data_4CKG
# 
_entry.id   4CKG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.302 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4CKG         
PDBE  EBI-59321    
WWPDB D_1290059321 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  4CKH     unspecified            
'HELICAL RECONSTRUCTION OF ACAP1(BAR-PH DOMAIN) DECORATED MEMBRANE TUBULES BY CRYO-ELECTRON MICROSCOPY' 
EMDB EMD-2546 'associated EM volume' 
'HELICAL RECONSTRUCTION OF ACAP1(BAR-PH DOMAIN) DECORATED MEMBRANE TUBULES BY CRYO-ELECTRON MICROSCOPY' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4CKG 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2014-01-06 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pang, X.Y.' 1  
'Fan, J.'    2  
'Zhang, Y.'  3  
'Zhang, K.'  4  
'Gao, B.Q.'  5  
'Ma, J.'     6  
'Li, J.'     7  
'Deng, Y.C.' 8  
'Zhou, Q.J.' 9  
'Hsu, V.'    10 
'Sun, F.'    11 
# 
_citation.id                        primary 
_citation.title                     
'A Ph Domain in Acap1 Possesses Key Features of the Bar Domain in Promoting Membrane Curvature.' 
_citation.journal_abbrev            Dev.Cell 
_citation.journal_volume            31 
_citation.page_first                73 
_citation.page_last                 ? 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1534-5807 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25284369 
_citation.pdbx_database_id_DOI      10.1016/J.DEVCEL.2014.08.020 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pang, X.'      1  ? 
primary 'Fan, J.'       2  ? 
primary 'Zhang, Y.'     3  ? 
primary 'Zhang, K.'     4  ? 
primary 'Gao, B.'       5  ? 
primary 'Ma, J.'        6  ? 
primary 'Li, J.'        7  ? 
primary 'Deng, Y.'      8  ? 
primary 'Zhou, Q.'      9  ? 
primary 'Egelman, E.H.' 10 ? 
primary 'Hsu, V.W.'     11 ? 
primary 'Sun, F.'       12 ? 
# 
_cell.entry_id           4CKG 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4CKG 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'ARF-GAP WITH COILED-COIL, ANK REPEAT AND PH DOMAIN-CONTAINING PROTEIN 1' 
_entity.formula_weight             43334.348 
_entity.pdbx_number_of_molecules   4 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'BAR-PH DOMAIN, RESIDUES 1-377' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CENTAURIN-BETA-1, CNT-B1, BAR-PH DOMAIN OF ACAP1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSMTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTGLLESGRHYLAASRAFVVGICDLARLGPPEPM
MAECLEKFTVSLNHKLDSHAELLDATQHTLQQQIQTLVKEGLRGFREARRDFWRGAESLEAALTHNAEVPRRRAQEAEEA
GAALRTARAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREK
RDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKKYKDPVTVVVDDLRLC
TVKLCPDSERRFCFEVVSTSKSCLLQADSERLLQLWVSAVQSSIASAFSQARLDDSPRGPGQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSMTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTGLLESGRHYLAASRAFVVGICDLARLGPPEPM
MAECLEKFTVSLNHKLDSHAELLDATQHTLQQQIQTLVKEGLRGFREARRDFWRGAESLEAALTHNAEVPRRRAQEAEEA
GAALRTARAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREK
RDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKKYKDPVTVVVDDLRLC
TVKLCPDSERRFCFEVVSTSKSCLLQADSERLLQLWVSAVQSSIASAFSQARLDDSPRGPGQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   MET n 
1 7   THR n 
1 8   VAL n 
1 9   LYS n 
1 10  LEU n 
1 11  ASP n 
1 12  PHE n 
1 13  GLU n 
1 14  GLU n 
1 15  CYS n 
1 16  LEU n 
1 17  LYS n 
1 18  ASP n 
1 19  SER n 
1 20  PRO n 
1 21  ARG n 
1 22  PHE n 
1 23  ARG n 
1 24  ALA n 
1 25  SER n 
1 26  ILE n 
1 27  GLU n 
1 28  LEU n 
1 29  VAL n 
1 30  GLU n 
1 31  ALA n 
1 32  GLU n 
1 33  VAL n 
1 34  SER n 
1 35  GLU n 
1 36  LEU n 
1 37  GLU n 
1 38  THR n 
1 39  ARG n 
1 40  LEU n 
1 41  GLU n 
1 42  LYS n 
1 43  LEU n 
1 44  LEU n 
1 45  LYS n 
1 46  LEU n 
1 47  GLY n 
1 48  THR n 
1 49  GLY n 
1 50  LEU n 
1 51  LEU n 
1 52  GLU n 
1 53  SER n 
1 54  GLY n 
1 55  ARG n 
1 56  HIS n 
1 57  TYR n 
1 58  LEU n 
1 59  ALA n 
1 60  ALA n 
1 61  SER n 
1 62  ARG n 
1 63  ALA n 
1 64  PHE n 
1 65  VAL n 
1 66  VAL n 
1 67  GLY n 
1 68  ILE n 
1 69  CYS n 
1 70  ASP n 
1 71  LEU n 
1 72  ALA n 
1 73  ARG n 
1 74  LEU n 
1 75  GLY n 
1 76  PRO n 
1 77  PRO n 
1 78  GLU n 
1 79  PRO n 
1 80  MET n 
1 81  MET n 
1 82  ALA n 
1 83  GLU n 
1 84  CYS n 
1 85  LEU n 
1 86  GLU n 
1 87  LYS n 
1 88  PHE n 
1 89  THR n 
1 90  VAL n 
1 91  SER n 
1 92  LEU n 
1 93  ASN n 
1 94  HIS n 
1 95  LYS n 
1 96  LEU n 
1 97  ASP n 
1 98  SER n 
1 99  HIS n 
1 100 ALA n 
1 101 GLU n 
1 102 LEU n 
1 103 LEU n 
1 104 ASP n 
1 105 ALA n 
1 106 THR n 
1 107 GLN n 
1 108 HIS n 
1 109 THR n 
1 110 LEU n 
1 111 GLN n 
1 112 GLN n 
1 113 GLN n 
1 114 ILE n 
1 115 GLN n 
1 116 THR n 
1 117 LEU n 
1 118 VAL n 
1 119 LYS n 
1 120 GLU n 
1 121 GLY n 
1 122 LEU n 
1 123 ARG n 
1 124 GLY n 
1 125 PHE n 
1 126 ARG n 
1 127 GLU n 
1 128 ALA n 
1 129 ARG n 
1 130 ARG n 
1 131 ASP n 
1 132 PHE n 
1 133 TRP n 
1 134 ARG n 
1 135 GLY n 
1 136 ALA n 
1 137 GLU n 
1 138 SER n 
1 139 LEU n 
1 140 GLU n 
1 141 ALA n 
1 142 ALA n 
1 143 LEU n 
1 144 THR n 
1 145 HIS n 
1 146 ASN n 
1 147 ALA n 
1 148 GLU n 
1 149 VAL n 
1 150 PRO n 
1 151 ARG n 
1 152 ARG n 
1 153 ARG n 
1 154 ALA n 
1 155 GLN n 
1 156 GLU n 
1 157 ALA n 
1 158 GLU n 
1 159 GLU n 
1 160 ALA n 
1 161 GLY n 
1 162 ALA n 
1 163 ALA n 
1 164 LEU n 
1 165 ARG n 
1 166 THR n 
1 167 ALA n 
1 168 ARG n 
1 169 ALA n 
1 170 GLY n 
1 171 TYR n 
1 172 ARG n 
1 173 GLY n 
1 174 ARG n 
1 175 ALA n 
1 176 LEU n 
1 177 ASP n 
1 178 TYR n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 ILE n 
1 183 ASN n 
1 184 VAL n 
1 185 ILE n 
1 186 GLU n 
1 187 ASP n 
1 188 LYS n 
1 189 ARG n 
1 190 LYS n 
1 191 PHE n 
1 192 ASP n 
1 193 ILE n 
1 194 MET n 
1 195 GLU n 
1 196 PHE n 
1 197 VAL n 
1 198 LEU n 
1 199 ARG n 
1 200 LEU n 
1 201 VAL n 
1 202 GLU n 
1 203 ALA n 
1 204 GLN n 
1 205 ALA n 
1 206 THR n 
1 207 HIS n 
1 208 PHE n 
1 209 GLN n 
1 210 GLN n 
1 211 GLY n 
1 212 HIS n 
1 213 GLU n 
1 214 GLU n 
1 215 LEU n 
1 216 SER n 
1 217 ARG n 
1 218 LEU n 
1 219 SER n 
1 220 GLN n 
1 221 TYR n 
1 222 ARG n 
1 223 LYS n 
1 224 GLU n 
1 225 LEU n 
1 226 GLY n 
1 227 ALA n 
1 228 GLN n 
1 229 LEU n 
1 230 HIS n 
1 231 GLN n 
1 232 LEU n 
1 233 VAL n 
1 234 LEU n 
1 235 ASN n 
1 236 SER n 
1 237 ALA n 
1 238 ARG n 
1 239 GLU n 
1 240 LYS n 
1 241 ARG n 
1 242 ASP n 
1 243 MET n 
1 244 GLU n 
1 245 GLN n 
1 246 ARG n 
1 247 HIS n 
1 248 VAL n 
1 249 LEU n 
1 250 LEU n 
1 251 LYS n 
1 252 GLN n 
1 253 LYS n 
1 254 GLU n 
1 255 LEU n 
1 256 GLY n 
1 257 GLY n 
1 258 GLU n 
1 259 GLU n 
1 260 PRO n 
1 261 GLU n 
1 262 PRO n 
1 263 SER n 
1 264 LEU n 
1 265 ARG n 
1 266 GLU n 
1 267 GLY n 
1 268 PRO n 
1 269 GLY n 
1 270 GLY n 
1 271 LEU n 
1 272 VAL n 
1 273 MET n 
1 274 GLU n 
1 275 GLY n 
1 276 HIS n 
1 277 LEU n 
1 278 PHE n 
1 279 LYS n 
1 280 ARG n 
1 281 ALA n 
1 282 SER n 
1 283 ASN n 
1 284 ALA n 
1 285 PHE n 
1 286 LYS n 
1 287 THR n 
1 288 TRP n 
1 289 SER n 
1 290 ARG n 
1 291 ARG n 
1 292 TRP n 
1 293 PHE n 
1 294 THR n 
1 295 ILE n 
1 296 GLN n 
1 297 SER n 
1 298 ASN n 
1 299 GLN n 
1 300 LEU n 
1 301 VAL n 
1 302 TYR n 
1 303 GLN n 
1 304 LYS n 
1 305 LYS n 
1 306 TYR n 
1 307 LYS n 
1 308 ASP n 
1 309 PRO n 
1 310 VAL n 
1 311 THR n 
1 312 VAL n 
1 313 VAL n 
1 314 VAL n 
1 315 ASP n 
1 316 ASP n 
1 317 LEU n 
1 318 ARG n 
1 319 LEU n 
1 320 CYS n 
1 321 THR n 
1 322 VAL n 
1 323 LYS n 
1 324 LEU n 
1 325 CYS n 
1 326 PRO n 
1 327 ASP n 
1 328 SER n 
1 329 GLU n 
1 330 ARG n 
1 331 ARG n 
1 332 PHE n 
1 333 CYS n 
1 334 PHE n 
1 335 GLU n 
1 336 VAL n 
1 337 VAL n 
1 338 SER n 
1 339 THR n 
1 340 SER n 
1 341 LYS n 
1 342 SER n 
1 343 CYS n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 ALA n 
1 348 ASP n 
1 349 SER n 
1 350 GLU n 
1 351 ARG n 
1 352 LEU n 
1 353 LEU n 
1 354 GLN n 
1 355 LEU n 
1 356 TRP n 
1 357 VAL n 
1 358 SER n 
1 359 ALA n 
1 360 VAL n 
1 361 GLN n 
1 362 SER n 
1 363 SER n 
1 364 ILE n 
1 365 ALA n 
1 366 SER n 
1 367 ALA n 
1 368 PHE n 
1 369 SER n 
1 370 GLN n 
1 371 ALA n 
1 372 ARG n 
1 373 LEU n 
1 374 ASP n 
1 375 ASP n 
1 376 SER n 
1 377 PRO n 
1 378 ARG n 
1 379 GLY n 
1 380 PRO n 
1 381 GLY n 
1 382 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEX-6P-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACAP1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q15027 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4CKG A 6 ? 382 ? Q15027 1 ? 377 ? 1 377 
2 1 4CKG B 6 ? 382 ? Q15027 1 ? 377 ? 1 377 
3 1 4CKG C 6 ? 382 ? Q15027 1 ? 377 ? 1 377 
4 1 4CKG D 6 ? 382 ? Q15027 1 ? 377 ? 1 377 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4CKG GLY A 1 ? UNP Q15027 ? ? 'expression tag' -4 1  
1 4CKG PRO A 2 ? UNP Q15027 ? ? 'expression tag' -3 2  
1 4CKG LEU A 3 ? UNP Q15027 ? ? 'expression tag' -2 3  
1 4CKG GLY A 4 ? UNP Q15027 ? ? 'expression tag' -1 4  
1 4CKG SER A 5 ? UNP Q15027 ? ? 'expression tag' 0  5  
2 4CKG GLY B 1 ? UNP Q15027 ? ? 'expression tag' -4 6  
2 4CKG PRO B 2 ? UNP Q15027 ? ? 'expression tag' -3 7  
2 4CKG LEU B 3 ? UNP Q15027 ? ? 'expression tag' -2 8  
2 4CKG GLY B 4 ? UNP Q15027 ? ? 'expression tag' -1 9  
2 4CKG SER B 5 ? UNP Q15027 ? ? 'expression tag' 0  10 
3 4CKG GLY C 1 ? UNP Q15027 ? ? 'expression tag' -4 11 
3 4CKG PRO C 2 ? UNP Q15027 ? ? 'expression tag' -3 12 
3 4CKG LEU C 3 ? UNP Q15027 ? ? 'expression tag' -2 13 
3 4CKG GLY C 4 ? UNP Q15027 ? ? 'expression tag' -1 14 
3 4CKG SER C 5 ? UNP Q15027 ? ? 'expression tag' 0  15 
4 4CKG GLY D 1 ? UNP Q15027 ? ? 'expression tag' -4 16 
4 4CKG PRO D 2 ? UNP Q15027 ? ? 'expression tag' -3 17 
4 4CKG LEU D 3 ? UNP Q15027 ? ? 'expression tag' -2 18 
4 4CKG GLY D 4 ? UNP Q15027 ? ? 'expression tag' -1 19 
4 4CKG SER D 5 ? UNP Q15027 ? ? 'expression tag' 0  20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4CKG 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 4CKG 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            12.00 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11682 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               11682 
_refine_hist.d_res_high                       12.00 
_refine_hist.d_res_low                        . 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1  given ? 1.000000  0.000000  0.000000 0.000000  1.000000  0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000   
2  given ? 0.735000  0.678100  0.000000 -0.678100 0.735000  0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 -23.19820 
3  given ? 0.735000  -0.678100 0.000000 0.678100  0.735000  0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 23.19820  
4  given ? -0.500000 -0.866600 0.000000 0.866600  -0.500000 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000   
5  given ? 0.220800  -0.975300 0.000000 0.975300  0.220800  0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 -23.19820 
6  given ? -0.954400 -0.298500 0.000000 0.298500  -0.954400 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 23.19820  
7  given ? -0.500000 0.865000  0.000000 -0.865000 -0.500000 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000   
8  given ? -0.955400 0.295500  0.000000 -0.295500 -0.955400 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 -23.19820 
9  given ? 0.217700  0.976000  0.000000 -0.976000 0.217700  0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 23.19820  
10 given ? 0.080400  -0.996800 0.000000 0.996800  0.080400  0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 46.39640  
# 
_struct.entry_id                  4CKG 
_struct.title                     
'Helical reconstruction of ACAP1(BAR-PH domain) decorated membrane tubules by cryo-electron microscopy' 
_struct.pdbx_descriptor           'ARF-GAP WITH COILED-COIL, ANK REPEAT AND PH DOMAIN-CONTAINING PROTEIN 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4CKG 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'SIGNALING PROTEIN, MEMBRANE REMODELING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET A 6   ? LEU A 10  ? MET A 1   LEU A 5   5 ? 5   
HELX_P HELX_P2  2  SER A 19  ? LEU A 74  ? SER A 14  LEU A 69  1 ? 56  
HELX_P HELX_P3  3  GLU A 78  ? GLN A 113 ? GLU A 73  GLN A 108 1 ? 36  
HELX_P HELX_P4  4  GLN A 113 ? LEU A 122 ? GLN A 108 LEU A 117 1 ? 10  
HELX_P HELX_P5  5  LEU A 122 ? VAL A 149 ? LEU A 117 VAL A 144 1 ? 28  
HELX_P HELX_P6  6  ARG A 153 ? GLU A 214 ? ARG A 148 GLU A 209 1 ? 62  
HELX_P HELX_P7  7  GLU A 214 ? GLU A 254 ? GLU A 209 GLU A 249 1 ? 41  
HELX_P HELX_P8  8  GLU A 266 ? LEU A 271 ? GLU A 261 LEU A 266 1 ? 6   
HELX_P HELX_P9  9  SER A 349 ? SER A 369 ? SER A 344 SER A 364 1 ? 21  
HELX_P HELX_P10 10 ASP B 11  ? ASP B 18  ? ASP B 6   ASP B 13  1 ? 8   
HELX_P HELX_P11 11 SER B 19  ? GLY B 75  ? SER B 14  GLY B 70  1 ? 57  
HELX_P HELX_P12 12 GLU B 78  ? GLU B 83  ? GLU B 73  GLU B 78  1 ? 6   
HELX_P HELX_P13 13 GLU B 83  ? GLY B 121 ? GLU B 78  GLY B 116 1 ? 39  
HELX_P HELX_P14 14 LEU B 122 ? GLU B 148 ? LEU B 117 GLU B 143 1 ? 27  
HELX_P HELX_P15 15 ALA B 154 ? GLU B 254 ? ALA B 149 GLU B 249 1 ? 101 
HELX_P HELX_P16 16 SER B 349 ? ALA B 365 ? SER B 344 ALA B 360 1 ? 17  
HELX_P HELX_P17 17 MET C 6   ? LEU C 10  ? MET C 1   LEU C 5   5 ? 5   
HELX_P HELX_P18 18 SER C 19  ? LEU C 74  ? SER C 14  LEU C 69  1 ? 56  
HELX_P HELX_P19 19 GLU C 78  ? GLN C 113 ? GLU C 73  GLN C 108 1 ? 36  
HELX_P HELX_P20 20 GLN C 113 ? LEU C 122 ? GLN C 108 LEU C 117 1 ? 10  
HELX_P HELX_P21 21 LEU C 122 ? VAL C 149 ? LEU C 117 VAL C 144 1 ? 28  
HELX_P HELX_P22 22 ARG C 153 ? GLU C 214 ? ARG C 148 GLU C 209 1 ? 62  
HELX_P HELX_P23 23 GLU C 214 ? GLU C 254 ? GLU C 209 GLU C 249 1 ? 41  
HELX_P HELX_P24 24 GLU C 266 ? LEU C 271 ? GLU C 261 LEU C 266 1 ? 6   
HELX_P HELX_P25 25 SER C 349 ? SER C 369 ? SER C 344 SER C 364 1 ? 21  
HELX_P HELX_P26 26 ASP D 11  ? ASP D 18  ? ASP D 6   ASP D 13  1 ? 8   
HELX_P HELX_P27 27 SER D 19  ? GLY D 75  ? SER D 14  GLY D 70  1 ? 57  
HELX_P HELX_P28 28 GLU D 78  ? GLU D 83  ? GLU D 73  GLU D 78  1 ? 6   
HELX_P HELX_P29 29 GLU D 83  ? GLY D 121 ? GLU D 78  GLY D 116 1 ? 39  
HELX_P HELX_P30 30 LEU D 122 ? GLU D 148 ? LEU D 117 GLU D 143 1 ? 27  
HELX_P HELX_P31 31 ALA D 154 ? GLU D 254 ? ALA D 149 GLU D 249 1 ? 101 
HELX_P HELX_P32 32 SER D 349 ? ALA D 365 ? SER D 344 ALA D 360 1 ? 17  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 7 ? 
BA ? 5 ? 
BB ? 3 ? 
CA ? 7 ? 
DA ? 5 ? 
DB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CA 4 5 ? anti-parallel 
CA 5 6 ? anti-parallel 
CA 6 7 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DA 4 5 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 THR A 311 ? VAL A 312 ? THR A 306 VAL A 307 
AA 2 GLN A 299 ? GLN A 303 ? GLN A 294 GLN A 298 
AA 3 SER A 289 ? GLN A 296 ? SER A 284 GLN A 291 
AA 4 MET A 273 ? ARG A 280 ? MET A 268 ARG A 275 
AA 5 CYS A 343 ? GLN A 346 ? CYS A 338 GLN A 341 
AA 6 CYS A 333 ? VAL A 337 ? CYS A 328 VAL A 332 
AA 7 THR A 321 ? LEU A 324 ? THR A 316 LEU A 319 
BA 1 ARG B 265 ? GLU B 266 ? ARG B 260 GLU B 261 
BA 2 LEU B 271 ? ARG B 280 ? LEU B 266 ARG B 275 
BA 3 TRP B 288 ? GLN B 296 ? TRP B 283 GLN B 291 
BA 4 GLN B 299 ? GLN B 303 ? GLN B 294 GLN B 298 
BA 5 THR B 311 ? VAL B 314 ? THR B 306 VAL B 309 
BB 1 THR B 321 ? LYS B 323 ? THR B 316 LYS B 318 
BB 2 CYS B 333 ? VAL B 337 ? CYS B 328 VAL B 332 
BB 3 SER B 342 ? GLN B 346 ? SER B 337 GLN B 341 
CA 1 THR C 311 ? VAL C 312 ? THR C 306 VAL C 307 
CA 2 GLN C 299 ? GLN C 303 ? GLN C 294 GLN C 298 
CA 3 SER C 289 ? GLN C 296 ? SER C 284 GLN C 291 
CA 4 MET C 273 ? ARG C 280 ? MET C 268 ARG C 275 
CA 5 CYS C 343 ? GLN C 346 ? CYS C 338 GLN C 341 
CA 6 CYS C 333 ? VAL C 337 ? CYS C 328 VAL C 332 
CA 7 THR C 321 ? LEU C 324 ? THR C 316 LEU C 319 
DA 1 ARG D 265 ? GLU D 266 ? ARG D 260 GLU D 261 
DA 2 LEU D 271 ? ARG D 280 ? LEU D 266 ARG D 275 
DA 3 TRP D 288 ? GLN D 296 ? TRP D 283 GLN D 291 
DA 4 GLN D 299 ? GLN D 303 ? GLN D 294 GLN D 298 
DA 5 THR D 311 ? VAL D 314 ? THR D 306 VAL D 309 
DB 1 THR D 321 ? LYS D 323 ? THR D 316 LYS D 318 
DB 2 CYS D 333 ? VAL D 337 ? CYS D 328 VAL D 332 
DB 3 SER D 342 ? GLN D 346 ? SER D 337 GLN D 341 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N THR A 311 ? N THR A 306 O TYR A 302 ? O TYR A 297 
AA 2 3 N GLN A 303 ? N GLN A 298 O TRP A 292 ? O TRP A 287 
AA 3 4 N ILE A 295 ? N ILE A 290 O MET A 273 ? O MET A 268 
AA 4 5 N ARG A 280 ? N ARG A 275 O LEU A 344 ? O LEU A 339 
AA 5 6 N LEU A 345 ? N LEU A 340 O PHE A 334 ? O PHE A 329 
AA 6 7 N VAL A 337 ? N VAL A 332 O THR A 321 ? O THR A 316 
BA 1 2 N ARG B 265 ? N ARG B 260 O VAL B 272 ? O VAL B 267 
BA 2 3 N LYS B 279 ? N LYS B 274 O SER B 289 ? O SER B 284 
BA 3 4 N GLN B 296 ? N GLN B 291 O GLN B 299 ? O GLN B 294 
BA 4 5 N TYR B 302 ? N TYR B 297 O THR B 311 ? O THR B 306 
BB 1 2 N LYS B 323 ? N LYS B 318 O GLU B 335 ? O GLU B 330 
BB 2 3 N VAL B 336 ? N VAL B 331 O CYS B 343 ? O CYS B 338 
CA 1 2 N THR C 311 ? N THR C 306 O TYR C 302 ? O TYR C 297 
CA 2 3 N GLN C 303 ? N GLN C 298 O TRP C 292 ? O TRP C 287 
CA 3 4 N ILE C 295 ? N ILE C 290 O MET C 273 ? O MET C 268 
CA 4 5 N ARG C 280 ? N ARG C 275 O LEU C 344 ? O LEU C 339 
CA 5 6 N LEU C 345 ? N LEU C 340 O PHE C 334 ? O PHE C 329 
CA 6 7 N VAL C 337 ? N VAL C 332 O THR C 321 ? O THR C 316 
DA 1 2 N ARG D 265 ? N ARG D 260 O VAL D 272 ? O VAL D 267 
DA 2 3 N LYS D 279 ? N LYS D 274 O SER D 289 ? O SER D 284 
DA 3 4 N GLN D 296 ? N GLN D 291 O GLN D 299 ? O GLN D 294 
DA 4 5 N TYR D 302 ? N TYR D 297 O THR D 311 ? O THR D 306 
DB 1 2 N LYS D 323 ? N LYS D 318 O GLU D 335 ? O GLU D 330 
DB 2 3 N VAL D 336 ? N VAL D 331 O CYS D 343 ? O CYS D 338 
# 
_database_PDB_matrix.entry_id          4CKG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4CKG 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . PRO A 1 2   ? -44.509  203.520 -2.141  1.00 0.00 ? -3  PRO A N   1 
ATOM 2     C CA  . PRO A 1 2   ? -45.801  203.066 -2.773  1.00 0.00 ? -3  PRO A CA  1 
ATOM 3     C C   . PRO A 1 2   ? -46.123  201.597 -2.452  1.00 0.00 ? -3  PRO A C   1 
ATOM 4     O O   . PRO A 1 2   ? -45.434  201.059 -1.616  1.00 0.00 ? -3  PRO A O   1 
ATOM 5     C CB  . PRO A 1 2   ? -45.599  203.384 -4.286  1.00 0.00 ? -3  PRO A CB  1 
ATOM 6     C CG  . PRO A 1 2   ? -44.794  204.692 -4.151  1.00 0.00 ? -3  PRO A CG  1 
ATOM 7     C CD  . PRO A 1 2   ? -43.824  204.521 -2.995  1.00 0.00 ? -3  PRO A CD  1 
ATOM 8     N N   . LEU A 1 3   ? -47.143  201.015 -3.044  1.00 0.00 ? -2  LEU A N   1 
ATOM 9     C CA  . LEU A 1 3   ? -47.703  199.812 -2.578  1.00 0.00 ? -2  LEU A CA  1 
ATOM 10    C C   . LEU A 1 3   ? -47.348  198.607 -3.448  1.00 0.00 ? -2  LEU A C   1 
ATOM 11    O O   . LEU A 1 3   ? -47.754  197.495 -3.091  1.00 0.00 ? -2  LEU A O   1 
ATOM 12    C CB  . LEU A 1 3   ? -49.235  200.152 -2.565  1.00 0.00 ? -2  LEU A CB  1 
ATOM 13    C CG  . LEU A 1 3   ? -50.156  199.095 -2.018  1.00 0.00 ? -2  LEU A CG  1 
ATOM 14    C CD1 . LEU A 1 3   ? -49.929  198.873 -0.481  1.00 0.00 ? -2  LEU A CD1 1 
ATOM 15    C CD2 . LEU A 1 3   ? -51.618  199.441 -2.322  1.00 0.00 ? -2  LEU A CD2 1 
ATOM 16    N N   . GLY A 1 4   ? -46.597  198.745 -4.562  1.00 0.00 ? -1  GLY A N   1 
ATOM 17    C CA  . GLY A 1 4   ? -46.272  197.653 -5.456  1.00 0.00 ? -1  GLY A CA  1 
ATOM 18    C C   . GLY A 1 4   ? -45.456  196.471 -4.900  1.00 0.00 ? -1  GLY A C   1 
ATOM 19    O O   . GLY A 1 4   ? -44.584  196.568 -4.082  1.00 0.00 ? -1  GLY A O   1 
ATOM 20    N N   . SER A 1 5   ? -45.673  195.267 -5.439  1.00 0.00 ? 0   SER A N   1 
ATOM 21    C CA  . SER A 1 5   ? -45.084  194.049 -4.808  1.00 0.00 ? 0   SER A CA  1 
ATOM 22    C C   . SER A 1 5   ? -43.591  194.010 -5.009  1.00 0.00 ? 0   SER A C   1 
ATOM 23    O O   . SER A 1 5   ? -42.834  193.708 -4.122  1.00 0.00 ? 0   SER A O   1 
ATOM 24    C CB  . SER A 1 5   ? -45.812  192.677 -5.127  1.00 0.00 ? 0   SER A CB  1 
ATOM 25    O OG  . SER A 1 5   ? -45.274  191.435 -4.590  1.00 0.00 ? 0   SER A OG  1 
ATOM 26    N N   . MET A 1 6   ? -43.070  194.336 -6.226  1.00 0.00 ? 1   MET A N   1 
ATOM 27    C CA  . MET A 1 6   ? -41.645  194.460 -6.383  1.00 0.00 ? 1   MET A CA  1 
ATOM 28    C C   . MET A 1 6   ? -41.086  195.748 -5.907  1.00 0.00 ? 1   MET A C   1 
ATOM 29    O O   . MET A 1 6   ? -39.918  195.826 -5.588  1.00 0.00 ? 1   MET A O   1 
ATOM 30    C CB  . MET A 1 6   ? -41.323  194.213 -7.898  1.00 0.00 ? 1   MET A CB  1 
ATOM 31    C CG  . MET A 1 6   ? -41.614  192.802 -8.293  1.00 0.00 ? 1   MET A CG  1 
ATOM 32    S SD  . MET A 1 6   ? -41.111  192.438 -10.027 1.00 0.00 ? 1   MET A SD  1 
ATOM 33    C CE  . MET A 1 6   ? -41.723  190.750 -10.437 1.00 0.00 ? 1   MET A CE  1 
ATOM 34    N N   . THR A 1 7   ? -41.899  196.773 -5.784  1.00 0.00 ? 2   THR A N   1 
ATOM 35    C CA  . THR A 1 7   ? -41.495  198.114 -5.304  1.00 0.00 ? 2   THR A CA  1 
ATOM 36    C C   . THR A 1 7   ? -41.039  198.041 -3.878  1.00 0.00 ? 2   THR A C   1 
ATOM 37    O O   . THR A 1 7   ? -39.964  198.558 -3.490  1.00 0.00 ? 2   THR A O   1 
ATOM 38    C CB  . THR A 1 7   ? -42.534  199.251 -5.411  1.00 0.00 ? 2   THR A CB  1 
ATOM 39    O OG1 . THR A 1 7   ? -43.195  199.103 -6.691  1.00 0.00 ? 2   THR A OG1 1 
ATOM 40    C CG2 . THR A 1 7   ? -41.776  200.551 -5.497  1.00 0.00 ? 2   THR A CG2 1 
ATOM 41    N N   . VAL A 1 8   ? -41.813  197.334 -2.994  1.00 0.00 ? 3   VAL A N   1 
ATOM 42    C CA  . VAL A 1 8   ? -41.654  197.446 -1.585  1.00 0.00 ? 3   VAL A CA  1 
ATOM 43    C C   . VAL A 1 8   ? -40.542  196.531 -1.122  1.00 0.00 ? 3   VAL A C   1 
ATOM 44    O O   . VAL A 1 8   ? -40.215  196.514 0.036   1.00 0.00 ? 3   VAL A O   1 
ATOM 45    C CB  . VAL A 1 8   ? -42.912  197.059 -0.869  1.00 0.00 ? 3   VAL A CB  1 
ATOM 46    C CG1 . VAL A 1 8   ? -44.056  198.035 -1.292  1.00 0.00 ? 3   VAL A CG1 1 
ATOM 47    C CG2 . VAL A 1 8   ? -43.399  195.537 -1.141  1.00 0.00 ? 3   VAL A CG2 1 
ATOM 48    N N   . LYS A 1 9   ? -39.854  195.736 -1.980  1.00 0.00 ? 4   LYS A N   1 
ATOM 49    C CA  . LYS A 1 9   ? -38.816  194.837 -1.637  1.00 0.00 ? 4   LYS A CA  1 
ATOM 50    C C   . LYS A 1 9   ? -37.603  195.032 -2.533  1.00 0.00 ? 4   LYS A C   1 
ATOM 51    O O   . LYS A 1 9   ? -36.674  194.243 -2.606  1.00 0.00 ? 4   LYS A O   1 
ATOM 52    C CB  . LYS A 1 9   ? -39.297  193.368 -1.683  1.00 0.00 ? 4   LYS A CB  1 
ATOM 53    C CG  . LYS A 1 9   ? -39.656  192.779 -3.095  1.00 0.00 ? 4   LYS A CG  1 
ATOM 54    C CD  . LYS A 1 9   ? -40.088  191.286 -3.189  1.00 0.00 ? 4   LYS A CD  1 
ATOM 55    C CE  . LYS A 1 9   ? -41.332  190.886 -2.296  1.00 0.00 ? 4   LYS A CE  1 
ATOM 56    N NZ  . LYS A 1 9   ? -42.610  191.212 -3.027  1.00 0.00 ? 4   LYS A NZ  1 
ATOM 57    N N   . LEU A 1 10  ? -37.591  196.213 -3.230  1.00 0.00 ? 5   LEU A N   1 
ATOM 58    C CA  . LEU A 1 10  ? -36.384  196.687 -3.933  1.00 0.00 ? 5   LEU A CA  1 
ATOM 59    C C   . LEU A 1 10  ? -35.904  198.028 -3.376  1.00 0.00 ? 5   LEU A C   1 
ATOM 60    O O   . LEU A 1 10  ? -36.813  198.807 -3.096  1.00 0.00 ? 5   LEU A O   1 
ATOM 61    C CB  . LEU A 1 10  ? -36.689  196.665 -5.474  1.00 0.00 ? 5   LEU A CB  1 
ATOM 62    C CG  . LEU A 1 10  ? -35.477  197.094 -6.423  1.00 0.00 ? 5   LEU A CG  1 
ATOM 63    C CD1 . LEU A 1 10  ? -34.997  198.572 -6.344  1.00 0.00 ? 5   LEU A CD1 1 
ATOM 64    C CD2 . LEU A 1 10  ? -34.298  196.043 -6.512  1.00 0.00 ? 5   LEU A CD2 1 
ATOM 65    N N   . ASP A 1 11  ? -34.582  198.188 -3.086  1.00 0.00 ? 6   ASP A N   1 
ATOM 66    C CA  . ASP A 1 11  ? -34.114  199.355 -2.413  1.00 0.00 ? 6   ASP A CA  1 
ATOM 67    C C   . ASP A 1 11  ? -33.538  200.331 -3.481  1.00 0.00 ? 6   ASP A C   1 
ATOM 68    O O   . ASP A 1 11  ? -32.400  200.248 -3.960  1.00 0.00 ? 6   ASP A O   1 
ATOM 69    C CB  . ASP A 1 11  ? -33.064  198.985 -1.349  1.00 0.00 ? 6   ASP A CB  1 
ATOM 70    C CG  . ASP A 1 11  ? -33.762  198.363 -0.205  1.00 0.00 ? 6   ASP A CG  1 
ATOM 71    O OD1 . ASP A 1 11  ? -34.789  198.947 0.201   1.00 0.00 ? 6   ASP A OD1 1 
ATOM 72    O OD2 . ASP A 1 11  ? -33.365  197.364 0.431   1.00 0.00 ? 6   ASP A OD2 1 
ATOM 73    N N   . PHE A 1 12  ? -34.375  201.272 -3.914  1.00 0.00 ? 7   PHE A N   1 
ATOM 74    C CA  . PHE A 1 12  ? -34.022  202.397 -4.761  1.00 0.00 ? 7   PHE A CA  1 
ATOM 75    C C   . PHE A 1 12  ? -32.947  203.214 -4.101  1.00 0.00 ? 7   PHE A C   1 
ATOM 76    O O   . PHE A 1 12  ? -31.998  203.647 -4.747  1.00 0.00 ? 7   PHE A O   1 
ATOM 77    C CB  . PHE A 1 12  ? -35.369  203.155 -4.940  1.00 0.00 ? 7   PHE A CB  1 
ATOM 78    C CG  . PHE A 1 12  ? -36.342  202.406 -5.731  1.00 0.00 ? 7   PHE A CG  1 
ATOM 79    C CD1 . PHE A 1 12  ? -35.978  202.232 -7.108  1.00 0.00 ? 7   PHE A CD1 1 
ATOM 80    C CD2 . PHE A 1 12  ? -37.410  201.662 -5.182  1.00 0.00 ? 7   PHE A CD2 1 
ATOM 81    C CE1 . PHE A 1 12  ? -36.772  201.456 -7.970  1.00 0.00 ? 7   PHE A CE1 1 
ATOM 82    C CE2 . PHE A 1 12  ? -38.254  200.882 -6.032  1.00 0.00 ? 7   PHE A CE2 1 
ATOM 83    C CZ  . PHE A 1 12  ? -37.860  200.821 -7.379  1.00 0.00 ? 7   PHE A CZ  1 
ATOM 84    N N   . GLU A 1 13  ? -33.064  203.449 -2.772  1.00 0.00 ? 8   GLU A N   1 
ATOM 85    C CA  . GLU A 1 13  ? -32.287  204.304 -1.932  1.00 0.00 ? 8   GLU A CA  1 
ATOM 86    C C   . GLU A 1 13  ? -30.799  203.888 -1.828  1.00 0.00 ? 8   GLU A C   1 
ATOM 87    O O   . GLU A 1 13  ? -29.900  204.707 -1.783  1.00 0.00 ? 8   GLU A O   1 
ATOM 88    C CB  . GLU A 1 13  ? -32.863  204.560 -0.529  1.00 0.00 ? 8   GLU A CB  1 
ATOM 89    C CG  . GLU A 1 13  ? -32.818  203.451 0.459   1.00 0.00 ? 8   GLU A CG  1 
ATOM 90    C CD  . GLU A 1 13  ? -33.703  203.569 1.727   1.00 0.00 ? 8   GLU A CD  1 
ATOM 91    O OE1 . GLU A 1 13  ? -33.330  204.375 2.600   1.00 0.00 ? 8   GLU A OE1 1 
ATOM 92    O OE2 . GLU A 1 13  ? -34.687  202.836 1.803   1.00 0.00 ? 8   GLU A OE2 1 
ATOM 93    N N   . GLU A 1 14  ? -30.567  202.606 -1.917  1.00 0.00 ? 9   GLU A N   1 
ATOM 94    C CA  . GLU A 1 14  ? -29.190  202.089 -1.848  1.00 0.00 ? 9   GLU A CA  1 
ATOM 95    C C   . GLU A 1 14  ? -28.621  201.643 -3.255  1.00 0.00 ? 9   GLU A C   1 
ATOM 96    O O   . GLU A 1 14  ? -27.612  201.050 -3.405  1.00 0.00 ? 9   GLU A O   1 
ATOM 97    C CB  . GLU A 1 14  ? -29.200  200.780 -0.937  1.00 0.00 ? 9   GLU A CB  1 
ATOM 98    C CG  . GLU A 1 14  ? -29.779  200.870 0.519   1.00 0.00 ? 9   GLU A CG  1 
ATOM 99    C CD  . GLU A 1 14  ? -29.046  201.788 1.447   1.00 0.00 ? 9   GLU A CD  1 
ATOM 100   O OE1 . GLU A 1 14  ? -27.933  201.386 1.950   1.00 0.00 ? 9   GLU A OE1 1 
ATOM 101   O OE2 . GLU A 1 14  ? -29.482  202.980 1.638   1.00 0.00 ? 9   GLU A OE2 1 
ATOM 102   N N   . CYS A 1 15  ? -29.409  201.968 -4.288  1.00 0.00 ? 10  CYS A N   1 
ATOM 103   C CA  . CYS A 1 15  ? -29.155  201.518 -5.709  1.00 0.00 ? 10  CYS A CA  1 
ATOM 104   C C   . CYS A 1 15  ? -27.921  202.124 -6.373  1.00 0.00 ? 10  CYS A C   1 
ATOM 105   O O   . CYS A 1 15  ? -27.292  201.421 -7.087  1.00 0.00 ? 10  CYS A O   1 
ATOM 106   C CB  . CYS A 1 15  ? -30.411  201.729 -6.622  1.00 0.00 ? 10  CYS A CB  1 
ATOM 107   S SG  . CYS A 1 15  ? -30.464  200.960 -8.317  1.00 0.00 ? 10  CYS A SG  1 
ATOM 108   N N   . LEU A 1 16  ? -27.522  203.328 -6.126  1.00 0.00 ? 11  LEU A N   1 
ATOM 109   C CA  . LEU A 1 16  ? -26.157  203.839 -6.465  1.00 0.00 ? 11  LEU A CA  1 
ATOM 110   C C   . LEU A 1 16  ? -25.004  203.440 -5.497  1.00 0.00 ? 11  LEU A C   1 
ATOM 111   O O   . LEU A 1 16  ? -23.828  203.647 -5.754  1.00 0.00 ? 11  LEU A O   1 
ATOM 112   C CB  . LEU A 1 16  ? -26.310  205.414 -6.629  1.00 0.00 ? 11  LEU A CB  1 
ATOM 113   C CG  . LEU A 1 16  ? -27.279  205.899 -7.710  1.00 0.00 ? 11  LEU A CG  1 
ATOM 114   C CD1 . LEU A 1 16  ? -27.808  207.281 -7.593  1.00 0.00 ? 11  LEU A CD1 1 
ATOM 115   C CD2 . LEU A 1 16  ? -26.843  205.524 -9.114  1.00 0.00 ? 11  LEU A CD2 1 
ATOM 116   N N   . LYS A 1 17  ? -25.414  202.976 -4.280  1.00 0.00 ? 12  LYS A N   1 
ATOM 117   C CA  . LYS A 1 17  ? -24.569  202.914 -3.136  1.00 0.00 ? 12  LYS A CA  1 
ATOM 118   C C   . LYS A 1 17  ? -23.991  201.509 -2.865  1.00 0.00 ? 12  LYS A C   1 
ATOM 119   O O   . LYS A 1 17  ? -22.989  201.333 -2.164  1.00 0.00 ? 12  LYS A O   1 
ATOM 120   C CB  . LYS A 1 17  ? -25.230  203.378 -1.831  1.00 0.00 ? 12  LYS A CB  1 
ATOM 121   C CG  . LYS A 1 17  ? -24.332  203.801 -0.642  1.00 0.00 ? 12  LYS A CG  1 
ATOM 122   C CD  . LYS A 1 17  ? -24.882  203.228 0.684   1.00 0.00 ? 12  LYS A CD  1 
ATOM 123   C CE  . LYS A 1 17  ? -26.105  203.980 1.279   1.00 0.00 ? 12  LYS A CE  1 
ATOM 124   N NZ  . LYS A 1 17  ? -26.383  203.429 2.591   1.00 0.00 ? 12  LYS A NZ  1 
ATOM 125   N N   . ASP A 1 18  ? -24.500  200.460 -3.433  1.00 0.00 ? 13  ASP A N   1 
ATOM 126   C CA  . ASP A 1 18  ? -24.009  199.116 -3.483  1.00 0.00 ? 13  ASP A CA  1 
ATOM 127   C C   . ASP A 1 18  ? -23.808  198.497 -2.081  1.00 0.00 ? 13  ASP A C   1 
ATOM 128   O O   . ASP A 1 18  ? -22.728  197.963 -1.787  1.00 0.00 ? 13  ASP A O   1 
ATOM 129   C CB  . ASP A 1 18  ? -22.894  199.079 -4.473  1.00 0.00 ? 13  ASP A CB  1 
ATOM 130   C CG  . ASP A 1 18  ? -22.521  197.652 -4.790  1.00 0.00 ? 13  ASP A CG  1 
ATOM 131   O OD1 . ASP A 1 18  ? -23.246  196.943 -5.504  1.00 0.00 ? 13  ASP A OD1 1 
ATOM 132   O OD2 . ASP A 1 18  ? -21.443  197.192 -4.339  1.00 0.00 ? 13  ASP A OD2 1 
ATOM 133   N N   . SER A 1 19  ? -24.738  198.533 -1.152  1.00 0.00 ? 14  SER A N   1 
ATOM 134   C CA  . SER A 1 19  ? -24.608  197.815 0.130   1.00 0.00 ? 14  SER A CA  1 
ATOM 135   C C   . SER A 1 19  ? -25.027  196.393 -0.042  1.00 0.00 ? 14  SER A C   1 
ATOM 136   O O   . SER A 1 19  ? -25.536  195.960 -1.092  1.00 0.00 ? 14  SER A O   1 
ATOM 137   C CB  . SER A 1 19  ? -25.599  198.514 1.125   1.00 0.00 ? 14  SER A CB  1 
ATOM 138   O OG  . SER A 1 19  ? -26.860  198.648 0.611   1.00 0.00 ? 14  SER A OG  1 
ATOM 139   N N   . PRO A 1 20  ? -24.596  195.523 0.880   1.00 0.00 ? 15  PRO A N   1 
ATOM 140   C CA  . PRO A 1 20  ? -25.166  194.174 1.020   1.00 0.00 ? 15  PRO A CA  1 
ATOM 141   C C   . PRO A 1 20  ? -26.628  194.002 1.084   1.00 0.00 ? 15  PRO A C   1 
ATOM 142   O O   . PRO A 1 20  ? -27.126  192.964 0.592   1.00 0.00 ? 15  PRO A O   1 
ATOM 143   C CB  . PRO A 1 20  ? -24.369  193.601 2.200   1.00 0.00 ? 15  PRO A CB  1 
ATOM 144   C CG  . PRO A 1 20  ? -22.983  194.296 2.104   1.00 0.00 ? 15  PRO A CG  1 
ATOM 145   C CD  . PRO A 1 20  ? -23.427  195.785 1.845   1.00 0.00 ? 15  PRO A CD  1 
ATOM 146   N N   . ARG A 1 21  ? -27.355  194.986 1.654   1.00 0.00 ? 16  ARG A N   1 
ATOM 147   C CA  . ARG A 1 21  ? -28.731  195.244 1.473   1.00 0.00 ? 16  ARG A CA  1 
ATOM 148   C C   . ARG A 1 21  ? -29.159  195.327 0.032   1.00 0.00 ? 16  ARG A C   1 
ATOM 149   O O   . ARG A 1 21  ? -30.104  194.702 -0.381  1.00 0.00 ? 16  ARG A O   1 
ATOM 150   C CB  . ARG A 1 21  ? -29.054  196.635 2.147   1.00 0.00 ? 16  ARG A CB  1 
ATOM 151   C CG  . ARG A 1 21  ? -30.447  197.163 1.913   1.00 0.00 ? 16  ARG A CG  1 
ATOM 152   C CD  . ARG A 1 21  ? -30.914  198.092 3.069   1.00 0.00 ? 16  ARG A CD  1 
ATOM 153   N NE  . ARG A 1 21  ? -32.146  198.733 2.578   1.00 0.00 ? 16  ARG A NE  1 
ATOM 154   C CZ  . ARG A 1 21  ? -32.700  199.879 3.041   1.00 0.00 ? 16  ARG A CZ  1 
ATOM 155   N NH1 . ARG A 1 21  ? -32.256  200.601 4.038   1.00 0.00 ? 16  ARG A NH1 1 
ATOM 156   N NH2 . ARG A 1 21  ? -33.856  200.260 2.502   1.00 0.00 ? 16  ARG A NH2 1 
ATOM 157   N N   . PHE A 1 22  ? -28.465  196.159 -0.799  1.00 0.00 ? 17  PHE A N   1 
ATOM 158   C CA  . PHE A 1 22  ? -28.812  196.329 -2.200  1.00 0.00 ? 17  PHE A CA  1 
ATOM 159   C C   . PHE A 1 22  ? -28.617  195.017 -2.964  1.00 0.00 ? 17  PHE A C   1 
ATOM 160   O O   . PHE A 1 22  ? -29.561  194.601 -3.658  1.00 0.00 ? 17  PHE A O   1 
ATOM 161   C CB  . PHE A 1 22  ? -28.054  197.562 -2.795  1.00 0.00 ? 17  PHE A CB  1 
ATOM 162   C CG  . PHE A 1 22  ? -28.565  197.812 -4.150  1.00 0.00 ? 17  PHE A CG  1 
ATOM 163   C CD1 . PHE A 1 22  ? -29.942  198.167 -4.329  1.00 0.00 ? 17  PHE A CD1 1 
ATOM 164   C CD2 . PHE A 1 22  ? -27.753  197.662 -5.289  1.00 0.00 ? 17  PHE A CD2 1 
ATOM 165   C CE1 . PHE A 1 22  ? -30.512  198.260 -5.638  1.00 0.00 ? 17  PHE A CE1 1 
ATOM 166   C CE2 . PHE A 1 22  ? -28.274  197.875 -6.577  1.00 0.00 ? 17  PHE A CE2 1 
ATOM 167   C CZ  . PHE A 1 22  ? -29.651  198.171 -6.736  1.00 0.00 ? 17  PHE A CZ  1 
ATOM 168   N N   . ARG A 1 23  ? -27.475  194.289 -2.729  1.00 0.00 ? 18  ARG A N   1 
ATOM 169   C CA  . ARG A 1 23  ? -27.223  192.983 -3.337  1.00 0.00 ? 18  ARG A CA  1 
ATOM 170   C C   . ARG A 1 23  ? -28.227  191.870 -2.995  1.00 0.00 ? 18  ARG A C   1 
ATOM 171   O O   . ARG A 1 23  ? -28.450  190.953 -3.812  1.00 0.00 ? 18  ARG A O   1 
ATOM 172   C CB  . ARG A 1 23  ? -25.779  192.701 -2.746  1.00 0.00 ? 18  ARG A CB  1 
ATOM 173   C CG  . ARG A 1 23  ? -24.625  193.569 -3.325  1.00 0.00 ? 18  ARG A CG  1 
ATOM 174   C CD  . ARG A 1 23  ? -24.232  193.396 -4.732  1.00 0.00 ? 18  ARG A CD  1 
ATOM 175   N NE  . ARG A 1 23  ? -23.045  194.283 -5.032  1.00 0.00 ? 18  ARG A NE  1 
ATOM 176   C CZ  . ARG A 1 23  ? -21.857  193.806 -5.406  1.00 0.00 ? 18  ARG A CZ  1 
ATOM 177   N NH1 . ARG A 1 23  ? -21.560  192.524 -5.544  1.00 0.00 ? 18  ARG A NH1 1 
ATOM 178   N NH2 . ARG A 1 23  ? -21.017  194.729 -5.715  1.00 0.00 ? 18  ARG A NH2 1 
ATOM 179   N N   . ALA A 1 24  ? -28.672  191.932 -1.730  1.00 0.00 ? 19  ALA A N   1 
ATOM 180   C CA  . ALA A 1 24  ? -29.832  191.207 -1.178  1.00 0.00 ? 19  ALA A CA  1 
ATOM 181   C C   . ALA A 1 24  ? -31.156  191.592 -1.833  1.00 0.00 ? 19  ALA A C   1 
ATOM 182   O O   . ALA A 1 24  ? -31.877  190.696 -2.285  1.00 0.00 ? 19  ALA A O   1 
ATOM 183   C CB  . ALA A 1 24  ? -29.858  191.287 0.333   1.00 0.00 ? 19  ALA A CB  1 
ATOM 184   N N   . SER A 1 25  ? -31.468  192.911 -2.126  1.00 0.00 ? 20  SER A N   1 
ATOM 185   C CA  . SER A 1 25  ? -32.727  193.245 -2.764  1.00 0.00 ? 20  SER A CA  1 
ATOM 186   C C   . SER A 1 25  ? -32.823  192.726 -4.233  1.00 0.00 ? 20  SER A C   1 
ATOM 187   O O   . SER A 1 25  ? -33.811  192.099 -4.648  1.00 0.00 ? 20  SER A O   1 
ATOM 188   C CB  . SER A 1 25  ? -33.205  194.753 -2.762  1.00 0.00 ? 20  SER A CB  1 
ATOM 189   O OG  . SER A 1 25  ? -32.352  195.597 -3.530  1.00 0.00 ? 20  SER A OG  1 
ATOM 190   N N   . ILE A 1 26  ? -31.696  192.914 -5.019  1.00 0.00 ? 21  ILE A N   1 
ATOM 191   C CA  . ILE A 1 26  ? -31.486  192.445 -6.447  1.00 0.00 ? 21  ILE A CA  1 
ATOM 192   C C   . ILE A 1 26  ? -31.706  190.986 -6.606  1.00 0.00 ? 21  ILE A C   1 
ATOM 193   O O   . ILE A 1 26  ? -32.350  190.492 -7.554  1.00 0.00 ? 21  ILE A O   1 
ATOM 194   C CB  . ILE A 1 26  ? -30.242  192.902 -7.176  1.00 0.00 ? 21  ILE A CB  1 
ATOM 195   C CG1 . ILE A 1 26  ? -28.928  192.242 -6.579  1.00 0.00 ? 21  ILE A CG1 1 
ATOM 196   C CG2 . ILE A 1 26  ? -30.246  194.391 -6.930  1.00 0.00 ? 21  ILE A CG2 1 
ATOM 197   C CD1 . ILE A 1 26  ? -27.681  192.920 -7.148  1.00 0.00 ? 21  ILE A CD1 1 
ATOM 198   N N   . GLU A 1 27  ? -31.213  190.227 -5.566  1.00 0.00 ? 22  GLU A N   1 
ATOM 199   C CA  . GLU A 1 27  ? -31.461  188.815 -5.444  1.00 0.00 ? 22  GLU A CA  1 
ATOM 200   C C   . GLU A 1 27  ? -32.865  188.395 -5.040  1.00 0.00 ? 22  GLU A C   1 
ATOM 201   O O   . GLU A 1 27  ? -33.479  187.542 -5.673  1.00 0.00 ? 22  GLU A O   1 
ATOM 202   C CB  . GLU A 1 27  ? -30.513  188.278 -4.376  1.00 0.00 ? 22  GLU A CB  1 
ATOM 203   C CG  . GLU A 1 27  ? -30.471  186.775 -4.142  1.00 0.00 ? 22  GLU A CG  1 
ATOM 204   C CD  . GLU A 1 27  ? -29.375  186.349 -3.192  1.00 0.00 ? 22  GLU A CD  1 
ATOM 205   O OE1 . GLU A 1 27  ? -28.192  186.740 -3.505  1.00 0.00 ? 22  GLU A OE1 1 
ATOM 206   O OE2 . GLU A 1 27  ? -29.647  185.787 -2.139  1.00 0.00 ? 22  GLU A OE2 1 
ATOM 207   N N   . LEU A 1 28  ? -33.452  189.079 -4.021  1.00 0.00 ? 23  LEU A N   1 
ATOM 208   C CA  . LEU A 1 28  ? -34.762  188.903 -3.446  1.00 0.00 ? 23  LEU A CA  1 
ATOM 209   C C   . LEU A 1 28  ? -35.919  189.156 -4.370  1.00 0.00 ? 23  LEU A C   1 
ATOM 210   O O   . LEU A 1 28  ? -36.863  188.350 -4.462  1.00 0.00 ? 23  LEU A O   1 
ATOM 211   C CB  . LEU A 1 28  ? -34.843  189.878 -2.232  1.00 0.00 ? 23  LEU A CB  1 
ATOM 212   C CG  . LEU A 1 28  ? -36.060  189.721 -1.415  1.00 0.00 ? 23  LEU A CG  1 
ATOM 213   C CD1 . LEU A 1 28  ? -36.063  188.380 -0.830  1.00 0.00 ? 23  LEU A CD1 1 
ATOM 214   C CD2 . LEU A 1 28  ? -36.172  190.869 -0.342  1.00 0.00 ? 23  LEU A CD2 1 
ATOM 215   N N   . VAL A 1 29  ? -35.781  190.288 -5.169  1.00 0.00 ? 24  VAL A N   1 
ATOM 216   C CA  . VAL A 1 29  ? -36.783  190.692 -6.128  1.00 0.00 ? 24  VAL A CA  1 
ATOM 217   C C   . VAL A 1 29  ? -36.963  189.777 -7.315  1.00 0.00 ? 24  VAL A C   1 
ATOM 218   O O   . VAL A 1 29  ? -38.091  189.498 -7.770  1.00 0.00 ? 24  VAL A O   1 
ATOM 219   C CB  . VAL A 1 29  ? -36.572  192.202 -6.507  1.00 0.00 ? 24  VAL A CB  1 
ATOM 220   C CG1 . VAL A 1 29  ? -35.706  192.444 -7.714  1.00 0.00 ? 24  VAL A CG1 1 
ATOM 221   C CG2 . VAL A 1 29  ? -37.895  192.811 -6.870  1.00 0.00 ? 24  VAL A CG2 1 
ATOM 222   N N   . GLU A 1 30  ? -35.872  189.153 -7.725  1.00 0.00 ? 25  GLU A N   1 
ATOM 223   C CA  . GLU A 1 30  ? -35.724  188.172 -8.791  1.00 0.00 ? 25  GLU A CA  1 
ATOM 224   C C   . GLU A 1 30  ? -36.580  186.881 -8.606  1.00 0.00 ? 25  GLU A C   1 
ATOM 225   O O   . GLU A 1 30  ? -37.040  186.258 -9.517  1.00 0.00 ? 25  GLU A O   1 
ATOM 226   C CB  . GLU A 1 30  ? -34.235  187.970 -9.037  1.00 0.00 ? 25  GLU A CB  1 
ATOM 227   C CG  . GLU A 1 30  ? -34.034  187.065 -10.268 1.00 0.00 ? 25  GLU A CG  1 
ATOM 228   C CD  . GLU A 1 30  ? -32.761  187.296 -11.040 1.00 0.00 ? 25  GLU A CD  1 
ATOM 229   O OE1 . GLU A 1 30  ? -31.723  187.284 -10.322 1.00 0.00 ? 25  GLU A OE1 1 
ATOM 230   O OE2 . GLU A 1 30  ? -32.704  187.506 -12.284 1.00 0.00 ? 25  GLU A OE2 1 
ATOM 231   N N   . ALA A 1 31  ? -36.809  186.537 -7.325  1.00 0.00 ? 26  ALA A N   1 
ATOM 232   C CA  . ALA A 1 31  ? -37.473  185.287 -6.954  1.00 0.00 ? 26  ALA A CA  1 
ATOM 233   C C   . ALA A 1 31  ? -38.951  185.307 -7.367  1.00 0.00 ? 26  ALA A C   1 
ATOM 234   O O   . ALA A 1 31  ? -39.551  184.444 -7.950  1.00 0.00 ? 26  ALA A O   1 
ATOM 235   C CB  . ALA A 1 31  ? -37.388  185.169 -5.416  1.00 0.00 ? 26  ALA A CB  1 
ATOM 236   N N   . GLU A 1 32  ? -39.543  186.549 -7.257  1.00 0.00 ? 27  GLU A N   1 
ATOM 237   C CA  . GLU A 1 32  ? -40.856  186.950 -7.747  1.00 0.00 ? 27  GLU A CA  1 
ATOM 238   C C   . GLU A 1 32  ? -40.889  186.980 -9.228  1.00 0.00 ? 27  GLU A C   1 
ATOM 239   O O   . GLU A 1 32  ? -41.905  186.604 -9.832  1.00 0.00 ? 27  GLU A O   1 
ATOM 240   C CB  . GLU A 1 32  ? -41.285  188.220 -7.032  1.00 0.00 ? 27  GLU A CB  1 
ATOM 241   C CG  . GLU A 1 32  ? -42.797  188.402 -7.344  1.00 0.00 ? 27  GLU A CG  1 
ATOM 242   C CD  . GLU A 1 32  ? -43.372  189.536 -6.458  1.00 0.00 ? 27  GLU A CD  1 
ATOM 243   O OE1 . GLU A 1 32  ? -42.872  189.732 -5.279  1.00 0.00 ? 27  GLU A OE1 1 
ATOM 244   O OE2 . GLU A 1 32  ? -44.358  190.174 -6.878  1.00 0.00 ? 27  GLU A OE2 1 
ATOM 245   N N   . VAL A 1 33  ? -39.840  187.444 -9.882  1.00 0.00 ? 28  VAL A N   1 
ATOM 246   C CA  . VAL A 1 33  ? -39.742  187.428 -11.341 1.00 0.00 ? 28  VAL A CA  1 
ATOM 247   C C   . VAL A 1 33  ? -39.878  186.033 -11.924 1.00 0.00 ? 28  VAL A C   1 
ATOM 248   O O   . VAL A 1 33  ? -40.653  185.821 -12.826 1.00 0.00 ? 28  VAL A O   1 
ATOM 249   C CB  . VAL A 1 33  ? -38.418  188.063 -11.828 1.00 0.00 ? 28  VAL A CB  1 
ATOM 250   C CG1 . VAL A 1 33  ? -38.327  187.995 -13.371 1.00 0.00 ? 28  VAL A CG1 1 
ATOM 251   C CG2 . VAL A 1 33  ? -38.510  189.481 -11.367 1.00 0.00 ? 28  VAL A CG2 1 
ATOM 252   N N   . SER A 1 34  ? -39.140  185.009 -11.370 1.00 0.00 ? 29  SER A N   1 
ATOM 253   C CA  . SER A 1 34  ? -39.210  183.585 -11.751 1.00 0.00 ? 29  SER A CA  1 
ATOM 254   C C   . SER A 1 34  ? -40.449  182.860 -11.443 1.00 0.00 ? 29  SER A C   1 
ATOM 255   O O   . SER A 1 34  ? -40.914  182.008 -12.189 1.00 0.00 ? 29  SER A O   1 
ATOM 256   C CB  . SER A 1 34  ? -38.076  182.799 -11.090 1.00 0.00 ? 29  SER A CB  1 
ATOM 257   O OG  . SER A 1 34  ? -36.854  183.314 -11.478 1.00 0.00 ? 29  SER A OG  1 
ATOM 258   N N   . GLU A 1 35  ? -40.997  183.340 -10.295 1.00 0.00 ? 30  GLU A N   1 
ATOM 259   C CA  . GLU A 1 35  ? -42.348  182.937 -9.852  1.00 0.00 ? 30  GLU A CA  1 
ATOM 260   C C   . GLU A 1 35  ? -43.486  183.271 -10.778 1.00 0.00 ? 30  GLU A C   1 
ATOM 261   O O   . GLU A 1 35  ? -44.206  182.368 -11.306 1.00 0.00 ? 30  GLU A O   1 
ATOM 262   C CB  . GLU A 1 35  ? -42.714  183.484 -8.446  1.00 0.00 ? 30  GLU A CB  1 
ATOM 263   C CG  . GLU A 1 35  ? -43.854  182.744 -7.713  1.00 0.00 ? 30  GLU A CG  1 
ATOM 264   C CD  . GLU A 1 35  ? -43.671  181.201 -7.674  1.00 0.00 ? 30  GLU A CD  1 
ATOM 265   O OE1 . GLU A 1 35  ? -42.495  180.674 -7.691  1.00 0.00 ? 30  GLU A OE1 1 
ATOM 266   O OE2 . GLU A 1 35  ? -44.668  180.467 -7.643  1.00 0.00 ? 30  GLU A OE2 1 
ATOM 267   N N   . LEU A 1 36  ? -43.502  184.593 -11.162 1.00 0.00 ? 31  LEU A N   1 
ATOM 268   C CA  . LEU A 1 36  ? -44.388  185.203 -12.091 1.00 0.00 ? 31  LEU A CA  1 
ATOM 269   C C   . LEU A 1 36  ? -44.308  184.605 -13.485 1.00 0.00 ? 31  LEU A C   1 
ATOM 270   O O   . LEU A 1 36  ? -45.363  184.272 -13.997 1.00 0.00 ? 31  LEU A O   1 
ATOM 271   C CB  . LEU A 1 36  ? -44.086  186.696 -12.095 1.00 0.00 ? 31  LEU A CB  1 
ATOM 272   C CG  . LEU A 1 36  ? -44.955  187.596 -13.042 1.00 0.00 ? 31  LEU A CG  1 
ATOM 273   C CD1 . LEU A 1 36  ? -46.488  187.554 -12.744 1.00 0.00 ? 31  LEU A CD1 1 
ATOM 274   C CD2 . LEU A 1 36  ? -44.451  189.045 -12.942 1.00 0.00 ? 31  LEU A CD2 1 
ATOM 275   N N   . GLU A 1 37  ? -43.211  184.330 -13.989 1.00 0.00 ? 32  GLU A N   1 
ATOM 276   C CA  . GLU A 1 37  ? -42.895  183.557 -15.280 1.00 0.00 ? 32  GLU A CA  1 
ATOM 277   C C   . GLU A 1 37  ? -43.332  182.093 -15.337 1.00 0.00 ? 32  GLU A C   1 
ATOM 278   O O   . GLU A 1 37  ? -43.814  181.647 -16.395 1.00 0.00 ? 32  GLU A O   1 
ATOM 279   C CB  . GLU A 1 37  ? -41.337  183.601 -15.522 1.00 0.00 ? 32  GLU A CB  1 
ATOM 280   C CG  . GLU A 1 37  ? -40.762  183.085 -16.857 1.00 0.00 ? 32  GLU A CG  1 
ATOM 281   C CD  . GLU A 1 37  ? -39.196  182.974 -17.032 1.00 0.00 ? 32  GLU A CD  1 
ATOM 282   O OE1 . GLU A 1 37  ? -38.519  182.795 -15.998 1.00 0.00 ? 32  GLU A OE1 1 
ATOM 283   O OE2 . GLU A 1 37  ? -38.698  182.997 -18.159 1.00 0.00 ? 32  GLU A OE2 1 
ATOM 284   N N   . THR A 1 38  ? -43.280  181.349 -14.183 1.00 0.00 ? 33  THR A N   1 
ATOM 285   C CA  . THR A 1 38  ? -43.805  179.948 -14.124 1.00 0.00 ? 33  THR A CA  1 
ATOM 286   C C   . THR A 1 38  ? -45.330  179.990 -14.083 1.00 0.00 ? 33  THR A C   1 
ATOM 287   O O   . THR A 1 38  ? -45.996  179.235 -14.740 1.00 0.00 ? 33  THR A O   1 
ATOM 288   C CB  . THR A 1 38  ? -43.258  179.184 -12.942 1.00 0.00 ? 33  THR A CB  1 
ATOM 289   O OG1 . THR A 1 38  ? -41.890  178.953 -13.249 1.00 0.00 ? 33  THR A OG1 1 
ATOM 290   C CG2 . THR A 1 38  ? -43.920  177.793 -12.736 1.00 0.00 ? 33  THR A CG2 1 
ATOM 291   N N   . ARG A 1 39  ? -45.919  181.004 -13.278 1.00 0.00 ? 34  ARG A N   1 
ATOM 292   C CA  . ARG A 1 39  ? -47.390  181.173 -13.197 1.00 0.00 ? 34  ARG A CA  1 
ATOM 293   C C   . ARG A 1 39  ? -48.004  181.588 -14.521 1.00 0.00 ? 34  ARG A C   1 
ATOM 294   O O   . ARG A 1 39  ? -48.990  181.010 -14.895 1.00 0.00 ? 34  ARG A O   1 
ATOM 295   C CB  . ARG A 1 39  ? -47.757  182.155 -12.098 1.00 0.00 ? 34  ARG A CB  1 
ATOM 296   C CG  . ARG A 1 39  ? -47.369  181.534 -10.766 1.00 0.00 ? 34  ARG A CG  1 
ATOM 297   C CD  . ARG A 1 39  ? -47.653  182.438 -9.540  1.00 0.00 ? 34  ARG A CD  1 
ATOM 298   N NE  . ARG A 1 39  ? -46.995  181.823 -8.377  1.00 0.00 ? 34  ARG A NE  1 
ATOM 299   C CZ  . ARG A 1 39  ? -47.234  182.254 -7.136  1.00 0.00 ? 34  ARG A CZ  1 
ATOM 300   N NH1 . ARG A 1 39  ? -48.216  183.043 -6.943  1.00 0.00 ? 34  ARG A NH1 1 
ATOM 301   N NH2 . ARG A 1 39  ? -46.373  182.003 -6.210  1.00 0.00 ? 34  ARG A NH2 1 
ATOM 302   N N   . LEU A 1 40  ? -47.334  182.483 -15.253 1.00 0.00 ? 35  LEU A N   1 
ATOM 303   C CA  . LEU A 1 40  ? -47.672  182.817 -16.691 1.00 0.00 ? 35  LEU A CA  1 
ATOM 304   C C   . LEU A 1 40  ? -47.642  181.614 -17.599 1.00 0.00 ? 35  LEU A C   1 
ATOM 305   O O   . LEU A 1 40  ? -48.552  181.418 -18.388 1.00 0.00 ? 35  LEU A O   1 
ATOM 306   C CB  . LEU A 1 40  ? -46.595  183.868 -17.339 1.00 0.00 ? 35  LEU A CB  1 
ATOM 307   C CG  . LEU A 1 40  ? -46.587  185.235 -16.714 1.00 0.00 ? 35  LEU A CG  1 
ATOM 308   C CD1 . LEU A 1 40  ? -45.448  186.065 -17.330 1.00 0.00 ? 35  LEU A CD1 1 
ATOM 309   C CD2 . LEU A 1 40  ? -47.933  185.993 -16.897 1.00 0.00 ? 35  LEU A CD2 1 
ATOM 310   N N   . GLU A 1 41  ? -46.660  180.728 -17.442 1.00 0.00 ? 36  GLU A N   1 
ATOM 311   C CA  . GLU A 1 41  ? -46.542  179.481 -18.221 1.00 0.00 ? 36  GLU A CA  1 
ATOM 312   C C   . GLU A 1 41  ? -47.595  178.465 -17.864 1.00 0.00 ? 36  GLU A C   1 
ATOM 313   O O   . GLU A 1 41  ? -48.168  177.761 -18.705 1.00 0.00 ? 36  GLU A O   1 
ATOM 314   C CB  . GLU A 1 41  ? -45.109  178.814 -18.216 1.00 0.00 ? 36  GLU A CB  1 
ATOM 315   C CG  . GLU A 1 41  ? -44.959  177.568 -19.122 1.00 0.00 ? 36  GLU A CG  1 
ATOM 316   C CD  . GLU A 1 41  ? -43.625  177.061 -18.910 1.00 0.00 ? 36  GLU A CD  1 
ATOM 317   O OE1 . GLU A 1 41  ? -42.649  177.805 -19.206 1.00 0.00 ? 36  GLU A OE1 1 
ATOM 318   O OE2 . GLU A 1 41  ? -43.519  175.938 -18.261 1.00 0.00 ? 36  GLU A OE2 1 
ATOM 319   N N   . LYS A 1 42  ? -47.967  178.309 -16.576 1.00 0.00 ? 37  LYS A N   1 
ATOM 320   C CA  . LYS A 1 42  ? -48.950  177.388 -16.104 1.00 0.00 ? 37  LYS A CA  1 
ATOM 321   C C   . LYS A 1 42  ? -50.262  177.809 -16.699 1.00 0.00 ? 37  LYS A C   1 
ATOM 322   O O   . LYS A 1 42  ? -51.149  177.009 -17.085 1.00 0.00 ? 37  LYS A O   1 
ATOM 323   C CB  . LYS A 1 42  ? -49.053  177.328 -14.567 1.00 0.00 ? 37  LYS A CB  1 
ATOM 324   C CG  . LYS A 1 42  ? -49.942  176.247 -13.930 1.00 0.00 ? 37  LYS A CG  1 
ATOM 325   C CD  . LYS A 1 42  ? -49.869  174.809 -14.484 1.00 0.00 ? 37  LYS A CD  1 
ATOM 326   C CE  . LYS A 1 42  ? -50.800  173.749 -13.847 1.00 0.00 ? 37  LYS A CE  1 
ATOM 327   N NZ  . LYS A 1 42  ? -50.576  173.632 -12.388 1.00 0.00 ? 37  LYS A NZ  1 
ATOM 328   N N   . LEU A 1 43  ? -50.462  179.146 -16.902 1.00 0.00 ? 38  LEU A N   1 
ATOM 329   C CA  . LEU A 1 43  ? -51.731  179.735 -17.451 1.00 0.00 ? 38  LEU A CA  1 
ATOM 330   C C   . LEU A 1 43  ? -51.839  179.455 -18.916 1.00 0.00 ? 38  LEU A C   1 
ATOM 331   O O   . LEU A 1 43  ? -52.912  179.143 -19.450 1.00 0.00 ? 38  LEU A O   1 
ATOM 332   C CB  . LEU A 1 43  ? -51.932  181.199 -16.930 1.00 0.00 ? 38  LEU A CB  1 
ATOM 333   C CG  . LEU A 1 43  ? -53.262  181.906 -17.266 1.00 0.00 ? 38  LEU A CG  1 
ATOM 334   C CD1 . LEU A 1 43  ? -54.459  181.048 -16.858 1.00 0.00 ? 38  LEU A CD1 1 
ATOM 335   C CD2 . LEU A 1 43  ? -53.247  183.285 -16.607 1.00 0.00 ? 38  LEU A CD2 1 
ATOM 336   N N   . LEU A 1 44  ? -50.783  179.493 -19.715 1.00 0.00 ? 39  LEU A N   1 
ATOM 337   C CA  . LEU A 1 44  ? -50.753  179.045 -21.096 1.00 0.00 ? 39  LEU A CA  1 
ATOM 338   C C   . LEU A 1 44  ? -51.029  177.537 -21.335 1.00 0.00 ? 39  LEU A C   1 
ATOM 339   O O   . LEU A 1 44  ? -51.746  177.256 -22.280 1.00 0.00 ? 39  LEU A O   1 
ATOM 340   C CB  . LEU A 1 44  ? -49.324  179.120 -21.705 1.00 0.00 ? 39  LEU A CB  1 
ATOM 341   C CG  . LEU A 1 44  ? -48.749  180.525 -22.032 1.00 0.00 ? 39  LEU A CG  1 
ATOM 342   C CD1 . LEU A 1 44  ? -47.266  180.552 -22.485 1.00 0.00 ? 39  LEU A CD1 1 
ATOM 343   C CD2 . LEU A 1 44  ? -49.564  181.309 -23.080 1.00 0.00 ? 39  LEU A CD2 1 
ATOM 344   N N   . LYS A 1 45  ? -50.535  176.573 -20.514 1.00 0.00 ? 40  LYS A N   1 
ATOM 345   C CA  . LYS A 1 45  ? -50.787  175.202 -20.571 1.00 0.00 ? 40  LYS A CA  1 
ATOM 346   C C   . LYS A 1 45  ? -52.271  174.819 -20.282 1.00 0.00 ? 40  LYS A C   1 
ATOM 347   O O   . LYS A 1 45  ? -52.908  174.011 -21.000 1.00 0.00 ? 40  LYS A O   1 
ATOM 348   C CB  . LYS A 1 45  ? -49.789  174.526 -19.609 1.00 0.00 ? 40  LYS A CB  1 
ATOM 349   C CG  . LYS A 1 45  ? -48.310  174.548 -20.153 1.00 0.00 ? 40  LYS A CG  1 
ATOM 350   C CD  . LYS A 1 45  ? -47.421  173.870 -19.177 1.00 0.00 ? 40  LYS A CD  1 
ATOM 351   C CE  . LYS A 1 45  ? -46.047  173.674 -19.831 1.00 0.00 ? 40  LYS A CE  1 
ATOM 352   N NZ  . LYS A 1 45  ? -44.935  173.413 -18.835 1.00 0.00 ? 40  LYS A NZ  1 
ATOM 353   N N   . LEU A 1 46  ? -52.806  175.388 -19.227 1.00 0.00 ? 41  LEU A N   1 
ATOM 354   C CA  . LEU A 1 46  ? -54.161  175.300 -18.891 1.00 0.00 ? 41  LEU A CA  1 
ATOM 355   C C   . LEU A 1 46  ? -55.145  175.915 -20.004 1.00 0.00 ? 41  LEU A C   1 
ATOM 356   O O   . LEU A 1 46  ? -56.250  175.478 -20.207 1.00 0.00 ? 41  LEU A O   1 
ATOM 357   C CB  . LEU A 1 46  ? -54.389  176.055 -17.628 1.00 0.00 ? 41  LEU A CB  1 
ATOM 358   C CG  . LEU A 1 46  ? -53.785  175.394 -16.315 1.00 0.00 ? 41  LEU A CG  1 
ATOM 359   C CD1 . LEU A 1 46  ? -53.752  176.500 -15.240 1.00 0.00 ? 41  LEU A CD1 1 
ATOM 360   C CD2 . LEU A 1 46  ? -54.623  174.178 -15.971 1.00 0.00 ? 41  LEU A CD2 1 
ATOM 361   N N   . GLY A 1 47  ? -54.673  176.925 -20.698 1.00 0.00 ? 42  GLY A N   1 
ATOM 362   C CA  . GLY A 1 47  ? -55.368  177.607 -21.741 1.00 0.00 ? 42  GLY A CA  1 
ATOM 363   C C   . GLY A 1 47  ? -55.542  176.699 -22.891 1.00 0.00 ? 42  GLY A C   1 
ATOM 364   O O   . GLY A 1 47  ? -56.686  176.626 -23.381 1.00 0.00 ? 42  GLY A O   1 
ATOM 365   N N   . THR A 1 48  ? -54.445  175.913 -23.361 1.00 0.00 ? 43  THR A N   1 
ATOM 366   C CA  . THR A 1 48  ? -54.708  174.872 -24.335 1.00 0.00 ? 43  THR A CA  1 
ATOM 367   C C   . THR A 1 48  ? -55.538  173.661 -23.908 1.00 0.00 ? 43  THR A C   1 
ATOM 368   O O   . THR A 1 48  ? -56.230  173.078 -24.755 1.00 0.00 ? 43  THR A O   1 
ATOM 369   C CB  . THR A 1 48  ? -53.450  174.472 -25.166 1.00 0.00 ? 43  THR A CB  1 
ATOM 370   O OG1 . THR A 1 48  ? -52.423  173.907 -24.317 1.00 0.00 ? 43  THR A OG1 1 
ATOM 371   C CG2 . THR A 1 48  ? -52.720  175.627 -25.847 1.00 0.00 ? 43  THR A CG2 1 
ATOM 372   N N   . GLY A 1 49  ? -55.491  173.294 -22.626 1.00 0.00 ? 44  GLY A N   1 
ATOM 373   C CA  . GLY A 1 49  ? -56.337  172.266 -22.002 1.00 0.00 ? 44  GLY A CA  1 
ATOM 374   C C   . GLY A 1 49  ? -57.719  172.711 -22.078 1.00 0.00 ? 44  GLY A C   1 
ATOM 375   O O   . GLY A 1 49  ? -58.607  171.974 -22.438 1.00 0.00 ? 44  GLY A O   1 
ATOM 376   N N   . LEU A 1 50  ? -58.022  173.988 -21.786 1.00 0.00 ? 45  LEU A N   1 
ATOM 377   C CA  . LEU A 1 50  ? -59.371  174.499 -21.899 1.00 0.00 ? 45  LEU A CA  1 
ATOM 378   C C   . LEU A 1 50  ? -59.806  174.584 -23.327 1.00 0.00 ? 45  LEU A C   1 
ATOM 379   O O   . LEU A 1 50  ? -60.935  174.243 -23.682 1.00 0.00 ? 45  LEU A O   1 
ATOM 380   C CB  . LEU A 1 50  ? -59.434  175.885 -21.233 1.00 0.00 ? 45  LEU A CB  1 
ATOM 381   C CG  . LEU A 1 50  ? -60.717  176.731 -21.093 1.00 0.00 ? 45  LEU A CG  1 
ATOM 382   C CD1 . LEU A 1 50  ? -61.783  175.924 -20.403 1.00 0.00 ? 45  LEU A CD1 1 
ATOM 383   C CD2 . LEU A 1 50  ? -60.579  178.114 -20.404 1.00 0.00 ? 45  LEU A CD2 1 
ATOM 384   N N   . LEU A 1 51  ? -58.913  174.945 -24.234 1.00 0.00 ? 46  LEU A N   1 
ATOM 385   C CA  . LEU A 1 51  ? -59.223  174.904 -25.642 1.00 0.00 ? 46  LEU A CA  1 
ATOM 386   C C   . LEU A 1 51  ? -59.508  173.448 -26.149 1.00 0.00 ? 46  LEU A C   1 
ATOM 387   O O   . LEU A 1 51  ? -60.540  173.192 -26.854 1.00 0.00 ? 46  LEU A O   1 
ATOM 388   C CB  . LEU A 1 51  ? -58.219  175.553 -26.593 1.00 0.00 ? 46  LEU A CB  1 
ATOM 389   C CG  . LEU A 1 51  ? -57.982  177.088 -26.284 1.00 0.00 ? 46  LEU A CG  1 
ATOM 390   C CD1 . LEU A 1 51  ? -56.598  177.455 -26.909 1.00 0.00 ? 46  LEU A CD1 1 
ATOM 391   C CD2 . LEU A 1 51  ? -59.146  178.032 -26.640 1.00 0.00 ? 46  LEU A CD2 1 
ATOM 392   N N   . GLU A 1 52  ? -58.728  172.435 -25.804 1.00 0.00 ? 47  GLU A N   1 
ATOM 393   C CA  . GLU A 1 52  ? -58.907  171.051 -26.105 1.00 0.00 ? 47  GLU A CA  1 
ATOM 394   C C   . GLU A 1 52  ? -60.196  170.424 -25.628 1.00 0.00 ? 47  GLU A C   1 
ATOM 395   O O   . GLU A 1 52  ? -60.956  169.788 -26.333 1.00 0.00 ? 47  GLU A O   1 
ATOM 396   C CB  . GLU A 1 52  ? -57.758  170.180 -25.424 1.00 0.00 ? 47  GLU A CB  1 
ATOM 397   C CG  . GLU A 1 52  ? -57.713  168.605 -25.885 1.00 0.00 ? 47  GLU A CG  1 
ATOM 398   C CD  . GLU A 1 52  ? -56.426  168.016 -25.491 1.00 0.00 ? 47  GLU A CD  1 
ATOM 399   O OE1 . GLU A 1 52  ? -55.401  168.593 -25.934 1.00 0.00 ? 47  GLU A OE1 1 
ATOM 400   O OE2 . GLU A 1 52  ? -56.382  166.984 -24.833 1.00 0.00 ? 47  GLU A OE2 1 
ATOM 401   N N   . SER A 1 53  ? -60.527  170.575 -24.294 1.00 0.00 ? 48  SER A N   1 
ATOM 402   C CA  . SER A 1 53  ? -61.798  170.109 -23.745 1.00 0.00 ? 48  SER A CA  1 
ATOM 403   C C   . SER A 1 53  ? -63.068  170.839 -24.289 1.00 0.00 ? 48  SER A C   1 
ATOM 404   O O   . SER A 1 53  ? -64.098  170.236 -24.526 1.00 0.00 ? 48  SER A O   1 
ATOM 405   C CB  . SER A 1 53  ? -61.741  170.389 -22.266 1.00 0.00 ? 48  SER A CB  1 
ATOM 406   O OG  . SER A 1 53  ? -62.549  169.645 -21.327 1.00 0.00 ? 48  SER A OG  1 
ATOM 407   N N   . GLY A 1 54  ? -62.958  172.166 -24.514 1.00 0.00 ? 49  GLY A N   1 
ATOM 408   C CA  . GLY A 1 54  ? -63.963  173.031 -25.111 1.00 0.00 ? 49  GLY A CA  1 
ATOM 409   C C   . GLY A 1 54  ? -64.382  172.556 -26.421 1.00 0.00 ? 49  GLY A C   1 
ATOM 410   O O   . GLY A 1 54  ? -65.580  172.439 -26.691 1.00 0.00 ? 49  GLY A O   1 
ATOM 411   N N   . ARG A 1 55  ? -63.370  172.250 -27.285 1.00 0.00 ? 50  ARG A N   1 
ATOM 412   C CA  . ARG A 1 55  ? -63.607  171.790 -28.638 1.00 0.00 ? 50  ARG A CA  1 
ATOM 413   C C   . ARG A 1 55  ? -64.178  170.291 -28.685 1.00 0.00 ? 50  ARG A C   1 
ATOM 414   O O   . ARG A 1 55  ? -65.057  170.012 -29.489 1.00 0.00 ? 50  ARG A O   1 
ATOM 415   C CB  . ARG A 1 55  ? -62.403  171.970 -29.648 1.00 0.00 ? 50  ARG A CB  1 
ATOM 416   C CG  . ARG A 1 55  ? -61.978  173.364 -29.887 1.00 0.00 ? 50  ARG A CG  1 
ATOM 417   C CD  . ARG A 1 55  ? -60.722  173.451 -30.751 1.00 0.00 ? 50  ARG A CD  1 
ATOM 418   N NE  . ARG A 1 55  ? -60.662  174.961 -31.004 1.00 0.00 ? 50  ARG A NE  1 
ATOM 419   C CZ  . ARG A 1 55  ? -59.633  175.766 -30.554 1.00 0.00 ? 50  ARG A CZ  1 
ATOM 420   N NH1 . ARG A 1 55  ? -58.463  175.289 -30.211 1.00 0.00 ? 50  ARG A NH1 1 
ATOM 421   N NH2 . ARG A 1 55  ? -59.781  177.055 -30.557 1.00 0.00 ? 50  ARG A NH2 1 
ATOM 422   N N   . HIS A 1 56  ? -63.679  169.414 -27.765 1.00 0.00 ? 51  HIS A N   1 
ATOM 423   C CA  . HIS A 1 56  ? -64.413  168.143 -27.520 1.00 0.00 ? 51  HIS A CA  1 
ATOM 424   C C   . HIS A 1 56  ? -65.811  168.207 -26.908 1.00 0.00 ? 51  HIS A C   1 
ATOM 425   O O   . HIS A 1 56  ? -66.623  167.416 -27.395 1.00 0.00 ? 51  HIS A O   1 
ATOM 426   C CB  . HIS A 1 56  ? -63.596  167.139 -26.721 1.00 0.00 ? 51  HIS A CB  1 
ATOM 427   C CG  . HIS A 1 56  ? -62.301  166.739 -27.462 1.00 0.00 ? 51  HIS A CG  1 
ATOM 428   N ND1 . HIS A 1 56  ? -61.312  165.982 -26.807 1.00 0.00 ? 51  HIS A ND1 1 
ATOM 429   C CD2 . HIS A 1 56  ? -61.860  166.914 -28.761 1.00 0.00 ? 51  HIS A CD2 1 
ATOM 430   C CE1 . HIS A 1 56  ? -60.287  165.833 -27.674 1.00 0.00 ? 51  HIS A CE1 1 
ATOM 431   N NE2 . HIS A 1 56  ? -60.623  166.339 -28.882 1.00 0.00 ? 51  HIS A NE2 1 
ATOM 432   N N   . TYR A 1 57  ? -66.138  169.122 -25.952 1.00 0.00 ? 52  TYR A N   1 
ATOM 433   C CA  . TYR A 1 57  ? -67.491  169.364 -25.426 1.00 0.00 ? 52  TYR A CA  1 
ATOM 434   C C   . TYR A 1 57  ? -68.443  169.847 -26.515 1.00 0.00 ? 52  TYR A C   1 
ATOM 435   O O   . TYR A 1 57  ? -69.569  169.371 -26.625 1.00 0.00 ? 52  TYR A O   1 
ATOM 436   C CB  . TYR A 1 57  ? -67.498  170.406 -24.264 1.00 0.00 ? 52  TYR A CB  1 
ATOM 437   C CG  . TYR A 1 57  ? -68.843  170.703 -23.573 1.00 0.00 ? 52  TYR A CG  1 
ATOM 438   C CD1 . TYR A 1 57  ? -69.852  169.766 -23.386 1.00 0.00 ? 52  TYR A CD1 1 
ATOM 439   C CD2 . TYR A 1 57  ? -69.088  172.009 -23.052 1.00 0.00 ? 52  TYR A CD2 1 
ATOM 440   C CE1 . TYR A 1 57  ? -70.964  169.983 -22.517 1.00 0.00 ? 52  TYR A CE1 1 
ATOM 441   C CE2 . TYR A 1 57  ? -70.184  172.197 -22.195 1.00 0.00 ? 52  TYR A CE2 1 
ATOM 442   C CZ  . TYR A 1 57  ? -71.140  171.226 -21.918 1.00 0.00 ? 52  TYR A CZ  1 
ATOM 443   O OH  . TYR A 1 57  ? -72.187  171.502 -21.045 1.00 0.00 ? 52  TYR A OH  1 
ATOM 444   N N   . LEU A 1 58  ? -68.000  170.741 -27.431 1.00 0.00 ? 53  LEU A N   1 
ATOM 445   C CA  . LEU A 1 58  ? -68.816  171.066 -28.551 1.00 0.00 ? 53  LEU A CA  1 
ATOM 446   C C   . LEU A 1 58  ? -68.909  170.078 -29.698 1.00 0.00 ? 53  LEU A C   1 
ATOM 447   O O   . LEU A 1 58  ? -70.012  169.964 -30.336 1.00 0.00 ? 53  LEU A O   1 
ATOM 448   C CB  . LEU A 1 58  ? -68.434  172.502 -29.068 1.00 0.00 ? 53  LEU A CB  1 
ATOM 449   C CG  . LEU A 1 58  ? -68.508  173.624 -27.932 1.00 0.00 ? 53  LEU A CG  1 
ATOM 450   C CD1 . LEU A 1 58  ? -67.923  174.886 -28.554 1.00 0.00 ? 53  LEU A CD1 1 
ATOM 451   C CD2 . LEU A 1 58  ? -69.950  173.732 -27.444 1.00 0.00 ? 53  LEU A CD2 1 
ATOM 452   N N   . ALA A 1 59  ? -67.943  169.210 -29.987 1.00 0.00 ? 54  ALA A N   1 
ATOM 453   C CA  . ALA A 1 59  ? -68.055  168.128 -30.905 1.00 0.00 ? 54  ALA A CA  1 
ATOM 454   C C   . ALA A 1 59  ? -69.144  167.130 -30.340 1.00 0.00 ? 54  ALA A C   1 
ATOM 455   O O   . ALA A 1 59  ? -70.046  166.765 -31.035 1.00 0.00 ? 54  ALA A O   1 
ATOM 456   C CB  . ALA A 1 59  ? -66.711  167.444 -31.132 1.00 0.00 ? 54  ALA A CB  1 
ATOM 457   N N   . ALA A 1 60  ? -69.225  166.860 -29.004 1.00 0.00 ? 55  ALA A N   1 
ATOM 458   C CA  . ALA A 1 60  ? -70.175  165.938 -28.370 1.00 0.00 ? 55  ALA A CA  1 
ATOM 459   C C   . ALA A 1 60  ? -71.597  166.437 -28.387 1.00 0.00 ? 55  ALA A C   1 
ATOM 460   O O   . ALA A 1 60  ? -72.486  165.733 -28.788 1.00 0.00 ? 55  ALA A O   1 
ATOM 461   C CB  . ALA A 1 60  ? -69.703  165.683 -26.910 1.00 0.00 ? 55  ALA A CB  1 
ATOM 462   N N   . SER A 1 61  ? -71.790  167.725 -28.116 1.00 0.00 ? 56  SER A N   1 
ATOM 463   C CA  . SER A 1 61  ? -72.958  168.626 -28.153 1.00 0.00 ? 56  SER A CA  1 
ATOM 464   C C   . SER A 1 61  ? -73.527  168.666 -29.554 1.00 0.00 ? 56  SER A C   1 
ATOM 465   O O   . SER A 1 61  ? -74.754  168.569 -29.835 1.00 0.00 ? 56  SER A O   1 
ATOM 466   C CB  . SER A 1 61  ? -72.612  170.108 -27.715 1.00 0.00 ? 56  SER A CB  1 
ATOM 467   O OG  . SER A 1 61  ? -72.294  170.179 -26.349 1.00 0.00 ? 56  SER A OG  1 
ATOM 468   N N   . ARG A 1 62  ? -72.684  168.899 -30.585 1.00 0.00 ? 57  ARG A N   1 
ATOM 469   C CA  . ARG A 1 62  ? -73.164  169.057 -32.011 1.00 0.00 ? 57  ARG A CA  1 
ATOM 470   C C   . ARG A 1 62  ? -73.741  167.708 -32.581 1.00 0.00 ? 57  ARG A C   1 
ATOM 471   O O   . ARG A 1 62  ? -74.818  167.622 -33.210 1.00 0.00 ? 57  ARG A O   1 
ATOM 472   C CB  . ARG A 1 62  ? -71.944  169.538 -32.866 1.00 0.00 ? 57  ARG A CB  1 
ATOM 473   C CG  . ARG A 1 62  ? -72.187  169.825 -34.347 1.00 0.00 ? 57  ARG A CG  1 
ATOM 474   C CD  . ARG A 1 62  ? -73.003  171.096 -34.475 1.00 0.00 ? 57  ARG A CD  1 
ATOM 475   N NE  . ARG A 1 62  ? -72.156  172.183 -33.948 1.00 0.00 ? 57  ARG A NE  1 
ATOM 476   C CZ  . ARG A 1 62  ? -72.081  173.354 -34.629 1.00 0.00 ? 57  ARG A CZ  1 
ATOM 477   N NH1 . ARG A 1 62  ? -73.072  173.841 -35.367 1.00 0.00 ? 57  ARG A NH1 1 
ATOM 478   N NH2 . ARG A 1 62  ? -70.951  173.995 -34.474 1.00 0.00 ? 57  ARG A NH2 1 
