.0282 0.0242  0.0404  94   ARG B CG  
2230 C CD  . ARG B 96  ? 0.1388 0.1309 0.2033 -0.0105 0.0049  0.0462  94   ARG B CD  
2231 N NE  . ARG B 96  ? 0.1798 0.2026 0.2345 -0.0075 -0.0251 0.0299  94   ARG B NE  
2232 C CZ  . ARG B 96  ? 0.2166 0.2445 0.2366 -0.0380 0.0175  0.0374  94   ARG B CZ  
2233 N NH1 . ARG B 96  ? 0.2007 0.1870 0.2346 -0.0251 0.0000  -0.0182 94   ARG B NH1 
2234 N NH2 . ARG B 96  ? 0.1894 0.2260 0.2055 -0.0530 0.0147  0.0282  94   ARG B NH2 
2235 N N   A LYS B 97  ? 0.0957 0.1032 0.1428 -0.0006 0.0213  0.0185  95   LYS B N   
2236 N N   B LYS B 97  ? 0.0833 0.0996 0.1322 0.0013  0.0195  0.0135  95   LYS B N   
2237 C CA  A LYS B 97  ? 0.1285 0.0884 0.1437 -0.0166 0.0236  0.0025  95   LYS B CA  
2238 C CA  B LYS B 97  ? 0.1103 0.0809 0.1080 -0.0115 0.0146  0.0007  95   LYS B CA  
2239 C C   A LYS B 97  ? 0.0890 0.0923 0.1112 0.0059  0.0112  0.0179  95   LYS B C   
2240 C C   B LYS B 97  ? 0.0858 0.0805 0.0914 0.0098  0.0103  0.0163  95   LYS B C   
2241 O O   A LYS B 97  ? 0.0932 0.0960 0.1516 0.0025  0.0111  0.0189  95   LYS B O   
2242 O O   B LYS B 97  ? 0.0892 0.0991 0.1020 0.0113  0.0080  0.0042  95   LYS B O   
2243 C CB  A LYS B 97  ? 0.1619 0.1418 0.1507 -0.0155 0.0348  0.0173  95   LYS B CB  
2244 C CB  B LYS B 97  ? 0.0764 0.0753 0.1099 0.0142  0.0187  0.0064  95   LYS B CB  
2245 C CG  A LYS B 97  ? 0.1703 0.1614 0.1769 -0.0055 -0.0012 0.0007  95   LYS B CG  
2246 C CG  B LYS B 97  ? 0.1020 0.0825 0.1102 0.0102  0.0266  -0.0051 95   LYS B CG  
2247 C CD  A LYS B 97  ? 0.2025 0.2041 0.2026 -0.0193 0.0316  -0.0117 95   LYS B CD  
2248 C CD  B LYS B 97  ? 0.0883 0.0873 0.1048 -0.0126 0.0240  -0.0083 95   LYS B CD  
2249 C CE  A LYS B 97  ? 0.2883 0.2062 0.2247 0.0180  -0.0320 0.0224  95   LYS B CE  
2250 C CE  B LYS B 97  ? 0.1132 0.1145 0.0935 -0.0137 0.0254  -0.0395 95   LYS B CE  
2251 N NZ  A LYS B 97  ? 0.2804 0.2366 0.2083 0.0175  -0.0196 -0.0135 95   LYS B NZ  
2252 N NZ  B LYS B 97  ? 0.1744 0.1403 0.1490 0.0173  0.0127  -0.0054 95   LYS B NZ  
2253 N N   . GLY B 98  ? 0.0868 0.0776 0.0976 0.0079  0.0030  0.0046  96   GLY B N   
2254 C CA  . GLY B 98  ? 0.0767 0.0750 0.0878 0.0217  0.0166  0.0015  96   GLY B CA  
2255 C C   . GLY B 98  ? 0.0718 0.0772 0.0986 0.0252  0.0063  0.0175  96   GLY B C   
2256 O O   . GLY B 98  ? 0.0833 0.1002 0.0952 0.0263  0.0187  0.0203  96   GLY B O   
2257 N N   . VAL B 99  ? 0.0700 0.0519 0.0653 0.0195  0.0247  0.0116  97   VAL B N   
2258 C CA  . VAL B 99  ? 0.0643 0.0819 0.0570 0.0025  0.0121  0.0128  97   VAL B CA  
2259 C C   . VAL B 99  ? 0.0652 0.0896 0.0737 0.0020  0.0194  0.0011  97   VAL B C   
2260 O O   . VAL B 99  ? 0.0604 0.0820 0.0861 0.0036  0.0269  0.0071  97   VAL B O   
2261 C CB  . VAL B 99  ? 0.0578 0.0862 0.0775 0.0097  0.0114  0.0158  97   VAL B CB  
2262 C CG1 . VAL B 99  ? 0.0911 0.1339 0.0682 0.0089  0.0190  0.0081  97   VAL B CG1 
2263 C CG2 . VAL B 99  ? 0.0966 0.1142 0.1292 -0.0197 0.0048  0.0001  97   VAL B CG2 
2264 N N   . TYR B 100 ? 0.0611 0.0631 0.0774 -0.0067 0.0094  0.0084  98   TYR B N   
2265 C CA  . TYR B 100 ? 0.0618 0.0640 0.0798 -0.0104 0.0214  0.0006  98   TYR B CA  
2266 C C   . TYR B 100 ? 0.0827 0.0864 0.0851 -0.0025 -0.0045 -0.0055 98   TYR B C   
2267 O O   . TYR B 100 ? 0.1364 0.1003 0.0779 0.0190  0.0280  0.0143  98   TYR B O   
2268 C CB  . TYR B 100 ? 0.0741 0.0949 0.1082 -0.0110 -0.0068 -0.0007 98   TYR B CB  
2269 C CG  . TYR B 100 ? 0.0842 0.1245 0.1030 -0.0138 0.0025  -0.0033 98   TYR B CG  
2270 C CD1 . TYR B 100 ? 0.0979 0.1289 0.0997 0.0275  -0.0292 -0.0377 98   TYR B CD1 
2271 C CD2 . TYR B 100 ? 0.0800 0.1276 0.1084 -0.0223 0.0113  0.0058  98   TYR B CD2 
2272 C CE1 . TYR B 100 ? 0.1592 0.1476 0.1532 0.0315  -0.0315 0.0198  98   TYR B CE1 
2273 C CE2 . TYR B 100 ? 0.0826 0.1484 0.0873 -0.0104 -0.0061 -0.0064 98   TYR B CE2 
2274 C CZ  . TYR B 100 ? 0.1154 0.1578 0.1195 -0.0157 0.0035  0.0175  98   TYR B CZ  
2275 O OH  . TYR B 100 ? 0.1258 0.1730 0.1214 -0.0054 -0.0080 0.0100  98   TYR B OH  
2276 N N   . VAL B 101 ? 0.0618 0.0846 0.0675 -0.0116 0.0142  0.0061  99   VAL B N   
2277 C CA  . VAL B 101 ? 0.0913 0.0825 0.0616 0.0081  0.0063  -0.0103 99   VAL B CA  
2278 C C   . VAL B 101 ? 0.1039 0.0933 0.0787 0.0026  0.0124  -0.0095 99   VAL B C   
2279 O O   . VAL B 101 ? 0.1120 0.0931 0.0779 -0.0063 0.0287  -0.0090 99   VAL B O   
2280 C CB  . VAL B 101 ? 0.0751 0.0975 0.0677 -0.0141 0.0015  -0.0249 99   VAL B CB  
2281 C CG1 . VAL B 101 ? 0.0906 0.1942 0.0680 0.0162  -0.0138 -0.0036 99   VAL B CG1 
2282 C CG2 . VAL B 101 ? 0.0821 0.1158 0.1410 -0.0327 0.0003  -0.0171 99   VAL B CG2 
2283 N N   A LYS B 102 ? 0.1004 0.1045 0.0758 -0.0114 0.0107  -0.0159 100  LYS B N   
2284 N N   B LYS B 102 ? 0.0984 0.0985 0.0728 -0.0093 0.0096  -0.0110 100  LYS B N   
2285 C CA  A LYS B 102 ? 0.1198 0.1070 0.1040 -0.0059 0.0244  0.0050  100  LYS B CA  
2286 C CA  B LYS B 102 ? 0.1305 0.1091 0.0880 -0.0189 0.0230  -0.0019 100  LYS B CA  
2287 C C   A LYS B 102 ? 0.0940 0.1027 0.0965 -0.0217 0.0163  -0.0031 100  LYS B C   
2288 C C   B LYS B 102 ? 0.1056 0.1016 0.0927 -0.0218 0.0110  -0.0007 100  LYS B C   
2289 O O   A LYS B 102 ? 0.0919 0.0966 0.0931 -0.0035 0.0097  0.0038  100  LYS B O   
2290 O O   B LYS B 102 ? 0.1026 0.0919 0.0884 0.0088  0.0107  0.0048  100  LYS B O   
2291 C CB  A LYS B 102 ? 0.1177 0.1718 0.1305 0.0201  0.0388  -0.0234 100  LYS B CB  
2292 C CB  B LYS B 102 ? 0.1319 0.1256 0.0990 -0.0159 0.0117  -0.0160 100  LYS B CB  
2293 C CG  A LYS B 102 ? 0.1049 0.2024 0.1787 0.0202  0.0350  0.0286  100  LYS B CG  
2294 C CG  B LYS B 102 ? 0.1088 0.1197 0.0925 0.0073  0.0327  -0.0099 100  LYS B CG  
2295 C CD  A LYS B 102 ? 0.1569 0.2688 0.2544 0.0513  -0.0485 0.0430  100  LYS B CD  
2296 C CD  B LYS B 102 ? 0.1245 0.1126 0.1191 -0.0003 0.0090  -0.0099 100  LYS B CD  
2297 C CE  A LYS B 102 ? 0.1691 0.2562 0.2587 0.0276  -0.0422 0.0136  100  LYS B CE  
2298 C CE  B LYS B 102 ? 0.1467 0.1400 0.1500 -0.0434 0.0092  -0.0230 100  LYS B CE  
2299 N NZ  A LYS B 102 ? 0.2887 0.2956 0.2343 -0.0363 -0.0568 0.0626  100  LYS B NZ  
2300 N NZ  B LYS B 102 ? 0.2378 0.1939 0.1404 -0.0239 -0.0720 0.0151  100  LYS B NZ  
2301 N N   . VAL B 103 ? 0.1465 0.1002 0.1003 -0.0078 0.0365  -0.0007 101  VAL B N   
2302 C CA  . VAL B 103 ? 0.1363 0.1344 0.0975 -0.0064 0.0307  -0.0077 101  VAL B CA  
2303 C C   . VAL B 103 ? 0.1508 0.1306 0.0989 -0.0314 0.0027  -0.0002 101  VAL B C   
2304 O O   . VAL B 103 ? 0.2011 0.1636 0.1185 -0.0732 0.0485  -0.0503 101  VAL B O   
2305 C CB  . VAL B 103 ? 0.1583 0.1540 0.1434 0.0285  0.0207  0.0141  101  VAL B CB  
2306 C CG1 . VAL B 103 ? 0.2097 0.1694 0.1683 0.0414  0.0398  0.0379  101  VAL B CG1 
2307 C CG2 . VAL B 103 ? 0.1627 0.1470 0.1779 0.0658  0.1122  -0.0055 101  VAL B CG2 
2308 N N   . TYR B 104 ? 0.1331 0.1411 0.0936 -0.0283 0.0021  -0.0086 102  TYR B N   
2309 C CA  . TYR B 104 ? 0.1160 0.1529 0.1126 -0.0354 -0.0068 -0.0087 102  TYR B CA  
2310 C C   . TYR B 104 ? 0.1055 0.1380 0.1243 -0.0040 0.0213  -0.0109 102  TYR B C   
2311 O O   . TYR B 104 ? 0.1087 0.0930 0.1197 -0.0089 0.0241  -0.0134 102  TYR B O   
2312 C CB  . TYR B 104 ? 0.1182 0.1626 0.1426 -0.0317 0.0414  -0.0091 102  TYR B CB  
2313 C CG  . TYR B 104 ? 0.1220 0.1547 0.1321 -0.0241 0.0237  -0.0314 102  TYR B CG  
2314 C CD1 . TYR B 104 ? 0.1132 0.1843 0.1267 -0.0263 0.0298  -0.0194 102  TYR B CD1 
2315 C CD2 . TYR B 104 ? 0.1125 0.1578 0.2142 0.0042  0.0016  0.0027  102  TYR B CD2 
2316 C CE1 . TYR B 104 ? 0.1367 0.1723 0.1211 -0.0113 0.0326  -0.0329 102  TYR B CE1 
2317 C CE2 . TYR B 104 ? 0.1375 0.1903 0.2143 -0.0501 -0.0729 0.0099  102  TYR B CE2 
2318 C CZ  . TYR B 104 ? 0.1520 0.2021 0.1371 -0.0021 -0.0144 0.0019  102  TYR B CZ  
2319 O OH  . TYR B 104 ? 0.2453 0.1624 0.2060 0.0288  -0.0045 0.0123  102  TYR B OH  
2320 N N   . PRO B 105 ? 0.1211 0.1431 0.1336 -0.0146 0.0360  -0.0160 103  PRO B N   
2321 C CA  . PRO B 105 ? 0.1380 0.1455 0.1028 -0.0056 0.0226  -0.0396 103  PRO B CA  
2322 C C   . PRO B 105 ? 0.1257 0.1590 0.1121 -0.0191 0.0224  -0.0336 103  PRO B C   
2323 O O   . PRO B 105 ? 0.1940 0.1572 0.1193 -0.0030 0.0141  -0.0411 103  PRO B O   
2324 C CB  . PRO B 105 ? 0.1863 0.1687 0.1859 -0.0574 0.0229  0.0268  103  PRO B CB  
2325 C CG  . PRO B 105 ? 0.1945 0.2025 0.2421 -0.0259 0.0457  0.0269  103  PRO B CG  
2326 C CD  . PRO B 105 ? 0.1260 0.1770 0.1226 -0.0060 0.0289  -0.0114 103  PRO B CD  
2327 N N   . ASP B 106 ? 0.1939 0.1312 0.1346 -0.0241 0.0338  0.0010  104  ASP B N   
2328 C CA  . ASP B 106 ? 0.1968 0.1614 0.1743 0.0115  0.0110  0.0012  104  ASP B CA  
2329 C C   . ASP B 106 ? 0.1527 0.1760 0.1408 -0.0292 0.0128  -0.0013 104  ASP B C   
2330 O O   . ASP B 106 ? 0.1437 0.1750 0.1155 -0.0117 0.0137  -0.0170 104  ASP B O   
2331 C CB  . ASP B 106 ? 0.2137 0.1412 0.1182 -0.0064 0.0144  -0.0124 104  ASP B CB  
2332 C CG  . ASP B 106 ? 0.2031 0.1674 0.1542 -0.0111 0.0219  -0.0154 104  ASP B CG  
2333 O OD1 . ASP B 106 ? 0.2290 0.1586 0.1679 -0.0004 0.0336  -0.0393 104  ASP B OD1 
2334 O OD2 . ASP B 106 ? 0.2170 0.1664 0.1750 -0.0237 0.0169  0.0224  104  ASP B OD2 
2335 N N   . ASN B 107 ? 0.1638 0.1929 0.1330 -0.0092 0.0202  -0.0276 105  ASN B N   
2336 C CA  . ASN B 107 ? 0.1554 0.1971 0.1312 0.0128  0.0051  -0.0255 105  ASN B CA  
2337 C C   . ASN B 107 ? 0.1398 0.2077 0.1715 0.0056  0.0217  0.0094  105  ASN B C   
2338 O O   . ASN B 107 ? 0.1533 0.2004 0.1780 -0.0135 0.0428  -0.0141 105  ASN B O   
2339 C CB  . ASN B 107 ? 0.2079 0.1849 0.2278 0.0215  -0.0077 0.0004  105  ASN B CB  
2340 C CG  . ASN B 107 ? 0.2179 0.1675 0.1525 -0.0121 -0.0057 -0.0151 105  ASN B CG  
2341 O OD1 . ASN B 107 ? 0.2280 0.1458 0.1405 -0.0202 0.0009  -0.0153 105  ASN B OD1 
2342 N ND2 . ASN B 107 ? 0.2346 0.2071 0.1358 0.0308  0.0171  0.0106  105  ASN B ND2 
2343 N N   . GLY B 108 ? 0.1625 0.1917 0.1629 -0.0218 0.0000  -0.0028 106  GLY B N   
2344 C CA  . GLY B 108 ? 0.1828 0.1822 0.2136 -0.0241 0.0188  0.0174  106  GLY B CA  
2345 C C   . GLY B 108 ? 0.2024 0.1680 0.1847 -0.0161 0.0540  0.0041  106  GLY B C   
2346 O O   . GLY B 108 ? 0.2411 0.1854 0.1676 0.0243  0.0285  -0.0030 106  GLY B O   
2347 N N   . THR B 109 ? 0.1689 0.1740 0.1393 -0.0150 0.0276  -0.0011 107  THR B N   
2348 C CA  . THR B 109 ? 0.1519 0.1741 0.1082 -0.0264 -0.0076 0.0039  107  THR B CA  
2349 C C   . THR B 109 ? 0.1228 0.1305 0.1142 -0.0109 -0.0094 0.0044  107  THR B C   
2350 O O   . THR B 109 ? 0.1303 0.1637 0.1026 -0.0116 0.0259  -0.0129 107  THR B O   
2351 C CB  . THR B 109 ? 0.2247 0.1643 0.1503 -0.0198 -0.0469 0.0057  107  THR B CB  
2352 O OG1 . THR B 109 ? 0.3066 0.2629 0.1328 -0.0816 -0.0634 -0.0195 107  THR B OG1 
2353 C CG2 . THR B 109 ? 0.2797 0.1974 0.1961 -0.0528 -0.0470 0.0309  107  THR B CG2 
2354 N N   . PRO B 110 ? 0.1119 0.1578 0.1264 -0.0035 -0.0058 0.0043  108  PRO B N   
2355 C CA  . PRO B 110 ? 0.1038 0.1613 0.1228 -0.0078 0.0096  0.0031  108  PRO B CA  
2356 C C   . PRO B 110 ? 0.1163 0.1481 0.1313 -0.0239 0.0034  0.0006  108  PRO B C   
2357 O O   . PRO B 110 ? 0.1028 0.1441 0.1190 -0.0056 0.0281  -0.0121 108  PRO B O   
2358 C CB  . PRO B 110 ? 0.1555 0.1320 0.1176 0.0190  0.0224  -0.0049 108  PRO B CB  
2359 C CG  . PRO B 110 ? 0.1112 0.1453 0.1093 0.0136  0.0191  -0.0003 108  PRO B CG  
2360 C CD  . PRO B 110 ? 0.1220 0.1512 0.1383 0.0016  -0.0103 0.0002  108  PRO B CD  
2361 N N   . THR B 111 ? 0.1144 0.1695 0.1078 0.0028  -0.0046 0.0014  109  THR B N   
2362 C CA  . THR B 111 ? 0.1441 0.1513 0.1180 -0.0050 -0.0008 0.0172  109  THR B CA  
2363 C C   . THR B 111 ? 0.0999 0.1701 0.0816 0.0227  -0.0118 -0.0034 109  THR B C   
2364 O O   . THR B 111 ? 0.1273 0.1668 0.1359 0.0145  0.0136  -0.0172 109  THR B O   
2365 C CB  . THR B 111 ? 0.1478 0.2108 0.1310 -0.0087 -0.0025 -0.0059 109  THR B CB  
2366 O OG1 . THR B 111 ? 0.1966 0.2295 0.1904 -0.0453 0.0377  0.0329  109  THR B OG1 
2367 C CG2 . THR B 111 ? 0.1195 0.1961 0.1471 -0.0158 0.0358  0.0370  109  THR B CG2 
2368 N N   . ASP B 112 ? 0.0772 0.1803 0.1074 -0.0082 -0.0008 -0.0147 110  ASP B N   
2369 C CA  . ASP B 112 ? 0.0997 0.1719 0.1357 0.0074  -0.0215 0.0054  110  ASP B CA  
2370 C C   . ASP B 112 ? 0.0837 0.1909 0.1256 0.0135  -0.0103 -0.0077 110  ASP B C   
2371 O O   . ASP B 112 ? 0.0921 0.2355 0.1529 0.0268  -0.0241 -0.0056 110  ASP B O   
2372 C CB  . ASP B 112 ? 0.1004 0.1649 0.1208 0.0059  -0.0104 -0.0045 110  ASP B CB  
2373 C CG  . ASP B 112 ? 0.1171 0.1647 0.1167 0.0101  -0.0152 -0.0153 110  ASP B CG  
2374 O OD1 . ASP B 112 ? 0.1115 0.1630 0.1374 0.0080  -0.0185 -0.0048 110  ASP B OD1 
2375 O OD2 . ASP B 112 ? 0.0906 0.1714 0.1048 0.0407  0.0034  -0.0209 110  ASP B OD2 
2376 N N   . TYR B 113 ? 0.0950 0.2287 0.1349 0.0269  0.0100  -0.0157 111  TYR B N   
2377 C CA  . TYR B 113 ? 0.1073 0.2636 0.1376 -0.0230 0.0035  0.0304  111  TYR B CA  
2378 C C   . TYR B 113 ? 0.1359 0.2821 0.1970 -0.0552 -0.0130 0.0775  111  TYR B C   
2379 O O   . TYR B 113 ? 0.1528 0.4013 0.1722 -0.0017 0.0487  0.0299  111  TYR B O   
2380 C CB  . TYR B 113 ? 0.1052 0.2560 0.1198 -0.0109 -0.0259 -0.0041 111  TYR B CB  
2381 C CG  . TYR B 113 ? 0.1857 0.2121 0.1554 0.0257  -0.0034 0.0127  111  TYR B CG  
2382 C CD1 . TYR B 113 ? 0.1653 0.2377 0.1996 0.0106  0.0078  0.0260  111  TYR B CD1 
2383 C CD2 . TYR B 113 ? 0.1664 0.1715 0.1905 -0.0167 -0.0578 -0.0120 111  TYR B CD2 
2384 C CE1 . TYR B 113 ? 0.1820 0.1745 0.1403 -0.0242 0.0011  -0.0086 111  TYR B CE1 
2385 C CE2 . TYR B 113 ? 0.1425 0.2834 0.1969 0.0031  -0.0389 -0.0008 111  TYR B CE2 
2386 C CZ  . TYR B 113 ? 0.1809 0.2186 0.1715 -0.0097 0.0015  0.0134  111  TYR B CZ  
2387 O OH  . TYR B 113 ? 0.2224 0.2547 0.1857 -0.0271 0.0262  0.0229  111  TYR B OH  
2388 N N   . GLN B 114 ? 0.1885 0.3469 0.1773 -0.0214 -0.0548 0.0290  112  GLN B N   
2389 C CA  . GLN B 114 ? 0.2299 0.3068 0.2607 -0.0263 -0.0284 0.0164  112  GLN B CA  
2390 C C   . GLN B 114 ? 0.1970 0.2298 0.2241 -0.0686 -0.0355 0.0342  112  GLN B C   
2391 O O   . GLN B 114 ? 0.1561 0.2519 0.2261 -0.0593 0.0043  0.0433  112  GLN B O   
2392 C CB  . GLN B 114 ? 0.1788 0.2729 0.2864 -0.0295 -0.0059 0.0192  112  GLN B CB  
2393 C CG  . GLN B 114 ? 0.1767 0.2229 0.2813 -0.0394 -0.0225 -0.0019 112  GLN B CG  
2394 C CD  . GLN B 114 ? 0.2097 0.3310 0.3573 -0.0088 -0.0604 0.0555  112  GLN B CD  
2395 O OE1 . GLN B 114 ? 0.2879 0.3610 0.4465 -0.0569 -0.0630 0.0733  112  GLN B OE1 
2396 N NE2 . GLN B 114 ? 0.3004 0.3465 0.2251 0.0538  -0.0823 0.0074  112  GLN B NE2 
2397 N N   . THR B 115 ? 0.1655 0.2630 0.2180 -0.0876 -0.0067 -0.0459 113  THR B N   
2398 C CA  . THR B 115 ? 0.1462 0.2001 0.1501 -0.0619 -0.0167 0.0341  113  THR B CA  
2399 C C   . THR B 115 ? 0.1324 0.1588 0.1380 -0.0343 -0.0261 0.0026  113  THR B C   
2400 O O   . THR B 115 ? 0.1461 0.2058 0.1914 -0.0112 0.0583  0.0315  113  THR B O   
2401 C CB  . THR B 115 ? 0.1491 0.2388 0.1943 -0.0315 -0.0087 0.0327  113  THR B CB  
2402 O OG1 . THR B 115 ? 0.2085 0.2841 0.2668 -0.0882 -0.0189 0.0232  113  THR B OG1 
2403 C CG2 . THR B 115 ? 0.1735 0.2811 0.2864 -0.0662 -0.0441 0.0920  113  THR B CG2 
2404 N N   . ALA B 116 ? 0.1308 0.1629 0.1445 -0.0137 -0.0239 0.0326  114  ALA B N   
2405 C CA  . ALA B 116 ? 0.1038 0.1465 0.1553 -0.0128 -0.0150 0.0321  114  ALA B CA  
2406 C C   . ALA B 116 ? 0.1388 0.1479 0.1592 -0.0027 -0.0121 0.0220  114  ALA B C   
2407 O O   . ALA B 116 ? 0.1216 0.1017 0.1582 0.0147  0.0068  -0.0167 114  ALA B O   
2408 C CB  . ALA B 116 ? 0.1395 0.1966 0.1683 0.0153  0.0061  0.0349  114  ALA B CB  
2409 N N   . GLU B 117 ? 0.1095 0.1349 0.2253 0.0164  0.0073  0.0062  115  GLU B N   
2410 C CA  . GLU B 117 ? 0.1496 0.1297 0.2349 0.0420  -0.0136 -0.0194 115  GLU B CA  
2411 C C   . GLU B 117 ? 0.1318 0.1491 0.1436 0.0021  0.0006  0.0252  115  GLU B C   
2412 O O   . GLU B 117 ? 0.1151 0.1872 0.2454 0.0000  -0.0183 -0.0386 115  GLU B O   
2413 C CB  . GLU B 117 ? 0.1935 0.1890 0.2863 -0.0068 -0.0445 0.0303  115  GLU B CB  
2414 C CG  . GLU B 117 ? 0.2691 0.3058 0.3199 0.0087  0.0369  0.0359  115  GLU B CG  
2415 C CD  . GLU B 117 ? 0.3235 0.3206 0.3213 -0.0501 0.0155  -0.0211 115  GLU B CD  
2416 O OE1 . GLU B 117 ? 0.3621 0.5250 0.7462 -0.1075 -0.1029 -0.1558 115  GLU B OE1 
2417 O OE2 . GLU B 117 ? 0.3548 0.4804 0.5877 -0.1435 0.1005  0.0132  115  GLU B OE2 
2418 N N   . ASN B 118 ? 0.1055 0.1167 0.1498 0.0021  -0.0065 0.0350  116  ASN B N   
2419 C CA  . ASN B 118 ? 0.1121 0.0833 0.1596 0.0070  0.0129  0.0282  116  ASN B CA  
2420 C C   . ASN B 118 ? 0.1019 0.0701 0.1183 0.0093  0.0104  0.0022  116  ASN B C   
2421 O O   . ASN B 118 ? 0.0951 0.1252 0.1210 0.0149  0.0233  0.0165  116  ASN B O   