ATOM 479   N N   . ALA A 1 63  ? -73.109  166.538 -32.230 1.00 0.00 ? 58  ALA A N   1 
ATOM 480   C CA  . ALA A 1 63  ? -73.592  165.188 -32.466 1.00 0.00 ? 58  ALA A CA  1 
ATOM 481   C C   . ALA A 1 63  ? -74.883  164.961 -31.701 1.00 0.00 ? 58  ALA A C   1 
ATOM 482   O O   . ALA A 1 63  ? -75.744  164.285 -32.279 1.00 0.00 ? 58  ALA A O   1 
ATOM 483   C CB  . ALA A 1 63  ? -72.584  164.102 -31.930 1.00 0.00 ? 58  ALA A CB  1 
ATOM 484   N N   . PHE A 1 64  ? -74.996  165.407 -30.486 1.00 0.00 ? 59  PHE A N   1 
ATOM 485   C CA  . PHE A 1 64  ? -76.207  165.199 -29.714 1.00 0.00 ? 59  PHE A CA  1 
ATOM 486   C C   . PHE A 1 64  ? -77.512  165.916 -30.335 1.00 0.00 ? 59  PHE A C   1 
ATOM 487   O O   . PHE A 1 64  ? -78.629  165.354 -30.333 1.00 0.00 ? 59  PHE A O   1 
ATOM 488   C CB  . PHE A 1 64  ? -75.903  165.793 -28.284 1.00 0.00 ? 59  PHE A CB  1 
ATOM 489   C CG  . PHE A 1 64  ? -76.987  165.473 -27.322 1.00 0.00 ? 59  PHE A CG  1 
ATOM 490   C CD1 . PHE A 1 64  ? -77.371  164.124 -27.134 1.00 0.00 ? 59  PHE A CD1 1 
ATOM 491   C CD2 . PHE A 1 64  ? -77.783  166.581 -26.802 1.00 0.00 ? 59  PHE A CD2 1 
ATOM 492   C CE1 . PHE A 1 64  ? -78.436  163.844 -26.236 1.00 0.00 ? 59  PHE A CE1 1 
ATOM 493   C CE2 . PHE A 1 64  ? -78.790  166.277 -25.842 1.00 0.00 ? 59  PHE A CE2 1 
ATOM 494   C CZ  . PHE A 1 64  ? -79.061  164.896 -25.582 1.00 0.00 ? 59  PHE A CZ  1 
ATOM 495   N N   . VAL A 1 65  ? -77.327  167.096 -30.823 1.00 0.00 ? 60  VAL A N   1 
ATOM 496   C CA  . VAL A 1 65  ? -78.382  167.954 -31.376 1.00 0.00 ? 60  VAL A CA  1 
ATOM 497   C C   . VAL A 1 65  ? -78.939  167.418 -32.730 1.00 0.00 ? 60  VAL A C   1 
ATOM 498   O O   . VAL A 1 65  ? -80.194  167.311 -32.900 1.00 0.00 ? 60  VAL A O   1 
ATOM 499   C CB  . VAL A 1 65  ? -77.782  169.418 -31.507 1.00 0.00 ? 60  VAL A CB  1 
ATOM 500   C CG1 . VAL A 1 65  ? -78.509  170.205 -32.549 1.00 0.00 ? 60  VAL A CG1 1 
ATOM 501   C CG2 . VAL A 1 65  ? -77.820  169.960 -30.072 1.00 0.00 ? 60  VAL A CG2 1 
ATOM 502   N N   . VAL A 1 66  ? -78.064  167.002 -33.652 1.00 0.00 ? 61  VAL A N   1 
ATOM 503   C CA  . VAL A 1 66  ? -78.459  166.132 -34.757 1.00 0.00 ? 61  VAL A CA  1 
ATOM 504   C C   . VAL A 1 66  ? -79.268  164.854 -34.403 1.00 0.00 ? 61  VAL A C   1 
ATOM 505   O O   . VAL A 1 66  ? -80.149  164.540 -35.118 1.00 0.00 ? 61  VAL A O   1 
ATOM 506   C CB  . VAL A 1 66  ? -77.484  165.892 -35.906 1.00 0.00 ? 61  VAL A CB  1 
ATOM 507   C CG1 . VAL A 1 66  ? -76.276  165.100 -35.428 1.00 0.00 ? 61  VAL A CG1 1 
ATOM 508   C CG2 . VAL A 1 66  ? -78.022  165.262 -37.147 1.00 0.00 ? 61  VAL A CG2 1 
ATOM 509   N N   . GLY A 1 67  ? -78.888  164.219 -33.219 1.00 0.00 ? 62  GLY A N   1 
ATOM 510   C CA  . GLY A 1 67  ? -79.282  162.901 -32.815 1.00 0.00 ? 62  GLY A CA  1 
ATOM 511   C C   . GLY A 1 67  ? -80.599  162.963 -32.102 1.00 0.00 ? 62  GLY A C   1 
ATOM 512   O O   . GLY A 1 67  ? -81.384  162.072 -32.271 1.00 0.00 ? 62  GLY A O   1 
ATOM 513   N N   . ILE A 1 68  ? -80.829  163.935 -31.261 1.00 0.00 ? 63  ILE A N   1 
ATOM 514   C CA  . ILE A 1 68  ? -82.096  164.320 -30.678 1.00 0.00 ? 63  ILE A CA  1 
ATOM 515   C C   . ILE A 1 68  ? -83.110  164.672 -31.644 1.00 0.00 ? 63  ILE A C   1 
ATOM 516   O O   . ILE A 1 68  ? -84.268  164.252 -31.479 1.00 0.00 ? 63  ILE A O   1 
ATOM 517   C CB  . ILE A 1 68  ? -82.253  165.336 -29.577 1.00 0.00 ? 63  ILE A CB  1 
ATOM 518   C CG1 . ILE A 1 68  ? -81.993  166.817 -30.080 1.00 0.00 ? 63  ILE A CG1 1 
ATOM 519   C CG2 . ILE A 1 68  ? -81.351  165.063 -28.402 1.00 0.00 ? 63  ILE A CG2 1 
ATOM 520   C CD1 . ILE A 1 68  ? -82.404  167.977 -29.180 1.00 0.00 ? 63  ILE A CD1 1 
ATOM 521   N N   . CYS A 1 69  ? -82.746  165.322 -32.741 1.00 0.00 ? 64  CYS A N   1 
ATOM 522   C CA  . CYS A 1 69  ? -83.697  165.691 -33.781 1.00 0.00 ? 64  CYS A CA  1 
ATOM 523   C C   . CYS A 1 69  ? -83.999  164.425 -34.594 1.00 0.00 ? 64  CYS A C   1 
ATOM 524   O O   . CYS A 1 69  ? -85.112  164.090 -34.873 1.00 0.00 ? 64  CYS A O   1 
ATOM 525   C CB  . CYS A 1 69  ? -83.211  166.883 -34.562 1.00 0.00 ? 64  CYS A CB  1 
ATOM 526   S SG  . CYS A 1 69  ? -83.023  168.305 -33.508 1.00 0.00 ? 64  CYS A SG  1 
ATOM 527   N N   . ASP A 1 70  ? -82.935  163.629 -34.989 1.00 0.00 ? 65  ASP A N   1 
ATOM 528   C CA  . ASP A 1 70  ? -83.020  162.519 -35.967 1.00 0.00 ? 65  ASP A CA  1 
ATOM 529   C C   . ASP A 1 70  ? -84.005  161.449 -35.432 1.00 0.00 ? 65  ASP A C   1 
ATOM 530   O O   . ASP A 1 70  ? -84.699  160.799 -36.247 1.00 0.00 ? 65  ASP A O   1 
ATOM 531   C CB  . ASP A 1 70  ? -81.638  161.904 -36.313 1.00 0.00 ? 65  ASP A CB  1 
ATOM 532   C CG  . ASP A 1 70  ? -81.738  160.853 -37.375 1.00 0.00 ? 65  ASP A CG  1 
ATOM 533   O OD1 . ASP A 1 70  ? -82.042  161.233 -38.520 1.00 0.00 ? 65  ASP A OD1 1 
ATOM 534   O OD2 . ASP A 1 70  ? -81.477  159.679 -37.099 1.00 0.00 ? 65  ASP A OD2 1 
ATOM 535   N N   . LEU A 1 71  ? -84.071  161.208 -34.111 1.00 0.00 ? 66  LEU A N   1 
ATOM 536   C CA  . LEU A 1 71  ? -84.869  160.254 -33.384 1.00 0.00 ? 66  LEU A CA  1 
ATOM 537   C C   . LEU A 1 71  ? -86.277  160.553 -33.360 1.00 0.00 ? 66  LEU A C   1 
ATOM 538   O O   . LEU A 1 71  ? -87.153  159.704 -33.571 1.00 0.00 ? 66  LEU A O   1 
ATOM 539   C CB  . LEU A 1 71  ? -84.423  160.029 -31.833 1.00 0.00 ? 66  LEU A CB  1 
ATOM 540   C CG  . LEU A 1 71  ? -84.018  158.590 -31.547 1.00 0.00 ? 66  LEU A CG  1 
ATOM 541   C CD1 . LEU A 1 71  ? -83.035  158.479 -30.308 1.00 0.00 ? 66  LEU A CD1 1 
ATOM 542   C CD2 . LEU A 1 71  ? -85.262  157.693 -31.410 1.00 0.00 ? 66  LEU A CD2 1 
ATOM 543   N N   . ALA A 1 72  ? -86.572  161.876 -33.109 1.00 0.00 ? 67  ALA A N   1 
ATOM 544   C CA  . ALA A 1 72  ? -87.873  162.463 -33.340 1.00 0.00 ? 67  ALA A CA  1 
ATOM 545   C C   . ALA A 1 72  ? -88.299  162.369 -34.785 1.00 0.00 ? 67  ALA A C   1 
ATOM 546   O O   . ALA A 1 72  ? -89.470  162.003 -34.963 1.00 0.00 ? 67  ALA A O   1 
ATOM 547   C CB  . ALA A 1 72  ? -87.862  163.929 -32.861 1.00 0.00 ? 67  ALA A CB  1 
ATOM 548   N N   . ARG A 1 73  ? -87.398  162.689 -35.740 1.00 0.00 ? 68  ARG A N   1 
ATOM 549   C CA  . ARG A 1 73  ? -87.614  162.468 -37.127 1.00 0.00 ? 68  ARG A CA  1 
ATOM 550   C C   . ARG A 1 73  ? -87.880  160.978 -37.560 1.00 0.00 ? 68  ARG A C   1 
ATOM 551   O O   . ARG A 1 73  ? -88.700  160.703 -38.426 1.00 0.00 ? 68  ARG A O   1 
ATOM 552   C CB  . ARG A 1 73  ? -86.605  163.117 -38.158 1.00 0.00 ? 68  ARG A CB  1 
ATOM 553   C CG  . ARG A 1 73  ? -86.422  164.637 -38.219 1.00 0.00 ? 68  ARG A CG  1 
ATOM 554   C CD  . ARG A 1 73  ? -85.137  164.954 -38.904 1.00 0.00 ? 68  ARG A CD  1 
ATOM 555   N NE  . ARG A 1 73  ? -85.010  166.439 -38.914 1.00 0.00 ? 68  ARG A NE  1 
ATOM 556   C CZ  . ARG A 1 73  ? -83.925  167.220 -38.660 1.00 0.00 ? 68  ARG A CZ  1 
ATOM 557   N NH1 . ARG A 1 73  ? -82.732  166.643 -38.402 1.00 0.00 ? 68  ARG A NH1 1 
ATOM 558   N NH2 . ARG A 1 73  ? -83.968  168.533 -38.762 1.00 0.00 ? 68  ARG A NH2 1 
ATOM 559   N N   . LEU A 1 74  ? -87.234  160.012 -36.902 1.00 0.00 ? 69  LEU A N   1 
ATOM 560   C CA  . LEU A 1 74  ? -87.521  158.565 -37.049 1.00 0.00 ? 69  LEU A CA  1 
ATOM 561   C C   . LEU A 1 74  ? -88.932  158.109 -36.517 1.00 0.00 ? 69  LEU A C   1 
ATOM 562   O O   . LEU A 1 74  ? -89.383  157.023 -36.907 1.00 0.00 ? 69  LEU A O   1 
ATOM 563   C CB  . LEU A 1 74  ? -86.384  157.836 -36.398 1.00 0.00 ? 69  LEU A CB  1 
ATOM 564   C CG  . LEU A 1 74  ? -86.257  156.285 -36.596 1.00 0.00 ? 69  LEU A CG  1 
ATOM 565   C CD1 . LEU A 1 74  ? -85.933  156.021 -38.113 1.00 0.00 ? 69  LEU A CD1 1 
ATOM 566   C CD2 . LEU A 1 74  ? -85.131  155.868 -35.636 1.00 0.00 ? 69  LEU A CD2 1 
ATOM 567   N N   . GLY A 1 75  ? -89.612  158.907 -35.713 1.00 0.00 ? 70  GLY A N   1 
ATOM 568   C CA  . GLY A 1 75  ? -90.979  158.599 -35.168 1.00 0.00 ? 70  GLY A CA  1 
ATOM 569   C C   . GLY A 1 75  ? -92.165  158.812 -36.029 1.00 0.00 ? 70  GLY A C   1 
ATOM 570   O O   . GLY A 1 75  ? -92.035  159.305 -37.134 1.00 0.00 ? 70  GLY A O   1 
ATOM 571   N N   . PRO A 1 76  ? -93.392  158.624 -35.573 1.00 0.00 ? 71  PRO A N   1 
ATOM 572   C CA  . PRO A 1 76  ? -94.555  158.875 -36.342 1.00 0.00 ? 71  PRO A CA  1 
ATOM 573   C C   . PRO A 1 76  ? -94.939  160.352 -36.241 1.00 0.00 ? 71  PRO A C   1 
ATOM 574   O O   . PRO A 1 76  ? -94.640  161.018 -35.233 1.00 0.00 ? 71  PRO A O   1 
ATOM 575   C CB  . PRO A 1 76  ? -95.558  157.865 -35.731 1.00 0.00 ? 71  PRO A CB  1 
ATOM 576   C CG  . PRO A 1 76  ? -95.292  157.937 -34.215 1.00 0.00 ? 71  PRO A CG  1 
ATOM 577   C CD  . PRO A 1 76  ? -93.728  157.921 -34.304 1.00 0.00 ? 71  PRO A CD  1 
ATOM 578   N N   . PRO A 1 77  ? -95.488  161.056 -37.278 1.00 0.00 ? 72  PRO A N   1 
ATOM 579   C CA  . PRO A 1 77  ? -95.143  162.378 -37.462 1.00 0.00 ? 72  PRO A CA  1 
ATOM 580   C C   . PRO A 1 77  ? -96.128  163.256 -36.704 1.00 0.00 ? 72  PRO A C   1 
ATOM 581   O O   . PRO A 1 77  ? -97.310  162.951 -36.621 1.00 0.00 ? 72  PRO A O   1 
ATOM 582   C CB  . PRO A 1 77  ? -95.275  162.563 -38.941 1.00 0.00 ? 72  PRO A CB  1 
ATOM 583   C CG  . PRO A 1 77  ? -96.268  161.418 -39.416 1.00 0.00 ? 72  PRO A CG  1 
ATOM 584   C CD  . PRO A 1 77  ? -96.135  160.337 -38.319 1.00 0.00 ? 72  PRO A CD  1 
ATOM 585   N N   . GLU A 1 78  ? -95.718  164.403 -36.101 1.00 0.00 ? 73  GLU A N   1 
ATOM 586   C CA  . GLU A 1 78  ? -96.628  165.426 -35.529 1.00 0.00 ? 73  GLU A CA  1 
ATOM 587   C C   . GLU A 1 78  ? -96.410  166.822 -36.035 1.00 0.00 ? 73  GLU A C   1 
ATOM 588   O O   . GLU A 1 78  ? -95.303  167.319 -35.830 1.00 0.00 ? 73  GLU A O   1 
ATOM 589   C CB  . GLU A 1 78  ? -96.507  165.529 -33.951 1.00 0.00 ? 73  GLU A CB  1 
ATOM 590   C CG  . GLU A 1 78  ? -97.583  166.340 -33.277 1.00 0.00 ? 73  GLU A CG  1 
ATOM 591   C CD  . GLU A 1 78  ? -98.971  165.698 -33.490 1.00 0.00 ? 73  GLU A CD  1 
ATOM 592   O OE1 . GLU A 1 78  ? -99.039  164.472 -33.447 1.00 0.00 ? 73  GLU A OE1 1 
ATOM 593   O OE2 . GLU A 1 78  ? -99.953  166.469 -33.874 1.00 0.00 ? 73  GLU A OE2 1 
ATOM 594   N N   . PRO A 1 79  ? -97.354  167.540 -36.791 1.00 0.00 ? 74  PRO A N   1 
ATOM 595   C CA  . PRO A 1 79  ? -96.890  168.669 -37.526 1.00 0.00 ? 74  PRO A CA  1 
ATOM 596   C C   . PRO A 1 79  ? -96.280  169.870 -36.721 1.00 0.00 ? 74  PRO A C   1 
ATOM 597   O O   . PRO A 1 79  ? -95.386  170.605 -37.218 1.00 0.00 ? 74  PRO A O   1 
ATOM 598   C CB  . PRO A 1 79  ? -98.108  169.042 -38.219 1.00 0.00 ? 74  PRO A CB  1 
ATOM 599   C CG  . PRO A 1 79  ? -98.743  167.690 -38.583 1.00 0.00 ? 74  PRO A CG  1 
ATOM 600   C CD  . PRO A 1 79  ? -98.498  166.881 -37.400 1.00 0.00 ? 74  PRO A CD  1 
ATOM 601   N N   . MET A 1 80  ? -96.658  170.070 -35.471 1.00 0.00 ? 75  MET A N   1 
ATOM 602   C CA  . MET A 1 80  ? -96.151  171.275 -34.709 1.00 0.00 ? 75  MET A CA  1 
ATOM 603   C C   . MET A 1 80  ? -94.741  170.967 -34.361 1.00 0.00 ? 75  MET A C   1 
ATOM 604   O O   . MET A 1 80  ? -93.979  171.862 -34.207 1.00 0.00 ? 75  MET A O   1 
ATOM 605   C CB  . MET A 1 80  ? -96.934  171.386 -33.400 1.00 0.00 ? 75  MET A CB  1 
ATOM 606   C CG  . MET A 1 80  ? -96.639  172.579 -32.533 1.00 0.00 ? 75  MET A CG  1 
ATOM 607   S SD  . MET A 1 80  ? -97.174  174.160 -33.244 1.00 0.00 ? 75  MET A SD  1 
ATOM 608   C CE  . MET A 1 80  ? -98.945  173.907 -32.822 1.00 0.00 ? 75  MET A CE  1 
ATOM 609   N N   . MET A 1 81  ? -94.384  169.678 -34.257 1.00 0.00 ? 76  MET A N   1 
ATOM 610   C CA  . MET A 1 81  ? -93.102  169.316 -33.934 1.00 0.00 ? 76  MET A CA  1 
ATOM 611   C C   . MET A 1 81  ? -92.166  169.475 -35.126 1.00 0.00 ? 76  MET A C   1 
ATOM 612   O O   . MET A 1 81  ? -91.090  169.987 -34.984 1.00 0.00 ? 76  MET A O   1 
ATOM 613   C CB  . MET A 1 81  ? -93.083  167.917 -33.285 1.00 0.00 ? 76  MET A CB  1 
ATOM 614   C CG  . MET A 1 81  ? -91.614  167.461 -32.902 1.00 0.00 ? 76  MET A CG  1 
ATOM 615   S SD  . MET A 1 81  ? -90.870  168.396 -31.587 1.00 0.00 ? 76  MET A SD  1 
ATOM 616   C CE  . MET A 1 81  ? -89.869  167.128 -30.825 1.00 0.00 ? 76  MET A CE  1 
ATOM 617   N N   . ALA A 1 82  ? -92.735  169.193 -36.363 1.00 0.00 ? 77  ALA A N   1 
ATOM 618   C CA  . ALA A 1 82  ? -92.060  169.312 -37.600 1.00 0.00 ? 77  ALA A CA  1 
ATOM 619   C C   . ALA A 1 82  ? -91.556  170.747 -37.810 1.00 0.00 ? 77  ALA A C   1 
ATOM 620   O O   . ALA A 1 82  ? -90.427  170.877 -38.274 1.00 0.00 ? 77  ALA A O   1 
ATOM 621   C CB  . ALA A 1 82  ? -92.919  168.787 -38.840 1.00 0.00 ? 77  ALA A CB  1 
ATOM 622   N N   . GLU A 1 83  ? -92.397  171.767 -37.524 1.00 0.00 ? 78  GLU A N   1 
ATOM 623   C CA  . GLU A 1 83  ? -91.846  173.127 -37.590 1.00 0.00 ? 78  GLU A CA  1 
ATOM 624   C C   . GLU A 1 83  ? -91.035  173.616 -36.351 1.00 0.00 ? 78  GLU A C   1 
ATOM 625   O O   . GLU A 1 83  ? -89.950  174.202 -36.516 1.00 0.00 ? 78  GLU A O   1 
ATOM 626   C CB  . GLU A 1 83  ? -93.010  174.180 -37.757 1.00 0.00 ? 78  GLU A CB  1 
ATOM 627   C CG  . GLU A 1 83  ? -92.448  175.624 -38.182 1.00 0.00 ? 78  GLU A CG  1 
ATOM 628   C CD  . GLU A 1 83  ? -93.590  176.572 -38.491 1.00 0.00 ? 78  GLU A CD  1 
ATOM 629   O OE1 . GLU A 1 83  ? -94.001  176.604 -39.683 1.00 0.00 ? 78  GLU A OE1 1 
ATOM 630   O OE2 . GLU A 1 83  ? -94.002  177.439 -37.649 1.00 0.00 ? 78  GLU A OE2 1 
ATOM 631   N N   . CYS A 1 84  ? -91.485  173.315 -35.099 1.00 0.00 ? 79  CYS A N   1 
ATOM 632   C CA  . CYS A 1 84  ? -90.804  173.760 -33.879 1.00 0.00 ? 79  CYS A CA  1 
ATOM 633   C C   . CYS A 1 84  ? -89.364  173.146 -33.854 1.00 0.00 ? 79  CYS A C   1 
ATOM 634   O O   . CYS A 1 84  ? -88.443  173.795 -33.460 1.00 0.00 ? 79  CYS A O   1 
ATOM 635   C CB  . CYS A 1 84  ? -91.461  173.249 -32.616 1.00 0.00 ? 79  CYS A CB  1 
ATOM 636   S SG  . CYS A 1 84  ? -93.049  174.111 -32.230 1.00 0.00 ? 79  CYS A SG  1 
ATOM 637   N N   . LEU A 1 85  ? -89.183  171.847 -34.306 1.00 0.00 ? 80  LEU A N   1 
ATOM 638   C CA  . LEU A 1 85  ? -87.924  171.079 -34.209 1.00 0.00 ? 80  LEU A CA  1 
ATOM 639   C C   . LEU A 1 85  ? -86.835  171.691 -35.127 1.00 0.00 ? 80  LEU A C   1 
ATOM 640   O O   . LEU A 1 85  ? -85.636  171.772 -34.711 1.00 0.00 ? 80  LEU A O   1 
ATOM 641   C CB  . LEU A 1 85  ? -88.155  169.619 -34.625 1.00 0.00 ? 80  LEU A CB  1 
ATOM 642   C CG  . LEU A 1 85  ? -86.928  168.669 -34.471 1.00 0.00 ? 80  LEU A CG  1 
ATOM 643   C CD1 . LEU A 1 85  ? -86.530  168.628 -32.969 1.00 0.00 ? 80  LEU A CD1 1 
ATOM 644   C CD2 . LEU A 1 85  ? -87.128  167.206 -35.050 1.00 0.00 ? 80  LEU A CD2 1 
ATOM 645   N N   . GLU A 1 86  ? -87.271  172.163 -36.224 1.00 0.00 ? 81  GLU A N   1 
ATOM 646   C CA  . GLU A 1 86  ? -86.534  173.057 -37.094 1.00 0.00 ? 81  GLU A CA  1 
ATOM 647   C C   . GLU A 1 86  ? -86.125  174.450 -36.563 1.00 0.00 ? 81  GLU A C   1 
ATOM 648   O O   . GLU A 1 86  ? -84.985  174.916 -36.693 1.00 0.00 ? 81  GLU A O   1 
ATOM 649   C CB  . GLU A 1 86  ? -87.314  173.211 -38.447 1.00 0.00 ? 81  GLU A CB  1 
ATOM 650   C CG  . GLU A 1 86  ? -87.437  171.913 -39.376 1.00 0.00 ? 81  GLU A CG  1 
ATOM 651   C CD  . GLU A 1 86  ? -86.129  171.474 -39.984 1.00 0.00 ? 81  GLU A CD  1 
ATOM 652   O OE1 . GLU A 1 86  ? -85.390  172.349 -40.442 1.00 0.00 ? 81  GLU A OE1 1 
ATOM 653   O OE2 . GLU A 1 86  ? -85.791  170.332 -39.842 1.00 0.00 ? 81  GLU A OE2 1 
ATOM 654   N N   . LYS A 1 87  ? -87.033  175.141 -35.843 1.00 0.00 ? 82  LYS A N   1 
ATOM 655   C CA  . LYS A 1 87  ? -86.643  176.311 -35.128 1.00 0.00 ? 82  LYS A CA  1 
ATOM 656   C C   . LYS A 1 87  ? -85.646  175.941 -34.022 1.00 0.00 ? 82  LYS A C   1 
ATOM 657   O O   . LYS A 1 87  ? -84.615  176.598 -33.804 1.00 0.00 ? 82  LYS A O   1 
ATOM 658   C CB  . LYS A 1 87  ? -87.861  177.016 -34.456 1.00 0.00 ? 82  LYS A CB  1 
ATOM 659   C CG  . LYS A 1 87  ? -89.085  177.272 -35.431 1.00 0.00 ? 82  LYS A CG  1 
ATOM 660   C CD  . LYS A 1 87  ? -88.927  178.509 -36.321 1.00 0.00 ? 82  LYS A CD  1 
ATOM 661   C CE  . LYS A 1 87  ? -90.090  178.605 -37.337 1.00 0.00 ? 82  LYS A CE  1 
ATOM 662   N NZ  . LYS A 1 87  ? -89.857  179.876 -38.109 1.00 0.00 ? 82  LYS A NZ  1 
ATOM 663   N N   . PHE A 1 88  ? -85.882  174.844 -33.235 1.00 0.00 ? 83  PHE A N   1 
ATOM 664   C CA  . PHE A 1 88  ? -84.991  174.454 -32.133 1.00 0.00 ? 83  PHE A CA  1 
ATOM 665   C C   . PHE A 1 88  ? -83.589  174.161 -32.668 1.00 0.00 ? 83  PHE A C   1 
ATOM 666   O O   . PHE A 1 88  ? -82.559  174.612 -32.204 1.00 0.00 ? 83  PHE A O   1 
ATOM 667   C CB  . PHE A 1 88  ? -85.337  173.235 -31.358 1.00 0.00 ? 83  PHE A CB  1 
ATOM 668   C CG  . PHE A 1 88  ? -86.612  173.360 -30.531 1.00 0.00 ? 83  PHE A CG  1 
ATOM 669   C CD1 . PHE A 1 88  ? -87.330  174.552 -30.325 1.00 0.00 ? 83  PHE A CD1 1 
ATOM 670   C CD2 . PHE A 1 88  ? -87.126  172.188 -29.860 1.00 0.00 ? 83  PHE A CD2 1 
ATOM 671   C CE1 . PHE A 1 88  ? -88.498  174.611 -29.531 1.00 0.00 ? 83  PHE A CE1 1 
ATOM 672   C CE2 . PHE A 1 88  ? -88.366  172.214 -29.183 1.00 0.00 ? 83  PHE A CE2 1 
ATOM 673   C CZ  . PHE A 1 88  ? -88.993  173.433 -28.963 1.00 0.00 ? 83  PHE A CZ  1 
ATOM 674   N N   . THR A 1 89  ? -83.541  173.362 -33.763 1.00 0.00 ? 84  THR A N   1 
ATOM 675   C CA  . THR A 1 89  ? -82.308  172.938 -34.452 1.00 0.00 ? 84  THR A CA  1 
ATOM 676   C C   . THR A 1 89  ? -81.426  174.074 -34.931 1.00 0.00 ? 84  THR A C   1 
ATOM 677   O O   . THR A 1 89  ? -80.269  174.093 -34.543 1.00 0.00 ? 84  THR A O   1 
ATOM 678   C CB  . THR A 1 89  ? -82.530  172.030 -35.716 1.00 0.00 ? 84  THR A CB  1 
ATOM 679   O OG1 . THR A 1 89  ? -83.162  170.830 -35.409 1.00 0.00 ? 84  THR A OG1 1 
ATOM 680   C CG2 . THR A 1 89  ? -81.225  171.657 -36.426 1.00 0.00 ? 84  THR A CG2 1 
ATOM 681   N N   . VAL A 1 90  ? -81.946  175.085 -35.638 1.00 0.00 ? 85  VAL A N   1 
ATOM 682   C CA  . VAL A 1 90  ? -81.119  176.127 -36.144 1.00 0.00 ? 85  VAL A CA  1 
ATOM 683   C C   . VAL A 1 90  ? -80.573  176.927 -34.910 1.00 0.00 ? 85  VAL A C   1 
ATOM 684   O O   . VAL A 1 90  ? -79.396  177.158 -34.827 1.00 0.00 ? 85  VAL A O   1 
ATOM 685   C CB  . VAL A 1 90  ? -81.770  177.043 -37.187 1.00 0.00 ? 85  VAL A CB  1 
ATOM 686   C CG1 . VAL A 1 90  ? -82.859  177.901 -36.461 1.00 0.00 ? 85  VAL A CG1 1 
ATOM 687   C CG2 . VAL A 1 90  ? -80.822  178.123 -37.772 1.00 0.00 ? 85  VAL A CG2 1 
ATOM 688   N N   . SER A 1 91  ? -81.374  177.280 -33.854 1.00 0.00 ? 86  SER A N   1 
ATOM 689   C CA  . SER A 1 91  ? -81.074  177.933 -32.596 1.00 0.00 ? 86  SER A CA  1 
ATOM 690   C C   . SER A 1 91  ? -80.018  177.174 -31.705 1.00 0.00 ? 86  SER A C   1 
ATOM 691   O O   . SER A 1 91  ? -79.049  177.724 -31.196 1.00 0.00 ? 86  SER A O   1 
ATOM 692   C CB  . SER A 1 91  ? -82.353  178.099 -31.779 1.00 0.00 ? 86  SER A CB  1 
ATOM 693   O OG  . SER A 1 91  ? -82.174  178.943 -30.685 1.00 0.00 ? 86  SER A OG  1 
ATOM 694   N N   . LEU A 1 92  ? -80.154  175.827 -31.531 1.00 0.00 ? 87  LEU A N   1 
ATOM 695   C CA  . LEU A 1 92  ? -79.256  175.011 -30.760 1.00 0.00 ? 87  LEU A CA  1 
ATOM 696   C C   . LEU A 1 92  ? -77.879  175.008 -31.340 1.00 0.00 ? 87  LEU A C   1 
ATOM 697   O O   . LEU A 1 92  ? -76.896  175.161 -30.630 1.00 0.00 ? 87  LEU A O   1 
ATOM 698   C CB  . LEU A 1 92  ? -79.781  173.531 -30.757 1.00 0.00 ? 87  LEU A CB  1 
ATOM 699   C CG  . LEU A 1 92  ? -80.954  173.241 -29.838 1.00 0.00 ? 87  LEU A CG  1 
ATOM 700   C CD1 . LEU A 1 92  ? -81.529  171.900 -30.349 1.00 0.00 ? 87  LEU A CD1 1 
ATOM 701   C CD2 . LEU A 1 92  ? -80.390  173.002 -28.412 1.00 0.00 ? 87  LEU A CD2 1 
ATOM 702   N N   . ASN A 1 93  ? -77.761  174.776 -32.629 1.00 0.00 ? 88  ASN A N   1 
ATOM 703   C CA  . ASN A 1 93  ? -76.449  174.811 -33.413 1.00 0.00 ? 88  ASN A CA  1 
ATOM 704   C C   . ASN A 1 93  ? -75.851  176.199 -33.363 1.00 0.00 ? 88  ASN A C   1 
ATOM 705   O O   . ASN A 1 93  ? -74.628  176.337 -33.181 1.00 0.00 ? 88  ASN A O   1 
ATOM 706   C CB  . ASN A 1 93  ? -76.779  174.484 -34.945 1.00 0.00 ? 88  ASN A CB  1 
ATOM 707   C CG  . ASN A 1 93  ? -76.753  172.959 -35.157 1.00 0.00 ? 88  ASN A CG  1 
ATOM 708   O OD1 . ASN A 1 93  ? -75.800  172.250 -34.840 1.00 0.00 ? 88  ASN A OD1 1 
ATOM 709   N ND2 . ASN A 1 93  ? -77.864  172.365 -35.543 1.00 0.00 ? 88  ASN A ND2 1 
ATOM 710   N N   . HIS A 1 94  ? -76.766  177.172 -33.332 1.00 0.00 ? 89  HIS A N   1 
ATOM 711   C CA  . HIS A 1 94  ? -76.379  178.617 -33.345 1.00 0.00 ? 89  HIS A CA  1 
ATOM 712   C C   . HIS A 1 94  ? -75.648  178.939 -32.039 1.00 0.00 ? 89  HIS A C   1 
ATOM 713   O O   . HIS A 1 94  ? -74.577  179.542 -32.081 1.00 0.00 ? 89  HIS A O   1 
ATOM 714   C CB  . HIS A 1 94  ? -77.582  179.582 -33.531 1.00 0.00 ? 89  HIS A CB  1 
ATOM 715   C CG  . HIS A 1 94  ? -77.323  181.078 -33.692 1.00 0.00 ? 89  HIS A CG  1 
ATOM 716   N ND1 . HIS A 1 94  ? -78.206  182.078 -33.401 1.00 0.00 ? 89  HIS A ND1 1 
ATOM 717   C CD2 . HIS A 1 94  ? -76.298  181.678 -34.353 1.00 0.00 ? 89  HIS A CD2 1 
ATOM 718   C CE1 . HIS A 1 94  ? -77.694  183.213 -33.821 1.00 0.00 ? 89  HIS A CE1 1 
ATOM 719   N NE2 . HIS A 1 94  ? -76.512  183.052 -34.463 1.00 0.00 ? 89  HIS A NE2 1 
ATOM 720   N N   . LYS A 1 95  ? -76.052  178.378 -30.888 1.00 0.00 ? 90  LYS A N   1 
ATOM 721   C CA  . LYS A 1 95  ? -75.282  178.518 -29.680 1.00 0.00 ? 90  LYS A CA  1 
ATOM 722   C C   . LYS A 1 95  ? -73.872  177.812 -29.792 1.00 0.00 ? 90  LYS A C   1 
ATOM 723   O O   . LYS A 1 95  ? -72.835  178.271 -29.214 1.00 0.00 ? 90  LYS A O   1 
ATOM 724   C CB  . LYS A 1 95  ? -76.060  177.964 -28.497 1.00 0.00 ? 90  LYS A CB  1 
ATOM 725   C CG  . LYS A 1 95  ? -77.353  178.789 -28.246 1.00 0.00 ? 90  LYS A CG  1 
ATOM 726   C CD  . LYS A 1 95  ? -78.187  178.240 -27.098 1.00 0.00 ? 90  LYS A CD  1 
ATOM 727   C CE  . LYS A 1 95  ? -79.446  179.081 -26.851 1.00 0.00 ? 90  LYS A CE  1 
ATOM 728   N NZ  . LYS A 1 95  ? -80.318  179.197 -28.041 1.00 0.00 ? 90  LYS A NZ  1 
ATOM 729   N N   . LEU A 1 96  ? -73.766  176.641 -30.502 1.00 0.00 ? 91  LEU A N   1 
ATOM 730   C CA  . LEU A 1 96  ? -72.477  175.901 -30.536 1.00 0.00 ? 91  LEU A CA  1 
ATOM 731   C C   . LEU A 1 96  ? -71.440  176.616 -31.423 1.00 0.00 ? 91  LEU A C   1 
ATOM 732   O O   . LEU A 1 96  ? -70.268  176.717 -30.945 1.00 0.00 ? 91  LEU A O   1 
ATOM 733   C CB  . LEU A 1 96  ? -72.832  174.481 -31.121 1.00 0.00 ? 91  LEU A CB  1 
ATOM 734   C CG  . LEU A 1 96  ? -73.758  173.545 -30.359 1.00 0.00 ? 91  LEU A CG  1 
ATOM 735   C CD1 . LEU A 1 96  ? -73.868  172.230 -31.014 1.00 0.00 ? 91  LEU A CD1 1 
ATOM 736   C CD2 . LEU A 1 96  ? -73.334  173.408 -28.890 1.00 0.00 ? 91  LEU A CD2 1 
ATOM 737   N N   . ASP A 1 97  ? -71.831  177.226 -32.574 1.00 0.00 ? 92  ASP A N   1 
ATOM 738   C CA  . ASP A 1 97  ? -70.943  177.972 -33.379 1.00 0.00 ? 92  ASP A CA  1 
ATOM 739   C C   . ASP A 1 97  ? -70.535  179.341 -32.717 1.00 0.00 ? 92  ASP A C   1 
ATOM 740   O O   . ASP A 1 97  ? -69.488  179.873 -32.931 1.00 0.00 ? 92  ASP A O   1 
ATOM 741   C CB  . ASP A 1 97  ? -71.536  178.238 -34.805 1.00 0.00 ? 92  ASP A CB  1 
ATOM 742   C CG  . ASP A 1 97  ? -71.479  176.925 -35.456 1.00 0.00 ? 92  ASP A CG  1 
ATOM 743   O OD1 . ASP A 1 97  ? -70.392  176.348 -35.754 1.00 0.00 ? 92  ASP A OD1 1 
ATOM 744   O OD2 . ASP A 1 97  ? -72.511  176.387 -35.788 1.00 0.00 ? 92  ASP A OD2 1 
ATOM 745   N N   . SER A 1 98  ? -71.428  179.977 -32.043 1.00 0.00 ? 93  SER A N   1 
ATOM 746   C CA  . SER A 1 98  ? -71.049  181.038 -31.170 1.00 0.00 ? 93  SER A CA  1 
ATOM 747   C C   . SER A 1 98  ? -70.076  180.591 -30.030 1.00 0.00 ? 93  SER A C   1 
ATOM 748   O O   . SER A 1 98  ? -69.071  181.256 -29.816 1.00 0.00 ? 93  SER A O   1 
ATOM 749   C CB  . SER A 1 98  ? -72.329  181.594 -30.549 1.00 0.00 ? 93  SER A CB  1 
ATOM 750   O OG  . SER A 1 98  ? -72.241  182.569 -29.520 1.00 0.00 ? 93  SER A OG  1 
ATOM 751   N N   . HIS A 1 99  ? -70.188  179.404 -29.386 1.00 0.00 ? 94  HIS A N   1 
ATOM 752   C CA  . HIS A 1 99  ? -69.379  179.084 -28.263 1.00 0.00 ? 94  HIS A CA  1 
ATOM 753   C C   . HIS A 1 99  ? -68.048  178.608 -28.737 1.00 0.00 ? 94  HIS A C   1 
ATOM 754   O O   . HIS A 1 99  ? -66.961  178.836 -28.169 1.00 0.00 ? 94  HIS A O   1 
ATOM 755   C CB  . HIS A 1 99  ? -70.070  178.042 -27.366 1.00 0.00 ? 94  HIS A CB  1 
ATOM 756   C CG  . HIS A 1 99  ? -69.479  177.999 -25.911 1.00 0.00 ? 94  HIS A CG  1 
ATOM 757   N ND1 . HIS A 1 99  ? -69.971  178.787 -24.899 1.00 0.00 ? 94  HIS A ND1 1 
ATOM 758   C CD2 . HIS A 1 99  ? -68.521  177.223 -25.334 1.00 0.00 ? 94  HIS A CD2 1 
ATOM 759   C CE1 . HIS A 1 99  ? -69.323  178.475 -23.771 1.00 0.00 ? 94  HIS A CE1 1 
ATOM 760   N NE2 . HIS A 1 99  ? -68.484  177.478 -23.954 1.00 0.00 ? 94  HIS A NE2 1 
ATOM 761   N N   . ALA A 1 100 ? -68.031  178.168 -30.035 1.00 0.00 ? 95  ALA A N   1 
ATOM 762   C CA  . ALA A 1 100 ? -66.757  177.733 -30.752 1.00 0.00 ? 95  ALA A CA  1 
ATOM 763   C C   . ALA A 1 100 ? -65.909  178.891 -31.143 1.00 0.00 ? 95  ALA A C   1 
ATOM 764   O O   . ALA A 1 100 ? -64.720  178.848 -30.915 1.00 0.00 ? 95  ALA A O   1 
ATOM 765   C CB  . ALA A 1 100 ? -67.107  176.874 -31.963 1.00 0.00 ? 95  ALA A CB  1 
ATOM 766   N N   . GLU A 1 101 ? -66.571  180.032 -31.606 1.00 0.00 ? 96  GLU A N   1 
ATOM 767   C CA  . GLU A 1 101 ? -66.034  181.350 -31.725 1.00 0.00 ? 96  GLU A CA  1 
ATOM 768   C C   . GLU A 1 101 ? -65.459  181.900 -30.402 1.00 0.00 ? 96  GLU A C   1 
ATOM 769   O O   . GLU A 1 101 ? -64.372  182.461 -30.299 1.00 0.00 ? 96  GLU A O   1 
ATOM 770   C CB  . GLU A 1 101 ? -67.075  182.433 -32.131 1.00 0.00 ? 96  GLU A CB  1 
ATOM 771   C CG  . GLU A 1 101 ? -66.512  183.709 -32.729 1.00 0.00 ? 96  GLU A CG  1 
ATOM 772   C CD  . GLU A 1 101 ? -67.575  184.600 -33.280 1.00 0.00 ? 96  GLU A CD  1 
ATOM 773   O OE1 . GLU A 1 101 ? -68.772  184.392 -33.026 1.00 0.00 ? 96  GLU A OE1 1 
ATOM 774   O OE2 . GLU A 1 101 ? -67.277  185.553 -33.991 1.00 0.00 ? 96  GLU A OE2 1 
ATOM 775   N N   . LEU A 1 102 ? -66.161  181.648 -29.254 1.00 0.00 ? 97  LEU A N   1 
ATOM 776   C CA  . LEU A 1 102 ? -65.661  182.042 -27.958 1.00 0.00 ? 97  LEU A CA  1 
ATOM 777   C C   . LEU A 1 102 ? -64.263  181.357 -27.677 1.00 0.00 ? 97  LEU A C   1 
ATOM 778   O O   . LEU A 1 102 ? -63.389  181.881 -27.003 1.00 0.00 ? 97  LEU A O   1 
ATOM 779   C CB  . LEU A 1 102 ? -66.707  181.696 -26.997 1.00 0.00 ? 97  LEU A CB  1 
ATOM 780   C CG  . LEU A 1 102 ? -66.314  181.969 -25.485 1.00 0.00 ? 97  LEU A CG  1 
ATOM 781   C CD1 . LEU A 1 102 ? -67.594  182.273 -24.687 1.00 0.00 ? 97  LEU A CD1 1 
ATOM 782   C CD2 . LEU A 1 102 ? -65.685  180.828 -24.725 1.00 0.00 ? 97  LEU A CD2 1 
ATOM 783   N N   . LEU A 1 103 ? -64.021  180.130 -28.106 1.00 0.00 ? 98  LEU A N   1 
ATOM 784   C CA  . LEU A 1 103 ? -62.675  179.425 -27.971 1.00 0.00 ? 98  LEU A CA  1 
ATOM 785   C C   . LEU A 1 103 ? -61.639  179.978 -28.790 1.00 0.00 ? 98  LEU A C   1 
ATOM 786   O O   . LEU A 1 103 ? -60.549  180.239 -28.348 1.00 0.00 ? 98  LEU A O   1 
ATOM 787   C CB  . LEU A 1 103 ? -62.641  177.885 -28.081 1.00 0.00 ? 98  LEU A CB  1 
ATOM 788   C CG  . LEU A 1 103 ? -63.546  177.268 -27.049 1.00 0.00 ? 98  LEU A CG  1 
ATOM 789   C CD1 . LEU A 1 103 ? -63.865  175.838 -27.450 1.00 0.00 ? 98  LEU A CD1 1 
ATOM 790   C CD2 . LEU A 1 103 ? -62.937  177.174 -25.625 1.00 0.00 ? 98  LEU A CD2 1 
ATOM 791   N N   . ASP A 1 104 ? -62.028  180.260 -30.030 1.00 0.00 ? 99  ASP A N   1 
ATOM 792   C CA  . ASP A 1 104 ? -61.067  180.844 -30.921 1.00 0.00 ? 99  ASP A CA  1 
ATOM 793   C C   . ASP A 1 104 ? -60.675  182.213 -30.440 1.00 0.00 ? 99  ASP A C   1 
ATOM 794   O O   . ASP A 1 104 ? -59.496  182.650 -30.471 1.00 0.00 ? 99  ASP A O   1 
ATOM 795   C CB  . ASP A 1 104 ? -61.642  180.860 -32.372 1.00 0.00 ? 99  ASP A CB  1 
ATOM 796   C CG  . ASP A 1 104 ? -61.408  179.504 -33.118 1.00 0.00 ? 99  ASP A CG  1 
ATOM 797   O OD1 . ASP A 1 104 ? -60.844  178.563 -32.550 1.00 0.00 ? 99  ASP A OD1 1 
ATOM 798   O OD2 . ASP A 1 104 ? -61.689  179.504 -34.319 1.00 0.00 ? 99  ASP A OD2 1 
ATOM 799   N N   . ALA A 1 105 ? -61.646  182.944 -29.862 1.00 0.00 ? 100 ALA A N   1 
ATOM 800   C CA  . ALA A 1 105 ? -61.375  184.113 -29.157 1.00 0.00 ? 100 ALA A CA  1 
ATOM 801   C C   . ALA A 1 105 ? -60.502  184.080 -27.933 1.00 0.00 ? 100 ALA A C   1 
ATOM 802   O O   . ALA A 1 105 ? -59.586  184.834 -27.738 1.00 0.00 ? 100 ALA A O   1 
ATOM 803   C CB  . ALA A 1 105 ? -62.763  184.733 -28.832 1.00 0.00 ? 100 ALA A CB  1 
ATOM 804   N N   . THR A 1 106 ? -60.699  183.029 -27.140 1.00 0.00 ? 101 THR A N   1 
ATOM 805   C CA  . THR A 1 106 ? -59.861  182.607 -26.089 1.00 0.00 ? 101 THR A CA  1 
ATOM 806   C C   . THR A 1 106 ? -58.397  182.354 -26.508 1.00 0.00 ? 101 THR A C   1 
ATOM 807   O O   . THR A 1 106 ? -57.465  182.717 -25.806 1.00 0.00 ? 101 THR A O   1 
ATOM 808   C CB  . THR A 1 106 ? -60.419  181.498 -25.264 1.00 0.00 ? 101 THR A CB  1 
ATOM 809   O OG1 . THR A 1 106 ? -61.838  181.584 -24.871 1.00 0.00 ? 101 THR A OG1 1 
ATOM 810   C CG2 . THR A 1 106 ? -59.624  181.399 -24.036 1.00 0.00 ? 101 THR A CG2 1 
ATOM 811   N N   . GLN A 1 107 ? -58.205  181.556 -27.571 1.00 0.00 ? 102 GLN A N   1 
ATOM 812   C CA  . GLN A 1 107 ? -56.948  181.221 -28.200 1.00 0.00 ? 102 GLN A CA  1 
ATOM 813   C C   . GLN A 1 107 ? -56.286  182.489 -28.604 1.00 0.00 ? 102 GLN A C   1 
ATOM 814   O O   . GLN A 1 107 ? -55.096  182.674 -28.285 1.00 0.00 ? 102 GLN A O   1 
ATOM 815   C CB  . GLN A 1 107 ? -57.156  180.170 -29.335 1.00 0.00 ? 102 GLN A CB  1 
ATOM 816   C CG  . GLN A 1 107 ? -55.814  179.530 -29.818 1.00 0.00 ? 102 GLN A CG  1 
ATOM 817   C CD  . GLN A 1 107 ? -56.092  178.242 -30.509 1.00 0.00 ? 102 GLN A CD  1 
ATOM 818   O OE1 . GLN A 1 107 ? -57.275  177.849 -30.579 1.00 0.00 ? 102 GLN A OE1 1 
ATOM 819   N NE2 . GLN A 1 107 ? -54.980  177.534 -31.004 1.00 0.00 ? 102 GLN A NE2 1 
ATOM 820   N N   . HIS A 1 108 ? -56.961  183.380 -29.263 1.00 0.00 ? 103 HIS A N   1 
ATOM 821   C CA  . HIS A 1 108 ? -56.418  184.668 -29.647 1.00 0.00 ? 103 HIS A CA  1 
ATOM 822   C C   . HIS A 1 108 ? -55.878  185.649 -28.621 1.00 0.00 ? 103 HIS A C   1 
ATOM 823   O O   . HIS A 1 108 ? -54.816  186.232 -28.677 1.00 0.00 ? 103 HIS A O   1 
ATOM 824   C CB  . HIS A 1 108 ? -57.444  185.385 -30.534 1.00 0.00 ? 103 HIS A CB  1 
ATOM 825   C CG  . HIS A 1 108 ? -57.004  186.641 -31.270 1.00 0.00 ? 103 HIS A CG  1 
ATOM 826   N ND1 . HIS A 1 108 ? -57.281  187.926 -30.789 1.00 0.00 ? 103 HIS A ND1 1 
ATOM 827   C CD2 . HIS A 1 108 ? -56.335  186.804 -32.484 1.00 0.00 ? 103 HIS A CD2 1 
ATOM 828   C CE1 . HIS A 1 108 ? -56.902  188.768 -31.773 1.00 0.00 ? 103 HIS A CE1 1 
ATOM 829   N NE2 . HIS A 1 108 ? -56.352  188.106 -32.814 1.00 0.00 ? 103 HIS A NE2 1 
ATOM 830   N N   . THR A 1 109 ? -56.716  185.792 -27.556 1.00 0.00 ? 104 THR A N   1 
ATOM 831   C CA  . THR A 1 109 ? -56.345  186.655 -26.438 1.00 0.00 ? 104 THR A CA  1 
ATOM 832   C C   . THR A 1 109 ? -55.083  186.113 -25.687 1.00 0.00 ? 104 THR A C   1 
ATOM 833   O O   . THR A 1 109 ? -54.146  186.880 -25.399 1.00 0.00 ? 104 THR A O   1 
ATOM 834   C CB  . THR A 1 109 ? -57.523  187.020 -25.470 1.00 0.00 ? 104 THR A CB  1 
ATOM 835   O OG1 . THR A 1 109 ? -57.152  187.876 -24.439 1.00 0.00 ? 104 THR A OG1 1 
ATOM 836   C CG2 . THR A 1 109 ? -58.141  185.762 -24.931 1.00 0.00 ? 104 THR A CG2 1 
ATOM 837   N N   . LEU A 1 110 ? -55.014  184.748 -25.491 1.00 0.00 ? 105 LEU A N   1 
ATOM 838   C CA  . LEU A 1 110 ? -53.837  184.114 -24.926 1.00 0.00 ? 105 LEU A CA  1 
ATOM 839   C C   . LEU A 1 110 ? -52.608  184.421 -25.749 1.00 0.00 ? 105 LEU A C   1 
ATOM 840   O O   . LEU A 1 110 ? -51.531  184.519 -25.162 1.00 0.00 ? 105 LEU A O   1 
ATOM 841   C CB  . LEU A 1 110 ? -54.173  182.574 -24.934 1.00 0.00 ? 105 LEU A CB  1 
ATOM 842   C CG  . LEU A 1 110 ? -53.191  181.743 -24.072 1.00 0.00 ? 105 LEU A CG  1 
ATOM 843   C CD1 . LEU A 1 110 ? -53.633  181.931 -22.620 1.00 0.00 ? 105 LEU A CD1 1 
ATOM 844   C CD2 . LEU A 1 110 ? -53.393  180.263 -24.445 1.00 0.00 ? 105 LEU A CD2 1 
ATOM 845   N N   . GLN A 1 111 ? -52.679  184.476 -27.116 1.00 0.00 ? 106 GLN A N   1 
ATOM 846   C CA  . GLN A 1 111 ? -51.542  184.793 -27.959 1.00 0.00 ? 106 GLN A CA  1 
ATOM 847   C C   . GLN A 1 111 ? -51.147  186.306 -27.871 1.00 0.00 ? 106 GLN A C   1 
ATOM 848   O O   . GLN A 1 111 ? -50.032  186.676 -27.544 1.00 0.00 ? 106 GLN A O   1 
ATOM 849   C CB  . GLN A 1 111 ? -51.870  184.416 -29.487 1.00 0.00 ? 106 GLN A CB  1 
ATOM 850   C CG  . GLN A 1 111 ? -50.798  184.531 -30.569 1.00 0.00 ? 106 GLN A CG  1 
ATOM 851   C CD  . GLN A 1 111 ? -49.598  183.558 -30.366 1.00 0.00 ? 106 GLN A CD  1 
ATOM 852   O OE1 . GLN A 1 111 ? -48.491  184.103 -30.103 1.00 0.00 ? 106 GLN A OE1 1 
ATOM 853   N NE2 . GLN A 1 111 ? -49.796  182.200 -30.516 1.00 0.00 ? 106 GLN A NE2 1 
ATOM 854   N N   . GLN A 1 112 ? -52.179  187.232 -27.940 1.00 0.00 ? 107 GLN A N   1 
ATOM 855   C CA  . GLN A 1 112 ? -52.002  188.668 -27.919 1.00 0.00 ? 107 GLN A CA  1 
ATOM 856   C C   . GLN A 1 112 ? -51.419  189.145 -26.669 1.00 0.00 ? 107 GLN A C   1 
ATOM 857   O O   . GLN A 1 112 ? -50.542  189.984 -26.603 1.00 0.00 ? 107 GLN A O   1 
ATOM 858   C CB  . GLN A 1 112 ? -53.391  189.298 -28.375 1.00 0.00 ? 107 GLN A CB  1 
ATOM 859   C CG  . GLN A 1 112 ? -53.214  190.855 -28.701 1.00 0.00 ? 107 GLN A CG  1 
ATOM 860   C CD  . GLN A 1 112 ? -54.513  191.603 -29.084 1.00 0.00 ? 107 GLN A CD  1 
ATOM 861   O OE1 . GLN A 1 112 ? -55.437  191.685 -28.271 1.00 0.00 ? 107 GLN A OE1 1 
ATOM 862   N NE2 . GLN A 1 112 ? -54.676  192.063 -30.395 1.00 0.00 ? 107 GLN A NE2 1 
ATOM 863   N N   . GLN A 1 113 ? -51.944  188.566 -25.555 1.00 0.00 ? 108 GLN A N   1 
ATOM 864   C CA  . GLN A 1 113 ? -51.559  188.883 -24.191 1.00 0.00 ? 108 GLN A CA  1 
ATOM 865   C C   . GLN A 1 113 ? -50.501  187.983 -23.621 1.00 0.00 ? 108 GLN A C   1 
ATOM 866   O O   . GLN A 1 113 ? -49.359  188.422 -23.662 1.00 0.00 ? 108 GLN A O   1 
ATOM 867   C CB  . GLN A 1 113 ? -52.745  188.903 -23.127 1.00 0.00 ? 108 GLN A CB  1 
ATOM 868   C CG  . GLN A 1 113 ? -53.772  190.074 -23.307 1.00 0.00 ? 108 GLN A CG  1 
ATOM 869   C CD  . GLN A 1 113 ? -54.290  190.483 -24.707 1.00 0.00 ? 108 GLN A CD  1 
ATOM 870   O OE1 . GLN A 1 113 ? -55.196  190.019 -25.341 1.00 0.00 ? 108 GLN A OE1 1 
ATOM 871   N NE2 . GLN A 1 113 ? -53.644  191.503 -25.259 1.00 0.00 ? 108 GLN A NE2 1 
ATOM 872   N N   . ILE A 1 114 ? -50.767  186.858 -22.916 1.00 0.00 ? 109 ILE A N   1 
ATOM 873   C CA  . ILE A 1 114 ? -49.865  186.036 -22.135 1.00 0.00 ? 109 ILE A CA  1 
ATOM 874   C C   . ILE A 1 114 ? -48.633  185.536 -22.890 1.00 0.00 ? 109 ILE A C   1 
ATOM 875   O O   . ILE A 1 114 ? -47.559  185.742 -22.378 1.00 0.00 ? 109 ILE A O   1 
ATOM 876   C CB  . ILE A 1 114 ? -50.621  184.926 -21.455 1.00 0.00 ? 109 ILE A CB  1 
ATOM 877   C CG1 . ILE A 1 114 ? -51.762  185.464 -20.591 1.00 0.00 ? 109 ILE A CG1 1 
ATOM 878   C CG2 . ILE A 1 114 ? -49.694  183.986 -20.580 1.00 0.00 ? 109 ILE A CG2 1 
ATOM 879   C CD1 . ILE A 1 114 ? -51.457  186.616 -19.620 1.00 0.00 ? 109 ILE A CD1 1 
ATOM 880   N N   . GLN A 1 115 ? -48.783  184.999 -24.083 1.00 0.00 ? 110 GLN A N   1 
ATOM 881   C CA  . GLN A 1 115 ? -47.616  184.595 -24.836 1.00 0.00 ? 110 GLN A CA  1 
ATOM 882   C C   . GLN A 1 115 ? -46.633  185.746 -25.241 1.00 0.00 ? 110 GLN A C   1 
ATOM 883   O O   . GLN A 1 115 ? -45.412  185.606 -25.031 1.00 0.00 ? 110 GLN A O   1 
ATOM 884   C CB  . GLN A 1 115 ? -48.081  183.672 -25.956 1.00 0.00 ? 110 GLN A CB  1 
ATOM 885   C CG  . GLN A 1 115 ? -46.878  183.300 -26.781 1.00 0.00 ? 110 GLN A CG  1 
ATOM 886   C CD  . GLN A 1 115 ? -45.711  182.590 -26.166 1.00 0.00 ? 110 GLN A CD  1 
ATOM 887   O OE1 . GLN A 1 115 ? -44.544  182.790 -26.540 1.00 0.00 ? 110 GLN A OE1 1 
ATOM 888   N NE2 . GLN A 1 115 ? -45.960  181.693 -25.191 1.00 0.00 ? 110 GLN A NE2 1 
ATOM 889   N N   . THR A 1 116 ? -47.184  186.896 -25.743 1.00 0.00 ? 111 THR A N   1 
ATOM 890   C CA  . THR A 1 116 ? -46.458  188.141 -25.985 1.00 0.00 ? 111 THR A CA  1 
ATOM 891   C C   . THR A 1 116 ? -45.709  188.562 -24.720 1.00 0.00 ? 111 THR A C   1 
ATOM 892   O O   . THR A 1 116 ? -44.600  189.018 -24.736 1.00 0.00 ? 111 THR A O   1 
ATOM 893   C CB  . THR A 1 116 ? -47.328  189.301 -26.423 1.00 0.00 ? 111 THR A CB  1 
ATOM 894   O OG1 . THR A 1 116 ? -48.111  189.008 -27.533 1.00 0.00 ? 111 THR A OG1 1 
ATOM 895   C CG2 . THR A 1 116 ? -46.627  190.622 -26.721 1.00 0.00 ? 111 THR A CG2 1 
ATOM 896   N N   . LEU A 1 117 ? -46.402  188.475 -23.564 1.00 0.00 ? 112 LEU A N   1 
ATOM 897   C CA  . LEU A 1 117 ? -45.885  188.786 -22.276 1.00 0.00 ? 112 LEU A CA  1 
ATOM 898   C C   . LEU A 1 117 ? -44.652  187.988 -21.753 1.00 0.00 ? 112 LEU A C   1 
ATOM 899   O O   . LEU A 1 117 ? -43.611  188.529 -21.395 1.00 0.00 ? 112 LEU A O   1 
ATOM 900   C CB  . LEU A 1 117 ? -47.090  188.923 -21.242 1.00 0.00 ? 112 LEU A CB  1 
ATOM 901   C CG  . LEU A 1 117 ? -46.721  189.704 -19.916 1.00 0.00 ? 112 LEU A CG  1 
ATOM 902   C CD1 . LEU A 1 117 ? -46.597  191.194 -20.236 1.00 0.00 ? 112 LEU A CD1 1 
ATOM 903   C CD2 . LEU A 1 117 ? -47.875  189.604 -18.846 1.00 0.00 ? 112 LEU A CD2 1 
ATOM 904   N N   . VAL A 1 118 ? -44.614  186.679 -21.874 1.00 0.00 ? 113 VAL A N   1 
ATOM 905   C CA  . VAL A 1 118 ? -43.528  185.843 -21.464 1.00 0.00 ? 113 VAL A CA  1 
ATOM 906   C C   . VAL A 1 118 ? -42.415  185.913 -22.537 1.00 0.00 ? 113 VAL A C   1 
ATOM 907   O O   . VAL A 1 118 ? -41.209  186.105 -22.265 1.00 0.00 ? 113 VAL A O   1 
ATOM 908   C CB  . VAL A 1 118 ? -43.967  184.392 -21.113 1.00 0.00 ? 113 VAL A CB  1 
ATOM 909   C CG1 . VAL A 1 118 ? -44.276  183.513 -22.373 1.00 0.00 ? 113 VAL A CG1 1 
ATOM 910   C CG2 . VAL A 1 118 ? -43.049  183.710 -20.154 1.00 0.00 ? 113 VAL A CG2 1 
ATOM 911   N N   . LYS A 1 119 ? -42.785  185.964 -23.826 1.00 0.00 ? 114 LYS A N   1 
ATOM 912   C CA  . LYS A 1 119 ? -41.917  186.097 -25.008 1.00 0.00 ? 114 LYS A CA  1 
ATOM 913   C C   . LYS A 1 119 ? -41.185  187.455 -25.041 1.00 0.00 ? 114 LYS A C   1 
ATOM 914   O O   . LYS A 1 119 ? -39.987  187.477 -25.089 1.00 0.00 ? 114 LYS A O   1 
ATOM 915   C CB  . LYS A 1 119 ? -42.747  185.899 -26.292 1.00 0.00 ? 114 LYS A CB  1 
ATOM 916   C CG  . LYS A 1 119 ? -41.802  185.644 -27.478 1.00 0.00 ? 114 LYS A CG  1 
ATOM 917   C CD  . LYS A 1 119 ? -42.460  185.278 -28.781 1.00 0.00 ? 114 LYS A CD  1 
ATOM 918   C CE  . LYS A 1 119 ? -42.728  186.560 -29.655 1.00 0.00 ? 114 LYS A CE  1 
ATOM 919   N NZ  . LYS A 1 119 ? -41.523  187.245 -30.098 1.00 0.00 ? 114 LYS A NZ  1 
ATOM 920   N N   . GLU A 1 120 ? -41.815  188.599 -24.978 1.00 0.00 ? 115 GLU A N   1 
ATOM 921   C CA  . GLU A 1 120 ? -41.203  189.900 -25.134 1.00 0.00 ? 115 GLU A CA  1 
ATOM 922   C C   . GLU A 1 120 ? -40.804  190.434 -23.746 1.00 0.00 ? 115 GLU A C   1 
ATOM 923   O O   . GLU A 1 120 ? -39.755  191.006 -23.560 1.00 0.00 ? 115 GLU A O   1 
ATOM 924   C CB  . GLU A 1 120 ? -42.203  190.826 -25.862 1.00 0.00 ? 115 GLU A CB  1 
ATOM 925   C CG  . GLU A 1 120 ? -42.390  190.313 -27.363 1.00 0.00 ? 115 GLU A CG  1 
ATOM 926   C CD  . GLU A 1 120 ? -41.087  190.236 -28.186 1.00 0.00 ? 115 GLU A CD  1 
ATOM 927   O OE1 . GLU A 1 120 ? -40.472  191.273 -28.448 1.00 0.00 ? 115 GLU A OE1 1 
ATOM 928   O OE2 . GLU A 1 120 ? -40.665  189.101 -28.601 1.00 0.00 ? 115 GLU A OE2 1 
ATOM 929   N N   . GLY A 1 121 ? -41.603  190.221 -22.693 1.00 0.00 ? 116 GLY A N   1 
ATOM 930   C CA  . GLY A 1 121 ? -41.652  191.209 -21.666 1.00 0.00 ? 116 GLY A CA  1 
ATOM 931   C C   . GLY A 1 121 ? -40.582  191.061 -20.628 1.00 0.00 ? 116 GLY A C   1 
ATOM 932   O O   . GLY A 1 121 ? -40.529  191.961 -19.804 1.00 0.00 ? 116 GLY A O   1 
ATOM 933   N N   . LEU A 1 122 ? -39.713  189.966 -20.644 1.00 0.00 ? 117 LEU A N   1 
ATOM 934   C CA  . LEU A 1 122 ? -38.641  189.925 -19.612 1.00 0.00 ? 117 LEU A CA  1 
ATOM 935   C C   . LEU A 1 122 ? -37.245  190.082 -20.257 1.00 0.00 ? 117 LEU A C   1 
ATOM 936   O O   . LEU A 1 122 ? -36.242  190.023 -19.575 1.00 0.00 ? 117 LEU A O   1 
ATOM 937   C CB  . LEU A 1 122 ? -38.640  188.707 -18.680 1.00 0.00 ? 117 LEU A CB  1 
ATOM 938   C CG  . LEU A 1 122 ? -39.880  188.626 -17.677 1.00 0.00 ? 117 LEU A CG  1 
ATOM 939   C CD1 . LEU A 1 122 ? -40.201  187.247 -17.155 1.00 0.00 ? 117 LEU A CD1 1 
ATOM 940   C CD2 . LEU A 1 122 ? -39.660  189.600 -16.513 1.00 0.00 ? 117 LEU A CD2 1 
ATOM 941   N N   . ARG A 1 123 ? -37.157  190.236 -21.637 1.00 0.00 ? 118 ARG A N   1 
ATOM 942   C CA  . ARG A 1 123 ? -35.973  190.290 -22.489 1.00 0.00 ? 118 ARG A CA  1 
ATOM 943   C C   . ARG A 1 123 ? -35.066  191.460 -22.077 1.00 0.00 ? 118 ARG A C   1 
ATOM 944   O O   . ARG A 1 123 ? -33.888  191.219 -21.882 1.00 0.00 ? 118 ARG A O   1 
ATOM 945   C CB  . ARG A 1 123 ? -36.395  190.543 -23.997 1.00 0.00 ? 118 ARG A CB  1 
ATOM 946   C CG  . ARG A 1 123 ? -35.215  190.427 -24.926 1.00 0.00 ? 118 ARG A CG  1 
ATOM 947   C CD  . ARG A 1 123 ? -35.492  190.722 -26.365 1.00 0.00 ? 118 ARG A CD  1 
ATOM 948   N NE  . ARG A 1 123 ? -36.315  189.605 -26.883 1.00 0.00 ? 118 ARG A NE  1 
ATOM 949   C CZ  . ARG A 1 123 ? -37.519  189.868 -27.371 1.00 0.00 ? 118 ARG A CZ  1 
ATOM 950   N NH1 . ARG A 1 123 ? -38.173  191.015 -27.238 1.00 0.00 ? 118 ARG A NH1 1 
ATOM 951   N NH2 . ARG A 1 123 ? -38.206  188.823 -27.803 1.00 0.00 ? 118 ARG A NH2 1 
ATOM 952   N N   . GLY A 1 124 ? -35.594  192.686 -22.078 1.00 0.00 ? 119 GLY A N   1 
ATOM 953   C CA  . GLY A 1 124 ? -34.826  193.862 -21.815 1.00 0.00 ? 119 GLY A CA  1 
ATOM 954   C C   . GLY A 1 124 ? -34.304  194.012 -20.348 1.00 0.00 ? 119 GLY A C   1 
ATOM 955   O O   . GLY A 1 124 ? -33.182  194.419 -20.147 1.00 0.00 ? 119 GLY A O   1 
ATOM 956   N N   . PHE A 1 125 ? -35.124  193.628 -19.348 1.00 0.00 ? 120 PHE A N   1 
ATOM 957   C CA  . PHE A 1 125 ? -34.671  193.349 -17.962 1.00 0.00 ? 120 PHE A CA  1 
ATOM 958   C C   . PHE A 1 125 ? -33.634  192.254 -17.806 1.00 0.00 ? 120 PHE A C   1 
ATOM 959   O O   . PHE A 1 125 ? -32.585  192.489 -17.221 1.00 0.00 ? 120 PHE A O   1 
ATOM 960   C CB  . PHE A 1 125 ? -35.885  193.001 -17.123 1.00 0.00 ? 120 PHE A CB  1 
ATOM 961   C CG  . PHE A 1 125 ? -35.524  192.982 -15.597 1.00 0.00 ? 120 PHE A CG  1 
ATOM 962   C CD1 . PHE A 1 125 ? -34.811  193.986 -14.972 1.00 0.00 ? 120 PHE A CD1 1 
ATOM 963   C CD2 . PHE A 1 125 ? -36.126  191.965 -14.762 1.00 0.00 ? 120 PHE A CD2 1 
ATOM 964   C CE1 . PHE A 1 125 ? -34.566  193.978 -13.606 1.00 0.00 ? 120 PHE A CE1 1 
ATOM 965   C CE2 . PHE A 1 125 ? -35.841  191.954 -13.396 1.00 0.00 ? 120 PHE A CE2 1 
ATOM 966   C CZ  . PHE A 1 125 ? -35.057  192.942 -12.761 1.00 0.00 ? 120 PHE A CZ  1 
ATOM 967   N N   . ARG A 1 126 ? -33.722  191.050 -18.361 1.00 0.00 ? 121 ARG A N   1 
ATOM 968   C CA  . ARG A 1 126 ? -32.660  190.021 -18.298 1.00 0.00 ? 121 ARG A CA  1 
ATOM 969   C C   . ARG A 1 126 ? -31.314  190.423 -19.024 1.00 0.00 ? 121 ARG A C   1 
ATOM 970   O O   . ARG A 1 126 ? -30.232  190.204 -18.572 1.00 0.00 ? 121 ARG A O   1 
ATOM 971   C CB  . ARG A 1 126 ? -33.268  188.680 -18.801 1.00 0.00 ? 121 ARG A CB  1 
ATOM 972   C CG  . ARG A 1 126 ? -34.147  188.098 -17.676 1.00 0.00 ? 121 ARG A CG  1 
ATOM 973   C CD  . ARG A 1 126 ? -35.094  187.014 -18.084 1.00 0.00 ? 121 ARG A CD  1 
ATOM 974   N NE  . ARG A 1 126 ? -35.758  186.520 -16.850 1.00 0.00 ? 121 ARG A NE  1 
ATOM 975   C CZ  . ARG A 1 126 ? -36.673  185.572 -16.757 1.00 0.00 ? 121 ARG A CZ  1 
ATOM 976   N NH1 . ARG A 1 126 ? -37.295  185.202 -17.870 1.00 0.00 ? 121 ARG A NH1 1 
ATOM 977   N NH2 . ARG A 1 126 ? -37.032  185.103 -15.602 1.00 0.00 ? 121 ARG A NH2 1 
ATOM 978   N N   . GLU A 1 127 ? -31.380  191.127 -20.197 1.00 0.00 ? 122 GLU A N   1 
ATOM 979   C CA  . GLU A 1 127 ? -30.196  191.745 -20.785 1.00 0.00 ? 122 GLU A CA  1 
ATOM 980   C C   . GLU A 1 127 ? -29.585  192.861 -19.927 1.00 0.00 ? 122 GLU A C   1 
ATOM 981   O O   . GLU A 1 127 ? -28.346  192.993 -19.988 1.00 0.00 ? 122 GLU A O   1 
ATOM 982   C CB  . GLU A 1 127 ? -30.534  192.340 -22.112 1.00 0.00 ? 122 GLU A CB  1 
ATOM 983   C CG  . GLU A 1 127 ? -30.591  191.126 -23.114 1.00 0.00 ? 122 GLU A CG  1 
ATOM 984   C CD  . GLU A 1 127 ? -29.256  190.668 -23.399 1.00 0.00 ? 122 GLU A CD  1 
ATOM 985   O OE1 . GLU A 1 127 ? -28.565  191.344 -24.226 1.00 0.00 ? 122 GLU A OE1 1 
ATOM 986   O OE2 . GLU A 1 127 ? -28.839  189.651 -22.813 1.00 0.00 ? 122 GLU A OE2 1 
ATOM 987   N N   . ALA A 1 128 ? -30.346  193.673 -19.199 1.00 0.00 ? 123 ALA A N   1 
ATOM 988   C CA  . ALA A 1 128 ? -29.855  194.608 -18.214 1.00 0.00 ? 123 ALA A CA  1 
ATOM 989   C C   . ALA A 1 128 ? -29.246  193.943 -16.968 1.00 0.00 ? 123 ALA A C   1 
ATOM 990   O O   . ALA A 1 128 ? -28.174  194.280 -16.500 1.00 0.00 ? 123 ALA A O   1 
ATOM 991   C CB  . ALA A 1 128 ? -31.056  195.595 -17.717 1.00 0.00 ? 123 ALA A CB  1 
ATOM 992   N N   . ARG A 1 129 ? -29.838  192.801 -16.506 1.00 0.00 ? 124 ARG A N   1 
ATOM 993   C CA  . ARG A 1 129 ? -29.336  191.897 -15.478 1.00 0.00 ? 124 ARG A CA  1 
ATOM 994   C C   . ARG A 1 129 ? -28.002  191.307 -15.898 1.00 0.00 ? 124 ARG A C   1 
ATOM 995   O O   . ARG A 1 129 ? -27.127  191.096 -15.093 1.00 0.00 ? 124 ARG A O   1 
ATOM 996   C CB  . ARG A 1 129 ? -30.351  190.808 -15.281 1.00 0.00 ? 124 ARG A CB  1 
ATOM 997   C CG  . ARG A 1 129 ? -30.334  189.922 -14.020 1.00 0.00 ? 124 ARG A CG  1 
ATOM 998   C CD  . ARG A 1 129 ? -29.464  188.616 -14.074 1.00 0.00 ? 124 ARG A CD  1 
ATOM 999   N NE  . ARG A 1 129 ? -30.084  187.550 -13.216 1.00 0.00 ? 124 ARG A NE  1 
ATOM 1000  C CZ  . ARG A 1 129 ? -29.353  186.488 -12.800 1.00 0.00 ? 124 ARG A CZ  1 
ATOM 1001  N NH1 . ARG A 1 129 ? -28.243  186.086 -13.416 1.00 0.00 ? 124 ARG A NH1 1 
ATOM 1002  N NH2 . ARG A 1 129 ? -29.877  185.822 -11.829 1.00 0.00 ? 124 ARG A NH2 1 
ATOM 1003  N N   . ARG A 1 130 ? -27.788  190.916 -17.194 1.00 0.00 ? 125 ARG A N   1 
ATOM 1004  C CA  . ARG A 1 130 ? -26.591  190.273 -17.647 1.00 0.00 ? 125 ARG A CA  1 
ATOM 1005  C C   . ARG A 1 130 ? -25.338  191.156 -17.550 1.00 0.00 ? 125 ARG A C   1 
ATOM 1006  O O   . ARG A 1 130 ? -24.324  190.823 -16.932 1.00 0.00 ? 125 ARG A O   1 
ATOM 1007  C CB  . ARG A 1 130 ? -26.808  189.805 -19.082 1.00 0.00 ? 125 ARG A CB  1 
ATOM 1008  C CG  . ARG A 1 130 ? -25.647  188.923 -19.622 1.00 0.00 ? 125 ARG A CG  1 
ATOM 1009  C CD  . ARG A 1 130 ? -26.023  188.095 -20.844 1.00 0.00 ? 125 ARG A CD  1 
ATOM 1010  N NE  . ARG A 1 130 ? -26.431  189.084 -21.870 1.00 0.00 ? 125 ARG A NE  1 
ATOM 1011  C CZ  . ARG A 1 130 ? -25.619  189.915 -22.574 1.00 0.00 ? 125 ARG A CZ  1 
ATOM 1012  N NH1 . ARG A 1 130 ? -24.328  190.095 -22.322 1.00 0.00 ? 125 ARG A NH1 1 
ATOM 1013  N NH2 . ARG A 1 130 ? -26.144  190.644 -23.568 1.00 0.00 ? 125 ARG A NH2 1 
ATOM 1014  N N   . ASP A 1 131 ? -25.388  192.311 -18.186 1.00 0.00 ? 126 ASP A N   1 
ATOM 1015  C CA  . ASP A 1 131 ? -24.444  193.452 -18.119 1.00 0.00 ? 126 ASP A CA  1 
ATOM 1016  C C   . ASP A 1 131 ? -24.216  194.048 -16.715 1.00 0.00 ? 126 ASP A C   1 
ATOM 1017  O O   . ASP A 1 131 ? -23.096  194.194 -16.265 1.00 0.00 ? 126 ASP A O   1 
ATOM 1018  C CB  . ASP A 1 131 ? -24.934  194.439 -19.159 1.00 0.00 ? 126 ASP A CB  1 
ATOM 1019  C CG  . ASP A 1 131 ? -23.758  195.278 -19.618 1.00 0.00 ? 126 ASP A CG  1 
ATOM 1020  O OD1 . ASP A 1 131 ? -22.690  194.691 -19.986 1.00 0.00 ? 126 ASP A OD1 1 
ATOM 1021  O OD2 . ASP A 1 131 ? -23.838  196.551 -19.655 1.00 0.00 ? 126 ASP A OD2 1 
ATOM 1022  N N   . PHE A 1 132 ? -25.285  194.172 -15.828 1.00 0.00 ? 127 PHE A N   1 
ATOM 1023  C CA  . PHE A 1 132 ? -25.160  194.582 -14.442 1.00 0.00 ? 127 PHE A CA  1 
ATOM 1024  C C   . PHE A 1 132 ? -24.320  193.640 -13.645 1.00 0.00 ? 127 PHE A C   1 
ATOM 1025  O O   . PHE A 1 132 ? -23.573  194.059 -12.802 1.00 0.00 ? 127 PHE A O   1 
ATOM 1026  C CB  . PHE A 1 132 ? -26.611  194.654 -13.881 1.00 0.00 ? 127 PHE A CB  1 
ATOM 1027  C CG  . PHE A 1 132 ? -26.907  195.105 -12.486 1.00 0.00 ? 127 PHE A CG  1 
ATOM 1028  C CD1 . PHE A 1 132 ? -26.393  196.276 -11.930 1.00 0.00 ? 127 PHE A CD1 1 
ATOM 1029  C CD2 . PHE A 1 132 ? -27.683  194.250 -11.641 1.00 0.00 ? 127 PHE A CD2 1 
ATOM 1030  C CE1 . PHE A 1 132 ? -26.648  196.638 -10.582 1.00 0.00 ? 127 PHE A CE1 1 
ATOM 1031  C CE2 . PHE A 1 132 ? -27.852  194.587 -10.287 1.00 0.00 ? 127 PHE A CE2 1 
ATOM 1032  C CZ  . PHE A 1 132 ? -27.393  195.798 -9.804  1.00 0.00 ? 127 PHE A CZ  1 
ATOM 1033  N N   . TRP A 1 133 ? -24.439  192.296 -13.838 1.00 0.00 ? 128 TRP A N   1 
ATOM 1034  C CA  . TRP A 1 133 ? -23.618  191.385 -13.123 1.00 0.00 ? 128 TRP A CA  1 
ATOM 1035  C C   . TRP A 1 133 ? -22.202  191.154 -13.707 1.00 0.00 ? 128 TRP A C   1 
ATOM 1036  O O   . TRP A 1 133 ? -21.246  190.906 -13.058 1.00 0.00 ? 128 TRP A O   1 
ATOM 1037  C CB  . TRP A 1 133 ? -24.245  189.984 -13.088 1.00 0.00 ? 128 TRP A CB  1 
ATOM 1038  C CG  . TRP A 1 133 ? -25.454  189.747 -12.174 1.00 0.00 ? 128 TRP A CG  1 
ATOM 1039  C CD1 . TRP A 1 133 ? -26.402  190.587 -11.647 1.00 0.00 ? 128 TRP A CD1 1 
ATOM 1040  C CD2 . TRP A 1 133 ? -25.645  188.477 -11.411 1.00 0.00 ? 128 TRP A CD2 1 
ATOM 1041  N NE1 . TRP A 1 133 ? -27.245  189.936 -10.727 1.00 0.00 ? 128 TRP A NE1 1 
ATOM 1042  C CE2 . TRP A 1 133 ? -26.781  188.665 -10.596 1.00 0.00 ? 128 TRP A CE2 1 
ATOM 1043  C CE3 . TRP A 1 133 ? -24.982  187.246 -11.473 1.00 0.00 ? 128 TRP A CE3 1 
ATOM 1044  C CZ2 . TRP A 1 133 ? -27.016  187.733 -9.628  1.00 0.00 ? 128 TRP A CZ2 1 
ATOM 1045  C CZ3 . TRP A 1 133 ? -25.304  186.221 -10.617 1.00 0.00 ? 128 TRP A CZ3 1 
ATOM 1046  C CH2 . TRP A 1 133 ? -26.257  186.506 -9.644  1.00 0.00 ? 128 TRP A CH2 1 
ATOM 1047  N N   . ARG A 1 134 ? -22.147  191.405 -15.044 1.00 0.00 ? 129 ARG A N   1 
ATOM 1048  C CA  . ARG A 1 134 ? -20.812  191.615 -15.706 1.00 0.00 ? 129 ARG A CA  1 
ATOM 1049  C C   . ARG A 1 134 ? -19.943  192.776 -15.242 1.00 0.00 ? 129 ARG A C   1 
ATOM 1050  O O   . ARG A 1 134 ? -18.731  192.682 -15.132 1.00 0.00 ? 129 ARG A O   1 
ATOM 1051  C CB  . ARG A 1 134 ? -21.061  191.759 -17.250 1.00 0.00 ? 129 ARG A CB  1 
ATOM 1052  C CG  . ARG A 1 134 ? -19.810  191.558 -18.100 1.00 0.00 ? 129 ARG A CG  1 
ATOM 1053  C CD  . ARG A 1 134 ? -20.142  191.027 -19.463 1.00 0.00 ? 129 ARG A CD  1 
ATOM 1054  N NE  . ARG A 1 134 ? -20.671  192.259 -20.166 1.00 0.00 ? 129 ARG A NE  1 
ATOM 1055  C CZ  . ARG A 1 134 ? -20.443  192.656 -21.464 1.00 0.00 ? 129 ARG A CZ  1 
ATOM 1056  N NH1 . ARG A 1 134 ? -19.608  192.030 -22.230 1.00 0.00 ? 129 ARG A NH1 1 
ATOM 1057  N NH2 . ARG A 1 134 ? -21.181  193.628 -21.964 1.00 0.00 ? 129 ARG A NH2 1 
ATOM 1058  N N   . GLY A 1 135 ? -20.631  193.871 -14.869 1.00 0.00 ? 130 GLY A N   1 
ATOM 1059  C CA  . GLY A 1 135 ? -20.175  195.121 -14.263 1.00 0.00 ? 130 GLY A CA  1 
ATOM 1060  C C   . GLY A 1 135 ? -19.866  194.994 -12.839 1.00 0.00 ? 130 GLY A C   1 
ATOM 1061  O O   . GLY A 1 135 ? -19.008  195.773 -12.391 1.00 0.00 ? 130 GLY A O   1 
ATOM 1062  N N   . ALA A 1 136 ? -20.554  194.069 -12.136 1.00 0.00 ? 131 ALA A N   1 
ATOM 1063  C CA  . ALA A 1 136 ? -20.201  193.665 -10.873 1.00 0.00 ? 131 ALA A CA  1 
ATOM 1064  C C   . ALA A 1 136 ? -18.910  192.924 -10.754 1.00 0.00 ? 131 ALA A C   1 
ATOM 1065  O O   . ALA A 1 136 ? -17.992  193.240 -10.019 1.00 0.00 ? 131 ALA A O   1 
ATOM 1066  C CB  . ALA A 1 136 ? -21.281  192.852 -10.206 1.00 0.00 ? 131 ALA A CB  1 
ATOM 1067  N N   . GLU A 1 137 ? -18.735  192.047 -11.755 1.00 0.00 ? 132 GLU A N   1 
ATOM 1068  C CA  . GLU A 1 137 ? -17.581  191.290 -12.029 1.00 0.00 ? 132 GLU A CA  1 
ATOM 1069  C C   . GLU A 1 137 ? -16.360  192.198 -12.314 1.00 0.00 ? 132 GLU A C   1 
ATOM 1070  O O   . GLU A 1 137 ? -15.245  192.004 -11.870 1.00 0.00 ? 132 GLU A O   1 
ATOM 1071  C CB  . GLU A 1 137 ? -17.809  190.185 -13.089 1.00 0.00 ? 132 GLU A CB  1 
ATOM 1072  C CG  . GLU A 1 137 ? -16.522  189.368 -13.225 1.00 0.00 ? 132 GLU A CG  1 
ATOM 1073  C CD  . GLU A 1 137 ? -16.668  188.225 -14.138 1.00 0.00 ? 132 GLU A CD  1 
ATOM 1074  O OE1 . GLU A 1 137 ? -16.854  188.484 -15.338 1.00 0.00 ? 132 GLU A OE1 1 
ATOM 1075  O OE2 . GLU A 1 137 ? -16.564  187.077 -13.686 1.00 0.00 ? 132 GLU A OE2 1 
ATOM 1076  N N   . SER A 1 138 ? -16.587  193.176 -13.202 1.00 0.00 ? 133 SER A N   1 
ATOM 1077  C CA  . SER A 1 138 ? -15.686  194.199 -13.580 1.00 0.00 ? 133 SER A CA  1 
ATOM 1078  C C   . SER A 1 138 ? -15.299  195.065 -12.422 1.00 0.00 ? 133 SER A C   1 
ATOM 1079  O O   . SER A 1 138 ? -14.150  195.477 -12.231 1.00 0.00 ? 133 SER A O   1 
ATOM 1080  C CB  . SER A 1 138 ? -16.149  195.084 -14.794 1.00 0.00 ? 133 SER A CB  1 
ATOM 1081  O OG  . SER A 1 138 ? -15.121  195.943 -15.205 1.00 0.00 ? 133 SER A OG  1 
ATOM 1082  N N   . LEU A 1 139 ? -16.283  195.459 -11.565 1.00 0.00 ? 134 LEU A N   1 
ATOM 1083  C CA  . LEU A 1 139 ? -16.065  196.180 -10.324 1.00 0.00 ? 134 LEU A CA  1 
ATOM 1084  C C   . LEU A 1 139 ? -15.229  195.360 -9.380  1.00 0.00 ? 134 LEU A C   1 
ATOM 1085  O O   . LEU A 1 139 ? -14.295  195.952 -8.757  1.00 0.00 ? 134 LEU A O   1 
ATOM 1086  C CB  . LEU A 1 139 ? -17.355  196.593 -9.618  1.00 0.00 ? 134 LEU A CB  1 
ATOM 1087  C CG  . LEU A 1 139 ? -17.167  197.514 -8.349  1.00 0.00 ? 134 LEU A CG  1 
ATOM 1088  C CD1 . LEU A 1 139 ? -16.627  198.933 -8.612  1.00 0.00 ? 134 LEU A CD1 1 
ATOM 1089  C CD2 . LEU A 1 139 ? -18.443  197.536 -7.575  1.00 0.00 ? 134 LEU A CD2 1 
ATOM 1090  N N   . GLU A 1 140 ? -15.484  194.043 -9.181  1.00 0.00 ? 135 GLU A N   1 
ATOM 1091  C CA  . GLU A 1 140 ? -14.702  193.264 -8.239  1.00 0.00 ? 135 GLU A CA  1 
ATOM 1092  C C   . GLU A 1 140 ? -13.233  193.147 -8.672  1.00 0.00 ? 135 GLU A C   1 
ATOM 1093  O O   . GLU A 1 140 ? -12.304  193.298 -7.813  1.00 0.00 ? 135 GLU A O   1 
ATOM 1094  C CB  . GLU A 1 140 ? -15.361  191.925 -7.988  1.00 0.00 ? 135 GLU A CB  1 
ATOM 1095  C CG  . GLU A 1 140 ? -14.840  191.124 -6.812  1.00 0.00 ? 135 GLU A CG  1 
ATOM 1096  C CD  . GLU A 1 140 ? -15.660  189.787 -6.702  1.00 0.00 ? 135 GLU A CD  1 
ATOM 1097  O OE1 . GLU A 1 140 ? -16.876  189.868 -6.595  1.00 0.00 ? 135 GLU A OE1 1 
ATOM 1098  O OE2 . GLU A 1 140 ? -14.978  188.709 -6.535  1.00 0.00 ? 135 GLU A OE2 1 
ATOM 1099  N N   . ALA A 1 141 ? -12.908  192.888 -9.969  1.00 0.00 ? 136 ALA A N   1 
ATOM 1100  C CA  . ALA A 1 141 ? -11.530  192.960 -10.352 1.00 0.00 ? 136 ALA A CA  1 
ATOM 1101  C C   . ALA A 1 141 ? -10.809  194.314 -10.392 1.00 0.00 ? 136 ALA A C   1 
ATOM 1102  O O   . ALA A 1 141 ? -9.606   194.475 -10.078 1.00 0.00 ? 136 ALA A O   1 
ATOM 1103  C CB  . ALA A 1 141 ? -11.368  192.266 -11.699 1.00 0.00 ? 136 ALA A CB  1 
ATOM 1104  N N   . ALA A 1 142 ? -11.616  195.331 -10.641 1.00 0.00 ? 137 ALA A N   1 
ATOM 1105  C CA  . ALA A 1 142 ? -11.317  196.718 -10.440 1.00 0.00 ? 137 ALA A CA  1 
ATOM 1106  C C   . ALA A 1 142 ? -10.907  197.098 -9.062  1.00 0.00 ? 137 ALA A C   1 
ATOM 1107  O O   . ALA A 1 142 ? -9.957   197.778 -8.728  1.00 0.00 ? 137 ALA A O   1 
ATOM 1108  C CB  . ALA A 1 142 ? -12.430  197.604 -10.999 1.00 0.00 ? 137 ALA A CB  1 
ATOM 1109  N N   . LEU A 1 143 ? -11.695  196.619 -8.036  1.00 0.00 ? 138 LEU A N   1 
ATOM 1110  C CA  . LEU A 1 143 ? -11.295  196.720 -6.606  1.00 0.00 ? 138 LEU A CA  1 
ATOM 1111  C C   . LEU A 1 143 ? -9.991   195.886 -6.363  1.00 0.00 ? 138 LEU A C   1 
ATOM 1112  O O   . LEU A 1 143 ? -9.092   196.260 -5.595  1.00 0.00 ? 138 LEU A O   1 
ATOM 1113  C CB  . LEU A 1 143 ? -12.367  196.228 -5.618  1.00 0.00 ? 138 LEU A CB  1 
ATOM 1114  C CG  . LEU A 1 143 ? -13.737  196.943 -5.564  1.00 0.00 ? 138 LEU A CG  1 
ATOM 1115  C CD1 . LEU A 1 143 ? -14.728  196.080 -4.837  1.00 0.00 ? 138 LEU A CD1 1 
ATOM 1116  C CD2 . LEU A 1 143 ? -13.604  198.380 -5.063  1.00 0.00 ? 138 LEU A CD2 1 
ATOM 1117  N N   . THR A 1 144 ? -9.895   194.649 -6.952  1.00 0.00 ? 139 THR A N   1 
ATOM 1118  C CA  . THR A 1 144 ? -8.833   193.708 -6.804  1.00 0.00 ? 139 THR A CA  1 
ATOM 1119  C C   . THR A 1 144 ? -7.475   194.210 -7.261  1.00 0.00 ? 139 THR A C   1 
ATOM 1120  O O   . THR A 1 144 ? -6.497   194.335 -6.604  1.00 0.00 ? 139 THR A O   1 
ATOM 1121  C CB  . THR A 1 144 ? -9.082   192.342 -7.461  1.00 0.00 ? 139 THR A CB  1 
ATOM 1122  O OG1 . THR A 1 144 ? -10.296  191.649 -7.072  1.00 0.00 ? 139 THR A OG1 1 
ATOM 1123  C CG2 . THR A 1 144 ? -7.919   191.351 -7.241  1.00 0.00 ? 139 THR A CG2 1 
ATOM 1124  N N   . HIS A 1 145 ? -7.538   194.861 -8.407  1.00 0.00 ? 140 HIS A N   1 
ATOM 1125  C CA  . HIS A 1 145 ? -6.381   195.555 -8.993  1.00 0.00 ? 140 HIS A CA  1 
ATOM 1126  C C   . HIS A 1 145 ? -6.044   196.878 -8.392  1.00 0.00 ? 140 HIS A C   1 
ATOM 1127  O O   . HIS A 1 145 ? -4.904   197.288 -8.328  1.00 0.00 ? 140 HIS A O   1 
ATOM 1128  C CB  . HIS A 1 145 ? -6.457   195.661 -10.531 1.00 0.00 ? 140 HIS A CB  1 
ATOM 1129  C CG  . HIS A 1 145 ? -6.326   194.315 -11.240 1.00 0.00 ? 140 HIS A CG  1 
ATOM 1130  N ND1 . HIS A 1 145 ? -5.158   193.554 -11.240 1.00 0.00 ? 140 HIS A ND1 1 
ATOM 1131  C CD2 . HIS A 1 145 ? -7.233   193.571 -11.954 1.00 0.00 ? 140 HIS A CD2 1 
ATOM 1132  C CE1 . HIS A 1 145 ? -5.360   192.480 -12.030 1.00 0.00 ? 140 HIS A CE1 1 
ATOM 1133  N NE2 . HIS A 1 145 ? -6.613   192.485 -12.542 1.00 0.00 ? 140 HIS A NE2 1 
ATOM 1134  N N   . ASN A 1 146 ? -7.058   197.543 -7.770  1.00 0.00 ? 141 ASN A N   1 
ATOM 1135  C CA  . ASN A 1 146 ? -6.853   198.733 -6.972  1.00 0.00 ? 141 ASN A CA  1 
ATOM 1136  C C   . ASN A 1 146 ? -6.197   198.450 -5.592  1.00 0.00 ? 141 ASN A C   1 
ATOM 1137  O O   . ASN A 1 146 ? -5.346   199.062 -4.981  1.00 0.00 ? 141 ASN A O   1 
ATOM 1138  C CB  . ASN A 1 146 ? -8.146   199.663 -6.821  1.00 0.00 ? 141 ASN A CB  1 
ATOM 1139  C CG  . ASN A 1 146 ? -7.936   201.041 -6.209  1.00 0.00 ? 141 ASN A CG  1 
ATOM 1140  O OD1 . ASN A 1 146 ? -7.182   201.917 -6.684  1.00 0.00 ? 141 ASN A OD1 1 
ATOM 1141  N ND2 . ASN A 1 146 ? -8.609   201.265 -5.064  1.00 0.00 ? 141 ASN A ND2 1 
ATOM 1142  N N   . ALA A 1 147 ? -6.617   197.354 -4.944  1.00 0.00 ? 142 ALA A N   1 
ATOM 1143  C CA  . ALA A 1 147 ? -6.010   196.976 -3.695  1.00 0.00 ? 142 ALA A CA  1 
ATOM 1144  C C   . ALA A 1 147 ? -4.611   196.325 -3.785  1.00 0.00 ? 142 ALA A C   1 
ATOM 1145  O O   . ALA A 1 147 ? -3.890   196.567 -2.848  1.00 0.00 ? 142 ALA A O   1 
ATOM 1146  C CB  . ALA A 1 147 ? -6.964   196.115 -2.912  1.00 0.00 ? 142 ALA A CB  1 
ATOM 1147  N N   . GLU A 1 148 ? -4.279   195.484 -4.813  1.00 0.00 ? 143 GLU A N   1 
ATOM 1148  C CA  . GLU A 1 148 ? -3.050   194.737 -4.688  1.00 0.00 ? 143 GLU A CA  1 
ATOM 1149  C C   . GLU A 1 148 ? -1.759   195.444 -5.178  1.00 0.00 ? 143 GLU A C   1 
ATOM 1150  O O   . GLU A 1 148 ? -0.672   194.977 -4.968  1.00 0.00 ? 143 GLU A O   1 
ATOM 1151  C CB  . GLU A 1 148 ? -3.093   193.391 -5.525  1.00 0.00 ? 143 GLU A CB  1 
ATOM 1152  C CG  . GLU A 1 148 ? -4.183   192.400 -4.923  1.00 0.00 ? 143 GLU A CG  1 
ATOM 1153  C CD  . GLU A 1 148 ? -3.785   191.780 -3.532  1.00 0.00 ? 143 GLU A CD  1 
ATOM 1154  O OE1 . GLU A 1 148 ? -2.616   191.290 -3.346  1.00 0.00 ? 143 GLU A OE1 1 
ATOM 1155  O OE2 . GLU A 1 148 ? -4.662   191.878 -2.661  1.00 0.00 ? 143 GLU A OE2 1 
ATOM 1156  N N   . VAL A 1 149 ? -1.772   196.678 -5.748  1.00 0.00 ? 144 VAL A N   1 
ATOM 1157  C CA  . VAL A 1 149 ? -0.678   197.419 -6.148  1.00 0.00 ? 144 VAL A CA  1 
ATOM 1158  C C   . VAL A 1 149 ? 0.197    197.862 -4.927  1.00 0.00 ? 144 VAL A C   1 
ATOM 1159  O O   . VAL A 1 149 ? -0.322   198.273 -3.922  1.00 0.00 ? 144 VAL A O   1 
ATOM 1160  C CB  . VAL A 1 149 ? -1.098   198.615 -7.000  1.00 0.00 ? 144 VAL A CB  1 
ATOM 1161  C CG1 . VAL A 1 149 ? -1.843   199.662 -6.145  1.00 0.00 ? 144 VAL A CG1 1 
ATOM 1162  C CG2 . VAL A 1 149 ? 0.166    199.204 -7.656  1.00 0.00 ? 144 VAL A CG2 1 
ATOM 1163  N N   . PRO A 1 150 ? 1.578    197.852 -4.948  1.00 0.00 ? 145 PRO A N   1 
ATOM 1164  C CA  . PRO A 1 150 ? 2.341    198.500 -3.917  1.00 0.00 ? 145 PRO A CA  1 
ATOM 1165  C C   . PRO A 1 150 ? 2.469    200.018 -4.026  1.00 0.00 ? 145 PRO A C   1 
ATOM 1166  O O   . PRO A 1 150 ? 2.636    200.649 -5.096  1.00 0.00 ? 145 PRO A O   1 
ATOM 1167  C CB  . PRO A 1 150 ? 3.776    197.943 -4.110  1.00 0.00 ? 145 PRO A CB  1 
ATOM 1168  C CG  . PRO A 1 150 ? 3.539    196.609 -4.729  1.00 0.00 ? 145 PRO A CG  1 
ATOM 1169  C CD  . PRO A 1 150 ? 2.417    196.929 -5.682  1.00 0.00 ? 145 PRO A CD  1 
ATOM 1170  N N   . ARG A 1 151 ? 2.464    200.767 -2.887  1.00 0.00 ? 146 ARG A N   1 
ATOM 1171  C CA  . ARG A 1 151 ? 2.474    202.178 -2.803  1.00 0.00 ? 146 ARG A CA  1 
ATOM 1172  C C   . ARG A 1 151 ? 3.675    202.886 -3.465  1.00 0.00 ? 146 ARG A C   1 
ATOM 1173  O O   . ARG A 1 151 ? 3.608    204.066 -3.784  1.00 0.00 ? 146 ARG A O   1 
ATOM 1174  C CB  . ARG A 1 151 ? 2.319    202.710 -1.367  1.00 0.00 ? 146 ARG A CB  1 
ATOM 1175  C CG  . ARG A 1 151 ? 3.420    202.249 -0.408  1.00 0.00 ? 146 ARG A CG  1 
ATOM 1176  C CD  . ARG A 1 151 ? 3.451    202.903 0.980   1.00 0.00 ? 146 ARG A CD  1 
ATOM 1177  N NE  . ARG A 1 151 ? 2.298    202.327 1.728   1.00 0.00 ? 146 ARG A NE  1 
ATOM 1178  C CZ  . ARG A 1 151 ? 1.757    202.773 2.884   1.00 0.00 ? 146 ARG A CZ  1 
ATOM 1179  N NH1 . ARG A 1 151 ? 2.022    204.009 3.332   1.00 0.00 ? 146 ARG A NH1 1 
ATOM 1180  N NH2 . ARG A 1 151 ? 0.858    202.080 3.517   1.00 0.00 ? 146 ARG A NH2 1 
ATOM 1181  N N   . ARG A 1 152 ? 4.787    202.134 -3.625  1.00 0.00 ? 147 ARG A N   1 
ATOM 1182  C CA  . ARG A 1 152 ? 5.933    202.644 -4.342  1.00 0.00 ? 147 ARG A CA  1 
ATOM 1183  C C   . ARG A 1 152 ? 5.731    202.823 -5.914  1.00 0.00 ? 147 ARG A C   1 
ATOM 1184  O O   . ARG A 1 152 ? 6.309    203.707 -6.572  1.00 0.00 ? 147 ARG A O   1 
ATOM 1185  C CB  . ARG A 1 152 ? 7.154    201.667 -4.095  1.00 0.00 ? 147 ARG A CB  1 
ATOM 1186  C CG  . ARG A 1 152 ? 7.091    200.247 -4.529  1.00 0.00 ? 147 ARG A CG  1 
ATOM 1187  C CD  . ARG A 1 152 ? 8.100    199.229 -3.997  1.00 0.00 ? 147 ARG A CD  1 
ATOM 1188  N NE  . ARG A 1 152 ? 7.579    197.921 -3.851  1.00 0.00 ? 147 ARG A NE  1 
ATOM 1189  C CZ  . ARG A 1 152 ? 7.686    196.864 -4.724  1.00 0.00 ? 147 ARG A CZ  1 
ATOM 1190  N NH1 . ARG A 1 152 ? 8.458    196.918 -5.762  1.00 0.00 ? 147 ARG A NH1 1 
ATOM 1191  N NH2 . ARG A 1 152 ? 7.060    195.692 -4.470  1.00 0.00 ? 147 ARG A NH2 1 
ATOM 1192  N N   . ARG A 1 153 ? 4.863    201.968 -6.462  1.00 0.00 ? 148 ARG A N   1 
ATOM 1193  C CA  . ARG A 1 153 ? 4.519    202.009 -7.872  1.00 0.00 ? 148 ARG A CA  1 
ATOM 1194  C C   . ARG A 1 153 ? 3.329    202.883 -8.237  1.00 0.00 ? 148 ARG A C   1 
ATOM 1195  O O   . ARG A 1 153 ? 2.348    202.417 -8.785  1.00 0.00 ? 148 ARG A O   1 
ATOM 1196  C CB  . ARG A 1 153 ? 4.258    200.600 -8.493  1.00 0.00 ? 148 ARG A CB  1 
ATOM 1197  C CG  . ARG A 1 153 ? 5.443    199.622 -8.481  1.00 0.00 ? 148 ARG A CG  1 
ATOM 1198  C CD  . ARG A 1 153 ? 5.120    198.157 -8.754  1.00 0.00 ? 148 ARG A CD  1 
ATOM 1199  N NE  . ARG A 1 153 ? 5.047    197.949 -10.276 1.00 0.00 ? 148 ARG A NE  1 
ATOM 1200  C CZ  . ARG A 1 153 ? 5.189    196.764 -10.864 1.00 0.00 ? 148 ARG A CZ  1 
ATOM 1201  N NH1 . ARG A 1 153 ? 5.446    195.599 -10.211 1.00 0.00 ? 148 ARG A NH1 1 
ATOM 1202  N NH2 . ARG A 1 153 ? 5.089    196.639 -12.210 1.00 0.00 ? 148 ARG A NH2 1 
ATOM 1203  N N   . ALA A 1 154 ? 3.429    204.146 -7.733  1.00 0.00 ? 149 ALA A N   1 
ATOM 1204  C CA  . ALA A 1 154 ? 2.485    205.212 -7.909  1.00 0.00 ? 149 ALA A CA  1 
ATOM 1205  C C   . ALA A 1 154 ? 1.753    205.452 -9.236  1.00 0.00 ? 149 ALA A C   1 
ATOM 1206  O O   . ALA A 1 154 ? 0.549    205.635 -9.327  1.00 0.00 ? 149 ALA A O   1 
ATOM 1207  C CB  . ALA A 1 154 ? 3.164    206.539 -7.716  1.00 0.00 ? 149 ALA A CB  1 
ATOM 1208  N N   . GLN A 1 155 ? 2.477    205.503 -10.366 1.00 0.00 ? 150 GLN A N   1 
ATOM 1209  C CA  . GLN A 1 155 ? 1.916    205.710 -11.721 1.00 0.00 ? 150 GLN A CA  1 
ATOM 1210  C C   . GLN A 1 155 ? 0.940    204.584 -12.058 1.00 0.00 ? 150 GLN A C   1 
ATOM 1211  O O   . GLN A 1 155 ? -0.129   204.787 -12.622 1.00 0.00 ? 150 GLN A O   1 
ATOM 1212  C CB  . GLN A 1 155 ? 3.059    205.828 -12.790 1.00 0.00 ? 150 GLN A CB  1 
ATOM 1213  C CG  . GLN A 1 155 ? 4.064    207.002 -12.542 1.00 0.00 ? 150 GLN A CG  1 
ATOM 1214  C CD  . GLN A 1 155 ? 5.144    206.889 -13.656 1.00 0.00 ? 150 GLN A CD  1 
ATOM 1215  O OE1 . GLN A 1 155 ? 4.853    206.232 -14.648 1.00 0.00 ? 150 GLN A OE1 1 
ATOM 1216  N NE2 . GLN A 1 155 ? 6.236    207.667 -13.510 1.00 0.00 ? 150 GLN A NE2 1 
ATOM 1217  N N   . GLU A 1 156 ? 1.324    203.309 -11.830 1.00 0.00 ? 151 GLU A N   1 
ATOM 1218  C CA  . GLU A 1 156 ? 0.641    202.073 -12.104 1.00 0.00 ? 151 GLU A CA  1 
ATOM 1219  C C   . GLU A 1 156 ? -0.594   201.941 -11.294 1.00 0.00 ? 151 GLU A C   1 
ATOM 1220  O O   . GLU A 1 156 ? -1.614   201.512 -11.806 1.00 0.00 ? 151 GLU A O   1 
ATOM 1221  C CB  . GLU A 1 156 ? 1.516    200.814 -11.969 1.00 0.00 ? 151 GLU A CB  1 
ATOM 1222  C CG  . GLU A 1 156 ? 2.584    200.711 -13.123 1.00 0.00 ? 151 GLU A CG  1 
ATOM 1223  C CD  . GLU A 1 156 ? 3.682    199.696 -12.942 1.00 0.00 ? 151 GLU A CD  1 
ATOM 1224  O OE1 . GLU A 1 156 ? 4.716    200.027 -12.216 1.00 0.00 ? 151 GLU A OE1 1 
ATOM 1225  O OE2 . GLU A 1 156 ? 3.658    198.579 -13.490 1.00 0.00 ? 151 GLU A OE2 1 
ATOM 1226  N N   . ALA A 1 157 ? -0.489   202.323 -9.992  1.00 0.00 ? 152 ALA A N   1 
ATOM 1227  C CA  . ALA A 1 157 ? -1.608   202.366 -9.101  1.00 0.00 ? 152 ALA A CA  1 
ATOM 1228  C C   . ALA A 1 157 ? -2.670   203.441 -9.527  1.00 0.00 ? 152 ALA A C   1 
ATOM 1229  O O   . ALA A 1 157 ? -3.846   203.148 -9.434  1.00 0.00 ? 152 ALA A O   1 
ATOM 1230  C CB  . ALA A 1 157 ? -0.995   202.817 -7.808  1.00 0.00 ? 152 ALA A CB  1 
ATOM 1231  N N   . GLU A 1 158 ? -2.197   204.634 -9.984  1.00 0.00 ? 153 GLU A N   1 
ATOM 1232  C CA  . GLU A 1 158 ? -3.082   205.718 -10.457 1.00 0.00 ? 153 GLU A CA  1 
ATOM 1233  C C   . GLU A 1 158 ? -3.884   205.309 -11.681 1.00 0.00 ? 153 GLU A C   1 
ATOM 1234  O O   . GLU A 1 158 ? -5.076   205.557 -11.751 1.00 0.00 ? 153 GLU A O   1 
ATOM 1235  C CB  . GLU A 1 158 ? -2.213   206.951 -10.797 1.00 0.00 ? 153 GLU A CB  1 
ATOM 1236  C CG  . GLU A 1 158 ? -2.927   208.341 -10.974 1.00 0.00 ? 153 GLU A CG  1 
ATOM 1237  C CD  . GLU A 1 158 ? -3.233   208.950 -9.600  1.00 0.00 ? 153 GLU A CD  1 
ATOM 1238  O OE1 . GLU A 1 158 ? -2.235   209.286 -8.970  1.00 0.00 ? 153 GLU A OE1 1 
ATOM 1239  O OE2 . GLU A 1 158 ? -4.414   209.092 -9.159  1.00 0.00 ? 153 GLU A OE2 1 
ATOM 1240  N N   . GLU A 1 159 ? -3.233   204.617 -12.634 1.00 0.00 ? 154 GLU A N   1 
ATOM 1241  C CA  . GLU A 1 159 ? -3.800   203.925 -13.783 1.00 0.00 ? 154 GLU A CA  1 
ATOM 1242  C C   . GLU A 1 159 ? -4.842   202.811 -13.400 1.00 0.00 ? 154 GLU A C   1 
ATOM 1243  O O   . GLU A 1 159 ? -5.979   202.829 -13.853 1.00 0.00 ? 154 GLU A O   1 
ATOM 1244  C CB  . GLU A 1 159 ? -2.551   203.388 -14.496 1.00 0.00 ? 154 GLU A CB  1 
ATOM 1245  C CG  . GLU A 1 159 ? -2.836   202.442 -15.693 1.00 0.00 ? 154 GLU A CG  1 
ATOM 1246  C CD  . GLU A 1 159 ? -1.503   202.118 -16.393 1.00 0.00 ? 154 GLU A CD  1 
ATOM 1247  O OE1 . GLU A 1 159 ? -0.566   201.925 -15.576 1.00 0.00 ? 154 GLU A OE1 1 
ATOM 1248  O OE2 . GLU A 1 159 ? -1.258   202.166 -17.622 1.00 0.00 ? 154 GLU A OE2 1 
ATOM 1249  N N   . ALA A 1 160 ? -4.448   202.022 -12.402 1.00 0.00 ? 155 ALA A N   1 
ATOM 1250  C CA  . ALA A 1 160 ? -5.432   201.099 -11.950 1.00 0.00 ? 155 ALA A CA  1 
ATOM 1251  C C   . ALA A 1 160 ? -6.746   201.721 -11.237 1.00 0.00 ? 155 ALA A C   1 
ATOM 1252  O O   . ALA A 1 160 ? -7.903   201.280 -11.423 1.00 0.00 ? 155 ALA A O   1 
ATOM 1253  C CB  . ALA A 1 160 ? -4.808   200.164 -11.026 1.00 0.00 ? 155 ALA A CB  1 
ATOM 1254  N N   . GLY A 1 161 ? -6.531   202.797 -10.420 1.00 0.00 ? 156 GLY A N   1 
ATOM 1255  C CA  . GLY A 1 161 ? -7.614   203.580 -9.824  1.00 0.00 ? 156 GLY A CA  1 
ATOM 1256  C C   . GLY A 1 161 ? -8.475   204.366 -10.817 1.00 0.00 ? 156 GLY A C   1 
ATOM 1257  O O   . GLY A 1 161 ? -9.662   204.587 -10.545 1.00 0.00 ? 156 GLY A O   1 
ATOM 1258  N N   . ALA A 1 162 ? -7.922   204.812 -11.976 1.00 0.00 ? 157 ALA A N   1 
ATOM 1259  C CA  . ALA A 1 162 ? -8.620   205.437 -13.061 1.00 0.00 ? 157 ALA A CA  1 
ATOM 1260  C C   . ALA A 1 162 ? -9.570   204.405 -13.678 1.00 0.00 ? 157 ALA A C   1 
ATOM 1261  O O   . ALA A 1 162 ? -10.748  204.714 -13.817 1.00 0.00 ? 157 ALA A O   1 
ATOM 1262  C CB  . ALA A 1 162 ? -7.530   205.648 -14.162 1.00 0.00 ? 157 ALA A CB  1 
ATOM 1263  N N   . ALA A 1 163 ? -9.203   203.123 -13.950 1.00 0.00 ? 158 ALA A N   1 
ATOM 1264  C CA  . ALA A 1 163 ? -10.082  202.079 -14.360 1.00 0.00 ? 158 ALA A CA  1 
ATOM 1265  C C   . ALA A 1 163 ? -11.214  201.796 -13.337 1.00 0.00 ? 158 ALA A C   1 
ATOM 1266  O O   . ALA A 1 163 ? -12.344  201.433 -13.630 1.00 0.00 ? 158 ALA A O   1 
ATOM 1267  C CB  . ALA A 1 163 ? -9.270   200.756 -14.553 1.00 0.00 ? 158 ALA A CB  1 
ATOM 1268  N N   . LEU A 1 164 ? -10.903  201.811 -11.998 1.00 0.00 ? 159 LEU A N   1 
ATOM 1269  C CA  . LEU A 1 164 ? -11.897  201.782 -10.907 1.00 0.00 ? 159 LEU A CA  1 
ATOM 1270  C C   . LEU A 1 164 ? -12.883  202.955 -10.900 1.00 0.00 ? 159 LEU A C   1 
ATOM 1271  O O   . LEU A 1 164 ? -14.070  202.702 -10.746 1.00 0.00 ? 159 LEU A O   1 
ATOM 1272  C CB  . LEU A 1 164 ? -11.197  201.686 -9.563  1.00 0.00 ? 159 LEU A CB  1 
ATOM 1273  C CG  . LEU A 1 164 ? -12.145  201.736 -8.380  1.00 0.00 ? 159 LEU A CG  1 
ATOM 1274  C CD1 . LEU A 1 164 ? -13.168  200.602 -8.472  1.00 0.00 ? 159 LEU A CD1 1 
ATOM 1275  C CD2 . LEU A 1 164 ? -11.444  201.812 -6.970  1.00 0.00 ? 159 LEU A CD2 1 
ATOM 1276  N N   . ARG A 1 165 ? -12.448  204.125 -11.246 1.00 0.00 ? 160 ARG A N   1 
ATOM 1277  C CA  . ARG A 1 165 ? -13.391  205.203 -11.477 1.00 0.00 ? 160 ARG A CA  1 
ATOM 1278  C C   . ARG A 1 165 ? -14.337  204.971 -12.644 1.00 0.00 ? 160 ARG A C   1 
ATOM 1279  O O   . ARG A 1 165 ? -15.500  205.271 -12.646 1.00 0.00 ? 160 ARG A O   1 
ATOM 1280  C CB  . ARG A 1 165 ? -12.686  206.527 -11.767 1.00 0.00 ? 160 ARG A CB  1 
ATOM 1281  C CG  . ARG A 1 165 ? -11.766  207.084 -10.619 1.00 0.00 ? 160 ARG A CG  1 
ATOM 1282  C CD  . ARG A 1 165 ? -12.312  207.128 -9.212  1.00 0.00 ? 160 ARG A CD  1 
ATOM 1283  N NE  . ARG A 1 165 ? -11.474  207.906 -8.327  1.00 0.00 ? 160 ARG A NE  1 
ATOM 1284  C CZ  . ARG A 1 165 ? -11.735  207.987 -7.050  1.00 0.00 ? 160 ARG A CZ  1 
ATOM 1285  N NH1 . ARG A 1 165 ? -12.578  207.174 -6.464  1.00 0.00 ? 160 ARG A NH1 1 
ATOM 1286  N NH2 . ARG A 1 165 ? -11.102  208.976 -6.327  1.00 0.00 ? 160 ARG A NH2 1 
ATOM 1287  N N   . THR A 1 166 ? -13.798  204.292 -13.667 1.00 0.00 ? 161 THR A N   1 
ATOM 1288  C CA  . THR A 1 166 ? -14.559  203.631 -14.846 1.00 0.00 ? 161 THR A CA  1 
ATOM 1289  C C   . THR A 1 166 ? -15.642  202.593 -14.448 1.00 0.00 ? 161 THR A C   1 
ATOM 1290  O O   . THR A 1 166 ? -16.837  202.634 -14.777 1.00 0.00 ? 161 THR A O   1 
ATOM 1291  C CB  . THR A 1 166 ? -13.669  203.203 -15.979 1.00 0.00 ? 161 THR A CB  1 
ATOM 1292  O OG1 . THR A 1 166 ? -12.775  204.203 -16.306 1.00 0.00 ? 161 THR A OG1 1 
ATOM 1293  C CG2 . THR A 1 166 ? -14.534  203.115 -17.306 1.00 0.00 ? 161 THR A CG2 1 
ATOM 1294  N N   . ALA A 1 167 ? -15.187  201.499 -13.699 1.00 0.00 ? 162 ALA A N   1 
ATOM 1295  C CA  . ALA A 1 167 ? -15.944  200.347 -13.177 1.00 0.00 ? 162 ALA A CA  1 
ATOM 1296  C C   . ALA A 1 167 ? -17.078  200.852 -12.332 1.00 0.00 ? 162 ALA A C   1 
ATOM 1297  O O   . ALA A 1 167 ? -18.212  200.486 -12.635 1.00 0.00 ? 162 ALA A O   1 
ATOM 1298  C CB  . ALA A 1 167 ? -14.975  199.454 -12.471 1.00 0.00 ? 162 ALA A CB  1 
ATOM 1299  N N   . ARG A 1 168 ? -16.715  201.701 -11.313 1.00 0.00 ? 163 ARG A N   1 
ATOM 1300  C CA  . ARG A 1 168 ? -17.722  202.211 -10.322 1.00 0.00 ? 163 ARG A CA  1 
ATOM 1301  C C   . ARG A 1 168 ? -18.769  203.032 -10.860 1.00 0.00 ? 163 ARG A C   1 
ATOM 1302  O O   . ARG A 1 168 ? -20.001  202.913 -10.614 1.00 0.00 ? 163 ARG A O   1 
ATOM 1303  C CB  . ARG A 1 168 ? -16.948  203.027 -9.292  1.00 0.00 ? 163 ARG A CB  1 
ATOM 1304  C CG  . ARG A 1 168 ? -17.810  203.630 -8.083  1.00 0.00 ? 163 ARG A CG  1 
ATOM 1305  C CD  . ARG A 1 168 ? -18.549  202.755 -7.138  1.00 0.00 ? 163 ARG A CD  1 
ATOM 1306  N NE  . ARG A 1 168 ? -17.593  202.029 -6.298  1.00 0.00 ? 163 ARG A NE  1 
ATOM 1307  C CZ  . ARG A 1 168 ? -17.982  200.917 -5.737  1.00 0.00 ? 163 ARG A CZ  1 
ATOM 1308  N NH1 . ARG A 1 168 ? -19.165  200.345 -5.780  1.00 0.00 ? 163 ARG A NH1 1 
ATOM 1309  N NH2 . ARG A 1 168 ? -17.126  200.171 -4.986  1.00 0.00 ? 163 ARG A NH2 1 
ATOM 1310  N N   . ALA A 1 169 ? -18.387  204.074 -11.694 1.00 0.00 ? 164 ALA A N   1 
ATOM 1311  C CA  . ALA A 1 169 ? -19.311  204.894 -12.495 1.00 0.00 ? 164 ALA A CA  1 
ATOM 1312  C C   . ALA A 1 169 ? -20.199  204.026 -13.415 1.00 0.00 ? 164 ALA A C   1 
ATOM 1313  O O   . ALA A 1 169 ? -21.430  204.197 -13.394 1.00 0.00 ? 164 ALA A O   1 
ATOM 1314  C CB  . ALA A 1 169 ? -18.461  205.920 -13.296 1.00 0.00 ? 164 ALA A CB  1 
ATOM 1315  N N   . GLY A 1 170 ? -19.571  203.164 -14.191 1.00 0.00 ? 165 GLY A N   1 
ATOM 1316  C CA  . GLY A 1 170 ? -20.429  202.567 -15.216 1.00 0.00 ? 165 GLY A CA  1 
ATOM 1317  C C   . GLY A 1 170 ? -21.293  201.494 -14.580 1.00 0.00 ? 165 GLY A C   1 
ATOM 1318  O O   . GLY A 1 170 ? -22.392  201.196 -14.992 1.00 0.00 ? 165 GLY A O   1 
ATOM 1319  N N   . TYR A 1 171 ? -20.817  200.917 -13.446 1.00 0.00 ? 166 TYR A N   1 
ATOM 1320  C CA  . TYR A 1 171 ? -21.727  200.107 -12.620 1.00 0.00 ? 166 TYR A CA  1 
ATOM 1321  C C   . TYR A 1 171 ? -22.949  200.848 -12.010 1.00 0.00 ? 166 TYR A C   1 
ATOM 1322  O O   . TYR A 1 171 ? -24.075  200.314 -11.854 1.00 0.00 ? 166 TYR A O   1 
ATOM 1323  C CB  . TYR A 1 171 ? -20.873  199.348 -11.559 1.00 0.00 ? 166 TYR A CB  1 
ATOM 1324  C CG  . TYR A 1 171 ? -21.642  198.418 -10.607 1.00 0.00 ? 166 TYR A CG  1 
ATOM 1325  C CD1 . TYR A 1 171 ? -22.129  197.214 -11.015 1.00 0.00 ? 166 TYR A CD1 1 
ATOM 1326  C CD2 . TYR A 1 171 ? -21.868  198.831 -9.268  1.00 0.00 ? 166 TYR A CD2 1 
ATOM 1327  C CE1 . TYR A 1 171 ? -22.763  196.383 -10.127 1.00 0.00 ? 166 TYR A CE1 1 
ATOM 1328  C CE2 . TYR A 1 171 ? -22.591  198.009 -8.406  1.00 0.00 ? 166 TYR A CE2 1 
ATOM 1329  C CZ  . TYR A 1 171 ? -23.079  196.819 -8.807  1.00 0.00 ? 166 TYR A CZ  1 
ATOM 1330  O OH  . TYR A 1 171 ? -23.808  196.000 -7.904  1.00 0.00 ? 166 TYR A OH  1 
ATOM 1331  N N   . ARG A 1 172 ? -22.805  202.107 -11.586 1.00 0.00 ? 167 ARG A N   1 
ATOM 1332  C CA  . ARG A 1 172 ? -23.921  202.976 -11.215 1.00 0.00 ? 167 ARG A CA  1 
ATOM 1333  C C   . ARG A 1 172 ? -24.936  203.201 -12.332 1.00 0.00 ? 167 ARG A C   1 
ATOM 1334  O O   . ARG A 1 172 ? -26.150  203.095 -12.293 1.00 0.00 ? 167 ARG A O   1 
ATOM 1335  C CB  . ARG A 1 172 ? -23.437  204.418 -10.763 1.00 0.00 ? 167 ARG A CB  1 
ATOM 1336  C CG  . ARG A 1 172 ? -23.060  204.409 -9.253  1.00 0.00 ? 167 ARG A CG  1 
ATOM 1337  C CD  . ARG A 1 172 ? -22.206  205.569 -8.778  1.00 0.00 ? 167 ARG A CD  1 
ATOM 1338  N NE  . ARG A 1 172 ? -22.026  205.304 -7.263  1.00 0.00 ? 167 ARG A NE  1 
ATOM 1339  C CZ  . ARG A 1 172 ? -20.977  205.733 -6.547  1.00 0.00 ? 167 ARG A CZ  1 
ATOM 1340  N NH1 . ARG A 1 172 ? -20.010  206.361 -7.200  1.00 0.00 ? 167 ARG A NH1 1 
ATOM 1341  N NH2 . ARG A 1 172 ? -21.044  205.593 -5.222  1.00 0.00 ? 167 ARG A NH2 1 
ATOM 1342  N N   . GLY A 1 173 ? -24.363  203.482 -13.499 1.00 0.00 ? 168 GLY A N   1 
ATOM 1343  C CA  . GLY A 1 173 ? -25.021  203.494 -14.910 1.00 0.00 ? 168 GLY A CA  1 
ATOM 1344  C C   . GLY A 1 173 ? -25.800  202.223 -15.255 1.00 0.00 ? 168 GLY A C   1 
ATOM 1345  O O   . GLY A 1 173 ? -26.981  202.339 -15.515 1.00 0.00 ? 168 GLY A O   1 
ATOM 1346  N N   . ARG A 1 174 ? -25.195  201.022 -15.131 1.00 0.00 ? 169 ARG A N   1 
ATOM 1347  C CA  . ARG A 1 174 ? -25.855  199.705 -15.204 1.00 0.00 ? 169 ARG A CA  1 
ATOM 1348  C C   . ARG A 1 174 ? -26.928  199.435 -14.149 1.00 0.00 ? 169 ARG A C   1 
ATOM 1349  O O   . ARG A 1 174 ? -27.986  198.909 -14.431 1.00 0.00 ? 169 ARG A O   1 
ATOM 1350  C CB  . ARG A 1 174 ? -24.788  198.531 -15.198 1.00 0.00 ? 169 ARG A CB  1 
ATOM 1351  C CG  . ARG A 1 174 ? -23.994  198.468 -16.527 1.00 0.00 ? 169 ARG A CG  1 
ATOM 1352  C CD  . ARG A 1 174 ? -22.579  197.836 -16.326 1.00 0.00 ? 169 ARG A CD  1 
ATOM 1353  N NE  . ARG A 1 174 ? -22.202  197.316 -17.620 1.00 0.00 ? 169 ARG A NE  1 
ATOM 1354  C CZ  . ARG A 1 174 ? -20.948  196.932 -18.025 1.00 0.00 ? 169 ARG A CZ  1 
ATOM 1355  N NH1 . ARG A 1 174 ? -19.970  197.111 -17.141 1.00 0.00 ? 169 ARG A NH1 1 
ATOM 1356  N NH2 . ARG A 1 174 ? -20.772  196.289 -19.164 1.00 0.00 ? 169 ARG A NH2 1 
ATOM 1357  N N   . ALA A 1 175 ? -26.761  199.948 -12.912 1.00 0.00 ? 170 ALA A N   1 
ATOM 1358  C CA  . ALA A 1 175 ? -27.643  199.792 -11.763 1.00 0.00 ? 170 ALA A CA  1 
ATOM 1359  C C   . ALA A 1 175 ? -28.951  200.555 -11.996 1.00 0.00 ? 170 ALA A C   1 
ATOM 1360  O O   . ALA A 1 175 ? -30.038  200.049 -11.731 1.00 0.00 ? 170 ALA A O   1 
ATOM 1361  C CB  . ALA A 1 175 ? -27.138  200.344 -10.384 1.00 0.00 ? 170 ALA A CB  1 
ATOM 1362  N N   . LEU A 1 176 ? -28.870  201.831 -12.473 1.00 0.00 ? 171 LEU A N   1 
ATOM 1363  C CA  . LEU A 1 176 ? -30.001  202.692 -12.908 1.00 0.00 ? 171 LEU A CA  1 
ATOM 1364  C C   . LEU A 1 176 ? -30.898  201.979 -13.954 1.00 0.00 ? 171 LEU A C   1 
ATOM 1365  O O   . LEU A 1 176 ? -32.129  202.142 -13.954 1.00 0.00 ? 171 LEU A O   1 
ATOM 1366  C CB  . LEU A 1 176 ? -29.647  204.108 -13.430 1.00 0.00 ? 171 LEU A CB  1 
ATOM 1367  C CG  . LEU A 1 176 ? -28.956  205.077 -12.376 1.00 0.00 ? 171 LEU A CG  1 
ATOM 1368  C CD1 . LEU A 1 176 ? -28.132  206.172 -13.030 1.00 0.00 ? 171 LEU A CD1 1 
ATOM 1369  C CD2 . LEU A 1 176 ? -30.019  205.603 -11.316 1.00 0.00 ? 171 LEU A CD2 1 
ATOM 1370  N N   . ASP A 1 177 ? -30.297  201.239 -14.918 1.00 0.00 ? 172 ASP A N   1 
ATOM 1371  C CA  . ASP A 1 177 ? -31.035  200.599 -16.004 1.00 0.00 ? 172 ASP A CA  1 
ATOM 1372  C C   . ASP A 1 177 ? -31.895  199.420 -15.512 1.00 0.00 ? 172 ASP A C   1 
ATOM 1373  O O   . ASP A 1 177 ? -33.079  199.176 -15.903 1.00 0.00 ? 172 ASP A O   1 
ATOM 1374  C CB  . ASP A 1 177 ? -30.085  199.965 -17.022 1.00 0.00 ? 172 ASP A CB  1 
ATOM 1375  C CG  . ASP A 1 177 ? -29.200  201.074 -17.635 1.00 0.00 ? 172 ASP A CG  1 
ATOM 1376  O OD1 . ASP A 1 177 ? -29.586  202.277 -17.690 1.00 0.00 ? 172 ASP A OD1 1 
ATOM 1377  O OD2 . ASP A 1 177 ? -28.107  200.719 -18.133 1.00 0.00 ? 172 ASP A OD2 1 
ATOM 1378  N N   . TYR A 1 178 ? -31.293  198.676 -14.564 1.00 0.00 ? 173 TYR A N   1 
ATOM 1379  C CA  . TYR A 1 178 ? -31.950  197.659 -13.789 1.00 0.00 ? 173 TYR A CA  1 
ATOM 1380  C C   . TYR A 1 178 ? -33.106  198.252 -12.983 1.00 0.00 ? 173 TYR A C   1 
ATOM 1381  O O   . TYR A 1 178 ? -34.242  197.697 -12.925 1.00 0.00 ? 173 TYR A O   1 
ATOM 1382  C CB  . TYR A 1 178 ? -30.899  196.822 -13.040 1.00 0.00 ? 173 TYR A CB  1 
ATOM 1383  C CG  . TYR A 1 178 ? -31.498  195.791 -12.180 1.00 0.00 ? 173 TYR A CG  1 
ATOM 1384  C CD1 . TYR A 1 178 ? -32.292  196.077 -10.984 1.00 0.00 ? 173 TYR A CD1 1 
ATOM 1385  C CD2 . TYR A 1 178 ? -31.373  194.486 -12.558 1.00 0.00 ? 173 TYR A CD2 1 
ATOM 1386  C CE1 . TYR A 1 178 ? -32.846  195.078 -10.186 1.00 0.00 ? 173 TYR A CE1 1 
ATOM 1387  C CE2 . TYR A 1 178 ? -31.799  193.438 -11.719 1.00 0.00 ? 173 TYR A CE2 1 
ATOM 1388  C CZ  . TYR A 1 178 ? -32.524  193.713 -10.514 1.00 0.00 ? 173 TYR A CZ  1 
ATOM 1389  O OH  . TYR A 1 178 ? -33.070  192.651 -9.909  1.00 0.00 ? 173 TYR A OH  1 
ATOM 1390  N N   . ALA A 1 179 ? -32.925  199.400 -12.318 1.00 0.00 ? 174 ALA A N   1 
ATOM 1391  C CA  . ALA A 1 179 ? -33.900  200.162 -11.651 1.00 0.00 ? 174 ALA A CA  1 
ATOM 1392  C C   . ALA A 1 179 ? -35.073  200.684 -12.473 1.00 0.00 ? 174 ALA A C   1 
ATOM 1393  O O   . ALA A 1 179 ? -36.202  200.572 -12.036 1.00 0.00 ? 174 ALA A O   1 
ATOM 1394  C CB  . ALA A 1 179 ? -33.092  201.305 -11.074 1.00 0.00 ? 174 ALA A CB  1 
ATOM 1395  N N   . LEU A 1 180 ? -34.787  201.169 -13.680 1.00 0.00 ? 175 LEU A N   1 
ATOM 1396  C CA  . LEU A 1 180 ? -35.758  201.563 -14.653 1.00 0.00 ? 175 LEU A CA  1 
ATOM 1397  C C   . LEU A 1 180 ? -36.609  200.402 -15.006 1.00 0.00 ? 175 LEU A C   1 
ATOM 1398  O O   . LEU A 1 180 ? -37.846  200.442 -14.957 1.00 0.00 ? 175 LEU A O   1 
ATOM 1399  C CB  . LEU A 1 180 ? -35.135  202.145 -16.005 1.00 0.00 ? 175 LEU A CB  1 
ATOM 1400  C CG  . LEU A 1 180 ? -36.112  202.562 -17.142 1.00 0.00 ? 175 LEU A CG  1 
ATOM 1401  C CD1 . LEU A 1 180 ? -37.061  203.678 -16.698 1.00 0.00 ? 175 LEU A CD1 1 
ATOM 1402  C CD2 . LEU A 1 180 ? -35.287  203.043 -18.375 1.00 0.00 ? 175 LEU A CD2 1 
ATOM 1403  N N   . GLN A 1 181 ? -35.964  199.236 -15.263 1.00 0.00 ? 176 GLN A N   1 
ATOM 1404  C CA  . GLN A 1 181 ? -36.621  198.134 -15.913 1.00 0.00 ? 176 GLN A CA  1 
ATOM 1405  C C   . GLN A 1 181 ? -37.496  197.208 -15.026 1.00 0.00 ? 176 GLN A C   1 
ATOM 1406  O O   . GLN A 1 181 ? -38.588  196.839 -15.464 1.00 0.00 ? 176 GLN A O   1 
ATOM 1407  C CB  . GLN A 1 181 ? -35.527  197.291 -16.694 1.00 0.00 ? 176 GLN A CB  1 
ATOM 1408  C CG  . GLN A 1 181 ? -34.920  197.867 -18.025 1.00 0.00 ? 176 GLN A CG  1 
ATOM 1409  C CD  . GLN A 1 181 ? -35.883  197.622 -19.232 1.00 0.00 ? 176 GLN A CD  1 
ATOM 1410  O OE1 . GLN A 1 181 ? -37.083  197.338 -19.036 1.00 0.00 ? 176 GLN A OE1 1 
ATOM 1411  N NE2 . GLN A 1 181 ? -35.348  197.789 -20.446 1.00 0.00 ? 176 GLN A NE2 1 
ATOM 1412  N N   . ILE A 1 182 ? -37.055  196.893 -13.817 1.00 0.00 ? 177 ILE A N   1 
ATOM 1413  C CA  . ILE A 1 182 ? -37.891  196.467 -12.715 1.00 0.00 ? 177 ILE A CA  1 
ATOM 1414  C C   . ILE A 1 182 ? -39.044  197.434 -12.436 1.00 0.00 ? 177 ILE A C   1 
ATOM 1415  O O   . ILE A 1 182 ? -40.173  197.126 -12.204 1.00 0.00 ? 177 ILE A O   1 
ATOM 1416  C CB  . ILE A 1 182 ? -36.856  196.252 -11.605 1.00 0.00 ? 177 ILE A CB  1 
ATOM 1417  C CG1 . ILE A 1 182 ? -37.233  194.913 -10.889 1.00 0.00 ? 177 ILE A CG1 1 
ATOM 1418  C CG2 . ILE A 1 182 ? -36.679  197.402 -10.587 1.00 0.00 ? 177 ILE A CG2 1 
ATOM 1419  C CD1 . ILE A 1 182 ? -38.510  194.973 -10.009 1.00 0.00 ? 177 ILE A CD1 1 
ATOM 1420  N N   . ASN A 1 183 ? -38.816  198.790 -12.453 1.00 0.00 ? 178 ASN A N   1 
ATOM 1421  C CA  . ASN A 1 183 ? -39.874  199.829 -12.162 1.00 0.00 ? 178 ASN A CA  1 
ATOM 1422  C C   . ASN A 1 183 ? -41.012  199.810 -13.275 1.00 0.00 ? 178 ASN A C   1 
ATOM 1423  O O   . ASN A 1 183 ? -42.200  200.007 -12.997 1.00 0.00 ? 178 ASN A O   1 
ATOM 1424  C CB  . ASN A 1 183 ? -39.235  201.204 -12.072 1.00 0.00 ? 178 ASN A CB  1 
ATOM 1425  C CG  . ASN A 1 183 ? -40.085  202.295 -11.271 1.00 0.00 ? 178 ASN A CG  1 
ATOM 1426  O OD1 . ASN A 1 183 ? -41.117  202.776 -11.786 1.00 0.00 ? 178 ASN A OD1 1 
ATOM 1427  N ND2 . ASN A 1 183 ? -39.643  202.655 -10.012 1.00 0.00 ? 178 ASN A ND2 1 
ATOM 1428  N N   . VAL A 1 184 ? -40.646  199.556 -14.527 1.00 0.00 ? 179 VAL A N   1 
ATOM 1429  C CA  . VAL A 1 184 ? -41.643  199.270 -15.605 1.00 0.00 ? 179 VAL A CA  1 
ATOM 1430  C C   . VAL A 1 184 ? -42.461  197.977 -15.313 1.00 0.00 ? 179 VAL A C   1 
ATOM 1431  O O   . VAL A 1 184 ? -43.688  197.918 -15.531 1.00 0.00 ? 179 VAL A O   1 
ATOM 1432  C CB  . VAL A 1 184 ? -40.894  198.982 -16.902 1.00 0.00 ? 179 VAL A CB  1 
ATOM 1433  C CG1 . VAL A 1 184 ? -41.763  198.344 -18.011 1.00 0.00 ? 179 VAL A CG1 1 
ATOM 1434  C CG2 . VAL A 1 184 ? -40.433  200.437 -17.401 1.00 0.00 ? 179 VAL A CG2 1 
ATOM 1435  N N   . ILE A 1 185 ? -41.903  196.796 -14.856 1.00 0.00 ? 180 ILE A N   1 
ATOM 1436  C CA  . ILE A 1 185 ? -42.612  195.567 -14.816 1.00 0.00 ? 180 ILE A CA  1 
ATOM 1437  C C   . ILE A 1 185 ? -43.616  195.484 -13.650 1.00 0.00 ? 180 ILE A C   1 
ATOM 1438  O O   . ILE A 1 185 ? -44.738  194.946 -13.721 1.00 0.00 ? 180 ILE A O   1 
ATOM 1439  C CB  . ILE A 1 185 ? -41.707  194.338 -14.906 1.00 0.00 ? 180 ILE A CB  1 
ATOM 1440  C CG1 . ILE A 1 185 ? -42.460  193.000 -15.148 1.00 0.00 ? 180 ILE A CG1 1 
ATOM 1441  C CG2 . ILE A 1 185 ? -40.840  194.181 -13.556 1.00 0.00 ? 180 ILE A CG2 1 
ATOM 1442  C CD1 . ILE A 1 185 ? -43.360  192.915 -16.429 1.00 0.00 ? 180 ILE A CD1 1 
ATOM 1443  N N   . GLU A 1 186 ? -43.335  196.202 -12.520 1.00 0.00 ? 181 GLU A N   1 
ATOM 1444  C CA  . GLU A 1 186 ? -44.290  196.362 -11.455 1.00 0.00 ? 181 GLU A CA  1 
ATOM 1445  C C   . GLU A 1 186 ? -45.632  197.041 -11.884 1.00 0.00 ? 181 GLU A C   1 
ATOM 1446  O O   . GLU A 1 186 ? -46.701  196.542 -11.633 1.00 0.00 ? 181 GLU A O   1 
ATOM 1447  C CB  . GLU A 1 186 ? -43.692  196.922 -10.214 1.00 0.00 ? 181 GLU A CB  1 
ATOM 1448  C CG  . GLU A 1 186 ? -44.615  197.190 -8.982  1.00 0.00 ? 181 GLU A CG  1 
ATOM 1449  C CD  . GLU A 1 186 ? -45.406  195.890 -8.558  1.00 0.00 ? 181 GLU A CD  1 
ATOM 1450  O OE1 . GLU A 1 186 ? -44.749  194.832 -8.463  1.00 0.00 ? 181 GLU A OE1 1 
ATOM 1451  O OE2 . GLU A 1 186 ? -46.617  195.976 -8.294  1.00 0.00 ? 181 GLU A OE2 1 
ATOM 1452  N N   . ASP A 1 187 ? -45.565  198.156 -12.646 1.00 0.00 ? 182 ASP A N   1 
ATOM 1453  C CA  . ASP A 1 187 ? -46.775  198.707 -13.186 1.00 0.00 ? 182 ASP A CA  1 
ATOM 1454  C C   . ASP A 1 187 ? -47.378  197.804 -14.298 1.00 0.00 ? 182 ASP A C   1 
ATOM 1455  O O   . ASP A 1 187 ? -48.582  197.501 -14.278 1.00 0.00 ? 182 ASP A O   1 
ATOM 1456  C CB  . ASP A 1 187 ? -46.486  200.185 -13.623 1.00 0.00 ? 182 ASP A CB  1 
ATOM 1457  C CG  . ASP A 1 187 ? -46.628  201.104 -12.453 1.00 0.00 ? 182 ASP A CG  1 
ATOM 1458  O OD1 . ASP A 1 187 ? -45.594  201.240 -11.684 1.00 0.00 ? 182 ASP A OD1 1 
ATOM 1459  O OD2 . ASP A 1 187 ? -47.679  201.791 -12.319 1.00 0.00 ? 182 ASP A OD2 1 
ATOM 1460  N N   . LYS A 1 188 ? -46.541  197.324 -15.230 1.00 0.00 ? 183 LYS A N   1 
ATOM 1461  C CA  . LYS A 1 188 ? -46.991  196.525 -16.394 1.00 0.00 ? 183 LYS A CA  1 
ATOM 1462  C C   . LYS A 1 188 ? -47.707  195.179 -16.130 1.00 0.00 ? 183 LYS A C   1 
ATOM 1463  O O   . LYS A 1 188 ? -48.705  194.839 -16.730 1.00 0.00 ? 183 LYS A O   1 
ATOM 1464  C CB  . LYS A 1 188 ? -45.938  196.531 -17.579 1.00 0.00 ? 183 LYS A CB  1 
ATOM 1465  C CG  . LYS A 1 188 ? -46.467  196.006 -18.961 1.00 0.00 ? 183 LYS A CG  1 
ATOM 1466  C CD  . LYS A 1 188 ? -45.308  195.720 -19.809 1.00 0.00 ? 183 LYS A CD  1 
ATOM 1467  C CE  . LYS A 1 188 ? -45.612  194.952 -21.086 1.00 0.00 ? 183 LYS A CE  1 
ATOM 1468  N NZ  . LYS A 1 188 ? -46.827  195.445 -21.713 1.00 0.00 ? 183 LYS A NZ  1 
ATOM 1469  N N   . ARG A 1 189 ? -47.189  194.335 -15.143 1.00 0.00 ? 184 ARG A N   1 
ATOM 1470  C CA  . ARG A 1 189 ? -47.716  193.012 -14.810 1.00 0.00 ? 184 ARG A CA  1 
ATOM 1471  C C   . ARG A 1 189 ? -49.229  193.053 -14.523 1.00 0.00 ? 184 ARG A C   1 
ATOM 1472  O O   . ARG A 1 189 ? -49.970  192.113 -14.795 1.00 0.00 ? 184 ARG A O   1 
ATOM 1473  C CB  . ARG A 1 189 ? -46.870  192.461 -13.666 1.00 0.00 ? 184 ARG A CB  1 
ATOM 1474  C CG  . ARG A 1 189 ? -46.984  193.199 -12.309 1.00 0.00 ? 184 ARG A CG  1 
ATOM 1475  C CD  . ARG A 1 189 ? -45.965  192.972 -11.273 1.00 0.00 ? 184 ARG A CD  1 
ATOM 1476  N NE  . ARG A 1 189 ? -46.136  191.594 -10.646 1.00 0.00 ? 184 ARG A NE  1 
ATOM 1477  C CZ  . ARG A 1 189 ? -45.650  191.221 -9.471  1.00 0.00 ? 184 ARG A CZ  1 
ATOM 1478  N NH1 . ARG A 1 189 ? -45.014  191.987 -8.642  1.00 0.00 ? 184 ARG A NH1 1 
ATOM 1479  N NH2 . ARG A 1 189 ? -45.789  189.951 -9.131  1.00 0.00 ? 184 ARG A NH2 1 
ATOM 1480  N N   . LYS A 1 190 ? -49.665  194.104 -13.750 1.00 0.00 ? 185 LYS A N   1 
ATOM 1481  C CA  . LYS A 1 190 ? -51.064  194.169 -13.260 1.00 0.00 ? 185 LYS A CA  1 
ATOM 1482  C C   . LYS A 1 190 ? -52.162  194.395 -14.397 1.00 0.00 ? 185 LYS A C   1 
ATOM 1483  O O   . LYS A 1 190 ? -53.204  193.764 -14.467 1.00 0.00 ? 185 LYS A O   1 
ATOM 1484  C CB  . LYS A 1 190 ? -51.283  195.183 -12.022 1.00 0.00 ? 185 LYS A CB  1 
ATOM 1485  C CG  . LYS A 1 190 ? -50.728  196.543 -12.295 1.00 0.00 ? 185 LYS A CG  1 
ATOM 1486  C CD  . LYS A 1 190 ? -50.816  197.367 -10.985 1.00 0.00 ? 185 LYS A CD  1 
ATOM 1487  C CE  . LYS A 1 190 ? -50.294  198.786 -11.158 1.00 0.00 ? 185 LYS A CE  1 
ATOM 1488  N NZ  . LYS A 1 190 ? -50.068  199.395 -9.805  1.00 0.00 ? 185 LYS A NZ  1 
ATOM 1489  N N   . PHE A 1 191 ? -51.743  195.276 -15.281 1.00 0.00 ? 186 PHE A N   1 
ATOM 1490  C CA  . PHE A 1 191 ? -52.581  195.803 -16.410 1.00 0.00 ? 186 PHE A CA  1 
ATOM 1491  C C   . PHE A 1 191 ? -52.796  194.742 -17.408 1.00 0.00 ? 186 PHE A C   1 
ATOM 1492  O O   . PHE A 1 191 ? -53.920  194.599 -17.826 1.00 0.00 ? 186 PHE A O   1 
ATOM 1493  C CB  . PHE A 1 191 ? -51.821  196.932 -17.137 1.00 0.00 ? 186 PHE A CB  1 
ATOM 1494  C CG  . PHE A 1 191 ? -51.535  198.154 -16.273 1.00 0.00 ? 186 PHE A CG  1 
ATOM 1495  C CD1 . PHE A 1 191 ? -52.252  198.504 -15.130 1.00 0.00 ? 186 PHE A CD1 1 
ATOM 1496  C CD2 . PHE A 1 191 ? -50.411  198.918 -16.579 1.00 0.00 ? 186 PHE A CD2 1 
ATOM 1497  C CE1 . PHE A 1 191 ? -51.742  199.571 -14.309 1.00 0.00 ? 186 PHE A CE1 1 
ATOM 1498  C CE2 . PHE A 1 191 ? -49.934  199.965 -15.822 1.00 0.00 ? 186 PHE A CE2 1 
ATOM 1499  C CZ  . PHE A 1 191 ? -50.511  200.267 -14.583 1.00 0.00 ? 186 PHE A CZ  1 
ATOM 1500  N N   . ASP A 1 192 ? -51.745  194.046 -17.851 1.00 0.00 ? 187 ASP A N   1 
ATOM 1501  C CA  . ASP A 1 192 ? -51.800  193.086 -18.942 1.00 0.00 ? 187 ASP A CA  1 
ATOM 1502  C C   . ASP A 1 192 ? -52.701  191.923 -18.649 1.00 0.00 ? 187 ASP A C   1 
ATOM 1503  O O   . ASP A 1 192 ? -53.603  191.488 -19.367 1.00 0.00 ? 187 ASP A O   1 
ATOM 1504  C CB  . ASP A 1 192 ? -50.365  192.744 -19.510 1.00 0.00 ? 187 ASP A CB  1 
ATOM 1505  C CG  . ASP A 1 192 ? -49.755  193.622 -20.582 1.00 0.00 ? 187 ASP A CG  1 
ATOM 1506  O OD1 . ASP A 1 192 ? -50.420  193.808 -21.668 1.00 0.00 ? 187 ASP A OD1 1 
ATOM 1507  O OD2 . ASP A 1 192 ? -48.601  194.062 -20.433 1.00 0.00 ? 187 ASP A OD2 1 
ATOM 1508  N N   . ILE A 1 193 ? -52.547  191.368 -17.407 1.00 0.00 ? 188 ILE A N   1 
ATOM 1509  C CA  . ILE A 1 193 ? -53.403  190.323 -16.863 1.00 0.00 ? 188 ILE A CA  1 
ATOM 1510  C C   . ILE A 1 193 ? -54.796  190.829 -16.507 1.00 0.00 ? 188 ILE A C   1 
ATOM 1511  O O   . ILE A 1 193 ? -55.748  190.100 -16.667 1.00 0.00 ? 188 ILE A O   1 
ATOM 1512  C CB  . ILE A 1 193 ? -52.776  189.461 -15.777 1.00 0.00 ? 188 ILE A CB  1 
ATOM 1513  C CG1 . ILE A 1 193 ? -52.546  190.305 -14.419 1.00 0.00 ? 188 ILE A CG1 1 
ATOM 1514  C CG2 . ILE A 1 193 ? -51.320  188.945 -16.184 1.00 0.00 ? 188 ILE A CG2 1 
ATOM 1515  C CD1 . ILE A 1 193 ? -53.727  190.098 -13.468 1.00 0.00 ? 188 ILE A CD1 1 
ATOM 1516  N N   . MET A 1 194 ? -54.963  192.055 -15.988 1.00 0.00 ? 189 MET A N   1 
ATOM 1517  C CA  . MET A 1 194 ? -56.293  192.665 -16.026 1.00 0.00 ? 189 MET A CA  1 
ATOM 1518  C C   . MET A 1 194 ? -56.954  192.752 -17.397 1.00 0.00 ? 189 MET A C   1 
ATOM 1519  O O   . MET A 1 194 ? -58.160  192.458 -17.498 1.00 0.00 ? 189 MET A O   1 
ATOM 1520  C CB  . MET A 1 194 ? -56.281  194.149 -15.361 1.00 0.00 ? 189 MET A CB  1 
ATOM 1521  C CG  . MET A 1 194 ? -57.593  194.898 -15.290 1.00 0.00 ? 189 MET A CG  1 
ATOM 1522  S SD  . MET A 1 194 ? -59.065  194.184 -14.510 1.00 0.00 ? 189 MET A SD  1 
ATOM 1523  C CE  . MET A 1 194 ? -58.873  194.647 -12.856 1.00 0.00 ? 189 MET A CE  1 
ATOM 1524  N N   . GLU A 1 195 ? -56.262  193.078 -18.435 1.00 0.00 ? 190 GLU A N   1 
ATOM 1525  C CA  . GLU A 1 195 ? -56.661  193.134 -19.809 1.00 0.00 ? 190 GLU A CA  1 
ATOM 1526  C C   . GLU A 1 195 ? -57.130  191.773 -20.281 1.00 0.00 ? 190 GLU A C   1 
ATOM 1527  O O   . GLU A 1 195 ? -58.136  191.677 -20.964 1.00 0.00 ? 190 GLU A O   1 
ATOM 1528  C CB  . GLU A 1 195 ? -55.549  193.746 -20.647 1.00 0.00 ? 190 GLU A CB  1 
ATOM 1529  C CG  . GLU A 1 195 ? -55.945  193.778 -22.153 1.00 0.00 ? 190 GLU A CG  1 
ATOM 1530  C CD  . GLU A 1 195 ? -55.006  194.496 -23.050 1.00 0.00 ? 190 GLU A CD  1 
ATOM 1531  O OE1 . GLU A 1 195 ? -54.004  195.102 -22.578 1.00 0.00 ? 190 GLU A OE1 1 
ATOM 1532  O OE2 . GLU A 1 195 ? -55.139  194.397 -24.309 1.00 0.00 ? 190 GLU A OE2 1 
ATOM 1533  N N   . PHE A 1 196 ? -56.380  190.720 -19.821 1.00 0.00 ? 191 PHE A N   1 
ATOM 1534  C CA  . PHE A 1 196 ? -56.612  189.320 -20.191 1.00 0.00 ? 191 PHE A CA  1 
ATOM 1535  C C   . PHE A 1 196 ? -57.975  188.954 -19.576 1.00 0.00 ? 191 PHE A C   1 
ATOM 1536  O O   . PHE A 1 196 ? -58.761  188.231 -20.207 1.00 0.00 ? 191 PHE A O   1 
ATOM 1537  C CB  . PHE A 1 196 ? -55.473  188.422 -19.677 1.00 0.00 ? 191 PHE A CB  1 
ATOM 1538  C CG  . PHE A 1 196 ? -55.665  187.121 -20.258 1.00 0.00 ? 191 PHE A CG  1 
ATOM 1539  C CD1 . PHE A 1 196 ? -55.631  186.940 -21.614 1.00 0.00 ? 191 PHE A CD1 1 
ATOM 1540  C CD2 . PHE A 1 196 ? -55.897  185.948 -19.432 1.00 0.00 ? 191 PHE A CD2 1 
ATOM 1541  C CE1 . PHE A 1 196 ? -55.778  185.645 -22.160 1.00 0.00 ? 191 PHE A CE1 1 
ATOM 1542  C CE2 . PHE A 1 196 ? -56.093  184.648 -19.940 1.00 0.00 ? 191 PHE A CE2 1 
ATOM 1543  C CZ  . PHE A 1 196 ? -56.126  184.544 -21.376 1.00 0.00 ? 191 PHE A CZ  1 
ATOM 1544  N N   . VAL A 1 197 ? -58.206  189.301 -18.372 1.00 0.00 ? 192 VAL A N   1 
ATOM 1545  C CA  . VAL A 1 197 ? -59.498  188.963 -17.643 1.00 0.00 ? 192 VAL A CA  1 
ATOM 1546  C C   . VAL A 1 197 ? -60.657  189.759 -18.242 1.00 0.00 ? 192 VAL A C   1 
ATOM 1547  O O   . VAL A 1 197 ? -61.759  189.255 -18.394 1.00 0.00 ? 192 VAL A O   1 
ATOM 1548  C CB  . VAL A 1 197 ? -59.295  189.260 -16.131 1.00 0.00 ? 192 VAL A CB  1 
ATOM 1549  C CG1 . VAL A 1 197 ? -60.605  189.257 -15.367 1.00 0.00 ? 192 VAL A CG1 1 
ATOM 1550  C CG2 . VAL A 1 197 ? -58.436  188.147 -15.463 1.00 0.00 ? 192 VAL A CG2 1 
ATOM 1551  N N   . LEU A 1 198 ? -60.381  191.032 -18.610 1.00 0.00 ? 193 LEU A N   1 
ATOM 1552  C CA  . LEU A 1 198 ? -61.348  191.924 -19.380 1.00 0.00 ? 193 LEU A CA  1 
ATOM 1553  C C   . LEU A 1 198 ? -61.860  191.227 -20.584 1.00 0.00 ? 193 LEU A C   1 
ATOM 1554  O O   . LEU A 1 198 ? -63.056  191.085 -20.805 1.00 0.00 ? 193 LEU A O   1 
ATOM 1555  C CB  . LEU A 1 198 ? -60.797  193.354 -19.720 1.00 0.00 ? 193 LEU A CB  1 
ATOM 1556  C CG  . LEU A 1 198 ? -60.680  194.328 -18.466 1.00 0.00 ? 193 LEU A CG  1 
ATOM 1557  C CD1 . LEU A 1 198 ? -60.155  195.663 -19.123 1.00 0.00 ? 193 LEU A CD1 1 
ATOM 1558  C CD2 . LEU A 1 198 ? -61.949  194.570 -17.775 1.00 0.00 ? 193 LEU A CD2 1 
ATOM 1559  N N   . ARG A 1 199 ? -60.903  190.680 -21.451 1.00 0.00 ? 194 ARG A N   1 
ATOM 1560  C CA  . ARG A 1 199 ? -61.161  189.962 -22.687 1.00 0.00 ? 194 ARG A CA  1 
ATOM 1561  C C   . ARG A 1 199 ? -61.827  188.650 -22.445 1.00 0.00 ? 194 ARG A C   1 
ATOM 1562  O O   . ARG A 1 199 ? -62.696  188.274 -23.221 1.00 0.00 ? 194 ARG A O   1 
ATOM 1563  C CB  . ARG A 1 199 ? -59.843  189.499 -23.360 1.00 0.00 ? 194 ARG A CB  1 
ATOM 1564  C CG  . ARG A 1 199 ? -59.137  190.478 -24.227 1.00 0.00 ? 194 ARG A CG  1 
ATOM 1565  C CD  . ARG A 1 199 ? -59.826  190.842 -25.625 1.00 0.00 ? 194 ARG A CD  1 
ATOM 1566  N NE  . ARG A 1 199 ? -60.965  191.900 -25.408 1.00 0.00 ? 194 ARG A NE  1 
ATOM 1567  C CZ  . ARG A 1 199 ? -60.600  193.169 -25.152 1.00 0.00 ? 194 ARG A CZ  1 
ATOM 1568  N NH1 . ARG A 1 199 ? -59.331  193.557 -25.116 1.00 0.00 ? 194 ARG A NH1 1 
ATOM 1569  N NH2 . ARG A 1 199 ? -61.484  194.147 -25.227 1.00 0.00 ? 194 ARG A NH2 1 
ATOM 1570  N N   . LEU A 1 200 ? -61.484  187.884 -21.415 1.00 0.00 ? 195 LEU A N   1 
ATOM 1571  C CA  . LEU A 1 200 ? -62.303  186.747 -20.997 1.00 0.00 ? 195 LEU A CA  1 
ATOM 1572  C C   . LEU A 1 200 ? -63.809  187.077 -20.783 1.00 0.00 ? 195 LEU A C   1 
ATOM 1573  O O   . LEU A 1 200 ? -64.684  186.502 -21.465 1.00 0.00 ? 195 LEU A O   1 
ATOM 1574  C CB  . LEU A 1 200 ? -61.740  185.979 -19.852 1.00 0.00 ? 195 LEU A CB  1 
ATOM 1575  C CG  . LEU A 1 200 ? -60.376  185.304 -20.163 1.00 0.00 ? 195 LEU A CG  1 
ATOM 1576  C CD1 . LEU A 1 200 ? -59.736  184.728 -18.859 1.00 0.00 ? 195 LEU A CD1 1 
ATOM 1577  C CD2 . LEU A 1 200 ? -60.474  184.180 -21.174 1.00 0.00 ? 195 LEU A CD2 1 
ATOM 1578  N N   . VAL A 1 201 ? -64.193  187.955 -19.840 1.00 0.00 ? 196 VAL A N   1 
ATOM 1579  C CA  . VAL A 1 201 ? -65.618  188.148 -19.518 1.00 0.00 ? 196 VAL A CA  1 
ATOM 1580  C C   . VAL A 1 201 ? -66.365  188.919 -20.524 1.00 0.00 ? 196 VAL A C   1 
ATOM 1581  O O   . VAL A 1 201 ? -67.625  188.876 -20.668 1.00 0.00 ? 196 VAL A O   1 
ATOM 1582  C CB  . VAL A 1 201 ? -65.814  188.850 -18.170 1.00 0.00 ? 196 VAL A CB  1 
ATOM 1583  C CG1 . VAL A 1 201 ? -65.069  188.127 -17.111 1.00 0.00 ? 196 VAL A CG1 1 
ATOM 1584  C CG2 . VAL A 1 201 ? -65.368  190.284 -18.199 1.00 0.00 ? 196 VAL A CG2 1 
ATOM 1585  N N   . GLU A 1 202 ? -65.662  189.661 -21.385 1.00 0.00 ? 197 GLU A N   1 
ATOM 1586  C CA  . GLU A 1 202 ? -66.155  190.265 -22.624 1.00 0.00 ? 197 GLU A CA  1 
ATOM 1587  C C   . GLU A 1 202 ? -66.775  189.250 -23.616 1.00 0.00 ? 197 GLU A C   1 
ATOM 1588  O O   . GLU A 1 202 ? -67.914  189.358 -24.011 1.00 0.00 ? 197 GLU A O   1 
ATOM 1589  C CB  . GLU A 1 202 ? -64.917  191.028 -23.275 1.00 0.00 ? 197 GLU A CB  1 
ATOM 1590  C CG  . GLU A 1 202 ? -65.388  191.982 -24.404 1.00 0.00 ? 197 GLU A CG  1 
ATOM 1591  C CD  . GLU A 1 202 ? -64.331  192.601 -25.333 1.00 0.00 ? 197 GLU A CD  1 
ATOM 1592  O OE1 . GLU A 1 202 ? -63.701  191.716 -25.954 1.00 0.00 ? 197 GLU A OE1 1 
ATOM 1593  O OE2 . GLU A 1 202 ? -64.117  193.863 -25.445 1.00 0.00 ? 197 GLU A OE2 1 
ATOM 1594  N N   . ALA A 1 203 ? -66.032  188.140 -23.962 1.00 0.00 ? 198 ALA A N   1 
ATOM 1595  C CA  . ALA A 1 203 ? -66.485  187.099 -24.847 1.00 0.00 ? 198 ALA A CA  1 
ATOM 1596  C C   . ALA A 1 203 ? -67.628  186.353 -24.263 1.00 0.00 ? 198 ALA A C   1 
ATOM 1597  O O   . ALA A 1 203 ? -68.561  186.031 -25.027 1.00 0.00 ? 198 ALA A O   1 
ATOM 1598  C CB  . ALA A 1 203 ? -65.263  186.146 -25.223 1.00 0.00 ? 198 ALA A CB  1 
ATOM 1599  N N   . GLN A 1 204 ? -67.701  186.138 -22.919 1.00 0.00 ? 199 GLN A N   1 
ATOM 1600  C CA  . GLN A 1 204 ? -68.837  185.609 -22.246 1.00 0.00 ? 199 GLN A CA  1 
ATOM 1601  C C   . GLN A 1 204 ? -70.077  186.506 -22.378 1.00 0.00 ? 199 GLN A C   1 
ATOM 1602  O O   . GLN A 1 204 ? -71.165  186.014 -22.698 1.00 0.00 ? 199 GLN A O   1 
ATOM 1603  C CB  . GLN A 1 204 ? -68.422  185.315 -20.726 1.00 0.00 ? 199 GLN A CB  1 
ATOM 1604  C CG  . GLN A 1 204 ? -69.424  184.419 -20.013 1.00 0.00 ? 199 GLN A CG  1 
ATOM 1605  C CD  . GLN A 1 204 ? -68.967  183.841 -18.664 1.00 0.00 ? 199 GLN A CD  1 
ATOM 1606  O OE1 . GLN A 1 204 ? -68.717  184.586 -17.655 1.00 0.00 ? 199 GLN A OE1 1 
ATOM 1607  N NE2 . GLN A 1 204 ? -68.934  182.497 -18.653 1.00 0.00 ? 199 GLN A NE2 1 
ATOM 1608  N N   . ALA A 1 205 ? -69.890  187.820 -22.097 1.00 0.00 ? 200 ALA A N   1 
ATOM 1609  C CA  . ALA A 1 205 ? -71.017  188.715 -22.274 1.00 0.00 ? 200 ALA A CA  1 
ATOM 1610  C C   . ALA A 1 205 ? -71.512  188.720 -23.706 1.00 0.00 ? 200 ALA A C   1 
ATOM 1611  O O   . ALA A 1 205 ? -72.744  188.711 -23.988 1.00 0.00 ? 200 ALA A O   1 
ATOM 1612  C CB  . ALA A 1 205 ? -70.603  190.109 -21.750 1.00 0.00 ? 200 ALA A CB  1 
ATOM 1613  N N   . THR A 1 206 ? -70.588  188.621 -24.617 1.00 0.00 ? 201 THR A N   1 
ATOM 1614  C CA  . THR A 1 206 ? -70.998  188.587 -25.990 1.00 0.00 ? 201 THR A CA  1 
ATOM 1615  C C   . THR A 1 206 ? -71.749  187.295 -26.397 1.00 0.00 ? 201 THR A C   1 
ATOM 1616  O O   . THR A 1 206 ? -72.806  187.320 -26.982 1.00 0.00 ? 201 THR A O   1 
ATOM 1617  C CB  . THR A 1 206 ? -69.986  188.744 -27.044 1.00 0.00 ? 201 THR A CB  1 
ATOM 1618  O OG1 . THR A 1 206 ? -69.384  190.060 -27.070 1.00 0.00 ? 201 THR A OG1 1 
ATOM 1619  C CG2 . THR A 1 206 ? -70.424  188.472 -28.459 1.00 0.00 ? 201 THR A CG2 1 
ATOM 1620  N N   . HIS A 1 207 ? -71.260  186.108 -25.933 1.00 0.00 ? 202 HIS A N   1 
ATOM 1621  C CA  . HIS A 1 207 ? -71.973  184.820 -26.051 1.00 0.00 ? 202 HIS A CA  1 
ATOM 1622  C C   . HIS A 1 207 ? -73.354  184.724 -25.348 1.00 0.00 ? 202 HIS A C   1 
ATOM 1623  O O   . HIS A 1 207 ? -74.257  184.169 -25.992 1.00 0.00 ? 202 HIS A O   1 
ATOM 1624  C CB  . HIS A 1 207 ? -71.060  183.719 -25.399 1.00 0.00 ? 202 HIS A CB  1 
ATOM 1625  C CG  . HIS A 1 207 ? -71.514  182.281 -25.492 1.00 0.00 ? 202 HIS A CG  1 
ATOM 1626  N ND1 . HIS A 1 207 ? -71.767  181.779 -26.751 1.00 0.00 ? 202 HIS A ND1 1 
ATOM 1627  C CD2 . HIS A 1 207 ? -72.135  181.414 -24.612 1.00 0.00 ? 202 HIS A CD2 1 
ATOM 1628  C CE1 . HIS A 1 207 ? -72.411  180.592 -26.585 1.00 0.00 ? 202 HIS A CE1 1 
ATOM 1629  N NE2 . HIS A 1 207 ? -72.613  180.310 -25.288 1.00 0.00 ? 202 HIS A NE2 1 
ATOM 1630  N N   . PHE A 1 208 ? -73.579  185.193 -24.123 1.00 0.00 ? 203 PHE A N   1 
ATOM 1631  C CA  . PHE A 1 208 ? -74.907  185.045 -23.588 1.00 0.00 ? 203 PHE A CA  1 
ATOM 1632  C C   . PHE A 1 208 ? -75.884  185.954 -24.241 1.00 0.00 ? 203 PHE A C   1 
ATOM 1633  O O   . PHE A 1 208 ? -77.107  185.635 -24.325 1.00 0.00 ? 203 PHE A O   1 
ATOM 1634  C CB  . PHE A 1 208 ? -74.869  185.229 -22.064 1.00 0.00 ? 203 PHE A CB  1 
ATOM 1635  C CG  . PHE A 1 208 ? -74.416  183.968 -21.235 1.00 0.00 ? 203 PHE A CG  1 
ATOM 1636  C CD1 . PHE A 1 208 ? -73.185  183.379 -21.502 1.00 0.00 ? 203 PHE A CD1 1 
ATOM 1637  C CD2 . PHE A 1 208 ? -75.234  183.399 -20.213 1.00 0.00 ? 203 PHE A CD2 1 
ATOM 1638  C CE1 . PHE A 1 208 ? -72.759  182.245 -20.802 1.00 0.00 ? 203 PHE A CE1 1 
ATOM 1639  C CE2 . PHE A 1 208 ? -74.846  182.174 -19.586 1.00 0.00 ? 203 PHE A CE2 1 
ATOM 1640  C CZ  . PHE A 1 208 ? -73.578  181.593 -19.921 1.00 0.00 ? 203 PHE A CZ  1 
ATOM 1641  N N   . GLN A 1 209 ? -75.408  187.031 -24.771 1.00 0.00 ? 204 GLN A N   1 
ATOM 1642  C CA  . GLN A 1 209 ? -76.354  188.011 -25.347 1.00 0.00 ? 204 GLN A CA  1 
ATOM 1643  C C   . GLN A 1 209 ? -76.869  187.536 -26.636 1.00 0.00 ? 204 GLN A C   1 
ATOM 1644  O O   . GLN A 1 209 ? -78.096  187.649 -26.787 1.00 0.00 ? 204 GLN A O   1 
ATOM 1645  C CB  . GLN A 1 209 ? -75.760  189.420 -25.305 1.00 0.00 ? 204 GLN A CB  1 
ATOM 1646  C CG  . GLN A 1 209 ? -76.802  190.499 -25.423 1.00 0.00 ? 204 GLN A CG  1 
ATOM 1647  C CD  . GLN A 1 209 ? -76.184  191.897 -25.626 1.00 0.00 ? 204 GLN A CD  1 
ATOM 1648  O OE1 . GLN A 1 209 ? -75.296  192.404 -24.842 1.00 0.00 ? 204 GLN A OE1 1 
ATOM 1649  N NE2 . GLN A 1 209 ? -76.629  192.591 -26.710 1.00 0.00 ? 204 GLN A NE2 1 
ATOM 1650  N N   . GLN A 1 210 ? -76.006  186.913 -27.574 1.00 0.00 ? 205 GLN A N   1 
ATOM 1651  C CA  . GLN A 1 210 ? -76.538  186.268 -28.823 1.00 0.00 ? 205 GLN A CA  1 
ATOM 1652  C C   . GLN A 1 210 ? -77.642  185.176 -28.574 1.00 0.00 ? 205 GLN A C   1 
ATOM 1653  O O   . GLN A 1 210 ? -78.708  185.107 -29.237 1.00 0.00 ? 205 GLN A O   1 
ATOM 1654  C CB  . GLN A 1 210 ? -75.470  185.675 -29.712 1.00 0.00 ? 205 GLN A CB  1 
ATOM 1655  C CG  . GLN A 1 210 ? -74.330  186.675 -29.972 1.00 0.00 ? 205 GLN A CG  1 
ATOM 1656  C CD  . GLN A 1 210 ? -73.311  186.139 -30.929 1.00 0.00 ? 205 GLN A CD  1 
ATOM 1657  O OE1 . GLN A 1 210 ? -73.126  184.945 -31.200 1.00 0.00 ? 205 GLN A OE1 1 
ATOM 1658  N NE2 . GLN A 1 210 ? -72.590  187.096 -31.600 1.00 0.00 ? 205 GLN A NE2 1 
ATOM 1659  N N   . GLY A 1 211 ? -77.428  184.427 -27.476 1.00 0.00 ? 206 GLY A N   1 
ATOM 1660  C CA  . GLY A 1 211 ? -78.339  183.380 -27.037 1.00 0.00 ? 206 GLY A CA  1 
ATOM 1661  C C   . GLY A 1 211 ? -79.581  183.861 -26.241 1.00 0.00 ? 206 GLY A C   1 
ATOM 1662  O O   . GLY A 1 211 ? -80.471  183.075 -26.002 1.00 0.00 ? 206 GLY A O   1 
ATOM 1663  N N   . HIS A 1 212 ? -79.572  185.106 -25.826 1.00 0.00 ? 207 HIS A N   1 
ATOM 1664  C CA  . HIS A 1 212 ? -80.603  185.723 -25.066 1.00 0.00 ? 207 HIS A CA  1 
ATOM 1665  C C   . HIS A 1 212 ? -81.544  186.484 -26.021 1.00 0.00 ? 207 HIS A C   1 
ATOM 1666  O O   . HIS A 1 212 ? -82.728  186.712 -25.802 1.00 0.00 ? 207 HIS A O   1 
ATOM 1667  C CB  . HIS A 1 212 ? -79.999  186.905 -24.202 1.00 0.00 ? 207 HIS A CB  1 
ATOM 1668  C CG  . HIS A 1 212 ? -80.976  187.514 -23.207 1.00 0.00 ? 207 HIS A CG  1 
ATOM 1669  N ND1 . HIS A 1 212 ? -81.690  188.648 -23.379 1.00 0.00 ? 207 HIS A ND1 1 
ATOM 1670  C CD2 . HIS A 1 212 ? -81.523  186.895 -22.185 1.00 0.00 ? 207 HIS A CD2 1 
ATOM 1671  C CE1 . HIS A 1 212 ? -82.464  188.746 -22.307 1.00 0.00 ? 207 HIS A CE1 1 
ATOM 1672  N NE2 . HIS A 1 212 ? -82.484  187.647 -21.540 1.00 0.00 ? 207 HIS A NE2 1 
ATOM 1673  N N   . GLU A 1 213 ? -80.932  186.898 -27.157 1.00 0.00 ? 208 GLU A N   1 
ATOM 1674  C CA  . GLU A 1 213 ? -81.490  187.787 -28.213 1.00 0.00 ? 208 GLU A CA  1 
ATOM 1675  C C   . GLU A 1 213 ? -82.599  187.125 -29.006 1.00 0.00 ? 208 GLU A C   1 
ATOM 1676  O O   . GLU A 1 213 ? -83.687  187.712 -29.223 1.00 0.00 ? 208 GLU A O   1 
ATOM 1677  C CB  . GLU A 1 213 ? -80.439  188.371 -29.160 1.00 0.00 ? 208 GLU A CB  1 
ATOM 1678  C CG  . GLU A 1 213 ? -80.900  189.332 -30.309 1.00 0.00 ? 208 GLU A CG  1 
ATOM 1679  C CD  . GLU A 1 213 ? -79.785  189.601 -31.253 1.00 0.00 ? 208 GLU A CD  1 
ATOM 1680  O OE1 . GLU A 1 213 ? -79.299  188.727 -32.004 1.00 0.00 ? 208 GLU A OE1 1 
ATOM 1681  O OE2 . GLU A 1 213 ? -79.309  190.759 -31.157 1.00 0.00 ? 208 GLU A OE2 1 
ATOM 1682  N N   . GLU A 1 214 ? -82.500  185.830 -29.381 1.00 0.00 ? 209 GLU A N   1 
ATOM 1683  C CA  . GLU A 1 214 ? -83.571  185.049 -30.002 1.00 0.00 ? 209 GLU A CA  1 
ATOM 1684  C C   . GLU A 1 214 ? -84.497  184.307 -28.946 1.00 0.00 ? 209 GLU A C   1 
ATOM 1685  O O   . GLU A 1 214 ? -85.395  183.645 -29.354 1.00 0.00 ? 209 GLU A O   1 
ATOM 1686  C CB  . GLU A 1 214 ? -83.059  184.101 -31.143 1.00 0.00 ? 209 GLU A CB  1 
ATOM 1687  C CG  . GLU A 1 214 ? -82.376  182.829 -30.633 1.00 0.00 ? 209 GLU A CG  1 
ATOM 1688  C CD  . GLU A 1 214 ? -81.871  181.940 -31.716 1.00 0.00 ? 209 GLU A CD  1 
ATOM 1689  O OE1 . GLU A 1 214 ? -82.782  181.138 -32.112 1.00 0.00 ? 209 GLU A OE1 1 
ATOM 1690  O OE2 . GLU A 1 214 ? -80.747  182.002 -32.185 1.00 0.00 ? 209 GLU A OE2 1 
ATOM 1691  N N   . LEU A 1 215 ? -84.192  184.383 -27.612 1.00 0.00 ? 210 LEU A N   1 
ATOM 1692  C CA  . LEU A 1 215 ? -84.921  183.734 -26.492 1.00 0.00 ? 210 LEU A CA  1 
ATOM 1693  C C   . LEU A 1 215 ? -86.385  183.891 -26.641 1.00 0.00 ? 210 LEU A C   1 
ATOM 1694  O O   . LEU A 1 215 ? -87.152  182.933 -26.522 1.00 0.00 ? 210 LEU A O   1 
ATOM 1695  C CB  . LEU A 1 215 ? -84.220  184.127 -25.132 1.00 0.00 ? 210 LEU A CB  1 
ATOM 1696  C CG  . LEU A 1 215 ? -84.609  183.333 -23.982 1.00 0.00 ? 210 LEU A CG  1 
ATOM 1697  C CD1 . LEU A 1 215 ? -83.500  182.350 -23.662 1.00 0.00 ? 210 LEU A CD1 1 
ATOM 1698  C CD2 . LEU A 1 215 ? -84.987  184.159 -22.780 1.00 0.00 ? 210 LEU A CD2 1 
ATOM 1699  N N   . SER A 1 216 ? -86.940  185.100 -26.980 1.00 0.00 ? 211 SER A N   1 
ATOM 1700  C CA  . SER A 1 216 ? -88.331  185.216 -27.351 1.00 0.00 ? 211 SER A CA  1 
ATOM 1701  C C   . SER A 1 216 ? -88.963  184.350 -28.434 1.00 0.00 ? 211 SER A C   1 
ATOM 1702  O O   . SER A 1 216 ? -90.082  183.781 -28.307 1.00 0.00 ? 211 SER A O   1 
ATOM 1703  C CB  . SER A 1 216 ? -88.657  186.660 -27.808 1.00 0.00 ? 211 SER A CB  1 
ATOM 1704  O OG  . SER A 1 216 ? -87.841  187.192 -28.836 1.00 0.00 ? 211 SER A OG  1 
ATOM 1705  N N   . ARG A 1 217 ? -88.332  184.191 -29.583 1.00 0.00 ? 212 ARG A N   1 
ATOM 1706  C CA  . ARG A 1 217 ? -88.644  183.222 -30.677 1.00 0.00 ? 212 ARG A CA  1 
ATOM 1707  C C   . ARG A 1 217 ? -88.608  181.809 -30.114 1.00 0.00 ? 212 ARG A C   1 
ATOM 1708  O O   . ARG A 1 217 ? -89.471  180.965 -30.448 1.00 0.00 ? 212 ARG A O   1 
ATOM 1709  C CB  . ARG A 1 217 ? -87.868  183.359 -31.991 1.00 0.00 ? 212 ARG A CB  1 
ATOM 1710  C CG  . ARG A 1 217 ? -86.572  182.625 -32.226 1.00 0.00 ? 212 ARG A CG  1 
ATOM 1711  C CD  . ARG A 1 217 ? -85.974  182.911 -33.598 1.00 0.00 ? 212 ARG A CD  1 
ATOM 1712  N NE  . ARG A 1 217 ? -84.743  182.035 -33.725 1.00 0.00 ? 212 ARG A NE  1 
ATOM 1713  C CZ  . ARG A 1 217 ? -84.097  181.845 -34.854 1.00 0.00 ? 212 ARG A CZ  1 
ATOM 1714  N NH1 . ARG A 1 217 ? -84.497  182.322 -36.004 1.00 0.00 ? 212 ARG A NH1 1 
ATOM 1715  N NH2 . ARG A 1 217 ? -82.997  181.048 -34.790 1.00 0.00 ? 212 ARG A NH2 1 
ATOM 1716  N N   . LEU A 1 218 ? -87.703  181.414 -29.237 1.00 0.00 ? 213 LEU A N   1 
ATOM 1717  C CA  . LEU A 1 218 ? -87.598  180.035 -28.771 1.00 0.00 ? 213 LEU A CA  1 
ATOM 1718  C C   . LEU A 1 218 ? -88.808  179.701 -27.849 1.00 0.00 ? 213 LEU A C   1 
ATOM 1719  O O   . LEU A 1 218 ? -89.333  178.557 -27.818 1.00 0.00 ? 213 LEU A O   1 
ATOM 1720  C CB  . LEU A 1 218 ? -86.196  179.813 -28.152 1.00 0.00 ? 213 LEU A CB  1 
ATOM 1721  C CG  . LEU A 1 218 ? -85.854  178.278 -28.060 1.00 0.00 ? 213 LEU A CG  1 
ATOM 1722  C CD1 . LEU A 1 218 ? -85.417  177.638 -29.344 1.00 0.00 ? 213 LEU A CD1 1 
ATOM 1723  C CD2 . LEU A 1 218 ? -84.617  178.243 -27.049 1.00 0.00 ? 213 LEU A CD2 1 
ATOM 1724  N N   . SER A 1 219 ? -89.195  180.682 -26.981 1.00 0.00 ? 214 SER A N   1 
ATOM 1725  C CA  . SER A 1 219 ? -90.184  180.682 -25.948 1.00 0.00 ? 214 SER A CA  1 
ATOM 1726  C C   . SER A 1 219 ? -91.570  180.543 -26.478 1.00 0.00 ? 214 SER A C   1 
ATOM 1727  O O   . SER A 1 219 ? -92.351  179.721 -25.908 1.00 0.00 ? 214 SER A O   1 
ATOM 1728  C CB  . SER A 1 219 ? -90.128  182.010 -25.097 1.00 0.00 ? 214 SER A CB  1 
ATOM 1729  O OG  . SER A 1 219 ? -88.832  182.200 -24.555 1.00 0.00 ? 214 SER A OG  1 
ATOM 1730  N N   . GLN A 1 220 ? -92.034  181.233 -27.548 1.00 0.00 ? 215 GLN A N   1 
ATOM 1731  C CA  . GLN A 1 220 ? -93.216  180.938 -28.302 1.00 0.00 ? 215 GLN A CA  1 
ATOM 1732  C C   . GLN A 1 220 ? -93.294  179.527 -28.767 1.00 0.00 ? 215 GLN A C   1 
ATOM 1733  O O   . GLN A 1 220 ? -94.322  178.898 -28.521 1.00 0.00 ? 215 GLN A O   1 
ATOM 1734  C CB  . GLN A 1 220 ? -93.313  181.848 -29.504 1.00 0.00 ? 215 GLN A CB  1 
ATOM 1735  C CG  . GLN A 1 220 ? -94.776  182.004 -30.160 1.00 0.00 ? 215 GLN A CG  1 
ATOM 1736  C CD  . GLN A 1 220 ? -95.823  182.725 -29.333 1.00 0.00 ? 215 GLN A CD  1 
ATOM 1737  O OE1 . GLN A 1 220 ? -95.835  183.934 -29.088 1.00 0.00 ? 215 GLN A OE1 1 
ATOM 1738  N NE2 . GLN A 1 220 ? -96.871  181.971 -28.917 1.00 0.00 ? 215 GLN A NE2 1 
ATOM 1739  N N   . TYR A 1 221 ? -92.268  178.881 -29.307 1.00 0.00 ? 216 TYR A N   1 
ATOM 1740  C CA  . TYR A 1 221 ? -92.375  177.494 -29.675 1.00 0.00 ? 216 TYR A CA  1 
ATOM 1741  C C   . TYR A 1 221 ? -92.468  176.491 -28.479 1.00 0.00 ? 216 TYR A C   1 
ATOM 1742  O O   . TYR A 1 221 ? -93.164  175.502 -28.631 1.00 0.00 ? 216 TYR A O   1 
ATOM 1743  C CB  . TYR A 1 221 ? -91.303  177.046 -30.702 1.00 0.00 ? 216 TYR A CB  1 
ATOM 1744  C CG  . TYR A 1 221 ? -91.331  177.933 -31.932 1.00 0.00 ? 216 TYR A CG  1 
ATOM 1745  C CD1 . TYR A 1 221 ? -92.449  177.929 -32.800 1.00 0.00 ? 216 TYR A CD1 1 
ATOM 1746  C CD2 . TYR A 1 221 ? -90.296  178.826 -32.180 1.00 0.00 ? 216 TYR A CD2 1 
ATOM 1747  C CE1 . TYR A 1 221 ? -92.689  178.994 -33.692 1.00 0.00 ? 216 TYR A CE1 1 
ATOM 1748  C CE2 . TYR A 1 221 ? -90.455  179.818 -33.138 1.00 0.00 ? 216 TYR A CE2 1 
ATOM 1749  C CZ  . TYR A 1 221 ? -91.667  179.903 -33.933 1.00 0.00 ? 216 TYR A CZ  1 
ATOM 1750  O OH  . TYR A 1 221 ? -91.744  180.960 -34.863 1.00 0.00 ? 216 TYR A OH  1 
ATOM 1751  N N   . ARG A 1 222 ? -91.820  176.805 -27.372 1.00 0.00 ? 217 ARG A N   1 
ATOM 1752  C CA  . ARG A 1 222 ? -91.746  175.989 -26.184 1.00 0.00 ? 217 ARG A CA  1 
ATOM 1753  C C   . ARG A 1 222 ? -93.189  175.921 -25.671 1.00 0.00 ? 217 ARG A C   1 
ATOM 1754  O O   . ARG A 1 222 ? -93.705  174.811 -25.422 1.00 0.00 ? 217 ARG A O   1 
ATOM 1755  C CB  . ARG A 1 222 ? -90.930  176.767 -25.158 1.00 0.00 ? 217 ARG A CB  1 
ATOM 1756  C CG  . ARG A 1 222 ? -90.807  176.151 -23.731 1.00 0.00 ? 217 ARG A CG  1 
ATOM 1757  C CD  . ARG A 1 222 ? -90.296  177.196 -22.695 1.00 0.00 ? 217 ARG A CD  1 
ATOM 1758  N NE  . ARG A 1 222 ? -90.459  176.739 -21.270 1.00 0.00 ? 217 ARG A NE  1 
ATOM 1759  C CZ  . ARG A 1 222 ? -90.188  177.525 -20.255 1.00 0.00 ? 217 ARG A CZ  1 
ATOM 1760  N NH1 . ARG A 1 222 ? -89.570  178.690 -20.307 1.00 0.00 ? 217 ARG A NH1 1 
ATOM 1761  N NH2 . ARG A 1 222 ? -90.600  177.074 -19.055 1.00 0.00 ? 217 ARG A NH2 1 
ATOM 1762  N N   . LYS A 1 223 ? -93.851  177.069 -25.474 1.00 0.00 ? 218 LYS A N   1 
ATOM 1763  C CA  . LYS A 1 223 ? -95.299  177.105 -25.162 1.00 0.00 ? 218 LYS A CA  1 
ATOM 1764  C C   . LYS A 1 223 ? -96.083  176.360 -26.227 1.00 0.00 ? 218 LYS A C   1 
ATOM 1765  O O   . LYS A 1 223 ? -96.880  175.549 -25.946 1.00 0.00 ? 218 LYS A O   1 
ATOM 1766  C CB  . LYS A 1 223 ? -95.680  178.655 -25.113 1.00 0.00 ? 218 LYS A CB  1 
ATOM 1767  C CG  . LYS A 1 223 ? -97.190  178.922 -24.857 1.00 0.00 ? 218 LYS A CG  1 
ATOM 1768  C CD  . LYS A 1 223 ? -97.952  179.249 -26.139 1.00 0.00 ? 218 LYS A CD  1 
ATOM 1769  C CE  . LYS A 1 223 ? -99.437  179.037 -25.786 1.00 0.00 ? 218 LYS A CE  1 
ATOM 1770  N NZ  . LYS A 1 223 ? -100.385 179.550 -26.913 1.00 0.00 ? 218 LYS A NZ  1 
ATOM 1771  N N   . GLU A 1 224 ? -96.037  176.677 -27.532 1.00 0.00 ? 219 GLU A N   1 
ATOM 1772  C CA  . GLU A 1 224 ? -96.989  176.114 -28.563 1.00 0.00 ? 219 GLU A CA  1 
ATOM 1773  C C   . GLU A 1 224 ? -96.765  174.627 -28.782 1.00 0.00 ? 219 GLU A C   1 
ATOM 1774  O O   . GLU A 1 224 ? -97.676  173.813 -29.010 1.00 0.00 ? 219 GLU A O   1 
ATOM 1775  C CB  . GLU A 1 224 ? -96.668  176.749 -29.949 1.00 0.00 ? 219 GLU A CB  1 
ATOM 1776  C CG  . GLU A 1 224 ? -97.093  178.238 -30.110 1.00 0.00 ? 219 GLU A CG  1 
ATOM 1777  C CD  . GLU A 1 224 ? -98.574  178.379 -30.114 1.00 0.00 ? 219 GLU A CD  1 
ATOM 1778  O OE1 . GLU A 1 224 ? -99.181  178.154 -31.169 1.00 0.00 ? 219 GLU A OE1 1 
ATOM 1779  O OE2 . GLU A 1 224 ? -99.168  178.838 -29.115 1.00 0.00 ? 219 GLU A OE2 1 
ATOM 1780  N N   . LEU A 1 225 ? -95.525  174.123 -28.700 1.00 0.00 ? 220 LEU A N   1 
ATOM 1781  C CA  . LEU A 1 225 ? -95.360  172.716 -28.632 1.00 0.00 ? 220 LEU A CA  1 
ATOM 1782  C C   . LEU A 1 225 ? -95.988  172.030 -27.404 1.00 0.00 ? 220 LEU A C   1 
ATOM 1783  O O   . LEU A 1 225 ? -96.477  170.906 -27.488 1.00 0.00 ? 220 LEU A O   1 
ATOM 1784  C CB  . LEU A 1 225 ? -93.801  172.441 -28.659 1.00 0.00 ? 220 LEU A CB  1 
ATOM 1785  C CG  . LEU A 1 225 ? -93.348  170.934 -28.963 1.00 0.00 ? 220 LEU A CG  1 
ATOM 1786  C CD1 . LEU A 1 225 ? -93.525  170.716 -30.363 1.00 0.00 ? 220 LEU A CD1 1 
ATOM 1787  C CD2 . LEU A 1 225 ? -91.863  170.628 -28.738 1.00 0.00 ? 220 LEU A CD2 1 
ATOM 1788  N N   . GLY A 1 226 ? -95.894  172.688 -26.160 1.00 0.00 ? 221 GLY A N   1 
ATOM 1789  C CA  . GLY A 1 226 ? -96.289  172.302 -24.802 1.00 0.00 ? 221 GLY A CA  1 
ATOM 1790  C C   . GLY A 1 226 ? -97.811  172.254 -24.704 1.00 0.00 ? 221 GLY A C   1 
ATOM 1791  O O   . GLY A 1 226 ? -98.380  171.338 -24.100 1.00 0.00 ? 221 GLY A O   1 
ATOM 1792  N N   . ALA A 1 227 ? -98.555  173.298 -25.182 1.00 0.00 ? 222 ALA A N   1 
ATOM 1793  C CA  . ALA A 1 227 ? -100.024 173.340 -25.119 1.00 0.00 ? 222 ALA A CA  1 
ATOM 1794  C C   . ALA A 1 227 ? -100.668 172.269 -25.911 1.00 0.00 ? 222 ALA A C   1 
ATOM 1795  O O   . ALA A 1 227 ? -101.683 171.649 -25.551 1.00 0.00 ? 222 ALA A O   1 
ATOM 1796  C CB  . ALA A 1 227 ? -100.614 174.695 -25.519 1.00 0.00 ? 222 ALA A CB  1 
ATOM 1797  N N   . GLN A 1 228 ? -99.984  171.952 -27.079 1.00 0.00 ? 223 GLN A N   1 
ATOM 1798  C CA  . GLN A 1 228 ? -100.295 170.892 -27.971 1.00 0.00 ? 223 GLN A CA  1 
ATOM 1799  C C   . GLN A 1 228 ? -99.983  169.515 -27.422 1.00 0.00 ? 223 GLN A C   1 
ATOM 1800  O O   . GLN A 1 228 ? -100.903 168.669 -27.552 1.00 0.00 ? 223 GLN A O   1 
ATOM 1801  C CB  . GLN A 1 228 ? -99.505  171.207 -29.313 1.00 0.00 ? 223 GLN A CB  1 
ATOM 1802  C CG  . GLN A 1 228 ? -99.690  170.199 -30.439 1.00 0.00 ? 223 GLN A CG  1 
ATOM 1803  C CD  . GLN A 1 228 ? -101.117 170.093 -31.039 1.00 0.00 ? 223 GLN A CD  1 
ATOM 1804  O OE1 . GLN A 1 228 ? -101.495 171.036 -31.764 1.00 0.00 ? 223 GLN A OE1 1 
ATOM 1805  N NE2 . GLN A 1 228 ? -101.926 169.126 -30.644 1.00 0.00 ? 223 GLN A NE2 1 
ATOM 1806  N N   . LEU A 1 229 ? -98.833  169.302 -26.774 1.00 0.00 ? 224 LEU A N   1 
ATOM 1807  C CA  . LEU A 1 229 ? -98.570  168.078 -26.119 1.00 0.00 ? 224 LEU A CA  1 
ATOM 1808  C C   . LEU A 1 229 ? -99.525  167.741 -25.015 1.00 0.00 ? 224 LEU A C   1 
ATOM 1809  O O   . LEU A 1 229 ? -99.947  166.559 -24.807 1.00 0.00 ? 224 LEU A O   1 
ATOM 1810  C CB  . LEU A 1 229 ? -97.075  168.168 -25.577 1.00 0.00 ? 224 LEU A CB  1 
ATOM 1811  C CG  . LEU A 1 229 ? -96.628  166.884 -24.865 1.00 0.00 ? 224 LEU A CG  1 
ATOM 1812  C CD1 . LEU A 1 229 ? -96.507  165.743 -25.896 1.00 0.00 ? 224 LEU A CD1 1 
ATOM 1813  C CD2 . LEU A 1 229 ? -95.318  167.161 -24.174 1.00 0.00 ? 224 LEU A CD2 1 
ATOM 1814  N N   . HIS A 1 230 ? -99.983  168.684 -24.168 1.00 0.00 ? 225 HIS A N   1 
ATOM 1815  C CA  . HIS A 1 230 ? -101.062 168.446 -23.184 1.00 0.00 ? 225 HIS A CA  1 
ATOM 1816  C C   . HIS A 1 230 ? -102.443 168.214 -23.624 1.00 0.00 ? 225 HIS A C   1 
ATOM 1817  O O   . HIS A 1 230 ? -103.196 167.381 -23.111 1.00 0.00 ? 225 HIS A O   1 
ATOM 1818  C CB  . HIS A 1 230 ? -101.235 169.710 -22.253 1.00 0.00 ? 225 HIS A CB  1 
ATOM 1819  C CG  . HIS A 1 230 ? -100.156 170.120 -21.300 1.00 0.00 ? 225 HIS A CG  1 
ATOM 1820  N ND1 . HIS A 1 230 ? -99.866  169.330 -20.208 1.00 0.00 ? 225 HIS A ND1 1 
ATOM 1821  C CD2 . HIS A 1 230 ? -99.407  171.241 -21.172 1.00 0.00 ? 225 HIS A CD2 1 
ATOM 1822  C CE1 . HIS A 1 230 ? -98.905  170.000 -19.535 1.00 0.00 ? 225 HIS A CE1 1 
ATOM 1823  N NE2 . HIS A 1 230 ? -98.630  171.131 -20.073 1.00 0.00 ? 225 HIS A NE2 1 
ATOM 1824  N N   . GLN A 1 231 ? -102.893 168.794 -24.769 1.00 0.00 ? 226 GLN A N   1 
ATOM 1825  C CA  . GLN A 1 231 ? -104.008 168.313 -25.492 1.00 0.00 ? 226 GLN A CA  1 
ATOM 1826  C C   . GLN A 1 231 ? -103.778 166.976 -26.114 1.00 0.00 ? 226 GLN A C   1 
ATOM 1827  O O   . GLN A 1 231 ? -104.558 166.114 -25.996 1.00 0.00 ? 226 GLN A O   1 
ATOM 1828  C CB  . GLN A 1 231 ? -104.199 169.426 -26.581 1.00 0.00 ? 226 GLN A CB  1 
ATOM 1829  C CG  . GLN A 1 231 ? -105.532 169.247 -27.291 1.00 0.00 ? 226 GLN A CG  1 
ATOM 1830  C CD  . GLN A 1 231 ? -105.862 170.375 -28.320 1.00 0.00 ? 226 GLN A CD  1 
ATOM 1831  O OE1 . GLN A 1 231 ? -106.081 171.546 -27.987 1.00 0.00 ? 226 GLN A OE1 1 
ATOM 1832  N NE2 . GLN A 1 231 ? -105.871 170.054 -29.625 1.00 0.00 ? 226 GLN A NE2 1 
ATOM 1833  N N   . LEU A 1 232 ? -102.649 166.732 -26.751 1.00 0.00 ? 227 LEU A N   1 
ATOM 1834  C CA  . LEU A 1 232 ? -102.396 165.341 -27.207 1.00 0.00 ? 227 LEU A CA  1 
ATOM 1835  C C   . LEU A 1 232 ? -102.461 164.201 -26.192 1.00 0.00 ? 227 LEU A C   1 
ATOM 1836  O O   . LEU A 1 232 ? -103.022 163.150 -26.478 1.00 0.00 ? 227 LEU A O   1 
ATOM 1837  C CB  . LEU A 1 232 ? -101.028 165.183 -27.936 1.00 0.00 ? 227 LEU A CB  1 
ATOM 1838  C CG  . LEU A 1 232 ? -100.980 165.924 -29.247 1.00 0.00 ? 227 LEU A CG  1 
ATOM 1839  C CD1 . LEU A 1 232 ? -99.530  165.736 -29.871 1.00 0.00 ? 227 LEU A CD1 1 
ATOM 1840  C CD2 . LEU A 1 232 ? -101.961 165.544 -30.385 1.00 0.00 ? 227 LEU A CD2 1 