2422 C CB  . ASN B 118 ? 0.1405 0.1369 0.1426 0.0141  -0.0012 0.0401  116  ASN B CB  
2423 C CG  . ASN B 118 ? 0.1454 0.1597 0.1736 0.0101  0.0100  0.0242  116  ASN B CG  
2424 O OD1 . ASN B 118 ? 0.1663 0.1304 0.1572 -0.0125 -0.0069 0.0098  116  ASN B OD1 
2425 N ND2 . ASN B 118 ? 0.1860 0.1979 0.1848 0.0108  0.0334  0.0245  116  ASN B ND2 
2426 N N   . GLU B 119 ? 0.0951 0.0820 0.1198 0.0062  -0.0016 0.0065  117  GLU B N   
2427 C CA  . GLU B 119 ? 0.0632 0.0917 0.0960 -0.0034 0.0114  0.0220  117  GLU B CA  
2428 C C   . GLU B 119 ? 0.0829 0.0994 0.1014 -0.0038 -0.0012 0.0030  117  GLU B C   
2429 O O   . GLU B 119 ? 0.0943 0.0994 0.1198 0.0121  -0.0023 0.0182  117  GLU B O   
2430 C CB  . GLU B 119 ? 0.0933 0.1102 0.0947 -0.0139 -0.0051 0.0297  117  GLU B CB  
2431 C CG  . GLU B 119 ? 0.0834 0.0967 0.1137 0.0100  0.0048  -0.0012 117  GLU B CG  
2432 C CD  . GLU B 119 ? 0.1342 0.1555 0.1381 -0.0356 -0.0178 -0.0084 117  GLU B CD  
2433 O OE1 . GLU B 119 ? 0.1413 0.1493 0.1601 -0.0101 -0.0189 0.0217  117  GLU B OE1 
2434 O OE2 . GLU B 119 ? 0.1131 0.1579 0.1396 0.0026  -0.0456 -0.0033 117  GLU B OE2 
2435 N N   A ILE B 120 ? 0.0870 0.0768 0.0886 -0.0071 0.0039  0.0018  118  ILE B N   
2436 N N   B ILE B 120 ? 0.0916 0.0818 0.0976 -0.0045 0.0022  0.0014  118  ILE B N   
2437 C CA  A ILE B 120 ? 0.0914 0.0934 0.0956 0.0162  0.0021  0.0118  118  ILE B CA  
2438 C CA  B ILE B 120 ? 0.0946 0.1003 0.1031 0.0119  0.0027  0.0110  118  ILE B CA  
2439 C C   A ILE B 120 ? 0.0876 0.0935 0.0933 0.0158  -0.0020 0.0073  118  ILE B C   
2440 C C   B ILE B 120 ? 0.0850 0.0984 0.1040 0.0130  0.0041  0.0065  118  ILE B C   
2441 O O   A ILE B 120 ? 0.0734 0.0875 0.1133 0.0028  0.0259  0.0165  118  ILE B O   
2442 O O   B ILE B 120 ? 0.0915 0.0972 0.1185 0.0150  0.0278  0.0208  118  ILE B O   
2443 C CB  A ILE B 120 ? 0.1204 0.0929 0.0977 -0.0018 0.0011  -0.0150 118  ILE B CB  
2444 C CB  B ILE B 120 ? 0.1623 0.1365 0.1350 -0.0382 -0.0091 -0.0034 118  ILE B CB  
2445 C CG1 A ILE B 120 ? 0.1052 0.1037 0.0999 -0.0116 -0.0211 0.0213  118  ILE B CG1 
2446 C CG1 B ILE B 120 ? 0.2008 0.1705 0.1379 -0.0329 -0.0411 -0.0141 118  ILE B CG1 
2447 C CG2 A ILE B 120 ? 0.1712 0.1456 0.1270 -0.0175 -0.0059 0.0391  118  ILE B CG2 
2448 C CG2 B ILE B 120 ? 0.1151 0.1910 0.2332 -0.0196 -0.0342 -0.0176 118  ILE B CG2 
2449 C CD1 A ILE B 120 ? 0.1617 0.0711 0.1473 -0.0422 -0.0113 -0.0393 118  ILE B CD1 
2450 C CD1 B ILE B 120 ? 0.1651 0.1454 0.2498 -0.0310 -0.0211 0.0252  118  ILE B CD1 
2451 N N   . PHE B 121 ? 0.0837 0.0846 0.1190 0.0208  0.0172  0.0059  119  PHE B N   
2452 C CA  . PHE B 121 ? 0.1232 0.1059 0.1154 0.0004  0.0379  0.0084  119  PHE B CA  
2453 C C   . PHE B 121 ? 0.0925 0.1121 0.1161 0.0196  0.0341  0.0028  119  PHE B C   
2454 O O   . PHE B 121 ? 0.1289 0.1733 0.0969 0.0521  0.0255  0.0081  119  PHE B O   
2455 C CB  . PHE B 121 ? 0.1003 0.1486 0.1665 0.0405  0.0332  0.0132  119  PHE B CB  
2456 C CG  . PHE B 121 ? 0.1773 0.1744 0.2482 -0.0072 0.0216  -0.0360 119  PHE B CG  
2457 C CD1 . PHE B 121 ? 0.2992 0.2295 0.2894 -0.0421 -0.0182 0.0309  119  PHE B CD1 
2458 C CD2 . PHE B 121 ? 0.3145 0.1600 0.2855 -0.0343 0.0037  -0.0332 119  PHE B CD2 
2459 C CE1 . PHE B 121 ? 0.3136 0.2665 0.2873 -0.0951 -0.0055 0.0091  119  PHE B CE1 
2460 C CE2 . PHE B 121 ? 0.2094 0.3768 0.2966 -0.0757 0.0327  0.0013  119  PHE B CE2 
2461 C CZ  . PHE B 121 ? 0.1038 0.3015 0.3096 -0.0405 -0.0154 -0.0402 119  PHE B CZ  
2462 N N   . VAL B 122 ? 0.0831 0.0890 0.0763 0.0058  0.0242  0.0146  120  VAL B N   
2463 C CA  . VAL B 122 ? 0.1096 0.0817 0.0735 -0.0114 0.0213  0.0104  120  VAL B CA  
2464 C C   . VAL B 122 ? 0.0830 0.0735 0.0919 0.0035  0.0401  -0.0055 120  VAL B C   
2465 O O   . VAL B 122 ? 0.1481 0.0760 0.1288 -0.0191 0.0559  -0.0118 120  VAL B O   
2466 C CB  . VAL B 122 ? 0.1206 0.1117 0.0816 -0.0071 0.0369  0.0213  120  VAL B CB  
2467 C CG1 . VAL B 122 ? 0.1249 0.1310 0.1145 0.0070  0.0110  0.0169  120  VAL B CG1 
2468 C CG2 . VAL B 122 ? 0.1043 0.1006 0.1184 0.0000  0.0167  0.0052  120  VAL B CG2 
2469 N N   A ARG B 123 ? 0.0884 0.0996 0.0616 0.0020  0.0127  0.0089  121  ARG B N   
2470 N N   B ARG B 123 ? 0.0885 0.0999 0.0648 0.0023  0.0165  0.0084  121  ARG B N   
2471 C CA  A ARG B 123 ? 0.0922 0.0806 0.0626 0.0060  0.0187  -0.0055 121  ARG B CA  
2472 C CA  B ARG B 123 ? 0.0916 0.0817 0.0679 0.0040  0.0195  -0.0048 121  ARG B CA  
2473 C C   A ARG B 123 ? 0.0700 0.0937 0.0631 -0.0025 0.0219  -0.0043 121  ARG B C   
2474 C C   B ARG B 123 ? 0.0826 0.0947 0.0663 -0.0022 0.0239  -0.0002 121  ARG B C   
2475 O O   A ARG B 123 ? 0.1261 0.0951 0.0729 -0.0057 0.0340  -0.0138 121  ARG B O   
2476 O O   B ARG B 123 ? 0.1355 0.0883 0.0881 -0.0073 0.0283  -0.0115 121  ARG B O   
2477 C CB  A ARG B 123 ? 0.0863 0.1207 0.0794 -0.0091 0.0137  -0.0175 121  ARG B CB  
2478 C CB  B ARG B 123 ? 0.0888 0.1225 0.0833 0.0019  0.0204  -0.0047 121  ARG B CB  
2479 C CG  A ARG B 123 ? 0.0929 0.1192 0.0865 -0.0151 0.0133  0.0093  121  ARG B CG  
2480 C CG  B ARG B 123 ? 0.1022 0.0934 0.1006 0.0130  0.0370  0.0154  121  ARG B CG  
2481 C CD  A ARG B 123 ? 0.1228 0.1330 0.1075 0.0261  0.0187  -0.0235 121  ARG B CD  
2482 C CD  B ARG B 123 ? 0.0968 0.1250 0.1388 0.0132  0.0118  -0.0035 121  ARG B CD  
2483 N NE  A ARG B 123 ? 0.1176 0.1899 0.1437 0.0265  -0.0034 -0.0123 121  ARG B NE  
2484 N NE  B ARG B 123 ? 0.1224 0.1589 0.1683 0.0077  -0.0023 0.0266  121  ARG B NE  
2485 C CZ  A ARG B 123 ? 0.1177 0.1530 0.1174 0.0198  0.0253  -0.0209 121  ARG B CZ  
2486 C CZ  B ARG B 123 ? 0.1173 0.1365 0.1635 0.0337  0.0190  0.0013  121  ARG B CZ  
2487 N NH1 A ARG B 123 ? 0.1550 0.1707 0.1475 -0.0048 -0.0029 -0.0242 121  ARG B NH1 
2488 N NH1 B ARG B 123 ? 0.0776 0.1426 0.1139 -0.0113 -0.0228 -0.0022 121  ARG B NH1 
2489 N NH2 A ARG B 123 ? 0.1577 0.1310 0.1632 0.0387  -0.0084 -0.0281 121  ARG B NH2 
2490 N NH2 B ARG B 123 ? 0.0660 0.1943 0.1544 -0.0095 -0.0238 0.0125  121  ARG B NH2 
2491 N N   . VAL B 124 ? 0.1046 0.1013 0.0737 0.0111  0.0133  0.0011  122  VAL B N   
2492 C CA  . VAL B 124 ? 0.0788 0.1126 0.0863 -0.0210 -0.0133 -0.0038 122  VAL B CA  
2493 C C   . VAL B 124 ? 0.1043 0.1162 0.0702 -0.0078 0.0178  0.0042  122  VAL B C   
2494 O O   . VAL B 124 ? 0.1341 0.1215 0.0914 -0.0470 0.0070  -0.0017 122  VAL B O   
2495 C CB  . VAL B 124 ? 0.0794 0.0927 0.1005 -0.0039 -0.0235 0.0102  122  VAL B CB  
2496 C CG1 . VAL B 124 ? 0.1252 0.0975 0.1158 -0.0182 -0.0062 -0.0020 122  VAL B CG1 
2497 C CG2 . VAL B 124 ? 0.1028 0.1189 0.1396 -0.0099 0.0212  -0.0032 122  VAL B CG2 
2498 N N   . SER B 125 ? 0.1172 0.0881 0.0728 -0.0135 0.0192  -0.0098 123  SER B N   
2499 C CA  . SER B 125 ? 0.1033 0.0873 0.0714 -0.0234 -0.0038 -0.0114 123  SER B CA  
2500 C C   . SER B 125 ? 0.1086 0.1086 0.0558 -0.0030 0.0130  -0.0118 123  SER B C   
2501 O O   . SER B 125 ? 0.1033 0.1249 0.0977 -0.0157 0.0254  0.0351  123  SER B O   
2502 C CB  . SER B 125 ? 0.1047 0.0773 0.0999 -0.0295 0.0178  0.0159  123  SER B CB  
2503 O OG  . SER B 125 ? 0.0923 0.1086 0.0896 -0.0158 0.0287  0.0079  123  SER B OG  
2504 N N   . LEU B 126 ? 0.1091 0.1122 0.0845 -0.0097 0.0105  -0.0092 124  LEU B N   
2505 C CA  . LEU B 126 ? 0.1107 0.1399 0.1092 -0.0015 0.0261  -0.0067 124  LEU B CA  
2506 C C   . LEU B 126 ? 0.1229 0.1397 0.0941 0.0113  0.0369  0.0135  124  LEU B C   
2507 O O   . LEU B 126 ? 0.1144 0.1797 0.1505 0.0341  0.0047  -0.0034 124  LEU B O   
2508 C CB  . LEU B 126 ? 0.1731 0.1400 0.1201 -0.0151 0.0216  0.0120  124  LEU B CB  
2509 C CG  . LEU B 126 ? 0.2058 0.1563 0.1881 -0.0247 0.0110  -0.0172 124  LEU B CG  
2510 C CD1 . LEU B 126 ? 0.2749 0.1989 0.2628 -0.0807 -0.0296 0.0113  124  LEU B CD1 
2511 C CD2 . LEU B 126 ? 0.2270 0.1708 0.2821 -0.0296 0.0673  -0.0240 124  LEU B CD2 
2512 N N   . SER B 127 ? 0.1059 0.1230 0.0750 0.0058  0.0131  0.0028  125  SER B N   
2513 C CA  . SER B 127 ? 0.0907 0.1126 0.1018 -0.0061 -0.0125 -0.0006 125  SER B CA  
2514 C C   . SER B 127 ? 0.1200 0.1054 0.0808 -0.0119 0.0066  0.0188  125  SER B C   
2515 O O   . SER B 127 ? 0.1061 0.1242 0.0794 -0.0173 0.0038  0.0087  125  SER B O   
2516 C CB  . SER B 127 ? 0.1176 0.1189 0.0988 -0.0315 -0.0092 0.0048  125  SER B CB  
2517 O OG  . SER B 127 ? 0.0941 0.1563 0.1082 -0.0139 0.0203  -0.0112 125  SER B OG  
2518 N N   . GLY B 128 ? 0.1033 0.0997 0.0838 -0.0015 0.0005  0.0253  126  GLY B N   
2519 C CA  . GLY B 128 ? 0.1178 0.1114 0.1077 -0.0111 0.0242  0.0069  126  GLY B CA  
2520 C C   . GLY B 128 ? 0.1034 0.0991 0.0559 -0.0217 0.0241  0.0152  126  GLY B C   
2521 O O   . GLY B 128 ? 0.1085 0.0989 0.1241 -0.0338 0.0161  0.0220  126  GLY B O   
2522 N N   . GLN B 129 ? 0.1034 0.0859 0.0855 -0.0078 0.0172  0.0130  127  GLN B N   
2523 C CA  . GLN B 129 ? 0.1108 0.0969 0.0710 -0.0070 -0.0104 -0.0125 127  GLN B CA  
2524 C C   . GLN B 129 ? 0.1011 0.0738 0.0844 -0.0024 -0.0038 -0.0003 127  GLN B C   
2525 O O   . GLN B 129 ? 0.1902 0.1012 0.0752 -0.0052 0.0018  -0.0036 127  GLN B O   
2526 C CB  . GLN B 129 ? 0.1366 0.1009 0.0816 -0.0137 0.0255  -0.0215 127  GLN B CB  
2527 C CG  . GLN B 129 ? 0.1520 0.1452 0.0923 -0.0389 0.0287  -0.0025 127  GLN B CG  
2528 C CD  . GLN B 129 ? 0.1304 0.1526 0.1028 -0.0314 0.0106  0.0077  127  GLN B CD  
2529 O OE1 . GLN B 129 ? 0.1555 0.1898 0.1281 -0.0234 0.0184  -0.0371 127  GLN B OE1 
2530 N NE2 . GLN B 129 ? 0.1698 0.1660 0.1174 -0.0077 0.0278  -0.0167 127  GLN B NE2 
2531 N N   . MET B 130 ? 0.1074 0.0725 0.0748 0.0049  0.0260  -0.0037 128  MET B N   
2532 C CA  . MET B 130 ? 0.0909 0.0975 0.0738 -0.0017 -0.0156 -0.0044 128  MET B CA  
2533 C C   . MET B 130 ? 0.0815 0.1036 0.0766 0.0001  0.0177  0.0169  128  MET B C   
2534 O O   . MET B 130 ? 0.0754 0.1107 0.0912 0.0017  0.0027  -0.0028 128  MET B O   
2535 C CB  . MET B 130 ? 0.0888 0.1004 0.0896 -0.0083 0.0224  0.0215  128  MET B CB  
2536 C CG  . MET B 130 ? 0.0891 0.1232 0.1442 -0.0309 0.0451  0.0270  128  MET B CG  
2537 S SD  . MET B 130 ? 0.1111 0.1668 0.1982 -0.0302 0.0045  0.0298  128  MET B SD  
2538 C CE  . MET B 130 ? 0.1296 0.2191 0.1760 0.0074  0.0106  0.0293  128  MET B CE  
2539 N N   . SER B 131 ? 0.0733 0.1103 0.0855 0.0018  0.0095  -0.0134 129  SER B N   
2540 C CA  . SER B 131 ? 0.0771 0.0938 0.0951 0.0028  0.0119  0.0092  129  SER B CA  
2541 C C   . SER B 131 ? 0.0797 0.0979 0.1027 0.0082  -0.0003 -0.0123 129  SER B C   
2542 O O   . SER B 131 ? 0.0875 0.0954 0.0936 -0.0046 0.0044  -0.0143 129  SER B O   
2543 C CB  . SER B 131 ? 0.0965 0.1302 0.1023 0.0040  0.0059  0.0015  129  SER B CB  
2544 O OG  . SER B 131 ? 0.0854 0.1186 0.0941 0.0046  0.0037  -0.0125 129  SER B OG  
2545 N N   . PRO B 132 ? 0.0761 0.1272 0.1268 0.0219  0.0114  -0.0044 130  PRO B N   
2546 C CA  . PRO B 132 ? 0.1052 0.1164 0.1050 0.0252  -0.0082 -0.0205 130  PRO B CA  
2547 C C   . PRO B 132 ? 0.1134 0.0961 0.1276 0.0134  -0.0048 0.0048  130  PRO B C   
2548 O O   . PRO B 132 ? 0.1363 0.0859 0.1693 -0.0009 -0.0003 -0.0015 130  PRO B O   
2549 C CB  . PRO B 132 ? 0.0989 0.1409 0.1592 0.0051  0.0078  -0.0284 130  PRO B CB  
2550 C CG  . PRO B 132 ? 0.1299 0.1425 0.1688 0.0275  0.0350  -0.0244 130  PRO B CG  
2551 C CD  . PRO B 132 ? 0.0732 0.1034 0.1102 -0.0033 0.0002  -0.0087 130  PRO B CD  
2552 N N   . ILE B 133 ? 0.0881 0.1269 0.1395 0.0248  -0.0012 0.0050  131  ILE B N   
2553 C CA  . ILE B 133 ? 0.1217 0.1096 0.1799 0.0019  0.0233  0.0166  131  ILE B CA  
2554 C C   . ILE B 133 ? 0.1343 0.0874 0.1537 0.0180  0.0068  -0.0056 131  ILE B C   
2555 O O   . ILE B 133 ? 0.1448 0.1121 0.1427 0.0264  0.0104  0.0339  131  ILE B O   
2556 C CB  . ILE B 133 ? 0.1356 0.1995 0.1702 0.0049  0.0090  0.0159  131  ILE B CB  
2557 C CG1 . ILE B 133 ? 0.1798 0.3062 0.2643 0.0413  -0.0082 0.0047  131  ILE B CG1 
2558 C CG2 . ILE B 133 ? 0.2104 0.2762 0.1399 -0.0511 -0.0189 0.0864  131  ILE B CG2 
2559 C CD1 . ILE B 133 ? 0.2390 0.3427 0.2920 -0.0172 -0.0525 0.0312  131  ILE B CD1 
2560 N N   . THR B 134 ? 0.0937 0.0885 0.0908 0.0033  -0.0064 0.0037  132  THR B N   
2561 C CA  . THR B 134 ? 0.0935 0.0916 0.0904 -0.0004 0.0199  0.0034  132  THR B CA  
2562 C C   . THR B 134 ? 0.0904 0.0679 0.0946 0.0096  0.0118  -0.0001 132  THR B C   
2563 O O   . THR B 134 ? 0.0895 0.0848 0.1169 -0.0045 0.0217  -0.0084 132  THR B O   
2564 C CB  . THR B 134 ? 0.0967 0.0869 0.1032 0.0172  0.0065  0.0000  132  THR B CB  
2565 O OG1 . THR B 134 ? 0.1006 0.0914 0.1124 0.0265  -0.0018 -0.0170 132  THR B OG1 
2566 C CG2 . THR B 134 ? 0.0941 0.1034 0.1244 0.0201  0.0107  0.0209  132  THR B CG2 
2567 N N   A ARG B 135 ? 0.0863 0.1094 0.0778 -0.0127 0.0010  0.0086  133  ARG B N   
2568 N N   B ARG B 135 ? 0.0887 0.1061 0.0817 -0.0125 0.0049  0.0080  133  ARG B N   
2569 C CA  A ARG B 135 ? 0.0999 0.1027 0.1018 -0.0100 -0.0092 -0.0050 133  ARG B CA  
2570 C CA  B ARG B 135 ? 0.0896 0.1002 0.0992 -0.0066 0.0015  -0.0080 133  ARG B CA  
2571 C C   A ARG B 135 ? 0.0981 0.1110 0.1035 -0.0119 0.0015  -0.0065 133  ARG B C   
2572 C C   B ARG B 135 ? 0.1101 0.1048 0.1071 -0.0070 0.0065  -0.0073 133  ARG B C   
2573 O O   A ARG B 135 ? 0.1148 0.1258 0.1411 -0.0361 -0.0118 -0.0292 133  ARG B O   
2574 O O   B ARG B 135 ? 0.1255 0.1378 0.1155 -0.0303 0.0140  -0.0356 133  ARG B O   
2575 C CB  A ARG B 135 ? 0.0959 0.1307 0.0930 -0.0005 -0.0274 -0.0051 133  ARG B CB  
2576 C CB  B ARG B 135 ? 0.1105 0.1164 0.1042 -0.0137 -0.0062 0.0038  133  ARG B CB  
2577 C CG  A ARG B 135 ? 0.1212 0.1664 0.1079 -0.0155 -0.0322 0.0246  133  ARG B CG  
2578 C CG  B ARG B 135 ? 0.1203 0.1081 0.1151 -0.0153 0.0095  -0.0149 133  ARG B CG  
2579 C CD  A ARG B 135 ? 0.0932 0.1483 0.1337 -0.0786 -0.0049 -0.0528 133  ARG B CD  
2580 C CD  B ARG B 135 ? 0.1272 0.2126 0.1067 0.0000  -0.0099 -0.0016 133  ARG B CD  
2581 N NE  A ARG B 135 ? 0.1518 0.2090 0.0990 -0.0311 0.0270  -0.0249 133  ARG B NE  
2582 N NE  B ARG B 135 ? 0.1713 0.1571 0.1685 0.0309  -0.0091 -0.0681 133  ARG B NE  
2583 C CZ  A ARG B 135 ? 0.1644 0.1795 0.2193 -0.0274 0.0140  -0.0351 133  ARG B CZ  
2584 C CZ  B ARG B 135 ? 0.2067 0.2055 0.1987 -0.0144 0.0209  -0.0504 133  ARG B CZ  
2585 N NH1 A ARG B 135 ? 0.2223 0.1720 0.2203 0.0062  0.0748  0.0063  133  ARG B NH1 
2586 N NH1 B ARG B 135 ? 0.1530 0.1648 0.1545 0.0123  -0.0089 0.0353  133  ARG B NH1 
2587 N NH2 A ARG B 135 ? 0.1787 0.2057 0.2382 0.0258  0.0013  0.0597  133  ARG B NH2 
2588 N NH2 B ARG B 135 ? 0.1383 0.2306 0.1839 -0.0067 0.0607  -0.0936 133  ARG B NH2 
2589 N N   . GLU B 136 ? 0.1120 0.1116 0.1199 -0.0055 0.0079  -0.0056 134  GLU B N   
2590 C CA  . GLU B 136 ? 0.1416 0.1059 0.1156 0.0011  0.0098  -0.0293 134  GLU B CA  
2591 C C   . GLU B 136 ? 0.1524 0.1220 0.1035 -0.0063 0.0128  -0.0199 134  GLU B C   
2592 O O   . GLU B 136 ? 0.2197 0.1239 0.1691 -0.0340 0.0451  -0.0322 134  GLU B O   
2593 C CB  . GLU B 136 ? 0.1952 0.1156 0.1914 0.0385  0.0097  0.0123  134  GLU B CB  
2594 C CG  . GLU B 136 ? 0.2273 0.1918 0.2745 0.0269  0.0507  -0.0212 134  GLU B CG  
2595 C CD  . GLU B 136 ? 0.2858 0.3685 0.3255 0.0475  0.0075  0.0977  134  GLU B CD  
2596 O OE1 . GLU B 136 ? 0.5135 0.3649 0.3735 0.0671  0.0600  0.1216  134  GLU B OE1 
2597 O OE2 . GLU B 136 ? 0.3433 0.4529 0.6125 0.0224  0.0973  0.0711  134  GLU B OE2 
2598 N N   . TYR B 137 ? 0.1009 0.0824 0.0934 0.0003  0.0048  0.0025  135  TYR B N   
2599 C CA  . TYR B 137 ? 0.1090 0.0771 0.0873 0.0122  0.0003  0.0178  135  TYR B CA  
2600 C C   . TYR B 137 ? 0.0863 0.0831 0.0780 -0.0185 -0.0013 -0.0026 135  TYR B C   
2601 O O   . TYR B 137 ? 0.1200 0.0752 0.0884 -0.0111 0.0210  0.0108  135  TYR B O   
2602 C CB  . TYR B 137 ? 0.0857 0.0812 0.1043 0.0133  0.0057  0.0044  135  TYR B CB  
2603 C CG  . TYR B 137 ? 0.0914 0.0993 0.0829 0.0083  0.0002  0.0127  135  TYR B CG  
2604 C CD1 . TYR B 137 ? 0.0899 0.0507 0.0840 -0.0059 0.0047  -0.0136 135  TYR B CD1 
2605 C CD2 . TYR B 137 ? 0.1007 0.0819 0.0857 -0.0093 -0.0016 0.0030  135  TYR B CD2 
2606 C CE1 . TYR B 137 ? 0.1154 0.0925 0.1092 -0.0031 0.0262  0.0030  135  TYR B CE1 
2607 C CE2 . TYR B 137 ? 0.0939 0.0729 0.0958 -0.0059 -0.0022 -0.0038 135  TYR B CE2 
2608 C CZ  . TYR B 137 ? 0.0969 0.0734 0.0657 -0.0056 -0.0051 -0.0122 135  TYR B CZ  
2609 O OH  . TYR B 137 ? 0.0992 0.0924 0.0730 -0.0057 -0.0039 -0.0105 135  TYR B OH  
2610 N N   . LEU B 138 ? 0.0792 0.0914 0.0660 -0.0008 -0.0017 0.0003  136  LEU B N   
2611 C CA  . LEU B 138 ? 0.0678 0.0777 0.0681 0.0068  0.0071  -0.0220 136  LEU B CA  
2612 C C   . LEU B 138 ? 0.0922 0.0929 0.0621 -0.0191 0.0028  -0.0026 136  LEU B C   
2613 O O   . LEU B 138 ? 0.0992 0.1055 0.0925 -0.0059 0.0157  -0.0179 136  LEU B O   
2614 C CB  . LEU B 138 ? 0.0829 0.0992 0.0858 0.0118  0.0161  0.0050  136  LEU B CB  