ATOM 1841  N N   . VAL A 1 233 ? -101.815 164.416 -24.997 1.00 0.00 ? 228 VAL A N   1 
ATOM 1842  C CA  . VAL A 1 233 ? -101.911 163.443 -23.949 1.00 0.00 ? 228 VAL A CA  1 
ATOM 1843  C C   . VAL A 1 233 ? -103.399 163.223 -23.482 1.00 0.00 ? 228 VAL A C   1 
ATOM 1844  O O   . VAL A 1 233 ? -103.839 162.096 -23.374 1.00 0.00 ? 228 VAL A O   1 
ATOM 1845  C CB  . VAL A 1 233 ? -100.949 163.756 -22.773 1.00 0.00 ? 228 VAL A CB  1 
ATOM 1846  C CG1 . VAL A 1 233 ? -101.284 162.803 -21.606 1.00 0.00 ? 228 VAL A CG1 1 
ATOM 1847  C CG2 . VAL A 1 233 ? -99.545  163.464 -23.258 1.00 0.00 ? 228 VAL A CG2 1 
ATOM 1848  N N   . LEU A 1 234 ? -104.240 164.221 -23.145 1.00 0.00 ? 229 LEU A N   1 
ATOM 1849  C CA  . LEU A 1 234 ? -105.582 164.088 -22.857 1.00 0.00 ? 229 LEU A CA  1 
ATOM 1850  C C   . LEU A 1 234 ? -106.325 163.460 -23.980 1.00 0.00 ? 229 LEU A C   1 
ATOM 1851  O O   . LEU A 1 234 ? -107.214 162.563 -23.785 1.00 0.00 ? 229 LEU A O   1 
ATOM 1852  C CB  . LEU A 1 234 ? -106.200 165.513 -22.438 1.00 0.00 ? 229 LEU A CB  1 
ATOM 1853  C CG  . LEU A 1 234 ? -107.657 165.356 -21.858 1.00 0.00 ? 229 LEU A CG  1 
ATOM 1854  C CD1 . LEU A 1 234 ? -107.610 164.571 -20.460 1.00 0.00 ? 229 LEU A CD1 1 
ATOM 1855  C CD2 . LEU A 1 234 ? -108.338 166.695 -21.573 1.00 0.00 ? 229 LEU A CD2 1 
ATOM 1856  N N   . ASN A 1 235 ? -106.022 163.778 -25.245 1.00 0.00 ? 230 ASN A N   1 
ATOM 1857  C CA  . ASN A 1 235 ? -106.606 163.115 -26.439 1.00 0.00 ? 230 ASN A CA  1 
ATOM 1858  C C   . ASN A 1 235 ? -106.211 161.684 -26.533 1.00 0.00 ? 230 ASN A C   1 
ATOM 1859  O O   . ASN A 1 235 ? -107.088 160.905 -26.853 1.00 0.00 ? 230 ASN A O   1 
ATOM 1860  C CB  . ASN A 1 235 ? -106.344 163.777 -27.777 1.00 0.00 ? 230 ASN A CB  1 
ATOM 1861  C CG  . ASN A 1 235 ? -107.020 165.138 -27.850 1.00 0.00 ? 230 ASN A CG  1 
ATOM 1862  O OD1 . ASN A 1 235 ? -107.943 165.351 -27.072 1.00 0.00 ? 230 ASN A OD1 1 
ATOM 1863  N ND2 . ASN A 1 235 ? -106.721 165.957 -28.872 1.00 0.00 ? 230 ASN A ND2 1 
ATOM 1864  N N   . SER A 1 236 ? -104.974 161.241 -26.278 1.00 0.00 ? 231 SER A N   1 
ATOM 1865  C CA  . SER A 1 236 ? -104.502 159.864 -26.264 1.00 0.00 ? 231 SER A CA  1 
ATOM 1866  C C   . SER A 1 236 ? -105.082 159.004 -25.132 1.00 0.00 ? 231 SER A C   1 
ATOM 1867  O O   . SER A 1 236 ? -105.466 157.890 -25.308 1.00 0.00 ? 231 SER A O   1 
ATOM 1868  C CB  . SER A 1 236 ? -102.960 160.024 -25.933 1.00 0.00 ? 231 SER A CB  1 
ATOM 1869  O OG  . SER A 1 236 ? -102.265 158.767 -26.102 1.00 0.00 ? 231 SER A OG  1 
ATOM 1870  N N   . ALA A 1 237 ? -105.214 159.650 -23.921 1.00 0.00 ? 232 ALA A N   1 
ATOM 1871  C CA  . ALA A 1 237 ? -105.874 159.070 -22.781 1.00 0.00 ? 232 ALA A CA  1 
ATOM 1872  C C   . ALA A 1 237 ? -107.219 158.617 -23.145 1.00 0.00 ? 232 ALA A C   1 
ATOM 1873  O O   . ALA A 1 237 ? -107.591 157.434 -23.121 1.00 0.00 ? 232 ALA A O   1 
ATOM 1874  C CB  . ALA A 1 237 ? -105.907 160.043 -21.594 1.00 0.00 ? 232 ALA A CB  1 
ATOM 1875  N N   . ARG A 1 238 ? -108.061 159.553 -23.661 1.00 0.00 ? 233 ARG A N   1 
ATOM 1876  C CA  . ARG A 1 238 ? -109.394 159.285 -24.219 1.00 0.00 ? 233 ARG A CA  1 
ATOM 1877  C C   . ARG A 1 238 ? -109.520 158.272 -25.369 1.00 0.00 ? 233 ARG A C   1 
ATOM 1878  O O   . ARG A 1 238 ? -110.406 157.378 -25.294 1.00 0.00 ? 233 ARG A O   1 
ATOM 1879  C CB  . ARG A 1 238 ? -110.153 160.610 -24.692 1.00 0.00 ? 233 ARG A CB  1 
ATOM 1880  C CG  . ARG A 1 238 ? -110.336 161.771 -23.689 1.00 0.00 ? 233 ARG A CG  1 
ATOM 1881  C CD  . ARG A 1 238 ? -110.729 163.115 -24.272 1.00 0.00 ? 233 ARG A CD  1 
ATOM 1882  N NE  . ARG A 1 238 ? -110.907 164.090 -23.076 1.00 0.00 ? 233 ARG A NE  1 
ATOM 1883  C CZ  . ARG A 1 238 ? -111.173 165.417 -23.138 1.00 0.00 ? 233 ARG A CZ  1 
ATOM 1884  N NH1 . ARG A 1 238 ? -111.192 166.001 -24.270 1.00 0.00 ? 233 ARG A NH1 1 
ATOM 1885  N NH2 . ARG A 1 238 ? -111.305 166.094 -22.029 1.00 0.00 ? 233 ARG A NH2 1 
ATOM 1886  N N   . GLU A 1 239 ? -108.674 158.286 -26.406 1.00 0.00 ? 234 GLU A N   1 
ATOM 1887  C CA  . GLU A 1 239 ? -108.556 157.416 -27.500 1.00 0.00 ? 234 GLU A CA  1 
ATOM 1888  C C   . GLU A 1 239 ? -108.172 155.982 -27.026 1.00 0.00 ? 234 GLU A C   1 
ATOM 1889  O O   . GLU A 1 239 ? -108.819 155.011 -27.374 1.00 0.00 ? 234 GLU A O   1 
ATOM 1890  C CB  . GLU A 1 239 ? -107.450 157.990 -28.432 1.00 0.00 ? 234 GLU A CB  1 
ATOM 1891  C CG  . GLU A 1 239 ? -107.449 157.150 -29.645 1.00 0.00 ? 234 GLU A CG  1 
ATOM 1892  C CD  . GLU A 1 239 ? -106.386 157.574 -30.720 1.00 0.00 ? 234 GLU A CD  1 
ATOM 1893  O OE1 . GLU A 1 239 ? -105.130 157.277 -30.491 1.00 0.00 ? 234 GLU A OE1 1 
ATOM 1894  O OE2 . GLU A 1 239 ? -106.619 158.097 -31.834 1.00 0.00 ? 234 GLU A OE2 1 
ATOM 1895  N N   . LYS A 1 240 ? -107.261 155.875 -26.083 1.00 0.00 ? 235 LYS A N   1 
ATOM 1896  C CA  . LYS A 1 240 ? -106.862 154.621 -25.494 1.00 0.00 ? 235 LYS A CA  1 
ATOM 1897  C C   . LYS A 1 240 ? -107.889 154.119 -24.494 1.00 0.00 ? 235 LYS A C   1 
ATOM 1898  O O   . LYS A 1 240 ? -108.022 152.882 -24.413 1.00 0.00 ? 235 LYS A O   1 
ATOM 1899  C CB  . LYS A 1 240 ? -105.397 154.625 -25.023 1.00 0.00 ? 235 LYS A CB  1 
ATOM 1900  C CG  . LYS A 1 240 ? -104.289 154.203 -26.036 1.00 0.00 ? 235 LYS A CG  1 
ATOM 1901  C CD  . LYS A 1 240 ? -104.253 155.150 -27.241 1.00 0.00 ? 235 LYS A CD  1 
ATOM 1902  C CE  . LYS A 1 240 ? -103.147 154.775 -28.146 1.00 0.00 ? 235 LYS A CE  1 
ATOM 1903  N NZ  . LYS A 1 240 ? -103.246 155.621 -29.360 1.00 0.00 ? 235 LYS A NZ  1 
ATOM 1904  N N   . ARG A 1 241 ? -108.719 154.986 -23.778 1.00 0.00 ? 236 ARG A N   1 
ATOM 1905  C CA  . ARG A 1 241 ? -109.775 154.598 -22.979 1.00 0.00 ? 236 ARG A CA  1 
ATOM 1906  C C   . ARG A 1 241 ? -110.785 153.920 -23.895 1.00 0.00 ? 236 ARG A C   1 
ATOM 1907  O O   . ARG A 1 241 ? -111.365 152.910 -23.619 1.00 0.00 ? 236 ARG A O   1 
ATOM 1908  C CB  . ARG A 1 241 ? -110.354 155.816 -22.214 1.00 0.00 ? 236 ARG A CB  1 
ATOM 1909  C CG  . ARG A 1 241 ? -111.605 155.488 -21.341 1.00 0.00 ? 236 ARG A CG  1 
ATOM 1910  C CD  . ARG A 1 241 ? -111.429 154.415 -20.353 1.00 0.00 ? 236 ARG A CD  1 
ATOM 1911  N NE  . ARG A 1 241 ? -112.702 154.431 -19.543 1.00 0.00 ? 236 ARG A NE  1 
ATOM 1912  C CZ  . ARG A 1 241 ? -113.221 153.347 -18.981 1.00 0.00 ? 236 ARG A CZ  1 
ATOM 1913  N NH1 . ARG A 1 241 ? -112.532 152.184 -19.002 1.00 0.00 ? 236 ARG A NH1 1 
ATOM 1914  N NH2 . ARG A 1 241 ? -114.470 153.333 -18.705 1.00 0.00 ? 236 ARG A NH2 1 
ATOM 1915  N N   . ASP A 1 242 ? -111.061 154.607 -25.035 1.00 0.00 ? 237 ASP A N   1 
ATOM 1916  C CA  . ASP A 1 242 ? -112.047 154.220 -25.964 1.00 0.00 ? 237 ASP A CA  1 
ATOM 1917  C C   . ASP A 1 242 ? -111.720 152.897 -26.643 1.00 0.00 ? 237 ASP A C   1 
ATOM 1918  O O   . ASP A 1 242 ? -112.576 152.007 -26.599 1.00 0.00 ? 237 ASP A O   1 
ATOM 1919  C CB  . ASP A 1 242 ? -112.213 155.323 -27.009 1.00 0.00 ? 237 ASP A CB  1 
ATOM 1920  C CG  . ASP A 1 242 ? -113.430 155.192 -27.867 1.00 0.00 ? 237 ASP A CG  1 
ATOM 1921  O OD1 . ASP A 1 242 ? -113.375 154.443 -28.881 1.00 0.00 ? 237 ASP A OD1 1 
ATOM 1922  O OD2 . ASP A 1 242 ? -114.434 155.818 -27.553 1.00 0.00 ? 237 ASP A OD2 1 
ATOM 1923  N N   . MET A 1 243 ? -110.451 152.698 -27.104 1.00 0.00 ? 238 MET A N   1 
ATOM 1924  C CA  . MET A 1 243 ? -109.752 151.510 -27.542 1.00 0.00 ? 238 MET A CA  1 
ATOM 1925  C C   . MET A 1 243 ? -109.708 150.343 -26.439 1.00 0.00 ? 238 MET A C   1 
ATOM 1926  O O   . MET A 1 243 ? -109.967 149.199 -26.837 1.00 0.00 ? 238 MET A O   1 
ATOM 1927  C CB  . MET A 1 243 ? -108.274 151.781 -27.985 1.00 0.00 ? 238 MET A CB  1 
ATOM 1928  C CG  . MET A 1 243 ? -107.755 150.881 -29.079 1.00 0.00 ? 238 MET A CG  1 
ATOM 1929  S SD  . MET A 1 243 ? -107.897 151.460 -30.832 1.00 0.00 ? 238 MET A SD  1 
ATOM 1930  C CE  . MET A 1 243 ? -106.906 150.221 -31.761 1.00 0.00 ? 238 MET A CE  1 
ATOM 1931  N N   . GLU A 1 244 ? -109.448 150.619 -25.097 1.00 0.00 ? 239 GLU A N   1 
ATOM 1932  C CA  . GLU A 1 244 ? -109.492 149.553 -24.008 1.00 0.00 ? 239 GLU A CA  1 
ATOM 1933  C C   . GLU A 1 244 ? -110.910 149.045 -23.850 1.00 0.00 ? 239 GLU A C   1 
ATOM 1934  O O   . GLU A 1 244 ? -111.186 147.874 -23.719 1.00 0.00 ? 239 GLU A O   1 
ATOM 1935  C CB  . GLU A 1 244 ? -108.986 150.094 -22.685 1.00 0.00 ? 239 GLU A CB  1 
ATOM 1936  C CG  . GLU A 1 244 ? -108.607 148.902 -21.606 1.00 0.00 ? 239 GLU A CG  1 
ATOM 1937  C CD  . GLU A 1 244 ? -107.915 149.550 -20.458 1.00 0.00 ? 239 GLU A CD  1 
ATOM 1938  O OE1 . GLU A 1 244 ? -107.783 150.827 -20.398 1.00 0.00 ? 239 GLU A OE1 1 
ATOM 1939  O OE2 . GLU A 1 244 ? -107.663 148.765 -19.553 1.00 0.00 ? 239 GLU A OE2 1 
ATOM 1940  N N   . GLN A 1 245 ? -111.880 150.001 -23.849 1.00 0.00 ? 240 GLN A N   1 
ATOM 1941  C CA  . GLN A 1 245 ? -113.248 149.497 -23.700 1.00 0.00 ? 240 GLN A CA  1 
ATOM 1942  C C   . GLN A 1 245 ? -113.788 148.649 -24.861 1.00 0.00 ? 240 GLN A C   1 
ATOM 1943  O O   . GLN A 1 245 ? -114.439 147.628 -24.682 1.00 0.00 ? 240 GLN A O   1 
ATOM 1944  C CB  . GLN A 1 245 ? -114.179 150.680 -23.374 1.00 0.00 ? 240 GLN A CB  1 
ATOM 1945  C CG  . GLN A 1 245 ? -114.121 150.994 -21.878 1.00 0.00 ? 240 GLN A CG  1 
ATOM 1946  C CD  . GLN A 1 245 ? -115.081 152.146 -21.702 1.00 0.00 ? 240 GLN A CD  1 
ATOM 1947  O OE1 . GLN A 1 245 ? -114.770 153.286 -21.982 1.00 0.00 ? 240 GLN A OE1 1 
ATOM 1948  N NE2 . GLN A 1 245 ? -116.248 151.818 -21.097 1.00 0.00 ? 240 GLN A NE2 1 
ATOM 1949  N N   . ARG A 1 246 ? -113.453 149.064 -26.087 1.00 0.00 ? 241 ARG A N   1 
ATOM 1950  C CA  . ARG A 1 246 ? -113.755 148.248 -27.367 1.00 0.00 ? 241 ARG A CA  1 
ATOM 1951  C C   . ARG A 1 246 ? -113.048 146.941 -27.563 1.00 0.00 ? 241 ARG A C   1 
ATOM 1952  O O   . ARG A 1 246 ? -113.488 145.927 -27.996 1.00 0.00 ? 241 ARG A O   1 
ATOM 1953  C CB  . ARG A 1 246 ? -113.588 149.149 -28.640 1.00 0.00 ? 241 ARG A CB  1 
ATOM 1954  C CG  . ARG A 1 246 ? -114.144 148.551 -29.978 1.00 0.00 ? 241 ARG A CG  1 
ATOM 1955  C CD  . ARG A 1 246 ? -114.352 149.589 -31.100 1.00 0.00 ? 241 ARG A CD  1 
ATOM 1956  N NE  . ARG A 1 246 ? -113.064 150.336 -31.314 1.00 0.00 ? 241 ARG A NE  1 
ATOM 1957  C CZ  . ARG A 1 246 ? -112.092 150.030 -32.168 1.00 0.00 ? 241 ARG A CZ  1 
ATOM 1958  N NH1 . ARG A 1 246 ? -111.928 148.856 -32.747 1.00 0.00 ? 241 ARG A NH1 1 
ATOM 1959  N NH2 . ARG A 1 246 ? -111.137 150.904 -32.362 1.00 0.00 ? 241 ARG A NH2 1 
ATOM 1960  N N   . HIS A 1 247 ? -111.770 146.888 -27.044 1.00 0.00 ? 242 HIS A N   1 
ATOM 1961  C CA  . HIS A 1 247 ? -110.848 145.731 -26.826 1.00 0.00 ? 242 HIS A CA  1 
ATOM 1962  C C   . HIS A 1 247 ? -111.507 144.713 -25.900 1.00 0.00 ? 242 HIS A C   1 
ATOM 1963  O O   . HIS A 1 247 ? -111.588 143.532 -26.204 1.00 0.00 ? 242 HIS A O   1 
ATOM 1964  C CB  . HIS A 1 247 ? -109.487 146.172 -26.243 1.00 0.00 ? 242 HIS A CB  1 
ATOM 1965  C CG  . HIS A 1 247 ? -108.534 145.143 -25.841 1.00 0.00 ? 242 HIS A CG  1 
ATOM 1966  N ND1 . HIS A 1 247 ? -107.447 144.799 -26.581 1.00 0.00 ? 242 HIS A ND1 1 
ATOM 1967  C CD2 . HIS A 1 247 ? -108.493 144.403 -24.674 1.00 0.00 ? 242 HIS A CD2 1 
ATOM 1968  C CE1 . HIS A 1 247 ? -106.703 143.964 -25.810 1.00 0.00 ? 242 HIS A CE1 1 
ATOM 1969  N NE2 . HIS A 1 247 ? -107.321 143.684 -24.686 1.00 0.00 ? 242 HIS A NE2 1 
ATOM 1970  N N   . VAL A 1 248 ? -112.091 145.179 -24.779 1.00 0.00 ? 243 VAL A N   1 
ATOM 1971  C CA  . VAL A 1 248 ? -112.864 144.522 -23.749 1.00 0.00 ? 243 VAL A CA  1 
ATOM 1972  C C   . VAL A 1 248 ? -114.045 143.864 -24.438 1.00 0.00 ? 243 VAL A C   1 
ATOM 1973  O O   . VAL A 1 248 ? -114.365 142.699 -24.205 1.00 0.00 ? 243 VAL A O   1 
ATOM 1974  C CB  . VAL A 1 248 ? -113.227 145.351 -22.501 1.00 0.00 ? 243 VAL A CB  1 
ATOM 1975  C CG1 . VAL A 1 248 ? -114.251 144.608 -21.590 1.00 0.00 ? 243 VAL A CG1 1 
ATOM 1976  C CG2 . VAL A 1 248 ? -111.961 145.766 -21.731 1.00 0.00 ? 243 VAL A CG2 1 
ATOM 1977  N N   . LEU A 1 249 ? -114.759 144.649 -25.279 1.00 0.00 ? 244 LEU A N   1 
ATOM 1978  C CA  . LEU A 1 249 ? -116.070 144.299 -25.819 1.00 0.00 ? 244 LEU A CA  1 
ATOM 1979  C C   . LEU A 1 249 ? -115.994 143.014 -26.693 1.00 0.00 ? 244 LEU A C   1 
ATOM 1980  O O   . LEU A 1 249 ? -116.821 142.107 -26.662 1.00 0.00 ? 244 LEU A O   1 
ATOM 1981  C CB  . LEU A 1 249 ? -116.600 145.575 -26.647 1.00 0.00 ? 244 LEU A CB  1 
ATOM 1982  C CG  . LEU A 1 249 ? -118.066 145.531 -27.183 1.00 0.00 ? 244 LEU A CG  1 
ATOM 1983  C CD1 . LEU A 1 249 ? -119.003 145.518 -26.029 1.00 0.00 ? 244 LEU A CD1 1 
ATOM 1984  C CD2 . LEU A 1 249 ? -118.135 146.740 -28.205 1.00 0.00 ? 244 LEU A CD2 1 
ATOM 1985  N N   . LEU A 1 250 ? -114.912 142.934 -27.562 1.00 0.00 ? 245 LEU A N   1 
ATOM 1986  C CA  . LEU A 1 250 ? -114.669 141.880 -28.586 1.00 0.00 ? 245 LEU A CA  1 
ATOM 1987  C C   . LEU A 1 250 ? -114.457 140.493 -27.917 1.00 0.00 ? 245 LEU A C   1 
ATOM 1988  O O   . LEU A 1 250 ? -114.906 139.433 -28.418 1.00 0.00 ? 245 LEU A O   1 
ATOM 1989  C CB  . LEU A 1 250 ? -113.516 142.182 -29.489 1.00 0.00 ? 245 LEU A CB  1 
ATOM 1990  C CG  . LEU A 1 250 ? -113.569 143.534 -30.259 1.00 0.00 ? 245 LEU A CG  1 
ATOM 1991  C CD1 . LEU A 1 250 ? -112.215 144.047 -30.852 1.00 0.00 ? 245 LEU A CD1 1 
ATOM 1992  C CD2 . LEU A 1 250 ? -114.645 143.393 -31.376 1.00 0.00 ? 245 LEU A CD2 1 
ATOM 1993  N N   . LYS A 1 251 ? -113.721 140.556 -26.793 1.00 0.00 ? 246 LYS A N   1 
ATOM 1994  C CA  . LYS A 1 251 ? -113.432 139.407 -25.979 1.00 0.00 ? 246 LYS A CA  1 
ATOM 1995  C C   . LYS A 1 251 ? -114.720 138.914 -25.159 1.00 0.00 ? 246 LYS A C   1 
ATOM 1996  O O   . LYS A 1 251 ? -114.776 137.725 -24.783 1.00 0.00 ? 246 LYS A O   1 
ATOM 1997  C CB  . LYS A 1 251 ? -112.288 139.799 -25.038 1.00 0.00 ? 246 LYS A CB  1 
ATOM 1998  C CG  . LYS A 1 251 ? -110.855 139.938 -25.708 1.00 0.00 ? 246 LYS A CG  1 
ATOM 1999  C CD  . LYS A 1 251 ? -109.744 140.317 -24.639 1.00 0.00 ? 246 LYS A CD  1 
ATOM 2000  C CE  . LYS A 1 251 ? -108.331 140.406 -25.127 1.00 0.00 ? 246 LYS A CE  1 
ATOM 2001  N NZ  . LYS A 1 251 ? -107.421 140.808 -24.122 1.00 0.00 ? 246 LYS A NZ  1 
ATOM 2002  N N   . GLN A 1 252 ? -115.682 139.858 -24.892 1.00 0.00 ? 247 GLN A N   1 
ATOM 2003  C CA  . GLN A 1 252 ? -116.887 139.589 -24.160 1.00 0.00 ? 247 GLN A CA  1 
ATOM 2004  C C   . GLN A 1 252 ? -117.843 138.648 -24.834 1.00 0.00 ? 247 GLN A C   1 
ATOM 2005  O O   . GLN A 1 252 ? -118.360 137.669 -24.232 1.00 0.00 ? 247 GLN A O   1 
ATOM 2006  C CB  . GLN A 1 252 ? -117.614 140.936 -23.906 1.00 0.00 ? 247 GLN A CB  1 
ATOM 2007  C CG  . GLN A 1 252 ? -118.612 140.800 -22.805 1.00 0.00 ? 247 GLN A CG  1 
ATOM 2008  C CD  . GLN A 1 252 ? -118.951 142.199 -22.264 1.00 0.00 ? 247 GLN A CD  1 
ATOM 2009  O OE1 . GLN A 1 252 ? -119.922 142.809 -22.686 1.00 0.00 ? 247 GLN A OE1 1 
ATOM 2010  N NE2 . GLN A 1 252 ? -118.050 142.736 -21.436 1.00 0.00 ? 247 GLN A NE2 1 
ATOM 2011  N N   . LYS A 1 253 ? -118.073 138.919 -26.197 1.00 0.00 ? 248 LYS A N   1 
ATOM 2012  C CA  . LYS A 1 253 ? -119.226 138.152 -26.681 1.00 0.00 ? 248 LYS A CA  1 
ATOM 2013  C C   . LYS A 1 253 ? -119.253 137.960 -28.235 1.00 0.00 ? 248 LYS A C   1 
ATOM 2014  O O   . LYS A 1 253 ? -120.258 137.476 -28.706 1.00 0.00 ? 248 LYS A O   1 
ATOM 2015  C CB  . LYS A 1 253 ? -120.542 138.908 -26.365 1.00 0.00 ? 248 LYS A CB  1 
ATOM 2016  C CG  . LYS A 1 253 ? -120.552 140.279 -26.898 1.00 0.00 ? 248 LYS A CG  1 
ATOM 2017  C CD  . LYS A 1 253 ? -121.903 141.004 -26.610 1.00 0.00 ? 248 LYS A CD  1 
ATOM 2018  C CE  . LYS A 1 253 ? -122.024 142.455 -26.974 1.00 0.00 ? 248 LYS A CE  1 
ATOM 2019  N NZ  . LYS A 1 253 ? -121.975 142.768 -28.346 1.00 0.00 ? 248 LYS A NZ  1 
ATOM 2020  N N   . GLU A 1 254 ? -118.202 138.280 -29.002 1.00 0.00 ? 249 GLU A N   1 
ATOM 2021  C CA  . GLU A 1 254 ? -118.385 138.398 -30.466 1.00 0.00 ? 249 GLU A CA  1 
ATOM 2022  C C   . GLU A 1 254 ? -117.131 138.106 -31.208 1.00 0.00 ? 249 GLU A C   1 
ATOM 2023  O O   . GLU A 1 254 ? -117.096 138.352 -32.434 1.00 0.00 ? 249 GLU A O   1 
ATOM 2024  C CB  . GLU A 1 254 ? -118.925 139.810 -30.710 1.00 0.00 ? 249 GLU A CB  1 
ATOM 2025  C CG  . GLU A 1 254 ? -117.979 140.882 -30.137 1.00 0.00 ? 249 GLU A CG  1 
ATOM 2026  C CD  . GLU A 1 254 ? -118.684 142.190 -30.128 1.00 0.00 ? 249 GLU A CD  1 
ATOM 2027  O OE1 . GLU A 1 254 ? -119.608 142.436 -29.315 1.00 0.00 ? 249 GLU A OE1 1 
ATOM 2028  O OE2 . GLU A 1 254 ? -118.332 143.036 -31.005 1.00 0.00 ? 249 GLU A OE2 1 
ATOM 2029  N N   . LEU A 1 255 ? -116.106 137.533 -30.551 1.00 0.00 ? 250 LEU A N   1 
ATOM 2030  C CA  . LEU A 1 255 ? -114.722 137.319 -31.101 1.00 0.00 ? 250 LEU A CA  1 
ATOM 2031  C C   . LEU A 1 255 ? -114.651 136.262 -32.214 1.00 0.00 ? 250 LEU A C   1 
ATOM 2032  O O   . LEU A 1 255 ? -113.972 136.353 -33.226 1.00 0.00 ? 250 LEU A O   1 
ATOM 2033  C CB  . LEU A 1 255 ? -113.888 136.757 -29.918 1.00 0.00 ? 250 LEU A CB  1 
ATOM 2034  C CG  . LEU A 1 255 ? -112.384 136.835 -30.094 1.00 0.00 ? 250 LEU A CG  1 
ATOM 2035  C CD1 . LEU A 1 255 ? -111.901 138.309 -30.061 1.00 0.00 ? 250 LEU A CD1 1 
ATOM 2036  C CD2 . LEU A 1 255 ? -111.589 135.944 -29.140 1.00 0.00 ? 250 LEU A CD2 1 
ATOM 2037  N N   . GLY A 1 256 ? -115.407 135.158 -32.041 1.00 0.00 ? 251 GLY A N   1 
ATOM 2038  C CA  . GLY A 1 256 ? -115.567 133.977 -32.842 1.00 0.00 ? 251 GLY A CA  1 
ATOM 2039  C C   . GLY A 1 256 ? -114.417 133.026 -32.852 1.00 0.00 ? 251 GLY A C   1 
ATOM 2040  O O   . GLY A 1 256 ? -113.234 133.347 -32.585 1.00 0.00 ? 251 GLY A O   1 
ATOM 2041  N N   . GLY A 1 257 ? -114.820 131.740 -33.053 1.00 0.00 ? 252 GLY A N   1 
ATOM 2042  C CA  . GLY A 1 257 ? -113.985 130.527 -32.918 1.00 0.00 ? 252 GLY A CA  1 
ATOM 2043  C C   . GLY A 1 257 ? -113.743 129.898 -34.344 1.00 0.00 ? 252 GLY A C   1 
ATOM 2044  O O   . GLY A 1 257 ? -112.663 129.322 -34.504 1.00 0.00 ? 252 GLY A O   1 
ATOM 2045  N N   . GLU A 1 258 ? -114.691 130.109 -35.294 1.00 0.00 ? 253 GLU A N   1 
ATOM 2046  C CA  . GLU A 1 258 ? -114.509 129.673 -36.659 1.00 0.00 ? 253 GLU A CA  1 
ATOM 2047  C C   . GLU A 1 258 ? -113.403 130.390 -37.411 1.00 0.00 ? 253 GLU A C   1 
ATOM 2048  O O   . GLU A 1 258 ? -113.173 131.604 -37.225 1.00 0.00 ? 253 GLU A O   1 
ATOM 2049  C CB  . GLU A 1 258 ? -115.873 129.724 -37.344 1.00 0.00 ? 253 GLU A CB  1 
ATOM 2050  C CG  . GLU A 1 258 ? -116.007 129.072 -38.725 1.00 0.00 ? 253 GLU A CG  1 
ATOM 2051  C CD  . GLU A 1 258 ? -115.684 127.557 -38.725 1.00 0.00 ? 253 GLU A CD  1 
ATOM 2052  O OE1 . GLU A 1 258 ? -116.350 126.722 -38.043 1.00 0.00 ? 253 GLU A OE1 1 
ATOM 2053  O OE2 . GLU A 1 258 ? -114.669 127.175 -39.396 1.00 0.00 ? 253 GLU A OE2 1 
ATOM 2054  N N   . GLU A 1 259 ? -112.718 129.663 -38.326 1.00 0.00 ? 254 GLU A N   1 
ATOM 2055  C CA  . GLU A 1 259 ? -111.751 130.211 -39.221 1.00 0.00 ? 254 GLU A CA  1 
ATOM 2056  C C   . GLU A 1 259 ? -112.255 131.316 -40.020 1.00 0.00 ? 254 GLU A C   1 
ATOM 2057  O O   . GLU A 1 259 ? -113.418 131.291 -40.537 1.00 0.00 ? 254 GLU A O   1 
ATOM 2058  C CB  . GLU A 1 259 ? -111.112 129.189 -40.132 1.00 0.00 ? 254 GLU A CB  1 
ATOM 2059  C CG  . GLU A 1 259 ? -110.499 127.902 -39.464 1.00 0.00 ? 254 GLU A CG  1 
ATOM 2060  C CD  . GLU A 1 259 ? -109.257 128.188 -38.788 1.00 0.00 ? 254 GLU A CD  1 
ATOM 2061  O OE1 . GLU A 1 259 ? -108.210 128.267 -39.451 1.00 0.00 ? 254 GLU A OE1 1 
ATOM 2062  O OE2 . GLU A 1 259 ? -109.303 128.413 -37.534 1.00 0.00 ? 254 GLU A OE2 1 
ATOM 2063  N N   . PRO A 1 260 ? -111.486 132.399 -40.194 1.00 0.00 ? 255 PRO A N   1 
ATOM 2064  C CA  . PRO A 1 260 ? -111.864 133.544 -41.041 1.00 0.00 ? 255 PRO A CA  1 
ATOM 2065  C C   . PRO A 1 260 ? -111.785 133.150 -42.480 1.00 0.00 ? 255 PRO A C   1 
ATOM 2066  O O   . PRO A 1 260 ? -111.068 132.220 -42.822 1.00 0.00 ? 255 PRO A O   1 
ATOM 2067  C CB  . PRO A 1 260 ? -110.817 134.643 -40.691 1.00 0.00 ? 255 PRO A CB  1 
ATOM 2068  C CG  . PRO A 1 260 ? -109.592 133.974 -40.183 1.00 0.00 ? 255 PRO A CG  1 
ATOM 2069  C CD  . PRO A 1 260 ? -110.098 132.613 -39.644 1.00 0.00 ? 255 PRO A CD  1 
ATOM 2070  N N   . GLU A 1 261 ? -112.527 133.841 -43.343 1.00 0.00 ? 256 GLU A N   1 
ATOM 2071  C CA  . GLU A 1 261 ? -112.744 133.530 -44.755 1.00 0.00 ? 256 GLU A CA  1 
ATOM 2072  C C   . GLU A 1 261 ? -111.859 134.350 -45.691 1.00 0.00 ? 256 GLU A C   1 
ATOM 2073  O O   . GLU A 1 261 ? -111.846 135.580 -45.531 1.00 0.00 ? 256 GLU A O   1 
ATOM 2074  C CB  . GLU A 1 261 ? -114.265 133.940 -44.911 1.00 0.00 ? 256 GLU A CB  1 
ATOM 2075  C CG  . GLU A 1 261 ? -114.674 133.402 -46.307 1.00 0.00 ? 256 GLU A CG  1 
ATOM 2076  C CD  . GLU A 1 261 ? -116.084 133.481 -46.650 1.00 0.00 ? 256 GLU A CD  1 
ATOM 2077  O OE1 . GLU A 1 261 ? -116.877 132.729 -46.088 1.00 0.00 ? 256 GLU A OE1 1 
ATOM 2078  O OE2 . GLU A 1 261 ? -116.553 134.292 -47.489 1.00 0.00 ? 256 GLU A OE2 1 
ATOM 2079  N N   . PRO A 1 262 ? -111.067 133.673 -46.705 1.00 0.00 ? 257 PRO A N   1 
ATOM 2080  C CA  . PRO A 1 262 ? -110.409 134.330 -47.735 1.00 0.00 ? 257 PRO A CA  1 
ATOM 2081  C C   . PRO A 1 262 ? -111.335 135.075 -48.643 1.00 0.00 ? 257 PRO A C   1 
ATOM 2082  O O   . PRO A 1 262 ? -112.376 134.486 -49.065 1.00 0.00 ? 257 PRO A O   1 
ATOM 2083  C CB  . PRO A 1 262 ? -109.724 133.237 -48.524 1.00 0.00 ? 257 PRO A CB  1 
ATOM 2084  C CG  . PRO A 1 262 ? -109.639 131.999 -47.553 1.00 0.00 ? 257 PRO A CG  1 
ATOM 2085  C CD  . PRO A 1 262 ? -110.763 132.283 -46.582 1.00 0.00 ? 257 PRO A CD  1 
ATOM 2086  N N   . SER A 1 263 ? -110.930 136.363 -48.832 1.00 0.00 ? 258 SER A N   1 
ATOM 2087  C CA  . SER A 1 263 ? -111.699 137.413 -49.544 1.00 0.00 ? 258 SER A CA  1 
ATOM 2088  C C   . SER A 1 263 ? -111.337 137.700 -50.978 1.00 0.00 ? 258 SER A C   1 
ATOM 2089  O O   . SER A 1 263 ? -110.220 138.106 -51.258 1.00 0.00 ? 258 SER A O   1 
ATOM 2090  C CB  . SER A 1 263 ? -111.507 138.674 -48.741 1.00 0.00 ? 258 SER A CB  1 
ATOM 2091  O OG  . SER A 1 263 ? -112.059 139.900 -49.230 1.00 0.00 ? 258 SER A OG  1 
ATOM 2092  N N   . LEU A 1 264 ? -112.209 137.275 -51.907 1.00 0.00 ? 259 LEU A N   1 
ATOM 2093  C CA  . LEU A 1 264 ? -111.897 137.423 -53.304 1.00 0.00 ? 259 LEU A CA  1 
ATOM 2094  C C   . LEU A 1 264 ? -112.128 138.816 -53.766 1.00 0.00 ? 259 LEU A C   1 
ATOM 2095  O O   . LEU A 1 264 ? -113.029 139.496 -53.330 1.00 0.00 ? 259 LEU A O   1 
ATOM 2096  C CB  . LEU A 1 264 ? -112.580 136.327 -54.192 1.00 0.00 ? 259 LEU A CB  1 
ATOM 2097  C CG  . LEU A 1 264 ? -114.092 136.280 -54.112 1.00 0.00 ? 259 LEU A CG  1 
ATOM 2098  C CD1 . LEU A 1 264 ? -114.658 137.088 -55.367 1.00 0.00 ? 259 LEU A CD1 1 
ATOM 2099  C CD2 . LEU A 1 264 ? -114.624 134.852 -53.963 1.00 0.00 ? 259 LEU A CD2 1 
ATOM 2100  N N   . ARG A 1 265 ? -111.258 139.315 -54.710 1.00 0.00 ? 260 ARG A N   1 
ATOM 2101  C CA  . ARG A 1 265 ? -111.466 140.595 -55.318 1.00 0.00 ? 260 ARG A CA  1 
ATOM 2102  C C   . ARG A 1 265 ? -111.026 140.658 -56.743 1.00 0.00 ? 260 ARG A C   1 
ATOM 2103  O O   . ARG A 1 265 ? -110.392 139.734 -57.236 1.00 0.00 ? 260 ARG A O   1 
ATOM 2104  C CB  . ARG A 1 265 ? -111.003 141.771 -54.465 1.00 0.00 ? 260 ARG A CB  1 
ATOM 2105  C CG  . ARG A 1 265 ? -109.440 141.795 -54.005 1.00 0.00 ? 260 ARG A CG  1 
ATOM 2106  C CD  . ARG A 1 265 ? -109.091 140.793 -52.933 1.00 0.00 ? 260 ARG A CD  1 
ATOM 2107  N NE  . ARG A 1 265 ? -107.652 140.908 -52.720 1.00 0.00 ? 260 ARG A NE  1 
ATOM 2108  C CZ  . ARG A 1 265 ? -106.932 139.992 -52.142 1.00 0.00 ? 260 ARG A CZ  1 
ATOM 2109  N NH1 . ARG A 1 265 ? -107.480 138.889 -51.544 1.00 0.00 ? 260 ARG A NH1 1 
ATOM 2110  N NH2 . ARG A 1 265 ? -105.654 140.139 -51.984 1.00 0.00 ? 260 ARG A NH2 1 
ATOM 2111  N N   . GLU A 1 266 ? -111.329 141.806 -57.396 1.00 0.00 ? 261 GLU A N   1 
ATOM 2112  C CA  . GLU A 1 266 ? -110.976 142.012 -58.778 1.00 0.00 ? 261 GLU A CA  1 
ATOM 2113  C C   . GLU A 1 266 ? -111.574 140.984 -59.806 1.00 0.00 ? 261 GLU A C   1 
ATOM 2114  O O   . GLU A 1 266 ? -110.990 140.643 -60.788 1.00 0.00 ? 261 GLU A O   1 
ATOM 2115  C CB  . GLU A 1 266 ? -109.432 142.159 -59.039 1.00 0.00 ? 261 GLU A CB  1 
ATOM 2116  C CG  . GLU A 1 266 ? -108.792 143.358 -58.390 1.00 0.00 ? 261 GLU A CG  1 
ATOM 2117  C CD  . GLU A 1 266 ? -107.364 143.546 -58.913 1.00 0.00 ? 261 GLU A CD  1 
ATOM 2118  O OE1 . GLU A 1 266 ? -107.174 143.875 -60.094 1.00 0.00 ? 261 GLU A OE1 1 
ATOM 2119  O OE2 . GLU A 1 266 ? -106.443 143.314 -58.103 1.00 0.00 ? 261 GLU A OE2 1 
ATOM 2120  N N   . GLY A 1 267 ? -112.852 140.530 -59.529 1.00 0.00 ? 262 GLY A N   1 
ATOM 2121  C CA  . GLY A 1 267 ? -113.760 139.581 -60.279 1.00 0.00 ? 262 GLY A CA  1 
ATOM 2122  C C   . GLY A 1 267 ? -113.026 138.328 -60.636 1.00 0.00 ? 262 GLY A C   1 
ATOM 2123  O O   . GLY A 1 267 ? -112.027 138.002 -60.060 1.00 0.00 ? 262 GLY A O   1 
ATOM 2124  N N   . PRO A 1 268 ? -113.579 137.555 -61.486 1.00 0.00 ? 263 PRO A N   1 
ATOM 2125  C CA  . PRO A 1 268 ? -113.114 136.133 -61.722 1.00 0.00 ? 263 PRO A CA  1 
ATOM 2126  C C   . PRO A 1 268 ? -111.886 136.120 -62.631 1.00 0.00 ? 263 PRO A C   1 
ATOM 2127  O O   . PRO A 1 268 ? -111.210 135.076 -62.587 1.00 0.00 ? 263 PRO A O   1 
ATOM 2128  C CB  . PRO A 1 268 ? -114.331 135.408 -62.306 1.00 0.00 ? 263 PRO A CB  1 
ATOM 2129  C CG  . PRO A 1 268 ? -115.050 136.505 -63.117 1.00 0.00 ? 263 PRO A CG  1 
ATOM 2130  C CD  . PRO A 1 268 ? -114.897 137.705 -62.118 1.00 0.00 ? 263 PRO A CD  1 
ATOM 2131  N N   . GLY A 1 269 ? -111.445 137.233 -63.180 1.00 0.00 ? 264 GLY A N   1 
ATOM 2132  C CA  . GLY A 1 269 ? -110.420 137.169 -64.187 1.00 0.00 ? 264 GLY A CA  1 
ATOM 2133  C C   . GLY A 1 269 ? -109.120 137.715 -63.623 1.00 0.00 ? 264 GLY A C   1 
ATOM 2134  O O   . GLY A 1 269 ? -108.002 137.527 -64.083 1.00 0.00 ? 264 GLY A O   1 
ATOM 2135  N N   . GLY A 1 270 ? -109.252 138.496 -62.549 1.00 0.00 ? 265 GLY A N   1 
ATOM 2136  C CA  . GLY A 1 270 ? -108.089 138.687 -61.656 1.00 0.00 ? 265 GLY A CA  1 
ATOM 2137  C C   . GLY A 1 270 ? -108.163 137.736 -60.512 1.00 0.00 ? 265 GLY A C   1 
ATOM 2138  O O   . GLY A 1 270 ? -107.179 137.133 -60.182 1.00 0.00 ? 265 GLY A O   1 
ATOM 2139  N N   . LEU A 1 271 ? -109.366 137.586 -60.021 1.00 0.00 ? 266 LEU A N   1 
ATOM 2140  C CA  . LEU A 1 271 ? -109.687 136.660 -58.887 1.00 0.00 ? 266 LEU A CA  1 
ATOM 2141  C C   . LEU A 1 271 ? -108.688 136.559 -57.738 1.00 0.00 ? 266 LEU A C   1 
ATOM 2142  O O   . LEU A 1 271 ? -108.110 135.540 -57.495 1.00 0.00 ? 266 LEU A O   1 
ATOM 2143  C CB  . LEU A 1 271 ? -110.225 135.289 -59.395 1.00 0.00 ? 266 LEU A CB  1 
ATOM 2144  C CG  . LEU A 1 271 ? -111.147 134.521 -58.419 1.00 0.00 ? 266 LEU A CG  1 
ATOM 2145  C CD1 . LEU A 1 271 ? -112.400 135.114 -57.912 1.00 0.00 ? 266 LEU A CD1 1 
ATOM 2146  C CD2 . LEU A 1 271 ? -111.399 133.028 -58.799 1.00 0.00 ? 266 LEU A CD2 1 
ATOM 2147  N N   . VAL A 1 272 ? -108.472 137.679 -56.955 1.00 0.00 ? 267 VAL A N   1 
ATOM 2148  C CA  . VAL A 1 272 ? -107.334 137.749 -56.073 1.00 0.00 ? 267 VAL A CA  1 
ATOM 2149  C C   . VAL A 1 272 ? -107.762 137.164 -54.760 1.00 0.00 ? 267 VAL A C   1 
ATOM 2150  O O   . VAL A 1 272 ? -108.675 137.664 -54.112 1.00 0.00 ? 267 VAL A O   1 
ATOM 2151  C CB  . VAL A 1 272 ? -106.648 139.116 -56.016 1.00 0.00 ? 267 VAL A CB  1 
ATOM 2152  C CG1 . VAL A 1 272 ? -105.282 138.899 -55.355 1.00 0.00 ? 267 VAL A CG1 1 
ATOM 2153  C CG2 . VAL A 1 272 ? -106.401 139.590 -57.477 1.00 0.00 ? 267 VAL A CG2 1 
ATOM 2154  N N   . MET A 1 273 ? -107.124 136.037 -54.325 1.00 0.00 ? 268 MET A N   1 
ATOM 2155  C CA  . MET A 1 273 ? -107.411 135.296 -53.111 1.00 0.00 ? 268 MET A CA  1 
ATOM 2156  C C   . MET A 1 273 ? -106.240 134.512 -52.563 1.00 0.00 ? 268 MET A C   1 
ATOM 2157  O O   . MET A 1 273 ? -105.581 133.823 -53.309 1.00 0.00 ? 268 MET A O   1 
ATOM 2158  C CB  . MET A 1 273 ? -108.601 134.483 -53.494 1.00 0.00 ? 268 MET A CB  1 
ATOM 2159  C CG  . MET A 1 273 ? -109.265 133.927 -52.245 1.00 0.00 ? 268 MET A CG  1 
ATOM 2160  S SD  . MET A 1 273 ? -110.582 132.809 -52.639 1.00 0.00 ? 268 MET A SD  1 
ATOM 2161  C CE  . MET A 1 273 ? -109.510 131.417 -52.344 1.00 0.00 ? 268 MET A CE  1 
ATOM 2162  N N   . GLU A 1 274 ? -105.926 134.647 -51.273 1.00 0.00 ? 269 GLU A N   1 
ATOM 2163  C CA  . GLU A 1 274 ? -104.692 134.082 -50.663 1.00 0.00 ? 269 GLU A CA  1 
ATOM 2164  C C   . GLU A 1 274 ? -105.159 133.408 -49.399 1.00 0.00 ? 269 GLU A C   1 
ATOM 2165  O O   . GLU A 1 274 ? -106.098 133.848 -48.717 1.00 0.00 ? 269 GLU A O   1 
ATOM 2166  C CB  . GLU A 1 274 ? -103.568 135.148 -50.440 1.00 0.00 ? 269 GLU A CB  1 
ATOM 2167  C CG  . GLU A 1 274 ? -103.930 136.192 -49.410 1.00 0.00 ? 269 GLU A CG  1 
ATOM 2168  C CD  . GLU A 1 274 ? -104.905 137.325 -50.003 1.00 0.00 ? 269 GLU A CD  1 
ATOM 2169  O OE1 . GLU A 1 274 ? -106.114 137.186 -50.098 1.00 0.00 ? 269 GLU A OE1 1 
ATOM 2170  O OE2 . GLU A 1 274 ? -104.315 138.407 -50.386 1.00 0.00 ? 269 GLU A OE2 1 
ATOM 2171  N N   . GLY A 1 275 ? -104.416 132.324 -49.027 1.00 0.00 ? 270 GLY A N   1 
ATOM 2172  C CA  . GLY A 1 275 ? -104.794 131.444 -47.889 1.00 0.00 ? 270 GLY A CA  1 
ATOM 2173  C C   . GLY A 1 275 ? -103.983 130.277 -47.857 1.00 0.00 ? 270 GLY A C   1 
ATOM 2174  O O   . GLY A 1 275 ? -103.437 129.865 -48.882 1.00 0.00 ? 270 GLY A O   1 
ATOM 2175  N N   . HIS A 1 276 ? -103.859 129.649 -46.675 1.00 0.00 ? 271 HIS A N   1 
ATOM 2176  C CA  . HIS A 1 276 ? -102.962 128.433 -46.648 1.00 0.00 ? 271 HIS A CA  1 
ATOM 2177  C C   . HIS A 1 276 ? -103.726 127.153 -46.930 1.00 0.00 ? 271 HIS A C   1 
ATOM 2178  O O   . HIS A 1 276 ? -104.986 127.017 -46.790 1.00 0.00 ? 271 HIS A O   1 
ATOM 2179  C CB  . HIS A 1 276 ? -102.180 128.341 -45.333 1.00 0.00 ? 271 HIS A CB  1 
ATOM 2180  C CG  . HIS A 1 276 ? -101.314 129.461 -44.960 1.00 0.00 ? 271 HIS A CG  1 
ATOM 2181  N ND1 . HIS A 1 276 ? -101.785 130.724 -44.572 1.00 0.00 ? 271 HIS A ND1 1 
ATOM 2182  C CD2 . HIS A 1 276 ? -99.977  129.420 -44.679 1.00 0.00 ? 271 HIS A CD2 1 
ATOM 2183  C CE1 . HIS A 1 276 ? -100.744 131.399 -44.112 1.00 0.00 ? 271 HIS A CE1 1 
ATOM 2184  N NE2 . HIS A 1 276 ? -99.598  130.677 -44.144 1.00 0.00 ? 271 HIS A NE2 1 
ATOM 2185  N N   . LEU A 1 277 ? -102.997 126.108 -47.325 1.00 0.00 ? 272 LEU A N   1 
ATOM 2186  C CA  . LEU A 1 277 ? -103.627 124.828 -47.532 1.00 0.00 ? 272 LEU A CA  1 
ATOM 2187  C C   . LEU A 1 277 ? -102.461 123.824 -47.129 1.00 0.00 ? 272 LEU A C   1 
ATOM 2188  O O   . LEU A 1 277 ? -101.306 124.139 -46.961 1.00 0.00 ? 272 LEU A O   1 
ATOM 2189  C CB  . LEU A 1 277 ? -104.034 124.559 -48.964 1.00 0.00 ? 272 LEU A CB  1 
ATOM 2190  C CG  . LEU A 1 277 ? -105.194 125.353 -49.584 1.00 0.00 ? 272 LEU A CG  1 
ATOM 2191  C CD1 . LEU A 1 277 ? -105.162 125.264 -51.107 1.00 0.00 ? 272 LEU A CD1 1 
ATOM 2192  C CD2 . LEU A 1 277 ? -106.649 124.961 -49.126 1.00 0.00 ? 272 LEU A CD2 1 
ATOM 2193  N N   . PHE A 1 278 ? -102.874 122.560 -47.104 1.00 0.00 ? 273 PHE A N   1 
ATOM 2194  C CA  . PHE A 1 278 ? -101.937 121.434 -46.923 1.00 0.00 ? 273 PHE A CA  1 
ATOM 2195  C C   . PHE A 1 278 ? -101.875 120.801 -48.298 1.00 0.00 ? 273 PHE A C   1 
ATOM 2196  O O   . PHE A 1 278 ? -102.866 120.573 -48.963 1.00 0.00 ? 273 PHE A O   1 
ATOM 2197  C CB  . PHE A 1 278 ? -102.327 120.362 -45.907 1.00 0.00 ? 273 PHE A CB  1 
ATOM 2198  C CG  . PHE A 1 278 ? -102.026 120.898 -44.581 1.00 0.00 ? 273 PHE A CG  1 
ATOM 2199  C CD1 . PHE A 1 278 ? -100.817 120.715 -43.907 1.00 0.00 ? 273 PHE A CD1 1 
ATOM 2200  C CD2 . PHE A 1 278 ? -103.108 121.351 -43.834 1.00 0.00 ? 273 PHE A CD2 1 
ATOM 2201  C CE1 . PHE A 1 278 ? -100.692 121.134 -42.564 1.00 0.00 ? 273 PHE A CE1 1 
ATOM 2202  C CE2 . PHE A 1 278 ? -102.993 121.826 -42.517 1.00 0.00 ? 273 PHE A CE2 1 
ATOM 2203  C CZ  . PHE A 1 278 ? -101.773 121.654 -41.859 1.00 0.00 ? 273 PHE A CZ  1 
ATOM 2204  N N   . LYS A 1 279 ? -100.652 120.568 -48.843 1.00 0.00 ? 274 LYS A N   1 
ATOM 2205  C CA  . LYS A 1 279 ? -100.461 120.049 -50.193 1.00 0.00 ? 274 LYS A CA  1 
ATOM 2206  C C   . LYS A 1 279 ? -99.766  118.704 -50.079 1.00 0.00 ? 274 LYS A C   1 
ATOM 2207  O O   . LYS A 1 279 ? -98.953  118.522 -49.183 1.00 0.00 ? 274 LYS A O   1 
ATOM 2208  C CB  . LYS A 1 279 ? -99.590  121.004 -51.063 1.00 0.00 ? 274 LYS A CB  1 
ATOM 2209  C CG  . LYS A 1 279 ? -99.395  120.714 -52.591 1.00 0.00 ? 274 LYS A CG  1 
ATOM 2210  C CD  . LYS A 1 279 ? -98.624  121.738 -53.489 1.00 0.00 ? 274 LYS A CD  1 
ATOM 2211  C CE  . LYS A 1 279 ? -97.192  121.984 -53.066 1.00 0.00 ? 274 LYS A CE  1 
ATOM 2212  N NZ  . LYS A 1 279 ? -96.368  120.794 -53.265 1.00 0.00 ? 274 LYS A NZ  1 
ATOM 2213  N N   . ARG A 1 280 ? -100.016 117.784 -51.033 1.00 0.00 ? 275 ARG A N   1 
ATOM 2214  C CA  . ARG A 1 280 ? -99.313  116.543 -51.198 1.00 0.00 ? 275 ARG A CA  1 
ATOM 2215  C C   . ARG A 1 280 ? -99.092  116.168 -52.628 1.00 0.00 ? 275 ARG A C   1 
ATOM 2216  O O   . ARG A 1 280 ? -99.932  116.320 -53.507 1.00 0.00 ? 275 ARG A O   1 
ATOM 2217  C CB  . ARG A 1 280 ? -100.086 115.420 -50.423 1.00 0.00 ? 275 ARG A CB  1 
ATOM 2218  C CG  . ARG A 1 280 ? -99.172  114.207 -50.131 1.00 0.00 ? 275 ARG A CG  1 
ATOM 2219  C CD  . ARG A 1 280 ? -99.803  113.025 -49.340 1.00 0.00 ? 275 ARG A CD  1 
ATOM 2220  N NE  . ARG A 1 280 ? -100.805 112.218 -50.157 1.00 0.00 ? 275 ARG A NE  1 
ATOM 2221  C CZ  . ARG A 1 280 ? -101.527 111.281 -49.581 1.00 0.00 ? 275 ARG A CZ  1 
ATOM 2222  N NH1 . ARG A 1 280 ? -101.342 110.907 -48.314 1.00 0.00 ? 275 ARG A NH1 1 
ATOM 2223  N NH2 . ARG A 1 280 ? -102.375 110.567 -50.387 1.00 0.00 ? 275 ARG A NH2 1 
ATOM 2224  N N   . ALA A 1 281 ? -97.870  115.754 -53.042 1.00 0.00 ? 276 ALA A N   1 
ATOM 2225  C CA  . ALA A 1 281 ? -97.627  115.405 -54.475 1.00 0.00 ? 276 ALA A CA  1 
ATOM 2226  C C   . ALA A 1 281 ? -98.018  113.974 -54.781 1.00 0.00 ? 276 ALA A C   1 
ATOM 2227  O O   . ALA A 1 281 ? -98.715  113.390 -54.020 1.00 0.00 ? 276 ALA A O   1 
ATOM 2228  C CB  . ALA A 1 281 ? -96.203  115.719 -54.675 1.00 0.00 ? 276 ALA A CB  1 
ATOM 2229  N N   . SER A 1 282 ? -97.629  113.379 -55.904 1.00 0.00 ? 277 SER A N   1 
ATOM 2230  C CA  . SER A 1 282 ? -97.999  112.017 -56.275 1.00 0.00 ? 277 SER A CA  1 
ATOM 2231  C C   . SER A 1 282 ? -96.815  111.062 -56.246 1.00 0.00 ? 277 SER A C   1 
ATOM 2232  O O   . SER A 1 282 ? -96.772  110.103 -57.064 1.00 0.00 ? 277 SER A O   1 
ATOM 2233  C CB  . SER A 1 282 ? -98.685  111.853 -57.619 1.00 0.00 ? 277 SER A CB  1 
ATOM 2234  O OG  . SER A 1 282 ? -99.780  110.917 -57.532 1.00 0.00 ? 277 SER A OG  1 
ATOM 2235  N N   . ASN A 1 283 ? -95.736  111.337 -55.493 1.00 0.00 ? 278 ASN A N   1 
ATOM 2236  C CA  . ASN A 1 283 ? -94.579  110.478 -55.467 1.00 0.00 ? 278 ASN A CA  1 
ATOM 2237  C C   . ASN A 1 283 ? -94.863  109.152 -54.785 1.00 0.00 ? 278 ASN A C   1 
ATOM 2238  O O   . ASN A 1 283 ? -95.602  109.037 -53.837 1.00 0.00 ? 278 ASN A O   1 
ATOM 2239  C CB  . ASN A 1 283 ? -93.327  111.082 -54.767 1.00 0.00 ? 278 ASN A CB  1 
ATOM 2240  C CG  . ASN A 1 283 ? -92.993  112.241 -55.662 1.00 0.00 ? 278 ASN A CG  1 
ATOM 2241  O OD1 . ASN A 1 283 ? -93.470  113.389 -55.540 1.00 0.00 ? 278 ASN A OD1 1 
ATOM 2242  N ND2 . ASN A 1 283 ? -92.100  111.892 -56.579 1.00 0.00 ? 278 ASN A ND2 1 
ATOM 2243  N N   . ALA A 1 284 ? -94.190  108.014 -55.097 1.00 0.00 ? 279 ALA A N   1 
ATOM 2244  C CA  . ALA A 1 284 ? -94.430  106.857 -54.272 1.00 0.00 ? 279 ALA A CA  1 
ATOM 2245  C C   . ALA A 1 284 ? -94.219  106.860 -52.733 1.00 0.00 ? 279 ALA A C   1 
ATOM 2246  O O   . ALA A 1 284 ? -94.914  106.185 -51.967 1.00 0.00 ? 279 ALA A O   1 
ATOM 2247  C CB  . ALA A 1 284 ? -93.409  105.796 -54.813 1.00 0.00 ? 279 ALA A CB  1 
ATOM 2248  N N   . PHE A 1 285 ? -93.183  107.641 -52.217 1.00 0.00 ? 280 PHE A N   1 
ATOM 2249  C CA  . PHE A 1 285 ? -93.055  107.982 -50.857 1.00 0.00 ? 280 PHE A CA  1 
ATOM 2250  C C   . PHE A 1 285 ? -93.255  109.482 -50.733 1.00 0.00 ? 280 PHE A C   1 
ATOM 2251  O O   . PHE A 1 285 ? -92.586  110.328 -51.317 1.00 0.00 ? 280 PHE A O   1 
ATOM 2252  C CB  . PHE A 1 285 ? -91.661  107.470 -50.286 1.00 0.00 ? 280 PHE A CB  1 
ATOM 2253  C CG  . PHE A 1 285 ? -91.419  106.125 -50.459 1.00 0.00 ? 280 PHE A CG  1 
ATOM 2254  C CD1 . PHE A 1 285 ? -92.270  105.181 -49.783 1.00 0.00 ? 280 PHE A CD1 1 
ATOM 2255  C CD2 . PHE A 1 285 ? -90.276  105.672 -51.214 1.00 0.00 ? 280 PHE A CD2 1 
ATOM 2256  C CE1 . PHE A 1 285 ? -91.980  103.815 -49.937 1.00 0.00 ? 280 PHE A CE1 1 
ATOM 2257  C CE2 . PHE A 1 285 ? -89.948  104.321 -51.297 1.00 0.00 ? 280 PHE A CE2 1 
ATOM 2258  C CZ  . PHE A 1 285 ? -90.791  103.413 -50.642 1.00 0.00 ? 280 PHE A CZ  1 
ATOM 2259  N N   . LYS A 1 286 ? -94.245  109.890 -49.933 1.00 0.00 ? 281 LYS A N   1 
ATOM 2260  C CA  . LYS A 1 286 ? -94.897  111.214 -50.171 1.00 0.00 ? 281 LYS A CA  1 
ATOM 2261  C C   . LYS A 1 286 ? -95.434  111.710 -48.815 1.00 0.00 ? 281 LYS A C   1 
ATOM 2262  O O   . LYS A 1 286 ? -95.842  110.912 -48.026 1.00 0.00 ? 281 LYS A O   1 
ATOM 2263  C CB  . LYS A 1 286 ? -95.950  111.228 -51.285 1.00 0.00 ? 281 LYS A CB  1 
ATOM 2264  C CG  . LYS A 1 286 ? -97.075  110.193 -51.287 1.00 0.00 ? 281 LYS A CG  1 
ATOM 2265  C CD  . LYS A 1 286 ? -98.100  110.361 -52.414 1.00 0.00 ? 281 LYS A CD  1 
ATOM 2266  C CE  . LYS A 1 286 ? -99.050  109.187 -52.656 1.00 0.00 ? 281 LYS A CE  1 
ATOM 2267  N NZ  . LYS A 1 286 ? -98.312  108.077 -53.279 1.00 0.00 ? 281 LYS A NZ  1 
ATOM 2268  N N   . THR A 1 287 ? -95.553  113.041 -48.509 1.00 0.00 ? 282 THR A N   1 
ATOM 2269  C CA  . THR A 1 287 ? -96.175  113.525 -47.332 1.00 0.00 ? 282 THR A CA  1 
ATOM 2270  C C   . THR A 1 287 ? -96.685  114.959 -47.478 1.00 0.00 ? 282 THR A C   1 
ATOM 2271  O O   . THR A 1 287 ? -96.508  115.669 -48.494 1.00 0.00 ? 282 THR A O   1 
ATOM 2272  C CB  . THR A 1 287 ? -95.426  113.262 -45.983 1.00 0.00 ? 282 THR A CB  1 
ATOM 2273  O OG1 . THR A 1 287 ? -96.218  113.454 -44.819 1.00 0.00 ? 282 THR A OG1 1 
ATOM 2274  C CG2 . THR A 1 287 ? -94.074  113.998 -45.904 1.00 0.00 ? 282 THR A CG2 1 
ATOM 2275  N N   . TRP A 1 288 ? -97.482  115.372 -46.490 1.00 0.00 ? 283 TRP A N   1 
ATOM 2276  C CA  . TRP A 1 288 ? -98.210  116.635 -46.392 1.00 0.00 ? 283 TRP A CA  1 
ATOM 2277  C C   . TRP A 1 288 ? -97.234  117.826 -45.915 1.00 0.00 ? 283 TRP A C   1 
ATOM 2278  O O   . TRP A 1 288 ? -96.387  117.627 -45.014 1.00 0.00 ? 283 TRP A O   1 
ATOM 2279  C CB  . TRP A 1 288 ? -99.534  116.560 -45.514 1.00 0.00 ? 283 TRP A CB  1 
ATOM 2280  C CG  . TRP A 1 288 ? -100.608 115.595 -46.052 1.00 0.00 ? 283 TRP A CG  1 
ATOM 2281  C CD1 . TRP A 1 288 ? -100.806 114.277 -45.692 1.00 0.00 ? 283 TRP A CD1 1 
ATOM 2282  C CD2 . TRP A 1 288 ? -101.741 115.909 -46.963 1.00 0.00 ? 283 TRP A CD2 1 
ATOM 2283  N NE1 . TRP A 1 288 ? -101.877 113.783 -46.285 1.00 0.00 ? 283 TRP A NE1 1 
ATOM 2284  C CE2 . TRP A 1 288 ? -102.550 114.769 -47.018 1.00 0.00 ? 283 TRP A CE2 1 
ATOM 2285  C CE3 . TRP A 1 288 ? -102.088 117.058 -47.628 1.00 0.00 ? 283 TRP A CE3 1 
ATOM 2286  C CZ2 . TRP A 1 288 ? -103.681 114.705 -47.698 1.00 0.00 ? 283 TRP A CZ2 1 
ATOM 2287  C CZ3 . TRP A 1 288 ? -103.367 117.040 -48.317 1.00 0.00 ? 283 TRP A CZ3 1 
ATOM 2288  C CH2 . TRP A 1 288 ? -104.037 115.789 -48.380 1.00 0.00 ? 283 TRP A CH2 1 
ATOM 2289  N N   . SER A 1 289 ? -97.406  119.015 -46.418 1.00 0.00 ? 284 SER A N   1 
ATOM 2290  C CA  . SER A 1 289 ? -96.836  120.202 -45.790 1.00 0.00 ? 284 SER A CA  1 
ATOM 2291  C C   . SER A 1 289 ? -97.740  121.330 -46.201 1.00 0.00 ? 284 SER A C   1 
ATOM 2292  O O   . SER A 1 289 ? -98.456  121.201 -47.185 1.00 0.00 ? 284 SER A O   1 
ATOM 2293  C CB  . SER A 1 289 ? -95.366  120.557 -46.098 1.00 0.00 ? 284 SER A CB  1 
ATOM 2294  O OG  . SER A 1 289 ? -95.296  120.540 -47.505 1.00 0.00 ? 284 SER A OG  1 
ATOM 2295  N N   . ARG A 1 290 ? -97.681  122.372 -45.401 1.00 0.00 ? 285 ARG A N   1 
ATOM 2296  C CA  . ARG A 1 290 ? -98.474  123.558 -45.607 1.00 0.00 ? 285 ARG A CA  1 
ATOM 2297  C C   . ARG A 1 290 ? -97.645  124.616 -46.270 1.00 0.00 ? 285 ARG A C   1 
ATOM 2298  O O   . ARG A 1 290 ? -96.480  124.877 -45.985 1.00 0.00 ? 285 ARG A O   1 
ATOM 2299  C CB  . ARG A 1 290 ? -98.878  124.000 -44.143 1.00 0.00 ? 285 ARG A CB  1 
ATOM 2300  C CG  . ARG A 1 290 ? -99.971  125.103 -44.022 1.00 0.00 ? 285 ARG A CG  1 
ATOM 2301  C CD  . ARG A 1 290 ? -100.480 125.104 -42.609 1.00 0.00 ? 285 ARG A CD  1 
ATOM 2302  N NE  . ARG A 1 290 ? -101.578 126.210 -42.471 1.00 0.00 ? 285 ARG A NE  1 
ATOM 2303  C CZ  . ARG A 1 290 ? -102.837 125.937 -42.652 1.00 0.00 ? 285 ARG A CZ  1 
ATOM 2304  N NH1 . ARG A 1 290 ? -103.279 124.742 -43.074 1.00 0.00 ? 285 ARG A NH1 1 
ATOM 2305  N NH2 . ARG A 1 290 ? -103.758 126.848 -42.268 1.00 0.00 ? 285 ARG A NH2 1 
ATOM 2306  N N   . ARG A 1 291 ? -98.251  125.349 -47.151 1.00 0.00 ? 286 ARG A N   1 
ATOM 2307  C CA  . ARG A 1 291 ? -97.713  126.418 -47.882 1.00 0.00 ? 286 ARG A CA  1 
ATOM 2308  C C   . ARG A 1 291 ? -98.736  127.479 -47.934 1.00 0.00 ? 286 ARG A C   1 
ATOM 2309  O O   . ARG A 1 291 ? -99.968  127.232 -47.786 1.00 0.00 ? 286 ARG A O   1 
ATOM 2310  C CB  . ARG A 1 291 ? -97.485  125.946 -49.359 1.00 0.00 ? 286 ARG A CB  1 
ATOM 2311  C CG  . ARG A 1 291 ? -96.507  124.827 -49.563 1.00 0.00 ? 286 ARG A CG  1 
ATOM 2312  C CD  . ARG A 1 291 ? -95.070  125.255 -49.124 1.00 0.00 ? 286 ARG A CD  1 
ATOM 2313  N NE  . ARG A 1 291 ? -94.130  124.018 -49.143 1.00 0.00 ? 286 ARG A NE  1 
ATOM 2314  C CZ  . ARG A 1 291 ? -93.200  123.706 -48.236 1.00 0.00 ? 286 ARG A CZ  1 
ATOM 2315  N NH1 . ARG A 1 291 ? -93.252  124.218 -47.006 1.00 0.00 ? 286 ARG A NH1 1 
ATOM 2316  N NH2 . ARG A 1 291 ? -92.199  122.943 -48.653 1.00 0.00 ? 286 ARG A NH2 1 
ATOM 2317  N N   . TRP A 1 292 ? -98.337  128.717 -48.194 1.00 0.00 ? 287 TRP A N   1 
ATOM 2318  C CA  . TRP A 1 292 ? -99.292  129.838 -48.355 1.00 0.00 ? 287 TRP A CA  1 
ATOM 2319  C C   . TRP A 1 292 ? -99.567  129.909 -49.879 1.00 0.00 ? 287 TRP A C   1 
ATOM 2320  O O   . TRP A 1 292 ? -98.690  130.127 -50.662 1.00 0.00 ? 287 TRP A O   1 
ATOM 2321  C CB  . TRP A 1 292 ? -98.775  131.228 -47.815 1.00 0.00 ? 287 TRP A CB  1 
ATOM 2322  C CG  . TRP A 1 292 ? -99.645  132.447 -47.816 1.00 0.00 ? 287 TRP A CG  1 
ATOM 2323  C CD1 . TRP A 1 292 ? -100.945 132.400 -47.558 1.00 0.00 ? 287 TRP A CD1 1 
ATOM 2324  C CD2 . TRP A 1 292 ? -99.268  133.834 -48.044 1.00 0.00 ? 287 TRP A CD2 1 
ATOM 2325  N NE1 . TRP A 1 292 ? -101.483 133.674 -47.648 1.00 0.00 ? 287 TRP A NE1 1 
ATOM 2326  C CE2 . TRP A 1 292 ? -100.426 134.580 -47.879 1.00 0.00 ? 287 TRP A CE2 1 
ATOM 2327  C CE3 . TRP A 1 292 ? -98.022  134.471 -48.318 1.00 0.00 ? 287 TRP A CE3 1 
ATOM 2328  C CZ2 . TRP A 1 292 ? -100.454 135.947 -48.165 1.00 0.00 ? 287 TRP A CZ2 1 
ATOM 2329  C CZ3 . TRP A 1 292 ? -98.071  135.814 -48.706 1.00 0.00 ? 287 TRP A CZ3 1 
ATOM 2330  C CH2 . TRP A 1 292 ? -99.299  136.537 -48.574 1.00 0.00 ? 287 TRP A CH2 1 
ATOM 2331  N N   . PHE A 1 293 ? -100.846 129.820 -50.309 1.00 0.00 ? 288 PHE A N   1 
ATOM 2332  C CA  . PHE A 1 293 ? -101.280 129.748 -51.677 1.00 0.00 ? 288 PHE A CA  1 
ATOM 2333  C C   . PHE A 1 293 ? -101.818 131.154 -52.022 1.00 0.00 ? 288 PHE A C   1 
ATOM 2334  O O   . PHE A 1 293 ? -102.212 132.028 -51.137 1.00 0.00 ? 288 PHE A O   1 
ATOM 2335  C CB  . PHE A 1 293 ? -102.357 128.664 -52.091 1.00 0.00 ? 288 PHE A CB  1 
ATOM 2336  C CG  . PHE A 1 293 ? -101.725 127.341 -52.089 1.00 0.00 ? 288 PHE A CG  1 
ATOM 2337  C CD1 . PHE A 1 293 ? -101.418 126.702 -50.882 1.00 0.00 ? 288 PHE A CD1 1 
ATOM 2338  C CD2 . PHE A 1 293 ? -101.518 126.740 -53.389 1.00 0.00 ? 288 PHE A CD2 1 
ATOM 2339  C CE1 . PHE A 1 293 ? -100.845 125.474 -50.945 1.00 0.00 ? 288 PHE A CE1 1 
ATOM 2340  C CE2 . PHE A 1 293 ? -100.927 125.475 -53.498 1.00 0.00 ? 288 PHE A CE2 1 
ATOM 2341  C CZ  . PHE A 1 293 ? -100.624 124.858 -52.251 1.00 0.00 ? 288 PHE A CZ  1 
ATOM 2342  N N   . THR A 1 294 ? -101.780 131.458 -53.328 1.00 0.00 ? 289 THR A N   1 
ATOM 2343  C CA  . THR A 1 294 ? -102.413 132.684 -53.849 1.00 0.00 ? 289 THR A CA  1 
ATOM 2344  C C   . THR A 1 294 ? -102.924 132.455 -55.269 1.00 0.00 ? 289 THR A C   1 
ATOM 2345  O O   . THR A 1 294 ? -102.132 132.027 -56.106 1.00 0.00 ? 289 THR A O   1 
ATOM 2346  C CB  . THR A 1 294 ? -101.512 133.937 -53.896 1.00 0.00 ? 289 THR A CB  1 
ATOM 2347  O OG1 . THR A 1 294 ? -100.997 134.220 -52.561 1.00 0.00 ? 289 THR A OG1 1 
ATOM 2348  C CG2 . THR A 1 294 ? -102.336 135.176 -54.346 1.00 0.00 ? 289 THR A CG2 1 
ATOM 2349  N N   . ILE A 1 295 ? -104.205 132.747 -55.611 1.00 0.00 ? 290 ILE A N   1 
ATOM 2350  C CA  . ILE A 1 295 ? -104.690 132.793 -56.987 1.00 0.00 ? 290 ILE A CA  1 
ATOM 2351  C C   . ILE A 1 295 ? -104.577 134.238 -57.278 1.00 0.00 ? 290 ILE A C   1 
ATOM 2352  O O   . ILE A 1 295 ? -105.237 135.057 -56.635 1.00 0.00 ? 290 ILE A O   1 
ATOM 2353  C CB  . ILE A 1 295 ? -106.173 132.511 -57.178 1.00 0.00 ? 290 ILE A CB  1 
ATOM 2354  C CG1 . ILE A 1 295 ? -106.728 131.393 -56.306 1.00 0.00 ? 290 ILE A CG1 1 
ATOM 2355  C CG2 . ILE A 1 295 ? -106.281 131.969 -58.620 1.00 0.00 ? 290 ILE A CG2 1 
ATOM 2356  C CD1 . ILE A 1 295 ? -108.192 131.112 -56.513 1.00 0.00 ? 290 ILE A CD1 1 
ATOM 2357  N N   . GLN A 1 296 ? -103.717 134.582 -58.267 1.00 0.00 ? 291 GLN A N   1 
ATOM 2358  C CA  . GLN A 1 296 ? -103.621 135.938 -58.752 1.00 0.00 ? 291 GLN A CA  1 
ATOM 2359  C C   . GLN A 1 296 ? -103.444 135.856 -60.246 1.00 0.00 ? 291 GLN A C   1 
ATOM 2360  O O   . GLN A 1 296 ? -102.595 135.127 -60.776 1.00 0.00 ? 291 GLN A O   1 
ATOM 2361  C CB  . GLN A 1 296 ? -102.515 136.900 -58.191 1.00 0.00 ? 291 GLN A CB  1 
ATOM 2362  C CG  . GLN A 1 296 ? -102.769 138.455 -58.501 1.00 0.00 ? 291 GLN A CG  1 
ATOM 2363  C CD  . GLN A 1 296 ? -101.868 139.379 -57.618 1.00 0.00 ? 291 GLN A CD  1 
ATOM 2364  O OE1 . GLN A 1 296 ? -100.664 139.128 -57.475 1.00 0.00 ? 291 GLN A OE1 1 
ATOM 2365  N NE2 . GLN A 1 296 ? -102.469 140.352 -56.941 1.00 0.00 ? 291 GLN A NE2 1 
ATOM 2366  N N   . SER A 1 297 ? -104.334 136.606 -61.000 1.00 0.00 ? 292 SER A N   1 
ATOM 2367  C CA  . SER A 1 297 ? -104.279 136.687 -62.439 1.00 0.00 ? 292 SER A CA  1 
ATOM 2368  C C   . SER A 1 297 ? -104.395 135.362 -63.206 1.00 0.00 ? 292 SER A C   1 
ATOM 2369  O O   . SER A 1 297 ? -103.807 135.032 -64.207 1.00 0.00 ? 292 SER A O   1 
ATOM 2370  C CB  . SER A 1 297 ? -102.988 137.362 -62.930 1.00 0.00 ? 292 SER A CB  1 
ATOM 2371  O OG  . SER A 1 297 ? -103.029 138.732 -62.479 1.00 0.00 ? 292 SER A OG  1 
ATOM 2372  N N   . ASN A 1 298 ? -105.362 134.641 -62.632 1.00 0.00 ? 293 ASN A N   1 
ATOM 2373  C CA  . ASN A 1 298 ? -105.629 133.224 -62.985 1.00 0.00 ? 293 ASN A CA  1 
ATOM 2374  C C   . ASN A 1 298 ? -104.484 132.310 -62.783 1.00 0.00 ? 293 ASN A C   1 
ATOM 2375  O O   . ASN A 1 298 ? -104.459 131.201 -63.373 1.00 0.00 ? 293 ASN A O   1 
ATOM 2376  C CB  . ASN A 1 298 ? -106.537 133.107 -64.215 1.00 0.00 ? 293 ASN A CB  1 
ATOM 2377  C CG  . ASN A 1 298 ? -107.827 133.919 -63.987 1.00 0.00 ? 293 ASN A CG  1 
ATOM 2378  O OD1 . ASN A 1 298 ? -108.391 134.486 -64.935 1.00 0.00 ? 293 ASN A OD1 1 
ATOM 2379  N ND2 . ASN A 1 298 ? -108.464 133.964 -62.801 1.00 0.00 ? 293 ASN A ND2 1 
ATOM 2380  N N   . GLN A 1 299 ? -103.525 132.628 -61.934 1.00 0.00 ? 294 GLN A N   1 
ATOM 2381  C CA  . GLN A 1 299 ? -102.376 131.836 -61.773 1.00 0.00 ? 294 GLN A CA  1 
ATOM 2382  C C   . GLN A 1 299 ? -102.370 131.297 -60.317 1.00 0.00 ? 294 GLN A C   1 
ATOM 2383  O O   . GLN A 1 299 ? -102.415 132.091 -59.409 1.00 0.00 ? 294 GLN A O   1 
ATOM 2384  C CB  . GLN A 1 299 ? -101.089 132.689 -62.145 1.00 0.00 ? 294 GLN A CB  1 
ATOM 2385  C CG  . GLN A 1 299 ? -99.785  131.893 -62.321 1.00 0.00 ? 294 GLN A CG  1 
ATOM 2386  C CD  . GLN A 1 299 ? -99.890  131.266 -63.713 1.00 0.00 ? 294 GLN A CD  1 
ATOM 2387  O OE1 . GLN A 1 299 ? -100.758 130.399 -63.923 1.00 0.00 ? 294 GLN A OE1 1 
ATOM 2388  N NE2 . GLN A 1 299 ? -99.319  131.949 -64.699 1.00 0.00 ? 294 GLN A NE2 1 
ATOM 2389  N N   . LEU A 1 300 ? -102.421 129.945 -60.131 1.00 0.00 ? 295 LEU A N   1 
ATOM 2390  C CA  . LEU A 1 300 ? -102.335 129.331 -58.855 1.00 0.00 ? 295 LEU A CA  1 
ATOM 2391  C C   . LEU A 1 300 ? -100.908 129.093 -58.470 1.00 0.00 ? 295 LEU A C   1 
ATOM 2392  O O   . LEU A 1 300 ? -100.089 128.405 -59.172 1.00 0.00 ? 295 LEU A O   1 
ATOM 2393  C CB  . LEU A 1 300 ? -103.202 127.981 -58.806 1.00 0.00 ? 295 LEU A CB  1 
ATOM 2394  C CG  . LEU A 1 300 ? -103.220 127.243 -57.484 1.00 0.00 ? 295 LEU A CG  1 
ATOM 2395  C CD1 . LEU A 1 300 ? -103.535 128.168 -56.222 1.00 0.00 ? 295 LEU A CD1 1 
ATOM 2396  C CD2 . LEU A 1 300 ? -104.064 125.977 -57.515 1.00 0.00 ? 295 LEU A CD2 1 
ATOM 2397  N N   . VAL A 1 301 ? -100.463 129.642 -57.349 1.00 0.00 ? 296 VAL A N   1 
ATOM 2398  C CA  . VAL A 1 301 ? -99.005  129.738 -56.886 1.00 0.00 ? 296 VAL A CA  1 
ATOM 2399  C C   . VAL A 1 301 ? -98.941  129.588 -55.387 1.00 0.00 ? 296 VAL A C   1 
ATOM 2400  O O   . VAL A 1 301 ? -99.939  129.725 -54.641 1.00 0.00 ? 296 VAL A O   1 
ATOM 2401  C CB  . VAL A 1 301 ? -98.462  131.129 -57.382 1.00 0.00 ? 296 VAL A CB  1 
ATOM 2402  C CG1 . VAL A 1 301 ? -98.667  131.210 -58.971 1.00 0.00 ? 296 VAL A CG1 1 
ATOM 2403  C CG2 . VAL A 1 301 ? -99.109  132.305 -56.667 1.00 0.00 ? 296 VAL A CG2 1 
ATOM 2404  N N   . TYR A 1 302 ? -97.768  129.127 -54.865 1.00 0.00 ? 297 TYR A N   1 
ATOM 2405  C CA  . TYR A 1 302 ? -97.458  128.877 -53.433 1.00 0.00 ? 297 TYR A CA  1 
ATOM 2406  C C   . TYR A 1 302 ? -96.084  129.430 -53.198 1.00 0.00 ? 297 TYR A C   1 
ATOM 2407  O O   . TYR A 1 302 ? -95.414  129.880 -54.108 1.00 0.00 ? 297 TYR A O   1 
ATOM 2408  C CB  . TYR A 1 302 ? -97.536  127.412 -52.919 1.00 0.00 ? 297 TYR A CB  1 
ATOM 2409  C CG  . TYR A 1 302 ? -96.525  126.502 -53.560 1.00 0.00 ? 297 TYR A CG  1 
ATOM 2410  C CD1 . TYR A 1 302 ? -96.594  126.166 -55.003 1.00 0.00 ? 297 TYR A CD1 1 
ATOM 2411  C CD2 . TYR A 1 302 ? -95.480  125.978 -52.880 1.00 0.00 ? 297 TYR A CD2 1 
ATOM 2412  C CE1 . TYR A 1 302 ? -95.628  125.306 -55.569 1.00 0.00 ? 297 TYR A CE1 1 
ATOM 2413  C CE2 . TYR A 1 302 ? -94.481  125.197 -53.510 1.00 0.00 ? 297 TYR A CE2 1 
ATOM 2414  C CZ  . TYR A 1 302 ? -94.513  124.770 -54.868 1.00 0.00 ? 297 TYR A CZ  1 
ATOM 2415  O OH  . TYR A 1 302 ? -93.613  123.779 -55.473 1.00 0.00 ? 297 TYR A OH  1 
ATOM 2416  N N   . GLN A 1 303 ? -95.678  129.524 -51.946 1.00 0.00 ? 298 GLN A N   1 
ATOM 2417  C CA  . GLN A 1 303 ? -94.401  130.054 -51.570 1.00 0.00 ? 298 GLN A CA  1 
ATOM 2418  C C   . GLN A 1 303 ? -94.084  129.417 -50.235 1.00 0.00 ? 298 GLN A C   1 
ATOM 2419  O O   . GLN A 1 303 ? -94.890  129.348 -49.329 1.00 0.00 ? 298 GLN A O   1 
ATOM 2420  C CB  . GLN A 1 303 ? -94.360  131.642 -51.466 1.00 0.00 ? 298 GLN A CB  1 
ATOM 2421  C CG  . GLN A 1 303 ? -95.631  132.288 -50.909 1.00 0.00 ? 298 GLN A CG  1 
ATOM 2422  C CD  . GLN A 1 303 ? -95.586  133.763 -50.743 1.00 0.00 ? 298 GLN A CD  1 
ATOM 2423  O OE1 . GLN A 1 303 ? -96.286  134.493 -51.438 1.00 0.00 ? 298 GLN A OE1 1 
ATOM 2424  N NE2 . GLN A 1 303 ? -94.767  134.231 -49.796 1.00 0.00 ? 298 GLN A NE2 1 
ATOM 2425  N N   . LYS A 1 304 ? -92.850  128.856 -50.074 1.00 0.00 ? 299 LYS A N   1 
ATOM 2426  C CA  . LYS A 1 304 ? -92.356  128.018 -49.014 1.00 0.00 ? 299 LYS A CA  1 
ATOM 2427  C C   . LYS A 1 304 ? -92.400  128.887 -47.683 1.00 0.00 ? 299 LYS A C   1 
ATOM 2428  O O   . LYS A 1 304 ? -92.584  128.357 -46.573 1.00 0.00 ? 299 LYS A O   1 
ATOM 2429  C CB  . LYS A 1 304 ? -90.939  127.565 -49.335 1.00 0.00 ? 299 LYS A CB  1 
ATOM 2430  C CG  . LYS A 1 304 ? -90.780  126.336 -50.191 1.00 0.00 ? 299 LYS A CG  1 
ATOM 2431  C CD  . LYS A 1 304 ? -89.397  126.008 -50.816 1.00 0.00 ? 299 LYS A CD  1 
ATOM 2432  C CE  . LYS A 1 304 ? -88.828  127.126 -51.762 1.00 0.00 ? 299 LYS A CE  1 
ATOM 2433  N NZ  . LYS A 1 304 ? -89.722  127.351 -52.906 1.00 0.00 ? 299 LYS A NZ  1 
ATOM 2434  N N   . LYS A 1 305 ? -92.283  130.197 -47.868 1.00 0.00 ? 300 LYS A N   1 
ATOM 2435  C CA  . LYS A 1 305 ? -92.140  131.167 -46.786 1.00 0.00 ? 300 LYS A CA  1 
ATOM 2436  C C   . LYS A 1 305 ? -93.007  132.397 -47.075 1.00 0.00 ? 300 LYS A C   1 
ATOM 2437  O O   . LYS A 1 305 ? -93.457  132.529 -48.230 1.00 0.00 ? 300 LYS A O   1 
ATOM 2438  C CB  . LYS A 1 305 ? -90.726  131.752 -46.668 1.00 0.00 ? 300 LYS A CB  1 
ATOM 2439  C CG  . LYS A 1 305 ? -89.661  130.659 -46.257 1.00 0.00 ? 300 LYS A CG  1 
ATOM 2440  C CD  . LYS A 1 305 ? -88.220  131.210 -46.114 1.00 0.00 ? 300 LYS A CD  1 
ATOM 2441  C CE  . LYS A 1 305 ? -87.302  129.991 -46.188 1.00 0.00 ? 300 LYS A CE  1 
ATOM 2442  N NZ  . LYS A 1 305 ? -85.927  130.566 -46.260 1.00 0.00 ? 300 LYS A NZ  1 
ATOM 2443  N N   . TYR A 1 306 ? -93.256  133.313 -46.079 1.00 0.00 ? 301 TYR A N   1 
ATOM 2444  C CA  . TYR A 1 306 ? -93.858  134.638 -46.263 1.00 0.00 ? 301 TYR A CA  1 
ATOM 2445  C C   . TYR A 1 306 ? -93.047  135.513 -47.233 1.00 0.00 ? 301 TYR A C   1 
ATOM 2446  O O   . TYR A 1 306 ? -93.652  136.129 -48.125 1.00 0.00 ? 301 TYR A O   1 
ATOM 2447  C CB  . TYR A 1 306 ? -93.884  135.274 -44.904 1.00 0.00 ? 301 TYR A CB  1 
ATOM 2448  C CG  . TYR A 1 306 ? -94.566  136.600 -44.888 1.00 0.00 ? 301 TYR A CG  1 
ATOM 2449  C CD1 . TYR A 1 306 ? -95.822  136.641 -45.458 1.00 0.00 ? 301 TYR A CD1 1 
ATOM 2450  C CD2 . TYR A 1 306 ? -93.997  137.774 -44.316 1.00 0.00 ? 301 TYR A CD2 1 
ATOM 2451  C CE1 . TYR A 1 306 ? -96.571  137.896 -45.516 1.00 0.00 ? 301 TYR A CE1 1 
ATOM 2452  C CE2 . TYR A 1 306 ? -94.590  138.987 -44.567 1.00 0.00 ? 301 TYR A CE2 1 
ATOM 2453  C CZ  . TYR A 1 306 ? -95.942  139.071 -45.103 1.00 0.00 ? 301 TYR A CZ  1 
ATOM 2454  O OH  . TYR A 1 306 ? -96.594  140.290 -45.197 1.00 0.00 ? 301 TYR A OH  1 
ATOM 2455  N N   . LYS A 1 307 ? -91.702  135.611 -47.167 1.00 0.00 ? 302 LYS A N   1 
ATOM 2456  C CA  . LYS A 1 307 ? -90.880  136.520 -47.911 1.00 0.00 ? 302 LYS A CA  1 
ATOM 2457  C C   . LYS A 1 307 ? -90.242  135.825 -49.137 1.00 0.00 ? 302 LYS A C   1 
ATOM 2458  O O   . LYS A 1 307 ? -89.318  136.367 -49.698 1.00 0.00 ? 302 LYS A O   1 
ATOM 2459  C CB  . LYS A 1 307 ? -89.767  137.114 -46.987 1.00 0.00 ? 302 LYS A CB  1 
ATOM 2460  C CG  . LYS A 1 307 ? -90.381  137.848 -45.744 1.00 0.00 ? 302 LYS A CG  1 
ATOM 2461  C CD  . LYS A 1 307 ? -89.638  139.111 -45.225 1.00 0.00 ? 302 LYS A CD  1 
ATOM 2462  C CE  . LYS A 1 307 ? -89.757  140.292 -46.248 1.00 0.00 ? 302 LYS A CE  1 
ATOM 2463  N NZ  . LYS A 1 307 ? -91.124  140.752 -46.154 1.00 0.00 ? 302 LYS A NZ  1 
ATOM 2464  N N   . ASP A 1 308 ? -90.721  134.655 -49.499 1.00 0.00 ? 303 ASP A N   1 
ATOM 2465  C CA  . ASP A 1 308 ? -90.206  133.981 -50.697 1.00 0.00 ? 303 ASP A CA  1 
ATOM 2466  C C   . ASP A 1 308 ? -91.012  134.539 -51.903 1.00 0.00 ? 303 ASP A C   1 
ATOM 2467  O O   . ASP A 1 308 ? -92.176  134.741 -51.768 1.00 0.00 ? 303 ASP A O   1 
ATOM 2468  C CB  . ASP A 1 308 ? -90.427  132.478 -50.382 1.00 0.00 ? 303 ASP A CB  1 
ATOM 2469  C CG  . ASP A 1 308 ? -89.928  131.567 -51.510 1.00 0.00 ? 303 ASP A CG  1 
ATOM 2470  O OD1 . ASP A 1 308 ? -88.833  131.780 -52.116 1.00 0.00 ? 303 ASP A OD1 1 
ATOM 2471  O OD2 . ASP A 1 308 ? -90.701  130.621 -51.762 1.00 0.00 ? 303 ASP A OD2 1 
ATOM 2472  N N   . PRO A 1 309 ? -90.346  134.719 -53.118 1.00 0.00 ? 304 PRO A N   1 
ATOM 2473  C CA  . PRO A 1 309 ? -91.090  134.906 -54.359 1.00 0.00 ? 304 PRO A CA  1 
ATOM 2474  C C   . PRO A 1 309 ? -91.920  133.720 -54.836 1.00 0.00 ? 304 PRO A C   1 
ATOM 2475  O O   . PRO A 1 309 ? -91.435  132.541 -54.813 1.00 0.00 ? 304 PRO A O   1 
ATOM 2476  C CB  . PRO A 1 309 ? -89.954  135.260 -55.320 1.00 0.00 ? 304 PRO A CB  1 
ATOM 2477  C CG  . PRO A 1 309 ? -88.825  135.964 -54.515 1.00 0.00 ? 304 PRO A CG  1 
ATOM 2478  C CD  . PRO A 1 309 ? -88.961  135.146 -53.219 1.00 0.00 ? 304 PRO A CD  1 
ATOM 2479  N N   . VAL A 1 310 ? -93.197  133.874 -55.367 1.00 0.00 ? 305 VAL A N   1 
ATOM 2480  C CA  . VAL A 1 310 ? -94.103  132.800 -55.683 1.00 0.00 ? 305 VAL A CA  1 
ATOM 2481  C C   . VAL A 1 310 ? -93.653  131.898 -56.874 1.00 0.00 ? 305 VAL A C   1 
ATOM 2482  O O   . VAL A 1 310 ? -92.925  132.286 -57.788 1.00 0.00 ? 305 VAL A O   1 
ATOM 2483  C CB  . VAL A 1 310 ? -95.550  133.183 -55.896 1.00 0.00 ? 305 VAL A CB  1 
ATOM 2484  C CG1 . VAL A 1 310 ? -96.248  133.796 -54.643 1.00 0.00 ? 305 VAL A CG1 1 
ATOM 2485  C CG2 . VAL A 1 310 ? -95.550  134.174 -57.030 1.00 0.00 ? 305 VAL A CG2 1 
ATOM 2486  N N   . THR A 1 311 ? -94.061  130.602 -56.830 1.00 0.00 ? 306 THR A N   1 
ATOM 2487  C CA  . THR A 1 311 ? -94.028  129.699 -57.876 1.00 0.00 ? 306 THR A CA  1 
ATOM 2488  C C   . THR A 1 311 ? -95.305  128.973 -58.287 1.00 0.00 ? 306 THR A C   1 
ATOM 2489  O O   . THR A 1 311 ? -96.105  128.830 -57.450 1.00 0.00 ? 306 THR A O   1 
ATOM 2490  C CB  . THR A 1 311 ? -92.898  128.717 -57.695 1.00 0.00 ? 306 THR A CB  1 
ATOM 2491  O OG1 . THR A 1 311 ? -92.650  127.927 -58.850 1.00 0.00 ? 306 THR A OG1 1 
ATOM 2492  C CG2 . THR A 1 311 ? -93.184  127.821 -56.443 1.00 0.00 ? 306 THR A CG2 1 
ATOM 2493  N N   . VAL A 1 312 ? -95.551  128.761 -59.650 1.00 0.00 ? 307 VAL A N   1 
ATOM 2494  C CA  . VAL A 1 312 ? -96.705  128.135 -60.175 1.00 0.00 ? 307 VAL A CA  1 
ATOM 2495  C C   . VAL A 1 312 ? -96.911  126.706 -59.669 1.00 0.00 ? 307 VAL A C   1 
ATOM 2496  O O   . VAL A 1 312 ? -96.025  125.905 -59.742 1.00 0.00 ? 307 VAL A O   1 
ATOM 2497  C CB  . VAL A 1 312 ? -96.834  128.356 -61.742 1.00 0.00 ? 307 VAL A CB  1 
ATOM 2498  C CG1 . VAL A 1 312 ? -96.735  129.848 -62.058 1.00 0.00 ? 307 VAL A CG1 1 
ATOM 2499  C CG2 . VAL A 1 312 ? -95.769  127.579 -62.462 1.00 0.00 ? 307 VAL A CG2 1 
ATOM 2500  N N   . VAL A 1 313 ? -98.163  126.408 -59.259 1.00 0.00 ? 308 VAL A N   1 
ATOM 2501  C CA  . VAL A 1 313 ? -98.628  125.069 -58.946 1.00 0.00 ? 308 VAL A CA  1 
ATOM 2502  C C   . VAL A 1 313 ? -98.760  124.378 -60.261 1.00 0.00 ? 308 VAL A C   1 
ATOM 2503  O O   . VAL A 1 313 ? -98.328  123.253 -60.360 1.00 0.00 ? 308 VAL A O   1 
ATOM 2504  C CB  . VAL A 1 313 ? -99.951  125.195 -58.135 1.00 0.00 ? 308 VAL A CB  1 
ATOM 2505  C CG1 . VAL A 1 313 ? -100.324 123.741 -57.815 1.00 0.00 ? 308 VAL A CG1 1 
ATOM 2506  C CG2 . VAL A 1 313 ? -99.784  126.067 -56.837 1.00 0.00 ? 308 VAL A CG2 1 
ATOM 2507  N N   . VAL A 1 314 ? -99.272  125.031 -61.259 1.00 0.00 ? 309 VAL A N   1 
ATOM 2508  C CA  . VAL A 1 314 ? -99.316  124.484 -62.576 1.00 0.00 ? 309 VAL A CA  1 
ATOM 2509  C C   . VAL A 1 314 ? -99.015  125.690 -63.445 1.00 0.00 ? 309 VAL A C   1 
ATOM 2510  O O   . VAL A 1 314 ? -99.504  126.734 -63.060 1.00 0.00 ? 309 VAL A O   1 
ATOM 2511  C CB  . VAL A 1 314 ? -100.736 123.928 -62.997 1.00 0.00 ? 309 VAL A CB  1 
ATOM 2512  C CG1 . VAL A 1 314 ? -100.974 122.469 -62.546 1.00 0.00 ? 309 VAL A CG1 1 
ATOM 2513  C CG2 . VAL A 1 314 ? -101.916 124.731 -62.550 1.00 0.00 ? 309 VAL A CG2 1 
ATOM 2514  N N   . ASP A 1 315 ? -98.195  125.597 -64.533 1.00 0.00 ? 310 ASP A N   1 
ATOM 2515  C CA  . ASP A 1 315 ? -97.786  126.619 -65.472 1.00 0.00 ? 310 ASP A CA  1 
ATOM 2516  C C   . ASP A 1 315 ? -98.922  127.490 -66.007 1.00 0.00 ? 310 ASP A C   1 
ATOM 2517  O O   . ASP A 1 315 ? -98.714  128.734 -66.197 1.00 0.00 ? 310 ASP A O   1 
ATOM 2518  C CB  . ASP A 1 315 ? -96.994  126.030 -66.676 1.00 0.00 ? 310 ASP A CB  1 
ATOM 2519  C CG  . ASP A 1 315 ? -95.779  125.309 -66.136 1.00 0.00 ? 310 ASP A CG  1 
ATOM 2520  O OD1 . ASP A 1 315 ? -94.703  125.960 -65.888 1.00 0.00 ? 310 ASP A OD1 1 
ATOM 2521  O OD2 . ASP A 1 315 ? -95.829  124.036 -65.990 1.00 0.00 ? 310 ASP A OD2 1 
ATOM 2522  N N   . ASP A 1 316 ? -100.079 126.824 -66.294 1.00 0.00 ? 311 ASP A N   1 
ATOM 2523  C CA  . ASP A 1 316 ? -101.226 127.403 -66.947 1.00 0.00 ? 311 ASP A CA  1 
ATOM 2524  C C   . ASP A 1 316 ? -102.398 126.592 -66.352 1.00 0.00 ? 311 ASP A C   1 
ATOM 2525  O O   . ASP A 1 316 ? -102.247 125.462 -65.984 1.00 0.00 ? 311 ASP A O   1 
ATOM 2526  C CB  . ASP A 1 316 ? -101.168 127.461 -68.525 1.00 0.00 ? 311 ASP A CB  1 
ATOM 2527  C CG  . ASP A 1 316 ? -102.014 128.571 -69.133 1.00 0.00 ? 311 ASP A CG  1 
ATOM 2528  O OD1 . ASP A 1 316 ? -101.641 129.762 -69.124 1.00 0.00 ? 311 ASP A OD1 1 
ATOM 2529  O OD2 . ASP A 1 316 ? -103.174 128.289 -69.502 1.00 0.00 ? 311 ASP A OD2 1 
ATOM 2530  N N   . LEU A 1 317 ? -103.596 127.152 -66.221 1.00 0.00 ? 312 LEU A N   1 
ATOM 2531  C CA  . LEU A 1 317 ? -104.697 126.621 -65.569 1.00 0.00 ? 312 LEU A CA  1 
ATOM 2532  C C   . LEU A 1 317 ? -106.013 126.477 -66.455 1.00 0.00 ? 312 LEU A C   1 
ATOM 2533  O O   . LEU A 1 317 ? -107.075 125.961 -66.052 1.00 0.00 ? 312 LEU A O   1 
ATOM 2534  C CB  . LEU A 1 317 ? -104.936 127.683 -64.332 1.00 0.00 ? 312 LEU A CB  1 
ATOM 2535  C CG  . LEU A 1 317 ? -106.023 127.319 -63.277 1.00 0.00 ? 312 LEU A CG  1 
ATOM 2536  C CD1 . LEU A 1 317 ? -105.678 126.070 -62.400 1.00 0.00 ? 312 LEU A CD1 1 
ATOM 2537  C CD2 . LEU A 1 317 ? -106.297 128.419 -62.274 1.00 0.00 ? 312 LEU A CD2 1 
ATOM 2538  N N   . ARG A 1 318 ? -105.768 126.833 -67.776 1.00 0.00 ? 313 ARG A N   1 
ATOM 2539  C CA  . ARG A 1 318 ? -106.661 126.680 -68.882 1.00 0.00 ? 313 ARG A CA  1 
ATOM 2540  C C   . ARG A 1 318 ? -107.089 125.245 -69.217 1.00 0.00 ? 313 ARG A C   1 
ATOM 2541  O O   . ARG A 1 318 ? -108.242 124.978 -69.507 1.00 0.00 ? 313 ARG A O   1 
ATOM 2542  C CB  . ARG A 1 318 ? -106.054 127.355 -70.172 1.00 0.00 ? 313 ARG A CB  1 
ATOM 2543  C CG  . ARG A 1 318 ? -107.054 127.702 -71.371 1.00 0.00 ? 313 ARG A CG  1 
ATOM 2544  C CD  . ARG A 1 318 ? -106.388 128.391 -72.573 1.00 0.00 ? 313 ARG A CD  1 
ATOM 2545  N NE  . ARG A 1 318 ? -107.409 128.368 -73.687 1.00 0.00 ? 313 ARG A NE  1 
ATOM 2546  C CZ  . ARG A 1 318 ? -108.599 129.033 -73.706 1.00 0.00 ? 313 ARG A CZ  1 
ATOM 2547  N NH1 . ARG A 1 318 ? -108.837 130.044 -72.860 1.00 0.00 ? 313 ARG A NH1 1 
ATOM 2548  N NH2 . ARG A 1 318 ? -109.489 128.581 -74.526 1.00 0.00 ? 313 ARG A NH2 1 
ATOM 2549  N N   . LEU A 1 319 ? -106.216 124.267 -69.137 1.00 0.00 ? 314 LEU A N   1 
ATOM 2550  C CA  . LEU A 1 319 ? -106.548 122.900 -69.537 1.00 0.00 ? 314 LEU A CA  1 
ATOM 2551  C C   . LEU A 1 319 ? -106.737 121.926 -68.332 1.00 0.00 ? 314 LEU A C   1 
ATOM 2552  O O   . LEU A 1 319 ? -106.705 120.710 -68.496 1.00 0.00 ? 314 LEU A O   1 
ATOM 2553  C CB  . LEU A 1 319 ? -105.379 122.176 -70.406 1.00 0.00 ? 314 LEU A CB  1 
ATOM 2554  C CG  . LEU A 1 319 ? -104.796 122.883 -71.644 1.00 0.00 ? 314 LEU A CG  1 
ATOM 2555  C CD1 . LEU A 1 319 ? -104.036 121.774 -72.423 1.00 0.00 ? 314 LEU A CD1 1 
ATOM 2556  C CD2 . LEU A 1 319 ? -105.915 123.400 -72.467 1.00 0.00 ? 314 LEU A CD2 1 
ATOM 2557  N N   . CYS A 1 320 ? -107.028 122.474 -67.096 1.00 0.00 ? 315 CYS A N   1 
ATOM 2558  C CA  . CYS A 1 320 ? -106.906 121.763 -65.822 1.00 0.00 ? 315 CYS A CA  1 
ATOM 2559  C C   . CYS A 1 320 ? -108.348 121.373 -65.465 1.00 0.00 ? 315 CYS A C   1 
ATOM 2560  O O   . CYS A 1 320 ? -109.332 121.859 -66.028 1.00 0.00 ? 315 CYS A O   1 
ATOM 2561  C CB  . CYS A 1 320 ? -106.285 122.734 -64.737 1.00 0.00 ? 315 CYS A CB  1 
ATOM 2562  S SG  . CYS A 1 320 ? -105.764 122.092 -63.066 1.00 0.00 ? 315 CYS A SG  1 
ATOM 2563  N N   . THR A 1 321 ? -108.570 120.489 -64.546 1.00 0.00 ? 316 THR A N   1 
ATOM 2564  C CA  . THR A 1 321 ? -109.896 120.182 -63.898 1.00 0.00 ? 316 THR A CA  1 
ATOM 2565  C C   . THR A 1 321 ? -109.686 119.788 -62.390 1.00 0.00 ? 316 THR A C   1 
ATOM 2566  O O   . THR A 1 321 ? -108.688 119.178 -62.072 1.00 0.00 ? 316 THR A O   1 
ATOM 2567  C CB  . THR A 1 321 ? -110.829 119.220 -64.620 1.00 0.00 ? 316 THR A CB  1 
ATOM 2568  O OG1 . THR A 1 321 ? -112.168 119.347 -64.197 1.00 0.00 ? 316 THR A OG1 1 
ATOM 2569  C CG2 . THR A 1 321 ? -110.341 117.755 -64.343 1.00 0.00 ? 316 THR A CG2 1 
ATOM 2570  N N   . VAL A 1 322 ? -110.655 120.183 -61.516 1.00 0.00 ? 317 VAL A N   1 
ATOM 2571  C CA  . VAL A 1 322 ? -110.661 119.962 -60.051 1.00 0.00 ? 317 VAL A CA  1 
ATOM 2572  C C   . VAL A 1 322 ? -111.532 118.746 -59.748 1.00 0.00 ? 317 VAL A C   1 
ATOM 2573  O O   . VAL A 1 322 ? -112.596 118.607 -60.365 1.00 0.00 ? 317 VAL A O   1 
ATOM 2574  C CB  . VAL A 1 322 ? -111.008 121.175 -59.186 1.00 0.00 ? 317 VAL A CB  1 
ATOM 2575  C CG1 . VAL A 1 322 ? -110.661 120.962 -57.758 1.00 0.00 ? 317 VAL A CG1 1 
ATOM 2576  C CG2 . VAL A 1 322 ? -110.167 122.364 -59.782 1.00 0.00 ? 317 VAL A CG2 1 
ATOM 2577  N N   . LYS A 1 323 ? -111.081 117.946 -58.803 1.00 0.00 ? 318 LYS A N   1 
ATOM 2578  C CA  . LYS A 1 323 ? -111.811 116.756 -58.382 1.00 0.00 ? 318 LYS A CA  1 
ATOM 2579  C C   . LYS A 1 323 ? -112.083 116.893 -56.936 1.00 0.00 ? 318 LYS A C   1 
ATOM 2580  O O   . LYS A 1 323 ? -111.196 117.139 -56.091 1.00 0.00 ? 318 LYS A O   1 
ATOM 2581  C CB  . LYS A 1 323 ? -110.883 115.461 -58.611 1.00 0.00 ? 318 LYS A CB  1 
ATOM 2582  C CG  . LYS A 1 323 ? -110.587 114.962 -60.024 1.00 0.00 ? 318 LYS A CG  1 
ATOM 2583  C CD  . LYS A 1 323 ? -109.328 114.131 -60.221 1.00 0.00 ? 318 LYS A CD  1 
ATOM 2584  C CE  . LYS A 1 323 ? -109.411 112.639 -59.755 1.00 0.00 ? 318 LYS A CE  1 
ATOM 2585  N NZ  . LYS A 1 323 ? -108.130 111.946 -60.140 1.00 0.00 ? 318 LYS A NZ  1 
ATOM 2586  N N   . LEU A 1 324 ? -113.342 116.900 -56.654 1.00 0.00 ? 319 LEU A N   1 
ATOM 2587  C CA  . LEU A 1 324 ? -113.698 116.947 -55.254 1.00 0.00 ? 319 LEU A CA  1 
ATOM 2588  C C   . LEU A 1 324 ? -113.715 115.421 -54.859 1.00 0.00 ? 319 LEU A C   1 
ATOM 2589  O O   . LEU A 1 324 ? -114.605 114.635 -55.256 1.00 0.00 ? 319 LEU A O   1 
ATOM 2590  C CB  . LEU A 1 324 ? -115.032 117.614 -54.989 1.00 0.00 ? 319 LEU A CB  1 
ATOM 2591  C CG  . LEU A 1 324 ? -115.497 117.730 -53.522 1.00 0.00 ? 319 LEU A CG  1 
ATOM 2592  C CD1 . LEU A 1 324 ? -114.354 118.085 -52.500 1.00 0.00 ? 319 LEU A CD1 1 
ATOM 2593  C CD2 . LEU A 1 324 ? -116.658 118.735 -53.317 1.00 0.00 ? 319 LEU A CD2 1 
ATOM 2594  N N   . CYS A 1 325 ? -112.681 114.988 -54.138 1.00 0.00 ? 320 CYS A N   1 
ATOM 2595  C CA  . CYS A 1 325 ? -112.492 113.581 -53.835 1.00 0.00 ? 320 CYS A CA  1 
ATOM 2596  C C   . CYS A 1 325 ? -113.693 113.036 -53.091 1.00 0.00 ? 320 CYS A C   1 
ATOM 2597  O O   . CYS A 1 325 ? -114.145 113.683 -52.114 1.00 0.00 ? 320 CYS A O   1 
ATOM 2598  C CB  . CYS A 1 325 ? -111.234 113.438 -53.039 1.00 0.00 ? 320 CYS A CB  1 
ATOM 2599  S SG  . CYS A 1 325 ? -109.774 114.352 -53.823 1.00 0.00 ? 320 CYS A SG  1 
ATOM 2600  N N   . PRO A 1 326 ? -114.299 111.854 -53.328 1.00 0.00 ? 321 PRO A N   1 
ATOM 2601  C CA  . PRO A 1 326 ? -115.223 111.212 -52.475 1.00 0.00 ? 321 PRO A CA  1 
ATOM 2602  C C   . PRO A 1 326 ? -114.470 110.378 -51.505 1.00 0.00 ? 321 PRO A C   1 
ATOM 2603  O O   . PRO A 1 326 ? -114.888 110.145 -50.377 1.00 0.00 ? 321 PRO A O   1 
ATOM 2604  C CB  . PRO A 1 326 ? -116.231 110.558 -53.391 1.00 0.00 ? 321 PRO A CB  1 
ATOM 2605  C CG  . PRO A 1 326 ? -115.527 110.282 -54.661 1.00 0.00 ? 321 PRO A CG  1 
ATOM 2606  C CD  . PRO A 1 326 ? -114.574 111.485 -54.751 1.00 0.00 ? 321 PRO A CD  1 
ATOM 2607  N N   . ASP A 1 327 ? -113.335 109.794 -52.014 1.00 0.00 ? 322 ASP A N   1 
ATOM 2608  C CA  . ASP A 1 327 ? -112.492 108.895 -51.205 1.00 0.00 ? 322 ASP A CA  1 
ATOM 2609  C C   . ASP A 1 327 ? -111.110 109.512 -51.146 1.00 0.00 ? 322 ASP A C   1 
ATOM 2610  O O   . ASP A 1 327 ? -110.451 109.789 -52.148 1.00 0.00 ? 322 ASP A O   1 
ATOM 2611  C CB  . ASP A 1 327 ? -112.282 107.601 -51.911 1.00 0.00 ? 322 ASP A CB  1 
ATOM 2612  C CG  . ASP A 1 327 ? -113.555 106.763 -51.986 1.00 0.00 ? 322 ASP A CG  1 
ATOM 2613  O OD1 . ASP A 1 327 ? -114.275 106.604 -50.945 1.00 0.00 ? 322 ASP A OD1 1 
ATOM 2614  O OD2 . ASP A 1 327 ? -113.829 106.242 -53.123 1.00 0.00 ? 322 ASP A OD2 1 
ATOM 2615  N N   . SER A 1 328 ? -110.690 109.823 -49.892 1.00 0.00 ? 323 SER A N   1 
ATOM 2616  C CA  . SER A 1 328 ? -109.484 110.541 -49.511 1.00 0.00 ? 323 SER A CA  1 
ATOM 2617  C C   . SER A 1 328 ? -109.209 110.063 -48.082 1.00 0.00 ? 323 SER A C   1 
ATOM 2618  O O   . SER A 1 328 ? -110.147 109.757 -47.262 1.00 0.00 ? 323 SER A O   1 
ATOM 2619  C CB  . SER A 1 328 ? -109.493 112.031 -49.709 1.00 0.00 ? 323 SER A CB  1 
ATOM 2620  O OG  . SER A 1 328 ? -110.516 112.673 -48.918 1.00 0.00 ? 323 SER A OG  1 
ATOM 2621  N N   . GLU A 1 329 ? -107.980 109.859 -47.746 1.00 0.00 ? 324 GLU A N   1 
ATOM 2622  C CA  . GLU A 1 329 ? -107.518 109.408 -46.391 1.00 0.00 ? 324 GLU A CA  1 
ATOM 2623  C C   . GLU A 1 329 ? -108.003 110.371 -45.288 1.00 0.00 ? 324 GLU A C   1 
ATOM 2624  O O   . GLU A 1 329 ? -108.525 110.098 -44.195 1.00 0.00 ? 324 GLU A O   1 
ATOM 2625  C CB  . GLU A 1 329 ? -105.940 109.321 -46.519 1.00 0.00 ? 324 GLU A CB  1 
ATOM 2626  C CG  . GLU A 1 329 ? -105.388 108.219 -47.527 1.00 0.00 ? 324 GLU A CG  1 
ATOM 2627  C CD  . GLU A 1 329 ? -104.048 108.673 -48.050 1.00 0.00 ? 324 GLU A CD  1 
ATOM 2628  O OE1 . GLU A 1 329 ? -103.120 108.943 -47.269 1.00 0.00 ? 324 GLU A OE1 1 
ATOM 2629  O OE2 . GLU A 1 329 ? -103.859 108.819 -49.273 1.00 0.00 ? 324 GLU A OE2 1 
ATOM 2630  N N   . ARG A 1 330 ? -107.865 111.666 -45.586 1.00 0.00 ? 325 ARG A N   1 
ATOM 2631  C CA  . ARG A 1 330 ? -108.273 112.718 -44.756 1.00 0.00 ? 325 ARG A CA  1 
ATOM 2632  C C   . ARG A 1 330 ? -109.613 113.474 -45.226 1.00 0.00 ? 325 ARG A C   1 
ATOM 2633  O O   . ARG A 1 330 ? -109.804 113.593 -46.430 1.00 0.00 ? 325 ARG A O   1 
ATOM 2634  C CB  . ARG A 1 330 ? -107.104 113.729 -44.665 1.00 0.00 ? 325 ARG A CB  1 
ATOM 2635  C CG  . ARG A 1 330 ? -105.898 113.266 -43.864 1.00 0.00 ? 325 ARG A CG  1 
ATOM 2636  C CD  . ARG A 1 330 ? -104.719 114.198 -44.153 1.00 0.00 ? 325 ARG A CD  1 
ATOM 2637  N NE  . ARG A 1 330 ? -103.589 113.981 -43.193 1.00 0.00 ? 325 ARG A NE  1 
ATOM 2638  C CZ  . ARG A 1 330 ? -102.676 114.892 -42.826 1.00 0.00 ? 325 ARG A CZ  1 
ATOM 2639  N NH1 . ARG A 1 330 ? -102.680 116.105 -43.334 1.00 0.00 ? 325 ARG A NH1 1 
ATOM 2640  N NH2 . ARG A 1 330 ? -101.731 114.556 -41.889 1.00 0.00 ? 325 ARG A NH2 1 
ATOM 2641  N N   . ARG A 1 331 ? -110.416 113.945 -44.265 1.00 0.00 ? 326 ARG A N   1 
ATOM 2642  C CA  . ARG A 1 331 ? -111.420 114.932 -44.562 1.00 0.00 ? 326 ARG A CA  1 
ATOM 2643  C C   . ARG A 1 331 ? -110.915 116.274 -45.212 1.00 0.00 ? 326 ARG A C   1 
ATOM 2644  O O   . ARG A 1 331 ? -109.771 116.770 -45.010 1.00 0.00 ? 326 ARG A O   1 
ATOM 2645  C CB  . ARG A 1 331 ? -112.302 115.149 -43.267 1.00 0.00 ? 326 ARG A CB  1 
ATOM 2646  C CG  . ARG A 1 331 ? -111.655 116.161 -42.247 1.00 0.00 ? 326 ARG A CG  1 
ATOM 2647  C CD  . ARG A 1 331 ? -112.461 116.534 -41.025 1.00 0.00 ? 326 ARG A CD  1 
ATOM 2648  N NE  . ARG A 1 331 ? -111.517 117.277 -40.034 1.00 0.00 ? 326 ARG A NE  1 
ATOM 2649  C CZ  . ARG A 1 331 ? -111.852 118.101 -39.048 1.00 0.00 ? 326 ARG A CZ  1 
ATOM 2650  N NH1 . ARG A 1 331 ? -113.092 118.339 -38.652 1.00 0.00 ? 326 ARG A NH1 1 
ATOM 2651  N NH2 . ARG A 1 331 ? -110.813 118.823 -38.558 1.00 0.00 ? 326 ARG A NH2 1 
ATOM 2652  N N   . PHE A 1 332 ? -111.801 116.815 -46.077 1.00 0.00 ? 327 PHE A N   1 
ATOM 2653  C CA  . PHE A 1 332 ? -111.575 118.162 -46.664 1.00 0.00 ? 327 PHE A CA  1 
ATOM 2654  C C   . PHE A 1 332 ? -110.347 118.168 -47.595 1.00 0.00 ? 327 PHE A C   1 
ATOM 2655  O O   . PHE A 1 332 ? -109.569 119.106 -47.625 1.00 0.00 ? 327 PHE A O   1 
ATOM 2656  C CB  . PHE A 1 332 ? -111.538 119.347 -45.585 1.00 0.00 ? 327 PHE A CB  1 
ATOM 2657  C CG  . PHE A 1 332 ? -112.703 119.260 -44.631 1.00 0.00 ? 327 PHE A CG  1 
ATOM 2658  C CD1 . PHE A 1 332 ? -113.997 119.038 -45.115 1.00 0.00 ? 327 PHE A CD1 1 
ATOM 2659  C CD2 . PHE A 1 332 ? -112.525 119.431 -43.172 1.00 0.00 ? 327 PHE A CD2 1 
ATOM 2660  C CE1 . PHE A 1 332 ? -115.116 119.088 -44.247 1.00 0.00 ? 327 PHE A CE1 1 
ATOM 2661  C CE2 . PHE A 1 332 ? -113.606 119.521 -42.338 1.00 0.00 ? 327 PHE A CE2 1 
ATOM 2662  C CZ  . PHE A 1 332 ? -114.903 119.292 -42.893 1.00 0.00 ? 327 PHE A CZ  1 
ATOM 2663  N N   . CYS A 1 333 ? -110.339 117.228 -48.497 1.00 0.00 ? 328 CYS A N   1 
ATOM 2664  C CA  . CYS A 1 333 ? -109.258 117.136 -49.462 1.00 0.00 ? 328 CYS A CA  1 
ATOM 2665  C C   . CYS A 1 333 ? -109.778 117.252 -50.894 1.00 0.00 ? 328 CYS A C   1 
ATOM 2666  O O   . CYS A 1 333 ? -110.894 116.840 -51.235 1.00 0.00 ? 328 CYS A O   1 
ATOM 2667  C CB  . CYS A 1 333 ? -108.467 115.763 -49.281 1.00 0.00 ? 328 CYS A CB  1 
ATOM 2668  S SG  . CYS A 1 333 ? -107.578 115.677 -47.657 1.00 0.00 ? 328 CYS A SG  1 
ATOM 2669  N N   . PHE A 1 334 ? -109.013 117.939 -51.808 1.00 0.00 ? 329 PHE A N   1 
ATOM 2670  C CA  . PHE A 1 334 ? -109.434 118.027 -53.212 1.00 0.00 ? 329 PHE A CA  1 
ATOM 2671  C C   . PHE A 1 334 ? -108.186 117.901 -54.121 1.00 0.00 ? 329 PHE A C   1 
ATOM 2672  O O   . PHE A 1 334 ? -107.031 117.971 -53.680 1.00 0.00 ? 329 PHE A O   1 
ATOM 2673  C CB  . PHE A 1 334 ? -110.279 119.331 -53.478 1.00 0.00 ? 329 PHE A CB  1 
ATOM 2674  C CG  . PHE A 1 334 ? -109.521 120.641 -53.124 1.00 0.00 ? 329 PHE A CG  1 
ATOM 2675  C CD1 . PHE A 1 334 ? -109.289 121.021 -51.776 1.00 0.00 ? 329 PHE A CD1 1 
ATOM 2676  C CD2 . PHE A 1 334 ? -109.164 121.529 -54.183 1.00 0.00 ? 329 PHE A CD2 1 
ATOM 2677  C CE1 . PHE A 1 334 ? -108.657 122.225 -51.501 1.00 0.00 ? 329 PHE A CE1 1 
ATOM 2678  C CE2 . PHE A 1 334 ? -108.527 122.755 -53.920 1.00 0.00 ? 329 PHE A CE2 1 
ATOM 2679  C CZ  . PHE A 1 334 ? -108.267 123.047 -52.626 1.00 0.00 ? 329 PHE A CZ  1 
ATOM 2680  N N   . GLU A 1 335 ? -108.447 117.612 -55.397 1.00 0.00 ? 330 GLU A N   1 
ATOM 2681  C CA  . GLU A 1 335 ? -107.310 117.185 -56.193 1.00 0.00 ? 330 GLU A CA  1 
ATOM 2682  C C   . GLU A 1 335 ? -107.313 117.995 -57.487 1.00 0.00 ? 330 GLU A C   1 
ATOM 2683  O O   . GLU A 1 335 ? -108.357 118.404 -57.979 1.00 0.00 ? 330 GLU A O   1 
ATOM 2684  C CB  . GLU A 1 335 ? -107.474 115.638 -56.448 1.00 0.00 ? 330 GLU A CB  1 
ATOM 2685  C CG  . GLU A 1 335 ? -106.308 114.989 -57.257 1.00 0.00 ? 330 GLU A CG  1 
ATOM 2686  C CD  . GLU A 1 335 ? -106.132 113.492 -57.385 1.00 0.00 ? 330 GLU A CD  1 
ATOM 2687  O OE1 . GLU A 1 335 ? -105.667 112.985 -56.352 1.00 0.00 ? 330 GLU A OE1 1 
ATOM 2688  O OE2 . GLU A 1 335 ? -106.523 112.811 -58.366 1.00 0.00 ? 330 GLU A OE2 1 
ATOM 2689  N N   . VAL A 1 336 ? -106.220 118.392 -58.066 1.00 0.00 ? 331 VAL A N   1 
ATOM 2690  C CA  . VAL A 1 336 ? -106.082 119.337 -59.133 1.00 0.00 ? 331 VAL A CA  1 
ATOM 2691  C C   . VAL A 1 336 ? -105.142 118.757 -60.178 1.00 0.00 ? 331 VAL A C   1 
ATOM 2692  O O   . VAL A 1 336 ? -103.972 118.447 -59.943 1.00 0.00 ? 331 VAL A O   1 
ATOM 2693  C CB  . VAL A 1 336 ? -105.544 120.680 -58.540 1.00 0.00 ? 331 VAL A CB  1 
ATOM 2694  C CG1 . VAL A 1 336 ? -105.552 121.747 -59.634 1.00 0.00 ? 331 VAL A CG1 1 
ATOM 2695  C CG2 . VAL A 1 336 ? -106.390 121.170 -57.359 1.00 0.00 ? 331 VAL A CG2 1 
ATOM 2696  N N   . VAL A 1 337 ? -105.783 118.426 -61.352 1.00 0.00 ? 332 VAL A N   1 
ATOM 2697  C CA  . VAL A 1 337 ? -105.223 117.658 -62.417 1.00 0.00 ? 332 VAL A CA  1 
ATOM 2698  C C   . VAL A 1 337 ? -105.008 118.301 -63.816 1.00 0.00 ? 332 VAL A C   1 
ATOM 2699  O O   . VAL A 1 337 ? -105.822 119.030 -64.284 1.00 0.00 ? 332 VAL A O   1 
ATOM 2700  C CB  . VAL A 1 337 ? -105.809 116.178 -62.545 1.00 0.00 ? 332 VAL A CB  1 
ATOM 2701  C CG1 . VAL A 1 337 ? -105.728 115.436 -61.169 1.00 0.00 ? 332 VAL A CG1 1 
ATOM 2702  C CG2 . VAL A 1 337 ? -107.237 116.244 -63.046 1.00 0.00 ? 332 VAL A CG2 1 
ATOM 2703  N N   . SER A 1 338 ? -103.817 118.108 -64.405 1.00 0.00 ? 333 SER A N   1 
ATOM 2704  C CA  . SER A 1 338 ? -103.293 118.997 -65.561 1.00 0.00 ? 333 SER A CA  1 
ATOM 2705  C C   . SER A 1 338 ? -102.294 118.128 -66.300 1.00 0.00 ? 333 SER A C   1 
ATOM 2706  O O   . SER A 1 338 ? -102.293 116.920 -66.016 1.00 0.00 ? 333 SER A O   1 
ATOM 2707  C CB  . SER A 1 338 ? -102.646 120.300 -65.010 1.00 0.00 ? 333 SER A CB  1 
ATOM 2708  O OG  . SER A 1 338 ? -102.453 121.428 -65.905 1.00 0.00 ? 333 SER A OG  1 
ATOM 2709  N N   . THR A 1 339 ? -101.714 118.732 -67.312 1.00 0.00 ? 334 THR A N   1 
ATOM 2710  C CA  . THR A 1 339 ? -100.697 118.077 -68.149 1.00 0.00 ? 334 THR A CA  1 
ATOM 2711  C C   . THR A 1 339 ? -99.425  117.625 -67.411 1.00 0.00 ? 334 THR A C   1 
ATOM 2712  O O   . THR A 1 339 ? -98.942  116.558 -67.773 1.00 0.00 ? 334 THR A O   1 
ATOM 2713  C CB  . THR A 1 339 ? -100.316 118.832 -69.471 1.00 0.00 ? 334 THR A CB  1 
ATOM 2714  O OG1 . THR A 1 339 ? -100.196 120.291 -69.288 1.00 0.00 ? 334 THR A OG1 1 
ATOM 2715  C CG2 . THR A 1 339 ? -101.426 118.482 -70.486 1.00 0.00 ? 334 THR A CG2 1 
ATOM 2716  N N   . SER A 1 340 ? -99.017  118.378 -66.412 1.00 0.00 ? 335 SER A N   1 
ATOM 2717  C CA  . SER A 1 340 ? -97.970  117.954 -65.523 1.00 0.00 ? 335 SER A CA  1 
ATOM 2718  C C   . SER A 1 340 ? -98.074  118.901 -64.304 1.00 0.00 ? 335 SER A C   1 
ATOM 2719  O O   . SER A 1 340 ? -98.778  119.948 -64.400 1.00 0.00 ? 335 SER A O   1 
ATOM 2720  C CB  . SER A 1 340 ? -96.528  117.996 -66.169 1.00 0.00 ? 335 SER A CB  1 
ATOM 2721  O OG  . SER A 1 340 ? -95.578  117.275 -65.328 1.00 0.00 ? 335 SER A OG  1 
ATOM 2722  N N   . LYS A 1 341 ? -97.523  118.469 -63.170 1.00 0.00 ? 336 LYS A N   1 
ATOM 2723  C CA  . LYS A 1 341 ? -97.670  119.072 -61.841 1.00 0.00 ? 336 LYS A CA  1 
ATOM 2724  C C   . LYS A 1 341 ? -98.953  118.839 -61.053 1.00 0.00 ? 336 LYS A C   1 
ATOM 2725  O O   . LYS A 1 341 ? -99.286  119.511 -60.045 1.00 0.00 ? 336 LYS A O   1 
ATOM 2726  C CB  . LYS A 1 341 ? -97.413  120.577 -61.787 1.00 0.00 ? 336 LYS A CB  1 
ATOM 2727  C CG  . LYS A 1 341 ? -96.049  121.023 -62.319 1.00 0.00 ? 336 LYS A CG  1 
ATOM 2728  C CD  . LYS A 1 341 ? -95.873  122.560 -62.456 1.00 0.00 ? 336 LYS A CD  1 
ATOM 2729  C CE  . LYS A 1 341 ? -94.456  123.101 -62.701 1.00 0.00 ? 336 LYS A CE  1 
ATOM 2730  N NZ  . LYS A 1 341 ? -94.046  122.823 -64.122 1.00 0.00 ? 336 LYS A NZ  1 
ATOM 2731  N N   . SER A 1 342 ? -99.756  117.813 -61.449 1.00 0.00 ? 337 SER A N   1 
ATOM 2732  C CA  . SER A 1 342 ? -100.987 117.413 -60.786 1.00 0.00 ? 337 SER A CA  1 
ATOM 2733  C C   . SER A 1 342 ? -100.735 117.055 -59.290 1.00 0.00 ? 337 SER A C   1 
ATOM 2734  O O   . SER A 1 342 ? -99.648  116.583 -58.913 1.00 0.00 ? 337 SER A O   1 
ATOM 2735  C CB  . SER A 1 342 ? -101.621 116.241 -61.443 1.00 0.00 ? 337 SER A CB  1 
ATOM 2736  O OG  . SER A 1 342 ? -101.719 116.519 -62.854 1.00 0.00 ? 337 SER A OG  1 
ATOM 2737  N N   . CYS A 1 343 ? -101.724 117.332 -58.458 1.00 0.00 ? 338 CYS A N   1 
ATOM 2738  C CA  . CYS A 1 343 ? -101.427 117.384 -56.980 1.00 0.00 ? 338 CYS A CA  1 
ATOM 2739  C C   . CYS A 1 343 ? -102.730 117.274 -56.146 1.00 0.00 ? 338 CYS A C   1 
ATOM 2740  O O   . CYS A 1 343 ? -103.838 117.330 -56.666 1.00 0.00 ? 338 CYS A O   1 
ATOM 2741  C CB  . CYS A 1 343 ? -100.598 118.603 -56.565 1.00 0.00 ? 338 CYS A CB  1 
ATOM 2742  S SG  . CYS A 1 343 ? -101.450 120.184 -57.232 1.00 0.00 ? 338 CYS A SG  1 
ATOM 2743  N N   . LEU A 1 344 ? -102.568 117.078 -54.829 1.00 0.00 ? 339 LEU A N   1 
ATOM 2744  C CA  . LEU A 1 344 ? -103.635 116.819 -53.882 1.00 0.00 ? 339 LEU A CA  1 
ATOM 2745  C C   . LEU A 1 344 ? -103.524 118.032 -52.918 1.00 0.00 ? 339 LEU A C   1 
ATOM 2746  O O   . LEU A 1 344 ? -102.479 118.463 -52.465 1.00 0.00 ? 339 LEU A O   1 
ATOM 2747  C CB  . LEU A 1 344 ? -103.578 115.492 -53.199 1.00 0.00 ? 339 LEU A CB  1 
ATOM 2748  C CG  . LEU A 1 344 ? -104.657 115.192 -52.000 1.00 0.00 ? 339 LEU A CG  1 
ATOM 2749  C CD1 . LEU A 1 344 ? -105.979 114.810 -52.615 1.00 0.00 ? 339 LEU A CD1 1 
ATOM 2750  C CD2 . LEU A 1 344 ? -104.036 113.985 -51.224 1.00 0.00 ? 339 LEU A CD2 1 
ATOM 2751  N N   . LEU A 1 345 ? -104.643 118.578 -52.524 1.00 0.00 ? 340 LEU A N   1 
ATOM 2752  C CA  . LEU A 1 345 ? -104.751 119.724 -51.605 1.00 0.00 ? 340 LEU A CA  1 
ATOM 2753  C C   . LEU A 1 345 ? -105.725 119.430 -50.364 1.00 0.00 ? 340 LEU A C   1 
ATOM 2754  O O   . LEU A 1 345 ? -106.670 118.634 -50.462 1.00 0.00 ? 340 LEU A O   1 
ATOM 2755  C CB  . LEU A 1 345 ? -105.100 121.117 -52.275 1.00 0.00 ? 340 LEU A CB  1 
ATOM 2756  C CG  . LEU A 1 345 ? -104.252 121.393 -53.525 1.00 0.00 ? 340 LEU A CG  1 
ATOM 2757  C CD1 . LEU A 1 345 ? -105.023 122.397 -54.465 1.00 0.00 ? 340 LEU A CD1 1 
ATOM 2758  C CD2 . LEU A 1 345 ? -102.857 122.048 -53.288 1.00 0.00 ? 340 LEU A CD2 1 
ATOM 2759  N N   . GLN A 1 346 ? -105.551 120.036 -49.213 1.00 0.00 ? 341 GLN A N   1 
ATOM 2760  C CA  . GLN A 1 346 ? -106.463 119.999 -48.056 1.00 0.00 ? 341 GLN A CA  1 
ATOM 2761  C C   . GLN A 1 346 ? -106.601 121.338 -47.397 1.00 0.00 ? 341 GLN A C   1 
ATOM 2762  O O   . GLN A 1 346 ? -105.671 122.144 -47.218 1.00 0.00 ? 341 GLN A O   1 
ATOM 2763  C CB  . GLN A 1 346 ? -105.934 118.943 -47.051 1.00 0.00 ? 341 GLN A CB  1 
ATOM 2764  C CG  . GLN A 1 346 ? -106.535 119.105 -45.652 1.00 0.00 ? 341 GLN A CG  1 
ATOM 2765  C CD  . GLN A 1 346 ? -106.081 117.899 -44.838 1.00 0.00 ? 341 GLN A CD  1 
ATOM 2766  O OE1 . GLN A 1 346 ? -104.852 117.547 -44.712 1.00 0.00 ? 341 GLN A OE1 1 
ATOM 2767  N NE2 . GLN A 1 346 ? -107.139 117.166 -44.334 1.00 0.00 ? 341 GLN A NE2 1 
ATOM 2768  N N   . ALA A 1 347 ? -107.823 121.718 -47.006 1.00 0.00 ? 342 ALA A N   1 
ATOM 2769  C CA  . ALA A 1 347 ? -108.179 122.929 -46.421 1.00 0.00 ? 342 ALA A CA  1 
ATOM 2770  C C   . ALA A 1 347 ? -108.638 122.652 -44.984 1.00 0.00 ? 342 ALA A C   1 
ATOM 2771  O O   . ALA A 1 347 ? -109.098 121.620 -44.604 1.00 0.00 ? 342 ALA A O   1 
ATOM 2772  C CB  . ALA A 1 347 ? -109.452 123.510 -47.164 1.00 0.00 ? 342 ALA A CB  1 
ATOM 2773  N N   . ASP A 1 348 ? -108.623 123.752 -44.213 1.00 0.00 ? 343 ASP A N   1 
ATOM 2774  C CA  . ASP A 1 348 ? -108.727 123.716 -42.676 1.00 0.00 ? 343 ASP A CA  1 
ATOM 2775  C C   . ASP A 1 348 ? -110.140 123.584 -42.065 1.00 0.00 ? 343 ASP A C   1 
ATOM 2776  O O   . ASP A 1 348 ? -110.401 123.251 -40.911 1.00 0.00 ? 343 ASP A O   1 
ATOM 2777  C CB  . ASP A 1 348 ? -108.036 124.914 -41.947 1.00 0.00 ? 343 ASP A CB  1 
ATOM 2778  C CG  . ASP A 1 348 ? -106.593 125.089 -42.369 1.00 0.00 ? 343 ASP A CG  1 
ATOM 2779  O OD1 . ASP A 1 348 ? -105.773 124.105 -42.336 1.00 0.00 ? 343 ASP A OD1 1 
ATOM 2780  O OD2 . ASP A 1 348 ? -106.256 126.140 -42.905 1.00 0.00 ? 343 ASP A OD2 1 
ATOM 2781  N N   . SER A 1 349 ? -111.234 123.798 -42.839 1.00 0.00 ? 344 SER A N   1 
ATOM 2782  C CA  . SER A 1 349 ? -112.553 123.792 -42.273 1.00 0.00 ? 344 SER A CA  1 
ATOM 2783  C C   . SER A 1 349 ? -113.496 123.799 -43.465 1.00 0.00 ? 344 SER A C   1 
ATOM 2784  O O   . SER A 1 349 ? -113.105 124.090 -44.601 1.00 0.00 ? 344 SER A O   1 
ATOM 2785  C CB  . SER A 1 349 ? -112.889 125.092 -41.502 1.00 0.00 ? 344 SER A CB  1 
ATOM 2786  O OG  . SER A 1 349 ? -114.210 125.122 -40.908 1.00 0.00 ? 344 SER A OG  1 
ATOM 2787  N N   . GLU A 1 350 ? -114.782 123.512 -43.253 1.00 0.00 ? 345 GLU A N   1 
ATOM 2788  C CA  . GLU A 1 350 ? -115.849 123.206 -44.180 1.00 0.00 ? 345 GLU A CA  1 
ATOM 2789  C C   . GLU A 1 350 ? -116.080 124.322 -45.181 1.00 0.00 ? 345 GLU A C   1 
ATOM 2790  O O   . GLU A 1 350 ? -116.364 124.070 -46.364 1.00 0.00 ? 345 GLU A O   1 
ATOM 2791  C CB  . GLU A 1 350 ? -117.115 123.016 -43.256 1.00 0.00 ? 345 GLU A CB  1 
ATOM 2792  C CG  . GLU A 1 350 ? -118.389 122.318 -43.926 1.00 0.00 ? 345 GLU A CG  1 
ATOM 2793  C CD  . GLU A 1 350 ? -119.509 121.999 -42.949 1.00 0.00 ? 345 GLU A CD  1 
ATOM 2794  O OE1 . GLU A 1 350 ? -119.894 122.845 -42.060 1.00 0.00 ? 345 GLU A OE1 1 
ATOM 2795  O OE2 . GLU A 1 350 ? -120.165 120.954 -43.180 1.00 0.00 ? 345 GLU A OE2 1 
ATOM 2796  N N   . ARG A 1 351 ? -116.016 125.635 -44.803 1.00 0.00 ? 346 ARG A N   1 
ATOM 2797  C CA  . ARG A 1 351 ? -116.271 126.737 -45.692 1.00 0.00 ? 346 ARG A CA  1 
ATOM 2798  C C   . ARG A 1 351 ? -114.991 127.108 -46.501 1.00 0.00 ? 346 ARG A C   1 
ATOM 2799  O O   . ARG A 1 351 ? -115.117 127.381 -47.678 1.00 0.00 ? 346 ARG A O   1 
ATOM 2800  C CB  . ARG A 1 351 ? -116.719 127.989 -44.888 1.00 0.00 ? 346 ARG A CB  1 
ATOM 2801  C CG  . ARG A 1 351 ? -116.921 129.288 -45.694 1.00 0.00 ? 346 ARG A CG  1 
ATOM 2802  C CD  . ARG A 1 351 ? -117.740 129.263 -46.974 1.00 0.00 ? 346 ARG A CD  1 
ATOM 2803  N NE  . ARG A 1 351 ? -117.521 130.624 -47.613 1.00 0.00 ? 346 ARG A NE  1 
ATOM 2804  C CZ  . ARG A 1 351 ? -117.937 131.126 -48.802 1.00 0.00 ? 346 ARG A CZ  1 
ATOM 2805  N NH1 . ARG A 1 351 ? -118.502 130.352 -49.722 1.00 0.00 ? 346 ARG A NH1 1 
ATOM 2806  N NH2 . ARG A 1 351 ? -117.896 132.466 -49.043 1.00 0.00 ? 346 ARG A NH2 1 
ATOM 2807  N N   . LEU A 1 352 ? -113.798 126.953 -45.946 1.00 0.00 ? 347 LEU A N   1 
ATOM 2808  C CA  . LEU A 1 352 ? -112.617 127.086 -46.696 1.00 0.00 ? 347 LEU A CA  1 
ATOM 2809  C C   . LEU A 1 352 ? -112.425 126.018 -47.765 1.00 0.00 ? 347 LEU A C   1 
ATOM 2810  O O   . LEU A 1 352 ? -112.161 126.420 -48.898 1.00 0.00 ? 347 LEU A O   1 
ATOM 2811  C CB  . LEU A 1 352 ? -111.390 127.141 -45.754 1.00 0.00 ? 347 LEU A CB  1 
ATOM 2812  C CG  . LEU A 1 352 ? -111.243 128.581 -45.130 1.00 0.00 ? 347 LEU A CG  1 
ATOM 2813  C CD1 . LEU A 1 352 ? -111.893 128.928 -43.761 1.00 0.00 ? 347 LEU A CD1 1 
ATOM 2814  C CD2 . LEU A 1 352 ? -109.739 128.938 -44.935 1.00 0.00 ? 347 LEU A CD2 1 
ATOM 2815  N N   . LEU A 1 353 ? -112.666 124.736 -47.524 1.00 0.00 ? 348 LEU A N   1 
ATOM 2816  C CA  . LEU A 1 353 ? -112.756 123.768 -48.558 1.00 0.00 ? 348 LEU A CA  1 
ATOM 2817  C C   . LEU A 1 353 ? -113.751 124.071 -49.677 1.00 0.00 ? 348 LEU A C   1 
ATOM 2818  O O   . LEU A 1 353 ? -113.361 124.040 -50.822 1.00 0.00 ? 348 LEU A O   1 
ATOM 2819  C CB  . LEU A 1 353 ? -113.270 122.489 -47.824 1.00 0.00 ? 348 LEU A CB  1 
ATOM 2820  C CG  . LEU A 1 353 ? -113.290 121.118 -48.538 1.00 0.00 ? 348 LEU A CG  1 
ATOM 2821  C CD1 . LEU A 1 353 ? -114.390 121.044 -49.593 1.00 0.00 ? 348 LEU A CD1 1 
ATOM 2822  C CD2 . LEU A 1 353 ? -111.964 120.615 -49.142 1.00 0.00 ? 348 LEU A CD2 1 
ATOM 2823  N N   . GLN A 1 354 ? -114.980 124.454 -49.383 1.00 0.00 ? 349 GLN A N   1 
ATOM 2824  C CA  . GLN A 1 354 ? -115.991 124.694 -50.326 1.00 0.00 ? 349 GLN A CA  1 
ATOM 2825  C C   . GLN A 1 354 ? -115.608 125.855 -51.231 1.00 0.00 ? 349 GLN A C   1 
ATOM 2826  O O   . GLN A 1 354 ? -115.712 125.781 -52.437 1.00 0.00 ? 349 GLN A O   1 
ATOM 2827  C CB  . GLN A 1 354 ? -117.250 125.076 -49.481 1.00 0.00 ? 349 GLN A CB  1 
ATOM 2828  C CG  . GLN A 1 354 ? -118.448 125.238 -50.400 1.00 0.00 ? 349 GLN A CG  1 
ATOM 2829  C CD  . GLN A 1 354 ? -119.392 126.330 -49.892 1.00 0.00 ? 349 GLN A CD  1 
ATOM 2830  O OE1 . GLN A 1 354 ? -118.978 127.480 -49.760 1.00 0.00 ? 349 GLN A OE1 1 
ATOM 2831  N NE2 . GLN A 1 354 ? -120.676 125.917 -49.542 1.00 0.00 ? 349 GLN A NE2 1 
ATOM 2832  N N   . LEU A 1 355 ? -115.100 126.955 -50.598 1.00 0.00 ? 350 LEU A N   1 
ATOM 2833  C CA  . LEU A 1 355 ? -114.707 128.138 -51.297 1.00 0.00 ? 350 LEU A CA  1 
ATOM 2834  C C   . LEU A 1 355 ? -113.490 127.938 -52.127 1.00 0.00 ? 350 LEU A C   1 
ATOM 2835  O O   . LEU A 1 355 ? -113.493 128.294 -53.289 1.00 0.00 ? 350 LEU A O   1 
ATOM 2836  C CB  . LEU A 1 355 ? -114.434 129.250 -50.193 1.00 0.00 ? 350 LEU A CB  1 
ATOM 2837  C CG  . LEU A 1 355 ? -113.821 130.644 -50.458 1.00 0.00 ? 350 LEU A CG  1 
ATOM 2838  C CD1 . LEU A 1 355 ? -114.577 131.382 -51.580 1.00 0.00 ? 350 LEU A CD1 1 
ATOM 2839  C CD2 . LEU A 1 355 ? -113.945 131.469 -49.183 1.00 0.00 ? 350 LEU A CD2 1 
ATOM 2840  N N   . TRP A 1 356 ? -112.431 127.285 -51.559 1.00 0.00 ? 351 TRP A N   1 
ATOM 2841  C CA  . TRP A 1 356 ? -111.218 127.106 -52.252 1.00 0.00 ? 351 TRP A CA  1 
ATOM 2842  C C   . TRP A 1 356 ? -111.432 126.334 -53.535 1.00 0.00 ? 351 TRP A C   1 
ATOM 2843  O O   . TRP A 1 356 ? -111.188 126.836 -54.673 1.00 0.00 ? 351 TRP A O   1 
ATOM 2844  C CB  . TRP A 1 356 ? -110.107 126.350 -51.402 1.00 0.00 ? 351 TRP A CB  1 
ATOM 2845  C CG  . TRP A 1 356 ? -109.178 127.379 -50.739 1.00 0.00 ? 351 TRP A CG  1 
ATOM 2846  C CD1 . TRP A 1 356 ? -109.312 128.020 -49.553 1.00 0.00 ? 351 TRP A CD1 1 
ATOM 2847  C CD2 . TRP A 1 356 ? -108.050 127.929 -51.403 1.00 0.00 ? 351 TRP A CD2 1 
ATOM 2848  N NE1 . TRP A 1 356 ? -108.245 128.897 -49.372 1.00 0.00 ? 351 TRP A NE1 1 
ATOM 2849  C CE2 . TRP A 1 356 ? -107.481 128.878 -50.517 1.00 0.00 ? 351 TRP A CE2 1 
ATOM 2850  C CE3 . TRP A 1 356 ? -107.721 127.898 -52.753 1.00 0.00 ? 351 TRP A CE3 1 
ATOM 2851  C CZ2 . TRP A 1 356 ? -106.427 129.698 -50.922 1.00 0.00 ? 351 TRP A CZ2 1 
ATOM 2852  C CZ3 . TRP A 1 356 ? -106.592 128.656 -53.129 1.00 0.00 ? 351 TRP A CZ3 1 
ATOM 2853  C CH2 . TRP A 1 356 ? -105.968 129.516 -52.225 1.00 0.00 ? 351 TRP A CH2 1 
ATOM 2854  N N   . VAL A 1 357 ? -112.172 125.142 -53.484 1.00 0.00 ? 352 VAL A N   1 
ATOM 2855  C CA  . VAL A 1 357 ? -112.599 124.369 -54.665 1.00 0.00 ? 352 VAL A CA  1 
ATOM 2856  C C   . VAL A 1 357 ? -113.495 125.251 -55.580 1.00 0.00 ? 352 VAL A C   1 
ATOM 2857  O O   . VAL A 1 357 ? -113.303 125.251 -56.818 1.00 0.00 ? 352 VAL A O   1 
ATOM 2858  C CB  . VAL A 1 357 ? -113.474 123.141 -54.155 1.00 0.00 ? 352 VAL A CB  1 
ATOM 2859  C CG1 . VAL A 1 357 ? -114.016 122.443 -55.393 1.00 0.00 ? 352 VAL A CG1 1 
ATOM 2860  C CG2 . VAL A 1 357 ? -112.503 122.148 -53.466 1.00 0.00 ? 352 VAL A CG2 1 
ATOM 2861  N N   . SER A 1 358 ? -114.393 126.137 -55.029 1.00 0.00 ? 353 SER A N   1 
ATOM 2862  C CA  . SER A 1 358 ? -115.221 126.955 -55.888 1.00 0.00 ? 353 SER A CA  1 
ATOM 2863  C C   . SER A 1 358 ? -114.480 127.974 -56.703 1.00 0.00 ? 353 SER A C   1 
ATOM 2864  O O   . SER A 1 358 ? -114.631 128.088 -57.939 1.00 0.00 ? 353 SER A O   1 
ATOM 2865  C CB  . SER A 1 358 ? -116.383 127.739 -55.109 1.00 0.00 ? 353 SER A CB  1 
ATOM 2866  O OG  . SER A 1 358 ? -117.440 126.771 -54.840 1.00 0.00 ? 353 SER A OG  1 
ATOM 2867  N N   . ALA A 1 359 ? -113.558 128.739 -55.964 1.00 0.00 ? 354 ALA A N   1 
ATOM 2868  C CA  . ALA A 1 359 ? -112.731 129.779 -56.496 1.00 0.00 ? 354 ALA A CA  1 
ATOM 2869  C C   . ALA A 1 359 ? -111.767 129.229 -57.508 1.00 0.00 ? 354 ALA A C   1 
ATOM 2870  O O   . ALA A 1 359 ? -111.570 129.770 -58.612 1.00 0.00 ? 354 ALA A O   1 
ATOM 2871  C CB  . ALA A 1 359 ? -112.030 130.521 -55.378 1.00 0.00 ? 354 ALA A CB  1 
ATOM 2872  N N   . VAL A 1 360 ? -111.164 128.118 -57.203 1.00 0.00 ? 355 VAL A N   1 
ATOM 2873  C CA  . VAL A 1 360 ? -110.199 127.456 -58.124 1.00 0.00 ? 355 VAL A CA  1 
ATOM 2874  C C   . VAL A 1 360 ? -110.940 126.948 -59.312 1.00 0.00 ? 355 VAL A C   1 
ATOM 2875  O O   . VAL A 1 360 ? -110.499 127.139 -60.445 1.00 0.00 ? 355 VAL A O   1 
ATOM 2876  C CB  . VAL A 1 360 ? -109.149 126.455 -57.601 1.00 0.00 ? 355 VAL A CB  1 
ATOM 2877  C CG1 . VAL A 1 360 ? -108.321 125.882 -58.752 1.00 0.00 ? 355 VAL A CG1 1 
ATOM 2878  C CG2 . VAL A 1 360 ? -108.366 127.182 -56.543 1.00 0.00 ? 355 VAL A CG2 1 
ATOM 2879  N N   . GLN A 1 361 ? -112.150 126.288 -59.190 1.00 0.00 ? 356 GLN A N   1 
ATOM 2880  C CA  . GLN A 1 361 ? -112.961 125.933 -60.351 1.00 0.00 ? 356 GLN A CA  1 
ATOM 2881  C C   . GLN A 1 361 ? -113.386 127.185 -61.143 1.00 0.00 ? 356 GLN A C   1 
ATOM 2882  O O   . GLN A 1 361 ? -113.261 127.211 -62.373 1.00 0.00 ? 356 GLN A O   1 
ATOM 2883  C CB  . GLN A 1 361 ? -114.188 125.116 -60.088 1.00 0.00 ? 356 GLN A CB  1 
ATOM 2884  C CG  . GLN A 1 361 ? -113.669 123.725 -59.579 1.00 0.00 ? 356 GLN A CG  1 
ATOM 2885  C CD  . GLN A 1 361 ? -114.875 122.714 -59.363 1.00 0.00 ? 356 GLN A CD  1 
ATOM 2886  O OE1 . GLN A 1 361 ? -115.140 121.808 -60.159 1.00 0.00 ? 356 GLN A OE1 1 
ATOM 2887  N NE2 . GLN A 1 361 ? -115.767 123.005 -58.380 1.00 0.00 ? 356 GLN A NE2 1 
ATOM 2888  N N   . SER A 1 362 ? -113.796 128.292 -60.475 1.00 0.00 ? 357 SER A N   1 
ATOM 2889  C CA  . SER A 1 362 ? -114.062 129.628 -61.103 1.00 0.00 ? 357 SER A CA  1 
ATOM 2890  C C   . SER A 1 362 ? -112.856 130.140 -61.905 1.00 0.00 ? 357 SER A C   1 
ATOM 2891  O O   . SER A 1 362 ? -112.939 130.502 -63.069 1.00 0.00 ? 357 SER A O   1 
ATOM 2892  C CB  . SER A 1 362 ? -114.578 130.677 -60.031 1.00 0.00 ? 357 SER A CB  1 
ATOM 2893  O OG  . SER A 1 362 ? -114.956 131.940 -60.670 1.00 0.00 ? 357 SER A OG  1 
ATOM 2894  N N   . SER A 1 363 ? -111.680 130.162 -61.388 1.00 0.00 ? 358 SER A N   1 
ATOM 2895  C CA  . SER A 1 363 ? -110.440 130.590 -62.092 1.00 0.00 ? 358 SER A CA  1 
ATOM 2896  C C   . SER A 1 363 ? -110.112 129.805 -63.398 1.00 0.00 ? 358 SER A C   1 
ATOM 2897  O O   . SER A 1 363 ? -109.726 130.378 -64.401 1.00 0.00 ? 358 SER A O   1 
ATOM 2898  C CB  . SER A 1 363 ? -109.217 130.387 -61.131 1.00 0.00 ? 358 SER A CB  1 
ATOM 2899  O OG  . SER A 1 363 ? -108.071 131.129 -61.575 1.00 0.00 ? 358 SER A OG  1 
ATOM 2900  N N   . ILE A 1 364 ? -110.414 128.494 -63.424 1.00 0.00 ? 359 ILE A N   1 
ATOM 2901  C CA  . ILE A 1 364 ? -110.399 127.609 -64.545 1.00 0.00 ? 359 ILE A CA  1 
ATOM 2902  C C   . ILE A 1 364 ? -111.393 128.063 -65.692 1.00 0.00 ? 359 ILE A C   1 
ATOM 2903  O O   . ILE A 1 364 ? -111.072 128.108 -66.866 1.00 0.00 ? 359 ILE A O   1 
ATOM 2904  C CB  . ILE A 1 364 ? -110.563 126.078 -64.200 1.00 0.00 ? 359 ILE A CB  1 
ATOM 2905  C CG1 . ILE A 1 364 ? -109.315 125.557 -63.421 1.00 0.00 ? 359 ILE A CG1 1 
ATOM 2906  C CG2 . ILE A 1 364 ? -110.626 125.310 -65.559 1.00 0.00 ? 359 ILE A CG2 1 
ATOM 2907  C CD1 . ILE A 1 364 ? -109.560 124.273 -62.778 1.00 0.00 ? 359 ILE A CD1 1 
ATOM 2908  N N   . ALA A 1 365 ? -112.625 128.489 -65.276 1.00 0.00 ? 360 ALA A N   1 
ATOM 2909  C CA  . ALA A 1 365 ? -113.559 129.106 -66.192 1.00 0.00 ? 360 ALA A CA  1 
ATOM 2910  C C   . ALA A 1 365 ? -112.993 130.412 -66.764 1.00 0.00 ? 360 ALA A C   1 
ATOM 2911  O O   . ALA A 1 365 ? -113.141 130.627 -67.921 1.00 0.00 ? 360 ALA A O   1 
ATOM 2912  C CB  . ALA A 1 365 ? -114.997 129.344 -65.618 1.00 0.00 ? 360 ALA A CB  1 
ATOM 2913  N N   . SER A 1 366 ? -112.409 131.298 -65.998 1.00 0.00 ? 361 SER A N   1 
ATOM 2914  C CA  . SER A 1 366 ? -111.799 132.522 -66.579 1.00 0.00 ? 361 SER A CA  1 
ATOM 2915  C C   . SER A 1 366 ? -110.771 132.288 -67.615 1.00 0.00 ? 361 SER A C   1 
ATOM 2916  O O   . SER A 1 366 ? -110.676 132.933 -68.663 1.00 0.00 ? 361 SER A O   1 
ATOM 2917  C CB  . SER A 1 366 ? -111.216 133.318 -65.393 1.00 0.00 ? 361 SER A CB  1 
ATOM 2918  O OG  . SER A 1 366 ? -112.314 133.607 -64.559 1.00 0.00 ? 361 SER A OG  1 
ATOM 2919  N N   . ALA A 1 367 ? -109.834 131.398 -67.187 1.00 0.00 ? 362 ALA A N   1 
ATOM 2920  C CA  . ALA A 1 367 ? -108.694 131.026 -67.865 1.00 0.00 ? 362 ALA A CA  1 
ATOM 2921  C C   . ALA A 1 367 ? -109.059 130.414 -69.205 1.00 0.00 ? 362 ALA A C   1 
ATOM 2922  O O   . ALA A 1 367 ? -108.457 130.680 -70.240 1.00 0.00 ? 362 ALA A O   1 
ATOM 2923  C CB  . ALA A 1 367 ? -107.882 130.183 -66.920 1.00 0.00 ? 362 ALA A CB  1 
ATOM 2924  N N   . PHE A 1 368 ? -110.137 129.566 -69.140 1.00 0.00 ? 363 PHE A N   1 
ATOM 2925  C CA  . PHE A 1 368 ? -110.703 128.782 -70.250 1.00 0.00 ? 363 PHE A CA  1 
ATOM 2926  C C   . PHE A 1 368 ? -111.534 129.612 -71.203 1.00 0.00 ? 363 PHE A C   1 
ATOM 2927  O O   . PHE A 1 368 ? -111.652 129.155 -72.346 1.00 0.00 ? 363 PHE A O   1 
ATOM 2928  C CB  . PHE A 1 368 ? -111.407 127.476 -69.785 1.00 0.00 ? 363 PHE A CB  1 
ATOM 2929  C CG  . PHE A 1 368 ? -111.807 126.643 -70.929 1.00 0.00 ? 363 PHE A CG  1 
ATOM 2930  C CD1 . PHE A 1 368 ? -110.848 125.844 -71.582 1.00 0.00 ? 363 PHE A CD1 1 
ATOM 2931  C CD2 . PHE A 1 368 ? -113.136 126.579 -71.217 1.00 0.00 ? 363 PHE A CD2 1 
ATOM 2932  C CE1 . PHE A 1 368 ? -111.270 125.021 -72.629 1.00 0.00 ? 363 PHE A CE1 1 
ATOM 2933  C CE2 . PHE A 1 368 ? -113.623 125.741 -72.238 1.00 0.00 ? 363 PHE A CE2 1 
ATOM 2934  C CZ  . PHE A 1 368 ? -112.669 124.952 -72.996 1.00 0.00 ? 363 PHE A CZ  1 
ATOM 2935  N N   . SER A 1 369 ? -111.964 130.758 -70.695 1.00 0.00 ? 364 SER A N   1 
ATOM 2936  C CA  . SER A 1 369 ? -112.682 131.779 -71.473 1.00 0.00 ? 364 SER A CA  1 
ATOM 2937  C C   . SER A 1 369 ? -111.808 132.483 -72.502 1.00 0.00 ? 364 SER A C   1 
ATOM 2938  O O   . SER A 1 369 ? -110.852 131.952 -73.141 1.00 0.00 ? 364 SER A O   1 
ATOM 2939  C CB  . SER A 1 369 ? -113.542 132.771 -70.623 1.00 0.00 ? 364 SER A CB  1 
ATOM 2940  O OG  . SER A 1 369 ? -114.496 132.072 -69.779 1.00 0.00 ? 364 SER A OG  1 
ATOM 2941  N N   . GLN A 1 370 ? -112.218 133.671 -72.717 1.00 0.00 ? 365 GLN A N   1 
ATOM 2942  N N   . SER B 1 5   ? -92.716  151.843 -44.773 1.00 0.00 ? 0   SER B N   1 
ATOM 2943  C CA  . SER B 1 5   ? -93.079  150.996 -43.577 1.00 0.00 ? 0   SER B CA  1 
ATOM 2944  C C   . SER B 1 5   ? -94.618  150.945 -43.379 1.00 0.00 ? 0   SER B C   1 
ATOM 2945  O O   . SER B 1 5   ? -95.404  151.302 -44.264 1.00 0.00 ? 0   SER B O   1 
ATOM 2946  C CB  . SER B 1 5   ? -92.473  151.498 -42.243 1.00 0.00 ? 0   SER B CB  1 
ATOM 2947  O OG  . SER B 1 5   ? -92.087  150.498 -41.358 1.00 0.00 ? 0   SER B OG  1 
ATOM 2948  N N   . MET B 1 6   ? -95.152  150.471 -42.244 1.00 0.00 ? 1   MET B N   1 
ATOM 2949  C CA  . MET B 1 6   ? -96.599  150.166 -42.067 1.00 0.00 ? 1   MET B CA  1 
ATOM 2950  C C   . MET B 1 6   ? -97.348  151.461 -41.701 1.00 0.00 ? 1   MET B C   1 
ATOM 2951  O O   . MET B 1 6   ? -96.807  152.412 -41.214 1.00 0.00 ? 1   MET B O   1 
ATOM 2952  C CB  . MET B 1 6   ? -96.872  149.119 -40.964 1.00 0.00 ? 1   MET B CB  1 
ATOM 2953  C CG  . MET B 1 6   ? -96.602  149.514 -39.497 1.00 0.00 ? 1   MET B CG  1 
ATOM 2954  S SD  . MET B 1 6   ? -94.904  149.934 -39.081 1.00 0.00 ? 1   MET B SD  1 
ATOM 2955  C CE  . MET B 1 6   ? -95.360  150.433 -37.416 1.00 0.00 ? 1   MET B CE  1 
ATOM 2956  N N   . THR B 1 7   ? -98.718  151.369 -41.800 1.00 0.00 ? 2   THR B N   1 
ATOM 2957  C CA  . THR B 1 7   ? -99.713  152.414 -41.382 1.00 0.00 ? 2   THR B CA  1 
ATOM 2958  C C   . THR B 1 7   ? -99.966  152.492 -39.836 1.00 0.00 ? 2   THR B C   1 
ATOM 2959  O O   . THR B 1 7   ? -99.888  151.544 -39.097 1.00 0.00 ? 2   THR B O   1 
ATOM 2960  C CB  . THR B 1 7   ? -101.007 152.520 -42.252 1.00 0.00 ? 2   THR B CB  1 
ATOM 2961  O OG1 . THR B 1 7   ? -101.756 151.329 -42.199 1.00 0.00 ? 2   THR B OG1 1 
ATOM 2962  C CG2 . THR B 1 7   ? -100.511 152.895 -43.628 1.00 0.00 ? 2   THR B CG2 1 
ATOM 2963  N N   . VAL B 1 8   ? -100.255 153.710 -39.355 1.00 0.00 ? 3   VAL B N   1 
ATOM 2964  C CA  . VAL B 1 8   ? -100.516 154.135 -37.980 1.00 0.00 ? 3   VAL B CA  1 
ATOM 2965  C C   . VAL B 1 8   ? -101.885 153.812 -37.498 1.00 0.00 ? 3   VAL B C   1 
ATOM 2966  O O   . VAL B 1 8   ? -102.848 153.540 -38.266 1.00 0.00 ? 3   VAL B O   1 
ATOM 2967  C CB  . VAL B 1 8   ? -100.449 155.679 -37.940 1.00 0.00 ? 3   VAL B CB  1 
ATOM 2968  C CG1 . VAL B 1 8   ? -99.033  156.185 -38.389 1.00 0.00 ? 3   VAL B CG1 1 
ATOM 2969  C CG2 . VAL B 1 8   ? -101.532 156.181 -38.895 1.00 0.00 ? 3   VAL B CG2 1 
ATOM 2970  N N   . LYS B 1 9   ? -102.016 153.762 -36.144 1.00 0.00 ? 4   LYS B N   1 
ATOM 2971  C CA  . LYS B 1 9   ? -103.271 153.437 -35.421 1.00 0.00 ? 4   LYS B CA  1 
ATOM 2972  C C   . LYS B 1 9   ? -103.906 151.977 -35.663 1.00 0.00 ? 4   LYS B C   1 
ATOM 2973  O O   . LYS B 1 9   ? -105.078 151.781 -35.759 1.00 0.00 ? 4   LYS B O   1 
ATOM 2974  C CB  . LYS B 1 9   ? -104.291 154.592 -35.585 1.00 0.00 ? 4   LYS B CB  1 
ATOM 2975  C CG  . LYS B 1 9   ? -103.765 155.887 -34.942 1.00 0.00 ? 4   LYS B CG  1 
ATOM 2976  C CD  . LYS B 1 9   ? -104.934 156.856 -34.564 1.00 0.00 ? 4   LYS B CD  1 
ATOM 2977  C CE  . LYS B 1 9   ? -104.575 158.276 -34.439 1.00 0.00 ? 4   LYS B CE  1 
ATOM 2978  N NZ  . LYS B 1 9   ? -104.321 158.575 -33.054 1.00 0.00 ? 4   LYS B NZ  1 
ATOM 2979  N N   . LEU B 1 10  ? -103.111 150.947 -35.800 1.00 0.00 ? 5   LEU B N   1 
ATOM 2980  C CA  . LEU B 1 10  ? -103.522 149.526 -36.176 1.00 0.00 ? 5   LEU B CA  1 
ATOM 2981  C C   . LEU B 1 10  ? -104.720 148.989 -35.293 1.00 0.00 ? 5   LEU B C   1 
ATOM 2982  O O   . LEU B 1 10  ? -104.716 148.916 -34.035 1.00 0.00 ? 5   LEU B O   1 
ATOM 2983  C CB  . LEU B 1 10  ? -102.293 148.692 -35.956 1.00 0.00 ? 5   LEU B CB  1 
ATOM 2984  C CG  . LEU B 1 10  ? -102.603 147.159 -36.194 1.00 0.00 ? 5   LEU B CG  1 
ATOM 2985  C CD1 . LEU B 1 10  ? -103.082 146.970 -37.646 1.00 0.00 ? 5   LEU B CD1 1 
ATOM 2986  C CD2 . LEU B 1 10  ? -101.310 146.450 -35.905 1.00 0.00 ? 5   LEU B CD2 1 
ATOM 2987  N N   . ASP B 1 11  ? -105.878 148.750 -36.033 1.00 0.00 ? 6   ASP B N   1 
ATOM 2988  C CA  . ASP B 1 11  ? -107.111 148.504 -35.368 1.00 0.00 ? 6   ASP B CA  1 
ATOM 2989  C C   . ASP B 1 11  ? -107.472 147.025 -35.580 1.00 0.00 ? 6   ASP B C   1 
ATOM 2990  O O   . ASP B 1 11  ? -106.858 146.315 -36.373 1.00 0.00 ? 6   ASP B O   1 
ATOM 2991  C CB  . ASP B 1 11  ? -108.222 149.461 -35.991 1.00 0.00 ? 6   ASP B CB  1 
ATOM 2992  C CG  . ASP B 1 11  ? -109.206 149.742 -34.976 1.00 0.00 ? 6   ASP B CG  1 
ATOM 2993  O OD1 . ASP B 1 11  ? -109.915 148.868 -34.463 1.00 0.00 ? 6   ASP B OD1 1 
ATOM 2994  O OD2 . ASP B 1 11  ? -109.325 150.963 -34.703 1.00 0.00 ? 6   ASP B OD2 1 
ATOM 2995  N N   . PHE B 1 12  ? -108.465 146.513 -34.820 1.00 0.00 ? 7   PHE B N   1 
ATOM 2996  C CA  . PHE B 1 12  ? -108.699 145.173 -34.375 1.00 0.00 ? 7   PHE B CA  1 
ATOM 2997  C C   . PHE B 1 12  ? -109.240 144.334 -35.538 1.00 0.00 ? 7   PHE B C   1 
ATOM 2998  O O   . PHE B 1 12  ? -109.047 143.122 -35.570 1.00 0.00 ? 7   PHE B O   1 
ATOM 2999  C CB  . PHE B 1 12  ? -109.532 145.203 -33.058 1.00 0.00 ? 7   PHE B CB  1 
ATOM 3000  C CG  . PHE B 1 12  ? -108.978 145.866 -31.815 1.00 0.00 ? 7   PHE B CG  1 
ATOM 3001  C CD1 . PHE B 1 12  ? -107.605 145.694 -31.471 1.00 0.00 ? 7   PHE B CD1 1 
ATOM 3002  C CD2 . PHE B 1 12  ? -109.710 146.604 -30.869 1.00 0.00 ? 7   PHE B CD2 1 
ATOM 3003  C CE1 . PHE B 1 12  ? -107.014 146.129 -30.285 1.00 0.00 ? 7   PHE B CE1 1 
ATOM 3004  C CE2 . PHE B 1 12  ? -109.143 147.168 -29.700 1.00 0.00 ? 7   PHE B CE2 1 
ATOM 3005  C CZ  . PHE B 1 12  ? -107.800 146.900 -29.411 1.00 0.00 ? 7   PHE B CZ  1 
ATOM 3006  N N   . GLU B 1 13  ? -109.812 144.924 -36.586 1.00 0.00 ? 8   GLU B N   1 
ATOM 3007  C CA  . GLU B 1 13  ? -110.353 144.170 -37.689 1.00 0.00 ? 8   GLU B CA  1 
ATOM 3008  C C   . GLU B 1 13  ? -109.372 143.255 -38.343 1.00 0.00 ? 8   GLU B C   1 
ATOM 3009  O O   . GLU B 1 13  ? -109.626 142.051 -38.559 1.00 0.00 ? 8   GLU B O   1 
ATOM 3010  C CB  . GLU B 1 13  ? -111.110 145.094 -38.605 1.00 0.00 ? 8   GLU B CB  1 
ATOM 3011  C CG  . GLU B 1 13  ? -112.062 144.538 -39.656 1.00 0.00 ? 8   GLU B CG  1 
ATOM 3012  C CD  . GLU B 1 13  ? -113.209 143.625 -39.114 1.00 0.00 ? 8   GLU B CD  1 
ATOM 3013  O OE1 . GLU B 1 13  ? -114.141 144.194 -38.452 1.00 0.00 ? 8   GLU B OE1 1 
ATOM 3014  O OE2 . GLU B 1 13  ? -113.268 142.351 -39.332 1.00 0.00 ? 8   GLU B OE2 1 
ATOM 3015  N N   . GLU B 1 14  ? -108.191 143.826 -38.678 1.00 0.00 ? 9   GLU B N   1 
ATOM 3016  C CA  . GLU B 1 14  ? -107.123 143.106 -39.328 1.00 0.00 ? 9   GLU B CA  1 
ATOM 3017  C C   . GLU B 1 14  ? -106.441 142.066 -38.512 1.00 0.00 ? 9   GLU B C   1 
ATOM 3018  O O   . GLU B 1 14  ? -106.143 140.948 -38.953 1.00 0.00 ? 9   GLU B O   1 
ATOM 3019  C CB  . GLU B 1 14  ? -105.952 144.114 -39.735 1.00 0.00 ? 9   GLU B CB  1 
ATOM 3020  C CG  . GLU B 1 14  ? -106.365 145.344 -40.545 1.00 0.00 ? 9   GLU B CG  1 
ATOM 3021  C CD  . GLU B 1 14  ? -106.914 144.896 -41.876 1.00 0.00 ? 9   GLU B CD  1 
ATOM 3022  O OE1 . GLU B 1 14  ? -106.164 144.203 -42.629 1.00 0.00 ? 9   GLU B OE1 1 
ATOM 3023  O OE2 . GLU B 1 14  ? -108.005 145.303 -42.262 1.00 0.00 ? 9   GLU B OE2 1 
ATOM 3024  N N   . CYS B 1 15  ? -106.392 142.334 -37.214 1.00 0.00 ? 10  CYS B N   1 
ATOM 3025  C CA  . CYS B 1 15  ? -105.815 141.494 -36.226 1.00 0.00 ? 10  CYS B CA  1 
ATOM 3026  C C   . CYS B 1 15  ? -106.442 140.163 -36.020 1.00 0.00 ? 10  CYS B C   1 
ATOM 3027  O O   . CYS B 1 15  ? -105.782 139.098 -35.862 1.00 0.00 ? 10  CYS B O   1 
ATOM 3028  C CB  . CYS B 1 15  ? -105.726 142.284 -34.866 1.00 0.00 ? 10  CYS B CB  1 
ATOM 3029  S SG  . CYS B 1 15  ? -104.756 143.845 -35.141 1.00 0.00 ? 10  CYS B SG  1 
ATOM 3030  N N   . LEU B 1 16  ? -107.807 140.180 -35.971 1.00 0.00 ? 11  LEU B N   1 
ATOM 3031  C CA  . LEU B 1 16  ? -108.554 139.025 -35.671 1.00 0.00 ? 11  LEU B CA  1 
ATOM 3032  C C   . LEU B 1 16  ? -108.848 138.155 -36.930 1.00 0.00 ? 11  LEU B C   1 
ATOM 3033  O O   . LEU B 1 16  ? -109.254 136.980 -36.809 1.00 0.00 ? 11  LEU B O   1 
ATOM 3034  C CB  . LEU B 1 16  ? -109.974 139.466 -35.238 1.00 0.00 ? 11  LEU B CB  1 
ATOM 3035  C CG  . LEU B 1 16  ? -109.934 140.286 -33.931 1.00 0.00 ? 11  LEU B CG  1 
ATOM 3036  C CD1 . LEU B 1 16  ? -111.233 141.179 -33.801 1.00 0.00 ? 11  LEU B CD1 1 
ATOM 3037  C CD2 . LEU B 1 16  ? -109.754 139.316 -32.757 1.00 0.00 ? 11  LEU B CD2 1 
ATOM 3038  N N   . LYS B 1 17  ? -108.597 138.702 -38.175 1.00 0.00 ? 12  LYS B N   1 
ATOM 3039  C CA  . LYS B 1 17  ? -108.811 137.857 -39.322 1.00 0.00 ? 12  LYS B CA  1 
ATOM 3040  C C   . LYS B 1 17  ? -107.515 137.339 -39.911 1.00 0.00 ? 12  LYS B C   1 
ATOM 3041  O O   . LYS B 1 17  ? -107.467 136.559 -40.921 1.00 0.00 ? 12  LYS B O   1 
ATOM 3042  C CB  . LYS B 1 17  ? -109.518 138.733 -40.428 1.00 0.00 ? 12  LYS B CB  1 
ATOM 3043  C CG  . LYS B 1 17  ? -108.685 139.872 -41.019 1.00 0.00 ? 12  LYS B CG  1 
ATOM 3044  C CD  . LYS B 1 17  ? -109.470 140.541 -42.200 1.00 0.00 ? 12  LYS B CD  1 
ATOM 3045  C CE  . LYS B 1 17  ? -110.840 141.226 -41.833 1.00 0.00 ? 12  LYS B CE  1 
ATOM 3046  N NZ  . LYS B 1 17  ? -111.373 142.025 -43.036 1.00 0.00 ? 12  LYS B NZ  1 
ATOM 3047  N N   . ASP B 1 18  ? -106.338 137.675 -39.253 1.00 0.00 ? 13  ASP B N   1 
ATOM 3048  C CA  . ASP B 1 18  ? -105.014 137.226 -39.665 1.00 0.00 ? 13  ASP B CA  1 
ATOM 3049  C C   . ASP B 1 18  ? -104.679 137.650 -41.092 1.00 0.00 ? 13  ASP B C   1 
ATOM 3050  O O   . ASP B 1 18  ? -104.192 136.882 -41.969 1.00 0.00 ? 13  ASP B O   1 
ATOM 3051  C CB  . ASP B 1 18  ? -104.967 135.791 -39.220 1.00 0.00 ? 13  ASP B CB  1 
ATOM 3052  C CG  . ASP B 1 18  ? -103.533 135.322 -39.189 1.00 0.00 ? 13  ASP B CG  1 
ATOM 3053  O OD1 . ASP B 1 18  ? -102.625 135.953 -38.536 1.00 0.00 ? 13  ASP B OD1 1 
ATOM 3054  O OD2 . ASP B 1 18  ? -103.231 134.336 -39.937 1.00 0.00 ? 13  ASP B OD2 1 
ATOM 3055  N N   . SER B 1 19  ? -104.920 138.960 -41.376 1.00 0.00 ? 14  SER B N   1 
ATOM 3056  C CA  . SER B 1 19  ? -104.732 139.579 -42.722 1.00 0.00 ? 14  SER B CA  1 
ATOM 3057  C C   . SER B 1 19  ? -103.242 139.717 -43.041 1.00 0.00 ? 14  SER B C   1 
ATOM 3058  O O   . SER B 1 19  ? -102.426 139.959 -42.129 1.00 0.00 ? 14  SER B O   1 
ATOM 3059  C CB  . SER B 1 19  ? -105.445 140.993 -42.857 1.00 0.00 ? 14  SER B CB  1 
ATOM 3060  O OG  . SER B 1 19  ? -104.942 142.015 -42.020 1.00 0.00 ? 14  SER B OG  1 
ATOM 3061  N N   . PRO B 1 20  ? -102.876 139.899 -44.305 1.00 0.00 ? 15  PRO B N   1 
ATOM 3062  C CA  . PRO B 1 20  ? -101.530 140.124 -44.693 1.00 0.00 ? 15  PRO B CA  1 
ATOM 3063  C C   . PRO B 1 20  ? -101.167 141.545 -44.328 1.00 0.00 ? 15  PRO B C   1 
ATOM 3064  O O   . PRO B 1 20  ? -99.956  141.809 -44.197 1.00 0.00 ? 15  PRO B O   1 
ATOM 3065  C CB  . PRO B 1 20  ? -101.591 140.001 -46.252 1.00 0.00 ? 15  PRO B CB  1 
ATOM 3066  C CG  . PRO B 1 20  ? -102.770 139.046 -46.554 1.00 0.00 ? 15  PRO B CG  1 
ATOM 3067  C CD  . PRO B 1 20  ? -103.756 139.387 -45.427 1.00 0.00 ? 15  PRO B CD  1 
ATOM 3068  N N   . ARG B 1 21  ? -102.124 142.533 -44.264 1.00 0.00 ? 16  ARG B N   1 
ATOM 3069  C CA  . ARG B 1 21  ? -101.860 143.890 -43.727 1.00 0.00 ? 16  ARG B CA  1 
ATOM 3070  C C   . ARG B 1 21  ? -101.392 143.922 -42.206 1.00 0.00 ? 16  ARG B C   1 
ATOM 3071  O O   . ARG B 1 21  ? -100.330 144.419 -41.811 1.00 0.00 ? 16  ARG B O   1 
ATOM 3072  C CB  . ARG B 1 21  ? -103.098 144.759 -43.934 1.00 0.00 ? 16  ARG B CB  1 
ATOM 3073  C CG  . ARG B 1 21  ? -102.973 146.141 -43.220 1.00 0.00 ? 16  ARG B CG  1 
ATOM 3074  C CD  . ARG B 1 21  ? -103.738 147.312 -43.986 1.00 0.00 ? 16  ARG B CD  1 
ATOM 3075  N NE  . ARG B 1 21  ? -105.203 146.966 -44.012 1.00 0.00 ? 16  ARG B NE  1 
ATOM 3076  C CZ  . ARG B 1 21  ? -106.186 147.919 -43.937 1.00 0.00 ? 16  ARG B CZ  1 
ATOM 3077  N NH1 . ARG B 1 21  ? -105.917 149.169 -44.136 1.00 0.00 ? 16  ARG B NH1 1 
ATOM 3078  N NH2 . ARG B 1 21  ? -107.453 147.633 -43.640 1.00 0.00 ? 16  ARG B NH2 1 
ATOM 3079  N N   . PHE B 1 22  ? -102.163 143.217 -41.341 1.00 0.00 ? 17  PHE B N   1 
ATOM 3080  C CA  . PHE B 1 22  ? -101.609 142.752 -40.065 1.00 0.00 ? 17  PHE B CA  1 
ATOM 3081  C C   . PHE B 1 22  ? -100.252 142.044 -40.122 1.00 0.00 ? 17  PHE B C   1 
ATOM 3082  O O   . PHE B 1 22  ? -99.315  142.532 -39.513 1.00 0.00 ? 17  PHE B O   1 
ATOM 3083  C CB  . PHE B 1 22  ? -102.695 141.825 -39.405 1.00 0.00 ? 17  PHE B CB  1 
ATOM 3084  C CG  . PHE B 1 22  ? -102.183 141.276 -38.079 1.00 0.00 ? 17  PHE B CG  1 
ATOM 3085  C CD1 . PHE B 1 22  ? -101.796 142.141 -37.075 1.00 0.00 ? 17  PHE B CD1 1 
ATOM 3086  C CD2 . PHE B 1 22  ? -102.251 139.907 -37.672 1.00 0.00 ? 17  PHE B CD2 1 
ATOM 3087  C CE1 . PHE B 1 22  ? -101.525 141.805 -35.792 1.00 0.00 ? 17  PHE B CE1 1 
ATOM 3088  C CE2 . PHE B 1 22  ? -102.110 139.509 -36.323 1.00 0.00 ? 17  PHE B CE2 1 
ATOM 3089  C CZ  . PHE B 1 22  ? -101.734 140.494 -35.407 1.00 0.00 ? 17  PHE B CZ  1 
ATOM 3090  N N   . ARG B 1 23  ? -100.102 140.953 -40.907 1.00 0.00 ? 18  ARG B N   1 
ATOM 3091  C CA  . ARG B 1 23  ? -98.932  140.091 -41.113 1.00 0.00 ? 18  ARG B CA  1 
ATOM 3092  C C   . ARG B 1 23  ? -97.674  140.805 -41.510 1.00 0.00 ? 18  ARG B C   1 
ATOM 3093  O O   . ARG B 1 23  ? -96.604  140.614 -40.943 1.00 0.00 ? 18  ARG B O   1 
ATOM 3094  C CB  . ARG B 1 23  ? -99.155  139.045 -42.192 1.00 0.00 ? 18  ARG B CB  1 
ATOM 3095  C CG  . ARG B 1 23  ? -98.084  137.949 -42.266 1.00 0.00 ? 18  ARG B CG  1 
ATOM 3096  C CD  . ARG B 1 23  ? -97.723  137.267 -40.948 1.00 0.00 ? 18  ARG B CD  1 
ATOM 3097  N NE  . ARG B 1 23  ? -96.485  136.484 -41.193 1.00 0.00 ? 18  ARG B NE  1 
ATOM 3098  C CZ  . ARG B 1 23  ? -95.270  136.896 -41.074 1.00 0.00 ? 18  ARG B CZ  1 
ATOM 3099  N NH1 . ARG B 1 23  ? -94.888  138.097 -40.582 1.00 0.00 ? 18  ARG B NH1 1 
ATOM 3100  N NH2 . ARG B 1 23  ? -94.266  136.033 -41.372 1.00 0.00 ? 18  ARG B NH2 1 
ATOM 3101  N N   . ALA B 1 24  ? -97.795  141.841 -42.403 1.00 0.00 ? 19  ALA B N   1 
ATOM 3102  C CA  . ALA B 1 24  ? -96.712  142.771 -42.629 1.00 0.00 ? 19  ALA B CA  1 
ATOM 3103  C C   . ALA B 1 24  ? -96.520  143.856 -41.596 1.00 0.00 ? 19  ALA B C   1 
ATOM 3104  O O   . ALA B 1 24  ? -95.463  144.350 -41.219 1.00 0.00 ? 19  ALA B O   1 
ATOM 3105  C CB  . ALA B 1 24  ? -96.915  143.495 -44.036 1.00 0.00 ? 19  ALA B CB  1 
ATOM 3106  N N   . SER B 1 25  ? -97.563  144.384 -40.941 1.00 0.00 ? 20  SER B N   1 
ATOM 3107  C CA  . SER B 1 25  ? -97.430  145.421 -39.829 1.00 0.00 ? 20  SER B CA  1 
ATOM 3108  C C   . SER B 1 25  ? -96.741  144.929 -38.606 1.00 0.00 ? 20  SER B C   1 
ATOM 3109  O O   . SER B 1 25  ? -96.155  145.815 -37.879 1.00 0.00 ? 20  SER B O   1 
ATOM 3110  C CB  . SER B 1 25  ? -98.804  146.127 -39.492 1.00 0.00 ? 20  SER B CB  1 
ATOM 3111  O OG  . SER B 1 25  ? -99.321  146.696 -40.670 1.00 0.00 ? 20  SER B OG  1 
ATOM 3112  N N   . ILE B 1 26  ? -96.917  143.678 -38.257 1.00 0.00 ? 21  ILE B N   1 
ATOM 3113  C CA  . ILE B 1 26  ? -96.243  143.036 -37.202 1.00 0.00 ? 21  ILE B CA  1 
ATOM 3114  C C   . ILE B 1 26  ? -94.794  142.730 -37.592 1.00 0.00 ? 21  ILE B C   1 
ATOM 3115  O O   . ILE B 1 26  ? -93.837  142.872 -36.781 1.00 0.00 ? 21  ILE B O   1 
ATOM 3116  C CB  . ILE B 1 26  ? -96.978  141.748 -36.754 1.00 0.00 ? 21  ILE B CB  1 
ATOM 3117  C CG1 . ILE B 1 26  ? -97.080  140.531 -37.754 1.00 0.00 ? 21  ILE B CG1 1 
ATOM 3118  C CG2 . ILE B 1 26  ? -98.329  142.243 -36.169 1.00 0.00 ? 21  ILE B CG2 1 
ATOM 3119  C CD1 . ILE B 1 26  ? -97.734  139.225 -37.218 1.00 0.00 ? 21  ILE B CD1 1 
ATOM 3120  N N   . GLU B 1 27  ? -94.547  142.369 -38.871 1.00 0.00 ? 22  GLU B N   1 
ATOM 3121  C CA  . GLU B 1 27  ? -93.188  142.311 -39.407 1.00 0.00 ? 22  GLU B CA  1 
ATOM 3122  C C   . GLU B 1 27  ? -92.457  143.611 -39.302 1.00 0.00 ? 22  GLU B C   1 
ATOM 3123  O O   . GLU B 1 27  ? -91.325  143.579 -38.748 1.00 0.00 ? 22  GLU B O   1 
ATOM 3124  C CB  . GLU B 1 27  ? -93.234  141.750 -40.767 1.00 0.00 ? 22  GLU B CB  1 
ATOM 3125  C CG  . GLU B 1 27  ? -91.812  141.526 -41.347 1.00 0.00 ? 22  GLU B CG  1 
ATOM 3126  C CD  . GLU B 1 27  ? -91.713  140.452 -42.430 1.00 0.00 ? 22  GLU B CD  1 
ATOM 3127  O OE1 . GLU B 1 27  ? -91.574  139.207 -42.168 1.00 0.00 ? 22  GLU B OE1 1 
ATOM 3128  O OE2 . GLU B 1 27  ? -91.702  140.990 -43.633 1.00 0.00 ? 22  GLU B OE2 1 
ATOM 3129  N N   . LEU B 1 28  ? -92.980  144.731 -39.629 1.00 0.00 ? 23  LEU B N   1 
ATOM 3130  C CA  . LEU B 1 28  ? -92.316  145.989 -39.649 1.00 0.00 ? 23  LEU B CA  1 
ATOM 3131  C C   . LEU B 1 28  ? -92.323  146.631 -38.283 1.00 0.00 ? 23  LEU B C   1 
ATOM 3132  O O   . LEU B 1 28  ? -91.487  147.510 -38.040 1.00 0.00 ? 23  LEU B O   1 
ATOM 3133  C CB  . LEU B 1 28  ? -93.205  146.744 -40.566 1.00 0.00 ? 23  LEU B CB  1 
ATOM 3134  C CG  . LEU B 1 28  ? -92.996  146.435 -42.054 1.00 0.00 ? 23  LEU B CG  1 
ATOM 3135  C CD1 . LEU B 1 28  ? -94.037  147.024 -43.053 1.00 0.00 ? 23  LEU B CD1 1 
ATOM 3136  C CD2 . LEU B 1 28  ? -91.652  146.903 -42.549 1.00 0.00 ? 23  LEU B CD2 1 
ATOM 3137  N N   . VAL B 1 29  ? -93.264  146.418 -37.288 1.00 0.00 ? 24  VAL B N   1 
ATOM 3138  C CA  . VAL B 1 29  ? -93.199  147.169 -35.987 1.00 0.00 ? 24  VAL B CA  1 
ATOM 3139  C C   . VAL B 1 29  ? -92.105  146.642 -35.150 1.00 0.00 ? 24  VAL B C   1 
ATOM 3140  O O   . VAL B 1 29  ? -91.414  147.353 -34.351 1.00 0.00 ? 24  VAL B O   1 
ATOM 3141  C CB  . VAL B 1 29  ? -94.601  147.220 -35.338 1.00 0.00 ? 24  VAL B CB  1 
ATOM 3142  C CG1 . VAL B 1 29  ? -94.930  145.741 -34.930 1.00 0.00 ? 24  VAL B CG1 1 
ATOM 3143  C CG2 . VAL B 1 29  ? -94.563  148.198 -34.130 1.00 0.00 ? 24  VAL B CG2 1 
ATOM 3144  N N   . GLU B 1 30  ? -91.716  145.298 -35.252 1.00 0.00 ? 25  GLU B N   1 
ATOM 3145  C CA  . GLU B 1 30  ? -90.648  144.706 -34.514 1.00 0.00 ? 25  GLU B CA  1 
ATOM 3146  C C   . GLU B 1 30  ? -89.269  145.159 -34.925 1.00 0.00 ? 25  GLU B C   1 
ATOM 3147  O O   . GLU B 1 30  ? -88.388  145.356 -34.095 1.00 0.00 ? 25  GLU B O   1 
ATOM 3148  C CB  . GLU B 1 30  ? -90.634  143.164 -34.408 1.00 0.00 ? 25  GLU B CB  1 
ATOM 3149  C CG  . GLU B 1 30  ? -90.589  142.350 -35.755 1.00 0.00 ? 25  GLU B CG  1 
ATOM 3150  C CD  . GLU B 1 30  ? -90.427  140.839 -35.580 1.00 0.00 ? 25  GLU B CD  1 
ATOM 3151  O OE1 . GLU B 1 30  ? -91.201  140.298 -34.716 1.00 0.00 ? 25  GLU B OE1 1 
ATOM 3152  O OE2 . GLU B 1 30  ? -89.488  140.253 -36.143 1.00 0.00 ? 25  GLU B OE2 1 
ATOM 3153  N N   . ALA B 1 31  ? -89.102  145.365 -36.210 1.00 0.00 ? 26  ALA B N   1 
ATOM 3154  C CA  . ALA B 1 31  ? -87.908  145.902 -36.856 1.00 0.00 ? 26  ALA B CA  1 
ATOM 3155  C C   . ALA B 1 31  ? -87.821  147.384 -36.537 1.00 0.00 ? 26  ALA B C   1 
ATOM 3156  O O   . ALA B 1 31  ? -86.695  147.854 -36.238 1.00 0.00 ? 26  ALA B O   1 
ATOM 3157  C CB  . ALA B 1 31  ? -88.188  145.876 -38.377 1.00 0.00 ? 26  ALA B CB  1 
ATOM 3158  N N   . GLU B 1 32  ? -88.899  148.153 -36.463 1.00 0.00 ? 27  GLU B N   1 
ATOM 3159  C CA  . GLU B 1 32  ? -88.835  149.464 -35.938 1.00 0.00 ? 27  GLU B CA  1 
ATOM 3160  C C   . GLU B 1 32  ? -88.406  149.530 -34.437 1.00 0.00 ? 27  GLU B C   1 
ATOM 3161  O O   . GLU B 1 32  ? -87.633  150.386 -34.155 1.00 0.00 ? 27  GLU B O   1 
ATOM 3162  C CB  . GLU B 1 32  ? -90.223  150.172 -36.027 1.00 0.00 ? 27  GLU B CB  1 
ATOM 3163  C CG  . GLU B 1 32  ? -90.681  150.545 -37.485 1.00 0.00 ? 27  GLU B CG  1 
ATOM 3164  C CD  . GLU B 1 32  ? -90.040  151.836 -37.945 1.00 0.00 ? 27  GLU B CD  1 
ATOM 3165  O OE1 . GLU B 1 32  ? -90.019  152.844 -37.167 1.00 0.00 ? 27  GLU B OE1 1 
ATOM 3166  O OE2 . GLU B 1 32  ? -89.647  151.955 -39.147 1.00 0.00 ? 27  GLU B OE2 1 
ATOM 3167  N N   . VAL B 1 33  ? -88.849  148.628 -33.573 1.00 0.00 ? 28  VAL B N   1 
ATOM 3168  C CA  . VAL B 1 33  ? -88.469  148.521 -32.220 1.00 0.00 ? 28  VAL B CA  1 
ATOM 3169  C C   . VAL B 1 33  ? -86.986  148.221 -32.038 1.00 0.00 ? 28  VAL B C   1 
ATOM 3170  O O   . VAL B 1 33  ? -86.391  148.873 -31.181 1.00 0.00 ? 28  VAL B O   1 
ATOM 3171  C CB  . VAL B 1 33  ? -89.310  147.506 -31.436 1.00 0.00 ? 28  VAL B CB  1 
ATOM 3172  C CG1 . VAL B 1 33  ? -88.695  147.316 -30.047 1.00 0.00 ? 28  VAL B CG1 1 
ATOM 3173  C CG2 . VAL B 1 33  ? -90.686  148.099 -31.215 1.00 0.00 ? 28  VAL B CG2 1 
ATOM 3174  N N   . SER B 1 34  ? -86.351  147.342 -32.777 1.00 0.00 ? 29  SER B N   1 
ATOM 3175  C CA  . SER B 1 34  ? -84.865  147.169 -32.826 1.00 0.00 ? 29  SER B CA  1 
ATOM 3176  C C   . SER B 1 34  ? -84.068  148.359 -33.268 1.00 0.00 ? 29  SER B C   1 
ATOM 3177  O O   . SER B 1 34  ? -83.047  148.580 -32.661 1.00 0.00 ? 29  SER B O   1 
ATOM 3178  C CB  . SER B 1 34  ? -84.419  145.996 -33.805 1.00 0.00 ? 29  SER B CB  1 
ATOM 3179  O OG  . SER B 1 34  ? -85.026  144.773 -33.392 1.00 0.00 ? 29  SER B OG  1 
ATOM 3180  N N   . GLU B 1 35  ? -84.461  149.111 -34.309 1.00 0.00 ? 30  GLU B N   1 
ATOM 3181  C CA  . GLU B 1 35  ? -83.845  150.364 -34.690 1.00 0.00 ? 30  GLU B CA  1 
ATOM 3182  C C   . GLU B 1 35  ? -83.992  151.391 -33.526 1.00 0.00 ? 30  GLU B C   1 
ATOM 3183  O O   . GLU B 1 35  ? -83.090  152.115 -33.166 1.00 0.00 ? 30  GLU B O   1 
ATOM 3184  C CB  . GLU B 1 35  ? -84.603  150.945 -35.943 1.00 0.00 ? 30  GLU B CB  1 
ATOM 3185  C CG  . GLU B 1 35  ? -83.874  152.166 -36.639 1.00 0.00 ? 30  GLU B CG  1 
ATOM 3186  C CD  . GLU B 1 35  ? -82.464  151.922 -37.097 1.00 0.00 ? 30  GLU B CD  1 
ATOM 3187  O OE1 . GLU B 1 35  ? -82.154  150.833 -37.640 1.00 0.00 ? 30  GLU B OE1 1 
ATOM 3188  O OE2 . GLU B 1 35  ? -81.653  152.866 -36.907 1.00 0.00 ? 30  GLU B OE2 1 
ATOM 3189  N N   . LEU B 1 36  ? -85.248  151.466 -32.939 1.00 0.00 ? 31  LEU B N   1 
ATOM 3190  C CA  . LEU B 1 36  ? -85.548  152.486 -31.973 1.00 0.00 ? 31  LEU B CA  1 
ATOM 3191  C C   . LEU B 1 36  ? -84.740  152.398 -30.751 1.00 0.00 ? 31  LEU B C   1 
ATOM 3192  O O   . LEU B 1 36  ? -84.242  153.424 -30.253 1.00 0.00 ? 31  LEU B O   1 
ATOM 3193  C CB  . LEU B 1 36  ? -87.118  152.590 -31.689 1.00 0.00 ? 31  LEU B CB  1 
ATOM 3194  C CG  . LEU B 1 36  ? -87.571  153.571 -30.560 1.00 0.00 ? 31  LEU B CG  1 
ATOM 3195  C CD1 . LEU B 1 36  ? -87.260  154.997 -30.909 1.00 0.00 ? 31  LEU B CD1 1 
ATOM 3196  C CD2 . LEU B 1 36  ? -89.119  153.476 -30.274 1.00 0.00 ? 31  LEU B CD2 1 
ATOM 3197  N N   . GLU B 1 37  ? -84.603  151.205 -30.230 1.00 0.00 ? 32  GLU B N   1 
ATOM 3198  C CA  . GLU B 1 37  ? -83.866  150.938 -29.008 1.00 0.00 ? 32  GLU B CA  1 
ATOM 3199  C C   . GLU B 1 37  ? -82.446  151.134 -29.234 1.00 0.00 ? 32  GLU B C   1 
ATOM 3200  O O   . GLU B 1 37  ? -81.771  151.695 -28.365 1.00 0.00 ? 32  GLU B O   1 
ATOM 3201  C CB  . GLU B 1 37  ? -84.111  149.392 -28.770 1.00 0.00 ? 32  GLU B CB  1 
ATOM 3202  C CG  . GLU B 1 37  ? -83.166  148.803 -27.627 1.00 0.00 ? 32  GLU B CG  1 
ATOM 3203  C CD  . GLU B 1 37  ? -83.487  147.321 -27.398 1.00 0.00 ? 32  GLU B CD  1 