2615 C CG  . LEU B 138 ? 0.1073 0.0878 0.1056 -0.0001 -0.0001 0.0040  136  LEU B CG  
2616 C CD1 . LEU B 138 ? 0.1124 0.1012 0.1253 0.0117  -0.0117 0.0238  136  LEU B CD1 
2617 C CD2 . LEU B 138 ? 0.1099 0.0777 0.0961 0.0020  -0.0037 0.0077  136  LEU B CD2 
2618 N N   . ASP B 139 ? 0.0921 0.0676 0.0628 -0.0080 -0.0049 0.0096  137  ASP B N   
2619 C CA  . ASP B 139 ? 0.0951 0.1029 0.0704 -0.0213 -0.0100 0.0032  137  ASP B CA  
2620 C C   . ASP B 139 ? 0.0960 0.0814 0.0622 -0.0316 0.0014  0.0085  137  ASP B C   
2621 O O   . ASP B 139 ? 0.0976 0.0755 0.0870 -0.0270 -0.0007 0.0171  137  ASP B O   
2622 C CB  . ASP B 139 ? 0.1336 0.1138 0.0708 -0.0397 -0.0001 0.0087  137  ASP B CB  
2623 C CG  . ASP B 139 ? 0.1706 0.1085 0.1822 -0.0364 0.0124  -0.0051 137  ASP B CG  
2624 O OD1 . ASP B 139 ? 0.1739 0.1294 0.1244 0.0024  -0.0025 0.0039  137  ASP B OD1 
2625 O OD2 . ASP B 139 ? 0.2108 0.2057 0.2514 -0.0172 0.0715  0.0325  137  ASP B OD2 
2626 N N   . GLU B 140 ? 0.1059 0.0773 0.0750 -0.0298 0.0017  -0.0046 138  GLU B N   
2627 C CA  . GLU B 140 ? 0.0970 0.0983 0.0840 -0.0240 -0.0047 0.0042  138  GLU B CA  
2628 C C   . GLU B 140 ? 0.1191 0.0882 0.0716 -0.0217 0.0183  -0.0036 138  GLU B C   
2629 O O   . GLU B 140 ? 0.1359 0.0821 0.0911 -0.0386 0.0300  -0.0138 138  GLU B O   
2630 C CB  . GLU B 140 ? 0.1259 0.1207 0.0766 -0.0330 -0.0031 -0.0033 138  GLU B CB  
2631 C CG  . GLU B 140 ? 0.1358 0.1374 0.0873 -0.0376 0.0035  0.0136  138  GLU B CG  
2632 C CD  . GLU B 140 ? 0.1574 0.1159 0.1278 -0.0177 0.0130  -0.0140 138  GLU B CD  
2633 O OE1 . GLU B 140 ? 0.2327 0.1353 0.1366 -0.0504 -0.0097 -0.0087 138  GLU B OE1 
2634 O OE2 . GLU B 140 ? 0.1930 0.1393 0.1059 -0.0129 0.0035  -0.0337 138  GLU B OE2 
2635 N N   . VAL B 141 ? 0.0839 0.0894 0.0897 -0.0297 0.0079  0.0056  139  VAL B N   
2636 C CA  . VAL B 141 ? 0.1094 0.0913 0.0912 -0.0139 -0.0164 -0.0023 139  VAL B CA  
2637 C C   . VAL B 141 ? 0.1058 0.0702 0.0985 -0.0219 -0.0106 0.0204  139  VAL B C   
2638 O O   . VAL B 141 ? 0.1184 0.0640 0.0845 -0.0019 0.0021  0.0121  139  VAL B O   
2639 C CB  . VAL B 141 ? 0.0869 0.1178 0.1406 -0.0151 -0.0141 -0.0050 139  VAL B CB  
2640 C CG1 . VAL B 141 ? 0.1463 0.1647 0.1971 -0.0140 0.0383  -0.0416 139  VAL B CG1 
2641 C CG2 . VAL B 141 ? 0.1570 0.1653 0.1821 -0.0441 -0.0095 -0.0458 139  VAL B CG2 
2642 N N   . GLN B 142 ? 0.0745 0.0729 0.0791 -0.0160 0.0078  0.0020  140  GLN B N   
2643 C CA  . GLN B 142 ? 0.0924 0.0677 0.0780 -0.0131 0.0000  -0.0022 140  GLN B CA  
2644 C C   . GLN B 142 ? 0.0820 0.0685 0.0819 0.0047  0.0054  0.0070  140  GLN B C   
2645 O O   . GLN B 142 ? 0.0908 0.0727 0.0813 -0.0094 0.0042  -0.0154 140  GLN B O   
2646 C CB  . GLN B 142 ? 0.0677 0.0865 0.0916 -0.0100 0.0023  0.0080  140  GLN B CB  
2647 C CG  . GLN B 142 ? 0.0850 0.0894 0.0908 -0.0248 0.0103  0.0020  140  GLN B CG  
2648 C CD  . GLN B 142 ? 0.0814 0.1056 0.0769 -0.0117 0.0101  0.0064  140  GLN B CD  
2649 O OE1 . GLN B 142 ? 0.0893 0.1096 0.0893 -0.0134 0.0074  0.0048  140  GLN B OE1 
2650 N NE2 . GLN B 142 ? 0.0790 0.0915 0.0738 -0.0190 0.0166  0.0118  140  GLN B NE2 
2651 N N   . ARG B 143 ? 0.0942 0.0733 0.0776 -0.0233 0.0028  -0.0180 141  ARG B N   
2652 C CA  . ARG B 143 ? 0.1069 0.0853 0.0726 -0.0289 0.0004  -0.0103 141  ARG B CA  
2653 C C   . ARG B 143 ? 0.1017 0.0700 0.0699 -0.0073 0.0209  -0.0133 141  ARG B C   
2654 O O   . ARG B 143 ? 0.1368 0.0688 0.0822 -0.0105 0.0311  -0.0160 141  ARG B O   
2655 C CB  . ARG B 143 ? 0.1054 0.0813 0.0723 -0.0097 -0.0252 -0.0065 141  ARG B CB  
2656 C CG  . ARG B 143 ? 0.0809 0.0951 0.0907 0.0054  -0.0021 -0.0036 141  ARG B CG  
2657 C CD  . ARG B 143 ? 0.0850 0.0607 0.1228 -0.0034 0.0082  -0.0119 141  ARG B CD  
2658 N NE  . ARG B 143 ? 0.1202 0.1005 0.0885 -0.0127 0.0089  -0.0069 141  ARG B NE  
2659 C CZ  . ARG B 143 ? 0.1214 0.1053 0.0841 -0.0040 -0.0153 0.0030  141  ARG B CZ  
2660 N NH1 . ARG B 143 ? 0.1190 0.0932 0.0883 -0.0210 -0.0086 0.0128  141  ARG B NH1 
2661 N NH2 . ARG B 143 ? 0.1199 0.0835 0.0766 -0.0071 -0.0160 0.0149  141  ARG B NH2 
2662 N N   A GLN B 144 ? 0.1322 0.0610 0.0910 -0.0006 -0.0112 0.0060  142  GLN B N   
2663 N N   B GLN B 144 ? 0.1225 0.0685 0.0895 -0.0038 -0.0061 0.0007  142  GLN B N   
2664 C CA  A GLN B 144 ? 0.1139 0.0793 0.1008 0.0108  0.0073  0.0152  142  GLN B CA  
2665 C CA  B GLN B 144 ? 0.1144 0.0821 0.0996 0.0045  0.0049  0.0092  142  GLN B CA  
2666 C C   A GLN B 144 ? 0.1114 0.0845 0.0812 -0.0087 0.0128  -0.0019 142  GLN B C   
2667 C C   B GLN B 144 ? 0.1145 0.0847 0.0813 -0.0084 0.0081  0.0023  142  GLN B C   
2668 O O   A GLN B 144 ? 0.1637 0.0766 0.0838 0.0028  0.0088  0.0036  142  GLN B O   
2669 O O   B GLN B 144 ? 0.1636 0.0804 0.0786 0.0065  0.0043  0.0085  142  GLN B O   
2670 C CB  A GLN B 144 ? 0.1187 0.1158 0.1074 0.0192  -0.0209 -0.0077 142  GLN B CB  
2671 C CB  B GLN B 144 ? 0.1137 0.1089 0.1146 0.0104  -0.0149 0.0000  142  GLN B CB  
2672 C CG  A GLN B 144 ? 0.1481 0.0881 0.1158 0.0065  -0.0233 -0.0003 142  GLN B CG  
2673 C CG  B GLN B 144 ? 0.1212 0.1147 0.1310 -0.0091 -0.0044 -0.0110 142  GLN B CG  
2674 C CD  A GLN B 144 ? 0.1775 0.1236 0.1145 -0.0181 -0.0146 -0.0035 142  GLN B CD  
2675 C CD  B GLN B 144 ? 0.1389 0.1000 0.1374 -0.0096 -0.0142 -0.0820 142  GLN B CD  
2676 O OE1 A GLN B 144 ? 0.1628 0.1901 0.1164 0.0235  0.0486  0.0217  142  GLN B OE1 
2677 O OE1 B GLN B 144 ? 0.1546 0.1442 0.1841 -0.0595 0.0045  -0.0731 142  GLN B OE1 
2678 N NE2 A GLN B 144 ? 0.1277 0.3052 0.1437 -0.0207 -0.0149 0.0516  142  GLN B NE2 
2679 N NE2 B GLN B 144 ? 0.1266 0.2083 0.1280 0.0227  -0.0179 -0.0641 142  GLN B NE2 
2680 N N   . ASP B 145 ? 0.1301 0.1048 0.0727 0.0029  0.0011  0.0204  143  ASP B N   
2681 C CA  . ASP B 145 ? 0.0918 0.0939 0.0863 -0.0074 -0.0061 0.0134  143  ASP B CA  
2682 C C   . ASP B 145 ? 0.0916 0.0730 0.0683 0.0002  0.0018  0.0060  143  ASP B C   
2683 O O   . ASP B 145 ? 0.1104 0.0916 0.0967 0.0317  0.0110  -0.0035 143  ASP B O   
2684 C CB  . ASP B 145 ? 0.1000 0.0829 0.0793 0.0146  -0.0012 0.0107  143  ASP B CB  
2685 C CG  . ASP B 145 ? 0.1165 0.1241 0.1400 -0.0174 0.0084  0.0011  143  ASP B CG  
2686 O OD1 . ASP B 145 ? 0.1280 0.2104 0.1616 -0.0403 -0.0258 0.0213  143  ASP B OD1 
2687 O OD2 . ASP B 145 ? 0.0969 0.1421 0.1411 -0.0361 -0.0138 0.0015  143  ASP B OD2 
2688 N N   . VAL B 146 ? 0.0905 0.0704 0.0679 -0.0116 0.0065  -0.0001 144  VAL B N   
2689 C CA  . VAL B 146 ? 0.0886 0.0568 0.0874 -0.0042 0.0120  -0.0103 144  VAL B CA  
2690 C C   . VAL B 146 ? 0.1499 0.0710 0.0537 0.0014  -0.0116 -0.0019 144  VAL B C   
2691 O O   . VAL B 146 ? 0.1045 0.0687 0.0603 0.0026  0.0127  -0.0041 144  VAL B O   
2692 C CB  . VAL B 146 ? 0.0919 0.0949 0.0531 -0.0043 0.0036  -0.0001 144  VAL B CB  
2693 C CG1 . VAL B 146 ? 0.1043 0.0892 0.0947 -0.0186 0.0050  -0.0113 144  VAL B CG1 
2694 C CG2 . VAL B 146 ? 0.0972 0.0613 0.0628 -0.0188 0.0093  0.0048  144  VAL B CG2 
2695 N N   . THR B 147 ? 0.1211 0.0754 0.0764 -0.0340 0.0150  -0.0123 145  THR B N   
2696 C CA  . THR B 147 ? 0.1194 0.1267 0.0821 -0.0147 0.0083  0.0186  145  THR B CA  
2697 C C   . THR B 147 ? 0.1579 0.0712 0.0728 -0.0008 0.0258  0.0014  145  THR B C   
2698 O O   . THR B 147 ? 0.1775 0.0838 0.0878 -0.0270 0.0161  0.0148  145  THR B O   
2699 C CB  . THR B 147 ? 0.1345 0.1954 0.0841 -0.0007 0.0723  0.0178  145  THR B CB  
2700 O OG1 . THR B 147 ? 0.3043 0.2043 0.1384 -0.0313 0.0133  -0.0174 145  THR B OG1 
2701 C CG2 . THR B 147 ? 0.1883 0.1540 0.1337 0.0059  0.0430  0.0030  145  THR B CG2 
2702 N N   . ASN B 148 ? 0.1644 0.0762 0.0721 -0.0088 0.0168  -0.0081 146  ASN B N   
2703 C CA  . ASN B 148 ? 0.1565 0.1229 0.1119 0.0012  -0.0062 -0.0102 146  ASN B CA  
2704 C C   . ASN B 148 ? 0.1311 0.0882 0.0888 0.0023  0.0099  0.0083  146  ASN B C   
2705 O O   . ASN B 148 ? 0.1684 0.0799 0.0550 -0.0235 0.0126  0.0007  146  ASN B O   
2706 C CB  . ASN B 148 ? 0.1667 0.1478 0.1079 -0.0195 -0.0536 0.0159  146  ASN B CB  
2707 C CG  . ASN B 148 ? 0.2463 0.2258 0.2146 0.0325  0.0093  0.0371  146  ASN B CG  
2708 O OD1 . ASN B 148 ? 0.3649 0.4229 0.2497 -0.0022 -0.0843 0.1040  146  ASN B OD1 
2709 N ND2 . ASN B 148 ? 0.2346 0.2025 0.3332 0.0582  -0.0121 -0.0140 146  ASN B ND2 
2710 N N   . PHE B 149 ? 0.1205 0.0700 0.0820 -0.0155 0.0116  -0.0037 147  PHE B N   
2711 C CA  . PHE B 149 ? 0.0839 0.0817 0.0862 -0.0122 0.0143  -0.0149 147  PHE B CA  
2712 C C   . PHE B 149 ? 0.0963 0.0637 0.0603 -0.0046 0.0182  0.0064  147  PHE B C   
2713 O O   . PHE B 149 ? 0.1165 0.0689 0.0686 0.0001  0.0070  0.0137  147  PHE B O   
2714 C CB  . PHE B 149 ? 0.0782 0.0921 0.0715 -0.0019 -0.0142 -0.0056 147  PHE B CB  
2715 C CG  . PHE B 149 ? 0.0789 0.0830 0.0654 0.0020  0.0151  -0.0113 147  PHE B CG  
2716 C CD1 . PHE B 149 ? 0.0789 0.1047 0.0705 -0.0029 -0.0063 -0.0034 147  PHE B CD1 
2717 C CD2 . PHE B 149 ? 0.0796 0.0756 0.0763 0.0047  0.0032  -0.0052 147  PHE B CD2 
2718 C CE1 . PHE B 149 ? 0.0972 0.0718 0.0871 -0.0022 0.0201  -0.0025 147  PHE B CE1 
2719 C CE2 . PHE B 149 ? 0.0766 0.1014 0.0652 -0.0138 -0.0047 -0.0063 147  PHE B CE2 
2720 C CZ  . PHE B 149 ? 0.0891 0.1077 0.0864 -0.0030 0.0089  -0.0153 147  PHE B CZ  
2721 N N   . LEU B 150 ? 0.1030 0.0898 0.0935 0.0044  0.0180  0.0092  148  LEU B N   
2722 C CA  . LEU B 150 ? 0.0983 0.1084 0.0985 0.0010  0.0429  0.0089  148  LEU B CA  
2723 C C   . LEU B 150 ? 0.1147 0.0953 0.0972 -0.0011 0.0196  0.0052  148  LEU B C   
2724 O O   . LEU B 150 ? 0.1244 0.0701 0.1013 0.0089  0.0193  0.0018  148  LEU B O   
2725 C CB  . LEU B 150 ? 0.0937 0.0869 0.0707 -0.0024 0.0183  -0.0158 148  LEU B CB  
2726 C CG  . LEU B 150 ? 0.0767 0.0796 0.0753 -0.0056 0.0120  0.0002  148  LEU B CG  
2727 C CD1 . LEU B 150 ? 0.0876 0.0885 0.0981 0.0073  0.0261  0.0151  148  LEU B CD1 
2728 C CD2 . LEU B 150 ? 0.1142 0.0887 0.1245 -0.0184 0.0042  -0.0169 148  LEU B CD2 
2729 N N   . VAL B 151 ? 0.1321 0.0661 0.0932 0.0012  0.0298  0.0198  149  VAL B N   
2730 C CA  . VAL B 151 ? 0.1400 0.1005 0.0813 -0.0026 0.0414  0.0080  149  VAL B CA  
2731 C C   . VAL B 151 ? 0.1352 0.0763 0.0979 -0.0229 0.0228  0.0156  149  VAL B C   
2732 O O   . VAL B 151 ? 0.1698 0.0703 0.0762 -0.0088 0.0383  0.0102  149  VAL B O   
2733 C CB  . VAL B 151 ? 0.2246 0.1065 0.1258 0.0083  0.0354  0.0036  149  VAL B CB  
2734 C CG1 . VAL B 151 ? 0.4375 0.1921 0.1484 0.0285  0.0443  0.0481  149  VAL B CG1 
2735 C CG2 . VAL B 151 ? 0.1913 0.1372 0.1336 0.0092  0.0242  0.0192  149  VAL B CG2 
2736 N N   . THR B 152 ? 0.1213 0.0736 0.0725 -0.0217 0.0036  -0.0169 150  THR B N   
2737 C CA  . THR B 152 ? 0.1339 0.0996 0.0615 -0.0020 0.0110  -0.0192 150  THR B CA  
2738 C C   . THR B 152 ? 0.1172 0.0915 0.0797 -0.0108 0.0012  0.0071  150  THR B C   
2739 O O   . THR B 152 ? 0.1161 0.0748 0.0931 -0.0039 0.0072  -0.0040 150  THR B O   
2740 C CB  . THR B 152 ? 0.1211 0.1028 0.1057 -0.0174 -0.0125 0.0228  150  THR B CB  
2741 O OG1 . THR B 152 ? 0.1404 0.1076 0.1511 -0.0262 -0.0415 0.0053  150  THR B OG1 
2742 C CG2 . THR B 152 ? 0.1548 0.1206 0.1289 0.0127  0.0169  0.0044  150  THR B CG2 
2743 N N   . ILE B 153 ? 0.1157 0.0667 0.0850 -0.0034 0.0044  0.0061  151  ILE B N   
2744 C CA  . ILE B 153 ? 0.0948 0.0845 0.0638 -0.0093 0.0123  -0.0158 151  ILE B CA  
2745 C C   . ILE B 153 ? 0.0895 0.0675 0.0777 0.0024  0.0098  -0.0031 151  ILE B C   
2746 O O   . ILE B 153 ? 0.0860 0.0672 0.0860 0.0039  0.0043  -0.0006 151  ILE B O   
2747 C CB  . ILE B 153 ? 0.1009 0.1008 0.0707 -0.0145 -0.0002 0.0100  151  ILE B CB  
2748 C CG1 . ILE B 153 ? 0.1180 0.1194 0.0799 -0.0175 0.0228  0.0027  151  ILE B CG1 
2749 C CG2 . ILE B 153 ? 0.1002 0.0912 0.0678 -0.0124 0.0034  -0.0047 151  ILE B CG2 
2750 C CD1 . ILE B 153 ? 0.1377 0.1428 0.0914 -0.0056 0.0354  -0.0339 151  ILE B CD1 
2751 N N   . TYR B 154 ? 0.0907 0.0685 0.0541 0.0085  0.0028  0.0002  152  TYR B N   
2752 C CA  . TYR B 154 ? 0.0780 0.0543 0.0745 -0.0167 -0.0089 -0.0101 152  TYR B CA  
2753 C C   . TYR B 154 ? 0.0808 0.0870 0.0695 -0.0031 0.0143  0.0007  152  TYR B C   
2754 O O   . TYR B 154 ? 0.0859 0.0677 0.0823 0.0044  0.0128  -0.0001 152  TYR B O   
2755 C CB  . TYR B 154 ? 0.0999 0.0869 0.0920 0.0111  0.0125  -0.0153 152  TYR B CB  
2756 C CG  . TYR B 154 ? 0.1031 0.1084 0.0858 0.0080  0.0037  0.0162  152  TYR B CG  
2757 C CD1 . TYR B 154 ? 0.0950 0.1796 0.1373 -0.0107 0.0126  0.0125  152  TYR B CD1 
2758 C CD2 . TYR B 154 ? 0.1393 0.1335 0.1133 0.0112  0.0086  -0.0136 152  TYR B CD2 
2759 C CE1 . TYR B 154 ? 0.1001 0.2114 0.1828 -0.0171 0.0305  -0.0201 152  TYR B CE1 
2760 C CE2 . TYR B 154 ? 0.1725 0.1340 0.0930 0.0490  0.0436  -0.0142 152  TYR B CE2 
2761 C CZ  . TYR B 154 ? 0.1573 0.1765 0.1124 0.0179  0.0548  0.0323  152  TYR B CZ  
2762 O OH  . TYR B 154 ? 0.1568 0.2704 0.2214 0.0570  0.0898  0.0520  152  TYR B OH  
2763 N N   . ASN B 155 ? 0.0908 0.0722 0.0797 -0.0031 0.0081  -0.0055 153  ASN B N   
2764 C CA  . ASN B 155 ? 0.1036 0.0703 0.0634 0.0065  0.0247  -0.0066 153  ASN B CA  
2765 C C   . ASN B 155 ? 0.1051 0.0674 0.0617 0.0040  0.0120  0.0018  153  ASN B C   
2766 O O   . ASN B 155 ? 0.1438 0.0688 0.0591 0.0029  0.0184  0.0052  153  ASN B O   
2767 C CB  . ASN B 155 ? 0.1098 0.0632 0.0769 0.0157  0.0022  0.0123  153  ASN B CB  
2768 C CG  . ASN B 155 ? 0.1103 0.0937 0.0526 0.0015  0.0137  0.0098  153  ASN B CG  
2769 O OD1 . ASN B 155 ? 0.1075 0.1132 0.0954 0.0113  0.0216  -0.0011 153  ASN B OD1 
2770 N ND2 . ASN B 155 ? 0.1992 0.0966 0.1158 -0.0177 0.0546  -0.0063 153  ASN B ND2 
2771 N N   . GLU B 156 ? 0.1015 0.0761 0.0680 -0.0064 0.0129  -0.0108 154  GLU B N   
2772 C CA  . GLU B 156 ? 0.0984 0.0696 0.0830 0.0086  0.0069  0.0086  154  GLU B CA  
2773 C C   . GLU B 156 ? 0.1134 0.0669 0.0766 0.0072  0.0115  0.0022  154  GLU B C   
2774 O O   . GLU B 156 ? 0.1135 0.0620 0.0938 0.0040  0.0226  0.0076  154  GLU B O   
2775 C CB  . GLU B 156 ? 0.1026 0.0787 0.0891 -0.0014 0.0171  -0.0035 154  GLU B CB  
2776 C CG  . GLU B 156 ? 0.1190 0.0778 0.0943 -0.0072 0.0116  -0.0140 154  GLU B CG  
2777 C CD  . GLU B 156 ? 0.1179 0.1008 0.0920 0.0106  0.0164  0.0028  154  GLU B CD  
2778 O OE1 . GLU B 156 ? 0.1279 0.0918 0.1130 -0.0035 0.0277  -0.0112 154  GLU B OE1 
2779 O OE2 . GLU B 156 ? 0.1470 0.1147 0.1250 -0.0012 0.0290  -0.0118 154  GLU B OE2 
2780 N N   . SER B 157 ? 0.1121 0.0718 0.0958 -0.0009 0.0034  0.0095  155  SER B N   
2781 C CA  . SER B 157 ? 0.1130 0.0637 0.0934 0.0057  0.0046  0.0018  155  SER B CA  
2782 C C   . SER B 157 ? 0.0986 0.0934 0.0957 -0.0001 0.0186  -0.0167 155  SER B C   
2783 O O   . SER B 157 ? 0.1466 0.0942 0.1111 -0.0285 0.0091  0.0236  155  SER B O   
2784 C CB  . SER B 157 ? 0.1027 0.1078 0.0856 -0.0031 -0.0004 -0.0009 155  SER B CB  
2785 O OG  . SER B 157 ? 0.1438 0.1101 0.1245 0.0141  0.0066  -0.0099 155  SER B OG  
2786 N N   . LEU B 158 ? 0.0931 0.0873 0.0974 -0.0096 0.0079  -0.0094 156  LEU B N   
2787 C CA  . LEU B 158 ? 0.1110 0.1137 0.1010 0.0110  0.0175  0.0011  156  LEU B CA  
2788 C C   . LEU B 158 ? 0.0967 0.0930 0.1403 0.0039  0.0116  0.0044  156  LEU B C   
2789 O O   . LEU B 158 ? 0.1610 0.1122 0.1427 0.0154  0.0326  0.0252  156  LEU B O   
2790 C CB  . LEU B 158 ? 0.1160 0.1163 0.1042 -0.0005 0.0204  -0.0012 156  LEU B CB  
2791 C CG  . LEU B 158 ? 0.0999 0.1154 0.1309 0.0012  0.0240  -0.0117 156  LEU B CG  
2792 C CD1 . LEU B 158 ? 0.1215 0.1082 0.1468 0.0042  0.0312  -0.0240 156  LEU B CD1 
2793 C CD2 . LEU B 158 ? 0.0775 0.1612 0.2321 0.0000  0.0125  -0.0277 156  LEU B CD2 
2794 N N   . GLU B 159 ? 0.1004 0.0889 0.1112 0.0024  0.0095  0.0082  157  GLU B N   
2795 C CA  . GLU B 159 ? 0.1544 0.0873 0.1148 0.0028  -0.0014 0.0124  157  GLU B CA  
2796 C C   . GLU B 159 ? 0.1547 0.0997 0.1285 -0.0184 -0.0275 0.0144  157  GLU B C   
2797 O O   . GLU B 159 ? 0.1743 0.1166 0.1878 0.0113  -0.0325 0.0178  157  GLU B O   
2798 C CB  . GLU B 159 ? 0.1666 0.0880 0.1442 -0.0015 -0.0024 0.0196  157  GLU B CB  
2799 C CG  . GLU B 159 ? 0.1638 0.1005 0.1634 0.0135  -0.0354 0.0177  157  GLU B CG  
2800 C CD  . GLU B 159 ? 0.1913 0.1467 0.1554 0.0276  -0.0186 0.0340  157  GLU B CD  
2801 O OE1 . GLU B 159 ? 0.3932 0.1870 0.1860 0.0862  -0.0864 0.0195  157  GLU B OE1 
2802 O OE2 . GLU B 159 ? 0.2447 0.1273 0.1959 0.0317  -0.0091 0.0450  157  GLU B OE2 
2803 N N   . SER B 160 ? 0.1250 0.1019 0.1217 -0.0223 0.0030  0.0108  158  SER B N   
2804 C CA  . SER B 160 ? 0.1601 0.1078 0.1548 -0.0291 0.0022  0.0113  158  SER B CA  
2805 C C   . SER B 160 ? 0.1563 0.1016 0.1216 -0.0148 0.0115  0.0287  158  SER B C   
2806 O O   . SER B 160 ? 0.1386 0.1396 0.1441 -0.0027 -0.0013 0.0038  158  SER B O   
2807 C CB  . SER B 160 ? 0.1068 0.0791 0.1627 -0.0290 -0.0063 -0.0185 158  SER B CB  
2808 O OG  . SER B 160 ? 0.1552 0.1006 0.1393 -0.0113 0.0085  -0.0214 158  SER B OG  
2809 N N   . ASN B 161 ? 0.1332 0.1306 0.1518 0.0003  0.0141  -0.0031 159  ASN B N   
2810 C CA  . ASN B 161 ? 0.1296 0.1401 0.1430 -0.0345 0.0277  0.0130  159  ASN B CA  
2811 C C   . ASN B 161 ? 0.1068 0.1514 0.1358 -0.0197 0.0215  -0.0021 159  ASN B C   
2812 O O   . ASN B 161 ? 0.1338 0.1688 0.1203 -0.0260 0.0205  -0.0021 159  ASN B O   
2813 C CB  . ASN B 161 ? 0.1242 0.1641 0.1956 -0.0711 -0.0122 0.0088  159  ASN B CB  
2814 C CG  . ASN B 161 ? 0.1732 0.1947 0.1717 -0.0156 -0.0002 -0.0111 159  ASN B CG  
2815 O OD1 . ASN B 161 ? 0.2669 0.2044 0.2455 -0.0149 -0.0119 -0.0447 159  ASN B OD1 
2816 N ND2 . ASN B 161 ? 0.1461 0.2369 0.1695 -0.0235 0.0100  0.0223  159  ASN B ND2 
2817 N N   . LEU B 162 ? 0.1144 0.1350 0.1384 -0.0085 0.0170  0.0216  160  LEU B N   
2818 C CA  . LEU B 162 ? 0.1069 0.0957 0.1116 -0.0193 0.0262  -0.0100 160  LEU B CA  
2819 C C   . LEU B 162 ? 0.0939 0.1327 0.1417 -0.0066 0.0018  -0.0389 160  LEU B C   
2820 O O   . LEU B 162 ? 0.1104 0.1461 0.1221 0.0176  0.0235  -0.0179 160  LEU B O   
2821 C CB  . LEU B 162 ? 0.1040 0.0882 0.1257 -0.0046 0.0048  0.0044  160  LEU B CB  
2822 C CG  . LEU B 162 ? 0.0912 0.0923 0.1052 0.0299  0.0087  0.0123  160  LEU B CG  
2823 C CD1 . LEU B 162 ? 0.1242 0.1240 0.1358 -0.0205 0.0060  -0.0052 160  LEU B CD1 
2824 C CD2 . LEU B 162 ? 0.1085 0.1205 0.1266 -0.0056 0.0257  0.0473  160  LEU B CD2 
2825 N N   . LEU B 163 ? 0.0926 0.1559 0.1003 0.0094  -0.0141 -0.0234 161  LEU B N   
2826 C CA  . LEU B 163 ? 0.1022 0.1701 0.1371 0.0239  0.0058  -0.0333 161  LEU B CA  
2827 C C   . LEU B 163 ? 0.1048 0.1583 0.1056 0.0220  0.0112  -0.0280 161  LEU B C   
2828 O O   . LEU B 163 ? 0.1182 0.1917 0.1290 0.0447  -0.0215 -0.0489 161  LEU B O   
2829 C CB  . LEU B 163 ? 0.1200 0.1606 0.1308 0.0092  0.0298  -0.0322 161  LEU B CB  
2830 C CG  . LEU B 163 ? 0.1510 0.1958 0.1940 0.0256  0.0103  -0.0495 161  LEU B CG  
2831 C CD1 . LEU B 163 ? 0.1788 0.1917 0.1675 0.0530  -0.0663 -0.0315 161  LEU B CD1 
2832 C CD2 . LEU B 163 ? 0.1964 0.2757 0.1885 0.0510  0.0296  -0.0730 161  LEU B CD2 
2833 N N   . GLU B 164 ? 0.0785 0.1872 0.1363 0.0128  0.0102  -0.0061 162  GLU B N   
2834 C CA  . GLU B 164 ? 0.0959 0.1882 0.1398 -0.0025 0.0003  -0.0268 162  GLU B CA  
2835 C C   . GLU B 164 ? 0.0990 0.2095 0.1202 0.0171  0.0104  0.0002  162  GLU B C   
2836 O O   . GLU B 164 ? 0.0930 0.2576 0.1271 0.0052  0.0050  -0.0208 162  GLU B O   
2837 C CB  . GLU B 164 ? 0.1496 0.2484 0.1583 -0.0172 -0.0478 0.0022  162  GLU B CB  
2838 C CG  . GLU B 164 ? 0.1843 0.2851 0.2115 -0.0469 0.0154  0.0092  162  GLU B CG  
2839 C CD  . GLU B 164 ? 0.2198 0.2499 0.2023 -0.0862 0.0025  -0.0137 162  GLU B CD  
2840 O OE1 . GLU B 164 ? 0.2759 0.3010 0.1898 -0.0141 -0.0192 -0.0048 162  GLU B OE1 
2841 O OE2 . GLU B 164 ? 0.2706 0.2438 0.1487 -0.0549 0.0260  0.0023  162  GLU B OE2 
2842 N N   . ARG B 165 ? 0.0978 0.1713 0.0983 0.0011  0.0092  -0.0146 163  ARG B N   
2843 C CA  . ARG B 165 ? 0.1013 0.1314 0.1058 -0.0139 0.0046  -0.0070 163  ARG B CA  
2844 C C   . ARG B 165 ? 0.1029 0.1128 0.1115 -0.0113 0.0108  -0.0198 163  ARG B C   
2845 O O   . ARG B 165 ? 0.1320 0.1523 0.1187 0.0100  0.0005  -0.0245 163  ARG B O   
2846 C CB  . ARG B 165 ? 0.1337 0.1281 0.0978 -0.0097 0.0526  0.0109  163  ARG B CB  
2847 C CG  . ARG B 165 ? 0.1346 0.1022 0.1184 -0.0291 0.0128  -0.0119 163  ARG B CG  
2848 C CD  . ARG B 165 ? 0.1684 0.1089 0.1647 -0.0035 0.0410  0.0177  163  ARG B CD  
2849 N NE  . ARG B 165 ? 0.1944 0.1013 0.2006 -0.0155 0.0324  -0.0133 163  ARG B NE  
2850 C CZ  . ARG B 165 ? 0.1933 0.1308 0.1908 -0.0320 -0.0006 -0.0004 163  ARG B CZ  
2851 N NH1 . ARG B 165 ? 0.1907 0.1816 0.2082 -0.0604 0.0053  0.0155  163  ARG B NH1 
2852 N NH2 . ARG B 165 ? 0.1735 0.1701 0.2406 -0.0498 -0.0268 0.0526  163  ARG B NH2 
2853 N N   A MET B 166 ? 0.0898 0.1296 0.1108 -0.0091 0.0114  -0.0291 164  MET B N   
2854 N N   B MET B 166 ? 0.1014 0.1399 0.1241 -0.0160 0.0059  -0.0372 164  MET B N   
2855 C CA  A MET B 166 ? 0.0989 0.1256 0.1234 0.0027  0.0187  -0.0273 164  MET B CA  
2856 C CA  B MET B 166 ? 0.1252 0.1407 0.1466 0.0058  0.0137  -0.0328 164  MET B CA  
2857 C C   A MET B 166 ? 0.1139 0.1486 0.1372 0.0223  -0.0017 -0.0498 164  MET B C   
2858 C C   B MET B 166 ? 0.1317 0.1623 0.1396 0.0161  0.0022  -0.0533 164  MET B C   
2859 O O   A MET B 166 ? 0.1279 0.1342 0.1995 -0.0090 -0.0455 -0.0359 164  MET B O   
2860 O O   B MET B 166 ? 0.1553 0.1332 0.2144 0.0054  -0.0346 -0.0370 164  MET B O   
2861 C CB  A MET B 166 ? 0.0977 0.1364 0.1309 0.0041  0.0135  -0.0180 164  MET B CB  
2862 C CB  B MET B 166 ? 0.1547 0.1788 0.1948 -0.0112 -0.0139 -0.0313 164  MET B CB  
2863 C CG  A MET B 166 ? 0.1070 0.0678 0.0808 -0.0053 0.0392  0.0057  164  MET B CG  
2864 C CG  B MET B 166 ? 0.2109 0.1780 0.2435 0.0257  0.0029  -0.1339 164  MET B CG  
2865 S SD  A MET B 166 ? 0.1172 0.1380 0.1578 -0.0200 0.0186  -0.0123 164  MET B SD  
2866 S SD  B MET B 166 ? 0.4429 0.1502 0.4000 -0.1198 0.0429  -0.0583 164  MET B SD  
2867 C CE  A MET B 166 ? 0.0795 0.2202 0.1112 -0.0507 0.0556  0.0132  164  MET B CE  
2868 C CE  B MET B 166 ? 0.0380 0.1211 0.0299 -0.0344 0.0031  -0.0052 164  MET B CE  
2869 N N   . GLN B 167 ? 0.1204 0.1790 0.1387 0.0282  0.0044  -0.0301 165  GLN B N   
2870 C CA  . GLN B 167 ? 0.1094 0.1851 0.1946 0.0190  -0.0209 -0.0375 165  GLN B CA  
2871 C C   . GLN B 167 ? 0.1314 0.1529 0.1395 0.0131  -0.0262 -0.0237 165  GLN B C   
2872 O O   . GLN B 167 ? 0.1490 0.2411 0.2193 0.0639  -0.0745 -0.0716 165  GLN B O   
2873 C CB  . GLN B 167 ? 0.1520 0.1929 0.1776 0.0304  -0.0142 -0.0324 165  GLN B CB  
2874 C CG  . GLN B 167 ? 0.1553 0.1763 0.1939 0.0251  -0.0075 -0.0227 165  GLN B CG  
2875 C CD  . GLN B 167 ? 0.2220 0.1721 0.2208 0.0148  0.0163  0.0041  165  GLN B CD  
2876 O OE1 . GLN B 167 ? 0.2997 0.1879 0.2597 -0.0167 0.0210  -0.0008 165  GLN B OE1 
2877 N NE2 . GLN B 167 ? 0.2388 0.1685 0.3150 -0.0422 0.0479  -0.0228 165  GLN B NE2 
2878 N N   . GLU B 168 ? 0.1026 0.1891 0.1939 0.0487  -0.0237 -0.0752 166  GLU B N   
2879 C CA  . GLU B 168 ? 0.0945 0.1599 0.2035 -0.0052 -0.0169 -0.0295 166  GLU B CA  
2880 C C   . GLU B 168 ? 0.1409 0.1685 0.1891 -0.0073 -0.0107 -0.0536 166  GLU B C   
2881 O O   . GLU B 168 ? 0.1381 0.2234 0.2035 -0.0158 -0.0475 -0.0104 166  GLU B O   
2882 C CB  . GLU B 168 ? 0.1474 0.1879 0.2138 0.0170  0.0087  -0.0626 166  GLU B CB  
2883 C CG  . GLU B 168 ? 0.1523 0.2443 0.1903 0.0150  0.0021  -0.0602 166  GLU B CG  
2884 C CD  . GLU B 168 ? 0.0894 0.2315 0.2178 -0.0333 0.0035  -0.0078 166  GLU B CD  
2885 O OE1 . GLU B 168 ? 0.1558 0.2622 0.2173 0.0197  0.0201  0.0320  166  GLU B OE1 
2886 O OE2 . GLU B 168 ? 0.1250 0.3101 0.1910 0.0142  0.0083  0.0163  166  GLU B OE2 
2887 N N   . LEU B 169 ? 0.1373 0.1880 0.2187 -0.0118 0.0020  -0.0527 167  LEU B N   
2888 C CA  . LEU B 169 ? 0.1321 0.2943 0.1871 -0.0660 -0.0006 -0.0423 167  LEU B CA  
2889 C C   . LEU B 169 ? 0.2330 0.2803 0.2034 -0.0183 0.0408  0.0076  167  LEU B C   
2890 O O   . LEU B 169 ? 0.2497 0.3756 0.2863 -0.0671 -0.0507 -0.0670 167  LEU B O   
2891 C CB  . LEU B 169 ? 0.1763 0.2198 0.1888 -0.0411 0.0427  -0.0080 167  LEU B CB  
2892 C CG  . LEU B 169 ? 0.1879 0.2186 0.1792 -0.0226 0.0298  -0.0292 167  LEU B CG  
2893 C CD1 . LEU B 169 ? 0.1283 0.1750 0.2061 0.0126  0.0145  -0.0267 167  LEU B CD1 
2894 C CD2 . LEU B 169 ? 0.1832 0.2101 0.1981 0.0127  0.0275  -0.0547 167  LEU B CD2 
2895 N N   . TYR B 170 ? 0.3223 0.2123 0.2476 -0.0804 0.0405  -0.0024 168  TYR B N   
2896 C CA  . TYR B 170 ? 0.4133 0.2579 0.3606 -0.0878 0.0064  -0.0594 168  TYR B CA  
2897 C C   . TYR B 170 ? 0.4583 0.3207 0.2889 -0.1251 0.0449  0.0144  168  TYR B C   
2898 O O   . TYR B 170 ? 0.2477 0.3255 0.3240 -0.0983 -0.0129 0.0789  168  TYR B O   
2899 C CB  . TYR B 170 ? 0.3495 0.1917 0.3149 -0.0391 0.0408  -0.0534 168  TYR B CB  
2900 C CG  . TYR B 170 ? 0.3378 0.2904 0.2881 0.0047  0.0858  -0.0232 168  TYR B CG  
2901 C CD1 . TYR B 170 ? 0.3230 0.2192 0.3415 -0.0291 0.0452  -0.0530 168  TYR B CD1 
2902 C CD2 . TYR B 170 ? 0.3071 0.1260 0.2080 -0.0348 0.0347  -0.0591 168  TYR B CD2 
2903 C CE1 . TYR B 170 ? 0.3018 0.2098 0.4111 0.0277  0.0458  -0.0225 168  TYR B CE1 
2904 C CE2 . TYR B 170 ? 0.3357 0.2316 0.2699 0.0273  0.1015  -0.0204 168  TYR B CE2 
2905 C CZ  . TYR B 170 ? 0.2701 0.2469 0.2675 -0.0645 -0.0014 -0.0119 168  TYR B CZ  
2906 O OH  . TYR B 170 ? 0.3063 0.2448 0.3902 0.0009  0.1061  0.0151  168  TYR B OH  
2907 C C1  . GOL C .   ? 0.1552 0.1679 0.1843 -0.0300 -0.0382 -0.0338 1168 GOL A C1  
2908 O O1  . GOL C .   ? 0.0551 0.1499 0.1074 0.0032  -0.0033 0.0214  1168 GOL A O1  
2909 C C2  . GOL C .   ? 0.1709 0.2763 0.2254 -0.0849 -0.0429 0.0266  1168 GOL A C2  
2910 O O2  . GOL C .   ? 0.2787 0.3853 0.2814 -0.0402 -0.0125 0.0230  1168 GOL A O2  
2911 C C3  . GOL C .   ? 0.1637 0.1574 0.2077 -0.0233 -0.0657 0.0086  1168 GOL A C3  
2912 O O3  . GOL C .   ? 0.1474 0.3050 0.3333 -0.0036 -0.0042 -0.0386 1168 GOL A O3  
2913 C C1  . GOL D .   ? 0.3263 0.2244 0.3428 0.0060  -0.0374 0.0713  1169 GOL B C1  
2914 O O1  . GOL D .   ? 0.2964 0.2285 0.4074 0.0539  -0.0906 0.0805  1169 GOL B O1  
2915 C C2  . GOL D .   ? 0.2475 0.2369 0.2587 -0.0706 -0.0674 0.0757  1169 GOL B C2  
2916 O O2  . GOL D .   ? 0.2988 0.3432 0.3486 -0.0185 -0.0489 -0.0242 1169 GOL B O2  
2917 C C3  . GOL D .   ? 0.3331 0.3201 0.2178 0.0036  -0.0265 -0.0560 1169 GOL B C3  
2918 O O3  . GOL D .   ? 0.2935 0.2116 0.2259 -0.0175 -0.0548 -0.0334 1169 GOL B O3  
2919 O O   . HOH E .   ? 0.6554 0.2792 0.4877 -0.0310 0.0455  0.0963  2001 HOH A O   
2920 O O   . HOH E .   ? 0.4350 0.4664 0.4442 0.1746  -0.1126 -0.1605 2002 HOH A O   
2921 O O   . HOH E .   ? 0.3422 0.3567 0.3277 0.0392  -0.0124 -0.0835 2003 HOH A O   
2922 O O   . HOH E .   ? 0.4148 0.4033 0.2805 -0.1210 0.0389  -0.0223 2004 HOH A O   
2923 O O   . HOH E .   ? 0.2728 0.2898 0.2672 -0.0574 0.0030  -0.0247 2005 HOH A O   
2924 O O   . HOH E .   ? 0.1847 0.3246 0.3745 -0.0084 0.1071  0.0138  2006 HOH A O   
2925 O O   . HOH E .   ? 0.2870 0.2695 0.3065 -0.0259 0.0262  0.0125  2007 HOH A O   
2926 O O   . HOH E .   ? 0.4723 0.3370 0.3922 -0.0367 -0.0989 0.1692  2008 HOH A O   
2927 O O   . HOH E .   ? 0.6157 0.3229 0.4938 -0.2134 -0.0559 0.1159  2009 HOH A O   
2928 O O   . HOH E .   ? 0.7679 0.5814 0.5838 -0.2684 -0.1813 -0.0233 2010 HOH A O   
2929 O O   . HOH E .   ? 0.3994 0.3826 0.1984 0.1290  0.0287  -0.0685 2011 HOH A O   
2930 O O   . HOH E .   ? 0.1922 0.2186 0.3324 0.0161  -0.0695 -0.0646 2012 HOH A O   
2931 O O   . HOH E .   ? 0.2069 0.3697 0.4212 -0.0782 -0.0558 0.1395  2013 HOH A O   
2932 O O   . HOH E .   ? 0.2153 0.4685 0.2636 -0.0066 -0.0100 -0.0037 2014 HOH A O   
2933 O O   . HOH E .   ? 0.1784 0.1682 0.2073 0.0316  -0.0159 -0.0425 2015 HOH A O   
2934 O O   . HOH E .   ? 0.3667 0.3437 0.3634 0.1391  0.0778  0.0087  2016 HOH A O   
2935 O O   . HOH E .   ? 0.2102 0.2014 0.4328 0.0095  0.0132  -0.0374 2017 HOH A O   
2936 O O   . HOH E .   ? 0.3644 0.2673 0.5405 0.0491  0.0914  0.0323  2018 HOH A O   
2937 O O   . HOH E .   ? 0.2036 0.2000 0.2769 -0.0262 0.0023  0.0148  2019 HOH A O   
2938 O O   . HOH E .   ? 0.2383 0.5638 0.5273 -0.0177 0.2286  0.0021  2020 HOH A O   
2939 O O   . HOH E .   ? 0.1540 0.2203 0.1716 -0.0442 0.0218  0.0202  2021 HOH A O   
2940 O O   . HOH E .   ? 0.2592 0.3399 0.4702 -0.0905 0.0158  -0.1050 2022 HOH A O   
2941 O O   . HOH E .   ? 0.1856 0.1787 0.1855 -0.0133 0.0748  -0.0286 2023 HOH A O   
2942 O O   . HOH E .   ? 0.3303 0.3090 0.2594 0.0147  -0.0782 0.0885  2024 HOH A O   
2943 O O   . HOH E .   ? 0.3792 0.2808 0.3311 -0.0616 0.1589  -0.0479 2025 HOH A O   
2944 O O   . HOH E .   ? 0.1436 0.0881 0.1378 -0.0228 0.0227  -0.0048 2026 HOH A O   
2945 O O   . HOH E .   ? 0.1056 0.1925 0.2118 0.0027  0.0168  0.0265  2027 HOH A O   
2946 O O   . HOH E .   ? 0.1316 0.1852 0.2613 0.0294  0.0422  0.0575  2028 HOH A O   
2947 O O   . HOH E .   ? 0.1159 0.5654 0.4234 0.0042  -0.0341 0.0326  2029 HOH A O   
2948 O O   . HOH E .   ? 0.3089 0.4662 0.2650 -0.1009 0.0739  -0.0320 2030 HOH A O   
2949 O O   . HOH E .   ? 0.1630 0.2435 0.2617 -0.0433 -0.0805 0.0431  2031 HOH A O   
2950 O O   . HOH E .   ? 0.1848 0.1471 0.1935 0.0088  -0.0526 0.0080  2032 HOH A O   
2951 O O   . HOH E .   ? 0.2800 0.3427 0.2639 -0.1263 -0.0322 0.0461  2033 HOH A O   
2952 O O   . HOH E .   ? 0.1408 0.2413 0.1521 -0.0736 -0.0351 0.0190  2034 HOH A O   
2953 O O   . HOH E .   ? 0.2932 0.3772 0.3311 -0.0256 0.0135  0.0892  2035 HOH A O   
2954 O O   . HOH E .   ? 0.1787 0.1674 0.1759 0.0578  -0.0163 0.0061  2036 HOH A O   
2955 O O   . HOH E .   ? 0.3283 0.4427 0.1890 0.1279  -0.0085 -0.0947 2037 HOH A O   
2956 O O   . HOH E .   ? 0.2400 0.1986 0.1772 0.0140  -0.0041 -0.0097 2038 HOH A O   
2957 O O   . HOH E .   ? 0.1839 0.1756 0.2095 -0.0461 -0.0124 -0.0605 2039 HOH A O   
2958 O O   . HOH E .   ? 0.1710 0.1830 0.1562 0.0038  -0.0074 0.0364  2040 HOH A O   
2959 O O   . HOH E .   ? 0.3070 0.5851 0.4035 -0.0498 -0.1542 -0.0491 2041 HOH A O   
2960 O O   . HOH E .   ? 0.4858 0.2458 0.5921 0.0462  -0.0653 0.0132  2042 HOH A O   
2961 O O   . HOH E .   ? 0.1954 0.5415 0.2046 0.0117  -0.0034 0.0635  2043 HOH A O   
2962 O O   . HOH E .   ? 0.3718 0.1496 0.2837 -0.0560 -0.0327 -0.0289 2044 HOH A O   
2963 O O   . HOH E .   ? 0.3809 0.2345 0.2983 0.0000  0.1593  -0.0249 2045 HOH A O   
2964 O O   . HOH E .   ? 0.4804 0.2732 0.1999 -0.0655 -0.1412 0.0589  2046 HOH A O   
2965 O O   . HOH E .   ? 0.2985 0.3044 0.5382 -0.0650 0.0626  -0.0562 2047 HOH A O   
2966 O O   . HOH E .   ? 0.4018 0.2904 0.1777 0.1062  0.1139  0.1075  2048 HOH A O   
2967 O O   . HOH E .   ? 0.3135 0.4012 0.3282 -0.0560 -0.0717 0.0296  2049 HOH A O   
2968 O O   . HOH E .   ? 0.4483 0.2552 0.3286 0.0044  0.1041  -0.0179 2050 HOH A O   
2969 O O   . HOH E .   ? 0.2082 0.2708 0.3139 -0.0132 -0.1052 0.0139  2051 HOH A O   
2970 O O   . HOH E .   ? 0.4004 0.2792 0.4640 -0.0208 0.0146  -0.1180 2052 HOH A O   
2971 O O   . HOH E .   ? 0.3605 0.6950 0.3124 0.1720  -0.0224 0.1318  2053 HOH A O   
2972 O O   . HOH E .   ? 0.2889 0.3931 0.3204 0.0152  0.0174  0.0202  2054 HOH A O   
2973 O O   . HOH E .   ? 0.1720 0.1720 0.2138 -0.0340 0.0472  -0.0412 2055 HOH A O   
2974 O O   . HOH E .   ? 0.5401 0.2916 0.3236 0.1201  -0.1429 -0.1106 2056 HOH A O   
2975 O O   . HOH E .   ? 0.3479 0.1820 0.2489 -0.0376 -0.0026 -0.0194 2057 HOH A O   
2976 O O   . HOH E .   ? 0.5038 0.2726 0.4654 0.0222  -0.0435 0.0931  2058 HOH A O   
2977 O O   . HOH E .   ? 0.1349 0.2026 0.1444 0.0063  0.0017  0.0041  2059 HOH A O   
2978 O O   . HOH E .   ? 0.3360 0.5256 0.2979 0.1562  -0.0456 -0.0544 2060 HOH A O   
2979 O O   . HOH E .   ? 0.2065 0.4278 0.3190 -0.0160 -0.0045 0.0611  2061 HOH A O   
2980 O O   . HOH E .   ? 0.4231 0.2389 0.3903 -0.0063 -0.0596 0.1198  2062 HOH A O   
2981 O O   . HOH E .   ? 0.2754 0.2436 0.4678 0.0635  -0.0090 -0.0234 2063 HOH A O   
2982 O O   . HOH E .   ? 0.3352 0.3709 0.5808 0.0636  -0.0011 -0.0446 2064 HOH A O   
2983 O O   . HOH E .   ? 0.6115 0.7781 0.5703 0.2012  -0.0321 0.0461  2065 HOH A O   
2984 O O   . HOH E .   ? 0.5553 0.5327 0.3563 -0.1158 -0.0570 -0.2103 2066 HOH A O   
2985 O O   . HOH E .   ? 0.1921 0.3869 0.4194 -0.0935 -0.0265 -0.0421 2067 HOH A O   
2986 O O   . HOH E .   ? 0.3821 0.2901 0.3722 -0.0164 0.0362  0.1059  2068 HOH A O   
2987 O O   . HOH E .   ? 0.4751 0.4870 0.2861 -0.2041 0.1343  -0.1018 2069 HOH A O   
2988 O O   . HOH E .   ? 0.2551 0.2392 0.2741 0.0077  -0.0926 -0.0007 2070 HOH A O   
2989 O O   . HOH E .   ? 0.1803 0.5391 0.3109 -0.0818 -0.0050 0.0413  2071 HOH A O   
2990 O O   . HOH E .   ? 0.2846 0.3538 0.2585 0.0943  0.0635  0.0220  2072 HOH A O   
2991 O O   . HOH E .   ? 0.1464 0.3836 0.6185 -0.0059 0.0150  -0.0324 2073 HOH A O   
2992 O O   . HOH E .   ? 0.1327 0.1674 0.1625 0.0385  0.0050  -0.0303 2074 HOH A O   
2993 O O   . HOH E .   ? 0.2189 0.3511 0.4213 0.0664  -0.0474 -0.0054 2075 HOH A O   
2994 O O   . HOH E .   ? 0.3723 0.3715 0.2962 -0.0188 0.1622  0.0063  2076 HOH A O   
2995 O O   . HOH E .   ? 0.1737 0.1878 0.1626 0.0587  -0.0001 0.0454  2077 HOH A O   
2996 O O   . HOH E .   ? 0.3690 0.3031 0.3080 0.0750  0.0086  -0.0009 2078 HOH A O   
2997 O O   . HOH E .   ? 0.1020 0.1096 0.1527 -0.0031 0.0161  0.0135  2079 HOH A O   
2998 O O   . HOH E .   ? 0.5027 0.4872 0.5115 -0.0261 -0.1768 -0.0910 2080 HOH A O   
2999 O O   . HOH E .   ? 0.4414 0.3510 0.4200 -0.1408 0.0738  -0.1832 2081 HOH A O   
3000 O O   . HOH E .   ? 0.3709 0.5821 0.1825 0.2219  0.0231  -0.1128 2082 HOH A O   