ATOM 3204  O OE1 . GLU B 1 37  ? -83.536  146.562 -28.412 1.00 0.00 ? 32  GLU B OE1 1 
ATOM 3205  O OE2 . GLU B 1 37  ? -83.664  146.970 -26.223 1.00 0.00 ? 32  GLU B OE2 1 
ATOM 3206  N N   . THR B 1 38  ? -81.950  150.699 -30.374 1.00 0.00 ? 33  THR B N   1 
ATOM 3207  C CA  . THR B 1 38  ? -80.533  150.910 -30.615 1.00 0.00 ? 33  THR B CA  1 
ATOM 3208  C C   . THR B 1 38  ? -80.249  152.413 -30.624 1.00 0.00 ? 33  THR B C   1 
ATOM 3209  O O   . THR B 1 38  ? -79.232  152.782 -30.004 1.00 0.00 ? 33  THR B O   1 
ATOM 3210  C CB  . THR B 1 38  ? -80.159  150.378 -32.016 1.00 0.00 ? 33  THR B CB  1 
ATOM 3211  O OG1 . THR B 1 38  ? -80.466  148.953 -31.973 1.00 0.00 ? 33  THR B OG1 1 
ATOM 3212  C CG2 . THR B 1 38  ? -78.767  150.680 -32.365 1.00 0.00 ? 33  THR B CG2 1 
ATOM 3213  N N   . ARG B 1 39  ? -81.050  153.271 -31.282 1.00 0.00 ? 34  ARG B N   1 
ATOM 3214  C CA  . ARG B 1 39  ? -80.818  154.713 -31.434 1.00 0.00 ? 34  ARG B CA  1 
ATOM 3215  C C   . ARG B 1 39  ? -81.014  155.435 -30.141 1.00 0.00 ? 34  ARG B C   1 
ATOM 3216  O O   . ARG B 1 39  ? -80.225  156.320 -29.803 1.00 0.00 ? 34  ARG B O   1 
ATOM 3217  C CB  . ARG B 1 39  ? -81.722  155.447 -32.468 1.00 0.00 ? 34  ARG B CB  1 
ATOM 3218  C CG  . ARG B 1 39  ? -81.513  155.022 -33.942 1.00 0.00 ? 34  ARG B CG  1 
ATOM 3219  C CD  . ARG B 1 39  ? -80.498  155.771 -34.695 1.00 0.00 ? 34  ARG B CD  1 
ATOM 3220  N NE  . ARG B 1 39  ? -80.347  155.014 -35.994 1.00 0.00 ? 34  ARG B NE  1 
ATOM 3221  C CZ  . ARG B 1 39  ? -79.571  155.366 -37.000 1.00 0.00 ? 34  ARG B CZ  1 
ATOM 3222  N NH1 . ARG B 1 39  ? -78.868  156.468 -36.984 1.00 0.00 ? 34  ARG B NH1 1 
ATOM 3223  N NH2 . ARG B 1 39  ? -79.509  154.552 -38.098 1.00 0.00 ? 34  ARG B NH2 1 
ATOM 3224  N N   . LEU B 1 40  ? -82.082  155.081 -29.322 1.00 0.00 ? 35  LEU B N   1 
ATOM 3225  C CA  . LEU B 1 40  ? -82.264  155.548 -27.973 1.00 0.00 ? 35  LEU B CA  1 
ATOM 3226  C C   . LEU B 1 40  ? -81.032  155.221 -27.114 1.00 0.00 ? 35  LEU B C   1 
ATOM 3227  O O   . LEU B 1 40  ? -80.433  156.024 -26.428 1.00 0.00 ? 35  LEU B O   1 
ATOM 3228  C CB  . LEU B 1 40  ? -83.492  154.884 -27.254 1.00 0.00 ? 35  LEU B CB  1 
ATOM 3229  C CG  . LEU B 1 40  ? -84.886  155.567 -27.504 1.00 0.00 ? 35  LEU B CG  1 
ATOM 3230  C CD1 . LEU B 1 40  ? -85.962  154.575 -27.250 1.00 0.00 ? 35  LEU B CD1 1 
ATOM 3231  C CD2 . LEU B 1 40  ? -84.973  156.791 -26.630 1.00 0.00 ? 35  LEU B CD2 1 
ATOM 3232  N N   . GLU B 1 41  ? -80.582  153.921 -27.176 1.00 0.00 ? 36  GLU B N   1 
ATOM 3233  C CA  . GLU B 1 41  ? -79.444  153.516 -26.329 1.00 0.00 ? 36  GLU B CA  1 
ATOM 3234  C C   . GLU B 1 41  ? -78.169  154.169 -26.811 1.00 0.00 ? 36  GLU B C   1 
ATOM 3235  O O   . GLU B 1 41  ? -77.279  154.574 -26.090 1.00 0.00 ? 36  GLU B O   1 
ATOM 3236  C CB  . GLU B 1 41  ? -79.338  151.949 -26.151 1.00 0.00 ? 36  GLU B CB  1 
ATOM 3237  C CG  . GLU B 1 41  ? -78.435  151.524 -24.997 1.00 0.00 ? 36  GLU B CG  1 
ATOM 3238  C CD  . GLU B 1 41  ? -78.346  150.034 -24.806 1.00 0.00 ? 36  GLU B CD  1 
ATOM 3239  O OE1 . GLU B 1 41  ? -77.864  149.356 -25.732 1.00 0.00 ? 36  GLU B OE1 1 
ATOM 3240  O OE2 . GLU B 1 41  ? -78.668  149.518 -23.690 1.00 0.00 ? 36  GLU B OE2 1 
ATOM 3241  N N   . LYS B 1 42  ? -77.989  154.413 -28.135 1.00 0.00 ? 37  LYS B N   1 
ATOM 3242  C CA  . LYS B 1 42  ? -76.881  155.254 -28.599 1.00 0.00 ? 37  LYS B CA  1 
ATOM 3243  C C   . LYS B 1 42  ? -76.986  156.693 -28.093 1.00 0.00 ? 37  LYS B C   1 
ATOM 3244  O O   . LYS B 1 42  ? -76.041  157.364 -27.666 1.00 0.00 ? 37  LYS B O   1 
ATOM 3245  C CB  . LYS B 1 42  ? -76.937  155.164 -30.139 1.00 0.00 ? 37  LYS B CB  1 
ATOM 3246  C CG  . LYS B 1 42  ? -75.825  155.874 -30.955 1.00 0.00 ? 37  LYS B CG  1 
ATOM 3247  C CD  . LYS B 1 42  ? -75.382  155.287 -32.371 1.00 0.00 ? 37  LYS B CD  1 
ATOM 3248  C CE  . LYS B 1 42  ? -74.507  154.024 -32.174 1.00 0.00 ? 37  LYS B CE  1 
ATOM 3249  N NZ  . LYS B 1 42  ? -73.115  154.342 -31.765 1.00 0.00 ? 37  LYS B NZ  1 
ATOM 3250  N N   . LEU B 1 43  ? -78.200  157.334 -28.178 1.00 0.00 ? 38  LEU B N   1 
ATOM 3251  C CA  . LEU B 1 43  ? -78.519  158.675 -27.707 1.00 0.00 ? 38  LEU B CA  1 
ATOM 3252  C C   . LEU B 1 43  ? -78.230  158.750 -26.166 1.00 0.00 ? 38  LEU B C   1 
ATOM 3253  O O   . LEU B 1 43  ? -77.635  159.706 -25.692 1.00 0.00 ? 38  LEU B O   1 
ATOM 3254  C CB  . LEU B 1 43  ? -79.921  159.089 -28.049 1.00 0.00 ? 38  LEU B CB  1 
ATOM 3255  C CG  . LEU B 1 43  ? -80.312  160.534 -27.540 1.00 0.00 ? 38  LEU B CG  1 
ATOM 3256  C CD1 . LEU B 1 43  ? -79.497  161.510 -28.475 1.00 0.00 ? 38  LEU B CD1 1 
ATOM 3257  C CD2 . LEU B 1 43  ? -81.780  160.765 -27.563 1.00 0.00 ? 38  LEU B CD2 1 
ATOM 3258  N N   . LEU B 1 44  ? -78.565  157.745 -25.363 1.00 0.00 ? 39  LEU B N   1 
ATOM 3259  C CA  . LEU B 1 44  ? -78.207  157.405 -23.966 1.00 0.00 ? 39  LEU B CA  1 
ATOM 3260  C C   . LEU B 1 44  ? -76.688  157.332 -23.621 1.00 0.00 ? 39  LEU B C   1 
ATOM 3261  O O   . LEU B 1 44  ? -76.176  158.129 -22.838 1.00 0.00 ? 39  LEU B O   1 
ATOM 3262  C CB  . LEU B 1 44  ? -78.876  156.037 -23.542 1.00 0.00 ? 39  LEU B CB  1 
ATOM 3263  C CG  . LEU B 1 44  ? -78.885  155.676 -22.017 1.00 0.00 ? 39  LEU B CG  1 
ATOM 3264  C CD1 . LEU B 1 44  ? -79.593  156.784 -21.096 1.00 0.00 ? 39  LEU B CD1 1 
ATOM 3265  C CD2 . LEU B 1 44  ? -79.547  154.272 -21.704 1.00 0.00 ? 39  LEU B CD2 1 
ATOM 3266  N N   . LYS B 1 45  ? -75.850  156.512 -24.321 1.00 0.00 ? 40  LYS B N   1 
ATOM 3267  C CA  . LYS B 1 45  ? -74.420  156.629 -24.190 1.00 0.00 ? 40  LYS B CA  1 
ATOM 3268  C C   . LYS B 1 45  ? -73.824  157.940 -24.670 1.00 0.00 ? 40  LYS B C   1 
ATOM 3269  O O   . LYS B 1 45  ? -72.942  158.529 -24.059 1.00 0.00 ? 40  LYS B O   1 
ATOM 3270  C CB  . LYS B 1 45  ? -73.779  155.466 -24.968 1.00 0.00 ? 40  LYS B CB  1 
ATOM 3271  C CG  . LYS B 1 45  ? -74.272  154.143 -24.613 1.00 0.00 ? 40  LYS B CG  1 
ATOM 3272  C CD  . LYS B 1 45  ? -73.437  153.022 -25.282 1.00 0.00 ? 40  LYS B CD  1 
ATOM 3273  C CE  . LYS B 1 45  ? -73.747  151.648 -24.770 1.00 0.00 ? 40  LYS B CE  1 
ATOM 3274  N NZ  . LYS B 1 45  ? -73.349  151.503 -23.401 1.00 0.00 ? 40  LYS B NZ  1 
ATOM 3275  N N   . LEU B 1 46  ? -74.353  158.531 -25.791 1.00 0.00 ? 41  LEU B N   1 
ATOM 3276  C CA  . LEU B 1 46  ? -73.897  159.869 -26.184 1.00 0.00 ? 41  LEU B CA  1 
ATOM 3277  C C   . LEU B 1 46  ? -74.294  161.034 -25.156 1.00 0.00 ? 41  LEU B C   1 
ATOM 3278  O O   . LEU B 1 46  ? -73.411  161.872 -24.787 1.00 0.00 ? 41  LEU B O   1 
ATOM 3279  C CB  . LEU B 1 46  ? -74.432  160.261 -27.577 1.00 0.00 ? 41  LEU B CB  1 
ATOM 3280  C CG  . LEU B 1 46  ? -73.774  161.551 -28.088 1.00 0.00 ? 41  LEU B CG  1 
ATOM 3281  C CD1 . LEU B 1 46  ? -72.261  161.368 -28.212 1.00 0.00 ? 41  LEU B CD1 1 
ATOM 3282  C CD2 . LEU B 1 46  ? -74.343  162.015 -29.396 1.00 0.00 ? 41  LEU B CD2 1 
ATOM 3283  N N   . GLY B 1 47  ? -75.498  161.116 -24.600 1.00 0.00 ? 42  GLY B N   1 
ATOM 3284  C CA  . GLY B 1 47  ? -75.871  161.996 -23.490 1.00 0.00 ? 42  GLY B CA  1 
ATOM 3285  C C   . GLY B 1 47  ? -75.186  161.774 -22.229 1.00 0.00 ? 42  GLY B C   1 
ATOM 3286  O O   . GLY B 1 47  ? -75.042  162.678 -21.440 1.00 0.00 ? 42  GLY B O   1 
ATOM 3287  N N   . THR B 1 48  ? -74.726  160.527 -21.935 1.00 0.00 ? 43  THR B N   1 
ATOM 3288  C CA  . THR B 1 48  ? -73.763  160.187 -20.873 1.00 0.00 ? 43  THR B CA  1 
ATOM 3289  C C   . THR B 1 48  ? -72.403  160.843 -21.081 1.00 0.00 ? 43  THR B C   1 
ATOM 3290  O O   . THR B 1 48  ? -71.849  161.490 -20.179 1.00 0.00 ? 43  THR B O   1 
ATOM 3291  C CB  . THR B 1 48  ? -73.661  158.744 -20.680 1.00 0.00 ? 43  THR B CB  1 
ATOM 3292  O OG1 . THR B 1 48  ? -74.965  158.192 -20.413 1.00 0.00 ? 43  THR B OG1 1 
ATOM 3293  C CG2 . THR B 1 48  ? -72.790  158.362 -19.475 1.00 0.00 ? 43  THR B CG2 1 
ATOM 3294  N N   . GLY B 1 49  ? -71.908  160.721 -22.362 1.00 0.00 ? 44  GLY B N   1 
ATOM 3295  C CA  . GLY B 1 49  ? -70.655  161.190 -22.784 1.00 0.00 ? 44  GLY B CA  1 
ATOM 3296  C C   . GLY B 1 49  ? -70.582  162.698 -22.796 1.00 0.00 ? 44  GLY B C   1 
ATOM 3297  O O   . GLY B 1 49  ? -69.554  163.307 -22.484 1.00 0.00 ? 44  GLY B O   1 
ATOM 3298  N N   . LEU B 1 50  ? -71.734  163.363 -23.110 1.00 0.00 ? 45  LEU B N   1 
ATOM 3299  C CA  . LEU B 1 50  ? -71.903  164.788 -23.105 1.00 0.00 ? 45  LEU B CA  1 
ATOM 3300  C C   . LEU B 1 50  ? -71.726  165.399 -21.706 1.00 0.00 ? 45  LEU B C   1 
ATOM 3301  O O   . LEU B 1 50  ? -70.936  166.314 -21.476 1.00 0.00 ? 45  LEU B O   1 
ATOM 3302  C CB  . LEU B 1 50  ? -73.314  165.140 -23.638 1.00 0.00 ? 45  LEU B CB  1 
ATOM 3303  C CG  . LEU B 1 50  ? -73.669  166.526 -23.765 1.00 0.00 ? 45  LEU B CG  1 
ATOM 3304  C CD1 . LEU B 1 50  ? -72.695  167.471 -24.547 1.00 0.00 ? 45  LEU B CD1 1 
ATOM 3305  C CD2 . LEU B 1 50  ? -74.997  166.744 -24.429 1.00 0.00 ? 45  LEU B CD2 1 
ATOM 3306  N N   . LEU B 1 51  ? -72.429  164.809 -20.696 1.00 0.00 ? 46  LEU B N   1 
ATOM 3307  C CA  . LEU B 1 51  ? -72.238  165.200 -19.295 1.00 0.00 ? 46  LEU B CA  1 
ATOM 3308  C C   . LEU B 1 51  ? -70.770  165.047 -18.878 1.00 0.00 ? 46  LEU B C   1 
ATOM 3309  O O   . LEU B 1 51  ? -70.321  165.922 -18.174 1.00 0.00 ? 46  LEU B O   1 
ATOM 3310  C CB  . LEU B 1 51  ? -73.177  164.358 -18.393 1.00 0.00 ? 46  LEU B CB  1 
ATOM 3311  C CG  . LEU B 1 51  ? -74.663  164.375 -18.742 1.00 0.00 ? 46  LEU B CG  1 
ATOM 3312  C CD1 . LEU B 1 51  ? -75.314  163.153 -18.109 1.00 0.00 ? 46  LEU B CD1 1 
ATOM 3313  C CD2 . LEU B 1 51  ? -75.310  165.666 -18.168 1.00 0.00 ? 46  LEU B CD2 1 
ATOM 3314  N N   . GLU B 1 52  ? -70.087  163.953 -19.256 1.00 0.00 ? 47  GLU B N   1 
ATOM 3315  C CA  . GLU B 1 52  ? -68.680  163.621 -18.917 1.00 0.00 ? 47  GLU B CA  1 
ATOM 3316  C C   . GLU B 1 52  ? -67.827  164.665 -19.587 1.00 0.00 ? 47  GLU B C   1 
ATOM 3317  O O   . GLU B 1 52  ? -66.946  165.256 -19.033 1.00 0.00 ? 47  GLU B O   1 
ATOM 3318  C CB  . GLU B 1 52  ? -68.241  162.264 -19.339 1.00 0.00 ? 47  GLU B CB  1 
ATOM 3319  C CG  . GLU B 1 52  ? -66.806  161.974 -18.933 1.00 0.00 ? 47  GLU B CG  1 
ATOM 3320  C CD  . GLU B 1 52  ? -66.456  160.559 -19.395 1.00 0.00 ? 47  GLU B CD  1 
ATOM 3321  O OE1 . GLU B 1 52  ? -66.983  159.545 -18.764 1.00 0.00 ? 47  GLU B OE1 1 
ATOM 3322  O OE2 . GLU B 1 52  ? -65.734  160.410 -20.427 1.00 0.00 ? 47  GLU B OE2 1 
ATOM 3323  N N   . SER B 1 53  ? -68.094  164.987 -20.849 1.00 0.00 ? 48  SER B N   1 
ATOM 3324  C CA  . SER B 1 53  ? -67.393  166.055 -21.571 1.00 0.00 ? 48  SER B CA  1 
ATOM 3325  C C   . SER B 1 53  ? -67.596  167.435 -21.010 1.00 0.00 ? 48  SER B C   1 
ATOM 3326  O O   . SER B 1 53  ? -66.673  168.170 -20.844 1.00 0.00 ? 48  SER B O   1 
ATOM 3327  C CB  . SER B 1 53  ? -67.789  166.031 -23.141 1.00 0.00 ? 48  SER B CB  1 
ATOM 3328  O OG  . SER B 1 53  ? -67.121  164.969 -23.834 1.00 0.00 ? 48  SER B OG  1 
ATOM 3329  N N   . GLY B 1 54  ? -68.835  167.836 -20.584 1.00 0.00 ? 49  GLY B N   1 
ATOM 3330  C CA  . GLY B 1 54  ? -69.249  169.060 -19.865 1.00 0.00 ? 49  GLY B CA  1 
ATOM 3331  C C   . GLY B 1 54  ? -68.503  169.052 -18.577 1.00 0.00 ? 49  GLY B C   1 
ATOM 3332  O O   . GLY B 1 54  ? -67.903  170.000 -18.165 1.00 0.00 ? 49  GLY B O   1 
ATOM 3333  N N   . ARG B 1 55  ? -68.462  167.867 -17.861 1.00 0.00 ? 50  ARG B N   1 
ATOM 3334  C CA  . ARG B 1 55  ? -67.878  167.970 -16.539 1.00 0.00 ? 50  ARG B CA  1 
ATOM 3335  C C   . ARG B 1 55  ? -66.342  168.147 -16.423 1.00 0.00 ? 50  ARG B C   1 
ATOM 3336  O O   . ARG B 1 55  ? -65.747  168.750 -15.504 1.00 0.00 ? 50  ARG B O   1 
ATOM 3337  C CB  . ARG B 1 55  ? -68.104  166.633 -15.759 1.00 0.00 ? 50  ARG B CB  1 
ATOM 3338  C CG  . ARG B 1 55  ? -69.497  166.455 -15.063 1.00 0.00 ? 50  ARG B CG  1 
ATOM 3339  C CD  . ARG B 1 55  ? -69.725  167.394 -13.829 1.00 0.00 ? 50  ARG B CD  1 
ATOM 3340  N NE  . ARG B 1 55  ? -71.141  167.117 -13.524 1.00 0.00 ? 50  ARG B NE  1 
ATOM 3341  C CZ  . ARG B 1 55  ? -71.939  167.757 -12.641 1.00 0.00 ? 50  ARG B CZ  1 
ATOM 3342  N NH1 . ARG B 1 55  ? -71.380  168.761 -11.930 1.00 0.00 ? 50  ARG B NH1 1 
ATOM 3343  N NH2 . ARG B 1 55  ? -73.224  167.565 -12.440 1.00 0.00 ? 50  ARG B NH2 1 
ATOM 3344  N N   . HIS B 1 56  ? -65.668  167.552 -17.410 1.00 0.00 ? 51  HIS B N   1 
ATOM 3345  C CA  . HIS B 1 56  ? -64.256  167.733 -17.864 1.00 0.00 ? 51  HIS B CA  1 
ATOM 3346  C C   . HIS B 1 56  ? -64.019  169.197 -18.292 1.00 0.00 ? 51  HIS B C   1 
ATOM 3347  O O   . HIS B 1 56  ? -62.981  169.815 -17.879 1.00 0.00 ? 51  HIS B O   1 
ATOM 3348  C CB  . HIS B 1 56  ? -63.645  166.781 -19.003 1.00 0.00 ? 51  HIS B CB  1 
ATOM 3349  C CG  . HIS B 1 56  ? -63.325  165.330 -18.618 1.00 0.00 ? 51  HIS B CG  1 
ATOM 3350  N ND1 . HIS B 1 56  ? -63.281  164.351 -19.538 1.00 0.00 ? 51  HIS B ND1 1 
ATOM 3351  C CD2 . HIS B 1 56  ? -63.580  164.703 -17.422 1.00 0.00 ? 51  HIS B CD2 1 
ATOM 3352  C CE1 . HIS B 1 56  ? -63.338  163.141 -18.904 1.00 0.00 ? 51  HIS B CE1 1 
ATOM 3353  N NE2 . HIS B 1 56  ? -63.558  163.336 -17.592 1.00 0.00 ? 51  HIS B NE2 1 
ATOM 3354  N N   . TYR B 1 57  ? -65.004  169.834 -19.013 1.00 0.00 ? 52  TYR B N   1 
ATOM 3355  C CA  . TYR B 1 57  ? -64.970  171.191 -19.366 1.00 0.00 ? 52  TYR B CA  1 
ATOM 3356  C C   . TYR B 1 57  ? -65.048  172.135 -18.165 1.00 0.00 ? 52  TYR B C   1 
ATOM 3357  O O   . TYR B 1 57  ? -64.328  173.093 -17.998 1.00 0.00 ? 52  TYR B O   1 
ATOM 3358  C CB  . TYR B 1 57  ? -65.807  171.479 -20.659 1.00 0.00 ? 52  TYR B CB  1 
ATOM 3359  C CG  . TYR B 1 57  ? -65.885  172.988 -21.109 1.00 0.00 ? 52  TYR B CG  1 
ATOM 3360  C CD1 . TYR B 1 57  ? -64.737  173.689 -21.650 1.00 0.00 ? 52  TYR B CD1 1 
ATOM 3361  C CD2 . TYR B 1 57  ? -67.044  173.699 -21.114 1.00 0.00 ? 52  TYR B CD2 1 
ATOM 3362  C CE1 . TYR B 1 57  ? -64.721  175.015 -22.129 1.00 0.00 ? 52  TYR B CE1 1 
ATOM 3363  C CE2 . TYR B 1 57  ? -67.121  174.953 -21.790 1.00 0.00 ? 52  TYR B CE2 1 
ATOM 3364  C CZ  . TYR B 1 57  ? -65.987  175.590 -22.303 1.00 0.00 ? 52  TYR B CZ  1 
ATOM 3365  O OH  . TYR B 1 57  ? -65.924  176.831 -22.917 1.00 0.00 ? 52  TYR B OH  1 
ATOM 3366  N N   . LEU B 1 58  ? -66.075  171.952 -17.264 1.00 0.00 ? 53  LEU B N   1 
ATOM 3367  C CA  . LEU B 1 58  ? -66.157  172.744 -16.044 1.00 0.00 ? 53  LEU B CA  1 
ATOM 3368  C C   . LEU B 1 58  ? -64.845  172.592 -15.156 1.00 0.00 ? 53  LEU B C   1 
ATOM 3369  O O   . LEU B 1 58  ? -64.255  173.562 -14.655 1.00 0.00 ? 53  LEU B O   1 
ATOM 3370  C CB  . LEU B 1 58  ? -67.446  172.330 -15.181 1.00 0.00 ? 53  LEU B CB  1 
ATOM 3371  C CG  . LEU B 1 58  ? -68.763  172.665 -15.853 1.00 0.00 ? 53  LEU B CG  1 
ATOM 3372  C CD1 . LEU B 1 58  ? -69.843  172.154 -14.988 1.00 0.00 ? 53  LEU B CD1 1 
ATOM 3373  C CD2 . LEU B 1 58  ? -68.858  174.181 -16.118 1.00 0.00 ? 53  LEU B CD2 1 
ATOM 3374  N N   . ALA B 1 59  ? -64.241  171.345 -14.962 1.00 0.00 ? 54  ALA B N   1 
ATOM 3375  C CA  . ALA B 1 59  ? -62.944  171.170 -14.290 1.00 0.00 ? 54  ALA B CA  1 
ATOM 3376  C C   . ALA B 1 59  ? -61.720  171.800 -14.940 1.00 0.00 ? 54  ALA B C   1 
ATOM 3377  O O   . ALA B 1 59  ? -60.929  172.551 -14.316 1.00 0.00 ? 54  ALA B O   1 
ATOM 3378  C CB  . ALA B 1 59  ? -62.754  169.739 -13.941 1.00 0.00 ? 54  ALA B CB  1 
ATOM 3379  N N   . ALA B 1 60  ? -61.612  171.739 -16.270 1.00 0.00 ? 55  ALA B N   1 
ATOM 3380  C CA  . ALA B 1 60  ? -60.688  172.487 -17.145 1.00 0.00 ? 55  ALA B CA  1 
ATOM 3381  C C   . ALA B 1 60  ? -60.815  174.000 -16.900 1.00 0.00 ? 55  ALA B C   1 
ATOM 3382  O O   . ALA B 1 60  ? -59.821  174.708 -16.663 1.00 0.00 ? 55  ALA B O   1 
ATOM 3383  C CB  . ALA B 1 60  ? -60.992  172.072 -18.606 1.00 0.00 ? 55  ALA B CB  1 
ATOM 3384  N N   . SER B 1 61  ? -61.997  174.566 -16.925 1.00 0.00 ? 56  SER B N   1 
ATOM 3385  C CA  . SER B 1 61  ? -62.257  175.965 -16.550 1.00 0.00 ? 56  SER B CA  1 
ATOM 3386  C C   . SER B 1 61  ? -61.937  176.314 -15.153 1.00 0.00 ? 56  SER B C   1 
ATOM 3387  O O   . SER B 1 61  ? -61.271  177.286 -14.941 1.00 0.00 ? 56  SER B O   1 
ATOM 3388  C CB  . SER B 1 61  ? -63.769  176.306 -16.798 1.00 0.00 ? 56  SER B CB  1 
ATOM 3389  O OG  . SER B 1 61  ? -64.135  176.003 -18.130 1.00 0.00 ? 56  SER B OG  1 
ATOM 3390  N N   . ARG B 1 62  ? -62.332  175.489 -14.169 1.00 0.00 ? 57  ARG B N   1 
ATOM 3391  C CA  . ARG B 1 62  ? -62.143  175.678 -12.782 1.00 0.00 ? 57  ARG B CA  1 
ATOM 3392  C C   . ARG B 1 62  ? -60.657  175.759 -12.447 1.00 0.00 ? 57  ARG B C   1 
ATOM 3393  O O   . ARG B 1 62  ? -60.173  176.573 -11.713 1.00 0.00 ? 57  ARG B O   1 
ATOM 3394  C CB  . ARG B 1 62  ? -62.893  174.501 -12.042 1.00 0.00 ? 57  ARG B CB  1 
ATOM 3395  C CG  . ARG B 1 62  ? -63.080  174.683 -10.529 1.00 0.00 ? 57  ARG B CG  1 
ATOM 3396  C CD  . ARG B 1 62  ? -64.252  175.566 -10.075 1.00 0.00 ? 57  ARG B CD  1 
ATOM 3397  N NE  . ARG B 1 62  ? -65.448  174.710 -10.062 1.00 0.00 ? 57  ARG B NE  1 
ATOM 3398  C CZ  . ARG B 1 62  ? -66.669  175.206 -9.617  1.00 0.00 ? 57  ARG B CZ  1 
ATOM 3399  N NH1 . ARG B 1 62  ? -66.812  176.424 -9.105  1.00 0.00 ? 57  ARG B NH1 1 
ATOM 3400  N NH2 . ARG B 1 62  ? -67.756  174.429 -9.665  1.00 0.00 ? 57  ARG B NH2 1 
ATOM 3401  N N   . ALA B 1 63  ? -59.838  174.906 -13.033 1.00 0.00 ? 58  ALA B N   1 
ATOM 3402  C CA  . ALA B 1 63  ? -58.331  174.984 -12.915 1.00 0.00 ? 58  ALA B CA  1 
ATOM 3403  C C   . ALA B 1 63  ? -57.680  176.235 -13.583 1.00 0.00 ? 58  ALA B C   1 
ATOM 3404  O O   . ALA B 1 63  ? -56.782  176.818 -13.084 1.00 0.00 ? 58  ALA B O   1 
ATOM 3405  C CB  . ALA B 1 63  ? -57.741  173.657 -13.541 1.00 0.00 ? 58  ALA B CB  1 
ATOM 3406  N N   . PHE B 1 64  ? -58.140  176.709 -14.801 1.00 0.00 ? 59  PHE B N   1 
ATOM 3407  C CA  . PHE B 1 64  ? -57.827  177.944 -15.492 1.00 0.00 ? 59  PHE B CA  1 
ATOM 3408  C C   . PHE B 1 64  ? -58.215  179.154 -14.608 1.00 0.00 ? 59  PHE B C   1 
ATOM 3409  O O   . PHE B 1 64  ? -57.413  180.077 -14.437 1.00 0.00 ? 59  PHE B O   1 
ATOM 3410  C CB  . PHE B 1 64  ? -58.613  177.966 -16.816 1.00 0.00 ? 59  PHE B CB  1 
ATOM 3411  C CG  . PHE B 1 64  ? -58.254  179.075 -17.739 1.00 0.00 ? 59  PHE B CG  1 
ATOM 3412  C CD1 . PHE B 1 64  ? -57.032  179.119 -18.516 1.00 0.00 ? 59  PHE B CD1 1 
ATOM 3413  C CD2 . PHE B 1 64  ? -59.247  180.017 -18.006 1.00 0.00 ? 59  PHE B CD2 1 
ATOM 3414  C CE1 . PHE B 1 64  ? -56.898  180.077 -19.495 1.00 0.00 ? 59  PHE B CE1 1 
ATOM 3415  C CE2 . PHE B 1 64  ? -59.119  181.021 -18.930 1.00 0.00 ? 59  PHE B CE2 1 
ATOM 3416  C CZ  . PHE B 1 64  ? -58.012  180.939 -19.806 1.00 0.00 ? 59  PHE B CZ  1 
ATOM 3417  N N   . VAL B 1 65  ? -59.467  179.195 -13.973 1.00 0.00 ? 60  VAL B N   1 
ATOM 3418  C CA  . VAL B 1 65  ? -59.752  180.299 -13.109 1.00 0.00 ? 60  VAL B CA  1 
ATOM 3419  C C   . VAL B 1 65  ? -58.873  180.323 -11.878 1.00 0.00 ? 60  VAL B C   1 
ATOM 3420  O O   . VAL B 1 65  ? -58.444  181.365 -11.402 1.00 0.00 ? 60  VAL B O   1 
ATOM 3421  C CB  . VAL B 1 65  ? -61.249  180.433 -12.748 1.00 0.00 ? 60  VAL B CB  1 
ATOM 3422  C CG1 . VAL B 1 65  ? -61.477  181.599 -11.800 1.00 0.00 ? 60  VAL B CG1 1 
ATOM 3423  C CG2 . VAL B 1 65  ? -62.148  180.596 -14.004 1.00 0.00 ? 60  VAL B CG2 1 
ATOM 3424  N N   . VAL B 1 66  ? -58.431  179.174 -11.282 1.00 0.00 ? 61  VAL B N   1 
ATOM 3425  C CA  . VAL B 1 66  ? -57.382  179.233 -10.223 1.00 0.00 ? 61  VAL B CA  1 
ATOM 3426  C C   . VAL B 1 66  ? -56.059  179.802 -10.728 1.00 0.00 ? 61  VAL B C   1 
ATOM 3427  O O   . VAL B 1 66  ? -55.457  180.668 -10.140 1.00 0.00 ? 61  VAL B O   1 
ATOM 3428  C CB  . VAL B 1 66  ? -57.033  177.795 -9.613  1.00 0.00 ? 61  VAL B CB  1 
ATOM 3429  C CG1 . VAL B 1 66  ? -55.998  178.024 -8.426  1.00 0.00 ? 61  VAL B CG1 1 
ATOM 3430  C CG2 . VAL B 1 66  ? -58.368  177.308 -8.956  1.00 0.00 ? 61  VAL B CG2 1 
ATOM 3431  N N   . GLY B 1 67  ? -55.577  179.439 -11.930 1.00 0.00 ? 62  GLY B N   1 
ATOM 3432  C CA  . GLY B 1 67  ? -54.378  180.127 -12.525 1.00 0.00 ? 62  GLY B CA  1 
ATOM 3433  C C   . GLY B 1 67  ? -54.441  181.645 -12.740 1.00 0.00 ? 62  GLY B C   1 
ATOM 3434  O O   . GLY B 1 67  ? -53.415  182.264 -12.651 1.00 0.00 ? 62  GLY B O   1 
ATOM 3435  N N   . ILE B 1 68  ? -55.684  182.269 -12.980 1.00 0.00 ? 63  ILE B N   1 
ATOM 3436  C CA  . ILE B 1 68  ? -55.766  183.742 -13.066 1.00 0.00 ? 63  ILE B CA  1 
ATOM 3437  C C   . ILE B 1 68  ? -55.715  184.305 -11.642 1.00 0.00 ? 63  ILE B C   1 
ATOM 3438  O O   . ILE B 1 68  ? -55.125  185.350 -11.372 1.00 0.00 ? 63  ILE B O   1 
ATOM 3439  C CB  . ILE B 1 68  ? -57.098  184.103 -13.726 1.00 0.00 ? 63  ILE B CB  1 
ATOM 3440  C CG1 . ILE B 1 68  ? -57.276  183.515 -15.193 1.00 0.00 ? 63  ILE B CG1 1 
ATOM 3441  C CG2 . ILE B 1 68  ? -57.241  185.661 -13.720 1.00 0.00 ? 63  ILE B CG2 1 
ATOM 3442  C CD1 . ILE B 1 68  ? -58.636  183.960 -15.783 1.00 0.00 ? 63  ILE B CD1 1 
ATOM 3443  N N   . CYS B 1 69  ? -56.358  183.592 -10.663 1.00 0.00 ? 64  CYS B N   1 
ATOM 3444  C CA  . CYS B 1 69  ? -56.266  183.965 -9.218  1.00 0.00 ? 64  CYS B CA  1 
ATOM 3445  C C   . CYS B 1 69  ? -54.876  184.059 -8.598  1.00 0.00 ? 64  CYS B C   1 
ATOM 3446  O O   . CYS B 1 69  ? -54.603  184.939 -7.717  1.00 0.00 ? 64  CYS B O   1 
ATOM 3447  C CB  . CYS B 1 69  ? -57.304  183.126 -8.403  1.00 0.00 ? 64  CYS B CB  1 
ATOM 3448  S SG  . CYS B 1 69  ? -59.061  183.328 -9.067  1.00 0.00 ? 64  CYS B SG  1 
ATOM 3449  N N   . ASP B 1 70  ? -53.900  183.349 -9.178  1.00 0.00 ? 65  ASP B N   1 
ATOM 3450  C CA  . ASP B 1 70  ? -52.627  183.166 -8.571  1.00 0.00 ? 65  ASP B CA  1 
ATOM 3451  C C   . ASP B 1 70  ? -51.698  184.326 -8.740  1.00 0.00 ? 65  ASP B C   1 
ATOM 3452  O O   . ASP B 1 70  ? -50.878  184.652 -7.873  1.00 0.00 ? 65  ASP B O   1 
ATOM 3453  C CB  . ASP B 1 70  ? -51.980  181.830 -9.266  1.00 0.00 ? 65  ASP B CB  1 
ATOM 3454  C CG  . ASP B 1 70  ? -50.983  181.275 -8.309  1.00 0.00 ? 65  ASP B CG  1 
ATOM 3455  O OD1 . ASP B 1 70  ? -50.664  181.949 -7.339  1.00 0.00 ? 65  ASP B OD1 1 
ATOM 3456  O OD2 . ASP B 1 70  ? -50.510  180.149 -8.526  1.00 0.00 ? 65  ASP B OD2 1 
ATOM 3457  N N   . LEU B 1 71  ? -51.919  185.033 -9.848  1.00 0.00 ? 66  LEU B N   1 
ATOM 3458  C CA  . LEU B 1 71  ? -51.381  186.309 -10.240 1.00 0.00 ? 66  LEU B CA  1 
ATOM 3459  C C   . LEU B 1 71  ? -51.725  187.350 -9.257  1.00 0.00 ? 66  LEU B C   1 
ATOM 3460  O O   . LEU B 1 71  ? -50.980  188.215 -8.834  1.00 0.00 ? 66  LEU B O   1 
ATOM 3461  C CB  . LEU B 1 71  ? -51.918  186.725 -11.626 1.00 0.00 ? 66  LEU B CB  1 
ATOM 3462  C CG  . LEU B 1 71  ? -51.692  185.729 -12.719 1.00 0.00 ? 66  LEU B CG  1 
ATOM 3463  C CD1 . LEU B 1 71  ? -52.631  186.047 -13.951 1.00 0.00 ? 66  LEU B CD1 1 
ATOM 3464  C CD2 . LEU B 1 71  ? -50.210  185.854 -13.126 1.00 0.00 ? 66  LEU B CD2 1 
ATOM 3465  N N   . ALA B 1 72  ? -52.996  187.297 -8.808  1.00 0.00 ? 67  ALA B N   1 
ATOM 3466  C CA  . ALA B 1 72  ? -53.669  188.315 -8.026  1.00 0.00 ? 67  ALA B CA  1 
ATOM 3467  C C   . ALA B 1 72  ? -53.151  188.461 -6.559  1.00 0.00 ? 67  ALA B C   1 
ATOM 3468  O O   . ALA B 1 72  ? -52.784  189.519 -6.143  1.00 0.00 ? 67  ALA B O   1 
ATOM 3469  C CB  . ALA B 1 72  ? -55.167  188.077 -8.006  1.00 0.00 ? 67  ALA B CB  1 
ATOM 3470  N N   . ARG B 1 73  ? -52.938  187.346 -5.863  1.00 0.00 ? 68  ARG B N   1 
ATOM 3471  C CA  . ARG B 1 73  ? -52.233  187.317 -4.571  1.00 0.00 ? 68  ARG B CA  1 
ATOM 3472  C C   . ARG B 1 73  ? -50.731  187.569 -4.672  1.00 0.00 ? 68  ARG B C   1 
ATOM 3473  O O   . ARG B 1 73  ? -50.056  187.838 -3.578  1.00 0.00 ? 68  ARG B O   1 
ATOM 3474  C CB  . ARG B 1 73  ? -52.471  185.973 -3.903  1.00 0.00 ? 68  ARG B CB  1 
ATOM 3475  C CG  . ARG B 1 73  ? -52.019  184.662 -4.601  1.00 0.00 ? 68  ARG B CG  1 
ATOM 3476  C CD  . ARG B 1 73  ? -52.447  183.409 -3.904  1.00 0.00 ? 68  ARG B CD  1 
ATOM 3477  N NE  . ARG B 1 73  ? -51.966  182.329 -4.780  1.00 0.00 ? 68  ARG B NE  1 
ATOM 3478  C CZ  . ARG B 1 73  ? -51.519  181.148 -4.422  1.00 0.00 ? 68  ARG B CZ  1 
ATOM 3479  N NH1 . ARG B 1 73  ? -51.755  180.636 -3.209  1.00 0.00 ? 68  ARG B NH1 1 
ATOM 3480  N NH2 . ARG B 1 73  ? -50.742  180.326 -5.174  1.00 0.00 ? 68  ARG B NH2 1 
ATOM 3481  N N   . LEU B 1 74  ? -50.094  187.463 -5.844  1.00 0.00 ? 69  LEU B N   1 
ATOM 3482  C CA  . LEU B 1 74  ? -48.638  187.712 -6.096  1.00 0.00 ? 69  LEU B CA  1 
ATOM 3483  C C   . LEU B 1 74  ? -48.380  189.203 -6.144  1.00 0.00 ? 69  LEU B C   1 
ATOM 3484  O O   . LEU B 1 74  ? -47.424  189.774 -5.599  1.00 0.00 ? 69  LEU B O   1 
ATOM 3485  C CB  . LEU B 1 74  ? -48.169  187.073 -7.363  1.00 0.00 ? 69  LEU B CB  1 
ATOM 3486  C CG  . LEU B 1 74  ? -46.572  186.862 -7.527  1.00 0.00 ? 69  LEU B CG  1 
ATOM 3487  C CD1 . LEU B 1 74  ? -45.936  185.967 -6.403  1.00 0.00 ? 69  LEU B CD1 1 
ATOM 3488  C CD2 . LEU B 1 74  ? -46.296  186.319 -8.934  1.00 0.00 ? 69  LEU B CD2 1 
ATOM 3489  N N   . GLY B 1 75  ? -49.338  189.871 -6.833  1.00 0.00 ? 70  GLY B N   1 
ATOM 3490  C CA  . GLY B 1 75  ? -49.364  191.292 -7.075  1.00 0.00 ? 70  GLY B CA  1 
ATOM 3491  C C   . GLY B 1 75  ? -49.538  192.152 -5.854  1.00 0.00 ? 70  GLY B C   1 
ATOM 3492  O O   . GLY B 1 75  ? -49.560  191.689 -4.704  1.00 0.00 ? 70  GLY B O   1 
ATOM 3493  N N   . PRO B 1 76  ? -49.666  193.459 -6.069  1.00 0.00 ? 71  PRO B N   1 
ATOM 3494  C CA  . PRO B 1 76  ? -49.938  194.305 -4.945  1.00 0.00 ? 71  PRO B CA  1 
ATOM 3495  C C   . PRO B 1 76  ? -51.399  194.195 -4.638  1.00 0.00 ? 71  PRO B C   1 
ATOM 3496  O O   . PRO B 1 76  ? -52.187  193.801 -5.472  1.00 0.00 ? 71  PRO B O   1 
ATOM 3497  C CB  . PRO B 1 76  ? -49.745  195.724 -5.491  1.00 0.00 ? 71  PRO B CB  1 
ATOM 3498  C CG  . PRO B 1 76  ? -50.122  195.610 -6.950  1.00 0.00 ? 71  PRO B CG  1 
ATOM 3499  C CD  . PRO B 1 76  ? -49.522  194.275 -7.284  1.00 0.00 ? 71  PRO B CD  1 
ATOM 3500  N N   . PRO B 1 77  ? -51.851  194.455 -3.447  1.00 0.00 ? 72  PRO B N   1 
ATOM 3501  C CA  . PRO B 1 77  ? -53.325  194.333 -3.079  1.00 0.00 ? 72  PRO B CA  1 
ATOM 3502  C C   . PRO B 1 77  ? -54.085  195.703 -3.131  1.00 0.00 ? 72  PRO B C   1 
ATOM 3503  O O   . PRO B 1 77  ? -54.667  196.244 -2.174  1.00 0.00 ? 72  PRO B O   1 
ATOM 3504  C CB  . PRO B 1 77  ? -53.099  194.074 -1.580  1.00 0.00 ? 72  PRO B CB  1 
ATOM 3505  C CG  . PRO B 1 77  ? -51.933  194.992 -1.176  1.00 0.00 ? 72  PRO B CG  1 
ATOM 3506  C CD  . PRO B 1 77  ? -51.013  194.543 -2.303  1.00 0.00 ? 72  PRO B CD  1 
ATOM 3507  N N   . GLU B 1 78  ? -54.043  196.277 -4.386  1.00 0.00 ? 73  GLU B N   1 
ATOM 3508  C CA  . GLU B 1 78  ? -54.635  197.614 -4.560  1.00 0.00 ? 73  GLU B CA  1 
ATOM 3509  C C   . GLU B 1 78  ? -56.129  197.573 -4.926  1.00 0.00 ? 73  GLU B C   1 
ATOM 3510  O O   . GLU B 1 78  ? -56.560  196.592 -5.548  1.00 0.00 ? 73  GLU B O   1 
ATOM 3511  C CB  . GLU B 1 78  ? -53.798  198.442 -5.535  1.00 0.00 ? 73  GLU B CB  1 
ATOM 3512  C CG  . GLU B 1 78  ? -53.938  197.819 -6.941  1.00 0.00 ? 73  GLU B CG  1 
ATOM 3513  C CD  . GLU B 1 78  ? -53.294  198.697 -8.010  1.00 0.00 ? 73  GLU B CD  1 
ATOM 3514  O OE1 . GLU B 1 78  ? -52.031  198.579 -8.190  1.00 0.00 ? 73  GLU B OE1 1 
ATOM 3515  O OE2 . GLU B 1 78  ? -54.010  199.398 -8.751  1.00 0.00 ? 73  GLU B OE2 1 
ATOM 3516  N N   . PRO B 1 79  ? -56.921  198.589 -4.577  1.00 0.00 ? 74  PRO B N   1 
ATOM 3517  C CA  . PRO B 1 79  ? -58.364  198.594 -4.971  1.00 0.00 ? 74  PRO B CA  1 
ATOM 3518  C C   . PRO B 1 79  ? -58.900  198.016 -6.267  1.00 0.00 ? 74  PRO B C   1 
ATOM 3519  O O   . PRO B 1 79  ? -59.911  197.212 -6.172  1.00 0.00 ? 74  PRO B O   1 
ATOM 3520  C CB  . PRO B 1 79  ? -58.722  200.190 -4.887  1.00 0.00 ? 74  PRO B CB  1 
ATOM 3521  C CG  . PRO B 1 79  ? -57.725  200.654 -3.784  1.00 0.00 ? 74  PRO B CG  1 
ATOM 3522  C CD  . PRO B 1 79  ? -56.466  199.818 -4.068  1.00 0.00 ? 74  PRO B CD  1 
ATOM 3523  N N   . MET B 1 80  ? -58.279  198.352 -7.415  1.00 0.00 ? 75  MET B N   1 
ATOM 3524  C CA  . MET B 1 80  ? -58.711  197.747 -8.732  1.00 0.00 ? 75  MET B CA  1 
ATOM 3525  C C   . MET B 1 80  ? -58.424  196.201 -8.805  1.00 0.00 ? 75  MET B C   1 
ATOM 3526  O O   . MET B 1 80  ? -59.229  195.353 -9.196  1.00 0.00 ? 75  MET B O   1 
ATOM 3527  C CB  . MET B 1 80  ? -57.817  198.405 -9.817  1.00 0.00 ? 75  MET B CB  1 
ATOM 3528  C CG  . MET B 1 80  ? -58.280  197.911 -11.241 1.00 0.00 ? 75  MET B CG  1 
ATOM 3529  S SD  . MET B 1 80  ? -57.742  198.904 -12.717 1.00 0.00 ? 75  MET B SD  1 
ATOM 3530  C CE  . MET B 1 80  ? -56.011  198.424 -12.779 1.00 0.00 ? 75  MET B CE  1 
ATOM 3531  N N   . MET B 1 81  ? -57.282  195.694 -8.324  1.00 0.00 ? 76  MET B N   1 
ATOM 3532  C CA  . MET B 1 81  ? -56.826  194.325 -8.201  1.00 0.00 ? 76  MET B CA  1 
ATOM 3533  C C   . MET B 1 81  ? -57.633  193.659 -7.095  1.00 0.00 ? 76  MET B C   1 
ATOM 3534  O O   . MET B 1 81  ? -58.151  192.549 -7.233  1.00 0.00 ? 76  MET B O   1 
ATOM 3535  C CB  . MET B 1 81  ? -55.330  194.205 -7.791  1.00 0.00 ? 76  MET B CB  1 
ATOM 3536  C CG  . MET B 1 81  ? -54.327  194.878 -8.822  1.00 0.00 ? 76  MET B CG  1 
ATOM 3537  S SD  . MET B 1 81  ? -54.388  194.093 -10.475 1.00 0.00 ? 76  MET B SD  1 
ATOM 3538  C CE  . MET B 1 81  ? -55.366  195.260 -11.384 1.00 0.00 ? 76  MET B CE  1 
ATOM 3539  N N   . ALA B 1 82  ? -57.697  194.391 -5.922  1.00 0.00 ? 77  ALA B N   1 
ATOM 3540  C CA  . ALA B 1 82  ? -58.238  193.804 -4.711  1.00 0.00 ? 77  ALA B CA  1 
ATOM 3541  C C   . ALA B 1 82  ? -59.771  193.436 -4.878  1.00 0.00 ? 77  ALA B C   1 
ATOM 3542  O O   . ALA B 1 82  ? -60.262  192.374 -4.422  1.00 0.00 ? 77  ALA B O   1 
ATOM 3543  C CB  . ALA B 1 82  ? -58.104  194.706 -3.487  1.00 0.00 ? 77  ALA B CB  1 
ATOM 3544  N N   . GLU B 1 83  ? -60.597  194.308 -5.514  1.00 0.00 ? 78  GLU B N   1 
ATOM 3545  C CA  . GLU B 1 83  ? -62.038  194.242 -5.586  1.00 0.00 ? 78  GLU B CA  1 
ATOM 3546  C C   . GLU B 1 83  ? -62.361  193.878 -7.032  1.00 0.00 ? 78  GLU B C   1 
ATOM 3547  O O   . GLU B 1 83  ? -62.879  192.772 -7.268  1.00 0.00 ? 78  GLU B O   1 
ATOM 3548  C CB  . GLU B 1 83  ? -62.655  195.605 -5.375  1.00 0.00 ? 78  GLU B CB  1 
ATOM 3549  C CG  . GLU B 1 83  ? -64.215  195.551 -5.520  1.00 0.00 ? 78  GLU B CG  1 
ATOM 3550  C CD  . GLU B 1 83  ? -64.828  196.905 -5.060  1.00 0.00 ? 78  GLU B CD  1 
ATOM 3551  O OE1 . GLU B 1 83  ? -65.062  197.059 -3.843  1.00 0.00 ? 78  GLU B OE1 1 
ATOM 3552  O OE2 . GLU B 1 83  ? -65.218  197.798 -5.871  1.00 0.00 ? 78  GLU B OE2 1 
ATOM 3553  N N   . CYS B 1 84  ? -61.966  194.694 -8.090  1.00 0.00 ? 79  CYS B N   1 
ATOM 3554  C CA  . CYS B 1 84  ? -62.440  194.374 -9.466  1.00 0.00 ? 79  CYS B CA  1 
ATOM 3555  C C   . CYS B 1 84  ? -61.922  193.014 -9.945  1.00 0.00 ? 79  CYS B C   1 
ATOM 3556  O O   . CYS B 1 84  ? -62.741  192.187 -10.438 1.00 0.00 ? 79  CYS B O   1 
ATOM 3557  C CB  . CYS B 1 84  ? -62.121  195.514 -10.456 1.00 0.00 ? 79  CYS B CB  1 
ATOM 3558  S SG  . CYS B 1 84  ? -62.618  197.135 -9.911  1.00 0.00 ? 79  CYS B SG  1 
ATOM 3559  N N   . LEU B 1 85  ? -60.659  192.697 -9.796  1.00 0.00 ? 80  LEU B N   1 
ATOM 3560  C CA  . LEU B 1 85  ? -60.052  191.518 -10.374 1.00 0.00 ? 80  LEU B CA  1 
ATOM 3561  C C   . LEU B 1 85  ? -60.701  190.243 -9.665  1.00 0.00 ? 80  LEU B C   1 
ATOM 3562  O O   . LEU B 1 85  ? -60.918  189.194 -10.215 1.00 0.00 ? 80  LEU B O   1 
ATOM 3563  C CB  . LEU B 1 85  ? -58.532  191.492 -10.387 1.00 0.00 ? 80  LEU B CB  1 
ATOM 3564  C CG  . LEU B 1 85  ? -57.768  190.445 -11.310 1.00 0.00 ? 80  LEU B CG  1 
ATOM 3565  C CD1 . LEU B 1 85  ? -57.865  190.881 -12.839 1.00 0.00 ? 80  LEU B CD1 1 
ATOM 3566  C CD2 . LEU B 1 85  ? -56.354  190.241 -10.818 1.00 0.00 ? 80  LEU B CD2 1 
ATOM 3567  N N   . GLU B 1 86  ? -60.948  190.408 -8.355  1.00 0.00 ? 81  GLU B N   1 
ATOM 3568  C CA  . GLU B 1 86  ? -61.706  189.386 -7.598  1.00 0.00 ? 81  GLU B CA  1 
ATOM 3569  C C   . GLU B 1 86  ? -63.194  189.227 -7.990  1.00 0.00 ? 81  GLU B C   1 
ATOM 3570  O O   . GLU B 1 86  ? -63.724  188.113 -8.003  1.00 0.00 ? 81  GLU B O   1 
ATOM 3571  C CB  . GLU B 1 86  ? -61.761  189.715 -6.062  1.00 0.00 ? 81  GLU B CB  1 
ATOM 3572  C CG  . GLU B 1 86  ? -62.068  188.427 -5.201  1.00 0.00 ? 81  GLU B CG  1 
ATOM 3573  C CD  . GLU B 1 86  ? -62.080  188.605 -3.741  1.00 0.00 ? 81  GLU B CD  1 
ATOM 3574  O OE1 . GLU B 1 86  ? -63.021  189.172 -3.134  1.00 0.00 ? 81  GLU B OE1 1 
ATOM 3575  O OE2 . GLU B 1 86  ? -61.069  188.103 -3.157  1.00 0.00 ? 81  GLU B OE2 1 
ATOM 3576  N N   . LYS B 1 87  ? -63.898  190.316 -8.343  1.00 0.00 ? 82  LYS B N   1 
ATOM 3577  C CA  . LYS B 1 87  ? -65.288  190.249 -8.730  1.00 0.00 ? 82  LYS B CA  1 
ATOM 3578  C C   . LYS B 1 87  ? -65.375  189.630 -10.098 1.00 0.00 ? 82  LYS B C   1 
ATOM 3579  O O   . LYS B 1 87  ? -66.304  188.842 -10.299 1.00 0.00 ? 82  LYS B O   1 
ATOM 3580  C CB  . LYS B 1 87  ? -65.891  191.674 -8.683  1.00 0.00 ? 82  LYS B CB  1 
ATOM 3581  C CG  . LYS B 1 87  ? -66.168  192.144 -7.227  1.00 0.00 ? 82  LYS B CG  1 
ATOM 3582  C CD  . LYS B 1 87  ? -67.467  191.615 -6.535  1.00 0.00 ? 82  LYS B CD  1 
ATOM 3583  C CE  . LYS B 1 87  ? -67.766  192.352 -5.251  1.00 0.00 ? 82  LYS B CE  1 
ATOM 3584  N NZ  . LYS B 1 87  ? -68.758  191.693 -4.494  1.00 0.00 ? 82  LYS B NZ  1 
ATOM 3585  N N   . PHE B 1 88  ? -64.373  189.807 -10.945 1.00 0.00 ? 83  PHE B N   1 
ATOM 3586  C CA  . PHE B 1 88  ? -64.410  189.154 -12.258 1.00 0.00 ? 83  PHE B CA  1 
ATOM 3587  C C   . PHE B 1 88  ? -64.264  187.684 -12.202 1.00 0.00 ? 83  PHE B C   1 
ATOM 3588  O O   . PHE B 1 88  ? -64.980  186.890 -12.780 1.00 0.00 ? 83  PHE B O   1 
ATOM 3589  C CB  . PHE B 1 88  ? -63.372  189.685 -13.286 1.00 0.00 ? 83  PHE B CB  1 
ATOM 3590  C CG  . PHE B 1 88  ? -63.734  191.075 -13.764 1.00 0.00 ? 83  PHE B CG  1 
ATOM 3591  C CD1 . PHE B 1 88  ? -64.843  191.269 -14.652 1.00 0.00 ? 83  PHE B CD1 1 
ATOM 3592  C CD2 . PHE B 1 88  ? -62.860  192.161 -13.567 1.00 0.00 ? 83  PHE B CD2 1 
ATOM 3593  C CE1 . PHE B 1 88  ? -65.097  192.572 -15.143 1.00 0.00 ? 83  PHE B CE1 1 
ATOM 3594  C CE2 . PHE B 1 88  ? -63.020  193.397 -14.218 1.00 0.00 ? 83  PHE B CE2 1 
ATOM 3595  C CZ  . PHE B 1 88  ? -64.161  193.622 -14.935 1.00 0.00 ? 83  PHE B CZ  1 
ATOM 3596  N N   . THR B 1 89  ? -63.380  187.171 -11.351 1.00 0.00 ? 84  THR B N   1 
ATOM 3597  C CA  . THR B 1 89  ? -62.995  185.753 -11.271 1.00 0.00 ? 84  THR B CA  1 
ATOM 3598  C C   . THR B 1 89  ? -64.087  184.961 -10.388 1.00 0.00 ? 84  THR B C   1 
ATOM 3599  O O   . THR B 1 89  ? -64.311  183.810 -10.787 1.00 0.00 ? 84  THR B O   1 
ATOM 3600  C CB  . THR B 1 89  ? -61.624  185.516 -10.759 1.00 0.00 ? 84  THR B CB  1 
ATOM 3601  O OG1 . THR B 1 89  ? -61.470  186.137 -9.479  1.00 0.00 ? 84  THR B OG1 1 
ATOM 3602  C CG2 . THR B 1 89  ? -60.466  186.092 -11.682 1.00 0.00 ? 84  THR B CG2 1 
ATOM 3603  N N   . VAL B 1 90  ? -64.634  185.547 -9.376  1.00 0.00 ? 85  VAL B N   1 
ATOM 3604  C CA  . VAL B 1 90  ? -65.694  184.900 -8.541  1.00 0.00 ? 85  VAL B CA  1 
ATOM 3605  C C   . VAL B 1 90  ? -67.002  184.757 -9.399  1.00 0.00 ? 85  VAL B C   1 
ATOM 3606  O O   . VAL B 1 90  ? -67.707  183.790 -9.316  1.00 0.00 ? 85  VAL B O   1 
ATOM 3607  C CB  . VAL B 1 90  ? -65.911  185.843 -7.355  1.00 0.00 ? 85  VAL B CB  1 
ATOM 3608  C CG1 . VAL B 1 90  ? -67.346  185.590 -6.677  1.00 0.00 ? 85  VAL B CG1 1 
ATOM 3609  C CG2 . VAL B 1 90  ? -64.834  185.753 -6.305  1.00 0.00 ? 85  VAL B CG2 1 
ATOM 3610  N N   . SER B 1 91  ? -67.328  185.766 -10.232 1.00 0.00 ? 86  SER B N   1 
ATOM 3611  C CA  . SER B 1 91  ? -68.367  185.631 -11.212 1.00 0.00 ? 86  SER B CA  1 
ATOM 3612  C C   . SER B 1 91  ? -68.076  184.458 -12.160 1.00 0.00 ? 86  SER B C   1 
ATOM 3613  O O   . SER B 1 91  ? -69.042  183.711 -12.403 1.00 0.00 ? 86  SER B O   1 
ATOM 3614  C CB  . SER B 1 91  ? -68.477  186.903 -12.091 1.00 0.00 ? 86  SER B CB  1 
ATOM 3615  O OG  . SER B 1 91  ? -69.622  186.897 -12.985 1.00 0.00 ? 86  SER B OG  1 
ATOM 3616  N N   . LEU B 1 92  ? -66.825  184.246 -12.598 1.00 0.00 ? 87  LEU B N   1 
ATOM 3617  C CA  . LEU B 1 92  ? -66.422  183.011 -13.318 1.00 0.00 ? 87  LEU B CA  1 
ATOM 3618  C C   . LEU B 1 92  ? -66.670  181.729 -12.604 1.00 0.00 ? 87  LEU B C   1 
ATOM 3619  O O   . LEU B 1 92  ? -67.184  180.754 -13.249 1.00 0.00 ? 87  LEU B O   1 
ATOM 3620  C CB  . LEU B 1 92  ? -65.064  183.153 -13.991 1.00 0.00 ? 87  LEU B CB  1 
ATOM 3621  C CG  . LEU B 1 92  ? -64.950  184.426 -14.905 1.00 0.00 ? 87  LEU B CG  1 
ATOM 3622  C CD1 . LEU B 1 92  ? -63.506  184.690 -15.143 1.00 0.00 ? 87  LEU B CD1 1 
ATOM 3623  C CD2 . LEU B 1 92  ? -65.724  184.235 -16.183 1.00 0.00 ? 87  LEU B CD2 1 
ATOM 3624  N N   . ASN B 1 93  ? -66.473  181.672 -11.312 1.00 0.00 ? 88  ASN B N   1 
ATOM 3625  C CA  . ASN B 1 93  ? -66.671  180.367 -10.516 1.00 0.00 ? 88  ASN B CA  1 
ATOM 3626  C C   . ASN B 1 93  ? -68.140  180.108 -10.303 1.00 0.00 ? 88  ASN B C   1 
ATOM 3627  O O   . ASN B 1 93  ? -68.680  178.974 -10.275 1.00 0.00 ? 88  ASN B O   1 
ATOM 3628  C CB  . ASN B 1 93  ? -65.752  180.188 -9.215  1.00 0.00 ? 88  ASN B CB  1 
ATOM 3629  C CG  . ASN B 1 93  ? -64.322  180.208 -9.679  1.00 0.00 ? 88  ASN B CG  1 
ATOM 3630  O OD1 . ASN B 1 93  ? -63.897  179.475 -10.543 1.00 0.00 ? 88  ASN B OD1 1 
ATOM 3631  N ND2 . ASN B 1 93  ? -63.508  181.094 -9.076  1.00 0.00 ? 88  ASN B ND2 1 
ATOM 3632  N N   . HIS B 1 94  ? -68.978  181.190 -10.109 1.00 0.00 ? 89  HIS B N   1 
ATOM 3633  C CA  . HIS B 1 94  ? -70.439  181.247 -9.865  1.00 0.00 ? 89  HIS B CA  1 
ATOM 3634  C C   . HIS B 1 94  ? -71.154  180.659 -11.060 1.00 0.00 ? 89  HIS B C   1 
ATOM 3635  O O   . HIS B 1 94  ? -72.026  179.749 -11.082 1.00 0.00 ? 89  HIS B O   1 
ATOM 3636  C CB  . HIS B 1 94  ? -70.852  182.754 -9.740  1.00 0.00 ? 89  HIS B CB  1 
ATOM 3637  C CG  . HIS B 1 94  ? -70.822  183.075 -8.257  1.00 0.00 ? 89  HIS B CG  1 
ATOM 3638  N ND1 . HIS B 1 94  ? -69.759  182.747 -7.428  1.00 0.00 ? 89  HIS B ND1 1 
ATOM 3639  C CD2 . HIS B 1 94  ? -71.634  183.815 -7.469  1.00 0.00 ? 89  HIS B CD2 1 
ATOM 3640  C CE1 . HIS B 1 94  ? -70.010  183.198 -6.182  1.00 0.00 ? 89  HIS B CE1 1 
ATOM 3641  N NE2 . HIS B 1 94  ? -71.192  183.887 -6.158  1.00 0.00 ? 89  HIS B NE2 1 
ATOM 3642  N N   . LYS B 1 95  ? -70.703  181.152 -12.242 1.00 0.00 ? 90  LYS B N   1 
ATOM 3643  C CA  . LYS B 1 95  ? -71.131  180.609 -13.579 1.00 0.00 ? 90  LYS B CA  1 
ATOM 3644  C C   . LYS B 1 95  ? -70.819  179.074 -13.869 1.00 0.00 ? 90  LYS B C   1 
ATOM 3645  O O   . LYS B 1 95  ? -71.669  178.335 -14.197 1.00 0.00 ? 90  LYS B O   1 
ATOM 3646  C CB  . LYS B 1 95  ? -70.788  181.700 -14.634 1.00 0.00 ? 90  LYS B CB  1 
ATOM 3647  C CG  . LYS B 1 95  ? -71.467  183.091 -14.427 1.00 0.00 ? 90  LYS B CG  1 
ATOM 3648  C CD  . LYS B 1 95  ? -72.935  183.020 -14.881 1.00 0.00 ? 90  LYS B CD  1 
ATOM 3649  C CE  . LYS B 1 95  ? -73.738  184.257 -14.470 1.00 0.00 ? 90  LYS B CE  1 
ATOM 3650  N NZ  . LYS B 1 95  ? -74.041  184.304 -13.032 1.00 0.00 ? 90  LYS B NZ  1 
ATOM 3651  N N   . LEU B 1 96  ? -69.633  178.595 -13.410 1.00 0.00 ? 91  LEU B N   1 
ATOM 3652  C CA  . LEU B 1 96  ? -69.283  177.175 -13.389 1.00 0.00 ? 91  LEU B CA  1 
ATOM 3653  C C   . LEU B 1 96  ? -70.283  176.319 -12.515 1.00 0.00 ? 91  LEU B C   1 
ATOM 3654  O O   . LEU B 1 96  ? -70.696  175.205 -12.901 1.00 0.00 ? 91  LEU B O   1 
ATOM 3655  C CB  . LEU B 1 96  ? -67.819  176.820 -13.130 1.00 0.00 ? 91  LEU B CB  1 
ATOM 3656  C CG  . LEU B 1 96  ? -66.782  177.597 -14.030 1.00 0.00 ? 91  LEU B CG  1 
ATOM 3657  C CD1 . LEU B 1 96  ? -65.411  177.179 -13.510 1.00 0.00 ? 91  LEU B CD1 1 
ATOM 3658  C CD2 . LEU B 1 96  ? -66.903  177.227 -15.526 1.00 0.00 ? 91  LEU B CD2 1 
ATOM 3659  N N   . ASP B 1 97  ? -70.513  176.708 -11.267 1.00 0.00 ? 92  ASP B N   1 
ATOM 3660  C CA  . ASP B 1 97  ? -71.529  176.074 -10.442 1.00 0.00 ? 92  ASP B CA  1 
ATOM 3661  C C   . ASP B 1 97  ? -72.973  176.047 -10.983 1.00 0.00 ? 92  ASP B C   1 
ATOM 3662  O O   . ASP B 1 97  ? -73.758  175.191 -10.652 1.00 0.00 ? 92  ASP B O   1 
ATOM 3663  C CB  . ASP B 1 97  ? -71.550  176.857 -9.087  1.00 0.00 ? 92  ASP B CB  1 
ATOM 3664  C CG  . ASP B 1 97  ? -70.157  176.499 -8.423  1.00 0.00 ? 92  ASP B CG  1 
ATOM 3665  O OD1 . ASP B 1 97  ? -69.881  175.256 -8.264  1.00 0.00 ? 92  ASP B OD1 1 
ATOM 3666  O OD2 . ASP B 1 97  ? -69.344  177.355 -8.057  1.00 0.00 ? 92  ASP B OD2 1 
ATOM 3667  N N   . SER B 1 98  ? -73.439  177.137 -11.645 1.00 0.00 ? 93  SER B N   1 
ATOM 3668  C CA  . SER B 1 98  ? -74.767  177.204 -12.276 1.00 0.00 ? 93  SER B CA  1 
ATOM 3669  C C   . SER B 1 98  ? -74.876  176.294 -13.443 1.00 0.00 ? 93  SER B C   1 
ATOM 3670  O O   . SER B 1 98  ? -75.894  175.585 -13.644 1.00 0.00 ? 93  SER B O   1 
ATOM 3671  C CB  . SER B 1 98  ? -74.956  178.631 -12.569 1.00 0.00 ? 93  SER B CB  1 
ATOM 3672  O OG  . SER B 1 98  ? -76.211  178.817 -13.228 1.00 0.00 ? 93  SER B OG  1 
ATOM 3673  N N   . HIS B 1 99  ? -73.819  176.206 -14.225 1.00 0.00 ? 94  HIS B N   1 
ATOM 3674  C CA  . HIS B 1 99  ? -73.663  175.331 -15.282 1.00 0.00 ? 94  HIS B CA  1 
ATOM 3675  C C   . HIS B 1 99  ? -73.595  173.830 -14.898 1.00 0.00 ? 94  HIS B C   1 
ATOM 3676  O O   . HIS B 1 99  ? -74.119  172.894 -15.459 1.00 0.00 ? 94  HIS B O   1 
ATOM 3677  C CB  . HIS B 1 99  ? -72.558  175.714 -16.255 1.00 0.00 ? 94  HIS B CB  1 
ATOM 3678  C CG  . HIS B 1 99  ? -72.708  175.162 -17.586 1.00 0.00 ? 94  HIS B CG  1 
ATOM 3679  N ND1 . HIS B 1 99  ? -73.724  175.491 -18.468 1.00 0.00 ? 94  HIS B ND1 1 
ATOM 3680  C CD2 . HIS B 1 99  ? -72.009  174.209 -18.210 1.00 0.00 ? 94  HIS B CD2 1 
ATOM 3681  C CE1 . HIS B 1 99  ? -73.484  174.853 -19.610 1.00 0.00 ? 94  HIS B CE1 1 
ATOM 3682  N NE2 . HIS B 1 99  ? -72.441  174.049 -19.545 1.00 0.00 ? 94  HIS B NE2 1 
ATOM 3683  N N   . ALA B 1 100 ? -72.950  173.540 -13.737 1.00 0.00 ? 95  ALA B N   1 
ATOM 3684  C CA  . ALA B 1 100 ? -73.073  172.305 -12.993 1.00 0.00 ? 95  ALA B CA  1 
ATOM 3685  C C   . ALA B 1 100 ? -74.535  171.962 -12.670 1.00 0.00 ? 95  ALA B C   1 
ATOM 3686  O O   . ALA B 1 100 ? -74.874  170.844 -12.940 1.00 0.00 ? 95  ALA B O   1 
ATOM 3687  C CB  . ALA B 1 100 ? -72.147  172.399 -11.807 1.00 0.00 ? 95  ALA B CB  1 
ATOM 3688  N N   . GLU B 1 101 ? -75.374  172.940 -12.224 1.00 0.00 ? 96  GLU B N   1 
ATOM 3689  C CA  . GLU B 1 101 ? -76.741  172.630 -12.013 1.00 0.00 ? 96  GLU B CA  1 
ATOM 3690  C C   . GLU B 1 101 ? -77.464  172.247 -13.304 1.00 0.00 ? 96  GLU B C   1 
ATOM 3691  O O   . GLU B 1 101 ? -78.263  171.324 -13.346 1.00 0.00 ? 96  GLU B O   1 
ATOM 3692  C CB  . GLU B 1 101 ? -77.479  173.701 -11.187 1.00 0.00 ? 96  GLU B CB  1 
ATOM 3693  C CG  . GLU B 1 101 ? -76.985  173.945 -9.754  1.00 0.00 ? 96  GLU B CG  1 
ATOM 3694  C CD  . GLU B 1 101 ? -77.727  174.996 -8.955  1.00 0.00 ? 96  GLU B CD  1 
ATOM 3695  O OE1 . GLU B 1 101 ? -77.726  176.188 -9.402  1.00 0.00 ? 96  GLU B OE1 1 
ATOM 3696  O OE2 . GLU B 1 101 ? -78.293  174.738 -7.889  1.00 0.00 ? 96  GLU B OE2 1 
ATOM 3697  N N   . LEU B 1 102 ? -77.081  172.857 -14.480 1.00 0.00 ? 97  LEU B N   1 
ATOM 3698  C CA  . LEU B 1 102 ? -77.641  172.444 -15.769 1.00 0.00 ? 97  LEU B CA  1 
ATOM 3699  C C   . LEU B 1 102 ? -77.197  171.011 -16.195 1.00 0.00 ? 97  LEU B C   1 
ATOM 3700  O O   . LEU B 1 102 ? -77.972  170.234 -16.774 1.00 0.00 ? 97  LEU B O   1 
ATOM 3701  C CB  . LEU B 1 102 ? -77.120  173.392 -16.840 1.00 0.00 ? 97  LEU B CB  1 
ATOM 3702  C CG  . LEU B 1 102 ? -77.793  173.202 -18.239 1.00 0.00 ? 97  LEU B CG  1 
ATOM 3703  C CD1 . LEU B 1 102 ? -79.278  173.418 -18.218 1.00 0.00 ? 97  LEU B CD1 1 
ATOM 3704  C CD2 . LEU B 1 102 ? -77.200  174.267 -19.178 1.00 0.00 ? 97  LEU B CD2 1 
ATOM 3705  N N   . LEU B 1 103 ? -75.930  170.583 -15.968 1.00 0.00 ? 98  LEU B N   1 
ATOM 3706  C CA  . LEU B 1 103 ? -75.535  169.228 -16.229 1.00 0.00 ? 98  LEU B CA  1 
ATOM 3707  C C   . LEU B 1 103 ? -76.208  168.259 -15.216 1.00 0.00 ? 98  LEU B C   1 
ATOM 3708  O O   . LEU B 1 103 ? -76.638  167.210 -15.579 1.00 0.00 ? 98  LEU B O   1 
ATOM 3709  C CB  . LEU B 1 103 ? -73.936  169.061 -16.043 1.00 0.00 ? 98  LEU B CB  1 
ATOM 3710  C CG  . LEU B 1 103 ? -73.151  169.722 -17.172 1.00 0.00 ? 98  LEU B CG  1 
ATOM 3711  C CD1 . LEU B 1 103 ? -71.682  169.407 -16.879 1.00 0.00 ? 98  LEU B CD1 1 
ATOM 3712  C CD2 . LEU B 1 103 ? -73.598  169.269 -18.602 1.00 0.00 ? 98  LEU B CD2 1 
ATOM 3713  N N   . ASP B 1 104 ? -76.420  168.596 -13.949 1.00 0.00 ? 99  ASP B N   1 
ATOM 3714  C CA  . ASP B 1 104 ? -77.260  167.846 -13.081 1.00 0.00 ? 99  ASP B CA  1 
ATOM 3715  C C   . ASP B 1 104 ? -78.675  167.734 -13.581 1.00 0.00 ? 99  ASP B C   1 
ATOM 3716  O O   . ASP B 1 104 ? -79.165  166.615 -13.656 1.00 0.00 ? 99  ASP B O   1 
ATOM 3717  C CB  . ASP B 1 104 ? -77.235  168.349 -11.615 1.00 0.00 ? 99  ASP B CB  1 
ATOM 3718  C CG  . ASP B 1 104 ? -76.048  167.839 -11.025 1.00 0.00 ? 99  ASP B CG  1 
ATOM 3719  O OD1 . ASP B 1 104 ? -75.962  166.627 -10.685 1.00 0.00 ? 99  ASP B OD1 1 
ATOM 3720  O OD2 . ASP B 1 104 ? -75.081  168.691 -10.932 1.00 0.00 ? 99  ASP B OD2 1 
ATOM 3721  N N   . ALA B 1 105 ? -79.284  168.801 -14.074 1.00 0.00 ? 100 ALA B N   1 
ATOM 3722  C CA  . ALA B 1 105 ? -80.632  168.709 -14.578 1.00 0.00 ? 100 ALA B CA  1 
ATOM 3723  C C   . ALA B 1 105 ? -80.755  167.972 -15.907 1.00 0.00 ? 100 ALA B C   1 
ATOM 3724  O O   . ALA B 1 105 ? -81.614  167.149 -16.212 1.00 0.00 ? 100 ALA B O   1 
ATOM 3725  C CB  . ALA B 1 105 ? -81.189  170.185 -14.652 1.00 0.00 ? 100 ALA B CB  1 
ATOM 3726  N N   . THR B 1 106 ? -79.815  168.112 -16.876 1.00 0.00 ? 101 THR B N   1 
ATOM 3727  C CA  . THR B 1 106 ? -79.682  167.215 -18.092 1.00 0.00 ? 101 THR B CA  1 
ATOM 3728  C C   . THR B 1 106 ? -79.605  165.717 -17.808 1.00 0.00 ? 101 THR B C   1 
ATOM 3729  O O   . THR B 1 106 ? -80.295  164.841 -18.358 1.00 0.00 ? 101 THR B O   1 
ATOM 3730  C CB  . THR B 1 106 ? -78.553  167.603 -19.009 1.00 0.00 ? 101 THR B CB  1 
ATOM 3731  O OG1 . THR B 1 106 ? -78.944  168.794 -19.740 1.00 0.00 ? 101 THR B OG1 1 
ATOM 3732  C CG2 . THR B 1 106 ? -78.380  166.592 -20.075 1.00 0.00 ? 101 THR B CG2 1 
ATOM 3733  N N   . GLN B 1 107 ? -78.817  165.297 -16.832 1.00 0.00 ? 102 GLN B N   1 
ATOM 3734  C CA  . GLN B 1 107 ? -78.722  163.976 -16.306 1.00 0.00 ? 102 GLN B CA  1 
ATOM 3735  C C   . GLN B 1 107 ? -80.055  163.471 -15.803 1.00 0.00 ? 102 GLN B C   1 
ATOM 3736  O O   . GLN B 1 107 ? -80.529  162.354 -16.089 1.00 0.00 ? 102 GLN B O   1 
ATOM 3737  C CB  . GLN B 1 107 ? -77.799  163.943 -15.040 1.00 0.00 ? 102 GLN B CB  1 
ATOM 3738  C CG  . GLN B 1 107 ? -77.308  162.474 -14.582 1.00 0.00 ? 102 GLN B CG  1 
ATOM 3739  C CD  . GLN B 1 107 ? -76.494  162.686 -13.269 1.00 0.00 ? 102 GLN B CD  1 
ATOM 3740  O OE1 . GLN B 1 107 ? -75.537  163.457 -13.149 1.00 0.00 ? 102 GLN B OE1 1 
ATOM 3741  N NE2 . GLN B 1 107 ? -76.991  162.038 -12.203 1.00 0.00 ? 102 GLN B NE2 1 
ATOM 3742  N N   . HIS B 1 108 ? -80.785  164.279 -14.997 1.00 0.00 ? 103 HIS B N   1 
ATOM 3743  C CA  . HIS B 1 108 ? -82.135  163.994 -14.430 1.00 0.00 ? 103 HIS B CA  1 
ATOM 3744  C C   . HIS B 1 108 ? -83.037  163.682 -15.549 1.00 0.00 ? 103 HIS B C   1 
ATOM 3745  O O   . HIS B 1 108 ? -83.568  162.596 -15.688 1.00 0.00 ? 103 HIS B O   1 
ATOM 3746  C CB  . HIS B 1 108 ? -82.677  165.160 -13.640 1.00 0.00 ? 103 HIS B CB  1 
ATOM 3747  C CG  . HIS B 1 108 ? -83.937  164.800 -12.857 1.00 0.00 ? 103 HIS B CG  1 
ATOM 3748  N ND1 . HIS B 1 108 ? -85.104  165.392 -13.222 1.00 0.00 ? 103 HIS B ND1 1 
ATOM 3749  C CD2 . HIS B 1 108 ? -84.330  163.866 -11.929 1.00 0.00 ? 103 HIS B CD2 1 
ATOM 3750  C CE1 . HIS B 1 108 ? -86.132  164.948 -12.494 1.00 0.00 ? 103 HIS B CE1 1 
ATOM 3751  N NE2 . HIS B 1 108 ? -85.739  163.988 -11.707 1.00 0.00 ? 103 HIS B NE2 1 
ATOM 3752  N N   . THR B 1 109 ? -83.090  164.590 -16.508 1.00 0.00 ? 104 THR B N   1 
ATOM 3753  C CA  . THR B 1 109 ? -83.834  164.585 -17.792 1.00 0.00 ? 104 THR B CA  1 
ATOM 3754  C C   . THR B 1 109 ? -83.577  163.286 -18.544 1.00 0.00 ? 104 THR B C   1 
ATOM 3755  O O   . THR B 1 109 ? -84.540  162.673 -18.943 1.00 0.00 ? 104 THR B O   1 
ATOM 3756  C CB  . THR B 1 109 ? -83.671  165.723 -18.624 1.00 0.00 ? 104 THR B CB  1 
ATOM 3757  O OG1 . THR B 1 109 ? -84.237  166.773 -17.845 1.00 0.00 ? 104 THR B OG1 1 
ATOM 3758  C CG2 . THR B 1 109 ? -84.549  165.732 -19.869 1.00 0.00 ? 104 THR B CG2 1 
ATOM 3759  N N   . LEU B 1 110 ? -82.355  162.892 -18.750 1.00 0.00 ? 105 LEU B N   1 
ATOM 3760  C CA  . LEU B 1 110 ? -81.882  161.677 -19.448 1.00 0.00 ? 105 LEU B CA  1 
ATOM 3761  C C   . LEU B 1 110 ? -82.194  160.433 -18.653 1.00 0.00 ? 105 LEU B C   1 
ATOM 3762  O O   . LEU B 1 110 ? -82.787  159.504 -19.147 1.00 0.00 ? 105 LEU B O   1 
ATOM 3763  C CB  . LEU B 1 110 ? -80.332  161.933 -19.627 1.00 0.00 ? 105 LEU B CB  1 
ATOM 3764  C CG  . LEU B 1 110 ? -79.527  160.898 -20.453 1.00 0.00 ? 105 LEU B CG  1 
ATOM 3765  C CD1 . LEU B 1 110 ? -79.866  161.087 -21.987 1.00 0.00 ? 105 LEU B CD1 1 
ATOM 3766  C CD2 . LEU B 1 110 ? -78.001  161.032 -20.204 1.00 0.00 ? 105 LEU B CD2 1 
ATOM 3767  N N   . GLN B 1 111 ? -81.934  160.402 -17.323 1.00 0.00 ? 106 GLN B N   1 
ATOM 3768  C CA  . GLN B 1 111 ? -82.376  159.282 -16.422 1.00 0.00 ? 106 GLN B CA  1 
ATOM 3769  C C   . GLN B 1 111 ? -83.906  159.075 -16.257 1.00 0.00 ? 106 GLN B C   1 
ATOM 3770  O O   . GLN B 1 111 ? -84.410  157.950 -16.290 1.00 0.00 ? 106 GLN B O   1 
ATOM 3771  C CB  . GLN B 1 111 ? -81.645  159.480 -15.120 1.00 0.00 ? 106 GLN B CB  1 
ATOM 3772  C CG  . GLN B 1 111 ? -82.065  158.615 -13.930 1.00 0.00 ? 106 GLN B CG  1 
ATOM 3773  C CD  . GLN B 1 111 ? -80.918  158.488 -12.910 1.00 0.00 ? 106 GLN B CD  1 
ATOM 3774  O OE1 . GLN B 1 111 ? -79.915  159.224 -12.977 1.00 0.00 ? 106 GLN B OE1 1 
ATOM 3775  N NE2 . GLN B 1 111 ? -80.866  157.445 -12.060 1.00 0.00 ? 106 GLN B NE2 1 
ATOM 3776  N N   . GLN B 1 112 ? -84.673  160.175 -16.233 1.00 0.00 ? 107 GLN B N   1 
ATOM 3777  C CA  . GLN B 1 112 ? -86.131  160.146 -16.369 1.00 0.00 ? 107 GLN B CA  1 
ATOM 3778  C C   . GLN B 1 112 ? -86.645  159.498 -17.640 1.00 0.00 ? 107 GLN B C   1 
ATOM 3779  O O   . GLN B 1 112 ? -87.498  158.594 -17.595 1.00 0.00 ? 107 GLN B O   1 
ATOM 3780  C CB  . GLN B 1 112 ? -86.771  161.555 -16.245 1.00 0.00 ? 107 GLN B CB  1 
ATOM 3781  C CG  . GLN B 1 112 ? -88.314  161.714 -15.979 1.00 0.00 ? 107 GLN B CG  1 
ATOM 3782  C CD  . GLN B 1 112 ? -88.796  163.154 -15.962 1.00 0.00 ? 107 GLN B CD  1 
ATOM 3783  O OE1 . GLN B 1 112 ? -89.164  163.632 -17.043 1.00 0.00 ? 107 GLN B OE1 1 
ATOM 3784  N NE2 . GLN B 1 112 ? -88.837  163.870 -14.844 1.00 0.00 ? 107 GLN B NE2 1 
ATOM 3785  N N   . GLN B 1 113 ? -86.203  159.987 -18.806 1.00 0.00 ? 108 GLN B N   1 
ATOM 3786  C CA  . GLN B 1 113 ? -86.862  159.587 -20.031 1.00 0.00 ? 108 GLN B CA  1 
ATOM 3787  C C   . GLN B 1 113 ? -86.131  158.464 -20.763 1.00 0.00 ? 108 GLN B C   1 
ATOM 3788  O O   . GLN B 1 113 ? -86.563  157.341 -21.061 1.00 0.00 ? 108 GLN B O   1 
ATOM 3789  C CB  . GLN B 1 113 ? -87.033  160.750 -20.984 1.00 0.00 ? 108 GLN B CB  1 
ATOM 3790  C CG  . GLN B 1 113 ? -88.025  161.916 -20.515 1.00 0.00 ? 108 GLN B CG  1 
ATOM 3791  C CD  . GLN B 1 113 ? -89.451  161.521 -20.134 1.00 0.00 ? 108 GLN B CD  1 
ATOM 3792  O OE1 . GLN B 1 113 ? -89.689  160.945 -19.024 1.00 0.00 ? 108 GLN B OE1 1 
ATOM 3793  N NE2 . GLN B 1 113 ? -90.358  161.822 -21.094 1.00 0.00 ? 108 GLN B NE2 1 
ATOM 3794  N N   . ILE B 1 114 ? -84.864  158.711 -21.112 1.00 0.00 ? 109 ILE B N   1 
ATOM 3795  C CA  . ILE B 1 114 ? -84.179  157.842 -22.072 1.00 0.00 ? 109 ILE B CA  1 
ATOM 3796  C C   . ILE B 1 114 ? -83.639  156.628 -21.436 1.00 0.00 ? 109 ILE B C   1 
ATOM 3797  O O   . ILE B 1 114 ? -83.663  155.498 -21.997 1.00 0.00 ? 109 ILE B O   1 
ATOM 3798  C CB  . ILE B 1 114 ? -82.937  158.505 -22.804 1.00 0.00 ? 109 ILE B CB  1 
ATOM 3799  C CG1 . ILE B 1 114 ? -83.206  159.872 -23.487 1.00 0.00 ? 109 ILE B CG1 1 
ATOM 3800  C CG2 . ILE B 1 114 ? -82.425  157.565 -23.859 1.00 0.00 ? 109 ILE B CG2 1 
ATOM 3801  C CD1 . ILE B 1 114 ? -84.340  159.918 -24.484 1.00 0.00 ? 109 ILE B CD1 1 
ATOM 3802  N N   . GLN B 1 115 ? -83.176  156.653 -20.198 1.00 0.00 ? 110 GLN B N   1 
ATOM 3803  C CA  . GLN B 1 115 ? -82.871  155.511 -19.429 1.00 0.00 ? 110 GLN B CA  1 
ATOM 3804  C C   . GLN B 1 115 ? -83.925  154.559 -19.020 1.00 0.00 ? 110 GLN B C   1 
ATOM 3805  O O   . GLN B 1 115 ? -83.750  153.380 -19.250 1.00 0.00 ? 110 GLN B O   1 
ATOM 3806  C CB  . GLN B 1 115 ? -81.978  155.995 -18.278 1.00 0.00 ? 110 GLN B CB  1 
ATOM 3807  C CG  . GLN B 1 115 ? -81.100  155.002 -17.509 1.00 0.00 ? 110 GLN B CG  1 
ATOM 3808  C CD  . GLN B 1 115 ? -80.224  155.782 -16.481 1.00 0.00 ? 110 GLN B CD  1 
ATOM 3809  O OE1 . GLN B 1 115 ? -79.465  156.699 -16.803 1.00 0.00 ? 110 GLN B OE1 1 
ATOM 3810  N NE2 . GLN B 1 115 ? -80.298  155.519 -15.182 1.00 0.00 ? 110 GLN B NE2 1 
ATOM 3811  N N   . THR B 1 116 ? -85.009  155.147 -18.592 1.00 0.00 ? 111 THR B N   1 
ATOM 3812  C CA  . THR B 1 116 ? -86.259  154.447 -18.398 1.00 0.00 ? 111 THR B CA  1 
ATOM 3813  C C   . THR B 1 116 ? -86.784  153.797 -19.665 1.00 0.00 ? 111 THR B C   1 
ATOM 3814  O O   . THR B 1 116 ? -87.173  152.597 -19.654 1.00 0.00 ? 111 THR B O   1 
ATOM 3815  C CB  . THR B 1 116 ? -87.322  155.347 -17.770 1.00 0.00 ? 111 THR B CB  1 
ATOM 3816  O OG1 . THR B 1 116 ? -86.889  155.984 -16.607 1.00 0.00 ? 111 THR B OG1 1 
ATOM 3817  C CG2 . THR B 1 116 ? -88.679  154.604 -17.425 1.00 0.00 ? 111 THR B CG2 1 
ATOM 3818  N N   . LEU B 1 117 ? -86.755  154.523 -20.745 1.00 0.00 ? 112 LEU B N   1 
ATOM 3819  C CA  . LEU B 1 117 ? -87.263  153.904 -21.994 1.00 0.00 ? 112 LEU B CA  1 
ATOM 3820  C C   . LEU B 1 117 ? -86.406  152.647 -22.454 1.00 0.00 ? 112 LEU B C   1 
ATOM 3821  O O   . LEU B 1 117 ? -86.913  151.570 -22.774 1.00 0.00 ? 112 LEU B O   1 
ATOM 3822  C CB  . LEU B 1 117 ? -87.357  154.819 -23.164 1.00 0.00 ? 112 LEU B CB  1 
ATOM 3823  C CG  . LEU B 1 117 ? -88.773  155.173 -23.677 1.00 0.00 ? 112 LEU B CG  1 
ATOM 3824  C CD1 . LEU B 1 117 ? -88.700  156.516 -24.431 1.00 0.00 ? 112 LEU B CD1 1 
ATOM 3825  C CD2 . LEU B 1 117 ? -89.341  154.036 -24.631 1.00 0.00 ? 112 LEU B CD2 1 
ATOM 3826  N N   . VAL B 1 118 ? -85.071  152.842 -22.472 1.00 0.00 ? 113 VAL B N   1 
ATOM 3827  C CA  . VAL B 1 118 ? -84.137  151.702 -22.775 1.00 0.00 ? 113 VAL B CA  1 
ATOM 3828  C C   . VAL B 1 118 ? -84.317  150.506 -21.794 1.00 0.00 ? 113 VAL B C   1 
ATOM 3829  O O   . VAL B 1 118 ? -84.334  149.322 -22.185 1.00 0.00 ? 113 VAL B O   1 
ATOM 3830  C CB  . VAL B 1 118 ? -82.770  152.330 -22.849 1.00 0.00 ? 113 VAL B CB  1 
ATOM 3831  C CG1 . VAL B 1 118 ? -81.685  151.212 -22.940 1.00 0.00 ? 113 VAL B CG1 1 
ATOM 3832  C CG2 . VAL B 1 118 ? -82.758  153.275 -24.038 1.00 0.00 ? 113 VAL B CG2 1 
ATOM 3833  N N   . LYS B 1 119 ? -84.367  150.840 -20.459 1.00 0.00 ? 114 LYS B N   1 
ATOM 3834  C CA  . LYS B 1 119 ? -84.462  149.846 -19.317 1.00 0.00 ? 114 LYS B CA  1 
ATOM 3835  C C   . LYS B 1 119 ? -85.781  149.127 -19.210 1.00 0.00 ? 114 LYS B C   1 
ATOM 3836  O O   . LYS B 1 119 ? -85.748  147.954 -18.845 1.00 0.00 ? 114 LYS B O   1 
ATOM 3837  C CB  . LYS B 1 119 ? -83.991  150.495 -17.975 1.00 0.00 ? 114 LYS B CB  1 
ATOM 3838  C CG  . LYS B 1 119 ? -83.341  149.572 -16.948 1.00 0.00 ? 114 LYS B CG  1 
ATOM 3839  C CD  . LYS B 1 119 ? -84.308  148.720 -16.055 1.00 0.00 ? 114 LYS B CD  1 
ATOM 3840  C CE  . LYS B 1 119 ? -83.723  147.878 -14.994 1.00 0.00 ? 114 LYS B CE  1 
ATOM 3841  N NZ  . LYS B 1 119 ? -84.788  147.235 -14.134 1.00 0.00 ? 114 LYS B NZ  1 
ATOM 3842  N N   . GLU B 1 120 ? -86.950  149.745 -19.394 1.00 0.00 ? 115 GLU B N   1 
ATOM 3843  C CA  . GLU B 1 120 ? -88.140  149.106 -18.975 1.00 0.00 ? 115 GLU B CA  1 
ATOM 3844  C C   . GLU B 1 120 ? -89.331  149.742 -19.793 1.00 0.00 ? 115 GLU B C   1 
ATOM 3845  O O   . GLU B 1 120 ? -90.525  149.640 -19.517 1.00 0.00 ? 115 GLU B O   1 
ATOM 3846  C CB  . GLU B 1 120 ? -88.282  149.322 -17.512 1.00 0.00 ? 115 GLU B CB  1 
ATOM 3847  C CG  . GLU B 1 120 ? -88.186  150.815 -17.040 1.00 0.00 ? 115 GLU B CG  1 
ATOM 3848  C CD  . GLU B 1 120 ? -88.443  150.890 -15.585 1.00 0.00 ? 115 GLU B CD  1 
ATOM 3849  O OE1 . GLU B 1 120 ? -88.674  149.814 -14.973 1.00 0.00 ? 115 GLU B OE1 1 
ATOM 3850  O OE2 . GLU B 1 120 ? -88.303  151.998 -14.945 1.00 0.00 ? 115 GLU B OE2 1 
ATOM 3851  N N   . GLY B 1 121 ? -89.039  150.387 -20.982 1.00 0.00 ? 116 GLY B N   1 
ATOM 3852  C CA  . GLY B 1 121 ? -90.044  151.163 -21.752 1.00 0.00 ? 116 GLY B CA  1 
ATOM 3853  C C   . GLY B 1 121 ? -90.497  150.257 -22.974 1.00 0.00 ? 116 GLY B C   1 
ATOM 3854  O O   . GLY B 1 121 ? -91.514  150.603 -23.655 1.00 0.00 ? 116 GLY B O   1 
ATOM 3855  N N   . LEU B 1 122 ? -89.852  149.134 -23.293 1.00 0.00 ? 117 LEU B N   1 
ATOM 3856  C CA  . LEU B 1 122 ? -90.160  148.206 -24.393 1.00 0.00 ? 117 LEU B CA  1 
ATOM 3857  C C   . LEU B 1 122 ? -90.736  146.881 -23.882 1.00 0.00 ? 117 LEU B C   1 
ATOM 3858  O O   . LEU B 1 122 ? -91.202  146.026 -24.651 1.00 0.00 ? 117 LEU B O   1 
ATOM 3859  C CB  . LEU B 1 122 ? -88.881  147.875 -25.256 1.00 0.00 ? 117 LEU B CB  1 
ATOM 3860  C CG  . LEU B 1 122 ? -88.241  149.187 -25.774 1.00 0.00 ? 117 LEU B CG  1 
ATOM 3861  C CD1 . LEU B 1 122 ? -86.998  148.733 -26.508 1.00 0.00 ? 117 LEU B CD1 1 
ATOM 3862  C CD2 . LEU B 1 122 ? -89.022  150.143 -26.673 1.00 0.00 ? 117 LEU B CD2 1 
ATOM 3863  N N   . ARG B 1 123 ? -90.828  146.792 -22.570 1.00 0.00 ? 118 ARG B N   1 
ATOM 3864  C CA  . ARG B 1 123 ? -91.024  145.598 -21.775 1.00 0.00 ? 118 ARG B CA  1 
ATOM 3865  C C   . ARG B 1 123 ? -92.410  145.023 -21.921 1.00 0.00 ? 118 ARG B C   1 
ATOM 3866  O O   . ARG B 1 123 ? -92.613  143.832 -22.032 1.00 0.00 ? 118 ARG B O   1 
ATOM 3867  C CB  . ARG B 1 123 ? -90.738  145.999 -20.316 1.00 0.00 ? 118 ARG B CB  1 
ATOM 3868  C CG  . ARG B 1 123 ? -90.551  144.810 -19.371 1.00 0.00 ? 118 ARG B CG  1 
ATOM 3869  C CD  . ARG B 1 123 ? -90.012  145.164 -17.994 1.00 0.00 ? 118 ARG B CD  1 
ATOM 3870  N NE  . ARG B 1 123 ? -89.921  143.801 -17.315 1.00 0.00 ? 118 ARG B NE  1 
ATOM 3871  C CZ  . ARG B 1 123 ? -89.139  143.581 -16.264 1.00 0.00 ? 118 ARG B CZ  1 
ATOM 3872  N NH1 . ARG B 1 123 ? -88.630  144.609 -15.545 1.00 0.00 ? 118 ARG B NH1 1 
ATOM 3873  N NH2 . ARG B 1 123 ? -88.952  142.393 -15.780 1.00 0.00 ? 118 ARG B NH2 1 
ATOM 3874  N N   . GLY B 1 124 ? -93.442  145.830 -22.033 1.00 0.00 ? 119 GLY B N   1 
ATOM 3875  C CA  . GLY B 1 124 ? -94.803  145.317 -22.279 1.00 0.00 ? 119 GLY B CA  1 
ATOM 3876  C C   . GLY B 1 124 ? -95.180  145.034 -23.708 1.00 0.00 ? 119 GLY B C   1 
ATOM 3877  O O   . GLY B 1 124 ? -95.990  144.111 -24.103 1.00 0.00 ? 119 GLY B O   1 
ATOM 3878  N N   . PHE B 1 125 ? -94.541  145.732 -24.644 1.00 0.00 ? 120 PHE B N   1 
ATOM 3879  C CA  . PHE B 1 125 ? -94.480  145.352 -26.056 1.00 0.00 ? 120 PHE B CA  1 
ATOM 3880  C C   . PHE B 1 125 ? -93.807  143.974 -26.217 1.00 0.00 ? 120 PHE B C   1 
ATOM 3881  O O   . PHE B 1 125 ? -94.220  143.096 -26.945 1.00 0.00 ? 120 PHE B O   1 
ATOM 3882  C CB  . PHE B 1 125 ? -93.821  146.498 -26.895 1.00 0.00 ? 120 PHE B CB  1 
ATOM 3883  C CG  . PHE B 1 125 ? -93.590  146.092 -28.387 1.00 0.00 ? 120 PHE B CG  1 
ATOM 3884  C CD1 . PHE B 1 125 ? -92.357  145.444 -28.771 1.00 0.00 ? 120 PHE B CD1 1 