3001 O O   . HOH E .   ? 0.4927 0.4215 0.4136 0.2333  -0.0607 -0.0872 2083 HOH A O   
3002 O O   . HOH E .   ? 0.3397 0.2967 0.4044 -0.0256 0.1940  0.0173  2084 HOH A O   
3003 O O   . HOH E .   ? 0.4205 0.3364 0.2926 -0.0903 -0.0200 -0.1137 2085 HOH A O   
3004 O O   . HOH E .   ? 0.2861 0.4266 0.4769 -0.1813 0.0007  0.0592  2086 HOH A O   
3005 O O   . HOH E .   ? 0.3904 0.6221 0.5164 -0.1522 0.0148  0.0011  2087 HOH A O   
3006 O O   . HOH E .   ? 0.3779 0.3753 0.3430 0.0062  0.0873  0.0744  2088 HOH A O   
3007 O O   . HOH E .   ? 0.2781 0.3702 0.4511 0.0141  0.0743  0.1212  2089 HOH A O   
3008 O O   . HOH E .   ? 0.3270 0.1851 0.3073 -0.0019 0.0289  0.0113  2090 HOH A O   
3009 O O   . HOH E .   ? 0.2205 0.2395 0.4638 0.0827  0.1246  0.1389  2091 HOH A O   
3010 O O   . HOH E .   ? 0.3530 0.3193 0.1960 0.1553  -0.0032 0.0256  2092 HOH A O   
3011 O O   . HOH E .   ? 0.2089 0.3225 0.2002 -0.0478 0.0168  -0.0823 2093 HOH A O   
3012 O O   . HOH E .   ? 0.4167 0.2513 0.4098 -0.1460 -0.0273 -0.0091 2094 HOH A O   
3013 O O   . HOH E .   ? 0.2483 0.2069 0.3044 -0.0134 -0.1067 -0.0014 2095 HOH A O   
3014 O O   . HOH E .   ? 0.2930 0.4746 0.4345 -0.1085 0.0048  -0.0132 2096 HOH A O   
3015 O O   . HOH E .   ? 0.5383 0.2893 0.3964 -0.1151 0.0023  0.1035  2097 HOH A O   
3016 O O   . HOH E .   ? 0.5292 0.4798 0.2329 0.0755  -0.0670 0.0744  2098 HOH A O   
3017 O O   . HOH E .   ? 0.1188 0.1291 0.1092 0.0295  -0.0162 -0.0184 2099 HOH A O   
3018 O O   . HOH E .   ? 0.1691 0.2723 0.2711 0.1343  0.0421  -0.0139 2100 HOH A O   
3019 O O   . HOH E .   ? 0.1554 0.1151 0.2200 -0.0136 0.0515  -0.0019 2101 HOH A O   
3020 O O   . HOH E .   ? 0.1887 0.2785 0.4033 -0.0213 0.0374  -0.0040 2102 HOH A O   
3021 O O   . HOH E .   ? 0.5528 0.4430 0.2922 0.1006  0.0443  -0.0836 2103 HOH A O   
3022 O O   . HOH E .   ? 0.4765 0.3158 0.3248 -0.0487 0.0139  -0.0988 2104 HOH A O   
3023 O O   . HOH E .   ? 0.1062 0.2045 0.1690 0.0095  -0.0080 0.1013  2105 HOH A O   
3024 O O   . HOH E .   ? 0.3326 0.2454 0.3380 -0.0960 -0.1404 -0.0198 2106 HOH A O   
3025 O O   . HOH E .   ? 0.2572 0.2511 0.3387 0.0058  -0.0264 0.0204  2107 HOH A O   
3026 O O   . HOH E .   ? 0.3785 0.3840 0.2776 -0.0899 0.0936  -0.0087 2108 HOH A O   
3027 O O   . HOH E .   ? 0.4376 0.4565 0.2754 0.1271  0.0030  -0.0963 2109 HOH A O   
3028 O O   . HOH E .   ? 0.2574 0.3168 0.3159 -0.0519 -0.0202 -0.0830 2110 HOH A O   
3029 O O   . HOH E .   ? 0.2618 0.3872 0.2999 -0.0435 0.0626  -0.0045 2111 HOH A O   
3030 O O   . HOH E .   ? 0.0931 0.1286 0.1322 0.0139  -0.0203 0.0357  2112 HOH A O   
3031 O O   . HOH E .   ? 0.3549 0.2727 0.4475 -0.0158 0.0485  -0.1287 2113 HOH A O   
3032 O O   . HOH E .   ? 0.3774 0.2148 0.2493 0.0965  0.0661  0.0116  2114 HOH A O   
3033 O O   . HOH E .   ? 0.2425 0.4439 0.4025 0.0492  -0.0292 -0.2508 2115 HOH A O   
3034 O O   . HOH E .   ? 0.1523 0.1272 0.2012 0.0441  -0.0045 -0.0520 2116 HOH A O   
3035 O O   . HOH E .   ? 0.2975 0.1883 0.2687 0.0784  0.0506  0.0444  2117 HOH A O   
3036 O O   . HOH E .   ? 0.2670 0.2282 0.4382 0.0276  0.0475  0.0947  2118 HOH A O   
3037 O O   . HOH E .   ? 0.2074 0.2553 0.1348 0.0182  -0.0312 -0.0353 2119 HOH A O   
3038 O O   . HOH E .   ? 0.1452 0.1727 0.1869 -0.0447 -0.0496 0.0415  2120 HOH A O   
3039 O O   . HOH E .   ? 0.3842 0.3311 0.2386 0.0235  0.0118  0.0108  2121 HOH A O   
3040 O O   . HOH E .   ? 0.2175 0.2007 0.2561 0.0015  0.0046  -0.0476 2122 HOH A O   
3041 O O   . HOH E .   ? 0.0803 0.2283 0.3327 0.0156  0.0194  0.0542  2123 HOH A O   
3042 O O   . HOH E .   ? 0.1662 0.3055 0.3495 0.0649  -0.0637 -0.0024 2124 HOH A O   
3043 O O   . HOH E .   ? 0.2110 0.2648 0.2323 -0.0753 0.0556  -0.0192 2125 HOH A O   
3044 O O   . HOH E .   ? 0.2766 0.3302 0.2548 -0.0022 -0.0024 0.0116  2126 HOH A O   
3045 O O   . HOH E .   ? 0.2805 0.2069 0.3251 -0.0806 -0.0360 0.0182  2127 HOH A O   
3046 O O   . HOH E .   ? 0.1402 0.1995 0.1223 -0.0152 -0.0337 0.0152  2128 HOH A O   
3047 O O   . HOH E .   ? 0.1024 0.2498 0.2977 0.0111  0.0612  -0.0682 2129 HOH A O   
3048 O O   . HOH E .   ? 0.2840 0.2662 0.2664 -0.0500 0.0374  -0.0612 2130 HOH A O   
3049 O O   . HOH E .   ? 0.5767 0.0923 0.4522 -0.0492 -0.1005 -0.0455 2131 HOH A O   
3050 O O   . HOH E .   ? 0.2592 0.2462 0.3401 0.0184  -0.0191 0.0462  2132 HOH A O   
3051 O O   . HOH E .   ? 0.2469 0.2664 0.1711 -0.0411 0.0163  0.0523  2133 HOH A O   
3052 O O   . HOH E .   ? 0.2789 0.2375 0.2075 -0.0788 0.0267  -0.0721 2134 HOH A O   
3053 O O   . HOH E .   ? 0.2157 0.2279 0.2221 -0.0056 -0.0529 -0.0037 2135 HOH A O   
3054 O O   . HOH E .   ? 0.4627 0.5045 0.2478 -0.0243 0.0623  -0.0330 2136 HOH A O   
3055 O O   . HOH E .   ? 0.3033 0.3307 0.2335 -0.0111 -0.0264 -0.0583 2137 HOH A O   
3056 O O   . HOH E .   ? 0.1386 0.1941 0.2064 0.0168  -0.0016 0.0024  2138 HOH A O   
3057 O O   . HOH E .   ? 0.1552 0.3212 0.2398 -0.0130 -0.0288 -0.0140 2139 HOH A O   
3058 O O   . HOH E .   ? 0.1101 0.1529 0.1448 -0.0052 0.0198  0.0138  2140 HOH A O   
3059 O O   . HOH E .   ? 0.3736 0.2908 0.4046 0.0537  0.1731  0.0747  2141 HOH A O   
3060 O O   . HOH E .   ? 0.2601 0.2544 0.4631 0.0047  0.0543  0.1037  2142 HOH A O   
3061 O O   . HOH E .   ? 0.5481 0.3939 0.3630 0.0690  0.0058  0.0233  2143 HOH A O   
3062 O O   . HOH E .   ? 0.3289 0.5312 0.3650 0.1193  0.0570  0.0440  2144 HOH A O   
3063 O O   . HOH E .   ? 0.3880 0.3645 0.3190 0.0087  -0.0491 -0.0185 2145 HOH A O   
3064 O O   . HOH E .   ? 0.3894 0.3131 0.5315 -0.0373 -0.0592 -0.0052 2146 HOH A O   
3065 O O   . HOH E .   ? 0.1682 0.1999 0.1879 0.0214  -0.0358 0.0108  2147 HOH A O   
3066 O O   . HOH E .   ? 0.1647 0.1752 0.2129 -0.0346 0.0358  0.0376  2148 HOH A O   
3067 O O   . HOH E .   ? 0.3119 0.4030 0.5353 -0.0304 0.1339  0.0533  2149 HOH A O   
3068 O O   . HOH E .   ? 0.1042 0.2119 0.1586 0.0076  0.0304  0.0481  2150 HOH A O   
3069 O O   . HOH E .   ? 0.0622 0.1113 0.1123 -0.0344 0.0167  -0.0201 2151 HOH A O   
3070 O O   . HOH E .   ? 0.2001 0.1818 0.3251 0.0037  0.0627  -0.0453 2152 HOH A O   
3071 O O   . HOH E .   ? 0.1262 0.1894 0.1105 -0.0066 0.0283  -0.0181 2153 HOH A O   
3072 O O   . HOH E .   ? 0.2063 0.1225 0.2442 -0.0077 -0.0366 0.0303  2154 HOH A O   
3073 O O   . HOH E .   ? 0.1794 0.3103 0.3749 0.0578  0.0147  -0.0354 2155 HOH A O   
3074 O O   . HOH E .   ? 0.3736 0.2698 0.2572 0.1494  -0.0684 0.0073  2156 HOH A O   
3075 O O   . HOH E .   ? 0.3348 0.2733 0.3585 0.0378  -0.0573 0.0865  2157 HOH A O   
3076 O O   . HOH E .   ? 0.3985 0.4943 0.2438 -0.0079 -0.0211 -0.0122 2158 HOH A O   
3077 O O   . HOH E .   ? 0.1742 0.3561 0.2420 -0.0124 0.0600  0.0804  2159 HOH A O   
3078 O O   . HOH E .   ? 0.2134 0.2527 0.1578 0.0764  0.0308  0.0397  2160 HOH A O   
3079 O O   . HOH E .   ? 0.2200 0.3412 0.3289 -0.0679 0.0500  -0.1547 2161 HOH A O   
3080 O O   . HOH E .   ? 0.2088 0.2166 0.4616 -0.0996 0.0976  -0.1140 2162 HOH A O   
3081 O O   . HOH E .   ? 0.2967 0.1803 0.1481 -0.0002 -0.0012 -0.0125 2163 HOH A O   
3082 O O   . HOH E .   ? 0.2096 0.2350 0.2155 0.0002  -0.0113 0.0600  2164 HOH A O   
3083 O O   . HOH E .   ? 0.1943 0.1908 0.3458 -0.0089 0.0215  0.0849  2165 HOH A O   
3084 O O   . HOH E .   ? 0.3645 0.3955 0.3441 0.0078  0.0090  -0.0624 2166 HOH A O   
3085 O O   . HOH E .   ? 0.4105 0.5380 0.6042 0.0028  -0.0037 0.1886  2167 HOH A O   
3086 O O   . HOH E .   ? 0.3472 0.2849 0.2366 0.0649  -0.0233 0.0015  2168 HOH A O   
3087 O O   . HOH E .   ? 0.4041 0.3545 0.2521 -0.0089 -0.0611 0.0361  2169 HOH A O   
3088 O O   . HOH E .   ? 0.3532 0.3353 0.5462 0.0204  -0.0484 -0.1753 2170 HOH A O   
3089 O O   . HOH E .   ? 0.3186 0.2453 0.3562 0.0261  -0.0777 0.0188  2171 HOH A O   
3090 O O   . HOH E .   ? 0.2307 0.3473 0.1163 0.1298  -0.0267 -0.0412 2172 HOH A O   
3091 O O   . HOH E .   ? 0.5590 0.3738 0.2355 0.0326  -0.1299 0.0262  2173 HOH A O   
3092 O O   . HOH E .   ? 0.1139 0.2844 0.2515 -0.0262 -0.0148 -0.0409 2174 HOH A O   
3093 O O   . HOH E .   ? 0.2708 0.4065 0.3412 -0.0463 0.0275  -0.0744 2175 HOH A O   
3094 O O   . HOH E .   ? 0.4115 0.4268 0.7175 0.1844  -0.1175 -0.0056 2176 HOH A O   
3095 O O   . HOH E .   ? 0.4577 0.4333 0.4972 0.1265  0.1867  0.1438  2177 HOH A O   
3096 O O   . HOH E .   ? 0.6997 0.4868 0.4532 -0.0248 0.0586  -0.1833 2178 HOH A O   
3097 O O   . HOH E .   ? 0.3814 0.3752 0.2379 0.1107  -0.1545 -0.0900 2179 HOH A O   
3098 O O   . HOH E .   ? 0.2609 0.2908 0.1395 -0.0942 0.0415  -0.0119 2180 HOH A O   
3099 O O   . HOH E .   ? 0.1653 0.5903 0.2830 0.0654  -0.0099 -0.0427 2181 HOH A O   
3100 O O   . HOH E .   ? 0.1858 0.3400 0.2965 -0.0150 -0.0293 -0.0842 2182 HOH A O   
3101 O O   . HOH E .   ? 0.2716 0.2821 0.1932 0.0471  -0.0325 -0.0495 2183 HOH A O   
3102 O O   . HOH E .   ? 0.3318 0.4111 0.3192 0.1396  0.0717  0.0256  2184 HOH A O   
3103 O O   . HOH E .   ? 0.2130 0.2553 0.1816 0.0344  -0.0335 -0.0952 2185 HOH A O   
3104 O O   . HOH E .   ? 0.2528 0.3768 0.5411 -0.1152 -0.0392 -0.0335 2186 HOH A O   
3105 O O   . HOH E .   ? 0.1899 0.3382 0.1315 -0.1145 -0.0076 -0.0105 2187 HOH A O   
3106 O O   . HOH E .   ? 0.1557 0.2843 0.2034 -0.0920 0.0165  -0.1103 2188 HOH A O   
3107 O O   . HOH E .   ? 0.2156 0.3818 0.2766 -0.0332 -0.0880 0.0364  2189 HOH A O   
3108 O O   . HOH E .   ? 0.1441 0.3820 0.3063 0.0646  0.0442  0.1219  2190 HOH A O   
3109 O O   . HOH E .   ? 0.1860 0.3756 0.3501 0.0374  0.0660  0.0867  2191 HOH A O   
3110 O O   . HOH E .   ? 0.4574 0.3940 0.3911 -0.0096 -0.0093 -0.1376 2192 HOH A O   
3111 O O   . HOH E .   ? 0.2897 0.4547 0.2769 -0.0997 0.0565  0.0217  2193 HOH A O   
3112 O O   . HOH E .   ? 0.2540 0.3705 0.2866 0.0849  0.0537  -0.1088 2194 HOH A O   
3113 O O   . HOH E .   ? 0.2423 0.3288 0.3346 0.0310  0.0282  -0.0500 2195 HOH A O   
3114 O O   . HOH E .   ? 0.1414 0.2403 0.3334 -0.0387 -0.0146 -0.1113 2196 HOH A O   
3115 O O   . HOH E .   ? 0.2312 0.2112 0.2536 -0.0136 0.0025  0.0602  2197 HOH A O   
3116 O O   . HOH E .   ? 0.0922 0.1975 0.1346 -0.0389 0.0138  -0.0110 2198 HOH A O   
3117 O O   . HOH E .   ? 0.3065 0.3990 0.4087 -0.0282 -0.1887 0.1166  2199 HOH A O   
3118 O O   . HOH E .   ? 0.2207 0.2708 0.4610 -0.0189 0.1444  0.0882  2200 HOH A O   
3119 O O   . HOH E .   ? 0.3227 0.2729 0.2143 0.1172  0.0334  -0.0376 2201 HOH A O   
3120 O O   . HOH E .   ? 0.3276 0.3205 0.1850 0.0611  -0.0059 0.0736  2202 HOH A O   
3121 O O   . HOH E .   ? 0.3505 0.2298 0.3250 -0.1314 0.0693  -0.0705 2203 HOH A O   
3122 O O   . HOH E .   ? 0.3378 0.3722 0.3850 -0.1207 -0.0253 -0.0518 2204 HOH A O   
3123 O O   . HOH E .   ? 0.1411 0.1280 0.0928 0.0118  0.0130  0.0019  2205 HOH A O   
3124 O O   . HOH E .   ? 0.1700 0.1078 0.0890 -0.0250 0.0338  -0.0006 2206 HOH A O   
3125 O O   . HOH E .   ? 0.3166 0.2598 0.3069 -0.0303 -0.0412 -0.0098 2207 HOH A O   
3126 O O   . HOH E .   ? 0.4251 0.1904 0.4183 0.0630  0.0249  -0.1169 2208 HOH A O   
3127 O O   . HOH E .   ? 0.2864 0.2226 0.2291 -0.0901 0.0431  0.0096  2209 HOH A O   
3128 O O   . HOH E .   ? 0.2868 0.2673 0.3485 0.0082  0.0799  -0.0600 2210 HOH A O   
3129 O O   . HOH E .   ? 0.3685 0.6565 0.6250 0.0848  -0.0869 0.2209  2211 HOH A O   
3130 O O   . HOH E .   ? 0.1988 0.1490 0.1701 -0.0145 0.0135  0.0263  2212 HOH A O   
3131 O O   . HOH E .   ? 0.2605 0.2273 0.2957 0.0184  0.0431  0.0128  2213 HOH A O   
3132 O O   . HOH E .   ? 0.1918 0.2528 0.4222 0.0075  -0.0099 -0.0638 2214 HOH A O   
3133 O O   . HOH E .   ? 0.2070 0.2860 0.1677 0.0546  -0.0199 0.0202  2215 HOH A O   
3134 O O   . HOH E .   ? 0.5128 0.1097 0.1907 0.0425  -0.0361 0.0308  2216 HOH A O   
3135 O O   . HOH E .   ? 0.4031 0.3132 0.1803 0.1445  0.0372  0.0657  2217 HOH A O   
3136 O O   . HOH E .   ? 0.2316 0.2584 0.1480 0.0827  0.0222  -0.0180 2218 HOH A O   
3137 O O   . HOH E .   ? 0.1668 0.1776 0.0928 -0.0161 0.0129  -0.0156 2219 HOH A O   
3138 O O   . HOH E .   ? 0.3636 0.5537 0.2476 0.0440  0.0958  0.1478  2220 HOH A O   
3139 O O   . HOH E .   ? 0.2301 0.1769 0.1331 -0.0275 0.0534  0.0118  2221 HOH A O   
3140 O O   . HOH E .   ? 0.3581 0.2878 0.3598 0.1036  -0.0665 -0.0716 2222 HOH A O   
3141 O O   . HOH E .   ? 0.1720 0.3868 0.4740 0.0697  0.0113  -0.1058 2223 HOH A O   
3142 O O   . HOH E .   ? 0.3072 0.1398 0.3636 0.0036  0.0152  -0.0186 2224 HOH A O   
3143 O O   . HOH E .   ? 0.1784 0.1563 0.1370 0.0069  0.0474  0.0000  2225 HOH A O   
3144 O O   . HOH E .   ? 0.2901 0.2449 0.4102 0.0404  0.0331  -0.0645 2226 HOH A O   
3145 O O   . HOH E .   ? 0.2101 0.1238 0.2449 -0.0201 -0.0300 -0.0187 2227 HOH A O   
3146 O O   . HOH E .   ? 0.4014 0.2463 0.3051 -0.0338 -0.0118 0.0570  2228 HOH A O   
3147 O O   . HOH E .   ? 0.2467 0.2732 0.2860 0.0670  -0.0644 -0.0451 2229 HOH A O   
3148 O O   . HOH E .   ? 0.4768 0.3194 0.2621 -0.0049 -0.0251 0.0998  2230 HOH A O   
3149 O O   . HOH E .   ? 0.2766 0.2613 0.3419 0.0968  -0.1046 0.0407  2231 HOH A O   
3150 O O   . HOH E .   ? 0.6953 0.3126 0.5900 -0.1674 0.1523  0.0232  2232 HOH A O   
3151 O O   . HOH E .   ? 0.2361 0.3031 0.1977 -0.1211 0.0024  -0.0005 2233 HOH A O   
3152 O O   . HOH E .   ? 0.4174 0.2521 0.5208 0.0390  -0.0070 0.0122  2234 HOH A O   
3153 O O   . HOH E .   ? 0.1894 0.3345 0.3126 0.0258  -0.0251 -0.0561 2235 HOH A O   
3154 O O   . HOH E .   ? 0.3964 0.4452 0.3315 0.1908  -0.0908 -0.0207 2236 HOH A O   
3155 O O   . HOH E .   ? 1.0410 0.7305 0.3592 0.1488  0.0911  0.0626  2237 HOH A O   
3156 O O   . HOH E .   ? 0.6274 0.2748 0.3903 -0.0488 0.0940  -0.1130 2238 HOH A O   
3157 O O   . HOH E .   ? 0.2072 0.5334 0.5774 0.1425  -0.0240 -0.1655 2239 HOH A O   
3158 O O   . HOH E .   ? 0.2693 0.3620 0.3224 -0.0283 -0.0361 0.0447  2240 HOH A O   
3159 O O   . HOH E .   ? 0.1745 0.1998 0.1779 -0.0389 -0.0131 -0.0083 2241 HOH A O   
3160 O O   . HOH E .   ? 0.2436 0.4200 0.3118 0.1261  -0.0698 -0.1876 2242 HOH A O   
3161 O O   . HOH E .   ? 0.3003 0.3790 0.2221 0.0088  -0.1289 -0.0489 2243 HOH A O   
3162 O O   . HOH F .   ? 0.4366 0.2145 0.3028 0.0223  0.0966  -0.0157 2001 HOH B O   
3163 O O   . HOH F .   ? 0.2849 0.2172 0.4771 0.0024  0.1392  -0.1494 2002 HOH B O   
3164 O O   . HOH F .   ? 0.5439 0.2362 0.3996 0.1693  -0.0700 0.0502  2003 HOH B O   
3165 O O   . HOH F .   ? 0.4804 0.9496 0.3995 -0.0557 0.1900  -0.3363 2004 HOH B O   
3166 O O   . HOH F .   ? 0.8454 0.6851 0.5016 -0.1381 0.0010  -0.0349 2005 HOH B O   
3167 O O   . HOH F .   ? 0.5269 0.2682 0.3647 0.0635  -0.1251 0.0740  2006 HOH B O   
3168 O O   . HOH F .   ? 0.4678 0.2001 0.2378 0.0092  0.0054  -0.0446 2007 HOH B O   
3169 O O   . HOH F .   ? 0.3058 0.3930 0.3237 0.0036  0.1336  -0.0166 2008 HOH B O   
3170 O O   . HOH F .   ? 0.2846 0.2365 0.2680 -0.0040 0.0542  -0.0401 2009 HOH B O   
3171 O O   . HOH F .   ? 0.1622 0.3860 0.2434 0.0907  -0.0176 -0.0761 2010 HOH B O   
3172 O O   . HOH F .   ? 0.2423 0.3004 0.2442 -0.0463 -0.0064 0.0560  2011 HOH B O   
3173 O O   . HOH F .   ? 0.3691 0.3699 0.3816 0.0269  -0.0096 0.1192  2012 HOH B O   
3174 O O   . HOH F .   ? 0.5632 0.1873 0.4848 -0.0123 0.0125  0.0726  2013 HOH B O   
3175 O O   . HOH F .   ? 0.4885 0.5745 0.2560 -0.1507 -0.0685 -0.0044 2014 HOH B O   
3176 O O   . HOH F .   ? 0.5083 0.2270 0.4425 -0.0090 -0.0935 -0.0759 2015 HOH B O   
3177 O O   . HOH F .   ? 0.3628 0.6171 0.3556 -0.0257 -0.0367 0.1276  2016 HOH B O   
3178 O O   . HOH F .   ? 0.1491 0.2759 0.3335 0.0465  0.0364  0.0667  2017 HOH B O   
3179 O O   . HOH F .   ? 1.5001 0.6070 0.4352 0.0405  -0.1368 0.2215  2018 HOH B O   
3180 O O   . HOH F .   ? 0.2164 0.2479 0.1694 0.0120  0.0179  0.0229  2019 HOH B O   
3181 O O   . HOH F .   ? 0.2321 0.2099 0.2634 -0.0440 -0.0064 0.0133  2020 HOH B O   
3182 O O   . HOH F .   ? 0.1785 0.3289 0.2527 0.0077  0.0203  0.0061  2021 HOH B O   
3183 O O   . HOH F .   ? 0.3259 0.4986 0.3289 0.2789  0.0669  0.0782  2022 HOH B O   
3184 O O   . HOH F .   ? 0.5401 0.2609 0.3254 -0.0758 -0.0519 -0.0143 2023 HOH B O   
3185 O O   . HOH F .   ? 0.2901 0.4281 0.3471 0.1304  -0.1084 -0.0082 2024 HOH B O   
3186 O O   . HOH F .   ? 0.1587 0.1914 0.1313 0.0175  -0.0248 -0.0134 2025 HOH B O   
3187 O O   . HOH F .   ? 0.3699 0.2105 0.3387 -0.0212 0.0097  -0.0295 2026 HOH B O   
3188 O O   . HOH F .   ? 0.3815 0.2012 0.3905 0.0302  -0.0880 -0.0229 2027 HOH B O   
3189 O O   . HOH F .   ? 0.1315 0.1322 0.0953 0.0449  -0.0025 0.0171  2028 HOH B O   
3190 O O   . HOH F .   ? 0.1329 0.1800 0.2060 0.0015  0.0120  0.0052  2029 HOH B O   
3191 O O   . HOH F .   ? 0.1733 0.1363 0.2435 -0.0011 0.0036  0.0463  2030 HOH B O   
3192 O O   . HOH F .   ? 0.2726 0.3551 0.1889 0.0900  -0.0967 -0.0589 2031 HOH B O   
3193 O O   . HOH F .   ? 0.1719 0.1272 0.2128 -0.0054 0.0063  -0.0223 2032 HOH B O   
3194 O O   . HOH F .   ? 0.2190 0.4796 0.2934 0.0773  0.0178  0.1201  2033 HOH B O   
3195 O O   . HOH F .   ? 0.3100 0.3114 0.2149 0.0850  0.0004  -0.0316 2034 HOH B O   
3196 O O   . HOH F .   ? 0.1548 0.3702 0.2147 0.0798  0.0240  0.0725  2035 HOH B O   
3197 O O   . HOH F .   ? 0.1056 0.1950 0.1495 0.0232  0.0177  0.0008  2036 HOH B O   
3198 O O   . HOH F .   ? 0.2603 0.4465 0.2365 0.0935  -0.0316 0.1254  2037 HOH B O   
3199 O O   . HOH F .   ? 0.1495 0.1407 0.1699 -0.0525 0.0239  0.0031  2038 HOH B O   
3200 O O   . HOH F .   ? 0.2832 0.3739 0.2638 -0.0724 0.0250  -0.0658 2039 HOH B O   
3201 O O   . HOH F .   ? 0.2358 0.3331 0.4359 0.0144  -0.0470 0.0053  2040 HOH B O   
3202 O O   . HOH F .   ? 0.4356 0.2013 0.3858 0.0309  0.1488  -0.0161 2041 HOH B O   
3203 O O   . HOH F .   ? 0.3547 0.2456 0.3392 -0.0084 0.0212  -0.0551 2042 HOH B O   
3204 O O   . HOH F .   ? 0.6216 0.6718 0.6416 0.0361  0.0486  -0.0156 2043 HOH B O   
3205 O O   . HOH F .   ? 0.2968 0.4181 0.2361 0.1115  0.0499  -0.0038 2044 HOH B O   
3206 O O   . HOH F .   ? 0.1845 0.3641 0.3130 0.1269  0.0667  -0.0504 2045 HOH B O   
3207 O O   . HOH F .   ? 0.4741 0.3881 0.3902 -0.0213 -0.1477 -0.0642 2046 HOH B O   
3208 O O   . HOH F .   ? 0.6745 0.3286 0.3807 -0.0423 -0.0183 -0.0766 2047 HOH B O   
3209 O O   . HOH F .   ? 0.3137 0.3026 0.4942 0.0728  0.0073  0.0485  2048 HOH B O   
3210 O O   . HOH F .   ? 0.2648 0.2770 0.2993 -0.0693 -0.0692 -0.0503 2049 HOH B O   
3211 O O   . HOH F .   ? 0.3686 0.2600 0.2877 0.0192  0.0285  -0.0289 2050 HOH B O   
3212 O O   . HOH F .   ? 0.3316 0.3678 0.2545 -0.0503 -0.0063 0.0754  2051 HOH B O   
3213 O O   . HOH F .   ? 0.2810 0.3712 0.4323 0.0982  -0.0770 -0.1375 2052 HOH B O   
3214 O O   . HOH F .   ? 0.3167 0.2914 0.2232 -0.0165 -0.0500 0.1379  2053 HOH B O   
3215 O O   . HOH F .   ? 0.3101 0.2290 0.2669 -0.0579 0.0497  0.0316  2054 HOH B O   
3216 O O   . HOH F .   ? 0.4746 0.4328 0.2803 0.1855  -0.1780 -0.0778 2055 HOH B O   
3217 O O   . HOH F .   ? 0.3177 0.3592 0.4761 0.0805  -0.0180 -0.0314 2056 HOH B O   
3218 O O   . HOH F .   ? 0.1371 0.1672 0.2015 -0.0102 0.0213  0.0052  2057 HOH B O   
3219 O O   . HOH F .   ? 0.5317 0.4499 0.8979 -0.0878 -0.0756 0.0067  2058 HOH B O   
3220 O O   . HOH F .   ? 0.4076 0.2235 0.5088 0.0818  -0.0386 0.0380  2059 HOH B O   
3221 O O   . HOH F .   ? 0.2006 0.3362 0.3230 0.1099  -0.0266 0.0360  2060 HOH B O   
3222 O O   . HOH F .   ? 0.1909 0.2582 0.2200 0.0266  0.0147  -0.0045 2061 HOH B O   
3223 O O   . HOH F .   ? 0.1331 0.2934 0.4574 0.0791  -0.0453 0.0453  2062 HOH B O   
3224 O O   . HOH F .   ? 0.2058 0.2290 0.3315 -0.0102 0.0621  -0.0326 2063 HOH B O   
3225 O O   . HOH F .   ? 0.2553 0.3106 0.3027 -0.0633 0.0179  -0.0093 2064 HOH B O   
3226 O O   . HOH F .   ? 0.3320 0.2641 0.3478 -0.0843 0.1071  -0.0825 2065 HOH B O   
3227 O O   . HOH F .   ? 0.3388 0.5530 0.6163 0.0682  -0.0493 0.2705  2066 HOH B O   
3228 O O   . HOH F .   ? 0.1225 0.1252 0.1504 0.0026  0.0109  0.0120  2067 HOH B O   
3229 O O   . HOH F .   ? 0.2236 0.1866 0.2222 -0.0070 0.0234  -0.0207 2068 HOH B O   
3230 O O   . HOH F .   ? 0.1196 0.1277 0.1517 0.0517  0.0233  0.0018  2069 HOH B O   
3231 O O   . HOH F .   ? 0.2411 0.4353 0.1973 0.0696  0.0136  -0.1132 2070 HOH B O   
3232 O O   . HOH F .   ? 0.3170 0.4005 0.3928 -0.0518 -0.1852 0.0359  2071 HOH B O   
3233 O O   . HOH F .   ? 0.3689 0.3679 0.3311 0.1145  -0.0854 -0.0765 2072 HOH B O   
3234 O O   . HOH F .   ? 0.5198 0.3927 0.4726 0.3339  0.0187  -0.0618 2073 HOH B O   
3235 O O   . HOH F .   ? 0.4504 0.3803 0.2598 -0.0954 -0.0469 0.0301  2074 HOH B O   
3236 O O   . HOH F .   ? 0.3202 0.2496 0.2766 -0.0664 -0.0656 0.0014  2075 HOH B O   
3237 O O   . HOH F .   ? 0.3702 0.3344 0.2525 -0.1582 -0.0096 0.0883  2076 HOH B O   
3238 O O   . HOH F .   ? 0.1559 0.2237 0.2150 0.0318  0.0397  -0.0544 2077 HOH B O   
3239 O O   . HOH F .   ? 0.1531 0.3068 0.3193 -0.0248 -0.0222 0.0043  2078 HOH B O   
3240 O O   . HOH F .   ? 0.2869 0.2304 0.2754 0.0342  0.0779  -0.0031 2079 HOH B O   
3241 O O   . HOH F .   ? 0.0535 0.1216 0.1111 -0.0054 0.0169  0.0086  2080 HOH B O   
3242 O O   . HOH F .   ? 0.1088 0.1456 0.1336 -0.0354 -0.0110 -0.0094 2081 HOH B O   
3243 O O   . HOH F .   ? 0.1838 0.1964 0.2242 -0.0690 -0.0110 -0.0063 2082 HOH B O   
3244 O O   . HOH F .   ? 0.1307 0.1258 0.2341 0.0168  -0.0397 0.0363  2083 HOH B O   
3245 O O   . HOH F .   ? 0.1038 0.1595 0.1906 -0.0070 0.0200  0.0833  2084 HOH B O   
3246 O O   . HOH F .   ? 0.3049 0.3099 0.3728 0.0236  0.0945  -0.1520 2085 HOH B O   
3247 O O   . HOH F .   ? 0.6106 0.3337 0.5066 0.0223  -0.1793 -0.0902 2086 HOH B O   
3248 O O   . HOH F .   ? 0.4093 0.3468 0.3452 0.0449  -0.0354 -0.0377 2087 HOH B O   
3249 O O   . HOH F .   ? 0.3579 0.5270 0.3076 0.0050  0.0100  -0.0575 2088 HOH B O   
3250 O O   . HOH F .   ? 0.5695 0.5436 0.3008 0.0194  0.0192  -0.1522 2089 HOH B O   
3251 O O   . HOH F .   ? 0.3144 0.1950 0.5269 0.0405  0.0248  0.0609  2090 HOH B O   
3252 O O   . HOH F .   ? 0.5759 0.3283 0.4517 0.0035  0.1827  -0.1056 2091 HOH B O   
3253 O O   . HOH F .   ? 0.3819 0.3575 0.8391 0.1353  -0.0899 0.0839  2092 HOH B O   
3254 O O   . HOH F .   ? 0.7300 0.5579 1.2134 0.0962  0.0355  -0.3366 2093 HOH B O   
3255 O O   . HOH F .   ? 0.3654 0.3410 0.3965 -0.0347 -0.1524 -0.0935 2094 HOH B O   
3256 O O   . HOH F .   ? 0.0984 0.1301 0.1254 -0.0202 0.0379  0.0193  2095 HOH B O   
3257 O O   . HOH F .   ? 0.3456 0.2861 0.3637 0.0092  0.1136  -0.0778 2096 HOH B O   
3258 O O   . HOH F .   ? 0.7022 0.5404 0.6168 -0.0513 0.1246  -0.0085 2097 HOH B O   
3259 O O   . HOH F .   ? 0.5207 0.4322 0.4055 -0.0769 0.0867  -0.0396 2098 HOH B O   
3260 O O   . HOH F .   ? 0.1541 0.1650 0.2758 -0.0584 0.1049  -0.0662 2099 HOH B O   
3261 O O   . HOH F .   ? 0.2714 0.2124 0.2798 0.0067  0.0005  0.0596  2100 HOH B O   
3262 O O   . HOH F .   ? 0.8553 0.4443 0.7924 0.0267  0.1712  -0.0736 2101 HOH B O   
3263 O O   . HOH F .   ? 0.5963 0.4280 0.3006 -0.0829 -0.1268 0.0531  2102 HOH B O   
3264 O O   . HOH F .   ? 0.3671 0.3965 0.4335 -0.1103 0.1471  -0.1937 2103 HOH B O   
3265 O O   . HOH F .   ? 0.3166 0.3240 0.2379 -0.0142 0.0059  -0.0610 2104 HOH B O   
3266 O O   . HOH F .   ? 0.3201 0.2007 0.4214 0.0570  -0.0387 -0.0232 2105 HOH B O   
3267 O O   . HOH F .   ? 0.1972 0.2331 0.2007 -0.0016 0.0333  -0.0639 2106 HOH B O   
3268 O O   . HOH F .   ? 0.2102 0.1694 0.1466 0.0506  0.0721  0.0580  2107 HOH B O   
3269 O O   . HOH F .   ? 0.4704 0.4307 0.2084 0.1142  -0.0235 -0.1001 2108 HOH B O   
3270 O O   . HOH F .   ? 0.4395 0.5922 0.3106 0.0310  0.0158  -0.1146 2109 HOH B O   
3271 O O   . HOH F .   ? 0.3819 0.2225 0.1969 -0.0045 0.0369  0.0638  2110 HOH B O   
3272 O O   . HOH F .   ? 0.1737 0.3346 0.2126 -0.0449 0.0168  -0.0358 2111 HOH B O   
3273 O O   . HOH F .   ? 0.1093 0.2055 0.3689 -0.0070 0.0211  0.1003  2112 HOH B O   
3274 O O   . HOH F .   ? 0.1565 0.3819 0.2541 -0.0493 0.0542  0.0317  2113 HOH B O   
3275 O O   . HOH F .   ? 0.1239 0.2076 0.1935 0.0094  0.0161  -0.0082 2114 HOH B O   
3276 O O   . HOH F .   ? 0.2785 0.3463 0.2725 0.0290  -0.0373 -0.0038 2115 HOH B O   
3277 O O   . HOH F .   ? 0.2249 0.2516 0.1562 0.0623  0.0172  0.0064  2116 HOH B O   
3278 O O   . HOH F .   ? 0.1268 0.1810 0.1124 0.0027  0.0569  0.0174  2117 HOH B O   
3279 O O   . HOH F .   ? 0.1882 0.2537 0.2061 0.0402  0.0034  0.0004  2118 HOH B O   
3280 O O   . HOH F .   ? 0.0890 0.1796 0.2309 0.0152  -0.0155 -0.0362 2119 HOH B O   
3281 O O   . HOH F .   ? 0.3293 0.2905 0.3422 0.0234  0.0703  0.0644  2120 HOH B O   
3282 O O   . HOH F .   ? 0.3299 0.3664 0.2467 -0.0502 0.0995  0.0110  2121 HOH B O   
3283 O O   . HOH F .   ? 0.3352 0.3144 0.3184 0.0264  0.0537  -0.0791 2122 HOH B O   
3284 O O   . HOH F .   ? 0.3355 0.3010 0.2202 0.0217  0.0107  0.0553  2123 HOH B O   
3285 O O   . HOH F .   ? 0.3188 0.2144 0.4062 0.0192  -0.0434 -0.0069 2124 HOH B O   
3286 O O   . HOH F .   ? 0.6073 0.3691 0.2892 -0.1037 -0.0151 0.0446  2125 HOH B O   
3287 O O   . HOH F .   ? 0.2410 0.2266 0.2367 -0.0170 -0.0240 -0.0402 2126 HOH B O   
3288 O O   . HOH F .   ? 0.4099 0.6482 0.1879 -0.0908 -0.0180 0.0820  2127 HOH B O   
3289 O O   . HOH F .   ? 0.2103 0.2492 0.2304 0.0105  0.0371  -0.0526 2128 HOH B O   
3290 O O   . HOH F .   ? 0.2382 0.3766 0.3910 0.0410  -0.0917 0.0023  2129 HOH B O   
3291 O O   . HOH F .   ? 0.3846 0.4598 0.2543 0.0507  0.0370  -0.0489 2130 HOH B O   
3292 O O   . HOH F .   ? 0.2174 0.3144 0.4053 0.0162  0.0576  0.0086  2131 HOH B O   
3293 O O   . HOH F .   ? 0.3152 0.6291 0.4950 0.1303  0.1054  -0.0061 2132 HOH B O   
3294 O O   . HOH F .   ? 0.3103 0.4287 0.3229 0.0040  0.1392  0.0631  2133 HOH B O   
3295 O O   . HOH F .   ? 0.2460 0.3211 0.2014 -0.0018 0.0372  -0.0724 2134 HOH B O   
3296 O O   . HOH F .   ? 0.1093 0.1651 0.1430 0.0227  0.0083  0.0199  2135 HOH B O   
3297 O O   . HOH F .   ? 0.3733 0.7029 0.3593 0.0530  -0.0105 -0.0683 2136 HOH B O   
3298 O O   . HOH F .   ? 0.1558 0.2119 0.1573 -0.0097 0.0307  0.0129  2137 HOH B O   
3299 O O   . HOH F .   ? 0.3472 0.8305 0.5418 0.0247  0.0414  -0.0735 2138 HOH B O   
3300 O O   . HOH F .   ? 0.1730 0.1903 0.2146 -0.0014 0.0409  -0.0001 2139 HOH B O   
3301 O O   . HOH F .   ? 0.5392 0.2761 0.5343 -0.1439 -0.1276 0.1161  2140 HOH B O   
3302 O O   . HOH F .   ? 0.0557 0.1515 0.2365 -0.0067 0.0051  0.0382  2141 HOH B O   
3303 O O   . HOH F .   ? 0.0621 0.1049 0.0898 0.0066  -0.0098 0.0014  2142 HOH B O   
3304 O O   . HOH F .   ? 0.1040 0.2076 0.1672 0.0065  0.0045  -0.0113 2143 HOH B O   
3305 O O   . HOH F .   ? 0.1945 0.1714 0.1932 -0.0355 0.0383  0.0084  2144 HOH B O   
3306 O O   . HOH F .   ? 0.2537 0.2426 0.3434 -0.0518 0.0666  -0.0537 2145 HOH B O   
3307 O O   . HOH F .   ? 0.3749 0.3326 0.2793 -0.0828 0.0235  0.0372  2146 HOH B O   
3308 O O   . HOH F .   ? 0.2317 0.5354 0.2245 0.0373  -0.0214 0.0303  2147 HOH B O   
3309 O O   . HOH F .   ? 0.2232 0.2238 0.3171 0.0557  -0.0576 -0.0526 2148 HOH B O   
3310 O O   . HOH F .   ? 0.3504 0.3613 0.4342 -0.0392 0.1795  0.0808  2149 HOH B O   
3311 O O   . HOH F .   ? 0.4678 0.2237 0.4311 0.0278  -0.0495 0.0249  2150 HOH B O   
3312 O O   . HOH F .   ? 0.5658 0.3216 0.3180 -0.1060 -0.2405 -0.1743 2151 HOH B O   
3313 O O   . HOH F .   ? 0.3553 0.1903 0.4554 0.0219  -0.0086 0.0130  2152 HOH B O   
3314 O O   . HOH F .   ? 0.2680 0.2498 0.3314 0.0633  -0.0533 -0.0276 2153 HOH B O   
3315 O O   . HOH F .   ? 0.3289 0.2019 0.1565 0.0080  0.0487  -0.0077 2154 HOH B O   
3316 O O   . HOH F .   ? 0.2686 0.2942 0.2154 -0.0041 0.0285  0.0349  2155 HOH B O   
3317 O O   . HOH F .   ? 0.3029 0.3608 0.3792 -0.1250 0.0204  0.1418  2156 HOH B O   
3318 O O   . HOH F .   ? 0.1839 0.2365 0.1647 0.0063  0.0321  0.0478  2157 HOH B O   
3319 O O   . HOH F .   ? 0.3384 0.3806 0.3216 0.0653  -0.0429 -0.1713 2158 HOH B O   
3320 O O   . HOH F .   ? 0.6350 0.4179 0.4696 0.1039  -0.1577 -0.1450 2159 HOH B O   
3321 O O   . HOH F .   ? 0.2109 0.2264 0.2680 -0.0238 -0.0214 0.0628  2160 HOH B O   
3322 O O   . HOH F .   ? 0.2152 0.4274 0.8276 0.0045  0.3153  0.3254  2161 HOH B O   
3323 O O   . HOH F .   ? 0.3436 0.2550 0.2913 -0.0960 -0.0651 0.0378  2162 HOH B O   
3324 O O   . HOH F .   ? 0.2852 0.2463 0.3064 -0.0387 -0.0146 -0.0200 2163 HOH B O   
3325 O O   . HOH F .   ? 0.2813 0.2754 0.0891 -0.0992 0.0034  0.0011  2164 HOH B O   
3326 O O   . HOH F .   ? 0.2167 0.2193 0.1560 0.0533  0.0151  -0.0127 2165 HOH B O   
3327 O O   . HOH F .   ? 0.4001 0.1739 0.3560 0.0844  -0.0392 -0.0684 2166 HOH B O   
3328 O O   . HOH F .   ? 0.2856 0.3798 0.3497 -0.0725 0.0059  0.0446  2167 HOH B O   
3329 O O   . HOH F .   ? 0.3852 0.3208 0.3574 -0.0423 0.0429  -0.0483 2168 HOH B O   
3330 O O   . HOH F .   ? 0.5400 0.5189 0.4093 0.0946  0.0199  0.0638  2169 HOH B O   
3331 O O   . HOH F .   ? 0.4312 0.3801 0.2215 -0.0195 0.0409  -0.0490 2170 HOH B O   
3332 O O   . HOH F .   ? 0.2414 0.4458 0.5697 -0.1862 -0.0206 -0.1053 2171 HOH B O   
3333 O O   . HOH F .   ? 0.3393 0.3084 0.1757 0.1435  0.0511  0.0364  2172 HOH B O   
3334 O O   . HOH F .   ? 0.1951 0.2292 0.2476 -0.0035 0.0181  -0.0418 2173 HOH B O   
3335 O O   . HOH F .   ? 0.2768 0.2347 0.2409 0.0012  -0.0116 -0.0883 2174 HOH B O   
3336 O O   . HOH F .   ? 0.3428 0.2848 0.3180 -0.0165 -0.0565 0.0093  2175 HOH B O   
3337 O O   . HOH F .   ? 0.2222 0.1672 0.2158 -0.0174 0.0348  -0.0352 2176 HOH B O   
3338 O O   . HOH F .   ? 0.1737 0.2413 0.1834 0.0470  0.0188  -0.0242 2177 HOH B O   
3339 O O   . HOH F .   ? 0.1908 0.3158 0.2455 0.1184  -0.0276 -0.0495 2178 HOH B O   
3340 O O   . HOH F .   ? 0.2402 0.3819 0.2524 0.0773  0.0167  -0.0317 2179 HOH B O   
3341 O O   . HOH F .   ? 0.5231 0.6551 0.7299 0.0606  -0.0148 -0.1333 2180 HOH B O   
3342 O O   . HOH F .   ? 0.2973 0.3105 0.2397 -0.1562 0.0987  -0.0506 2181 HOH B O   
3343 O O   . HOH F .   ? 0.2047 0.3131 0.2643 0.0332  0.0140  0.0494  2182 HOH B O   
3344 O O   . HOH F .   ? 0.4167 0.2912 0.3823 0.0333  -0.0050 0.0149  2183 HOH B O   
3345 O O   . HOH F .   ? 0.3141 0.3244 0.3022 -0.0699 0.0224  -0.1192 2184 HOH B O   
3346 O O   . HOH F .   ? 0.3258 0.2956 0.3120 0.0171  0.0204  -0.0634 2185 HOH B O   
3347 O O   . HOH F .   ? 0.1161 0.1868 0.1821 0.0249  0.0249  -0.0383 2186 HOH B O   
3348 O O   . HOH F .   ? 0.2427 0.2327 0.3335 0.0215  0.0472  0.0571  2187 HOH B O   
3349 O O   . HOH F .   ? 0.1807 0.1918 0.3344 -0.0234 0.0362  -0.0785 2188 HOH B O   
3350 O O   . HOH F .   ? 0.3793 0.2542 0.7010 -0.0004 -0.0226 0.1155  2189 HOH B O   
3351 O O   . HOH F .   ? 0.2544 0.2106 0.1891 -0.0274 0.0548  0.0525  2190 HOH B O   
3352 O O   . HOH F .   ? 0.2970 0.1999 0.3525 -0.0186 0.0050  -0.0471 2191 HOH B O   
3353 O O   . HOH F .   ? 0.1989 0.5591 0.4652 -0.0775 -0.0560 0.0372  2192 HOH B O   
3354 O O   . HOH F .   ? 0.1527 0.1458 0.0960 -0.0026 -0.0156 0.0048  2193 HOH B O   
3355 O O   . HOH F .   ? 0.2336 0.0910 0.0789 0.0297  -0.0322 -0.0104 2194 HOH B O   
3356 O O   . HOH F .   ? 0.3235 0.2658 0.5121 0.0355  0.0869  -0.0884 2195 HOH B O   
3357 O O   . HOH F .   ? 0.2464 0.2203 0.2917 0.0975  0.0111  0.0309  2196 HOH B O   
3358 O O   . HOH F .   ? 0.1792 0.3700 0.3003 0.0491  -0.0300 -0.0391 2197 HOH B O   
3359 O O   . HOH F .   ? 0.3400 0.4142 0.2722 -0.0772 -0.0416 -0.1662 2198 HOH B O   
3360 O O   . HOH F .   ? 0.3177 0.4708 0.5257 -0.0691 0.1092  -0.0378 2199 HOH B O   
3361 O O   . HOH F .   ? 0.2363 0.1374 0.2005 0.0395  0.0103  -0.0378 2200 HOH B O   
3362 O O   . HOH F .   ? 0.3590 0.2937 0.2981 -0.0506 0.0176  0.0017  2201 HOH B O   
3363 O O   . HOH F .   ? 0.2888 0.2794 0.3955 0.0480  -0.0958 0.1097  2202 HOH B O   
3364 O O   . HOH F .   ? 0.5134 0.3344 0.4020 -0.1407 -0.0416 0.1780  2203 HOH B O   
3365 O O   . HOH F .   ? 0.2986 0.3542 0.5625 -0.0671 -0.0912 0.1467  2204 HOH B O   
3366 O O   . HOH F .   ? 0.2538 0.2325 0.2009 -0.0627 0.0150  0.0655  2205 HOH B O   
3367 O O   . HOH F .   ? 0.5003 0.1555 0.1527 -0.0423 -0.0108 0.0203  2206 HOH B O   
3368 O O   . HOH F .   ? 0.3085 0.2329 0.2267 -0.1063 -0.0238 -0.0336 2207 HOH B O   
3369 O O   . HOH F .   ? 0.3597 0.2964 0.2204 -0.1134 0.0586  -0.0270 2208 HOH B O   
3370 O O   . HOH F .   ? 0.1941 0.3285 0.4473 0.0458  -0.0445 0.1018  2209 HOH B O   
3371 O O   . HOH F .   ? 0.1804 0.1715 0.1684 0.0398  -0.0171 0.0173  2210 HOH B O   
3372 O O   . HOH F .   ? 0.2934 0.5538 0.2515 -0.0775 0.0280  0.0695  2211 HOH B O   
3373 O O   . HOH F .   ? 0.1594 0.3980 0.5635 -0.0853 0.1323  -0.1516 2212 HOH B O   
3374 O O   . HOH F .   ? 0.3229 0.1745 0.3949 -0.0241 0.0907  -0.1113 2213 HOH B O   
3375 O O   . HOH F .   ? 0.3956 0.4540 0.7470 -0.1373 -0.1453 -0.0426 2214 HOH B O   
3376 O O   . HOH F .   ? 0.2810 0.3601 0.3344 0.0422  0.0409  -0.0114 2215 HOH B O   
3377 O O   . HOH F .   ? 0.1647 0.1019 0.2031 -0.0116 0.0552  -0.0508 2216 HOH B O   
3378 O O   . HOH F .   ? 0.2900 0.1957 0.3771 0.0568  0.0354  0.0536  2217 HOH B O   
3379 O O   . HOH F .   ? 0.2452 0.2418 0.2283 -0.1053 0.0892  -0.0853 2218 HOH B O   
3380 O O   . HOH F .   ? 0.6656 0.3333 0.4124 -0.1254 0.2077  -0.0778 2219 HOH B O   
3381 O O   . HOH F .   ? 0.2100 0.1891 0.2961 -0.0092 0.0718  0.0187  2220 HOH B O   
3382 O O   . HOH F .   ? 0.1476 0.2142 0.1465 -0.0172 0.0137  -0.0609 2221 HOH B O   
3383 O O   . HOH F .   ? 0.2107 0.2189 0.2699 0.0537  -0.0280 -0.0050 2222 HOH B O   
3384 O O   . HOH F .   ? 0.2103 0.3308 0.2588 -0.0465 0.0687  -0.0164 2223 HOH B O   
3385 O O   . HOH F .   ? 0.1714 0.2450 0.1818 -0.0413 -0.0297 0.0159  2224 HOH B O   
3386 O O   . HOH F .   ? 0.6433 0.5912 0.5522 0.0681  -0.0671 -0.1398 2225 HOH B O   