ATOM 3885  C CD2 . PHE B 1 125 ? -94.576  146.313 -29.356 1.00 0.00 ? 120 PHE B CD2 1 
ATOM 3886  C CE1 . PHE B 1 125 ? -92.224  145.025 -30.114 1.00 0.00 ? 120 PHE B CE1 1 
ATOM 3887  C CE2 . PHE B 1 125 ? -94.334  145.951 -30.702 1.00 0.00 ? 120 PHE B CE2 1 
ATOM 3888  C CZ  . PHE B 1 125 ? -93.167  145.231 -31.106 1.00 0.00 ? 120 PHE B CZ  1 
ATOM 3889  N N   . ARG B 1 126 ? -92.732  143.673 -25.440 1.00 0.00 ? 121 ARG B N   1 
ATOM 3890  C CA  . ARG B 1 126 ? -92.004  142.447 -25.661 1.00 0.00 ? 121 ARG B CA  1 
ATOM 3891  C C   . ARG B 1 126 ? -92.745  141.308 -25.002 1.00 0.00 ? 121 ARG B C   1 
ATOM 3892  O O   . ARG B 1 126 ? -92.842  140.225 -25.630 1.00 0.00 ? 121 ARG B O   1 
ATOM 3893  C CB  . ARG B 1 126 ? -90.471  142.496 -25.195 1.00 0.00 ? 121 ARG B CB  1 
ATOM 3894  C CG  . ARG B 1 126 ? -89.642  143.327 -26.276 1.00 0.00 ? 121 ARG B CG  1 
ATOM 3895  C CD  . ARG B 1 126 ? -88.151  143.659 -25.821 1.00 0.00 ? 121 ARG B CD  1 
ATOM 3896  N NE  . ARG B 1 126 ? -87.524  144.078 -27.069 1.00 0.00 ? 121 ARG B NE  1 
ATOM 3897  C CZ  . ARG B 1 126 ? -86.526  144.903 -27.137 1.00 0.00 ? 121 ARG B CZ  1 
ATOM 3898  N NH1 . ARG B 1 126 ? -85.811  145.245 -26.015 1.00 0.00 ? 121 ARG B NH1 1 
ATOM 3899  N NH2 . ARG B 1 126 ? -86.090  145.371 -28.317 1.00 0.00 ? 121 ARG B NH2 1 
ATOM 3900  N N   . GLU B 1 127 ? -93.371  141.548 -23.746 1.00 0.00 ? 122 GLU B N   1 
ATOM 3901  C CA  . GLU B 1 127 ? -94.388  140.671 -23.146 1.00 0.00 ? 122 GLU B CA  1 
ATOM 3902  C C   . GLU B 1 127 ? -95.442  140.235 -24.053 1.00 0.00 ? 122 GLU B C   1 
ATOM 3903  O O   . GLU B 1 127 ? -95.742  139.070 -24.260 1.00 0.00 ? 122 GLU B O   1 
ATOM 3904  C CB  . GLU B 1 127 ? -95.022  141.357 -21.961 1.00 0.00 ? 122 GLU B CB  1 
ATOM 3905  C CG  . GLU B 1 127 ? -95.578  140.409 -20.885 1.00 0.00 ? 122 GLU B CG  1 
ATOM 3906  C CD  . GLU B 1 127 ? -94.498  139.476 -20.387 1.00 0.00 ? 122 GLU B CD  1 
ATOM 3907  O OE1 . GLU B 1 127 ? -93.590  140.059 -19.675 1.00 0.00 ? 122 GLU B OE1 1 
ATOM 3908  O OE2 . GLU B 1 127 ? -94.544  138.239 -20.590 1.00 0.00 ? 122 GLU B OE2 1 
ATOM 3909  N N   . ALA B 1 128 ? -96.157  141.240 -24.741 1.00 0.00 ? 123 ALA B N   1 
ATOM 3910  C CA  . ALA B 1 128 ? -97.319  140.992 -25.669 1.00 0.00 ? 123 ALA B CA  1 
ATOM 3911  C C   . ALA B 1 128 ? -96.888  140.234 -26.895 1.00 0.00 ? 123 ALA B C   1 
ATOM 3912  O O   . ALA B 1 128 ? -97.517  139.249 -27.314 1.00 0.00 ? 123 ALA B O   1 
ATOM 3913  C CB  . ALA B 1 128 ? -98.068  142.315 -26.071 1.00 0.00 ? 123 ALA B CB  1 
ATOM 3914  N N   . ARG B 1 129 ? -95.771  140.636 -27.559 1.00 0.00 ? 124 ARG B N   1 
ATOM 3915  C CA  . ARG B 1 129 ? -95.206  139.978 -28.703 1.00 0.00 ? 124 ARG B CA  1 
ATOM 3916  C C   . ARG B 1 129 ? -94.790  138.503 -28.530 1.00 0.00 ? 124 ARG B C   1 
ATOM 3917  O O   . ARG B 1 129 ? -95.159  137.646 -29.300 1.00 0.00 ? 124 ARG B O   1 
ATOM 3918  C CB  . ARG B 1 129 ? -94.015  140.880 -29.085 1.00 0.00 ? 124 ARG B CB  1 
ATOM 3919  C CG  . ARG B 1 129 ? -93.098  140.351 -30.256 1.00 0.00 ? 124 ARG B CG  1 
ATOM 3920  C CD  . ARG B 1 129 ? -91.943  141.223 -30.706 1.00 0.00 ? 124 ARG B CD  1 
ATOM 3921  N NE  . ARG B 1 129 ? -91.280  140.394 -31.851 1.00 0.00 ? 124 ARG B NE  1 
ATOM 3922  C CZ  . ARG B 1 129 ? -90.405  139.439 -31.635 1.00 0.00 ? 124 ARG B CZ  1 
ATOM 3923  N NH1 . ARG B 1 129 ? -89.789  139.208 -30.475 1.00 0.00 ? 124 ARG B NH1 1 
ATOM 3924  N NH2 . ARG B 1 129 ? -89.890  138.942 -32.732 1.00 0.00 ? 124 ARG B NH2 1 
ATOM 3925  N N   . ARG B 1 130 ? -94.016  138.167 -27.470 1.00 0.00 ? 125 ARG B N   1 
ATOM 3926  C CA  . ARG B 1 130 ? -93.642  136.756 -27.182 1.00 0.00 ? 125 ARG B CA  1 
ATOM 3927  C C   . ARG B 1 130 ? -94.869  135.889 -26.814 1.00 0.00 ? 125 ARG B C   1 
ATOM 3928  O O   . ARG B 1 130 ? -95.043  134.745 -27.222 1.00 0.00 ? 125 ARG B O   1 
ATOM 3929  C CB  . ARG B 1 130 ? -92.742  136.733 -25.901 1.00 0.00 ? 125 ARG B CB  1 
ATOM 3930  C CG  . ARG B 1 130 ? -92.282  135.383 -25.360 1.00 0.00 ? 125 ARG B CG  1 
ATOM 3931  C CD  . ARG B 1 130 ? -91.465  135.362 -24.095 1.00 0.00 ? 125 ARG B CD  1 
ATOM 3932  N NE  . ARG B 1 130 ? -92.304  135.700 -22.877 1.00 0.00 ? 125 ARG B NE  1 
ATOM 3933  C CZ  . ARG B 1 130 ? -91.793  135.781 -21.614 1.00 0.00 ? 125 ARG B CZ  1 
ATOM 3934  N NH1 . ARG B 1 130 ? -90.691  135.145 -21.318 1.00 0.00 ? 125 ARG B NH1 1 
ATOM 3935  N NH2 . ARG B 1 130 ? -92.430  136.449 -20.651 1.00 0.00 ? 125 ARG B NH2 1 
ATOM 3936  N N   . ASP B 1 131 ? -95.877  136.472 -26.068 1.00 0.00 ? 126 ASP B N   1 
ATOM 3937  C CA  . ASP B 1 131 ? -97.163  135.770 -25.743 1.00 0.00 ? 126 ASP B CA  1 
ATOM 3938  C C   . ASP B 1 131 ? -97.958  135.568 -27.103 1.00 0.00 ? 126 ASP B C   1 
ATOM 3939  O O   . ASP B 1 131 ? -98.432  134.455 -27.424 1.00 0.00 ? 126 ASP B O   1 
ATOM 3940  C CB  . ASP B 1 131 ? -97.952  136.572 -24.724 1.00 0.00 ? 126 ASP B CB  1 
ATOM 3941  C CG  . ASP B 1 131 ? -98.856  135.667 -23.965 1.00 0.00 ? 126 ASP B CG  1 
ATOM 3942  O OD1 . ASP B 1 131 ? -98.435  134.687 -23.344 1.00 0.00 ? 126 ASP B OD1 1 
ATOM 3943  O OD2 . ASP B 1 131 ? -100.067 135.876 -24.124 1.00 0.00 ? 126 ASP B OD2 1 
ATOM 3944  N N   . PHE B 1 132 ? -98.050  136.591 -27.924 1.00 0.00 ? 127 PHE B N   1 
ATOM 3945  C CA  . PHE B 1 132 ? -98.697  136.558 -29.243 1.00 0.00 ? 127 PHE B CA  1 
ATOM 3946  C C   . PHE B 1 132 ? -98.142  135.536 -30.326 1.00 0.00 ? 127 PHE B C   1 
ATOM 3947  O O   . PHE B 1 132 ? -98.909  134.729 -30.910 1.00 0.00 ? 127 PHE B O   1 
ATOM 3948  C CB  . PHE B 1 132 ? -98.728  138.062 -29.807 1.00 0.00 ? 127 PHE B CB  1 
ATOM 3949  C CG  . PHE B 1 132 ? -99.064  138.105 -31.346 1.00 0.00 ? 127 PHE B CG  1 
ATOM 3950  C CD1 . PHE B 1 132 ? -100.423 137.871 -31.879 1.00 0.00 ? 127 PHE B CD1 1 
ATOM 3951  C CD2 . PHE B 1 132 ? -97.954  138.255 -32.142 1.00 0.00 ? 127 PHE B CD2 1 
ATOM 3952  C CE1 . PHE B 1 132 ? -100.447 137.790 -33.275 1.00 0.00 ? 127 PHE B CE1 1 
ATOM 3953  C CE2 . PHE B 1 132 ? -98.077  138.053 -33.523 1.00 0.00 ? 127 PHE B CE2 1 
ATOM 3954  C CZ  . PHE B 1 132 ? -99.305  137.801 -34.072 1.00 0.00 ? 127 PHE B CZ  1 
ATOM 3955  N N   . TRP B 1 133 ? -96.826  135.433 -30.527 1.00 0.00 ? 128 TRP B N   1 
ATOM 3956  C CA  . TRP B 1 133 ? -96.117  134.472 -31.350 1.00 0.00 ? 128 TRP B CA  1 
ATOM 3957  C C   . TRP B 1 133 ? -96.233  133.055 -30.693 1.00 0.00 ? 128 TRP B C   1 
ATOM 3958  O O   . TRP B 1 133 ? -96.292  132.036 -31.425 1.00 0.00 ? 128 TRP B O   1 
ATOM 3959  C CB  . TRP B 1 133 ? -94.643  134.808 -31.683 1.00 0.00 ? 128 TRP B CB  1 
ATOM 3960  C CG  . TRP B 1 133 ? -94.390  135.904 -32.649 1.00 0.00 ? 128 TRP B CG  1 
ATOM 3961  C CD1 . TRP B 1 133 ? -93.473  137.004 -32.549 1.00 0.00 ? 128 TRP B CD1 1 
ATOM 3962  C CD2 . TRP B 1 133 ? -94.854  135.957 -34.016 1.00 0.00 ? 128 TRP B CD2 1 
ATOM 3963  N NE1 . TRP B 1 133 ? -93.643  137.842 -33.629 1.00 0.00 ? 128 TRP B NE1 1 
ATOM 3964  C CE2 . TRP B 1 133 ? -94.446  137.192 -34.562 1.00 0.00 ? 128 TRP B CE2 1 
ATOM 3965  C CE3 . TRP B 1 133 ? -95.634  135.063 -34.783 1.00 0.00 ? 128 TRP B CE3 1 
ATOM 3966  C CZ2 . TRP B 1 133 ? -94.853  137.488 -35.886 1.00 0.00 ? 128 TRP B CZ2 1 
ATOM 3967  C CZ3 . TRP B 1 133 ? -96.121  135.422 -36.079 1.00 0.00 ? 128 TRP B CZ3 1 
ATOM 3968  C CH2 . TRP B 1 133 ? -95.715  136.606 -36.648 1.00 0.00 ? 128 TRP B CH2 1 
ATOM 3969  N N   . ARG B 1 134 ? -96.210  132.992 -29.342 1.00 0.00 ? 129 ARG B N   1 
ATOM 3970  C CA  . ARG B 1 134 ? -96.637  131.755 -28.621 1.00 0.00 ? 129 ARG B CA  1 
ATOM 3971  C C   . ARG B 1 134 ? -98.014  131.266 -29.002 1.00 0.00 ? 129 ARG B C   1 
ATOM 3972  O O   . ARG B 1 134 ? -98.233  130.108 -29.326 1.00 0.00 ? 129 ARG B O   1 
ATOM 3973  C CB  . ARG B 1 134 ? -96.624  131.781 -27.127 1.00 0.00 ? 129 ARG B CB  1 
ATOM 3974  C CG  . ARG B 1 134 ? -96.642  130.365 -26.447 1.00 0.00 ? 129 ARG B CG  1 
ATOM 3975  C CD  . ARG B 1 134 ? -95.496  129.385 -26.786 1.00 0.00 ? 129 ARG B CD  1 
ATOM 3976  N NE  . ARG B 1 134 ? -94.305  129.936 -26.036 1.00 0.00 ? 129 ARG B NE  1 
ATOM 3977  C CZ  . ARG B 1 134 ? -93.051  129.654 -26.279 1.00 0.00 ? 129 ARG B CZ  1 
ATOM 3978  N NH1 . ARG B 1 134 ? -92.693  128.729 -27.171 1.00 0.00 ? 129 ARG B NH1 1 
ATOM 3979  N NH2 . ARG B 1 134 ? -92.164  130.303 -25.589 1.00 0.00 ? 129 ARG B NH2 1 
ATOM 3980  N N   . GLY B 1 135 ? -99.070  132.161 -29.077 1.00 0.00 ? 130 GLY B N   1 
ATOM 3981  C CA  . GLY B 1 135 ? -100.386 131.849 -29.649 1.00 0.00 ? 130 GLY B CA  1 
ATOM 3982  C C   . GLY B 1 135 ? -100.428 131.336 -31.019 1.00 0.00 ? 130 GLY B C   1 
ATOM 3983  O O   . GLY B 1 135 ? -101.323 130.520 -31.308 1.00 0.00 ? 130 GLY B O   1 
ATOM 3984  N N   . ALA B 1 136 ? -99.550  131.828 -31.853 1.00 0.00 ? 131 ALA B N   1 
ATOM 3985  C CA  . ALA B 1 136 ? -99.492  131.382 -33.279 1.00 0.00 ? 131 ALA B CA  1 
ATOM 3986  C C   . ALA B 1 136 ? -98.681  130.078 -33.493 1.00 0.00 ? 131 ALA B C   1 
ATOM 3987  O O   . ALA B 1 136 ? -98.929  129.285 -34.422 1.00 0.00 ? 131 ALA B O   1 
ATOM 3988  C CB  . ALA B 1 136 ? -98.704  132.470 -33.913 1.00 0.00 ? 131 ALA B CB  1 
ATOM 3989  N N   . GLU B 1 137 ? -97.792  129.754 -32.479 1.00 0.00 ? 132 GLU B N   1 
ATOM 3990  C CA  . GLU B 1 137 ? -97.072  128.534 -32.390 1.00 0.00 ? 132 GLU B CA  1 
ATOM 3991  C C   . GLU B 1 137 ? -97.955  127.346 -32.082 1.00 0.00 ? 132 GLU B C   1 
ATOM 3992  O O   . GLU B 1 137 ? -97.956  126.409 -32.897 1.00 0.00 ? 132 GLU B O   1 
ATOM 3993  C CB  . GLU B 1 137 ? -95.987  128.575 -31.264 1.00 0.00 ? 132 GLU B CB  1 
ATOM 3994  C CG  . GLU B 1 137 ? -95.072  127.342 -31.279 1.00 0.00 ? 132 GLU B CG  1 
ATOM 3995  C CD  . GLU B 1 137 ? -94.003  127.670 -30.157 1.00 0.00 ? 132 GLU B CD  1 
ATOM 3996  O OE1 . GLU B 1 137 ? -93.032  128.418 -30.504 1.00 0.00 ? 132 GLU B OE1 1 
ATOM 3997  O OE2 . GLU B 1 137 ? -94.152  127.243 -28.988 1.00 0.00 ? 132 GLU B OE2 1 
ATOM 3998  N N   . SER B 1 138 ? -98.726  127.540 -31.064 1.00 0.00 ? 133 SER B N   1 
ATOM 3999  C CA  . SER B 1 138 ? -99.766  126.658 -30.805 1.00 0.00 ? 133 SER B CA  1 
ATOM 4000  C C   . SER B 1 138 ? -100.885 126.539 -31.862 1.00 0.00 ? 133 SER B C   1 
ATOM 4001  O O   . SER B 1 138 ? -101.280 125.412 -32.135 1.00 0.00 ? 133 SER B O   1 
ATOM 4002  C CB  . SER B 1 138 ? -100.551 127.054 -29.458 1.00 0.00 ? 133 SER B CB  1 
ATOM 4003  O OG  . SER B 1 138 ? -99.768  127.014 -28.283 1.00 0.00 ? 133 SER B OG  1 
ATOM 4004  N N   . LEU B 1 139 ? -101.328 127.651 -32.510 1.00 0.00 ? 134 LEU B N   1 
ATOM 4005  C CA  . LEU B 1 139 ? -102.271 127.581 -33.618 1.00 0.00 ? 134 LEU B CA  1 
ATOM 4006  C C   . LEU B 1 139 ? -101.688 126.910 -34.866 1.00 0.00 ? 134 LEU B C   1 
ATOM 4007  O O   . LEU B 1 139 ? -102.324 126.048 -35.495 1.00 0.00 ? 134 LEU B O   1 
ATOM 4008  C CB  . LEU B 1 139 ? -102.747 129.064 -34.023 1.00 0.00 ? 134 LEU B CB  1 
ATOM 4009  C CG  . LEU B 1 139 ? -103.770 129.183 -35.118 1.00 0.00 ? 134 LEU B CG  1 
ATOM 4010  C CD1 . LEU B 1 139 ? -104.992 128.350 -34.890 1.00 0.00 ? 134 LEU B CD1 1 
ATOM 4011  C CD2 . LEU B 1 139 ? -104.214 130.643 -35.319 1.00 0.00 ? 134 LEU B CD2 1 
ATOM 4012  N N   . GLU B 1 140 ? -100.375 127.106 -35.189 1.00 0.00 ? 135 GLU B N   1 
ATOM 4013  C CA  . GLU B 1 140 ? -99.659  126.392 -36.312 1.00 0.00 ? 135 GLU B CA  1 
ATOM 4014  C C   . GLU B 1 140 ? -99.705  124.905 -36.086 1.00 0.00 ? 135 GLU B C   1 
ATOM 4015  O O   . GLU B 1 140 ? -100.042 124.152 -37.007 1.00 0.00 ? 135 GLU B O   1 
ATOM 4016  C CB  . GLU B 1 140 ? -98.257  127.005 -36.482 1.00 0.00 ? 135 GLU B CB  1 
ATOM 4017  C CG  . GLU B 1 140 ? -97.485  126.611 -37.822 1.00 0.00 ? 135 GLU B CG  1 
ATOM 4018  C CD  . GLU B 1 140 ? -96.058  127.217 -37.941 1.00 0.00 ? 135 GLU B CD  1 
ATOM 4019  O OE1 . GLU B 1 140 ? -95.642  128.164 -37.148 1.00 0.00 ? 135 GLU B OE1 1 
ATOM 4020  O OE2 . GLU B 1 140 ? -95.373  126.815 -38.922 1.00 0.00 ? 135 GLU B OE2 1 
ATOM 4021  N N   . ALA B 1 141 ? -99.415  124.452 -34.829 1.00 0.00 ? 136 ALA B N   1 
ATOM 4022  C CA  . ALA B 1 141 ? -99.395  123.082 -34.360 1.00 0.00 ? 136 ALA B CA  1 
ATOM 4023  C C   . ALA B 1 141 ? -100.860 122.488 -34.438 1.00 0.00 ? 136 ALA B C   1 
ATOM 4024  O O   . ALA B 1 141 ? -101.158 121.394 -34.947 1.00 0.00 ? 136 ALA B O   1 
ATOM 4025  C CB  . ALA B 1 141 ? -98.940  123.099 -32.842 1.00 0.00 ? 136 ALA B CB  1 
ATOM 4026  N N   . ALA B 1 142 ? -101.903 123.175 -33.978 1.00 0.00 ? 137 ALA B N   1 
ATOM 4027  C CA  . ALA B 1 142 ? -103.311 122.789 -34.002 1.00 0.00 ? 137 ALA B CA  1 
ATOM 4028  C C   . ALA B 1 142 ? -104.018 122.840 -35.329 1.00 0.00 ? 137 ALA B C   1 
ATOM 4029  O O   . ALA B 1 142 ? -104.975 122.113 -35.517 1.00 0.00 ? 137 ALA B O   1 
ATOM 4030  C CB  . ALA B 1 142 ? -104.146 123.775 -33.065 1.00 0.00 ? 137 ALA B CB  1 
ATOM 4031  N N   . LEU B 1 143 ? -103.533 123.706 -36.283 1.00 0.00 ? 138 LEU B N   1 
ATOM 4032  C CA  . LEU B 1 143 ? -103.851 123.562 -37.715 1.00 0.00 ? 138 LEU B CA  1 
ATOM 4033  C C   . LEU B 1 143 ? -103.355 122.294 -38.340 1.00 0.00 ? 138 LEU B C   1 
ATOM 4034  O O   . LEU B 1 143 ? -104.078 121.659 -39.079 1.00 0.00 ? 138 LEU B O   1 
ATOM 4035  C CB  . LEU B 1 143 ? -103.219 124.704 -38.464 1.00 0.00 ? 138 LEU B CB  1 
ATOM 4036  C CG  . LEU B 1 143 ? -104.003 126.054 -38.179 1.00 0.00 ? 138 LEU B CG  1 
ATOM 4037  C CD1 . LEU B 1 143 ? -103.113 127.291 -38.647 1.00 0.00 ? 138 LEU B CD1 1 
ATOM 4038  C CD2 . LEU B 1 143 ? -105.351 126.089 -38.826 1.00 0.00 ? 138 LEU B CD2 1 
ATOM 4039  N N   . THR B 1 144 ? -102.128 121.877 -37.947 1.00 0.00 ? 139 THR B N   1 
ATOM 4040  C CA  . THR B 1 144 ? -101.593 120.482 -38.291 1.00 0.00 ? 139 THR B CA  1 
ATOM 4041  C C   . THR B 1 144 ? -102.409 119.371 -37.695 1.00 0.00 ? 139 THR B C   1 
ATOM 4042  O O   . THR B 1 144 ? -102.899 118.447 -38.295 1.00 0.00 ? 139 THR B O   1 
ATOM 4043  C CB  . THR B 1 144 ? -100.169 120.282 -37.742 1.00 0.00 ? 139 THR B CB  1 
ATOM 4044  O OG1 . THR B 1 144 ? -99.280  121.267 -38.300 1.00 0.00 ? 139 THR B OG1 1 
ATOM 4045  C CG2 . THR B 1 144 ? -99.598  118.943 -38.360 1.00 0.00 ? 139 THR B CG2 1 
ATOM 4046  N N   . HIS B 1 145 ? -102.743 119.581 -36.381 1.00 0.00 ? 140 HIS B N   1 
ATOM 4047  C CA  . HIS B 1 145 ? -103.494 118.650 -35.613 1.00 0.00 ? 140 HIS B CA  1 
ATOM 4048  C C   . HIS B 1 145 ? -104.912 118.411 -36.150 1.00 0.00 ? 140 HIS B C   1 
ATOM 4049  O O   . HIS B 1 145 ? -105.374 117.267 -36.206 1.00 0.00 ? 140 HIS B O   1 
ATOM 4050  C CB  . HIS B 1 145 ? -103.626 118.990 -34.044 1.00 0.00 ? 140 HIS B CB  1 
ATOM 4051  C CG  . HIS B 1 145 ? -104.342 118.031 -33.127 1.00 0.00 ? 140 HIS B CG  1 
ATOM 4052  N ND1 . HIS B 1 145 ? -104.061 116.702 -32.927 1.00 0.00 ? 140 HIS B ND1 1 
ATOM 4053  C CD2 . HIS B 1 145 ? -105.467 118.224 -32.431 1.00 0.00 ? 140 HIS B CD2 1 
ATOM 4054  C CE1 . HIS B 1 145 ? -104.997 116.150 -32.127 1.00 0.00 ? 140 HIS B CE1 1 
ATOM 4055  N NE2 . HIS B 1 145 ? -105.826 117.105 -31.729 1.00 0.00 ? 140 HIS B NE2 1 
ATOM 4056  N N   . ASN B 1 146 ? -105.623 119.520 -36.639 1.00 0.00 ? 141 ASN B N   1 
ATOM 4057  C CA  . ASN B 1 146 ? -106.884 119.651 -37.225 1.00 0.00 ? 141 ASN B CA  1 
ATOM 4058  C C   . ASN B 1 146 ? -106.968 118.951 -38.606 1.00 0.00 ? 141 ASN B C   1 
ATOM 4059  O O   . ASN B 1 146 ? -108.072 118.594 -39.011 1.00 0.00 ? 141 ASN B O   1 
ATOM 4060  C CB  . ASN B 1 146 ? -107.266 121.170 -37.304 1.00 0.00 ? 141 ASN B CB  1 
ATOM 4061  C CG  . ASN B 1 146 ? -108.650 121.339 -37.890 1.00 0.00 ? 141 ASN B CG  1 
ATOM 4062  O OD1 . ASN B 1 146 ? -109.683 121.081 -37.287 1.00 0.00 ? 141 ASN B OD1 1 
ATOM 4063  N ND2 . ASN B 1 146 ? -108.685 121.860 -39.069 1.00 0.00 ? 141 ASN B ND2 1 
ATOM 4064  N N   . ALA B 1 147 ? -105.773 118.762 -39.173 1.00 0.00 ? 142 ALA B N   1 
ATOM 4065  C CA  . ALA B 1 147 ? -105.635 118.304 -40.565 1.00 0.00 ? 142 ALA B CA  1 
ATOM 4066  C C   . ALA B 1 147 ? -105.394 116.825 -40.538 1.00 0.00 ? 142 ALA B C   1 
ATOM 4067  O O   . ALA B 1 147 ? -105.776 116.084 -41.456 1.00 0.00 ? 142 ALA B O   1 
ATOM 4068  C CB  . ALA B 1 147 ? -104.565 119.087 -41.333 1.00 0.00 ? 142 ALA B CB  1 
ATOM 4069  N N   . GLU B 1 148 ? -104.775 116.244 -39.466 1.00 0.00 ? 143 GLU B N   1 
ATOM 4070  C CA  . GLU B 1 148 ? -104.588 114.788 -39.269 1.00 0.00 ? 143 GLU B CA  1 
ATOM 4071  C C   . GLU B 1 148 ? -105.857 114.080 -38.826 1.00 0.00 ? 143 GLU B C   1 
ATOM 4072  O O   . GLU B 1 148 ? -105.888 113.491 -37.710 1.00 0.00 ? 143 GLU B O   1 
ATOM 4073  C CB  . GLU B 1 148 ? -103.486 114.565 -38.151 1.00 0.00 ? 143 GLU B CB  1 
ATOM 4074  C CG  . GLU B 1 148 ? -101.974 114.891 -38.498 1.00 0.00 ? 143 GLU B CG  1 
ATOM 4075  C CD  . GLU B 1 148 ? -101.107 114.742 -37.333 1.00 0.00 ? 143 GLU B CD  1 
ATOM 4076  O OE1 . GLU B 1 148 ? -101.489 115.116 -36.207 1.00 0.00 ? 143 GLU B OE1 1 
ATOM 4077  O OE2 . GLU B 1 148 ? -100.134 113.974 -37.524 1.00 0.00 ? 143 GLU B OE2 1 
ATOM 4078  N N   . VAL B 1 149 ? -106.956 114.173 -39.587 1.00 0.00 ? 144 VAL B N   1 
ATOM 4079  C CA  . VAL B 1 149 ? -108.234 113.523 -39.281 1.00 0.00 ? 144 VAL B CA  1 
ATOM 4080  C C   . VAL B 1 149 ? -108.551 112.579 -40.441 1.00 0.00 ? 144 VAL B C   1 
ATOM 4081  O O   . VAL B 1 149 ? -108.796 112.958 -41.598 1.00 0.00 ? 144 VAL B O   1 
ATOM 4082  C CB  . VAL B 1 149 ? -109.370 114.470 -38.976 1.00 0.00 ? 144 VAL B CB  1 
ATOM 4083  C CG1 . VAL B 1 149 ? -110.737 113.768 -38.796 1.00 0.00 ? 144 VAL B CG1 1 
ATOM 4084  C CG2 . VAL B 1 149 ? -109.043 115.125 -37.564 1.00 0.00 ? 144 VAL B CG2 1 
ATOM 4085  N N   . PRO B 1 150 ? -108.544 111.264 -40.185 1.00 0.00 ? 145 PRO B N   1 
ATOM 4086  C CA  . PRO B 1 150 ? -109.070 110.324 -41.126 1.00 0.00 ? 145 PRO B CA  1 
ATOM 4087  C C   . PRO B 1 150 ? -110.472 110.562 -41.564 1.00 0.00 ? 145 PRO B C   1 
ATOM 4088  O O   . PRO B 1 150 ? -111.259 110.804 -40.651 1.00 0.00 ? 145 PRO B O   1 
ATOM 4089  C CB  . PRO B 1 150 ? -108.779 108.971 -40.452 1.00 0.00 ? 145 PRO B CB  1 
ATOM 4090  C CG  . PRO B 1 150 ? -107.478 109.266 -39.682 1.00 0.00 ? 145 PRO B CG  1 
ATOM 4091  C CD  . PRO B 1 150 ? -107.595 110.692 -39.170 1.00 0.00 ? 145 PRO B CD  1 
ATOM 4092  N N   . ARG B 1 151 ? -110.872 110.502 -42.889 1.00 0.00 ? 146 ARG B N   1 
ATOM 4093  C CA  . ARG B 1 151 ? -112.248 110.715 -43.440 1.00 0.00 ? 146 ARG B CA  1 
ATOM 4094  C C   . ARG B 1 151 ? -113.416 109.888 -42.863 1.00 0.00 ? 146 ARG B C   1 
ATOM 4095  O O   . ARG B 1 151 ? -114.559 110.358 -42.666 1.00 0.00 ? 146 ARG B O   1 
ATOM 4096  C CB  . ARG B 1 151 ? -112.265 110.504 -44.962 1.00 0.00 ? 146 ARG B CB  1 
ATOM 4097  C CG  . ARG B 1 151 ? -113.550 111.142 -45.643 1.00 0.00 ? 146 ARG B CG  1 
ATOM 4098  C CD  . ARG B 1 151 ? -113.512 111.145 -47.128 1.00 0.00 ? 146 ARG B CD  1 
ATOM 4099  N NE  . ARG B 1 151 ? -114.712 112.044 -47.587 1.00 0.00 ? 146 ARG B NE  1 
ATOM 4100  C CZ  . ARG B 1 151 ? -114.581 113.202 -48.309 1.00 0.00 ? 146 ARG B CZ  1 
ATOM 4101  N NH1 . ARG B 1 151 ? -113.420 113.577 -48.792 1.00 0.00 ? 146 ARG B NH1 1 
ATOM 4102  N NH2 . ARG B 1 151 ? -115.618 113.992 -48.527 1.00 0.00 ? 146 ARG B NH2 1 
ATOM 4103  N N   . ARG B 1 152 ? -113.182 108.643 -42.522 1.00 0.00 ? 147 ARG B N   1 
ATOM 4104  C CA  . ARG B 1 152 ? -114.093 107.782 -41.773 1.00 0.00 ? 147 ARG B CA  1 
ATOM 4105  C C   . ARG B 1 152 ? -114.573 108.314 -40.392 1.00 0.00 ? 147 ARG B C   1 
ATOM 4106  O O   . ARG B 1 152 ? -115.700 108.049 -39.920 1.00 0.00 ? 147 ARG B O   1 
ATOM 4107  C CB  . ARG B 1 152 ? -113.532 106.368 -41.653 1.00 0.00 ? 147 ARG B CB  1 
ATOM 4108  C CG  . ARG B 1 152 ? -112.221 106.138 -40.877 1.00 0.00 ? 147 ARG B CG  1 
ATOM 4109  C CD  . ARG B 1 152 ? -111.537 104.747 -41.076 1.00 0.00 ? 147 ARG B CD  1 
ATOM 4110  N NE  . ARG B 1 152 ? -110.475 104.659 -40.090 1.00 0.00 ? 147 ARG B NE  1 
ATOM 4111  C CZ  . ARG B 1 152 ? -109.128 104.846 -40.337 1.00 0.00 ? 147 ARG B CZ  1 
ATOM 4112  N NH1 . ARG B 1 152 ? -108.627 105.072 -41.581 1.00 0.00 ? 147 ARG B NH1 1 
ATOM 4113  N NH2 . ARG B 1 152 ? -108.285 104.803 -39.322 1.00 0.00 ? 147 ARG B NH2 1 
ATOM 4114  N N   . ARG B 1 153 ? -113.702 109.167 -39.806 1.00 0.00 ? 148 ARG B N   1 
ATOM 4115  C CA  . ARG B 1 153 ? -113.911 109.506 -38.406 1.00 0.00 ? 148 ARG B CA  1 
ATOM 4116  C C   . ARG B 1 153 ? -114.722 110.697 -38.109 1.00 0.00 ? 148 ARG B C   1 
ATOM 4117  O O   . ARG B 1 153 ? -114.839 111.663 -38.895 1.00 0.00 ? 148 ARG B O   1 
ATOM 4118  C CB  . ARG B 1 153 ? -112.534 109.697 -37.696 1.00 0.00 ? 148 ARG B CB  1 
ATOM 4119  C CG  . ARG B 1 153 ? -111.743 108.388 -37.667 1.00 0.00 ? 148 ARG B CG  1 
ATOM 4120  C CD  . ARG B 1 153 ? -110.736 108.294 -36.530 1.00 0.00 ? 148 ARG B CD  1 
ATOM 4121  N NE  . ARG B 1 153 ? -110.057 106.943 -36.602 1.00 0.00 ? 148 ARG B NE  1 
ATOM 4122  C CZ  . ARG B 1 153 ? -109.124 106.542 -35.692 1.00 0.00 ? 148 ARG B CZ  1 
ATOM 4123  N NH1 . ARG B 1 153 ? -108.496 107.429 -34.919 1.00 0.00 ? 148 ARG B NH1 1 
ATOM 4124  N NH2 . ARG B 1 153 ? -108.834 105.272 -35.517 1.00 0.00 ? 148 ARG B NH2 1 
ATOM 4125  N N   . ALA B 1 154 ? -115.350 110.662 -36.903 1.00 0.00 ? 149 ALA B N   1 
ATOM 4126  C CA  . ALA B 1 154 ? -116.323 111.668 -36.399 1.00 0.00 ? 149 ALA B CA  1 
ATOM 4127  C C   . ALA B 1 154 ? -116.049 112.133 -34.916 1.00 0.00 ? 149 ALA B C   1 
ATOM 4128  O O   . ALA B 1 154 ? -116.262 113.268 -34.525 1.00 0.00 ? 149 ALA B O   1 
ATOM 4129  C CB  . ALA B 1 154 ? -117.736 111.094 -36.504 1.00 0.00 ? 149 ALA B CB  1 
ATOM 4130  N N   . GLN B 1 155 ? -115.529 111.197 -34.102 1.00 0.00 ? 150 GLN B N   1 
ATOM 4131  C CA  . GLN B 1 155 ? -115.112 111.440 -32.770 1.00 0.00 ? 150 GLN B CA  1 
ATOM 4132  C C   . GLN B 1 155 ? -113.696 112.036 -32.808 1.00 0.00 ? 150 GLN B C   1 
ATOM 4133  O O   . GLN B 1 155 ? -113.314 112.845 -32.019 1.00 0.00 ? 150 GLN B O   1 
ATOM 4134  C CB  . GLN B 1 155 ? -115.217 110.071 -31.864 1.00 0.00 ? 150 GLN B CB  1 
ATOM 4135  C CG  . GLN B 1 155 ? -115.105 110.447 -30.310 1.00 0.00 ? 150 GLN B CG  1 
ATOM 4136  C CD  . GLN B 1 155 ? -114.856 109.219 -29.472 1.00 0.00 ? 150 GLN B CD  1 
ATOM 4137  O OE1 . GLN B 1 155 ? -115.882 108.779 -28.817 1.00 0.00 ? 150 GLN B OE1 1 
ATOM 4138  N NE2 . GLN B 1 155 ? -113.723 108.508 -29.597 1.00 0.00 ? 150 GLN B NE2 1 
ATOM 4139  N N   . GLU B 1 156 ? -112.871 111.594 -33.779 1.00 0.00 ? 151 GLU B N   1 
ATOM 4140  C CA  . GLU B 1 156 ? -111.632 112.310 -34.008 1.00 0.00 ? 151 GLU B CA  1 
ATOM 4141  C C   . GLU B 1 156 ? -111.812 113.656 -34.583 1.00 0.00 ? 151 GLU B C   1 
ATOM 4142  O O   . GLU B 1 156 ? -111.164 114.623 -34.281 1.00 0.00 ? 151 GLU B O   1 
ATOM 4143  C CB  . GLU B 1 156 ? -110.651 111.463 -34.883 1.00 0.00 ? 151 GLU B CB  1 
ATOM 4144  C CG  . GLU B 1 156 ? -109.203 111.949 -34.839 1.00 0.00 ? 151 GLU B CG  1 
ATOM 4145  C CD  . GLU B 1 156 ? -108.073 110.940 -34.653 1.00 0.00 ? 151 GLU B CD  1 
ATOM 4146  O OE1 . GLU B 1 156 ? -108.047 110.036 -35.499 1.00 0.00 ? 151 GLU B OE1 1 
ATOM 4147  O OE2 . GLU B 1 156 ? -107.127 111.199 -33.900 1.00 0.00 ? 151 GLU B OE2 1 
ATOM 4148  N N   . ALA B 1 157 ? -112.812 113.853 -35.491 1.00 0.00 ? 152 ALA B N   1 
ATOM 4149  C CA  . ALA B 1 157 ? -113.180 115.190 -36.046 1.00 0.00 ? 152 ALA B CA  1 
ATOM 4150  C C   . ALA B 1 157 ? -113.630 116.215 -35.089 1.00 0.00 ? 152 ALA B C   1 
ATOM 4151  O O   . ALA B 1 157 ? -113.199 117.386 -35.089 1.00 0.00 ? 152 ALA B O   1 
ATOM 4152  C CB  . ALA B 1 157 ? -114.331 114.988 -37.085 1.00 0.00 ? 152 ALA B CB  1 
ATOM 4153  N N   . GLU B 1 158 ? -114.483 115.813 -34.112 1.00 0.00 ? 153 GLU B N   1 
ATOM 4154  C CA  . GLU B 1 158 ? -114.939 116.816 -33.168 1.00 0.00 ? 153 GLU B CA  1 
ATOM 4155  C C   . GLU B 1 158 ? -113.840 117.159 -32.100 1.00 0.00 ? 153 GLU B C   1 
ATOM 4156  O O   . GLU B 1 158 ? -113.792 118.210 -31.465 1.00 0.00 ? 153 GLU B O   1 
ATOM 4157  C CB  . GLU B 1 158 ? -116.426 116.429 -32.612 1.00 0.00 ? 153 GLU B CB  1 
ATOM 4158  C CG  . GLU B 1 158 ? -117.573 116.520 -33.661 1.00 0.00 ? 153 GLU B CG  1 
ATOM 4159  C CD  . GLU B 1 158 ? -117.582 117.932 -34.220 1.00 0.00 ? 153 GLU B CD  1 
ATOM 4160  O OE1 . GLU B 1 158 ? -117.669 118.872 -33.447 1.00 0.00 ? 153 GLU B OE1 1 
ATOM 4161  O OE2 . GLU B 1 158 ? -117.553 118.143 -35.487 1.00 0.00 ? 153 GLU B OE2 1 
ATOM 4162  N N   . GLU B 1 159 ? -113.021 116.199 -31.764 1.00 0.00 ? 154 GLU B N   1 
ATOM 4163  C CA  . GLU B 1 159 ? -111.872 116.238 -30.846 1.00 0.00 ? 154 GLU B CA  1 
ATOM 4164  C C   . GLU B 1 159 ? -110.707 117.056 -31.413 1.00 0.00 ? 154 GLU B C   1 
ATOM 4165  O O   . GLU B 1 159 ? -110.126 117.849 -30.737 1.00 0.00 ? 154 GLU B O   1 
ATOM 4166  C CB  . GLU B 1 159 ? -111.470 114.783 -30.296 1.00 0.00 ? 154 GLU B CB  1 
ATOM 4167  C CG  . GLU B 1 159 ? -110.396 114.762 -29.162 1.00 0.00 ? 154 GLU B CG  1 
ATOM 4168  C CD  . GLU B 1 159 ? -109.768 113.484 -28.839 1.00 0.00 ? 154 GLU B CD  1 
ATOM 4169  O OE1 . GLU B 1 159 ? -109.065 112.864 -29.769 1.00 0.00 ? 154 GLU B OE1 1 
ATOM 4170  O OE2 . GLU B 1 159 ? -110.053 112.949 -27.740 1.00 0.00 ? 154 GLU B OE2 1 
ATOM 4171  N N   . ALA B 1 160 ? -110.419 116.832 -32.691 1.00 0.00 ? 155 ALA B N   1 
ATOM 4172  C CA  . ALA B 1 160 ? -109.419 117.621 -33.308 1.00 0.00 ? 155 ALA B CA  1 
ATOM 4173  C C   . ALA B 1 160 ? -109.882 119.059 -33.420 1.00 0.00 ? 155 ALA B C   1 
ATOM 4174  O O   . ALA B 1 160 ? -109.189 120.038 -33.120 1.00 0.00 ? 155 ALA B O   1 
ATOM 4175  C CB  . ALA B 1 160 ? -109.109 117.009 -34.734 1.00 0.00 ? 155 ALA B CB  1 
ATOM 4176  N N   . GLY B 1 161 ? -111.159 119.198 -33.954 1.00 0.00 ? 156 GLY B N   1 
ATOM 4177  C CA  . GLY B 1 161 ? -111.745 120.540 -34.126 1.00 0.00 ? 156 GLY B CA  1 
ATOM 4178  C C   . GLY B 1 161 ? -111.928 121.310 -32.907 1.00 0.00 ? 156 GLY B C   1 
ATOM 4179  O O   . GLY B 1 161 ? -111.893 122.561 -33.031 1.00 0.00 ? 156 GLY B O   1 
ATOM 4180  N N   . ALA B 1 162 ? -112.100 120.782 -31.723 1.00 0.00 ? 157 ALA B N   1 
ATOM 4181  C CA  . ALA B 1 162 ? -112.219 121.511 -30.498 1.00 0.00 ? 157 ALA B CA  1 
ATOM 4182  C C   . ALA B 1 162 ? -110.864 122.180 -30.041 1.00 0.00 ? 157 ALA B C   1 
ATOM 4183  O O   . ALA B 1 162 ? -110.762 123.390 -29.746 1.00 0.00 ? 157 ALA B O   1 
ATOM 4184  C CB  . ALA B 1 162 ? -112.848 120.626 -29.425 1.00 0.00 ? 157 ALA B CB  1 
ATOM 4185  N N   . ALA B 1 163 ? -109.756 121.443 -30.249 1.00 0.00 ? 158 ALA B N   1 
ATOM 4186  C CA  . ALA B 1 163 ? -108.387 121.887 -30.096 1.00 0.00 ? 158 ALA B CA  1 
ATOM 4187  C C   . ALA B 1 163 ? -108.046 123.073 -31.045 1.00 0.00 ? 158 ALA B C   1 
ATOM 4188  O O   . ALA B 1 163 ? -107.433 124.045 -30.619 1.00 0.00 ? 158 ALA B O   1 
ATOM 4189  C CB  . ALA B 1 163 ? -107.475 120.645 -30.299 1.00 0.00 ? 158 ALA B CB  1 
ATOM 4190  N N   . LEU B 1 164 ? -108.525 123.055 -32.335 1.00 0.00 ? 159 LEU B N   1 
ATOM 4191  C CA  . LEU B 1 164 ? -108.400 124.136 -33.245 1.00 0.00 ? 159 LEU B CA  1 
ATOM 4192  C C   . LEU B 1 164 ? -109.176 125.423 -32.804 1.00 0.00 ? 159 LEU B C   1 
ATOM 4193  O O   . LEU B 1 164 ? -108.555 126.559 -32.745 1.00 0.00 ? 159 LEU B O   1 
ATOM 4194  C CB  . LEU B 1 164 ? -109.035 123.664 -34.597 1.00 0.00 ? 159 LEU B CB  1 
ATOM 4195  C CG  . LEU B 1 164 ? -109.144 124.733 -35.710 1.00 0.00 ? 159 LEU B CG  1 
ATOM 4196  C CD1 . LEU B 1 164 ? -107.769 125.048 -36.387 1.00 0.00 ? 159 LEU B CD1 1 
ATOM 4197  C CD2 . LEU B 1 164 ? -110.231 124.362 -36.815 1.00 0.00 ? 159 LEU B CD2 1 
ATOM 4198  N N   . ARG B 1 165 ? -110.394 125.259 -32.310 1.00 0.00 ? 160 ARG B N   1 
ATOM 4199  C CA  . ARG B 1 165 ? -111.268 126.262 -31.739 1.00 0.00 ? 160 ARG B CA  1 
ATOM 4200  C C   . ARG B 1 165 ? -110.672 127.129 -30.649 1.00 0.00 ? 160 ARG B C   1 
ATOM 4201  O O   . ARG B 1 165 ? -110.640 128.371 -30.620 1.00 0.00 ? 160 ARG B O   1 
ATOM 4202  C CB  . ARG B 1 165 ? -112.744 125.979 -31.373 1.00 0.00 ? 160 ARG B CB  1 
ATOM 4203  C CG  . ARG B 1 165 ? -113.618 125.210 -32.363 1.00 0.00 ? 160 ARG B CG  1 
ATOM 4204  C CD  . ARG B 1 165 ? -113.150 125.384 -33.877 1.00 0.00 ? 160 ARG B CD  1 
ATOM 4205  N NE  . ARG B 1 165 ? -114.161 124.639 -34.762 1.00 0.00 ? 160 ARG B NE  1 
ATOM 4206  C CZ  . ARG B 1 165 ? -114.567 125.087 -35.974 1.00 0.00 ? 160 ARG B CZ  1 
ATOM 4207  N NH1 . ARG B 1 165 ? -113.707 125.834 -36.708 1.00 0.00 ? 160 ARG B NH1 1 
ATOM 4208  N NH2 . ARG B 1 165 ? -115.736 124.811 -36.435 1.00 0.00 ? 160 ARG B NH2 1 
ATOM 4209  N N   . THR B 1 166 ? -110.076 126.486 -29.657 1.00 0.00 ? 161 THR B N   1 
ATOM 4210  C CA  . THR B 1 166 ? -109.458 127.203 -28.543 1.00 0.00 ? 161 THR B CA  1 
ATOM 4211  C C   . THR B 1 166 ? -108.151 127.866 -28.847 1.00 0.00 ? 161 THR B C   1 
ATOM 4212  O O   . THR B 1 166 ? -107.867 128.954 -28.387 1.00 0.00 ? 161 THR B O   1 
ATOM 4213  C CB  . THR B 1 166 ? -109.229 126.286 -27.383 1.00 0.00 ? 161 THR B CB  1 
ATOM 4214  O OG1 . THR B 1 166 ? -108.759 125.045 -27.891 1.00 0.00 ? 161 THR B OG1 1 
ATOM 4215  C CG2 . THR B 1 166 ? -110.521 126.047 -26.640 1.00 0.00 ? 161 THR B CG2 1 
ATOM 4216  N N   . ALA B 1 167 ? -107.297 127.199 -29.686 1.00 0.00 ? 162 ALA B N   1 
ATOM 4217  C CA  . ALA B 1 167 ? -106.173 127.767 -30.370 1.00 0.00 ? 162 ALA B CA  1 
ATOM 4218  C C   . ALA B 1 167 ? -106.490 129.000 -31.220 1.00 0.00 ? 162 ALA B C   1 
ATOM 4219  O O   . ALA B 1 167 ? -105.610 129.892 -31.205 1.00 0.00 ? 162 ALA B O   1 
ATOM 4220  C CB  . ALA B 1 167 ? -105.385 126.785 -31.246 1.00 0.00 ? 162 ALA B CB  1 
ATOM 4221  N N   . ARG B 1 168 ? -107.609 129.067 -31.979 1.00 0.00 ? 163 ARG B N   1 
ATOM 4222  C CA  . ARG B 1 168 ? -107.971 130.150 -32.820 1.00 0.00 ? 163 ARG B CA  1 
ATOM 4223  C C   . ARG B 1 168 ? -108.528 131.338 -31.983 1.00 0.00 ? 163 ARG B C   1 
ATOM 4224  O O   . ARG B 1 168 ? -108.011 132.458 -32.195 1.00 0.00 ? 163 ARG B O   1 
ATOM 4225  C CB  . ARG B 1 168 ? -108.945 129.740 -34.019 1.00 0.00 ? 163 ARG B CB  1 
ATOM 4226  C CG  . ARG B 1 168 ? -109.577 130.920 -34.809 1.00 0.00 ? 163 ARG B CG  1 
ATOM 4227  C CD  . ARG B 1 168 ? -108.521 131.727 -35.660 1.00 0.00 ? 163 ARG B CD  1 
ATOM 4228  N NE  . ARG B 1 168 ? -108.124 130.880 -36.839 1.00 0.00 ? 163 ARG B NE  1 
ATOM 4229  C CZ  . ARG B 1 168 ? -107.147 131.150 -37.721 1.00 0.00 ? 163 ARG B CZ  1 
ATOM 4230  N NH1 . ARG B 1 168 ? -106.478 132.280 -37.748 1.00 0.00 ? 163 ARG B NH1 1 
ATOM 4231  N NH2 . ARG B 1 168 ? -106.792 130.279 -38.660 1.00 0.00 ? 163 ARG B NH2 1 
ATOM 4232  N N   . ALA B 1 169 ? -109.329 131.082 -30.962 1.00 0.00 ? 164 ALA B N   1 
ATOM 4233  C CA  . ALA B 1 169 ? -109.909 132.068 -30.019 1.00 0.00 ? 164 ALA B CA  1 
ATOM 4234  C C   . ALA B 1 169 ? -108.871 132.775 -29.169 1.00 0.00 ? 164 ALA B C   1 
ATOM 4235  O O   . ALA B 1 169 ? -108.852 133.999 -28.925 1.00 0.00 ? 164 ALA B O   1 
ATOM 4236  C CB  . ALA B 1 169 ? -110.987 131.266 -29.115 1.00 0.00 ? 164 ALA B CB  1 
ATOM 4237  N N   . GLY B 1 170 ? -107.873 132.046 -28.763 1.00 0.00 ? 165 GLY B N   1 
ATOM 4238  C CA  . GLY B 1 170 ? -106.789 132.524 -27.981 1.00 0.00 ? 165 GLY B CA  1 
ATOM 4239  C C   . GLY B 1 170 ? -105.748 133.320 -28.684 1.00 0.00 ? 165 GLY B C   1 
ATOM 4240  O O   . GLY B 1 170 ? -105.362 134.436 -28.247 1.00 0.00 ? 165 GLY B O   1 
ATOM 4241  N N   . TYR B 1 171 ? -105.421 132.864 -29.977 1.00 0.00 ? 166 TYR B N   1 
ATOM 4242  C CA  . TYR B 1 171 ? -104.647 133.665 -30.953 1.00 0.00 ? 166 TYR B CA  1 
ATOM 4243  C C   . TYR B 1 171 ? -105.247 135.055 -31.224 1.00 0.00 ? 166 TYR B C   1 
ATOM 4244  O O   . TYR B 1 171 ? -104.578 136.107 -31.218 1.00 0.00 ? 166 TYR B O   1 
ATOM 4245  C CB  . TYR B 1 171 ? -104.552 132.857 -32.297 1.00 0.00 ? 166 TYR B CB  1 
ATOM 4246  C CG  . TYR B 1 171 ? -103.696 133.470 -33.343 1.00 0.00 ? 166 TYR B CG  1 
ATOM 4247  C CD1 . TYR B 1 171 ? -102.500 133.961 -33.043 1.00 0.00 ? 166 TYR B CD1 1 
ATOM 4248  C CD2 . TYR B 1 171 ? -104.311 133.838 -34.566 1.00 0.00 ? 166 TYR B CD2 1 
ATOM 4249  C CE1 . TYR B 1 171 ? -101.695 134.637 -34.040 1.00 0.00 ? 166 TYR B CE1 1 
ATOM 4250  C CE2 . TYR B 1 171 ? -103.512 134.467 -35.543 1.00 0.00 ? 166 TYR B CE2 1 
ATOM 4251  C CZ  . TYR B 1 171 ? -102.200 134.862 -35.301 1.00 0.00 ? 166 TYR B CZ  1 
ATOM 4252  O OH  . TYR B 1 171 ? -101.462 135.643 -36.258 1.00 0.00 ? 166 TYR B OH  1 
ATOM 4253  N N   . ARG B 1 172 ? -106.593 135.133 -31.308 1.00 0.00 ? 167 ARG B N   1 
ATOM 4254  C CA  . ARG B 1 172 ? -107.377 136.303 -31.472 1.00 0.00 ? 167 ARG B CA  1 
ATOM 4255  C C   . ARG B 1 172 ? -107.423 137.201 -30.229 1.00 0.00 ? 167 ARG B C   1 
ATOM 4256  O O   . ARG B 1 172 ? -107.244 138.419 -30.376 1.00 0.00 ? 167 ARG B O   1 
ATOM 4257  C CB  . ARG B 1 172 ? -108.772 135.856 -31.933 1.00 0.00 ? 167 ARG B CB  1 
ATOM 4258  C CG  . ARG B 1 172 ? -108.959 135.488 -33.399 1.00 0.00 ? 167 ARG B CG  1 
ATOM 4259  C CD  . ARG B 1 172 ? -110.385 135.132 -33.817 1.00 0.00 ? 167 ARG B CD  1 
ATOM 4260  N NE  . ARG B 1 172 ? -110.431 135.011 -35.294 1.00 0.00 ? 167 ARG B NE  1 
ATOM 4261  C CZ  . ARG B 1 172 ? -111.491 134.581 -35.974 1.00 0.00 ? 167 ARG B CZ  1 
ATOM 4262  N NH1 . ARG B 1 172 ? -112.515 133.960 -35.328 1.00 0.00 ? 167 ARG B NH1 1 
ATOM 4263  N NH2 . ARG B 1 172 ? -111.587 134.893 -37.265 1.00 0.00 ? 167 ARG B NH2 1 
ATOM 4264  N N   . GLY B 1 173 ? -107.513 136.671 -28.996 1.00 0.00 ? 168 GLY B N   1 
ATOM 4265  C CA  . GLY B 1 173 ? -107.382 137.456 -27.780 1.00 0.00 ? 168 GLY B CA  1 
ATOM 4266  C C   . GLY B 1 173 ? -105.933 138.007 -27.619 1.00 0.00 ? 168 GLY B C   1 
ATOM 4267  O O   . GLY B 1 173 ? -105.798 139.156 -27.235 1.00 0.00 ? 168 GLY B O   1 
ATOM 4268  N N   . ARG B 1 174 ? -104.908 137.238 -28.003 1.00 0.00 ? 169 ARG B N   1 
ATOM 4269  C CA  . ARG B 1 174 ? -103.517 137.567 -27.979 1.00 0.00 ? 169 ARG B CA  1 
ATOM 4270  C C   . ARG B 1 174 ? -103.156 138.639 -29.051 1.00 0.00 ? 169 ARG B C   1 
ATOM 4271  O O   . ARG B 1 174 ? -102.341 139.536 -28.888 1.00 0.00 ? 169 ARG B O   1 
ATOM 4272  C CB  . ARG B 1 174 ? -102.592 136.298 -28.065 1.00 0.00 ? 169 ARG B CB  1 
ATOM 4273  C CG  . ARG B 1 174 ? -102.717 135.647 -26.675 1.00 0.00 ? 169 ARG B CG  1 
ATOM 4274  C CD  . ARG B 1 174 ? -102.483 134.121 -26.611 1.00 0.00 ? 169 ARG B CD  1 
ATOM 4275  N NE  . ARG B 1 174 ? -101.114 133.949 -25.894 1.00 0.00 ? 169 ARG B NE  1 
ATOM 4276  C CZ  . ARG B 1 174 ? -100.703 132.773 -25.618 1.00 0.00 ? 169 ARG B CZ  1 
ATOM 4277  N NH1 . ARG B 1 174 ? -101.290 131.606 -26.003 1.00 0.00 ? 169 ARG B NH1 1 
ATOM 4278  N NH2 . ARG B 1 174 ? -99.567  132.565 -25.018 1.00 0.00 ? 169 ARG B NH2 1 
ATOM 4279  N N   . ALA B 1 175 ? -103.844 138.506 -30.182 1.00 0.00 ? 170 ALA B N   1 
ATOM 4280  C CA  . ALA B 1 175 ? -103.837 139.493 -31.185 1.00 0.00 ? 170 ALA B CA  1 
ATOM 4281  C C   . ALA B 1 175 ? -104.378 140.880 -30.755 1.00 0.00 ? 170 ALA B C   1 
ATOM 4282  O O   . ALA B 1 175 ? -103.807 141.977 -30.977 1.00 0.00 ? 170 ALA B O   1 
ATOM 4283  C CB  . ALA B 1 175 ? -104.625 139.151 -32.460 1.00 0.00 ? 170 ALA B CB  1 
ATOM 4284  N N   . LEU B 1 176 ? -105.548 140.876 -30.094 1.00 0.00 ? 171 LEU B N   1 
ATOM 4285  C CA  . LEU B 1 176 ? -106.052 142.119 -29.504 1.00 0.00 ? 171 LEU B CA  1 
ATOM 4286  C C   . LEU B 1 176 ? -105.025 142.868 -28.530 1.00 0.00 ? 171 LEU B C   1 
ATOM 4287  O O   . LEU B 1 176 ? -104.837 144.097 -28.677 1.00 0.00 ? 171 LEU B O   1 
ATOM 4288  C CB  . LEU B 1 176 ? -107.350 141.771 -28.747 1.00 0.00 ? 171 LEU B CB  1 
ATOM 4289  C CG  . LEU B 1 176 ? -108.548 141.400 -29.676 1.00 0.00 ? 171 LEU B CG  1 
ATOM 4290  C CD1 . LEU B 1 176 ? -109.811 141.056 -28.898 1.00 0.00 ? 171 LEU B CD1 1 
ATOM 4291  C CD2 . LEU B 1 176 ? -108.790 142.532 -30.703 1.00 0.00 ? 171 LEU B CD2 1 
ATOM 4292  N N   . ASP B 1 177 ? -104.349 142.163 -27.567 1.00 0.00 ? 172 ASP B N   1 
ATOM 4293  C CA  . ASP B 1 177 ? -103.236 142.652 -26.730 1.00 0.00 ? 172 ASP B CA  1 
ATOM 4294  C C   . ASP B 1 177 ? -102.000 143.090 -27.496 1.00 0.00 ? 172 ASP B C   1 
ATOM 4295  O O   . ASP B 1 177 ? -101.443 144.097 -27.089 1.00 0.00 ? 172 ASP B O   1 
ATOM 4296  C CB  . ASP B 1 177 ? -102.873 141.603 -25.540 1.00 0.00 ? 172 ASP B CB  1 
ATOM 4297  C CG  . ASP B 1 177 ? -103.844 141.690 -24.426 1.00 0.00 ? 172 ASP B CG  1 
ATOM 4298  O OD1 . ASP B 1 177 ? -103.691 142.685 -23.644 1.00 0.00 ? 172 ASP B OD1 1 
ATOM 4299  O OD2 . ASP B 1 177 ? -104.782 140.800 -24.308 1.00 0.00 ? 172 ASP B OD2 1 
ATOM 4300  N N   . TYR B 1 178 ? -101.567 142.445 -28.623 1.00 0.00 ? 173 TYR B N   1 
ATOM 4301  C CA  . TYR B 1 178 ? -100.392 142.918 -29.437 1.00 0.00 ? 173 TYR B CA  1 
ATOM 4302  C C   . TYR B 1 178 ? -100.829 144.202 -30.111 1.00 0.00 ? 173 TYR B C   1 
ATOM 4303  O O   . TYR B 1 178 ? -100.161 145.223 -29.878 1.00 0.00 ? 173 TYR B O   1 
ATOM 4304  C CB  . TYR B 1 178 ? -99.862  141.740 -30.282 1.00 0.00 ? 173 TYR B CB  1 
ATOM 4305  C CG  . TYR B 1 178 ? -98.516  142.057 -30.855 1.00 0.00 ? 173 TYR B CG  1 
ATOM 4306  C CD1 . TYR B 1 178 ? -97.487  142.730 -30.113 1.00 0.00 ? 173 TYR B CD1 1 
ATOM 4307  C CD2 . TYR B 1 178 ? -98.294  141.611 -32.188 1.00 0.00 ? 173 TYR B CD2 1 
ATOM 4308  C CE1 . TYR B 1 178 ? -96.295  142.988 -30.770 1.00 0.00 ? 173 TYR B CE1 1 
ATOM 4309  C CE2 . TYR B 1 178 ? -96.956  141.717 -32.703 1.00 0.00 ? 173 TYR B CE2 1 
ATOM 4310  C CZ  . TYR B 1 178 ? -95.995  142.368 -32.001 1.00 0.00 ? 173 TYR B CZ  1 
ATOM 4311  O OH  . TYR B 1 178 ? -94.699  142.454 -32.404 1.00 0.00 ? 173 TYR B OH  1 
ATOM 4312  N N   . ALA B 1 179 ? -101.987 144.226 -30.705 1.00 0.00 ? 174 ALA B N   1 
ATOM 4313  C CA  . ALA B 1 179 ? -102.491 145.413 -31.415 1.00 0.00 ? 174 ALA B CA  1 
ATOM 4314  C C   . ALA B 1 179 ? -102.580 146.696 -30.602 1.00 0.00 ? 174 ALA B C   1 
ATOM 4315  O O   . ALA B 1 179 ? -102.270 147.808 -30.991 1.00 0.00 ? 174 ALA B O   1 
ATOM 4316  C CB  . ALA B 1 179 ? -103.831 145.181 -32.052 1.00 0.00 ? 174 ALA B CB  1 
ATOM 4317  N N   . LEU B 1 180 ? -103.179 146.494 -29.407 1.00 0.00 ? 175 LEU B N   1 
ATOM 4318  C CA  . LEU B 1 180 ? -103.393 147.599 -28.512 1.00 0.00 ? 175 LEU B CA  1 
ATOM 4319  C C   . LEU B 1 180 ? -102.063 148.155 -28.103 1.00 0.00 ? 175 LEU B C   1 
ATOM 4320  O O   . LEU B 1 180 ? -101.903 149.324 -28.040 1.00 0.00 ? 175 LEU B O   1 
ATOM 4321  C CB  . LEU B 1 180 ? -104.141 146.958 -27.343 1.00 0.00 ? 175 LEU B CB  1 
ATOM 4322  C CG  . LEU B 1 180 ? -104.478 147.927 -26.122 1.00 0.00 ? 175 LEU B CG  1 
ATOM 4323  C CD1 . LEU B 1 180 ? -105.416 149.121 -26.320 1.00 0.00 ? 175 LEU B CD1 1 
ATOM 4324  C CD2 . LEU B 1 180 ? -105.026 147.008 -24.971 1.00 0.00 ? 175 LEU B CD2 1 
ATOM 4325  N N   . GLN B 1 181 ? -101.022 147.312 -27.885 1.00 0.00 ? 176 GLN B N   1 
ATOM 4326  C CA  . GLN B 1 181 ? -99.660  147.789 -27.443 1.00 0.00 ? 176 GLN B CA  1 
ATOM 4327  C C   . GLN B 1 181 ? -98.908  148.417 -28.580 1.00 0.00 ? 176 GLN B C   1 
ATOM 4328  O O   . GLN B 1 181 ? -98.063  149.338 -28.420 1.00 0.00 ? 176 GLN B O   1 
ATOM 4329  C CB  . GLN B 1 181 ? -98.722  146.666 -26.958 1.00 0.00 ? 176 GLN B CB  1 
ATOM 4330  C CG  . GLN B 1 181 ? -99.130  146.265 -25.539 1.00 0.00 ? 176 GLN B CG  1 
ATOM 4331  C CD  . GLN B 1 181 ? -98.496  147.269 -24.504 1.00 0.00 ? 176 GLN B CD  1 
ATOM 4332  O OE1 . GLN B 1 181 ? -97.364  147.774 -24.619 1.00 0.00 ? 176 GLN B OE1 1 
ATOM 4333  N NE2 . GLN B 1 181 ? -99.212  147.384 -23.336 1.00 0.00 ? 176 GLN B NE2 1 
ATOM 4334  N N   . ILE B 1 182 ? -99.347  148.035 -29.829 1.00 0.00 ? 177 ILE B N   1 
ATOM 4335  C CA  . ILE B 1 182 ? -98.687  148.627 -30.994 1.00 0.00 ? 177 ILE B CA  1 
ATOM 4336  C C   . ILE B 1 182 ? -99.130  150.089 -31.170 1.00 0.00 ? 177 ILE B C   1 
ATOM 4337  O O   . ILE B 1 182 ? -98.354  150.958 -31.512 1.00 0.00 ? 177 ILE B O   1 
ATOM 4338  C CB  . ILE B 1 182 ? -99.095  147.826 -32.257 1.00 0.00 ? 177 ILE B CB  1 
ATOM 4339  C CG1 . ILE B 1 182 ? -98.359  146.487 -32.183 1.00 0.00 ? 177 ILE B CG1 1 
ATOM 4340  C CG2 . ILE B 1 182 ? -98.611  148.610 -33.580 1.00 0.00 ? 177 ILE B CG2 1 
ATOM 4341  C CD1 . ILE B 1 182 ? -98.650  145.429 -33.234 1.00 0.00 ? 177 ILE B CD1 1 
ATOM 4342  N N   . ASN B 1 183 ? -100.376 150.373 -30.814 1.00 0.00 ? 178 ASN B N   1 
ATOM 4343  C CA  . ASN B 1 183 ? -100.841 151.750 -30.590 1.00 0.00 ? 178 ASN B CA  1 
ATOM 4344  C C   . ASN B 1 183 ? -100.190 152.470 -29.387 1.00 0.00 ? 178 ASN B C   1 
ATOM 4345  O O   . ASN B 1 183 ? -99.890  153.639 -29.469 1.00 0.00 ? 178 ASN B O   1 
ATOM 4346  C CB  . ASN B 1 183 ? -102.420 151.698 -30.406 1.00 0.00 ? 178 ASN B CB  1 
ATOM 4347  C CG  . ASN B 1 183 ? -103.104 151.542 -31.691 1.00 0.00 ? 178 ASN B CG  1 
ATOM 4348  O OD1 . ASN B 1 183 ? -103.581 152.560 -32.245 1.00 0.00 ? 178 ASN B OD1 1 
ATOM 4349  N ND2 . ASN B 1 183 ? -103.011 150.396 -32.283 1.00 0.00 ? 178 ASN B ND2 1 
ATOM 4350  N N   . VAL B 1 184 ? -99.972  151.791 -28.219 1.00 0.00 ? 179 VAL B N   1 
ATOM 4351  C CA  . VAL B 1 184 ? -99.235  152.438 -27.077 1.00 0.00 ? 179 VAL B CA  1 
ATOM 4352  C C   . VAL B 1 184 ? -97.790  152.876 -27.207 1.00 0.00 ? 179 VAL B C   1 
ATOM 4353  O O   . VAL B 1 184 ? -97.394  153.965 -26.758 1.00 0.00 ? 179 VAL B O   1 
ATOM 4354  C CB  . VAL B 1 184 ? -99.340  151.514 -25.839 1.00 0.00 ? 179 VAL B CB  1 
ATOM 4355  C CG1 . VAL B 1 184 ? -98.583  151.984 -24.568 1.00 0.00 ? 179 VAL B CG1 1 
ATOM 4356  C CG2 . VAL B 1 184 ? -100.884 151.417 -25.466 1.00 0.00 ? 179 VAL B CG2 1 
ATOM 4357  N N   . ILE B 1 185 ? -96.980  152.043 -27.923 1.00 0.00 ? 180 ILE B N   1 
ATOM 4358  C CA  . ILE B 1 185 ? -95.631  152.303 -28.372 1.00 0.00 ? 180 ILE B CA  1 
ATOM 4359  C C   . ILE B 1 185 ? -95.449  153.426 -29.293 1.00 0.00 ? 180 ILE B C   1 
ATOM 4360  O O   . ILE B 1 185 ? -94.365  154.035 -29.274 1.00 0.00 ? 180 ILE B O   1 
ATOM 4361  C CB  . ILE B 1 185 ? -94.900  151.068 -28.729 1.00 0.00 ? 180 ILE B CB  1 
ATOM 4362  C CG1 . ILE B 1 185 ? -93.356  151.159 -28.589 1.00 0.00 ? 180 ILE B CG1 1 
ATOM 4363  C CG2 . ILE B 1 185 ? -95.153  150.642 -30.166 1.00 0.00 ? 180 ILE B CG2 1 
ATOM 4364  C CD1 . ILE B 1 185 ? -92.713  149.765 -28.439 1.00 0.00 ? 180 ILE B CD1 1 
ATOM 4365  N N   . GLU B 1 186 ? -96.505  153.650 -30.162 1.00 0.00 ? 181 GLU B N   1 
ATOM 4366  C CA  . GLU B 1 186 ? -96.516  154.582 -31.239 1.00 0.00 ? 181 GLU B CA  1 
ATOM 4367  C C   . GLU B 1 186 ? -96.666  156.046 -30.781 1.00 0.00 ? 181 GLU B C   1 
ATOM 4368  O O   . GLU B 1 186 ? -95.943  156.875 -31.298 1.00 0.00 ? 181 GLU B O   1 
ATOM 4369  C CB  . GLU B 1 186 ? -97.774  154.207 -32.085 1.00 0.00 ? 181 GLU B CB  1 
ATOM 4370  C CG  . GLU B 1 186 ? -98.215  155.052 -33.309 1.00 0.00 ? 181 GLU B CG  1 
ATOM 4371  C CD  . GLU B 1 186 ? -99.430  154.539 -34.014 1.00 0.00 ? 181 GLU B CD  1 
ATOM 4372  O OE1 . GLU B 1 186 ? -99.278  153.654 -34.887 1.00 0.00 ? 181 GLU B OE1 1 
ATOM 4373  O OE2 . GLU B 1 186 ? -100.503 155.209 -33.893 1.00 0.00 ? 181 GLU B OE2 1 
ATOM 4374  N N   . ASP B 1 187 ? -97.520  156.241 -29.792 1.00 0.00 ? 182 ASP B N   1 
ATOM 4375  C CA  . ASP B 1 187 ? -97.698  157.459 -28.977 1.00 0.00 ? 182 ASP B CA  1 
ATOM 4376  C C   . ASP B 1 187 ? -96.606  157.577 -27.922 1.00 0.00 ? 182 ASP B C   1 
ATOM 4377  O O   . ASP B 1 187 ? -96.213  158.699 -27.833 1.00 0.00 ? 182 ASP B O   1 
ATOM 4378  C CB  . ASP B 1 187 ? -99.067  157.476 -28.368 1.00 0.00 ? 182 ASP B CB  1 
ATOM 4379  C CG  . ASP B 1 187 ? -100.159 157.456 -29.424 1.00 0.00 ? 182 ASP B CG  1 
ATOM 4380  O OD1 . ASP B 1 187 ? -99.992  157.762 -30.610 1.00 0.00 ? 182 ASP B OD1 1 
ATOM 4381  O OD2 . ASP B 1 187 ? -101.351 157.406 -28.920 1.00 0.00 ? 182 ASP B OD2 1 
ATOM 4382  N N   . LYS B 1 188 ? -96.179  156.541 -27.227 1.00 0.00 ? 183 LYS B N   1 
ATOM 4383  C CA  . LYS B 1 188 ? -95.020  156.621 -26.308 1.00 0.00 ? 183 LYS B CA  1 
ATOM 4384  C C   . LYS B 1 188 ? -93.733  157.068 -27.000 1.00 0.00 ? 183 LYS B C   1 
ATOM 4385  O O   . LYS B 1 188 ? -93.103  157.940 -26.459 1.00 0.00 ? 183 LYS B O   1 
ATOM 4386  C CB  . LYS B 1 188 ? -94.757  155.305 -25.589 1.00 0.00 ? 183 LYS B CB  1 
ATOM 4387  C CG  . LYS B 1 188 ? -93.683  155.341 -24.471 1.00 0.00 ? 183 LYS B CG  1 
ATOM 4388  C CD  . LYS B 1 188 ? -93.621  154.100 -23.476 1.00 0.00 ? 183 LYS B CD  1 
ATOM 4389  C CE  . LYS B 1 188 ? -92.428  153.998 -22.456 1.00 0.00 ? 183 LYS B CE  1 
ATOM 4390  N NZ  . LYS B 1 188 ? -92.465  155.173 -21.573 1.00 0.00 ? 183 LYS B NZ  1 
ATOM 4391  N N   . ARG B 1 189 ? -93.400  156.483 -28.190 1.00 0.00 ? 184 ARG B N   1 
ATOM 4392  C CA  . ARG B 1 189 ? -92.243  156.999 -28.997 1.00 0.00 ? 184 ARG B CA  1 
ATOM 4393  C C   . ARG B 1 189 ? -92.397  158.444 -29.405 1.00 0.00 ? 184 ARG B C   1 
ATOM 4394  O O   . ARG B 1 189 ? -91.444  159.205 -29.347 1.00 0.00 ? 184 ARG B O   1 
ATOM 4395  C CB  . ARG B 1 189 ? -91.806  156.090 -30.148 1.00 0.00 ? 184 ARG B CB  1 
ATOM 4396  C CG  . ARG B 1 189 ? -92.634  156.243 -31.470 1.00 0.00 ? 184 ARG B CG  1 
ATOM 4397  C CD  . ARG B 1 189 ? -92.236  155.100 -32.501 1.00 0.00 ? 184 ARG B CD  1 
ATOM 4398  N NE  . ARG B 1 189 ? -90.879  155.421 -33.092 1.00 0.00 ? 184 ARG B NE  1 
ATOM 4399  C CZ  . ARG B 1 189 ? -90.402  154.812 -34.236 1.00 0.00 ? 184 ARG B CZ  1 
ATOM 4400  N NH1 . ARG B 1 189 ? -90.938  153.753 -34.838 1.00 0.00 ? 184 ARG B NH1 1 
ATOM 4401  N NH2 . ARG B 1 189 ? -89.232  155.145 -34.666 1.00 0.00 ? 184 ARG B NH2 1 
ATOM 4402  N N   . LYS B 1 190 ? -93.557  159.002 -29.777 1.00 0.00 ? 185 LYS B N   1 
ATOM 4403  C CA  . LYS B 1 190 ? -93.774  160.424 -29.915 1.00 0.00 ? 185 LYS B CA  1 
ATOM 4404  C C   . LYS B 1 190 ? -93.667  161.305 -28.632 1.00 0.00 ? 185 LYS B C   1 
ATOM 4405  O O   . LYS B 1 190 ? -92.886  162.230 -28.554 1.00 0.00 ? 185 LYS B O   1 
ATOM 4406  C CB  . LYS B 1 190 ? -95.098  160.622 -30.559 1.00 0.00 ? 185 LYS B CB  1 
ATOM 4407  C CG  . LYS B 1 190 ? -95.429  162.085 -31.048 1.00 0.00 ? 185 LYS B CG  1 
ATOM 4408  C CD  . LYS B 1 190 ? -96.867  162.339 -31.530 1.00 0.00 ? 185 LYS B CD  1 
ATOM 4409  C CE  . LYS B 1 190 ? -97.148  161.628 -32.889 1.00 0.00 ? 185 LYS B CE  1 
ATOM 4410  N NZ  . LYS B 1 190 ? -98.536  161.869 -33.187 1.00 0.00 ? 185 LYS B NZ  1 
ATOM 4411  N N   . PHE B 1 191 ? -94.359  160.989 -27.572 1.00 0.00 ? 186 PHE B N   1 
ATOM 4412  C CA  . PHE B 1 191 ? -94.480  161.851 -26.405 1.00 0.00 ? 186 PHE B CA  1 
ATOM 4413  C C   . PHE B 1 191 ? -93.328  161.904 -25.393 1.00 0.00 ? 186 PHE B C   1 
ATOM 4414  O O   . PHE B 1 191 ? -93.023  162.860 -24.665 1.00 0.00 ? 186 PHE B O   1 
ATOM 4415  C CB  . PHE B 1 191 ? -95.695  161.502 -25.564 1.00 0.00 ? 186 PHE B CB  1 
ATOM 4416  C CG  . PHE B 1 191 ? -96.992  161.410 -26.356 1.00 0.00 ? 186 PHE B CG  1 
ATOM 4417  C CD1 . PHE B 1 191 ? -97.372  162.169 -27.435 1.00 0.00 ? 186 PHE B CD1 1 
ATOM 4418  C CD2 . PHE B 1 191 ? -97.942  160.577 -25.688 1.00 0.00 ? 186 PHE B CD2 1 
ATOM 4419  C CE1 . PHE B 1 191 ? -98.702  162.200 -27.882 1.00 0.00 ? 186 PHE B CE1 1 
ATOM 4420  C CE2 . PHE B 1 191 ? -99.249  160.599 -26.161 1.00 0.00 ? 186 PHE B CE2 1 
ATOM 4421  C CZ  . PHE B 1 191 ? -99.682  161.430 -27.231 1.00 0.00 ? 186 PHE B CZ  1 
ATOM 4422  N N   . ASP B 1 192 ? -92.642  160.774 -25.234 1.00 0.00 ? 187 ASP B N   1 
ATOM 4423  C CA  . ASP B 1 192 ? -91.465  160.695 -24.414 1.00 0.00 ? 187 ASP B CA  1 
ATOM 4424  C C   . ASP B 1 192 ? -90.272  161.437 -25.070 1.00 0.00 ? 187 ASP B C   1 
ATOM 4425  O O   . ASP B 1 192 ? -89.478  162.113 -24.427 1.00 0.00 ? 187 ASP B O   1 
ATOM 4426  C CB  . ASP B 1 192 ? -91.170  159.246 -24.032 1.00 0.00 ? 187 ASP B CB  1 
ATOM 4427  C CG  . ASP B 1 192 ? -92.097  158.665 -22.972 1.00 0.00 ? 187 ASP B CG  1 
ATOM 4428  O OD1 . ASP B 1 192 ? -93.156  159.188 -22.605 1.00 0.00 ? 187 ASP B OD1 1 
ATOM 4429  O OD2 . ASP B 1 192 ? -91.643  157.617 -22.409 1.00 0.00 ? 187 ASP B OD2 1 
ATOM 4430  N N   . ILE B 1 193 ? -90.209  161.333 -26.430 1.00 0.00 ? 188 ILE B N   1 
ATOM 4431  C CA  . ILE B 1 193 ? -89.131  162.035 -27.117 1.00 0.00 ? 188 ILE B CA  1 
ATOM 4432  C C   . ILE B 1 193 ? -89.456  163.561 -27.236 1.00 0.00 ? 188 ILE B C   1 
ATOM 4433  O O   . ILE B 1 193 ? -88.598  164.400 -27.099 1.00 0.00 ? 188 ILE B O   1 
ATOM 4434  C CB  . ILE B 1 193 ? -88.971  161.493 -28.526 1.00 0.00 ? 188 ILE B CB  1 
ATOM 4435  C CG1 . ILE B 1 193 ? -88.472  159.993 -28.498 1.00 0.00 ? 188 ILE B CG1 1 
ATOM 4436  C CG2 . ILE B 1 193 ? -88.026  162.392 -29.375 1.00 0.00 ? 188 ILE B CG2 1 
ATOM 4437  C CD1 . ILE B 1 193 ? -87.030  159.839 -27.916 1.00 0.00 ? 188 ILE B CD1 1 
ATOM 4438  N N   . MET B 1 194 ? -90.683  163.949 -27.515 1.00 0.00 ? 189 MET B N   1 
ATOM 4439  C CA  . MET B 1 194 ? -91.182  165.416 -27.615 1.00 0.00 ? 189 MET B CA  1 
ATOM 4440  C C   . MET B 1 194 ? -91.001  166.143 -26.320 1.00 0.00 ? 189 MET B C   1 
ATOM 4441  O O   . MET B 1 194 ? -90.481  167.242 -26.227 1.00 0.00 ? 189 MET B O   1 
ATOM 4442  C CB  . MET B 1 194 ? -92.666  165.455 -28.219 1.00 0.00 ? 189 MET B CB  1 
ATOM 4443  C CG  . MET B 1 194 ? -93.063  166.945 -28.562 1.00 0.00 ? 189 MET B CG  1 
ATOM 4444  S SD  . MET B 1 194 ? -94.834  167.137 -28.944 1.00 0.00 ? 189 MET B SD  1 
ATOM 4445  C CE  . MET B 1 194 ? -94.937  166.089 -30.440 1.00 0.00 ? 189 MET B CE  1 
ATOM 4446  N N   . GLU B 1 195 ? -91.448  165.476 -25.126 1.00 0.00 ? 190 GLU B N   1 
ATOM 4447  C CA  . GLU B 1 195 ? -91.208  165.994 -23.732 1.00 0.00 ? 190 GLU B CA  1 
ATOM 4448  C C   . GLU B 1 195 ? -89.761  166.084 -23.365 1.00 0.00 ? 190 GLU B C   1 
ATOM 4449  O O   . GLU B 1 195 ? -89.298  167.064 -22.768 1.00 0.00 ? 190 GLU B O   1 
ATOM 4450  C CB  . GLU B 1 195 ? -91.872  165.026 -22.779 1.00 0.00 ? 190 GLU B CB  1 
ATOM 4451  C CG  . GLU B 1 195 ? -92.037  165.511 -21.354 1.00 0.00 ? 190 GLU B CG  1 
ATOM 4452  C CD  . GLU B 1 195 ? -92.900  164.536 -20.614 1.00 0.00 ? 190 GLU B CD  1 
ATOM 4453  O OE1 . GLU B 1 195 ? -92.519  163.353 -20.416 1.00 0.00 ? 190 GLU B OE1 1 
ATOM 4454  O OE2 . GLU B 1 195 ? -94.018  164.925 -20.256 1.00 0.00 ? 190 GLU B OE2 1 
ATOM 4455  N N   . PHE B 1 196 ? -88.942  165.041 -23.708 1.00 0.00 ? 191 PHE B N   1 
ATOM 4456  C CA  . PHE B 1 196 ? -87.521  165.173 -23.564 1.00 0.00 ? 191 PHE B CA  1 
ATOM 4457  C C   . PHE B 1 196 ? -86.884  166.464 -24.189 1.00 0.00 ? 191 PHE B C   1 
ATOM 4458  O O   . PHE B 1 196 ? -86.362  167.293 -23.471 1.00 0.00 ? 191 PHE B O   1 
ATOM 4459  C CB  . PHE B 1 196 ? -86.805  163.946 -24.296 1.00 0.00 ? 191 PHE B CB  1 
ATOM 4460  C CG  . PHE B 1 196 ? -85.355  163.832 -24.080 1.00 0.00 ? 191 PHE B CG  1 
ATOM 4461  C CD1 . PHE B 1 196 ? -84.886  163.705 -22.816 1.00 0.00 ? 191 PHE B CD1 1 
ATOM 4462  C CD2 . PHE B 1 196 ? -84.485  163.700 -25.127 1.00 0.00 ? 191 PHE B CD2 1 
ATOM 4463  C CE1 . PHE B 1 196 ? -83.500  163.428 -22.561 1.00 0.00 ? 191 PHE B CE1 1 
ATOM 4464  C CE2 . PHE B 1 196 ? -83.148  163.480 -24.926 1.00 0.00 ? 191 PHE B CE2 1 
ATOM 4465  C CZ  . PHE B 1 196 ? -82.626  163.231 -23.685 1.00 0.00 ? 191 PHE B CZ  1 
ATOM 4466  N N   . VAL B 1 197 ? -87.108  166.722 -25.515 1.00 0.00 ? 192 VAL B N   1 
ATOM 4467  C CA  . VAL B 1 197 ? -86.593  167.888 -26.250 1.00 0.00 ? 192 VAL B CA  1 
ATOM 4468  C C   . VAL B 1 197 ? -87.058  169.175 -25.653 1.00 0.00 ? 192 VAL B C   1 
ATOM 4469  O O   . VAL B 1 197 ? -86.286  170.062 -25.362 1.00 0.00 ? 192 VAL B O   1 
ATOM 4470  C CB  . VAL B 1 197 ? -86.863  167.720 -27.768 1.00 0.00 ? 192 VAL B CB  1 
ATOM 4471  C CG1 . VAL B 1 197 ? -86.295  168.975 -28.483 1.00 0.00 ? 192 VAL B CG1 1 
ATOM 4472  C CG2 . VAL B 1 197 ? -86.123  166.453 -28.305 1.00 0.00 ? 192 VAL B CG2 1 
ATOM 4473  N N   . LEU B 1 198 ? -88.328  169.298 -25.406 1.00 0.00 ? 193 LEU B N   1 
ATOM 4474  C CA  . LEU B 1 198 ? -88.923  170.473 -24.820 1.00 0.00 ? 193 LEU B CA  1 
ATOM 4475  C C   . LEU B 1 198 ? -88.384  170.708 -23.386 1.00 0.00 ? 193 LEU B C   1 
ATOM 4476  O O   . LEU B 1 198 ? -88.114  171.810 -23.040 1.00 0.00 ? 193 LEU B O   1 
ATOM 4477  C CB  . LEU B 1 198 ? -90.395  170.130 -24.607 1.00 0.00 ? 193 LEU B CB  1 
ATOM 4478  C CG  . LEU B 1 198 ? -91.280  171.203 -23.945 1.00 0.00 ? 193 LEU B CG  1 
ATOM 4479  C CD1 . LEU B 1 198 ? -91.027  172.467 -24.739 1.00 0.00 ? 193 LEU B CD1 1 
ATOM 4480  C CD2 . LEU B 1 198 ? -92.738  170.726 -24.067 1.00 0.00 ? 193 LEU B CD2 1 
ATOM 4481  N N   . ARG B 1 199 ? -88.131  169.654 -22.558 1.00 0.00 ? 194 ARG B N   1 
ATOM 4482  C CA  . ARG B 1 199 ? -87.497  169.910 -21.286 1.00 0.00 ? 194 ARG B CA  1 
ATOM 4483  C C   . ARG B 1 199 ? -86.092  170.427 -21.359 1.00 0.00 ? 194 ARG B C   1 
ATOM 4484  O O   . ARG B 1 199 ? -85.713  171.295 -20.641 1.00 0.00 ? 194 ARG B O   1 
ATOM 4485  C CB  . ARG B 1 199 ? -87.425  168.604 -20.566 1.00 0.00 ? 194 ARG B CB  1 
ATOM 4486  C CG  . ARG B 1 199 ? -87.075  168.621 -19.003 1.00 0.00 ? 194 ARG B CG  1 
ATOM 4487  C CD  . ARG B 1 199 ? -88.100  169.389 -18.190 1.00 0.00 ? 194 ARG B CD  1 
ATOM 4488  N NE  . ARG B 1 199 ? -89.351  168.599 -18.281 1.00 0.00 ? 194 ARG B NE  1 
ATOM 4489  C CZ  . ARG B 1 199 ? -90.492  168.930 -18.961 1.00 0.00 ? 194 ARG B CZ  1 
ATOM 4490  N NH1 . ARG B 1 199 ? -90.608  170.084 -19.614 1.00 0.00 ? 194 ARG B NH1 1 
ATOM 4491  N NH2 . ARG B 1 199 ? -91.485  168.049 -19.086 1.00 0.00 ? 194 ARG B NH2 1 
ATOM 4492  N N   . LEU B 1 200 ? -85.308  169.883 -22.193 1.00 0.00 ? 195 LEU B N   1 
ATOM 4493  C CA  . LEU B 1 200 ? -83.971  170.325 -22.427 1.00 0.00 ? 195 LEU B CA  1 
ATOM 4494  C C   . LEU B 1 200 ? -83.838  171.758 -22.937 1.00 0.00 ? 195 LEU B C   1 
ATOM 4495  O O   . LEU B 1 200 ? -82.951  172.474 -22.413 1.00 0.00 ? 195 LEU B O   1 
ATOM 4496  C CB  . LEU B 1 200 ? -83.224  169.442 -23.417 1.00 0.00 ? 195 LEU B CB  1 
ATOM 4497  C CG  . LEU B 1 200 ? -82.819  168.035 -22.832 1.00 0.00 ? 195 LEU B CG  1 
ATOM 4498  C CD1 . LEU B 1 200 ? -82.131  167.300 -24.003 1.00 0.00 ? 195 LEU B CD1 1 
ATOM 4499  C CD2 . LEU B 1 200 ? -81.957  168.087 -21.581 1.00 0.00 ? 195 LEU B CD2 1 
ATOM 4500  N N   . VAL B 1 201 ? -84.594  172.198 -23.943 1.00 0.00 ? 196 VAL B N   1 
ATOM 4501  C CA  . VAL B 1 201 ? -84.675  173.575 -24.604 1.00 0.00 ? 196 VAL B CA  1 
ATOM 4502  C C   . VAL B 1 201 ? -85.113  174.620 -23.596 1.00 0.00 ? 196 VAL B C   1 
ATOM 4503  O O   . VAL B 1 201 ? -84.642  175.739 -23.551 1.00 0.00 ? 196 VAL B O   1 
ATOM 4504  C CB  . VAL B 1 201 ? -85.370  173.626 -25.968 1.00 0.00 ? 196 VAL B CB  1 
ATOM 4505  C CG1 . VAL B 1 201 ? -85.422  175.021 -26.635 1.00 0.00 ? 196 VAL B CG1 1 
ATOM 4506  C CG2 . VAL B 1 201 ? -84.784  172.539 -26.921 1.00 0.00 ? 196 VAL B CG2 1 
ATOM 4507  N N   . GLU B 1 202 ? -86.062  174.159 -22.719 1.00 0.00 ? 197 GLU B N   1 
ATOM 4508  C CA  . GLU B 1 202 ? -86.652  174.964 -21.590 1.00 0.00 ? 197 GLU B CA  1 
ATOM 4509  C C   . GLU B 1 202 ? -85.676  175.308 -20.485 1.00 0.00 ? 197 GLU B C   1 
ATOM 4510  O O   . GLU B 1 202 ? -85.566  176.499 -20.123 1.00 0.00 ? 197 GLU B O   1 
ATOM 4511  C CB  . GLU B 1 202 ? -88.027  174.282 -21.131 1.00 0.00 ? 197 GLU B CB  1 
ATOM 4512  C CG  . GLU B 1 202 ? -88.429  174.485 -19.665 1.00 0.00 ? 197 GLU B CG  1 
ATOM 4513  C CD  . GLU B 1 202 ? -89.729  173.842 -19.372 1.00 0.00 ? 197 GLU B CD  1 
ATOM 4514  O OE1 . GLU B 1 202 ? -90.789  174.414 -19.788 1.00 0.00 ? 197 GLU B OE1 1 
ATOM 4515  O OE2 . GLU B 1 202 ? -89.766  172.670 -18.911 1.00 0.00 ? 197 GLU B OE2 1 
ATOM 4516  N N   . ALA B 1 203 ? -84.977  174.326 -20.020 1.00 0.00 ? 198 ALA B N   1 
ATOM 4517  C CA  . ALA B 1 203 ? -83.891  174.441 -19.010 1.00 0.00 ? 198 ALA B CA  1 
ATOM 4518  C C   . ALA B 1 203 ? -82.580  175.079 -19.503 1.00 0.00 ? 198 ALA B C   1 
ATOM 4519  O O   . ALA B 1 203 ? -81.920  175.809 -18.817 1.00 0.00 ? 198 ALA B O   1 
ATOM 4520  C CB  . ALA B 1 203 ? -83.599  173.056 -18.569 1.00 0.00 ? 198 ALA B CB  1 
ATOM 4521  N N   . GLN B 1 204 ? -82.197  174.854 -20.799 1.00 0.00 ? 199 GLN B N   1 
ATOM 4522  C CA  . GLN B 1 204 ? -81.107  175.665 -21.387 1.00 0.00 ? 199 GLN B CA  1 
ATOM 4523  C C   . GLN B 1 204 ? -81.369  177.124 -21.437 1.00 0.00 ? 199 GLN B C   1 
ATOM 4524  O O   . GLN B 1 204 ? -80.617  178.007 -21.139 1.00 0.00 ? 199 GLN B O   1 
ATOM 4525  C CB  . GLN B 1 204 ? -80.758  175.107 -22.792 1.00 0.00 ? 199 GLN B CB  1 
ATOM 4526  C CG  . GLN B 1 204 ? -79.770  175.976 -23.625 1.00 0.00 ? 199 GLN B CG  1 
ATOM 4527  C CD  . GLN B 1 204 ? -79.740  175.261 -25.034 1.00 0.00 ? 199 GLN B CD  1 
ATOM 4528  O OE1 . GLN B 1 204 ? -80.444  175.525 -26.014 1.00 0.00 ? 199 GLN B OE1 1 
ATOM 4529  N NE2 . GLN B 1 204 ? -79.028  174.132 -25.084 1.00 0.00 ? 199 GLN B NE2 1 
ATOM 4530  N N   . ALA B 1 205 ? -82.602  177.522 -21.834 1.00 0.00 ? 200 ALA B N   1 
ATOM 4531  C CA  . ALA B 1 205 ? -83.015  178.826 -22.065 1.00 0.00 ? 200 ALA B CA  1 
ATOM 4532  C C   . ALA B 1 205 ? -83.025  179.727 -20.860 1.00 0.00 ? 200 ALA B C   1 
ATOM 4533  O O   . ALA B 1 205 ? -82.559  180.816 -20.903 1.00 0.00 ? 200 ALA B O   1 
ATOM 4534  C CB  . ALA B 1 205 ? -84.400  178.922 -22.712 1.00 0.00 ? 200 ALA B CB  1 
ATOM 4535  N N   . THR B 1 206 ? -83.492  179.151 -19.654 1.00 0.00 ? 201 THR B N   1 
ATOM 4536  C CA  . THR B 1 206 ? -83.502  179.886 -18.324 1.00 0.00 ? 201 THR B CA  1 
ATOM 4537  C C   . THR B 1 206 ? -82.061  180.322 -17.892 1.00 0.00 ? 201 THR B C   1 
ATOM 4538  O O   . THR B 1 206 ? -81.895  181.468 -17.459 1.00 0.00 ? 201 THR B O   1 
ATOM 4539  C CB  . THR B 1 206 ? -84.041  178.930 -17.192 1.00 0.00 ? 201 THR B CB  1 
ATOM 4540  O OG1 . THR B 1 206 ? -85.300  178.410 -17.513 1.00 0.00 ? 201 THR B OG1 1 
ATOM 4541  C CG2 . THR B 1 206 ? -84.078  179.865 -15.881 1.00 0.00 ? 201 THR B CG2 1 
ATOM 4542  N N   . HIS B 1 207 ? -81.066  179.428 -18.105 1.00 0.00 ? 202 HIS B N   1 
ATOM 4543  C CA  . HIS B 1 207 ? -79.651  179.704 -17.750 1.00 0.00 ? 202 HIS B CA  1 
ATOM 4544  C C   . HIS B 1 207 ? -79.028  180.849 -18.469 1.00 0.00 ? 202 HIS B C   1 
ATOM 4545  O O   . HIS B 1 207 ? -78.301  181.664 -17.921 1.00 0.00 ? 202 HIS B O   1 
ATOM 4546  C CB  . HIS B 1 207 ? -78.935  178.381 -18.111 1.00 0.00 ? 202 HIS B CB  1 
ATOM 4547  C CG  . HIS B 1 207 ? -77.485  178.251 -17.784 1.00 0.00 ? 202 HIS B CG  1 
ATOM 4548  N ND1 . HIS B 1 207 ? -76.866  178.118 -16.532 1.00 0.00 ? 202 HIS B ND1 1 
ATOM 4549  C CD2 . HIS B 1 207 ? -76.468  178.178 -18.669 1.00 0.00 ? 202 HIS B CD2 1 
ATOM 4550  C CE1 . HIS B 1 207 ? -75.542  177.937 -16.746 1.00 0.00 ? 202 HIS B CE1 1 
ATOM 4551  N NE2 . HIS B 1 207 ? -75.298  177.967 -18.012 1.00 0.00 ? 202 HIS B NE2 1 
ATOM 4552  N N   . PHE B 1 208 ? -79.315  180.989 -19.776 1.00 0.00 ? 203 PHE B N   1 
ATOM 4553  C CA  . PHE B 1 208 ? -79.086  182.266 -20.477 1.00 0.00 ? 203 PHE B CA  1 
ATOM 4554  C C   . PHE B 1 208 ? -79.880  183.485 -19.986 1.00 0.00 ? 203 PHE B C   1 
ATOM 4555  O O   . PHE B 1 208 ? -79.312  184.561 -19.929 1.00 0.00 ? 203 PHE B O   1 
ATOM 4556  C CB  . PHE B 1 208 ? -79.472  182.199 -21.960 1.00 0.00 ? 203 PHE B CB  1 
ATOM 4557  C CG  . PHE B 1 208 ? -78.437  181.419 -22.709 1.00 0.00 ? 203 PHE B CG  1 
ATOM 4558  C CD1 . PHE B 1 208 ? -77.206  182.052 -22.972 1.00 0.00 ? 203 PHE B CD1 1 
ATOM 4559  C CD2 . PHE B 1 208 ? -78.642  180.067 -22.937 1.00 0.00 ? 203 PHE B CD2 1 
ATOM 4560  C CE1 . PHE B 1 208 ? -76.161  181.349 -23.462 1.00 0.00 ? 203 PHE B CE1 1 
ATOM 4561  C CE2 . PHE B 1 208 ? -77.572  179.349 -23.541 1.00 0.00 ? 203 PHE B CE2 1 
ATOM 4562  C CZ  . PHE B 1 208 ? -76.335  179.961 -23.693 1.00 0.00 ? 203 PHE B CZ  1 
ATOM 4563  N N   . GLN B 1 209 ? -81.199  183.366 -19.655 1.00 0.00 ? 204 GLN B N   1 
ATOM 4564  C CA  . GLN B 1 209 ? -82.058  184.453 -19.191 1.00 0.00 ? 204 GLN B CA  1 
ATOM 4565  C C   . GLN B 1 209 ? -81.535  185.150 -17.983 1.00 0.00 ? 204 GLN B C   1 