3387 O O   . HOH F .   ? 0.3495 0.4267 0.3150 0.2153  0.0571  -0.0137 2226 HOH B O   
3388 O O   . HOH F .   ? 0.3359 0.3926 0.5554 -0.0556 -0.1916 -0.0409 2227 HOH B O   
3389 O O   . HOH F .   ? 0.2345 0.3015 0.2499 -0.0314 0.0703  -0.0507 2228 HOH B O   
3390 O O   . HOH F .   ? 0.4048 0.3794 0.4475 -0.0825 0.0229  0.1830  2229 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -1  ?   ?   ?   A . n 
A 1 2   ALA 2   0   0   ALA ALA A . n 
A 1 3   MET 3   1   1   MET MET A . n 
A 1 4   ASP 4   2   2   ASP ASP A . n 
A 1 5   ARG 5   3   3   ARG ARG A . n 
A 1 6   HIS 6   4   4   HIS HIS A . n 
A 1 7   LYS 7   5   5   LYS LYS A . n 
A 1 8   PRO 8   6   6   PRO PRO A . n 
A 1 9   LYS 9   7   7   LYS LYS A . n 
A 1 10  SER 10  8   8   SER SER A . n 
A 1 11  ILE 11  9   9   ILE ILE A . n 
A 1 12  SER 12  10  10  SER SER A . n 
A 1 13  SER 13  11  11  SER SER A . n 
A 1 14  GLU 14  12  12  GLU GLU A . n 
A 1 15  ILE 15  13  13  ILE ILE A . n 
A 1 16  TRP 16  14  14  TRP TRP A . n 
A 1 17  ALA 17  15  15  ALA ALA A . n 
A 1 18  LEU 18  16  16  LEU LEU A . n 
A 1 19  SER 19  17  17  SER SER A . n 
A 1 20  GLU 20  18  18  GLU GLU A . n 
A 1 21  THR 21  19  19  THR THR A . n 
A 1 22  SER 22  20  20  SER SER A . n 
A 1 23  LYS 23  21  21  LYS LYS A . n 
A 1 24  GLU 24  22  22  GLU GLU A . n 
A 1 25  TRP 25  23  23  TRP TRP A . n 
A 1 26  MET 26  24  24  MET MET A . n 
A 1 27  SER 27  25  25  SER SER A . n 
A 1 28  ASN 28  26  26  ASN ASN A . n 
A 1 29  LEU 29  27  27  LEU LEU A . n 
A 1 30  ARG 30  28  28  ARG ARG A . n 
A 1 31  PRO 31  29  29  PRO PRO A . n 
A 1 32  LEU 32  30  30  LEU LEU A . n 
A 1 33  GLU 33  31  31  GLU GLU A . n 
A 1 34  ALA 34  32  32  ALA ALA A . n 
A 1 35  ARG 35  33  33  ARG ARG A . n 
A 1 36  ILE 36  34  34  ILE ILE A . n 
A 1 37  VAL 37  35  35  VAL VAL A . n 
A 1 38  GLU 38  36  36  GLU GLU A . n 
A 1 39  CYS 39  37  37  CYS CYS A . n 
A 1 40  ILE 40  38  38  ILE ILE A . n 
A 1 41  LYS 41  39  39  LYS LYS A . n 
A 1 42  TYR 42  40  40  TYR TYR A . n 
A 1 43  THR 43  41  41  THR THR A . n 
A 1 44  VAL 44  42  42  VAL VAL A . n 
A 1 45  CYS 45  43  43  CYS CYS A . n 
A 1 46  CME 46  44  44  CME CME A . n 
A 1 47  HIS 47  45  45  HIS HIS A . n 
A 1 48  ILE 48  46  46  ILE ILE A . n 
A 1 49  SER 49  47  47  SER SER A . n 
A 1 50  ASP 50  48  48  ASP ASP A . n 
A 1 51  MET 51  49  49  MET MET A . n 
A 1 52  HIS 52  50  50  HIS HIS A . n 
A 1 53  LEU 53  51  51  LEU LEU A . n 
A 1 54  HIS 54  52  52  HIS HIS A . n 
A 1 55  ASN 55  53  53  ASN ASN A . n 
A 1 56  GLY 56  54  54  GLY GLY A . n 
A 1 57  VAL 57  55  55  VAL VAL A . n 
A 1 58  PRO 58  56  56  PRO PRO A . n 
A 1 59  ARG 59  57  57  ARG ARG A . n 
A 1 60  TYR 60  58  58  TYR TYR A . n 
A 1 61  ILE 61  59  59  ILE ILE A . n 
A 1 62  VAL 62  60  60  VAL VAL A . n 
A 1 63  ASN 63  61  61  ASN ASN A . n 
A 1 64  MET 64  62  62  MET MET A . n 
A 1 65  TRP 65  63  63  TRP TRP A . n 
A 1 66  THR 66  64  64  THR THR A . n 
A 1 67  PRO 67  65  65  PRO PRO A . n 
A 1 68  PRO 68  66  66  PRO PRO A . n 
A 1 69  GLU 69  67  67  GLU GLU A . n 
A 1 70  VAL 70  68  68  VAL VAL A . n 
A 1 71  ALA 71  69  69  ALA ALA A . n 
A 1 72  ASP 72  70  70  ASP ASP A . n 
A 1 73  GLN 73  71  71  GLN GLN A . n 
A 1 74  GLU 74  72  72  GLU GLU A . n 
A 1 75  MET 75  73  73  MET MET A . n 
A 1 76  LYS 76  74  74  LYS LYS A . n 
A 1 77  ARG 77  75  75  ARG ARG A . n 
A 1 78  GLN 78  76  76  GLN GLN A . n 
A 1 79  ASN 79  77  77  ASN ASN A . n 
A 1 80  LEU 80  78  78  LEU LEU A . n 
A 1 81  ILE 81  79  79  ILE ILE A . n 
A 1 82  PHE 82  80  80  PHE PHE A . n 
A 1 83  ALA 83  81  81  ALA ALA A . n 
A 1 84  ARG 84  82  82  ARG ARG A . n 
A 1 85  PRO 85  83  83  PRO PRO A . n 
A 1 86  ASN 86  84  84  ASN ASN A . n 
A 1 87  VAL 87  85  85  VAL VAL A . n 
A 1 88  PRO 88  86  86  PRO PRO A . n 
A 1 89  ASP 89  87  87  ASP ASP A . n 
A 1 90  LEU 90  88  88  LEU LEU A . n 
A 1 91  LEU 91  89  89  LEU LEU A . n 
A 1 92  ASP 92  90  90  ASP ASP A . n 
A 1 93  LEU 93  91  91  LEU LEU A . n 
A 1 94  LYS 94  92  92  LYS LYS A . n 
A 1 95  GLU 95  93  93  GLU GLU A . n 
A 1 96  ARG 96  94  94  ARG ARG A . n 
A 1 97  LYS 97  95  95  LYS LYS A . n 
A 1 98  GLY 98  96  96  GLY GLY A . n 
A 1 99  VAL 99  97  97  VAL VAL A . n 
A 1 100 TYR 100 98  98  TYR TYR A . n 
A 1 101 VAL 101 99  99  VAL VAL A . n 
A 1 102 LYS 102 100 100 LYS LYS A . n 
A 1 103 VAL 103 101 101 VAL VAL A . n 
A 1 104 TYR 104 102 102 TYR TYR A . n 
A 1 105 PRO 105 103 103 PRO PRO A . n 
A 1 106 ASP 106 104 104 ASP ASP A . n 
A 1 107 ASN 107 105 105 ASN ASN A . n 
A 1 108 GLY 108 106 106 GLY GLY A . n 
A 1 109 THR 109 107 107 THR THR A . n 
A 1 110 PRO 110 108 108 PRO PRO A . n 
A 1 111 THR 111 109 109 THR THR A . n 
A 1 112 ASP 112 110 110 ASP ASP A . n 
A 1 113 TYR 113 111 111 TYR TYR A . n 
A 1 114 GLN 114 112 112 GLN GLN A . n 
A 1 115 THR 115 113 113 THR THR A . n 
A 1 116 ALA 116 114 114 ALA ALA A . n 
A 1 117 GLU 117 115 115 GLU GLU A . n 
A 1 118 ASN 118 116 116 ASN ASN A . n 
A 1 119 GLU 119 117 117 GLU GLU A . n 
A 1 120 ILE 120 118 118 ILE ILE A . n 
A 1 121 PHE 121 119 119 PHE PHE A . n 
A 1 122 VAL 122 120 120 VAL VAL A . n 
A 1 123 ARG 123 121 121 ARG ARG A . n 
A 1 124 VAL 124 122 122 VAL VAL A . n 
A 1 125 SER 125 123 123 SER SER A . n 
A 1 126 LEU 126 124 124 LEU LEU A . n 
A 1 127 SER 127 125 125 SER SER A . n 
A 1 128 GLY 128 126 126 GLY GLY A . n 
A 1 129 GLN 129 127 127 GLN GLN A . n 
A 1 130 MET 130 128 128 MET MET A . n 
A 1 131 SER 131 129 129 SER SER A . n 
A 1 132 PRO 132 130 130 PRO PRO A . n 
A 1 133 ILE 133 131 131 ILE ILE A . n 
A 1 134 THR 134 132 132 THR THR A . n 
A 1 135 ARG 135 133 133 ARG ARG A . n 
A 1 136 GLU 136 134 134 GLU GLU A . n 
A 1 137 TYR 137 135 135 TYR TYR A . n 
A 1 138 LEU 138 136 136 LEU LEU A . n 
A 1 139 ASP 139 137 137 ASP ASP A . n 
A 1 140 GLU 140 138 138 GLU GLU A . n 
A 1 141 VAL 141 139 139 VAL VAL A . n 
A 1 142 GLN 142 140 140 GLN GLN A . n 
A 1 143 ARG 143 141 141 ARG ARG A . n 
A 1 144 GLN 144 142 142 GLN GLN A . n 
A 1 145 ASP 145 143 143 ASP ASP A . n 
A 1 146 VAL 146 144 144 VAL VAL A . n 
A 1 147 THR 147 145 145 THR THR A . n 
A 1 148 ASN 148 146 146 ASN ASN A . n 
A 1 149 PHE 149 147 147 PHE PHE A . n 
A 1 150 LEU 150 148 148 LEU LEU A . n 
A 1 151 VAL 151 149 149 VAL VAL A . n 
A 1 152 THR 152 150 150 THR THR A . n 
A 1 153 ILE 153 151 151 ILE ILE A . n 
A 1 154 TYR 154 152 152 TYR TYR A . n 
A 1 155 ASN 155 153 153 ASN ASN A . n 
A 1 156 GLU 156 154 154 GLU GLU A . n 
A 1 157 SER 157 155 155 SER SER A . n 
A 1 158 LEU 158 156 156 LEU LEU A . n 
A 1 159 GLU 159 157 157 GLU GLU A . n 
A 1 160 SER 160 158 158 SER SER A . n 
A 1 161 ASN 161 159 159 ASN ASN A . n 
A 1 162 LEU 162 160 160 LEU LEU A . n 
A 1 163 LEU 163 161 161 LEU LEU A . n 
A 1 164 GLU 164 162 162 GLU GLU A . n 
A 1 165 ARG 165 163 163 ARG ARG A . n 
A 1 166 MET 166 164 164 MET MET A . n 
A 1 167 GLN 167 165 165 GLN GLN A . n 
A 1 168 GLU 168 166 166 GLU GLU A . n 
A 1 169 LEU 169 167 167 LEU LEU A . n 
A 1 170 TYR 170 168 ?   ?   ?   A . n 
A 1 171 ASP 171 169 ?   ?   ?   A . n 
A 1 172 THR 172 170 ?   ?   ?   A . n 
A 1 173 ASP 173 171 ?   ?   ?   A . n 
B 1 1   GLY 1   -1  ?   ?   ?   B . n 
B 1 2   ALA 2   0   0   ALA ALA B . n 
B 1 3   MET 3   1   1   MET MET B . n 
B 1 4   ASP 4   2   2   ASP ASP B . n 
B 1 5   ARG 5   3   3   ARG ARG B . n 
B 1 6   HIS 6   4   4   HIS HIS B . n 
B 1 7   LYS 7   5   5   LYS LYS B . n 
B 1 8   PRO 8   6   6   PRO PRO B . n 
B 1 9   LYS 9   7   7   LYS LYS B . n 
B 1 10  SER 10  8   8   SER SER B . n 
B 1 11  ILE 11  9   9   ILE ILE B . n 
B 1 12  SER 12  10  10  SER SER B . n 
B 1 13  SER 13  11  11  SER SER B . n 
B 1 14  GLU 14  12  12  GLU GLU B . n 
B 1 15  ILE 15  13  13  ILE ILE B . n 
B 1 16  TRP 16  14  14  TRP TRP B . n 
B 1 17  ALA 17  15  15  ALA ALA B . n 
B 1 18  LEU 18  16  16  LEU LEU B . n 
B 1 19  SER 19  17  17  SER SER B . n 
B 1 20  GLU 20  18  18  GLU GLU B . n 
B 1 21  THR 21  19  19  THR THR B . n 
B 1 22  SER 22  20  20  SER SER B . n 
B 1 23  LYS 23  21  21  LYS LYS B . n 
B 1 24  GLU 24  22  22  GLU GLU B . n 
B 1 25  TRP 25  23  23  TRP TRP B . n 
B 1 26  MET 26  24  24  MET MET B . n 
B 1 27  SER 27  25  25  SER SER B . n 
B 1 28  ASN 28  26  26  ASN ASN B . n 
B 1 29  LEU 29  27  27  LEU LEU B . n 
B 1 30  ARG 30  28  28  ARG ARG B . n 
B 1 31  PRO 31  29  29  PRO PRO B . n 
B 1 32  LEU 32  30  30  LEU LEU B . n 
B 1 33  GLU 33  31  31  GLU GLU B . n 
B 1 34  ALA 34  32  32  ALA ALA B . n 
B 1 35  ARG 35  33  33  ARG ARG B . n 
B 1 36  ILE 36  34  34  ILE ILE B . n 
B 1 37  VAL 37  35  35  VAL VAL B . n 
B 1 38  GLU 38  36  36  GLU GLU B . n 
B 1 39  CYS 39  37  37  CYS CYS B . n 
B 1 40  ILE 40  38  38  ILE ILE B . n 
B 1 41  LYS 41  39  39  LYS LYS B . n 
B 1 42  TYR 42  40  40  TYR TYR B . n 
B 1 43  THR 43  41  41  THR THR B . n 
B 1 44  VAL 44  42  42  VAL VAL B . n 
B 1 45  CYS 45  43  43  CYS CYS B . n 
B 1 46  CME 46  44  44  CME CME B . n 
B 1 47  HIS 47  45  45  HIS HIS B . n 
B 1 48  ILE 48  46  46  ILE ILE B . n 
B 1 49  SER 49  47  47  SER SER B . n 
B 1 50  ASP 50  48  48  ASP ASP B . n 
B 1 51  MET 51  49  49  MET MET B . n 
B 1 52  HIS 52  50  50  HIS HIS B . n 
B 1 53  LEU 53  51  51  LEU LEU B . n 
B 1 54  HIS 54  52  52  HIS HIS B . n 
B 1 55  ASN 55  53  53  ASN ASN B . n 
B 1 56  GLY 56  54  54  GLY GLY B . n 
B 1 57  VAL 57  55  55  VAL VAL B . n 
B 1 58  PRO 58  56  56  PRO PRO B . n 
B 1 59  ARG 59  57  57  ARG ARG B . n 
B 1 60  TYR 60  58  58  TYR TYR B . n 
B 1 61  ILE 61  59  59  ILE ILE B . n 
B 1 62  VAL 62  60  60  VAL VAL B . n 
B 1 63  ASN 63  61  61  ASN ASN B . n 
B 1 64  MET 64  62  62  MET MET B . n 
B 1 65  TRP 65  63  63  TRP TRP B . n 
B 1 66  THR 66  64  64  THR THR B . n 
B 1 67  PRO 67  65  65  PRO PRO B . n 
B 1 68  PRO 68  66  66  PRO PRO B . n 
B 1 69  GLU 69  67  67  GLU GLU B . n 
B 1 70  VAL 70  68  68  VAL VAL B . n 
B 1 71  ALA 71  69  69  ALA ALA B . n 
B 1 72  ASP 72  70  70  ASP ASP B . n 
B 1 73  GLN 73  71  71  GLN GLN B . n 
B 1 74  GLU 74  72  72  GLU GLU B . n 
B 1 75  MET 75  73  73  MET MET B . n 
B 1 76  LYS 76  74  74  LYS LYS B . n 
B 1 77  ARG 77  75  75  ARG ARG B . n 
B 1 78  GLN 78  76  76  GLN GLN B . n 
B 1 79  ASN 79  77  77  ASN ASN B . n 
B 1 80  LEU 80  78  78  LEU LEU B . n 
B 1 81  ILE 81  79  79  ILE ILE B . n 
B 1 82  PHE 82  80  80  PHE PHE B . n 
B 1 83  ALA 83  81  81  ALA ALA B . n 
B 1 84  ARG 84  82  82  ARG ARG B . n 
B 1 85  PRO 85  83  83  PRO PRO B . n 
B 1 86  ASN 86  84  84  ASN ASN B . n 
B 1 87  VAL 87  85  85  VAL VAL B . n 
B 1 88  PRO 88  86  86  PRO PRO B . n 
B 1 89  ASP 89  87  87  ASP ASP B . n 
B 1 90  LEU 90  88  88  LEU LEU B . n 
B 1 91  LEU 91  89  89  LEU LEU B . n 
B 1 92  ASP 92  90  90  ASP ASP B . n 
B 1 93  LEU 93  91  91  LEU LEU B . n 
B 1 94  LYS 94  92  92  LYS LYS B . n 
B 1 95  GLU 95  93  93  GLU GLU B . n 
B 1 96  ARG 96  94  94  ARG ARG B . n 
B 1 97  LYS 97  95  95  LYS LYS B . n 
B 1 98  GLY 98  96  96  GLY GLY B . n 
B 1 99  VAL 99  97  97  VAL VAL B . n 
B 1 100 TYR 100 98  98  TYR TYR B . n 
B 1 101 VAL 101 99  99  VAL VAL B . n 
B 1 102 LYS 102 100 100 LYS LYS B . n 
B 1 103 VAL 103 101 101 VAL VAL B . n 
B 1 104 TYR 104 102 102 TYR TYR B . n 
B 1 105 PRO 105 103 103 PRO PRO B . n 
B 1 106 ASP 106 104 104 ASP ASP B . n 
B 1 107 ASN 107 105 105 ASN ASN B . n 
B 1 108 GLY 108 106 106 GLY GLY B . n 
B 1 109 THR 109 107 107 THR THR B . n 
B 1 110 PRO 110 108 108 PRO PRO B . n 
B 1 111 THR 111 109 109 THR THR B . n 
B 1 112 ASP 112 110 110 ASP ASP B . n 
B 1 113 TYR 113 111 111 TYR TYR B . n 
B 1 114 GLN 114 112 112 GLN GLN B . n 
B 1 115 THR 115 113 113 THR THR B . n 
B 1 116 ALA 116 114 114 ALA ALA B . n 
B 1 117 GLU 117 115 115 GLU GLU B . n 
B 1 118 ASN 118 116 116 ASN ASN B . n 
B 1 119 GLU 119 117 117 GLU GLU B . n 
B 1 120 ILE 120 118 118 ILE ILE B . n 
B 1 121 PHE 121 119 119 PHE PHE B . n 
B 1 122 VAL 122 120 120 VAL VAL B . n 
B 1 123 ARG 123 121 121 ARG ARG B . n 
B 1 124 VAL 124 122 122 VAL VAL B . n 
B 1 125 SER 125 123 123 SER SER B . n 
B 1 126 LEU 126 124 124 LEU LEU B . n 
B 1 127 SER 127 125 125 SER SER B . n 
B 1 128 GLY 128 126 126 GLY GLY B . n 
B 1 129 GLN 129 127 127 GLN GLN B . n 
B 1 130 MET 130 128 128 MET MET B . n 
B 1 131 SER 131 129 129 SER SER B . n 
B 1 132 PRO 132 130 130 PRO PRO B . n 
B 1 133 ILE 133 131 131 ILE ILE B . n 
B 1 134 THR 134 132 132 THR THR B . n 
B 1 135 ARG 135 133 133 ARG ARG B . n 
B 1 136 GLU 136 134 134 GLU GLU B . n 
B 1 137 TYR 137 135 135 TYR TYR B . n 
B 1 138 LEU 138 136 136 LEU LEU B . n 
B 1 139 ASP 139 137 137 ASP ASP B . n 
B 1 140 GLU 140 138 138 GLU GLU B . n 
B 1 141 VAL 141 139 139 VAL VAL B . n 
B 1 142 GLN 142 140 140 GLN GLN B . n 
B 1 143 ARG 143 141 141 ARG ARG B . n 
B 1 144 GLN 144 142 142 GLN GLN B . n 
B 1 145 ASP 145 143 143 ASP ASP B . n 
B 1 146 VAL 146 144 144 VAL VAL B . n 
B 1 147 THR 147 145 145 THR THR B . n 
B 1 148 ASN 148 146 146 ASN ASN B . n 
B 1 149 PHE 149 147 147 PHE PHE B . n 
B 1 150 LEU 150 148 148 LEU LEU B . n 
B 1 151 VAL 151 149 149 VAL VAL B . n 
B 1 152 THR 152 150 150 THR THR B . n 
B 1 153 ILE 153 151 151 ILE ILE B . n 
B 1 154 TYR 154 152 152 TYR TYR B . n 
B 1 155 ASN 155 153 153 ASN ASN B . n 
B 1 156 GLU 156 154 154 GLU GLU B . n 
B 1 157 SER 157 155 155 SER SER B . n 
B 1 158 LEU 158 156 156 LEU LEU B . n 
B 1 159 GLU 159 157 157 GLU GLU B . n 
B 1 160 SER 160 158 158 SER SER B . n 
B 1 161 ASN 161 159 159 ASN ASN B . n 
B 1 162 LEU 162 160 160 LEU LEU B . n 
B 1 163 LEU 163 161 161 LEU LEU B . n 
B 1 164 GLU 164 162 162 GLU GLU B . n 
B 1 165 ARG 165 163 163 ARG ARG B . n 
B 1 166 MET 166 164 164 MET MET B . n 
B 1 167 GLN 167 165 165 GLN GLN B . n 
B 1 168 GLU 168 166 166 GLU GLU B . n 
B 1 169 LEU 169 167 167 LEU LEU B . n 
B 1 170 TYR 170 168 168 TYR TYR B . n 
B 1 171 ASP 171 169 ?   ?   ?   B . n 
B 1 172 THR 172 170 ?   ?   ?   B . n 
B 1 173 ASP 173 171 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 GOL 1   1168 1168 GOL GOL A . 
D 2 GOL 1   1169 1169 GOL GOL B . 
E 3 HOH 1   2001 2001 HOH HOH A . 
E 3 HOH 2   2002 2002 HOH HOH A . 
E 3 HOH 3   2003 2003 HOH HOH A . 
E 3 HOH 4   2004 2004 HOH HOH A . 
E 3 HOH 5   2005 2005 HOH HOH A . 
E 3 HOH 6   2006 2006 HOH HOH A . 
E 3 HOH 7   2007 2007 HOH HOH A . 
E 3 HOH 8   2008 2008 HOH HOH A . 
E 3 HOH 9   2009 2009 HOH HOH A . 
E 3 HOH 10  2010 2010 HOH HOH A . 
E 3 HOH 11  2011 2011 HOH HOH A . 
E 3 HOH 12  2012 2012 HOH HOH A . 
E 3 HOH 13  2013 2013 HOH HOH A . 
E 3 HOH 14  2014 2014 HOH HOH A . 
E 3 HOH 15  2015 2015 HOH HOH A . 
E 3 HOH 16  2016 2016 HOH HOH A . 
E 3 HOH 17  2017 2017 HOH HOH A . 
E 3 HOH 18  2018 2018 HOH HOH A . 
E 3 HOH 19  2019 2019 HOH HOH A . 
E 3 HOH 20  2020 2020 HOH HOH A . 
E 3 HOH 21  2021 2021 HOH HOH A . 
E 3 HOH 22  2022 2022 HOH HOH A . 
E 3 HOH 23  2023 2023 HOH HOH A . 
E 3 HOH 24  2024 2024 HOH HOH A . 
E 3 HOH 25  2025 2025 HOH HOH A . 
E 3 HOH 26  2026 2026 HOH HOH A . 
E 3 HOH 27  2027 2027 HOH HOH A . 
E 3 HOH 28  2028 2028 HOH HOH A . 
E 3 HOH 29  2029 2029 HOH HOH A . 
E 3 HOH 30  2030 2030 HOH HOH A . 
E 3 HOH 31  2031 2031 HOH HOH A . 
E 3 HOH 32  2032 2032 HOH HOH A . 
E 3 HOH 33  2033 2033 HOH HOH A . 
E 3 HOH 34  2034 2034 HOH HOH A . 
E 3 HOH 35  2035 2035 HOH HOH A . 
E 3 HOH 36  2036 2036 HOH HOH A . 
E 3 HOH 37  2037 2037 HOH HOH A . 
E 3 HOH 38  2038 2038 HOH HOH A . 
E 3 HOH 39  2039 2039 HOH HOH A . 
E 3 HOH 40  2040 2040 HOH HOH A . 
E 3 HOH 41  2041 2041 HOH HOH A . 
E 3 HOH 42  2042 2042 HOH HOH A . 
E 3 HOH 43  2043 2043 HOH HOH A . 
E 3 HOH 44  2044 2044 HOH HOH A . 
E 3 HOH 45  2045 2045 HOH HOH A . 
E 3 HOH 46  2046 2046 HOH HOH A . 
E 3 HOH 47  2047 2047 HOH HOH A . 
E 3 HOH 48  2048 2048 HOH HOH A . 
E 3 HOH 49  2049 2049 HOH HOH A . 
E 3 HOH 50  2050 2050 HOH HOH A . 
E 3 HOH 51  2051 2051 HOH HOH A . 
E 3 HOH 52  2052 2052 HOH HOH A . 
E 3 HOH 53  2053 2053 HOH HOH A . 
E 3 HOH 54  2054 2054 HOH HOH A . 
E 3 HOH 55  2055 2055 HOH HOH A . 
E 3 HOH 56  2056 2056 HOH HOH A . 
E 3 HOH 57  2057 2057 HOH HOH A . 
E 3 HOH 58  2058 2058 HOH HOH A . 
E 3 HOH 59  2059 2059 HOH HOH A . 
E 3 HOH 60  2060 2060 HOH HOH A . 
E 3 HOH 61  2061 2061 HOH HOH A . 
E 3 HOH 62  2062 2062 HOH HOH A . 
E 3 HOH 63  2063 2063 HOH HOH A . 
E 3 HOH 64  2064 2064 HOH HOH A . 
E 3 HOH 65  2065 2065 HOH HOH A . 
E 3 HOH 66  2066 2066 HOH HOH A . 
E 3 HOH 67  2067 2067 HOH HOH A . 
E 3 HOH 68  2068 2068 HOH HOH A . 
E 3 HOH 69  2069 2069 HOH HOH A . 
E 3 HOH 70  2070 2070 HOH HOH A . 
E 3 HOH 71  2071 2071 HOH HOH A . 
E 3 HOH 72  2072 2072 HOH HOH A . 
E 3 HOH 73  2073 2073 HOH HOH A . 
E 3 HOH 74  2074 2074 HOH HOH A . 
E 3 HOH 75  2075 2075 HOH HOH A . 
E 3 HOH 76  2076 2076 HOH HOH A . 
E 3 HOH 77  2077 2077 HOH HOH A . 
E 3 HOH 78  2078 2078 HOH HOH A . 
E 3 HOH 79  2079 2079 HOH HOH A . 
E 3 HOH 80  2080 2080 HOH HOH A . 
E 3 HOH 81  2081 2081 HOH HOH A . 
E 3 HOH 82  2082 2082 HOH HOH A . 
E 3 HOH 83  2083 2083 HOH HOH A . 
E 3 HOH 84  2084 2084 HOH HOH A . 
E 3 HOH 85  2085 2085 HOH HOH A . 
E 3 HOH 86  2086 2086 HOH HOH A . 
E 3 HOH 87  2087 2087 HOH HOH A . 
E 3 HOH 88  2088 2088 HOH HOH A . 
E 3 HOH 89  2089 2089 HOH HOH A . 
E 3 HOH 90  2090 2090 HOH HOH A . 
E 3 HOH 91  2091 2091 HOH HOH A . 
E 3 HOH 92  2092 2092 HOH HOH A . 
E 3 HOH 93  2093 2093 HOH HOH A . 
E 3 HOH 94  2094 2094 HOH HOH A . 
E 3 HOH 95  2095 2095 HOH HOH A . 
E 3 HOH 96  2096 2096 HOH HOH A . 
E 3 HOH 97  2097 2097 HOH HOH A . 
E 3 HOH 98  2098 2098 HOH HOH A . 
E 3 HOH 99  2099 2099 HOH HOH A . 
E 3 HOH 100 2100 2100 HOH HOH A . 
E 3 HOH 101 2101 2101 HOH HOH A . 
E 3 HOH 102 2102 2102 HOH HOH A . 
E 3 HOH 103 2103 2103 HOH HOH A . 
E 3 HOH 104 2104 2104 HOH HOH A . 
E 3 HOH 105 2105 2105 HOH HOH A . 
E 3 HOH 106 2106 2106 HOH HOH A . 
E 3 HOH 107 2107 2107 HOH HOH A . 
E 3 HOH 108 2108 2108 HOH HOH A . 
E 3 HOH 109 2109 2109 HOH HOH A . 
E 3 HOH 110 2110 2110 HOH HOH A . 
E 3 HOH 111 2111 2111 HOH HOH A . 
E 3 HOH 112 2112 2112 HOH HOH A . 
E 3 HOH 113 2113 2113 HOH HOH A . 
E 3 HOH 114 2114 2114 HOH HOH A . 
E 3 HOH 115 2115 2115 HOH HOH A . 
E 3 HOH 116 2116 2116 HOH HOH A . 
E 3 HOH 117 2117 2117 HOH HOH A . 
E 3 HOH 118 2118 2118 HOH HOH A . 
E 3 HOH 119 2119 2119 HOH HOH A . 
E 3 HOH 120 2120 2120 HOH HOH A . 
E 3 HOH 121 2121 2121 HOH HOH A . 
E 3 HOH 122 2122 2122 HOH HOH A . 
E 3 HOH 123 2123 2123 HOH HOH A . 
E 3 HOH 124 2124 2124 HOH HOH A . 
E 3 HOH 125 2125 2125 HOH HOH A . 
E 3 HOH 126 2126 2126 HOH HOH A . 
E 3 HOH 127 2127 2127 HOH HOH A . 
E 3 HOH 128 2128 2128 HOH HOH A . 
E 3 HOH 129 2129 2129 HOH HOH A . 
E 3 HOH 130 2130 2130 HOH HOH A . 
E 3 HOH 131 2131 2131 HOH HOH A . 
E 3 HOH 132 2132 2132 HOH HOH A . 
E 3 HOH 133 2133 2133 HOH HOH A . 
E 3 HOH 134 2134 2134 HOH HOH A . 
E 3 HOH 135 2135 2135 HOH HOH A . 
E 3 HOH 136 2136 2136 HOH HOH A . 
E 3 HOH 137 2137 2137 HOH HOH A . 
E 3 HOH 138 2138 2138 HOH HOH A . 
E 3 HOH 139 2139 2139 HOH HOH A . 
E 3 HOH 140 2140 2140 HOH HOH A . 
E 3 HOH 141 2141 2141 HOH HOH A . 
E 3 HOH 142 2142 2142 HOH HOH A . 
E 3 HOH 143 2143 2143 HOH HOH A . 
E 3 HOH 144 2144 2144 HOH HOH A . 
E 3 HOH 145 2145 2145 HOH HOH A . 
E 3 HOH 146 2146 2146 HOH HOH A . 
E 3 HOH 147 2147 2147 HOH HOH A . 
E 3 HOH 148 2148 2148 HOH HOH A . 
E 3 HOH 149 2149 2149 HOH HOH A . 
E 3 HOH 150 2150 2150 HOH HOH A . 
E 3 HOH 151 2151 2151 HOH HOH A . 
E 3 HOH 152 2152 2152 HOH HOH A . 
E 3 HOH 153 2153 2153 HOH HOH A . 
E 3 HOH 154 2154 2154 HOH HOH A . 
E 3 HOH 155 2155 2155 HOH HOH A . 
E 3 HOH 156 2156 2156 HOH HOH A . 
E 3 HOH 157 2157 2157 HOH HOH A . 
E 3 HOH 158 2158 2158 HOH HOH A . 
E 3 HOH 159 2159 2159 HOH HOH A . 
E 3 HOH 160 2160 2160 HOH HOH A . 
E 3 HOH 161 2161 2161 HOH HOH A . 
E 3 HOH 162 2162 2162 HOH HOH A . 
E 3 HOH 163 2163 2163 HOH HOH A . 
E 3 HOH 164 2164 2164 HOH HOH A . 
E 3 HOH 165 2165 2165 HOH HOH A . 
E 3 HOH 166 2166 2166 HOH HOH A . 
E 3 HOH 167 2167 2167 HOH HOH A . 
E 3 HOH 168 2168 2168 HOH HOH A . 
E 3 HOH 169 2169 2169 HOH HOH A . 
E 3 HOH 170 2170 2170 HOH HOH A . 
E 3 HOH 171 2171 2171 HOH HOH A . 
E 3 HOH 172 2172 2172 HOH HOH A . 
E 3 HOH 173 2173 2173 HOH HOH A . 
E 3 HOH 174 2174 2174 HOH HOH A . 
E 3 HOH 175 2175 2175 HOH HOH A . 
E 3 HOH 176 2176 2176 HOH HOH A . 
E 3 HOH 177 2177 2177 HOH HOH A . 
E 3 HOH 178 2178 2178 HOH HOH A . 
E 3 HOH 179 2179 2179 HOH HOH A . 
E 3 HOH 180 2180 2180 HOH HOH A . 
E 3 HOH 181 2181 2181 HOH HOH A . 
E 3 HOH 182 2182 2182 HOH HOH A . 
E 3 HOH 183 2183 2183 HOH HOH A . 
E 3 HOH 184 2184 2184 HOH HOH A . 
E 3 HOH 185 2185 2185 HOH HOH A . 
E 3 HOH 186 2186 2186 HOH HOH A . 
E 3 HOH 187 2187 2187 HOH HOH A . 
E 3 HOH 188 2188 2188 HOH HOH A . 
E 3 HOH 189 2189 2189 HOH HOH A . 
E 3 HOH 190 2190 2190 HOH HOH A . 
E 3 HOH 191 2191 2191 HOH HOH A . 
E 3 HOH 192 2192 2192 HOH HOH A . 
E 3 HOH 193 2193 2193 HOH HOH A . 
E 3 HOH 194 2194 2194 HOH HOH A . 
E 3 HOH 195 2195 2195 HOH HOH A . 
E 3 HOH 196 2196 2196 HOH HOH A . 
E 3 HOH 197 2197 2197 HOH HOH A . 
E 3 HOH 198 2198 2198 HOH HOH A . 
E 3 HOH 199 2199 2199 HOH HOH A . 
E 3 HOH 200 2200 2200 HOH HOH A . 
E 3 HOH 201 2201 2201 HOH HOH A . 
E 3 HOH 202 2202 2202 HOH HOH A . 
E 3 HOH 203 2203 2203 HOH HOH A . 
E 3 HOH 204 2204 2204 HOH HOH A . 
E 3 HOH 205 2205 2205 HOH HOH A . 
E 3 HOH 206 2206 2206 HOH HOH A . 
E 3 HOH 207 2207 2207 HOH HOH A . 
E 3 HOH 208 2208 2208 HOH HOH A . 
E 3 HOH 209 2209 2209 HOH HOH A . 
E 3 HOH 210 2210 2210 HOH HOH A . 
E 3 HOH 211 2211 2211 HOH HOH A . 
E 3 HOH 212 2212 2212 HOH HOH A . 
E 3 HOH 213 2213 2213 HOH HOH A . 
E 3 HOH 214 2214 2214 HOH HOH A . 
E 3 HOH 215 2215 2215 HOH HOH A . 
E 3 HOH 216 2216 2216 HOH HOH A . 
E 3 HOH 217 2217 2217 HOH HOH A . 
E 3 HOH 218 2218 2218 HOH HOH A . 
E 3 HOH 219 2219 2219 HOH HOH A . 
E 3 HOH 220 2220 2220 HOH HOH A . 
E 3 HOH 221 2221 2221 HOH HOH A . 
E 3 HOH 222 2222 2222 HOH HOH A . 
E 3 HOH 223 2223 2223 HOH HOH A . 
E 3 HOH 224 2224 2224 HOH HOH A . 
E 3 HOH 225 2225 2225 HOH HOH A . 
E 3 HOH 226 2226 2226 HOH HOH A . 
E 3 HOH 227 2227 2227 HOH HOH A . 
E 3 HOH 228 2228 2228 HOH HOH A . 
E 3 HOH 229 2229 2229 HOH HOH A . 
E 3 HOH 230 2230 2230 HOH HOH A . 
E 3 HOH 231 2231 2231 HOH HOH A . 
E 3 HOH 232 2232 2232 HOH HOH A . 
E 3 HOH 233 2233 2233 HOH HOH A . 
E 3 HOH 234 2234 2234 HOH HOH A . 
E 3 HOH 235 2235 2235 HOH HOH A . 
E 3 HOH 236 2236 2236 HOH HOH A . 
E 3 HOH 237 2237 2237 HOH HOH A . 
E 3 HOH 238 2238 2238 HOH HOH A . 
E 3 HOH 239 2239 2239 HOH HOH A . 
E 3 HOH 240 2240 2240 HOH HOH A . 
E 3 HOH 241 2241 2241 HOH HOH A . 
E 3 HOH 242 2242 2242 HOH HOH A . 
E 3 HOH 243 2243 2243 HOH HOH A . 
F 3 HOH 1   2001 2001 HOH HOH B . 
F 3 HOH 2   2002 2002 HOH HOH B . 
F 3 HOH 3   2003 2003 HOH HOH B . 
F 3 HOH 4   2004 2004 HOH HOH B . 
F 3 HOH 5   2005 2005 HOH HOH B . 
F 3 HOH 6   2006 2006 HOH HOH B . 
F 3 HOH 7   2007 2007 HOH HOH B . 
F 3 HOH 8   2008 2008 HOH HOH B . 
F 3 HOH 9   2009 2009 HOH HOH B . 
F 3 HOH 10  2010 2010 HOH HOH B . 
F 3 HOH 11  2011 2011 HOH HOH B . 
F 3 HOH 12  2012 2012 HOH HOH B . 
F 3 HOH 13  2013 2013 HOH HOH B . 
F 3 HOH 14  2014 2014 HOH HOH B . 
F 3 HOH 15  2015 2015 HOH HOH B . 
F 3 HOH 16  2016 2016 HOH HOH B . 
F 3 HOH 17  2017 2017 HOH HOH B . 
F 3 HOH 18  2018 2018 HOH HOH B . 
F 3 HOH 19  2019 2019 HOH HOH B . 
F 3 HOH 20  2020 2020 HOH HOH B . 
F 3 HOH 21  2021 2021 HOH HOH B . 
F 3 HOH 22  2022 2022 HOH HOH B . 
F 3 HOH 23  2023 2023 HOH HOH B . 
F 3 HOH 24  2024 2024 HOH HOH B . 
F 3 HOH 25  2025 2025 HOH HOH B . 
F 3 HOH 26  2026 2026 HOH HOH B . 
F 3 HOH 27  2027 2027 HOH HOH B . 
F 3 HOH 28  2028 2028 HOH HOH B . 
F 3 HOH 29  2029 2029 HOH HOH B . 
F 3 HOH 30  2030 2030 HOH HOH B . 
F 3 HOH 31  2031 2031 HOH HOH B . 
F 3 HOH 32  2032 2032 HOH HOH B . 
F 3 HOH 33  2033 2033 HOH HOH B . 
F 3 HOH 34  2034 2034 HOH HOH B . 
F 3 HOH 35  2035 2035 HOH HOH B . 
F 3 HOH 36  2036 2036 HOH HOH B . 
F 3 HOH 37  2037 2037 HOH HOH B . 
F 3 HOH 38  2038 2038 HOH HOH B . 
F 3 HOH 39  2039 2039 HOH HOH B . 
F 3 HOH 40  2040 2040 HOH HOH B . 
F 3 HOH 41  2041 2041 HOH HOH B . 
F 3 HOH 42  2042 2042 HOH HOH B . 
F 3 HOH 43  2043 2043 HOH HOH B . 
F 3 HOH 44  2044 2044 HOH HOH B . 
F 3 HOH 45  2045 2045 HOH HOH B . 
F 3 HOH 46  2046 2046 HOH HOH B . 
F 3 HOH 47  2047 2047 HOH HOH B . 
F 3 HOH 48  2048 2048 HOH HOH B . 
F 3 HOH 49  2049 2049 HOH HOH B . 
F 3 HOH 50  2050 2050 HOH HOH B . 
F 3 HOH 51  2051 2051 HOH HOH B . 
F 3 HOH 52  2052 2052 HOH HOH B . 
F 3 HOH 53  2053 2053 HOH HOH B . 
F 3 HOH 54  2054 2054 HOH HOH B . 
F 3 HOH 55  2055 2055 HOH HOH B . 
F 3 HOH 56  2056 2056 HOH HOH B . 
F 3 HOH 57  2057 2057 HOH HOH B . 
F 3 HOH 58  2058 2058 HOH HOH B . 
F 3 HOH 59  2059 2059 HOH HOH B . 
F 3 HOH 60  2060 2060 HOH HOH B . 
F 3 HOH 61  2061 2061 HOH HOH B . 
F 3 HOH 62  2062 2062 HOH HOH B . 
F 3 HOH 63  2063 2063 HOH HOH B . 
F 3 HOH 64  2064 2064 HOH HOH B . 
F 3 HOH 65  2065 2065 HOH HOH B . 
F 3 HOH 66  2066 2066 HOH HOH B . 
F 3 HOH 67  2067 2067 HOH HOH B . 
F 3 HOH 68  2068 2068 HOH HOH B . 
F 3 HOH 69  2069 2069 HOH HOH B . 
F 3 HOH 70  2070 2070 HOH HOH B . 
F 3 HOH 71  2071 2071 HOH HOH B . 
F 3 HOH 72  2072 2072 HOH HOH B . 
F 3 HOH 73  2073 2073 HOH HOH B . 
F 3 HOH 74  2074 2074 HOH HOH B . 
F 3 HOH 75  2075 2075 HOH HOH B . 
F 3 HOH 76  2076 2076 HOH HOH B . 
F 3 HOH 77  2077 2077 HOH HOH B . 
F 3 HOH 78  2078 2078 HOH HOH B . 
F 3 HOH 79  2079 2079 HOH HOH B . 
F 3 HOH 80  2080 2080 HOH HOH B . 
F 3 HOH 81  2081 2081 HOH HOH B . 
F 3 HOH 82  2082 2082 HOH HOH B . 
F 3 HOH 83  2083 2083 HOH HOH B . 
F 3 HOH 84  2084 2084 HOH HOH B . 
F 3 HOH 85  2085 2085 HOH HOH B . 
F 3 HOH 86  2086 2086 HOH HOH B . 
F 3 HOH 87  2087 2087 HOH HOH B . 
F 3 HOH 88  2088 2088 HOH HOH B . 
F 3 HOH 89  2089 2089 HOH HOH B . 
F 3 HOH 90  2090 2090 HOH HOH B . 
F 3 HOH 91  2091 2091 HOH HOH B . 
F 3 HOH 92  2092 2092 HOH HOH B . 
F 3 HOH 93  2093 2093 HOH HOH B . 
F 3 HOH 94  2094 2094 HOH HOH B . 
F 3 HOH 95  2095 2095 HOH HOH B . 
F 3 HOH 96  2096 2096 HOH HOH B . 
F 3 HOH 97  2097 2097 HOH HOH B . 
F 3 HOH 98  2098 2098 HOH HOH B . 
F 3 HOH 99  2099 2099 HOH HOH B . 
F 3 HOH 100 2100 2100 HOH HOH B . 
F 3 HOH 101 2101 2101 HOH HOH B . 
F 3 HOH 102 2102 2102 HOH HOH B . 
F 3 HOH 103 2103 2103 HOH HOH B . 
F 3 HOH 104 2104 2104 HOH HOH B . 
F 3 HOH 105 2105 2105 HOH HOH B . 
F 3 HOH 106 2106 2106 HOH HOH B . 
F 3 HOH 107 2107 2107 HOH HOH B . 
F 3 HOH 108 2108 2108 HOH HOH B . 
F 3 HOH 109 2109 2109 HOH HOH B . 
F 3 HOH 110 2110 2110 HOH HOH B . 
F 3 HOH 111 2111 2111 HOH HOH B . 
F 3 HOH 112 2112 2112 HOH HOH B . 
F 3 HOH 113 2113 2113 HOH HOH B . 
F 3 HOH 114 2114 2114 HOH HOH B . 
F 3 HOH 115 2115 2115 HOH HOH B . 
F 3 HOH 116 2116 2116 HOH HOH B . 
F 3 HOH 117 2117 2117 HOH HOH B . 
F 3 HOH 118 2118 2118 HOH HOH B . 
F 3 HOH 119 2119 2119 HOH HOH B . 
F 3 HOH 120 2120 2120 HOH HOH B . 
F 3 HOH 121 2121 2121 HOH HOH B . 
F 3 HOH 122 2122 2122 HOH HOH B . 
F 3 HOH 123 2123 2123 HOH HOH B . 
F 3 HOH 124 2124 2124 HOH HOH B . 
F 3 HOH 125 2125 2125 HOH HOH B . 
F 3 HOH 126 2126 2126 HOH HOH B . 
F 3 HOH 127 2127 2127 HOH HOH B . 
F 3 HOH 128 2128 2128 HOH HOH B . 
F 3 HOH 129 2129 2129 HOH HOH B . 
F 3 HOH 130 2130 2130 HOH HOH B . 
F 3 HOH 131 2131 2131 HOH HOH B . 
F 3 HOH 132 2132 2132 HOH HOH B . 
F 3 HOH 133 2133 2133 HOH HOH B . 
F 3 HOH 134 2134 2134 HOH HOH B . 
F 3 HOH 135 2135 2135 HOH HOH B . 
F 3 HOH 136 2136 2136 HOH HOH B . 
F 3 HOH 137 2137 2137 HOH HOH B . 
F 3 HOH 138 2138 2138 HOH HOH B . 
F 3 HOH 139 2139 2139 HOH HOH B . 
F 3 HOH 140 2140 2140 HOH HOH B . 
F 3 HOH 141 2141 2141 HOH HOH B . 
F 3 HOH 142 2142 2142 HOH HOH B . 
F 3 HOH 143 2143 2143 HOH HOH B . 
F 3 HOH 144 2144 2144 HOH HOH B . 
F 3 HOH 145 2145 2145 HOH HOH B . 
F 3 HOH 146 2146 2146 HOH HOH B . 
F 3 HOH 147 2147 2147 HOH HOH B . 
F 3 HOH 148 2148 2148 HOH HOH B . 
F 3 HOH 149 2149 2149 HOH HOH B . 
F 3 HOH 150 2150 2150 HOH HOH B . 
F 3 HOH 151 2151 2151 HOH HOH B . 
F 3 HOH 152 2152 2152 HOH HOH B . 
F 3 HOH 153 2153 2153 HOH HOH B . 
F 3 HOH 154 2154 2154 HOH HOH B . 
F 3 HOH 155 2155 2155 HOH HOH B . 
F 3 HOH 156 2156 2156 HOH HOH B . 
F 3 HOH 157 2157 2157 HOH HOH B . 
F 3 HOH 158 2158 2158 HOH HOH B . 
F 3 HOH 159 2159 2159 HOH HOH B . 
F 3 HOH 160 2160 2160 HOH HOH B . 
F 3 HOH 161 2161 2161 HOH HOH B . 
F 3 HOH 162 2162 2162 HOH HOH B . 
F 3 HOH 163 2163 2163 HOH HOH B . 
F 3 HOH 164 2164 2164 HOH HOH B . 
F 3 HOH 165 2165 2165 HOH HOH B . 
F 3 HOH 166 2166 2166 HOH HOH B . 
F 3 HOH 167 2167 2167 HOH HOH B . 
F 3 HOH 168 2168 2168 HOH HOH B . 
F 3 HOH 169 2169 2169 HOH HOH B . 
F 3 HOH 170 2170 2170 HOH HOH B . 
F 3 HOH 171 2171 2171 HOH HOH B . 
F 3 HOH 172 2172 2172 HOH HOH B . 
F 3 HOH 173 2173 2173 HOH HOH B . 
F 3 HOH 174 2174 2174 HOH HOH B . 
F 3 HOH 175 2175 2175 HOH HOH B . 
F 3 HOH 176 2176 2176 HOH HOH B . 
F 3 HOH 177 2177 2177 HOH HOH B . 
F 3 HOH 178 2178 2178 HOH HOH B . 
F 3 HOH 179 2179 2179 HOH HOH B . 
F 3 HOH 180 2180 2180 HOH HOH B . 
F 3 HOH 181 2181 2181 HOH HOH B . 
F 3 HOH 182 2182 2182 HOH HOH B . 
F 3 HOH 183 2183 2183 HOH HOH B . 
F 3 HOH 184 2184 2184 HOH HOH B . 
F 3 HOH 185 2185 2185 HOH HOH B . 
F 3 HOH 186 2186 2186 HOH HOH B . 
F 3 HOH 187 2187 2187 HOH HOH B . 
F 3 HOH 188 2188 2188 HOH HOH B . 
F 3 HOH 189 2189 2189 HOH HOH B . 
F 3 HOH 190 2190 2190 HOH HOH B . 
F 3 HOH 191 2191 2191 HOH HOH B . 
F 3 HOH 192 2192 2192 HOH HOH B . 
F 3 HOH 193 2193 2193 HOH HOH B . 
F 3 HOH 194 2194 2194 HOH HOH B . 
F 3 HOH 195 2195 2195 HOH HOH B . 
F 3 HOH 196 2196 2196 HOH HOH B . 
F 3 HOH 197 2197 2197 HOH HOH B . 
F 3 HOH 198 2198 2198 HOH HOH B . 
F 3 HOH 199 2199 2199 HOH HOH B . 
F 3 HOH 200 2200 2200 HOH HOH B . 
F 3 HOH 201 2201 2201 HOH HOH B . 
F 3 HOH 202 2202 2202 HOH HOH B . 
F 3 HOH 203 2203 2203 HOH HOH B . 
F 3 HOH 204 2204 2204 HOH HOH B . 
F 3 HOH 205 2205 2205 HOH HOH B . 
F 3 HOH 206 2206 2206 HOH HOH B . 
F 3 HOH 207 2207 2207 HOH HOH B . 
F 3 HOH 208 2208 2208 HOH HOH B . 
F 3 HOH 209 2209 2209 HOH HOH B . 
F 3 HOH 210 2210 2210 HOH HOH B . 
F 3 HOH 211 2211 2211 HOH HOH B . 
F 3 HOH 212 2212 2212 HOH HOH B . 
F 3 HOH 213 2213 2213 HOH HOH B . 
F 3 HOH 214 2214 2214 HOH HOH B . 
F 3 HOH 215 2215 2215 HOH HOH B . 
F 3 HOH 216 2216 2216 HOH HOH B . 
F 3 HOH 217 2217 2217 HOH HOH B . 
F 3 HOH 218 2218 2218 HOH HOH B . 
F 3 HOH 219 2219 2219 HOH HOH B . 
F 3 HOH 220 2220 2220 HOH HOH B . 
F 3 HOH 221 2221 2221 HOH HOH B . 
F 3 HOH 222 2222 2222 HOH HOH B . 
F 3 HOH 223 2223 2223 HOH HOH B . 
F 3 HOH 224 2224 2224 HOH HOH B . 
F 3 HOH 225 2225 2225 HOH HOH B . 
F 3 HOH 226 2226 2226 HOH HOH B . 
F 3 HOH 227 2227 2227 HOH HOH B . 
F 3 HOH 228 2228 2228 HOH HOH B . 
F 3 HOH 229 2229 2229 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A CME 46 A CME 44 ? CYS 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' 
2 B CME 46 B CME 44 ? CYS 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PISA monomeric 1 
2 software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2014-02-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.6.0116 ? 1 
XDS       'data reduction' .        ? 2 
XSCALE    'data scaling'   .        ? 3 
autoSHARP phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             4CGS 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   'GLYCEROL (GOL): FROM CRYOPROTECTANT' 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG A HIS 45 ? ? CD2 A HIS 45 ? ? 1.413 1.354 0.059  0.009 N 
2 1 CG B HIS 45 ? ? CD2 B HIS 45 ? ? 1.422 1.354 0.068  0.009 N 
3 1 CB B SER 47 ? ? OG  B SER 47 ? ? 1.327 1.418 -0.091 0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 28  ? ? CZ A ARG 28  ? ? NH1 A ARG 28  ? ? 123.41 120.30 3.11  0.50 N 
2 1 NE A ARG 28  ? ? CZ A ARG 28  ? ? NH2 A ARG 28  ? ? 115.34 120.30 -4.96 0.50 N 
3 1 NE A ARG 133 ? ? CZ A ARG 133 ? ? NH1 A ARG 133 ? ? 124.29 120.30 3.99  0.50 N 
4 1 NE A ARG 133 ? ? CZ A ARG 133 ? ? NH2 A ARG 133 ? ? 116.77 120.30 -3.53 0.50 N 
5 1 NE B ARG 28  ? ? CZ B ARG 28  ? ? NH1 B ARG 28  ? ? 123.66 120.30 3.36  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 48  ? ? -39.00  103.62  
2 1 ASP A 48  ? ? -26.77  103.62  
3 1 ASP A 104 ? ? -165.71 112.01  
4 1 SER A 158 ? ? -140.20 -159.97 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      B 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2093 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.01 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY -1  ? A GLY 1   
2 1 Y 1 A TYR 168 ? A TYR 170 
3 1 Y 1 A ASP 169 ? A ASP 171 
4 1 Y 1 A THR 170 ? A THR 172 
5 1 Y 1 A ASP 171 ? A ASP 173 
6 1 Y 1 B GLY -1  ? B GLY 1   
7 1 Y 1 B ASP 169 ? B ASP 171 
8 1 Y 1 B THR 170 ? B THR 172 
9 1 Y 1 B ASP 171 ? B ASP 173 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL GOL 
3 water    HOH 
#