ATOM 4566  O O   . GLN B 1 209 ? -81.234  186.333 -17.901 1.00 0.00 ? 204 GLN B O   1 
ATOM 4567  C CB  . GLN B 1 209 ? -83.485  183.874 -19.057 1.00 0.00 ? 204 GLN B CB  1 
ATOM 4568  C CG  . GLN B 1 209 ? -84.756  184.824 -18.840 1.00 0.00 ? 204 GLN B CG  1 
ATOM 4569  C CD  . GLN B 1 209 ? -86.004  183.911 -18.700 1.00 0.00 ? 204 GLN B CD  1 
ATOM 4570  O OE1 . GLN B 1 209 ? -86.037  182.701 -18.818 1.00 0.00 ? 204 GLN B OE1 1 
ATOM 4571  N NE2 . GLN B 1 209 ? -87.082  184.680 -18.386 1.00 0.00 ? 204 GLN B NE2 1 
ATOM 4572  N N   . GLN B 1 210 ? -81.286  184.306 -16.983 1.00 0.00 ? 205 GLN B N   1 
ATOM 4573  C CA  . GLN B 1 210 ? -80.659  184.672 -15.690 1.00 0.00 ? 205 GLN B CA  1 
ATOM 4574  C C   . GLN B 1 210 ? -79.191  185.129 -15.879 1.00 0.00 ? 205 GLN B C   1 
ATOM 4575  O O   . GLN B 1 210 ? -78.716  186.006 -15.240 1.00 0.00 ? 205 GLN B O   1 
ATOM 4576  C CB  . GLN B 1 210 ? -80.768  183.623 -14.651 1.00 0.00 ? 205 GLN B CB  1 
ATOM 4577  C CG  . GLN B 1 210 ? -82.222  183.296 -14.235 1.00 0.00 ? 205 GLN B CG  1 
ATOM 4578  C CD  . GLN B 1 210 ? -82.271  182.162 -13.275 1.00 0.00 ? 205 GLN B CD  1 
ATOM 4579  O OE1 . GLN B 1 210 ? -81.600  181.180 -13.390 1.00 0.00 ? 205 GLN B OE1 1 
ATOM 4580  N NE2 . GLN B 1 210 ? -83.050  182.345 -12.200 1.00 0.00 ? 205 GLN B NE2 1 
ATOM 4581  N N   . GLY B 1 211 ? -78.547  184.480 -16.920 1.00 0.00 ? 206 GLY B N   1 
ATOM 4582  C CA  . GLY B 1 211 ? -77.125  184.703 -17.160 1.00 0.00 ? 206 GLY B CA  1 
ATOM 4583  C C   . GLY B 1 211 ? -76.875  186.117 -17.619 1.00 0.00 ? 206 GLY B C   1 
ATOM 4584  O O   . GLY B 1 211 ? -76.003  186.803 -17.056 1.00 0.00 ? 206 GLY B O   1 
ATOM 4585  N N   . HIS B 1 212 ? -77.544  186.524 -18.655 1.00 0.00 ? 207 HIS B N   1 
ATOM 4586  C CA  . HIS B 1 212 ? -77.515  187.765 -19.330 1.00 0.00 ? 207 HIS B CA  1 
ATOM 4587  C C   . HIS B 1 212 ? -77.850  188.924 -18.396 1.00 0.00 ? 207 HIS B C   1 
ATOM 4588  O O   . HIS B 1 212 ? -77.153  189.912 -18.465 1.00 0.00 ? 207 HIS B O   1 
ATOM 4589  C CB  . HIS B 1 212 ? -78.419  187.874 -20.554 1.00 0.00 ? 207 HIS B CB  1 
ATOM 4590  C CG  . HIS B 1 212 ? -78.565  189.229 -21.149 1.00 0.00 ? 207 HIS B CG  1 
ATOM 4591  N ND1 . HIS B 1 212 ? -77.475  189.896 -21.694 1.00 0.00 ? 207 HIS B ND1 1 
ATOM 4592  C CD2 . HIS B 1 212 ? -79.572  190.094 -21.323 1.00 0.00 ? 207 HIS B CD2 1 
ATOM 4593  C CE1 . HIS B 1 212 ? -77.865  191.133 -22.132 1.00 0.00 ? 207 HIS B CE1 1 
ATOM 4594  N NE2 . HIS B 1 212 ? -79.206  191.307 -21.883 1.00 0.00 ? 207 HIS B NE2 1 
ATOM 4595  N N   . GLU B 1 213 ? -78.770  188.825 -17.490 1.00 0.00 ? 208 GLU B N   1 
ATOM 4596  C CA  . GLU B 1 213 ? -79.067  189.796 -16.418 1.00 0.00 ? 208 GLU B CA  1 
ATOM 4597  C C   . GLU B 1 213 ? -77.794  190.304 -15.676 1.00 0.00 ? 208 GLU B C   1 
ATOM 4598  O O   . GLU B 1 213 ? -77.491  191.532 -15.605 1.00 0.00 ? 208 GLU B O   1 
ATOM 4599  C CB  . GLU B 1 213 ? -80.096  189.133 -15.439 1.00 0.00 ? 208 GLU B CB  1 
ATOM 4600  C CG  . GLU B 1 213 ? -80.836  190.182 -14.511 1.00 0.00 ? 208 GLU B CG  1 
ATOM 4601  C CD  . GLU B 1 213 ? -81.761  191.130 -15.070 1.00 0.00 ? 208 GLU B CD  1 
ATOM 4602  O OE1 . GLU B 1 213 ? -81.301  192.214 -15.496 1.00 0.00 ? 208 GLU B OE1 1 
ATOM 4603  O OE2 . GLU B 1 213 ? -82.997  190.791 -15.087 1.00 0.00 ? 208 GLU B OE2 1 
ATOM 4604  N N   . GLU B 1 214 ? -77.103  189.364 -15.146 1.00 0.00 ? 209 GLU B N   1 
ATOM 4605  C CA  . GLU B 1 214 ? -75.832  189.507 -14.551 1.00 0.00 ? 209 GLU B CA  1 
ATOM 4606  C C   . GLU B 1 214 ? -74.650  189.853 -15.448 1.00 0.00 ? 209 GLU B C   1 
ATOM 4607  O O   . GLU B 1 214 ? -73.936  190.793 -15.221 1.00 0.00 ? 209 GLU B O   1 
ATOM 4608  C CB  . GLU B 1 214 ? -75.566  188.310 -13.630 1.00 0.00 ? 209 GLU B CB  1 
ATOM 4609  C CG  . GLU B 1 214 ? -76.624  188.193 -12.507 1.00 0.00 ? 209 GLU B CG  1 
ATOM 4610  C CD  . GLU B 1 214 ? -76.249  187.250 -11.422 1.00 0.00 ? 209 GLU B CD  1 
ATOM 4611  O OE1 . GLU B 1 214 ? -75.646  186.276 -11.860 1.00 0.00 ? 209 GLU B OE1 1 
ATOM 4612  O OE2 . GLU B 1 214 ? -76.635  187.382 -10.199 1.00 0.00 ? 209 GLU B OE2 1 
ATOM 4613  N N   . LEU B 1 215 ? -74.445  189.058 -16.536 1.00 0.00 ? 210 LEU B N   1 
ATOM 4614  C CA  . LEU B 1 215 ? -73.288  189.248 -17.440 1.00 0.00 ? 210 LEU B CA  1 
ATOM 4615  C C   . LEU B 1 215 ? -73.416  190.513 -18.285 1.00 0.00 ? 210 LEU B C   1 
ATOM 4616  O O   . LEU B 1 215 ? -72.399  190.998 -18.750 1.00 0.00 ? 210 LEU B O   1 
ATOM 4617  C CB  . LEU B 1 215 ? -73.041  187.969 -18.314 1.00 0.00 ? 210 LEU B CB  1 
ATOM 4618  C CG  . LEU B 1 215 ? -72.473  186.789 -17.515 1.00 0.00 ? 210 LEU B CG  1 
ATOM 4619  C CD1 . LEU B 1 215 ? -72.754  185.428 -18.134 1.00 0.00 ? 210 LEU B CD1 1 
ATOM 4620  C CD2 . LEU B 1 215 ? -70.957  186.887 -17.261 1.00 0.00 ? 210 LEU B CD2 1 
ATOM 4621  N N   . SER B 1 216 ? -74.639  191.022 -18.551 1.00 0.00 ? 211 SER B N   1 
ATOM 4622  C CA  . SER B 1 216 ? -74.802  192.333 -19.193 1.00 0.00 ? 211 SER B CA  1 
ATOM 4623  C C   . SER B 1 216 ? -74.409  193.399 -18.223 1.00 0.00 ? 211 SER B C   1 
ATOM 4624  O O   . SER B 1 216 ? -73.705  194.299 -18.585 1.00 0.00 ? 211 SER B O   1 
ATOM 4625  C CB  . SER B 1 216 ? -76.386  192.570 -19.484 1.00 0.00 ? 211 SER B CB  1 
ATOM 4626  O OG  . SER B 1 216 ? -76.657  193.802 -20.271 1.00 0.00 ? 211 SER B OG  1 
ATOM 4627  N N   . ARG B 1 217 ? -74.754  193.325 -16.888 1.00 0.00 ? 212 ARG B N   1 
ATOM 4628  C CA  . ARG B 1 217 ? -74.167  194.227 -15.838 1.00 0.00 ? 212 ARG B CA  1 
ATOM 4629  C C   . ARG B 1 217 ? -72.682  194.125 -15.753 1.00 0.00 ? 212 ARG B C   1 
ATOM 4630  O O   . ARG B 1 217 ? -71.999  195.166 -15.788 1.00 0.00 ? 212 ARG B O   1 
ATOM 4631  C CB  . ARG B 1 217 ? -74.787  194.013 -14.423 1.00 0.00 ? 212 ARG B CB  1 
ATOM 4632  C CG  . ARG B 1 217 ? -76.192  194.528 -14.167 1.00 0.00 ? 212 ARG B CG  1 
ATOM 4633  C CD  . ARG B 1 217 ? -76.135  196.056 -14.271 1.00 0.00 ? 212 ARG B CD  1 
ATOM 4634  N NE  . ARG B 1 217 ? -75.521  196.650 -13.043 1.00 0.00 ? 212 ARG B NE  1 
ATOM 4635  C CZ  . ARG B 1 217 ? -74.716  197.743 -13.179 1.00 0.00 ? 212 ARG B CZ  1 
ATOM 4636  N NH1 . ARG B 1 217 ? -74.755  198.522 -14.171 1.00 0.00 ? 212 ARG B NH1 1 
ATOM 4637  N NH2 . ARG B 1 217 ? -73.850  197.927 -12.227 1.00 0.00 ? 212 ARG B NH2 1 
ATOM 4638  N N   . LEU B 1 218 ? -72.102  192.888 -15.741 1.00 0.00 ? 213 LEU B N   1 
ATOM 4639  C CA  . LEU B 1 218 ? -70.622  192.617 -15.899 1.00 0.00 ? 213 LEU B CA  1 
ATOM 4640  C C   . LEU B 1 218 ? -69.935  193.218 -17.192 1.00 0.00 ? 213 LEU B C   1 
ATOM 4641  O O   . LEU B 1 218 ? -68.768  193.679 -17.194 1.00 0.00 ? 213 LEU B O   1 
ATOM 4642  C CB  . LEU B 1 218 ? -70.273  191.067 -15.923 1.00 0.00 ? 213 LEU B CB  1 
ATOM 4643  C CG  . LEU B 1 218 ? -68.817  190.699 -15.432 1.00 0.00 ? 213 LEU B CG  1 
ATOM 4644  C CD1 . LEU B 1 218 ? -68.721  190.927 -13.966 1.00 0.00 ? 213 LEU B CD1 1 
ATOM 4645  C CD2 . LEU B 1 218 ? -68.477  189.225 -15.653 1.00 0.00 ? 213 LEU B CD2 1 
ATOM 4646  N N   . SER B 1 219 ? -70.670  193.274 -18.418 1.00 0.00 ? 214 SER B N   1 
ATOM 4647  C CA  . SER B 1 219 ? -70.293  193.998 -19.674 1.00 0.00 ? 214 SER B CA  1 
ATOM 4648  C C   . SER B 1 219 ? -70.142  195.453 -19.399 1.00 0.00 ? 214 SER B C   1 
ATOM 4649  O O   . SER B 1 219 ? -69.238  196.035 -19.945 1.00 0.00 ? 214 SER B O   1 
ATOM 4650  C CB  . SER B 1 219 ? -71.229  193.780 -20.876 1.00 0.00 ? 214 SER B CB  1 
ATOM 4651  O OG  . SER B 1 219 ? -70.682  194.265 -22.079 1.00 0.00 ? 214 SER B OG  1 
ATOM 4652  N N   . GLN B 1 220 ? -71.067  196.019 -18.637 1.00 0.00 ? 215 GLN B N   1 
ATOM 4653  C CA  . GLN B 1 220 ? -71.020  197.390 -18.191 1.00 0.00 ? 215 GLN B CA  1 
ATOM 4654  C C   . GLN B 1 220 ? -69.786  197.757 -17.303 1.00 0.00 ? 215 GLN B C   1 
ATOM 4655  O O   . GLN B 1 220 ? -69.163  198.825 -17.448 1.00 0.00 ? 215 GLN B O   1 
ATOM 4656  C CB  . GLN B 1 220 ? -72.434  197.775 -17.534 1.00 0.00 ? 215 GLN B CB  1 
ATOM 4657  C CG  . GLN B 1 220 ? -72.690  199.306 -17.357 1.00 0.00 ? 215 GLN B CG  1 
ATOM 4658  C CD  . GLN B 1 220 ? -72.684  200.019 -18.674 1.00 0.00 ? 215 GLN B CD  1 
ATOM 4659  O OE1 . GLN B 1 220 ? -73.024  199.521 -19.750 1.00 0.00 ? 215 GLN B OE1 1 
ATOM 4660  N NE2 . GLN B 1 220 ? -72.196  201.281 -18.547 1.00 0.00 ? 215 GLN B NE2 1 
ATOM 4661  N N   . TYR B 1 221 ? -69.446  196.805 -16.399 1.00 0.00 ? 216 TYR B N   1 
ATOM 4662  C CA  . TYR B 1 221 ? -68.316  196.875 -15.491 1.00 0.00 ? 216 TYR B CA  1 
ATOM 4663  C C   . TYR B 1 221 ? -66.962  196.862 -16.277 1.00 0.00 ? 216 TYR B C   1 
ATOM 4664  O O   . TYR B 1 221 ? -66.063  197.688 -16.091 1.00 0.00 ? 216 TYR B O   1 
ATOM 4665  C CB  . TYR B 1 221 ? -68.432  195.632 -14.595 1.00 0.00 ? 216 TYR B CB  1 
ATOM 4666  C CG  . TYR B 1 221 ? -67.704  195.760 -13.286 1.00 0.00 ? 216 TYR B CG  1 
ATOM 4667  C CD1 . TYR B 1 221 ? -67.956  196.890 -12.478 1.00 0.00 ? 216 TYR B CD1 1 
ATOM 4668  C CD2 . TYR B 1 221 ? -66.813  194.767 -12.857 1.00 0.00 ? 216 TYR B CD2 1 
ATOM 4669  C CE1 . TYR B 1 221 ? -67.252  197.115 -11.294 1.00 0.00 ? 216 TYR B CE1 1 
ATOM 4670  C CE2 . TYR B 1 221 ? -66.225  194.881 -11.598 1.00 0.00 ? 216 TYR B CE2 1 
ATOM 4671  C CZ  . TYR B 1 221 ? -66.446  196.038 -10.877 1.00 0.00 ? 216 TYR B CZ  1 
ATOM 4672  O OH  . TYR B 1 221 ? -65.869  195.981 -9.539  1.00 0.00 ? 216 TYR B OH  1 
ATOM 4673  N N   . ARG B 1 222 ? -66.883  195.933 -17.322 1.00 0.00 ? 217 ARG B N   1 
ATOM 4674  C CA  . ARG B 1 222 ? -65.842  195.611 -18.275 1.00 0.00 ? 217 ARG B CA  1 
ATOM 4675  C C   . ARG B 1 222 ? -65.480  196.815 -19.089 1.00 0.00 ? 217 ARG B C   1 
ATOM 4676  O O   . ARG B 1 222 ? -64.355  197.198 -19.217 1.00 0.00 ? 217 ARG B O   1 
ATOM 4677  C CB  . ARG B 1 222 ? -66.258  194.403 -19.157 1.00 0.00 ? 217 ARG B CB  1 
ATOM 4678  C CG  . ARG B 1 222 ? -65.028  193.741 -19.811 1.00 0.00 ? 217 ARG B CG  1 
ATOM 4679  C CD  . ARG B 1 222 ? -64.366  194.464 -20.991 1.00 0.00 ? 217 ARG B CD  1 
ATOM 4680  N NE  . ARG B 1 222 ? -65.467  194.572 -22.024 1.00 0.00 ? 217 ARG B NE  1 
ATOM 4681  C CZ  . ARG B 1 222 ? -65.521  195.703 -22.816 1.00 0.00 ? 217 ARG B CZ  1 
ATOM 4682  N NH1 . ARG B 1 222 ? -64.465  196.505 -22.948 1.00 0.00 ? 217 ARG B NH1 1 
ATOM 4683  N NH2 . ARG B 1 222 ? -66.597  196.004 -23.570 1.00 0.00 ? 217 ARG B NH2 1 
ATOM 4684  N N   . LYS B 1 223 ? -66.451  197.428 -19.806 1.00 0.00 ? 218 LYS B N   1 
ATOM 4685  C CA  . LYS B 1 223 ? -66.280  198.614 -20.583 1.00 0.00 ? 218 LYS B CA  1 
ATOM 4686  C C   . LYS B 1 223 ? -65.928  199.819 -19.778 1.00 0.00 ? 218 LYS B C   1 
ATOM 4687  O O   . LYS B 1 223 ? -65.077  200.617 -20.187 1.00 0.00 ? 218 LYS B O   1 
ATOM 4688  C CB  . LYS B 1 223 ? -67.505  198.851 -21.451 1.00 0.00 ? 218 LYS B CB  1 
ATOM 4689  C CG  . LYS B 1 223 ? -68.867  199.194 -20.824 1.00 0.00 ? 218 LYS B CG  1 
ATOM 4690  C CD  . LYS B 1 223 ? -70.099  199.132 -21.801 1.00 0.00 ? 218 LYS B CD  1 
ATOM 4691  C CE  . LYS B 1 223 ? -70.245  197.894 -22.669 1.00 0.00 ? 218 LYS B CE  1 
ATOM 4692  N NZ  . LYS B 1 223 ? -71.311  198.031 -23.632 1.00 0.00 ? 218 LYS B NZ  1 
ATOM 4693  N N   . GLU B 1 224 ? -66.453  200.028 -18.557 1.00 0.00 ? 219 GLU B N   1 
ATOM 4694  C CA  . GLU B 1 224 ? -66.116  201.132 -17.627 1.00 0.00 ? 219 GLU B CA  1 
ATOM 4695  C C   . GLU B 1 224 ? -64.626  200.938 -17.122 1.00 0.00 ? 219 GLU B C   1 
ATOM 4696  O O   . GLU B 1 224 ? -63.866  201.907 -17.278 1.00 0.00 ? 219 GLU B O   1 
ATOM 4697  C CB  . GLU B 1 224 ? -67.173  201.259 -16.464 1.00 0.00 ? 219 GLU B CB  1 
ATOM 4698  C CG  . GLU B 1 224 ? -67.143  202.535 -15.637 1.00 0.00 ? 219 GLU B CG  1 
ATOM 4699  C CD  . GLU B 1 224 ? -68.029  202.459 -14.371 1.00 0.00 ? 219 GLU B CD  1 
ATOM 4700  O OE1 . GLU B 1 224 ? -69.251  202.582 -14.442 1.00 0.00 ? 219 GLU B OE1 1 
ATOM 4701  O OE2 . GLU B 1 224 ? -67.370  202.343 -13.253 1.00 0.00 ? 219 GLU B OE2 1 
ATOM 4702  N N   . LEU B 1 225 ? -64.276  199.768 -16.554 1.00 0.00 ? 220 LEU B N   1 
ATOM 4703  C CA  . LEU B 1 225 ? -62.908  199.512 -16.123 1.00 0.00 ? 220 LEU B CA  1 
ATOM 4704  C C   . LEU B 1 225 ? -61.950  199.533 -17.264 1.00 0.00 ? 220 LEU B C   1 
ATOM 4705  O O   . LEU B 1 225 ? -60.889  200.210 -17.191 1.00 0.00 ? 220 LEU B O   1 
ATOM 4706  C CB  . LEU B 1 225 ? -62.680  198.267 -15.221 1.00 0.00 ? 220 LEU B CB  1 
ATOM 4707  C CG  . LEU B 1 225 ? -61.385  198.485 -14.342 1.00 0.00 ? 220 LEU B CG  1 
ATOM 4708  C CD1 . LEU B 1 225 ? -61.611  199.518 -13.238 1.00 0.00 ? 220 LEU B CD1 1 
ATOM 4709  C CD2 . LEU B 1 225 ? -60.859  197.144 -13.805 1.00 0.00 ? 220 LEU B CD2 1 
ATOM 4710  N N   . GLY B 1 226 ? -62.340  198.917 -18.382 1.00 0.00 ? 221 GLY B N   1 
ATOM 4711  C CA  . GLY B 1 226 ? -61.492  198.768 -19.503 1.00 0.00 ? 221 GLY B CA  1 
ATOM 4712  C C   . GLY B 1 226 ? -61.069  200.181 -20.056 1.00 0.00 ? 221 GLY B C   1 
ATOM 4713  O O   . GLY B 1 226 ? -59.937  200.377 -20.500 1.00 0.00 ? 221 GLY B O   1 
ATOM 4714  N N   . ALA B 1 227 ? -61.918  201.189 -19.898 1.00 0.00 ? 222 ALA B N   1 
ATOM 4715  C CA  . ALA B 1 227 ? -61.735  202.554 -20.270 1.00 0.00 ? 222 ALA B CA  1 
ATOM 4716  C C   . ALA B 1 227 ? -60.736  203.271 -19.317 1.00 0.00 ? 222 ALA B C   1 
ATOM 4717  O O   . ALA B 1 227 ? -59.918  204.083 -19.738 1.00 0.00 ? 222 ALA B O   1 
ATOM 4718  C CB  . ALA B 1 227 ? -63.127  203.210 -20.380 1.00 0.00 ? 222 ALA B CB  1 
ATOM 4719  N N   . GLN B 1 228 ? -60.844  203.040 -18.035 1.00 0.00 ? 223 GLN B N   1 
ATOM 4720  C CA  . GLN B 1 228 ? -59.839  203.480 -17.095 1.00 0.00 ? 223 GLN B CA  1 
ATOM 4721  C C   . GLN B 1 228 ? -58.490  202.820 -17.419 1.00 0.00 ? 223 GLN B C   1 
ATOM 4722  O O   . GLN B 1 228 ? -57.452  203.465 -17.526 1.00 0.00 ? 223 GLN B O   1 
ATOM 4723  C CB  . GLN B 1 228 ? -60.302  202.974 -15.649 1.00 0.00 ? 223 GLN B CB  1 
ATOM 4724  C CG  . GLN B 1 228 ? -59.536  203.696 -14.487 1.00 0.00 ? 223 GLN B CG  1 
ATOM 4725  C CD  . GLN B 1 228 ? -59.940  203.169 -13.079 1.00 0.00 ? 223 GLN B CD  1 
ATOM 4726  O OE1 . GLN B 1 228 ? -59.103  202.824 -12.302 1.00 0.00 ? 223 GLN B OE1 1 
ATOM 4727  N NE2 . GLN B 1 228 ? -61.272  203.050 -12.845 1.00 0.00 ? 223 GLN B NE2 1 
ATOM 4728  N N   . LEU B 1 229 ? -58.448  201.519 -17.823 1.00 0.00 ? 224 LEU B N   1 
ATOM 4729  C CA  . LEU B 1 229 ? -57.241  200.766 -18.193 1.00 0.00 ? 224 LEU B CA  1 
ATOM 4730  C C   . LEU B 1 229 ? -56.508  201.365 -19.342 1.00 0.00 ? 224 LEU B C   1 
ATOM 4731  O O   . LEU B 1 229 ? -55.244  201.468 -19.302 1.00 0.00 ? 224 LEU B O   1 
ATOM 4732  C CB  . LEU B 1 229 ? -57.563  199.239 -18.247 1.00 0.00 ? 224 LEU B CB  1 
ATOM 4733  C CG  . LEU B 1 229 ? -56.430  198.237 -18.012 1.00 0.00 ? 224 LEU B CG  1 
ATOM 4734  C CD1 . LEU B 1 229 ? -55.924  198.305 -16.569 1.00 0.00 ? 224 LEU B CD1 1 
ATOM 4735  C CD2 . LEU B 1 229 ? -56.804  196.905 -18.404 1.00 0.00 ? 224 LEU B CD2 1 
ATOM 4736  N N   . HIS B 1 230 ? -57.070  201.837 -20.448 1.00 0.00 ? 225 HIS B N   1 
ATOM 4737  C CA  . HIS B 1 230 ? -56.279  202.361 -21.601 1.00 0.00 ? 225 HIS B CA  1 
ATOM 4738  C C   . HIS B 1 230 ? -55.597  203.688 -21.196 1.00 0.00 ? 225 HIS B C   1 
ATOM 4739  O O   . HIS B 1 230 ? -54.386  203.955 -21.391 1.00 0.00 ? 225 HIS B O   1 
ATOM 4740  C CB  . HIS B 1 230 ? -57.083  202.607 -22.876 1.00 0.00 ? 225 HIS B CB  1 
ATOM 4741  C CG  . HIS B 1 230 ? -57.799  201.360 -23.370 1.00 0.00 ? 225 HIS B CG  1 
ATOM 4742  N ND1 . HIS B 1 230 ? -57.200  200.416 -24.204 1.00 0.00 ? 225 HIS B ND1 1 
ATOM 4743  C CD2 . HIS B 1 230 ? -59.093  200.959 -23.225 1.00 0.00 ? 225 HIS B CD2 1 
ATOM 4744  C CE1 . HIS B 1 230 ? -58.153  199.550 -24.589 1.00 0.00 ? 225 HIS B CE1 1 
ATOM 4745  N NE2 . HIS B 1 230 ? -59.328  199.838 -24.034 1.00 0.00 ? 225 HIS B NE2 1 
ATOM 4746  N N   . GLN B 1 231 ? -56.285  204.619 -20.453 1.00 0.00 ? 226 GLN B N   1 
ATOM 4747  C CA  . GLN B 1 231 ? -55.707  205.858 -20.067 1.00 0.00 ? 226 GLN B CA  1 
ATOM 4748  C C   . GLN B 1 231 ? -54.579  205.666 -19.046 1.00 0.00 ? 226 GLN B C   1 
ATOM 4749  O O   . GLN B 1 231 ? -53.504  206.229 -19.119 1.00 0.00 ? 226 GLN B O   1 
ATOM 4750  C CB  . GLN B 1 231 ? -56.800  206.873 -19.599 1.00 0.00 ? 226 GLN B CB  1 
ATOM 4751  C CG  . GLN B 1 231 ? -56.255  208.282 -19.187 1.00 0.00 ? 226 GLN B CG  1 
ATOM 4752  C CD  . GLN B 1 231 ? -55.628  209.091 -20.356 1.00 0.00 ? 226 GLN B CD  1 
ATOM 4753  O OE1 . GLN B 1 231 ? -56.299  209.337 -21.335 1.00 0.00 ? 226 GLN B OE1 1 
ATOM 4754  N NE2 . GLN B 1 231 ? -54.350  209.438 -20.264 1.00 0.00 ? 226 GLN B NE2 1 
ATOM 4755  N N   . LEU B 1 232 ? -54.817  204.690 -18.031 1.00 0.00 ? 227 LEU B N   1 
ATOM 4756  C CA  . LEU B 1 232 ? -53.871  204.332 -16.990 1.00 0.00 ? 227 LEU B CA  1 
ATOM 4757  C C   . LEU B 1 232 ? -52.545  203.876 -17.583 1.00 0.00 ? 227 LEU B C   1 
ATOM 4758  O O   . LEU B 1 232 ? -51.492  204.318 -17.116 1.00 0.00 ? 227 LEU B O   1 
ATOM 4759  C CB  . LEU B 1 232 ? -54.617  203.310 -16.087 1.00 0.00 ? 227 LEU B CB  1 
ATOM 4760  C CG  . LEU B 1 232 ? -53.852  202.897 -14.869 1.00 0.00 ? 227 LEU B CG  1 
ATOM 4761  C CD1 . LEU B 1 232 ? -53.717  204.097 -13.933 1.00 0.00 ? 227 LEU B CD1 1 
ATOM 4762  C CD2 . LEU B 1 232 ? -54.714  201.832 -14.168 1.00 0.00 ? 227 LEU B CD2 1 
ATOM 4763  N N   . VAL B 1 233 ? -52.599  203.016 -18.582 1.00 0.00 ? 228 VAL B N   1 
ATOM 4764  C CA  . VAL B 1 233 ? -51.391  202.632 -19.183 1.00 0.00 ? 228 VAL B CA  1 
ATOM 4765  C C   . VAL B 1 233 ? -50.802  203.695 -20.123 1.00 0.00 ? 228 VAL B C   1 
ATOM 4766  O O   . VAL B 1 233 ? -49.541  203.661 -20.231 1.00 0.00 ? 228 VAL B O   1 
ATOM 4767  C CB  . VAL B 1 233 ? -51.574  201.203 -19.796 1.00 0.00 ? 228 VAL B CB  1 
ATOM 4768  C CG1 . VAL B 1 233 ? -52.385  201.261 -21.098 1.00 0.00 ? 228 VAL B CG1 1 
ATOM 4769  C CG2 . VAL B 1 233 ? -50.293  200.432 -20.059 1.00 0.00 ? 228 VAL B CG2 1 
ATOM 4770  N N   . LEU B 1 234 ? -51.587  204.623 -20.744 1.00 0.00 ? 229 LEU B N   1 
ATOM 4771  C CA  . LEU B 1 234 ? -50.983  205.796 -21.413 1.00 0.00 ? 229 LEU B CA  1 
ATOM 4772  C C   . LEU B 1 234 ? -50.191  206.648 -20.408 1.00 0.00 ? 229 LEU B C   1 
ATOM 4773  O O   . LEU B 1 234 ? -49.111  207.233 -20.728 1.00 0.00 ? 229 LEU B O   1 
ATOM 4774  C CB  . LEU B 1 234 ? -52.016  206.600 -22.148 1.00 0.00 ? 229 LEU B CB  1 
ATOM 4775  C CG  . LEU B 1 234 ? -52.508  205.826 -23.417 1.00 0.00 ? 229 LEU B CG  1 
ATOM 4776  C CD1 . LEU B 1 234 ? -53.773  206.404 -24.003 1.00 0.00 ? 229 LEU B CD1 1 
ATOM 4777  C CD2 . LEU B 1 234 ? -51.388  205.735 -24.474 1.00 0.00 ? 229 LEU B CD2 1 
ATOM 4778  N N   . ASN B 1 235 ? -50.783  206.935 -19.262 1.00 0.00 ? 230 ASN B N   1 
ATOM 4779  C CA  . ASN B 1 235 ? -50.244  207.577 -18.069 1.00 0.00 ? 230 ASN B CA  1 
ATOM 4780  C C   . ASN B 1 235 ? -48.920  206.984 -17.682 1.00 0.00 ? 230 ASN B C   1 
ATOM 4781  O O   . ASN B 1 235 ? -47.886  207.599 -17.435 1.00 0.00 ? 230 ASN B O   1 
ATOM 4782  C CB  . ASN B 1 235 ? -51.138  207.485 -16.798 1.00 0.00 ? 230 ASN B CB  1 
ATOM 4783  C CG  . ASN B 1 235 ? -52.467  208.281 -16.954 1.00 0.00 ? 230 ASN B CG  1 
ATOM 4784  O OD1 . ASN B 1 235 ? -52.690  209.120 -17.859 1.00 0.00 ? 230 ASN B OD1 1 
ATOM 4785  N ND2 . ASN B 1 235 ? -53.412  208.062 -15.988 1.00 0.00 ? 230 ASN B ND2 1 
ATOM 4786  N N   . SER B 1 236 ? -48.913  205.627 -17.604 1.00 0.00 ? 231 SER B N   1 
ATOM 4787  C CA  . SER B 1 236 ? -47.677  204.845 -17.341 1.00 0.00 ? 231 SER B CA  1 
ATOM 4788  C C   . SER B 1 236 ? -46.613  205.050 -18.433 1.00 0.00 ? 231 SER B C   1 
ATOM 4789  O O   . SER B 1 236 ? -45.429  205.219 -18.070 1.00 0.00 ? 231 SER B O   1 
ATOM 4790  C CB  . SER B 1 236 ? -47.961  203.305 -17.259 1.00 0.00 ? 231 SER B CB  1 
ATOM 4791  O OG  . SER B 1 236 ? -46.975  202.724 -16.414 1.00 0.00 ? 231 SER B OG  1 
ATOM 4792  N N   . ALA B 1 237 ? -47.017  205.032 -19.708 1.00 0.00 ? 232 ALA B N   1 
ATOM 4793  C CA  . ALA B 1 237 ? -46.142  205.179 -20.872 1.00 0.00 ? 232 ALA B CA  1 
ATOM 4794  C C   . ALA B 1 237 ? -45.311  206.432 -20.932 1.00 0.00 ? 232 ALA B C   1 
ATOM 4795  O O   . ALA B 1 237 ? -44.107  206.384 -21.206 1.00 0.00 ? 232 ALA B O   1 
ATOM 4796  C CB  . ALA B 1 237 ? -47.040  205.085 -22.153 1.00 0.00 ? 232 ALA B CB  1 
ATOM 4797  N N   . ARG B 1 238 ? -46.037  207.606 -20.574 1.00 0.00 ? 233 ARG B N   1 
ATOM 4798  C CA  . ARG B 1 238 ? -45.419  208.824 -20.146 1.00 0.00 ? 233 ARG B CA  1 
ATOM 4799  C C   . ARG B 1 238 ? -44.537  208.680 -18.907 1.00 0.00 ? 233 ARG B C   1 
ATOM 4800  O O   . ARG B 1 238 ? -43.401  209.130 -18.910 1.00 0.00 ? 233 ARG B O   1 
ATOM 4801  C CB  . ARG B 1 238 ? -46.516  209.939 -19.815 1.00 0.00 ? 233 ARG B CB  1 
ATOM 4802  C CG  . ARG B 1 238 ? -47.108  210.534 -21.096 1.00 0.00 ? 233 ARG B CG  1 
ATOM 4803  C CD  . ARG B 1 238 ? -47.832  211.843 -20.911 1.00 0.00 ? 233 ARG B CD  1 
ATOM 4804  N NE  . ARG B 1 238 ? -49.234  211.519 -20.445 1.00 0.00 ? 233 ARG B NE  1 
ATOM 4805  C CZ  . ARG B 1 238 ? -49.938  212.067 -19.385 1.00 0.00 ? 233 ARG B CZ  1 
ATOM 4806  N NH1 . ARG B 1 238 ? -49.292  212.837 -18.534 1.00 0.00 ? 233 ARG B NH1 1 
ATOM 4807  N NH2 . ARG B 1 238 ? -51.205  211.795 -19.169 1.00 0.00 ? 233 ARG B NH2 1 
ATOM 4808  N N   . GLU B 1 239 ? -45.006  208.111 -17.765 1.00 0.00 ? 234 GLU B N   1 
ATOM 4809  C CA  . GLU B 1 239 ? -44.276  207.914 -16.556 1.00 0.00 ? 234 GLU B CA  1 
ATOM 4810  C C   . GLU B 1 239 ? -42.946  207.259 -16.674 1.00 0.00 ? 234 GLU B C   1 
ATOM 4811  O O   . GLU B 1 239 ? -41.977  207.807 -16.111 1.00 0.00 ? 234 GLU B O   1 
ATOM 4812  C CB  . GLU B 1 239 ? -45.096  207.193 -15.439 1.00 0.00 ? 234 GLU B CB  1 
ATOM 4813  C CG  . GLU B 1 239 ? -44.391  207.132 -14.000 1.00 0.00 ? 234 GLU B CG  1 
ATOM 4814  C CD  . GLU B 1 239 ? -45.085  206.171 -13.066 1.00 0.00 ? 234 GLU B CD  1 
ATOM 4815  O OE1 . GLU B 1 239 ? -46.307  206.276 -12.886 1.00 0.00 ? 234 GLU B OE1 1 
ATOM 4816  O OE2 . GLU B 1 239 ? -44.375  205.334 -12.426 1.00 0.00 ? 234 GLU B OE2 1 
ATOM 4817  N N   . LYS B 1 240 ? -42.861  206.117 -17.275 1.00 0.00 ? 235 LYS B N   1 
ATOM 4818  C CA  . LYS B 1 240 ? -41.559  205.397 -17.326 1.00 0.00 ? 235 LYS B CA  1 
ATOM 4819  C C   . LYS B 1 240 ? -40.636  205.982 -18.359 1.00 0.00 ? 235 LYS B C   1 
ATOM 4820  O O   . LYS B 1 240 ? -39.438  205.860 -18.216 1.00 0.00 ? 235 LYS B O   1 
ATOM 4821  C CB  . LYS B 1 240 ? -41.861  203.875 -17.655 1.00 0.00 ? 235 LYS B CB  1 
ATOM 4822  C CG  . LYS B 1 240 ? -42.946  203.244 -16.764 1.00 0.00 ? 235 LYS B CG  1 
ATOM 4823  C CD  . LYS B 1 240 ? -42.715  203.287 -15.209 1.00 0.00 ? 235 LYS B CD  1 
ATOM 4824  C CE  . LYS B 1 240 ? -43.820  202.658 -14.422 1.00 0.00 ? 235 LYS B CE  1 
ATOM 4825  N NZ  . LYS B 1 240 ? -43.704  202.783 -12.961 1.00 0.00 ? 235 LYS B NZ  1 
ATOM 4826  N N   . ARG B 1 241 ? -41.110  206.725 -19.354 1.00 0.00 ? 236 ARG B N   1 
ATOM 4827  C CA  . ARG B 1 241 ? -40.262  207.502 -20.289 1.00 0.00 ? 236 ARG B CA  1 
ATOM 4828  C C   . ARG B 1 241 ? -39.597  208.729 -19.594 1.00 0.00 ? 236 ARG B C   1 
ATOM 4829  O O   . ARG B 1 241 ? -38.491  209.132 -19.941 1.00 0.00 ? 236 ARG B O   1 
ATOM 4830  C CB  . ARG B 1 241 ? -41.165  208.007 -21.428 1.00 0.00 ? 236 ARG B CB  1 
ATOM 4831  C CG  . ARG B 1 241 ? -40.353  208.473 -22.688 1.00 0.00 ? 236 ARG B CG  1 
ATOM 4832  C CD  . ARG B 1 241 ? -39.472  207.396 -23.302 1.00 0.00 ? 236 ARG B CD  1 
ATOM 4833  N NE  . ARG B 1 241 ? -38.922  207.948 -24.637 1.00 0.00 ? 236 ARG B NE  1 
ATOM 4834  C CZ  . ARG B 1 241 ? -37.633  208.386 -24.779 1.00 0.00 ? 236 ARG B CZ  1 
ATOM 4835  N NH1 . ARG B 1 241 ? -36.791  208.203 -23.787 1.00 0.00 ? 236 ARG B NH1 1 
ATOM 4836  N NH2 . ARG B 1 241 ? -37.253  208.950 -25.951 1.00 0.00 ? 236 ARG B NH2 1 
ATOM 4837  N N   . ASP B 1 242 ? -40.396  209.408 -18.729 1.00 0.00 ? 237 ASP B N   1 
ATOM 4838  C CA  . ASP B 1 242 ? -39.907  210.497 -17.886 1.00 0.00 ? 237 ASP B CA  1 
ATOM 4839  C C   . ASP B 1 242 ? -38.731  210.131 -16.981 1.00 0.00 ? 237 ASP B C   1 
ATOM 4840  O O   . ASP B 1 242 ? -37.726  210.853 -16.821 1.00 0.00 ? 237 ASP B O   1 
ATOM 4841  C CB  . ASP B 1 242 ? -41.227  210.993 -17.179 1.00 0.00 ? 237 ASP B CB  1 
ATOM 4842  C CG  . ASP B 1 242 ? -40.963  212.410 -16.770 1.00 0.00 ? 237 ASP B CG  1 
ATOM 4843  O OD1 . ASP B 1 242 ? -40.112  212.620 -15.881 1.00 0.00 ? 237 ASP B OD1 1 
ATOM 4844  O OD2 . ASP B 1 242 ? -41.506  213.356 -17.347 1.00 0.00 ? 237 ASP B OD2 1 
ATOM 4845  N N   . MET B 1 243 ? -38.900  208.922 -16.407 1.00 0.00 ? 238 MET B N   1 
ATOM 4846  C CA  . MET B 1 243 ? -37.909  208.248 -15.701 1.00 0.00 ? 238 MET B CA  1 
ATOM 4847  C C   . MET B 1 243 ? -36.706  207.919 -16.482 1.00 0.00 ? 238 MET B C   1 
ATOM 4848  O O   . MET B 1 243 ? -35.591  208.170 -16.013 1.00 0.00 ? 238 MET B O   1 
ATOM 4849  C CB  . MET B 1 243 ? -38.507  206.881 -15.132 1.00 0.00 ? 238 MET B CB  1 
ATOM 4850  C CG  . MET B 1 243 ? -37.732  206.251 -13.953 1.00 0.00 ? 238 MET B CG  1 
ATOM 4851  S SD  . MET B 1 243 ? -38.401  204.662 -13.248 1.00 0.00 ? 238 MET B SD  1 
ATOM 4852  C CE  . MET B 1 243 ? -37.502  204.664 -11.718 1.00 0.00 ? 238 MET B CE  1 
ATOM 4853  N N   . GLU B 1 244 ? -36.788  207.426 -17.774 1.00 0.00 ? 239 GLU B N   1 
ATOM 4854  C CA  . GLU B 1 244 ? -35.703  207.159 -18.651 1.00 0.00 ? 239 GLU B CA  1 
ATOM 4855  C C   . GLU B 1 244 ? -34.890  208.444 -19.072 1.00 0.00 ? 239 GLU B C   1 
ATOM 4856  O O   . GLU B 1 244 ? -33.667  208.538 -18.978 1.00 0.00 ? 239 GLU B O   1 
ATOM 4857  C CB  . GLU B 1 244 ? -36.316  206.488 -19.898 1.00 0.00 ? 239 GLU B CB  1 
ATOM 4858  C CG  . GLU B 1 244 ? -35.268  205.973 -20.875 1.00 0.00 ? 239 GLU B CG  1 
ATOM 4859  C CD  . GLU B 1 244 ? -35.852  205.137 -22.053 1.00 0.00 ? 239 GLU B CD  1 
ATOM 4860  O OE1 . GLU B 1 244 ? -36.848  205.637 -22.650 1.00 0.00 ? 239 GLU B OE1 1 
ATOM 4861  O OE2 . GLU B 1 244 ? -35.250  204.094 -22.375 1.00 0.00 ? 239 GLU B OE2 1 
ATOM 4862  N N   . GLN B 1 245 ? -35.602  209.583 -19.323 1.00 0.00 ? 240 GLN B N   1 
ATOM 4863  C CA  . GLN B 1 245 ? -35.186  210.891 -19.685 1.00 0.00 ? 240 GLN B CA  1 
ATOM 4864  C C   . GLN B 1 245 ? -34.370  211.580 -18.510 1.00 0.00 ? 240 GLN B C   1 
ATOM 4865  O O   . GLN B 1 245 ? -33.298  212.186 -18.726 1.00 0.00 ? 240 GLN B O   1 
ATOM 4866  C CB  . GLN B 1 245 ? -36.421  211.818 -20.042 1.00 0.00 ? 240 GLN B CB  1 
ATOM 4867  C CG  . GLN B 1 245 ? -36.975  211.625 -21.487 1.00 0.00 ? 240 GLN B CG  1 
ATOM 4868  C CD  . GLN B 1 245 ? -36.089  212.029 -22.622 1.00 0.00 ? 240 GLN B CD  1 
ATOM 4869  O OE1 . GLN B 1 245 ? -34.984  212.485 -22.473 1.00 0.00 ? 240 GLN B OE1 1 
ATOM 4870  N NE2 . GLN B 1 245 ? -36.584  211.840 -23.928 1.00 0.00 ? 240 GLN B NE2 1 
ATOM 4871  N N   . ARG B 1 246 ? -34.814  211.426 -17.281 1.00 0.00 ? 241 ARG B N   1 
ATOM 4872  C CA  . ARG B 1 246 ? -34.011  211.784 -16.091 1.00 0.00 ? 241 ARG B CA  1 
ATOM 4873  C C   . ARG B 1 246 ? -32.760  210.919 -16.009 1.00 0.00 ? 241 ARG B C   1 
ATOM 4874  O O   . ARG B 1 246 ? -31.671  211.350 -15.737 1.00 0.00 ? 241 ARG B O   1 
ATOM 4875  C CB  . ARG B 1 246 ? -34.951  211.503 -14.888 1.00 0.00 ? 241 ARG B CB  1 
ATOM 4876  C CG  . ARG B 1 246 ? -34.233  211.619 -13.468 1.00 0.00 ? 241 ARG B CG  1 
ATOM 4877  C CD  . ARG B 1 246 ? -33.767  213.101 -13.180 1.00 0.00 ? 241 ARG B CD  1 
ATOM 4878  N NE  . ARG B 1 246 ? -32.713  213.012 -12.132 1.00 0.00 ? 241 ARG B NE  1 
ATOM 4879  C CZ  . ARG B 1 246 ? -31.587  213.754 -12.142 1.00 0.00 ? 241 ARG B CZ  1 
ATOM 4880  N NH1 . ARG B 1 246 ? -31.457  214.821 -12.869 1.00 0.00 ? 241 ARG B NH1 1 
ATOM 4881  N NH2 . ARG B 1 246 ? -30.650  213.405 -11.262 1.00 0.00 ? 241 ARG B NH2 1 
ATOM 4882  N N   . HIS B 1 247 ? -32.860  209.673 -16.340 1.00 0.00 ? 242 HIS B N   1 
ATOM 4883  C CA  . HIS B 1 247 ? -31.744  208.731 -16.283 1.00 0.00 ? 242 HIS B CA  1 
ATOM 4884  C C   . HIS B 1 247 ? -30.635  208.969 -17.251 1.00 0.00 ? 242 HIS B C   1 
ATOM 4885  O O   . HIS B 1 247 ? -29.481  208.992 -16.823 1.00 0.00 ? 242 HIS B O   1 
ATOM 4886  C CB  . HIS B 1 247 ? -32.120  207.268 -16.265 1.00 0.00 ? 242 HIS B CB  1 
ATOM 4887  C CG  . HIS B 1 247 ? -32.727  206.791 -15.038 1.00 0.00 ? 242 HIS B CG  1 
ATOM 4888  N ND1 . HIS B 1 247 ? -33.069  205.514 -14.859 1.00 0.00 ? 242 HIS B ND1 1 
ATOM 4889  C CD2 . HIS B 1 247 ? -33.013  207.437 -13.836 1.00 0.00 ? 242 HIS B CD2 1 
ATOM 4890  C CE1 . HIS B 1 247 ? -33.575  205.340 -13.602 1.00 0.00 ? 242 HIS B CE1 1 
ATOM 4891  N NE2 . HIS B 1 247 ? -33.551  206.507 -12.951 1.00 0.00 ? 242 HIS B NE2 1 
ATOM 4892  N N   . VAL B 1 248 ? -30.856  209.249 -18.452 1.00 0.00 ? 243 VAL B N   1 
ATOM 4893  C CA  . VAL B 1 248 ? -29.774  209.666 -19.363 1.00 0.00 ? 243 VAL B CA  1 
ATOM 4894  C C   . VAL B 1 248 ? -29.147  211.043 -19.024 1.00 0.00 ? 243 VAL B C   1 
ATOM 4895  O O   . VAL B 1 248 ? -27.931  211.204 -19.148 1.00 0.00 ? 243 VAL B O   1 
ATOM 4896  C CB  . VAL B 1 248 ? -30.253  209.605 -20.771 1.00 0.00 ? 243 VAL B CB  1 
ATOM 4897  C CG1 . VAL B 1 248 ? -30.505  208.102 -21.187 1.00 0.00 ? 243 VAL B CG1 1 
ATOM 4898  C CG2 . VAL B 1 248 ? -31.522  210.391 -21.117 1.00 0.00 ? 243 VAL B CG2 1 
ATOM 4899  N N   . LEU B 1 249 ? -30.049  211.906 -18.427 1.00 0.00 ? 244 LEU B N   1 
ATOM 4900  C CA  . LEU B 1 249 ? -29.585  213.147 -17.800 1.00 0.00 ? 244 LEU B CA  1 
ATOM 4901  C C   . LEU B 1 249 ? -28.708  212.955 -16.545 1.00 0.00 ? 244 LEU B C   1 
ATOM 4902  O O   . LEU B 1 249 ? -27.659  213.548 -16.375 1.00 0.00 ? 244 LEU B O   1 
ATOM 4903  C CB  . LEU B 1 249 ? -30.823  214.095 -17.603 1.00 0.00 ? 244 LEU B CB  1 
ATOM 4904  C CG  . LEU B 1 249 ? -30.512  215.624 -17.381 1.00 0.00 ? 244 LEU B CG  1 
ATOM 4905  C CD1 . LEU B 1 249 ? -31.439  216.557 -18.207 1.00 0.00 ? 244 LEU B CD1 1 
ATOM 4906  C CD2 . LEU B 1 249 ? -30.834  215.924 -15.917 1.00 0.00 ? 244 LEU B CD2 1 
ATOM 4907  N N   . LEU B 1 250 ? -29.058  211.987 -15.695 1.00 0.00 ? 245 LEU B N   1 
ATOM 4908  C CA  . LEU B 1 250 ? -28.299  211.517 -14.531 1.00 0.00 ? 245 LEU B CA  1 
ATOM 4909  C C   . LEU B 1 250 ? -26.974  210.946 -15.006 1.00 0.00 ? 245 LEU B C   1 
ATOM 4910  O O   . LEU B 1 250 ? -25.900  211.309 -14.555 1.00 0.00 ? 245 LEU B O   1 
ATOM 4911  C CB  . LEU B 1 250 ? -29.033  210.454 -13.669 1.00 0.00 ? 245 LEU B CB  1 
ATOM 4912  C CG  . LEU B 1 250 ? -28.741  210.528 -12.102 1.00 0.00 ? 245 LEU B CG  1 
ATOM 4913  C CD1 . LEU B 1 250 ? -29.727  209.571 -11.417 1.00 0.00 ? 245 LEU B CD1 1 
ATOM 4914  C CD2 . LEU B 1 250 ? -27.308  210.106 -11.676 1.00 0.00 ? 245 LEU B CD2 1 
ATOM 4915  N N   . LYS B 1 251 ? -27.011  209.996 -15.972 1.00 0.00 ? 246 LYS B N   1 
ATOM 4916  C CA  . LYS B 1 251 ? -25.769  209.350 -16.447 1.00 0.00 ? 246 LYS B CA  1 
ATOM 4917  C C   . LYS B 1 251 ? -24.732  210.363 -17.059 1.00 0.00 ? 246 LYS B C   1 
ATOM 4918  O O   . LYS B 1 251 ? -23.543  210.155 -16.789 1.00 0.00 ? 246 LYS B O   1 
ATOM 4919  C CB  . LYS B 1 251 ? -26.077  208.252 -17.560 1.00 0.00 ? 246 LYS B CB  1 
ATOM 4920  C CG  . LYS B 1 251 ? -26.970  207.091 -17.007 1.00 0.00 ? 246 LYS B CG  1 
ATOM 4921  C CD  . LYS B 1 251 ? -27.009  206.064 -18.109 1.00 0.00 ? 246 LYS B CD  1 
ATOM 4922  C CE  . LYS B 1 251 ? -27.730  204.768 -17.668 1.00 0.00 ? 246 LYS B CE  1 
ATOM 4923  N NZ  . LYS B 1 251 ? -27.413  203.659 -18.619 1.00 0.00 ? 246 LYS B NZ  1 
ATOM 4924  N N   . GLN B 1 252 ? -25.145  211.359 -17.898 1.00 0.00 ? 247 GLN B N   1 
ATOM 4925  C CA  . GLN B 1 252 ? -24.414  212.299 -18.704 1.00 0.00 ? 247 GLN B CA  1 
ATOM 4926  C C   . GLN B 1 252 ? -23.818  213.369 -17.846 1.00 0.00 ? 247 GLN B C   1 
ATOM 4927  O O   . GLN B 1 252 ? -22.655  213.745 -17.980 1.00 0.00 ? 247 GLN B O   1 
ATOM 4928  C CB  . GLN B 1 252 ? -25.197  212.927 -19.827 1.00 0.00 ? 247 GLN B CB  1 
ATOM 4929  C CG  . GLN B 1 252 ? -24.339  213.802 -20.764 1.00 0.00 ? 247 GLN B CG  1 
ATOM 4930  C CD  . GLN B 1 252 ? -25.266  214.483 -21.764 1.00 0.00 ? 247 GLN B CD  1 
ATOM 4931  O OE1 . GLN B 1 252 ? -25.420  213.952 -22.855 1.00 0.00 ? 247 GLN B OE1 1 
ATOM 4932  N NE2 . GLN B 1 252 ? -25.598  215.743 -21.572 1.00 0.00 ? 247 GLN B NE2 1 
ATOM 4933  N N   . LYS B 1 253 ? -24.548  213.857 -16.864 1.00 0.00 ? 248 LYS B N   1 
ATOM 4934  C CA  . LYS B 1 253 ? -24.409  215.074 -16.063 1.00 0.00 ? 248 LYS B CA  1 
ATOM 4935  C C   . LYS B 1 253 ? -24.137  215.069 -14.556 1.00 0.00 ? 248 LYS B C   1 
ATOM 4936  O O   . LYS B 1 253 ? -23.464  215.896 -13.915 1.00 0.00 ? 248 LYS B O   1 
ATOM 4937  C CB  . LYS B 1 253 ? -25.633  216.013 -16.501 1.00 0.00 ? 248 LYS B CB  1 
ATOM 4938  C CG  . LYS B 1 253 ? -25.437  217.498 -16.052 1.00 0.00 ? 248 LYS B CG  1 
ATOM 4939  C CD  . LYS B 1 253 ? -26.439  218.440 -16.617 1.00 0.00 ? 248 LYS B CD  1 
ATOM 4940  C CE  . LYS B 1 253 ? -26.358  219.843 -15.860 1.00 0.00 ? 248 LYS B CE  1 
ATOM 4941  N NZ  . LYS B 1 253 ? -27.042  220.873 -16.651 1.00 0.00 ? 248 LYS B NZ  1 
ATOM 4942  N N   . GLU B 1 254 ? -24.792  214.059 -13.903 1.00 0.00 ? 249 GLU B N   1 
ATOM 4943  C CA  . GLU B 1 254 ? -24.671  213.864 -12.510 1.00 0.00 ? 249 GLU B CA  1 
ATOM 4944  C C   . GLU B 1 254 ? -24.042  212.435 -12.004 1.00 0.00 ? 249 GLU B C   1 
ATOM 4945  O O   . GLU B 1 254 ? -23.932  212.118 -10.799 1.00 0.00 ? 249 GLU B O   1 
ATOM 4946  C CB  . GLU B 1 254 ? -26.076  213.954 -11.861 1.00 0.00 ? 249 GLU B CB  1 
ATOM 4947  C CG  . GLU B 1 254 ? -26.857  215.242 -12.321 1.00 0.00 ? 249 GLU B CG  1 
ATOM 4948  C CD  . GLU B 1 254 ? -28.145  215.295 -11.606 1.00 0.00 ? 249 GLU B CD  1 
ATOM 4949  O OE1 . GLU B 1 254 ? -28.211  214.749 -10.441 1.00 0.00 ? 249 GLU B OE1 1 
ATOM 4950  O OE2 . GLU B 1 254 ? -29.158  215.851 -12.132 1.00 0.00 ? 249 GLU B OE2 1 
ATOM 4951  N N   . LEU B 1 255 ? -23.574  211.551 -12.875 1.00 0.00 ? 250 LEU B N   1 
ATOM 4952  C CA  . LEU B 1 255 ? -23.130  210.187 -12.489 1.00 0.00 ? 250 LEU B CA  1 
ATOM 4953  C C   . LEU B 1 255 ? -21.711  210.170 -11.822 1.00 0.00 ? 250 LEU B C   1 
ATOM 4954  O O   . LEU B 1 255 ? -20.781  210.797 -12.337 1.00 0.00 ? 250 LEU B O   1 
ATOM 4955  C CB  . LEU B 1 255 ? -23.127  209.309 -13.769 1.00 0.00 ? 250 LEU B CB  1 
ATOM 4956  C CG  . LEU B 1 255 ? -23.038  207.796 -13.530 1.00 0.00 ? 250 LEU B CG  1 
ATOM 4957  C CD1 . LEU B 1 255 ? -24.409  207.306 -12.991 1.00 0.00 ? 250 LEU B CD1 1 
ATOM 4958  C CD2 . LEU B 1 255 ? -22.650  207.212 -14.855 1.00 0.00 ? 250 LEU B CD2 1 
ATOM 4959  N N   . GLY B 1 256 ? -21.472  209.464 -10.668 1.00 0.00 ? 251 GLY B N   1 
ATOM 4960  C CA  . GLY B 1 256 ? -20.356  209.657 -9.881  1.00 0.00 ? 251 GLY B CA  1 
ATOM 4961  C C   . GLY B 1 256 ? -19.379  208.500 -9.964  1.00 0.00 ? 251 GLY B C   1 
ATOM 4962  O O   . GLY B 1 256 ? -19.827  207.377 -9.653  1.00 0.00 ? 251 GLY B O   1 
ATOM 4963  N N   . GLY B 1 257 ? -18.089  208.741 -10.212 1.00 0.00 ? 252 GLY B N   1 
ATOM 4964  C CA  . GLY B 1 257 ? -17.104  207.697 -10.195 1.00 0.00 ? 252 GLY B CA  1 
ATOM 4965  C C   . GLY B 1 257 ? -16.446  207.381 -8.881  1.00 0.00 ? 252 GLY B C   1 
ATOM 4966  O O   . GLY B 1 257 ? -15.569  206.481 -8.769  1.00 0.00 ? 252 GLY B O   1 
ATOM 4967  N N   . GLU B 1 258 ? -16.725  208.135 -7.802  1.00 0.00 ? 253 GLU B N   1 
ATOM 4968  C CA  . GLU B 1 258 ? -16.030  208.179 -6.492  1.00 0.00 ? 253 GLU B CA  1 
ATOM 4969  C C   . GLU B 1 258 ? -16.574  207.040 -5.668  1.00 0.00 ? 253 GLU B C   1 
ATOM 4970  O O   . GLU B 1 258 ? -17.687  206.517 -5.927  1.00 0.00 ? 253 GLU B O   1 
ATOM 4971  C CB  . GLU B 1 258 ? -16.288  209.565 -5.864  1.00 0.00 ? 253 GLU B CB  1 
ATOM 4972  C CG  . GLU B 1 258 ? -15.437  209.851 -4.600  1.00 0.00 ? 253 GLU B CG  1 
ATOM 4973  C CD  . GLU B 1 258 ? -13.951  209.435 -4.541  1.00 0.00 ? 253 GLU B CD  1 
ATOM 4974  O OE1 . GLU B 1 258 ? -13.662  208.217 -4.294  1.00 0.00 ? 253 GLU B OE1 1 
ATOM 4975  O OE2 . GLU B 1 258 ? -12.999  210.234 -4.759  1.00 0.00 ? 253 GLU B OE2 1 
ATOM 4976  N N   . GLU B 1 259 ? -15.864  206.547 -4.690  1.00 0.00 ? 254 GLU B N   1 
ATOM 4977  C CA  . GLU B 1 259 ? -16.263  205.523 -3.825  1.00 0.00 ? 254 GLU B CA  1 
ATOM 4978  C C   . GLU B 1 259 ? -17.365  206.046 -2.893  1.00 0.00 ? 254 GLU B C   1 
ATOM 4979  O O   . GLU B 1 259 ? -17.219  207.166 -2.375  1.00 0.00 ? 254 GLU B O   1 
ATOM 4980  C CB  . GLU B 1 259 ? -15.064  205.115 -3.037  1.00 0.00 ? 254 GLU B CB  1 
ATOM 4981  C CG  . GLU B 1 259 ? -14.092  204.084 -3.841  1.00 0.00 ? 254 GLU B CG  1 
ATOM 4982  C CD  . GLU B 1 259 ? -14.868  202.947 -4.532  1.00 0.00 ? 254 GLU B CD  1 
ATOM 4983  O OE1 . GLU B 1 259 ? -15.410  202.012 -3.880  1.00 0.00 ? 254 GLU B OE1 1 
ATOM 4984  O OE2 . GLU B 1 259 ? -15.070  203.051 -5.792  1.00 0.00 ? 254 GLU B OE2 1 
ATOM 4985  N N   . PRO B 1 260 ? -18.443  205.306 -2.676  1.00 0.00 ? 255 PRO B N   1 
ATOM 4986  C CA  . PRO B 1 260 ? -19.273  205.463 -1.461  1.00 0.00 ? 255 PRO B CA  1 
ATOM 4987  C C   . PRO B 1 260 ? -18.545  205.815 -0.126  1.00 0.00 ? 255 PRO B C   1 
ATOM 4988  O O   . PRO B 1 260 ? -17.647  205.106 0.296   1.00 0.00 ? 255 PRO B O   1 
ATOM 4989  C CB  . PRO B 1 260 ? -20.088  204.127 -1.304  1.00 0.00 ? 255 PRO B CB  1 
ATOM 4990  C CG  . PRO B 1 260 ? -19.782  203.261 -2.535  1.00 0.00 ? 255 PRO B CG  1 
ATOM 4991  C CD  . PRO B 1 260 ? -18.441  203.854 -3.039  1.00 0.00 ? 255 PRO B CD  1 
ATOM 4992  N N   . GLU B 1 261 ? -18.920  206.932 0.505   1.00 0.00 ? 256 GLU B N   1 
ATOM 4993  C CA  . GLU B 1 261 ? -18.233  207.388 1.726   1.00 0.00 ? 256 GLU B CA  1 
ATOM 4994  C C   . GLU B 1 261 ? -19.080  207.132 2.948   1.00 0.00 ? 256 GLU B C   1 
ATOM 4995  O O   . GLU B 1 261 ? -20.141  207.672 3.068   1.00 0.00 ? 256 GLU B O   1 
ATOM 4996  C CB  . GLU B 1 261 ? -18.075  208.920 1.637   1.00 0.00 ? 256 GLU B CB  1 
ATOM 4997  C CG  . GLU B 1 261 ? -17.221  209.516 2.865   1.00 0.00 ? 256 GLU B CG  1 
ATOM 4998  C CD  . GLU B 1 261 ? -16.734  210.963 2.724   1.00 0.00 ? 256 GLU B CD  1 
ATOM 4999  O OE1 . GLU B 1 261 ? -16.077  211.416 1.769   1.00 0.00 ? 256 GLU B OE1 1 
ATOM 5000  O OE2 . GLU B 1 261 ? -17.120  211.791 3.630   1.00 0.00 ? 256 GLU B OE2 1 
ATOM 5001  N N   . PRO B 1 262 ? -18.675  206.247 3.830   1.00 0.00 ? 257 PRO B N   1 
ATOM 5002  C CA  . PRO B 1 262 ? -19.164  206.131 5.238   1.00 0.00 ? 257 PRO B CA  1 
ATOM 5003  C C   . PRO B 1 262 ? -19.340  207.417 6.018   1.00 0.00 ? 257 PRO B C   1 
ATOM 5004  O O   . PRO B 1 262 ? -18.820  208.521 5.777   1.00 0.00 ? 257 PRO B O   1 
ATOM 5005  C CB  . PRO B 1 262 ? -18.110  205.258 5.898   1.00 0.00 ? 257 PRO B CB  1 
ATOM 5006  C CG  . PRO B 1 262 ? -17.861  204.279 4.735   1.00 0.00 ? 257 PRO B CG  1 
ATOM 5007  C CD  . PRO B 1 262 ? -17.713  205.239 3.564   1.00 0.00 ? 257 PRO B CD  1 
ATOM 5008  N N   . SER B 1 263 ? -20.190  207.337 7.143   1.00 0.00 ? 258 SER B N   1 
ATOM 5009  C CA  . SER B 1 263 ? -20.613  208.574 7.823   1.00 0.00 ? 258 SER B CA  1 
ATOM 5010  C C   . SER B 1 263 ? -20.503  208.289 9.325   1.00 0.00 ? 258 SER B C   1 
ATOM 5011  O O   . SER B 1 263 ? -20.947  207.212 9.705   1.00 0.00 ? 258 SER B O   1 
ATOM 5012  C CB  . SER B 1 263 ? -22.054  208.947 7.380   1.00 0.00 ? 258 SER B CB  1 
ATOM 5013  O OG  . SER B 1 263 ? -22.576  210.069 8.101   1.00 0.00 ? 258 SER B OG  1 
ATOM 5014  N N   . LEU B 1 264 ? -19.862  209.209 10.036  1.00 0.00 ? 259 LEU B N   1 
ATOM 5015  C CA  . LEU B 1 264 ? -19.529  209.264 11.382  1.00 0.00 ? 259 LEU B CA  1 
ATOM 5016  C C   . LEU B 1 264 ? -20.498  210.147 12.212  1.00 0.00 ? 259 LEU B C   1 
ATOM 5017  O O   . LEU B 1 264 ? -20.220  211.340 12.420  1.00 0.00 ? 259 LEU B O   1 
ATOM 5018  C CB  . LEU B 1 264 ? -18.070  209.599 11.476  1.00 0.00 ? 259 LEU B CB  1 
ATOM 5019  C CG  . LEU B 1 264 ? -17.361  209.395 12.828  1.00 0.00 ? 259 LEU B CG  1 
ATOM 5020  C CD1 . LEU B 1 264 ? -17.422  207.928 13.248  1.00 0.00 ? 259 LEU B CD1 1 
ATOM 5021  C CD2 . LEU B 1 264 ? -15.930  209.825 12.705  1.00 0.00 ? 259 LEU B CD2 1 
ATOM 5022  N N   . ARG B 1 265 ? -21.678  209.560 12.468  1.00 0.00 ? 260 ARG B N   1 
ATOM 5023  C CA  . ARG B 1 265 ? -22.801  210.371 13.020  1.00 0.00 ? 260 ARG B CA  1 
ATOM 5024  C C   . ARG B 1 265 ? -23.504  209.682 14.277  1.00 0.00 ? 260 ARG B C   1 
ATOM 5025  O O   . ARG B 1 265 ? -23.535  208.498 14.450  1.00 0.00 ? 260 ARG B O   1 
ATOM 5026  C CB  . ARG B 1 265 ? -23.941  210.421 11.891  1.00 0.00 ? 260 ARG B CB  1 
ATOM 5027  C CG  . ARG B 1 265 ? -24.732  209.163 11.560  1.00 0.00 ? 260 ARG B CG  1 
ATOM 5028  C CD  . ARG B 1 265 ? -24.007  208.016 10.814  1.00 0.00 ? 260 ARG B CD  1 
ATOM 5029  N NE  . ARG B 1 265 ? -25.020  206.921 10.789  1.00 0.00 ? 260 ARG B NE  1 
ATOM 5030  C CZ  . ARG B 1 265 ? -24.653  205.646 10.488  1.00 0.00 ? 260 ARG B CZ  1 
ATOM 5031  N NH1 . ARG B 1 265 ? -23.403  205.339 10.181  1.00 0.00 ? 260 ARG B NH1 1 
ATOM 5032  N NH2 . ARG B 1 265 ? -25.598  204.745 10.306  1.00 0.00 ? 260 ARG B NH2 1 
ATOM 5033  N N   . GLU B 1 266 ? -23.892  210.547 15.224  1.00 0.00 ? 261 GLU B N   1 
ATOM 5034  C CA  . GLU B 1 266 ? -24.419  210.025 16.513  1.00 0.00 ? 261 GLU B CA  1 
ATOM 5035  C C   . GLU B 1 266 ? -25.724  209.243 16.379  1.00 0.00 ? 261 GLU B C   1 
ATOM 5036  O O   . GLU B 1 266 ? -26.563  209.636 15.514  1.00 0.00 ? 261 GLU B O   1 
ATOM 5037  C CB  . GLU B 1 266 ? -24.547  211.085 17.613  1.00 0.00 ? 261 GLU B CB  1 
ATOM 5038  C CG  . GLU B 1 266 ? -23.160  211.350 18.308  1.00 0.00 ? 261 GLU B CG  1 
ATOM 5039  C CD  . GLU B 1 266 ? -23.317  212.389 19.409  1.00 0.00 ? 261 GLU B CD  1 
ATOM 5040  O OE1 . GLU B 1 266 ? -23.761  213.537 19.142  1.00 0.00 ? 261 GLU B OE1 1 
ATOM 5041  O OE2 . GLU B 1 266 ? -23.036  212.062 20.603  1.00 0.00 ? 261 GLU B OE2 1 
ATOM 5042  N N   . GLY B 1 267 ? -25.890  208.176 17.188  1.00 0.00 ? 262 GLY B N   1 
ATOM 5043  C CA  . GLY B 1 267 ? -26.998  207.289 17.204  1.00 0.00 ? 262 GLY B CA  1 
ATOM 5044  C C   . GLY B 1 267 ? -27.731  207.135 18.595  1.00 0.00 ? 262 GLY B C   1 
ATOM 5045  O O   . GLY B 1 267 ? -27.911  208.087 19.321  1.00 0.00 ? 262 GLY B O   1 
ATOM 5046  N N   . PRO B 1 268 ? -28.082  205.866 19.005  1.00 0.00 ? 263 PRO B N   1 
ATOM 5047  C CA  . PRO B 1 268 ? -28.530  205.622 20.372  1.00 0.00 ? 263 PRO B CA  1 
ATOM 5048  C C   . PRO B 1 268 ? -27.412  205.820 21.434  1.00 0.00 ? 263 PRO B C   1 
ATOM 5049  O O   . PRO B 1 268 ? -27.770  206.073 22.629  1.00 0.00 ? 263 PRO B O   1 
ATOM 5050  C CB  . PRO B 1 268 ? -28.952  204.144 20.331  1.00 0.00 ? 263 PRO B CB  1 
ATOM 5051  C CG  . PRO B 1 268 ? -29.506  204.070 18.920  1.00 0.00 ? 263 PRO B CG  1 
ATOM 5052  C CD  . PRO B 1 268 ? -28.391  204.780 18.076  1.00 0.00 ? 263 PRO B CD  1 
ATOM 5053  N N   . GLY B 1 269 ? -26.144  205.483 21.171  1.00 0.00 ? 264 GLY B N   1 
ATOM 5054  C CA  . GLY B 1 269 ? -25.088  205.489 22.187  1.00 0.00 ? 264 GLY B CA  1 
ATOM 5055  C C   . GLY B 1 269 ? -23.848  206.213 21.828  1.00 0.00 ? 264 GLY B C   1 
ATOM 5056  O O   . GLY B 1 269 ? -22.918  206.255 22.646  1.00 0.00 ? 264 GLY B O   1 
ATOM 5057  N N   . GLY B 1 270 ? -23.747  206.929 20.700  1.00 0.00 ? 265 GLY B N   1 
ATOM 5058  C CA  . GLY B 1 270 ? -22.589  207.758 20.287  1.00 0.00 ? 265 GLY B CA  1 
ATOM 5059  C C   . GLY B 1 270 ? -22.494  207.570 18.823  1.00 0.00 ? 265 GLY B C   1 
ATOM 5060  O O   . GLY B 1 270 ? -23.324  207.083 18.117  1.00 0.00 ? 265 GLY B O   1 
ATOM 5061  N N   . LEU B 1 271 ? -21.275  207.809 18.332  1.00 0.00 ? 266 LEU B N   1 
ATOM 5062  C CA  . LEU B 1 271 ? -20.982  207.800 16.927  1.00 0.00 ? 266 LEU B CA  1 
ATOM 5063  C C   . LEU B 1 271 ? -21.000  206.411 16.306  1.00 0.00 ? 266 LEU B C   1 
ATOM 5064  O O   . LEU B 1 271 ? -20.439  205.453 16.844  1.00 0.00 ? 266 LEU B O   1 
ATOM 5065  C CB  . LEU B 1 271 ? -19.542  208.461 16.778  1.00 0.00 ? 266 LEU B CB  1 
ATOM 5066  C CG  . LEU B 1 271 ? -19.558  210.004 17.057  1.00 0.00 ? 266 LEU B CG  1 
ATOM 5067  C CD1 . LEU B 1 271 ? -18.100  210.546 17.051  1.00 0.00 ? 266 LEU B CD1 1 
ATOM 5068  C CD2 . LEU B 1 271 ? -20.408  210.805 16.011  1.00 0.00 ? 266 LEU B CD2 1 
ATOM 5069  N N   . VAL B 1 272 ? -21.615  206.263 15.109  1.00 0.00 ? 267 VAL B N   1 
ATOM 5070  C CA  . VAL B 1 272 ? -21.831  205.049 14.349  1.00 0.00 ? 267 VAL B CA  1 
ATOM 5071  C C   . VAL B 1 272 ? -21.140  205.224 13.027  1.00 0.00 ? 267 VAL B C   1 
ATOM 5072  O O   . VAL B 1 272 ? -21.158  206.344 12.584  1.00 0.00 ? 267 VAL B O   1 
ATOM 5073  C CB  . VAL B 1 272 ? -23.254  204.540 14.196  1.00 0.00 ? 267 VAL B CB  1 
ATOM 5074  C CG1 . VAL B 1 272 ? -23.469  203.288 13.310  1.00 0.00 ? 267 VAL B CG1 1 
ATOM 5075  C CG2 . VAL B 1 272 ? -23.863  204.295 15.554  1.00 0.00 ? 267 VAL B CG2 1 
ATOM 5076  N N   . MET B 1 273 ? -20.506  204.138 12.531  1.00 0.00 ? 268 MET B N   1 
ATOM 5077  C CA  . MET B 1 273 ? -20.054  204.068 11.097  1.00 0.00 ? 268 MET B CA  1 
ATOM 5078  C C   . MET B 1 273 ? -20.039  202.620 10.620  1.00 0.00 ? 268 MET B C   1 
ATOM 5079  O O   . MET B 1 273 ? -19.676  201.781 11.402  1.00 0.00 ? 268 MET B O   1 
ATOM 5080  C CB  . MET B 1 273 ? -18.686  204.775 10.870  1.00 0.00 ? 268 MET B CB  1 
ATOM 5081  C CG  . MET B 1 273 ? -18.401  205.061 9.342   1.00 0.00 ? 268 MET B CG  1 
ATOM 5082  S SD  . MET B 1 273 ? -17.062  206.340 9.338   1.00 0.00 ? 268 MET B SD  1 
ATOM 5083  C CE  . MET B 1 273 ? -15.714  205.206 9.291   1.00 0.00 ? 268 MET B CE  1 
ATOM 5084  N N   . GLU B 1 274 ? -20.423  202.430 9.393   1.00 0.00 ? 269 GLU B N   1 
ATOM 5085  C CA  . GLU B 1 274 ? -20.573  201.102 8.878   1.00 0.00 ? 269 GLU B CA  1 
ATOM 5086  C C   . GLU B 1 274 ? -20.133  201.127 7.386   1.00 0.00 ? 269 GLU B C   1 
ATOM 5087  O O   . GLU B 1 274 ? -20.309  202.077 6.659   1.00 0.00 ? 269 GLU B O   1 
ATOM 5088  C CB  . GLU B 1 274 ? -21.879  200.261 9.127   1.00 0.00 ? 269 GLU B CB  1 
ATOM 5089  C CG  . GLU B 1 274 ? -23.161  200.767 8.329   1.00 0.00 ? 269 GLU B CG  1 
ATOM 5090  C CD  . GLU B 1 274 ? -23.625  202.147 8.795   1.00 0.00 ? 269 GLU B CD  1 
ATOM 5091  O OE1 . GLU B 1 274 ? -23.064  203.184 8.308   1.00 0.00 ? 269 GLU B OE1 1 
ATOM 5092  O OE2 . GLU B 1 274 ? -24.645  202.265 9.528   1.00 0.00 ? 269 GLU B OE2 1 
ATOM 5093  N N   . GLY B 1 275 ? -19.517  200.102 6.959   1.00 0.00 ? 270 GLY B N   1 
ATOM 5094  C CA  . GLY B 1 275 ? -18.946  200.125 5.605   1.00 0.00 ? 270 GLY B CA  1 
ATOM 5095  C C   . GLY B 1 275 ? -17.954  199.030 5.295   1.00 0.00 ? 270 GLY B C   1 
ATOM 5096  O O   . GLY B 1 275 ? -17.449  198.369 6.175   1.00 0.00 ? 270 GLY B O   1 
ATOM 5097  N N   . HIS B 1 276 ? -17.753  198.924 3.945   1.00 0.00 ? 271 HIS B N   1 
ATOM 5098  C CA  . HIS B 1 276 ? -16.834  197.978 3.413   1.00 0.00 ? 271 HIS B CA  1 
ATOM 5099  C C   . HIS B 1 276 ? -15.364  198.197 3.794   1.00 0.00 ? 271 HIS B C   1 
ATOM 5100  O O   . HIS B 1 276 ? -14.773  199.282 3.762   1.00 0.00 ? 271 HIS B O   1 
ATOM 5101  C CB  . HIS B 1 276 ? -16.922  197.923 1.915   1.00 0.00 ? 271 HIS B CB  1 
ATOM 5102  C CG  . HIS B 1 276 ? -18.231  197.578 1.297   1.00 0.00 ? 271 HIS B CG  1 
ATOM 5103  N ND1 . HIS B 1 276 ? -18.885  196.365 1.342   1.00 0.00 ? 271 HIS B ND1 1 
ATOM 5104  C CD2 . HIS B 1 276 ? -19.026  198.333 0.453   1.00 0.00 ? 271 HIS B CD2 1 
ATOM 5105  C CE1 . HIS B 1 276 ? -20.016  196.454 0.550   1.00 0.00 ? 271 HIS B CE1 1 
ATOM 5106  N NE2 . HIS B 1 276 ? -20.091  197.636 0.013   1.00 0.00 ? 271 HIS B NE2 1 
ATOM 5107  N N   . LEU B 1 277 ? -14.709  197.027 4.108   1.00 0.00 ? 272 LEU B N   1 
ATOM 5108  C CA  . LEU B 1 277 ? -13.274  197.040 4.271   1.00 0.00 ? 272 LEU B CA  1 
ATOM 5109  C C   . LEU B 1 277 ? -12.663  195.719 3.780   1.00 0.00 ? 272 LEU B C   1 
ATOM 5110  O O   . LEU B 1 277 ? -13.288  194.632 3.846   1.00 0.00 ? 272 LEU B O   1 
ATOM 5111  C CB  . LEU B 1 277 ? -12.833  197.133 5.760   1.00 0.00 ? 272 LEU B CB  1 
ATOM 5112  C CG  . LEU B 1 277 ? -13.209  198.393 6.502   1.00 0.00 ? 272 LEU B CG  1 
ATOM 5113  C CD1 . LEU B 1 277 ? -13.060  198.228 7.997   1.00 0.00 ? 272 LEU B CD1 1 
ATOM 5114  C CD2 . LEU B 1 277 ? -12.255  199.613 6.160   1.00 0.00 ? 272 LEU B CD2 1 
ATOM 5115  N N   . PHE B 1 278 ? -11.375  195.780 3.421   1.00 0.00 ? 273 PHE B N   1 
ATOM 5116  C CA  . PHE B 1 278 ? -10.610  194.564 3.138   1.00 0.00 ? 273 PHE B CA  1 
ATOM 5117  C C   . PHE B 1 278 ? -9.800   194.160 4.359   1.00 0.00 ? 273 PHE B C   1 
ATOM 5118  O O   . PHE B 1 278 ? -9.319   194.973 5.107   1.00 0.00 ? 273 PHE B O   1 
ATOM 5119  C CB  . PHE B 1 278 ? -9.553   194.800 2.084   1.00 0.00 ? 273 PHE B CB  1 
ATOM 5120  C CG  . PHE B 1 278 ? -10.071  194.705 0.671   1.00 0.00 ? 273 PHE B CG  1 
ATOM 5121  C CD1 . PHE B 1 278 ? -10.496  193.491 0.180   1.00 0.00 ? 273 PHE B CD1 1 
ATOM 5122  C CD2 . PHE B 1 278 ? -9.955   195.738 -0.305  1.00 0.00 ? 273 PHE B CD2 1 
ATOM 5123  C CE1 . PHE B 1 278 ? -10.969  193.322 -1.135  1.00 0.00 ? 273 PHE B CE1 1 
ATOM 5124  C CE2 . PHE B 1 278 ? -10.535  195.639 -1.546  1.00 0.00 ? 273 PHE B CE2 1 
ATOM 5125  C CZ  . PHE B 1 278 ? -10.931  194.341 -2.054  1.00 0.00 ? 273 PHE B CZ  1 
ATOM 5126  N N   . LYS B 1 279 ? -9.636   192.819 4.538   1.00 0.00 ? 274 LYS B N   1 
ATOM 5127  C CA  . LYS B 1 279 ? -9.020   192.201 5.698   1.00 0.00 ? 274 LYS B CA  1 
ATOM 5128  C C   . LYS B 1 279 ? -8.311   190.990 5.131   1.00 0.00 ? 274 LYS B C   1 
ATOM 5129  O O   . LYS B 1 279 ? -8.431   190.703 3.976   1.00 0.00 ? 274 LYS B O   1 
ATOM 5130  C CB  . LYS B 1 279 ? -10.062  191.689 6.779   1.00 0.00 ? 274 LYS B CB  1 
ATOM 5131  C CG  . LYS B 1 279 ? -11.252  190.954 6.195   1.00 0.00 ? 274 LYS B CG  1 
ATOM 5132  C CD  . LYS B 1 279 ? -11.977  189.929 7.156   1.00 0.00 ? 274 LYS B CD  1 
ATOM 5133  C CE  . LYS B 1 279 ? -11.222  188.656 7.492   1.00 0.00 ? 274 LYS B CE  1 
ATOM 5134  N NZ  . LYS B 1 279 ? -11.866  187.926 8.530   1.00 0.00 ? 274 LYS B NZ  1 
ATOM 5135  N N   . ARG B 1 280 ? -7.533   190.258 5.932   1.00 0.00 ? 275 ARG B N   1 
ATOM 5136  C CA  . ARG B 1 280 ? -6.829   189.035 5.567   1.00 0.00 ? 275 ARG B CA  1 
ATOM 5137  C C   . ARG B 1 280 ? -7.486   187.828 6.190   1.00 0.00 ? 275 ARG B C   1 
ATOM 5138  O O   . ARG B 1 280 ? -7.949   187.886 7.385   1.00 0.00 ? 275 ARG B O   1 
ATOM 5139  C CB  . ARG B 1 280 ? -5.332   189.032 6.025   1.00 0.00 ? 275 ARG B CB  1 
ATOM 5140  C CG  . ARG B 1 280 ? -4.573   190.228 5.397   1.00 0.00 ? 275 ARG B CG  1 
ATOM 5141  C CD  . ARG B 1 280 ? -2.972   190.197 5.416   1.00 0.00 ? 275 ARG B CD  1 
ATOM 5142  N NE  . ARG B 1 280 ? -2.636   189.159 4.442   1.00 0.00 ? 275 ARG B NE  1 
ATOM 5143  C CZ  . ARG B 1 280 ? -1.460   188.993 3.823   1.00 0.00 ? 275 ARG B CZ  1 
ATOM 5144  N NH1 . ARG B 1 280 ? -0.451   189.863 3.979   1.00 0.00 ? 275 ARG B NH1 1 
ATOM 5145  N NH2 . ARG B 1 280 ? -1.413   188.135 2.864   1.00 0.00 ? 275 ARG B NH2 1 
ATOM 5146  N N   . ALA B 1 281 ? -7.658   186.704 5.457   1.00 0.00 ? 276 ALA B N   1 
ATOM 5147  C CA  . ALA B 1 281 ? -8.322   185.468 5.896   1.00 0.00 ? 276 ALA B CA  1 
ATOM 5148  C C   . ALA B 1 281 ? -7.458   184.686 6.889   1.00 0.00 ? 276 ALA B C   1 
ATOM 5149  O O   . ALA B 1 281 ? -6.259   184.843 6.986   1.00 0.00 ? 276 ALA B O   1 
ATOM 5150  C CB  . ALA B 1 281 ? -8.755   184.628 4.710   1.00 0.00 ? 276 ALA B CB  1 
ATOM 5151  N N   . SER B 1 282 ? -8.066   183.652 7.509   1.00 0.00 ? 277 SER B N   1 
ATOM 5152  C CA  . SER B 1 282 ? -7.413   182.746 8.467   1.00 0.00 ? 277 SER B CA  1 
ATOM 5153  C C   . SER B 1 282 ? -6.917   181.415 7.999   1.00 0.00 ? 277 SER B C   1 
ATOM 5154  O O   . SER B 1 282 ? -6.361   180.623 8.760   1.00 0.00 ? 277 SER B O   1 
ATOM 5155  C CB  . SER B 1 282 ? -8.116   182.540 9.778   1.00 0.00 ? 277 SER B CB  1 
ATOM 5156  O OG  . SER B 1 282 ? -8.676   183.675 10.387  1.00 0.00 ? 277 SER B OG  1 
ATOM 5157  N N   . ASN B 1 283 ? -7.153   181.144 6.737   1.00 0.00 ? 278 ASN B N   1 
ATOM 5158  C CA  . ASN B 1 283 ? -6.370   180.174 5.887   1.00 0.00 ? 278 ASN B CA  1 
ATOM 5159  C C   . ASN B 1 283 ? -4.842   180.275 5.944   1.00 0.00 ? 278 ASN B C   1 
ATOM 5160  O O   . ASN B 1 283 ? -4.162   181.202 6.489   1.00 0.00 ? 278 ASN B O   1 
ATOM 5161  C CB  . ASN B 1 283 ? -6.926   180.099 4.442   1.00 0.00 ? 278 ASN B CB  1 
ATOM 5162  C CG  . ASN B 1 283 ? -6.706   181.372 3.701   1.00 0.00 ? 278 ASN B CG  1 
ATOM 5163  O OD1 . ASN B 1 283 ? -5.637   181.954 3.799   1.00 0.00 ? 278 ASN B OD1 1 
ATOM 5164  N ND2 . ASN B 1 283 ? -7.674   181.737 2.899   1.00 0.00 ? 278 ASN B ND2 1 
ATOM 5165  N N   . ALA B 1 284 ? -4.144   179.233 5.454   1.00 0.00 ? 279 ALA B N   1 
ATOM 5166  C CA  . ALA B 1 284 ? -2.714   179.199 5.642   1.00 0.00 ? 279 ALA B CA  1 
ATOM 5167  C C   . ALA B 1 284 ? -1.949   180.190 4.726   1.00 0.00 ? 279 ALA B C   1 
ATOM 5168  O O   . ALA B 1 284 ? -0.899   180.641 5.188   1.00 0.00 ? 279 ALA B O   1 
ATOM 5169  C CB  . ALA B 1 284 ? -2.186   177.796 5.566   1.00 0.00 ? 279 ALA B CB  1 
ATOM 5170  N N   . PHE B 1 285 ? -2.544   180.500 3.537   1.00 0.00 ? 280 PHE B N   1 
ATOM 5171  C CA  . PHE B 1 285 ? -1.974   181.556 2.713   1.00 0.00 ? 280 PHE B CA  1 
ATOM 5172  C C   . PHE B 1 285 ? -2.246   182.959 3.191   1.00 0.00 ? 280 PHE B C   1 
ATOM 5173  O O   . PHE B 1 285 ? -1.699   183.953 2.681   1.00 0.00 ? 280 PHE B O   1 
ATOM 5174  C CB  . PHE B 1 285 ? -2.361   181.388 1.212   1.00 0.00 ? 280 PHE B CB  1 
ATOM 5175  C CG  . PHE B 1 285 ? -1.830   180.039 0.677   1.00 0.00 ? 280 PHE B CG  1 
ATOM 5176  C CD1 . PHE B 1 285 ? -0.454   179.796 0.383   1.00 0.00 ? 280 PHE B CD1 1 
ATOM 5177  C CD2 . PHE B 1 285 ? -2.713   179.044 0.209   1.00 0.00 ? 280 PHE B CD2 1 
ATOM 5178  C CE1 . PHE B 1 285 ? -0.049   178.735 -0.369  1.00 0.00 ? 280 PHE B CE1 1 
ATOM 5179  C CE2 . PHE B 1 285 ? -2.271   177.876 -0.435  1.00 0.00 ? 280 PHE B CE2 1 
ATOM 5180  C CZ  . PHE B 1 285 ? -0.923   177.750 -0.698  1.00 0.00 ? 280 PHE B CZ  1 
ATOM 5181  N N   . LYS B 1 286 ? -3.160   183.195 4.193   1.00 0.00 ? 281 LYS B N   1 
ATOM 5182  C CA  . LYS B 1 286 ? -3.607   184.490 4.631   1.00 0.00 ? 281 LYS B CA  1 
ATOM 5183  C C   . LYS B 1 286 ? -4.173   185.415 3.549   1.00 0.00 ? 281 LYS B C   1 
ATOM 5184  O O   . LYS B 1 286 ? -3.742   186.538 3.446   1.00 0.00 ? 281 LYS B O   1 
ATOM 5185  C CB  . LYS B 1 286 ? -2.511   185.216 5.521   1.00 0.00 ? 281 LYS B CB  1 
ATOM 5186  C CG  . LYS B 1 286 ? -2.155   184.481 6.840   1.00 0.00 ? 281 LYS B CG  1 
ATOM 5187  C CD  . LYS B 1 286 ? -0.822   183.761 6.661   1.00 0.00 ? 281 LYS B CD  1 
ATOM 5188  C CE  . LYS B 1 286 ? -0.724   182.631 7.722   1.00 0.00 ? 281 LYS B CE  1 
ATOM 5189  N NZ  . LYS B 1 286 ? 0.651    182.095 7.922   1.00 0.00 ? 281 LYS B NZ  1 
ATOM 5190  N N   . THR B 1 287 ? -5.198   184.943 2.742   1.00 0.00 ? 282 THR B N   1 
ATOM 5191  C CA  . THR B 1 287 ? -5.598   185.640 1.560   1.00 0.00 ? 282 THR B CA  1 
ATOM 5192  C C   . THR B 1 287 ? -6.683   186.680 1.905   1.00 0.00 ? 282 THR B C   1 
ATOM 5193  O O   . THR B 1 287 ? -7.581   186.519 2.733   1.00 0.00 ? 282 THR B O   1 
ATOM 5194  C CB  . THR B 1 287 ? -6.128   184.784 0.412   1.00 0.00 ? 282 THR B CB  1 
ATOM 5195  O OG1 . THR B 1 287 ? -7.192   183.926 0.774   1.00 0.00 ? 282 THR B OG1 1 
ATOM 5196  C CG2 . THR B 1 287 ? -4.952   183.920 -0.161  1.00 0.00 ? 282 THR B CG2 1 
ATOM 5197  N N   . TRP B 1 288 ? -6.498   187.835 1.199   1.00 0.00 ? 283 TRP B N   1 
ATOM 5198  C CA  . TRP B 1 288 ? -7.257   189.038 1.476   1.00 0.00 ? 283 TRP B CA  1 
ATOM 5199  C C   . TRP B 1 288 ? -8.757   188.826 1.056   1.00 0.00 ? 283 TRP B C   1 
ATOM 5200  O O   . TRP B 1 288 ? -9.122   188.162 0.139   1.00 0.00 ? 283 TRP B O   1 
ATOM 5201  C CB  . TRP B 1 288 ? -6.673   190.263 0.772   1.00 0.00 ? 283 TRP B CB  1 
ATOM 5202  C CG  . TRP B 1 288 ? -5.317   190.683 1.254   1.00 0.00 ? 283 TRP B CG  1 
ATOM 5203  C CD1 . TRP B 1 288 ? -4.101   190.142 1.094   1.00 0.00 ? 283 TRP B CD1 1 
ATOM 5204  C CD2 . TRP B 1 288 ? -5.118   191.811 2.155   1.00 0.00 ? 283 TRP B CD2 1 
ATOM 5205  N NE1 . TRP B 1 288 ? -3.123   191.007 1.578   1.00 0.00 ? 283 TRP B NE1 1 
ATOM 5206  C CE2 . TRP B 1 288 ? -3.704   191.966 2.312   1.00 0.00 ? 283 TRP B CE2 1 
ATOM 5207  C CE3 . TRP B 1 288 ? -6.078   192.718 2.697   1.00 0.00 ? 283 TRP B CE3 1 
ATOM 5208  C CZ2 . TRP B 1 288 ? -3.201   193.001 3.090   1.00 0.00 ? 283 TRP B CZ2 1 
ATOM 5209  C CZ3 . TRP B 1 288 ? -5.560   193.790 3.462   1.00 0.00 ? 283 TRP B CZ3 1 
ATOM 5210  C CH2 . TRP B 1 288 ? -4.178   193.886 3.708   1.00 0.00 ? 283 TRP B CH2 1 
ATOM 5211  N N   . SER B 1 289 ? -9.696   189.547 1.774   1.00 0.00 ? 284 SER B N   1 
ATOM 5212  C CA  . SER B 1 289 ? -11.114  189.364 1.551   1.00 0.00 ? 284 SER B CA  1 
ATOM 5213  C C   . SER B 1 289 ? -11.816  190.573 2.149   1.00 0.00 ? 284 SER B C   1 
ATOM 5214  O O   . SER B 1 289 ? -11.544  191.231 3.109   1.00 0.00 ? 284 SER B O   1 
ATOM 5215  C CB  . SER B 1 289 ? -11.633  188.064 2.210   1.00 0.00 ? 284 SER B CB  1 
ATOM 5216  O OG  . SER B 1 289 ? -13.059  187.864 2.174   1.00 0.00 ? 284 SER B OG  1 
ATOM 5217  N N   . ARG B 1 290 ? -12.935  190.914 1.435   1.00 0.00 ? 285 ARG B N   1 
ATOM 5218  C CA  . ARG B 1 290 ? -13.782  192.085 1.661   1.00 0.00 ? 285 ARG B CA  1 
ATOM 5219  C C   . ARG B 1 290 ? -15.035  191.728 2.538   1.00 0.00 ? 285 ARG B C   1 
ATOM 5220  O O   . ARG B 1 290 ? -15.810  190.831 2.244   1.00 0.00 ? 285 ARG B O   1 
ATOM 5221  C CB  . ARG B 1 290 ? -14.100  192.647 0.294   1.00 0.00 ? 285 ARG B CB  1 
ATOM 5222  C CG  . ARG B 1 290 ? -14.702  194.098 0.230   1.00 0.00 ? 285 ARG B CG  1 
ATOM 5223  C CD  . ARG B 1 290 ? -14.657  194.780 -1.126  1.00 0.00 ? 285 ARG B CD  1 
ATOM 5224  N NE  . ARG B 1 290 ? -15.089  196.194 -1.044  1.00 0.00 ? 285 ARG B NE  1 
ATOM 5225  C CZ  . ARG B 1 290 ? -14.302  197.242 -0.757  1.00 0.00 ? 285 ARG B CZ  1 
ATOM 5226  N NH1 . ARG B 1 290 ? -12.965  197.177 -0.656  1.00 0.00 ? 285 ARG B NH1 1 
ATOM 5227  N NH2 . ARG B 1 290 ? -14.819  198.458 -0.798  1.00 0.00 ? 285 ARG B NH2 1 
ATOM 5228  N N   . ARG B 1 291 ? -15.195  192.444 3.656   1.00 0.00 ? 286 ARG B N   1 
ATOM 5229  C CA  . ARG B 1 291 ? -16.342  192.296 4.526   1.00 0.00 ? 286 ARG B CA  1 
ATOM 5230  C C   . ARG B 1 291 ? -16.858  193.613 4.965   1.00 0.00 ? 286 ARG B C   1 
ATOM 5231  O O   . ARG B 1 291 ? -16.214  194.653 4.791   1.00 0.00 ? 286 ARG B O   1 
ATOM 5232  C CB  . ARG B 1 291 ? -16.056  191.343 5.767   1.00 0.00 ? 286 ARG B CB  1 
ATOM 5233  C CG  . ARG B 1 291 ? -15.980  189.898 5.348   1.00 0.00 ? 286 ARG B CG  1 
ATOM 5234  C CD  . ARG B 1 291 ? -17.244  189.417 4.718   1.00 0.00 ? 286 ARG B CD  1 
ATOM 5235  N NE  . ARG B 1 291 ? -17.145  187.953 4.358   1.00 0.00 ? 286 ARG B NE  1 
ATOM 5236  C CZ  . ARG B 1 291 ? -16.791  187.471 3.136   1.00 0.00 ? 286 ARG B CZ  1 
ATOM 5237  N NH1 . ARG B 1 291 ? -16.541  188.282 2.089   1.00 0.00 ? 286 ARG B NH1 1 
ATOM 5238  N NH2 . ARG B 1 291 ? -16.824  186.140 2.972   1.00 0.00 ? 286 ARG B NH2 1 
ATOM 5239  N N   . TRP B 1 292 ? -18.134  193.582 5.476   1.00 0.00 ? 287 TRP B N   1 
ATOM 5240  C CA  . TRP B 1 292 ? -18.827  194.865 5.860   1.00 0.00 ? 287 TRP B CA  1 
ATOM 5241  C C   . TRP B 1 292 ? -18.712  194.947 7.384   1.00 0.00 ? 287 TRP B C   1 
ATOM 5242  O O   . TRP B 1 292 ? -19.206  194.087 8.159   1.00 0.00 ? 287 TRP B O   1 
ATOM 5243  C CB  . TRP B 1 292 ? -20.280  194.918 5.297   1.00 0.00 ? 287 TRP B CB  1 
ATOM 5244  C CG  . TRP B 1 292 ? -21.111  196.048 5.804   1.00 0.00 ? 287 TRP B CG  1 
ATOM 5245  C CD1 . TRP B 1 292 ? -21.633  196.267 7.079   1.00 0.00 ? 287 TRP B CD1 1 
ATOM 5246  C CD2 . TRP B 1 292 ? -21.454  197.199 5.031   1.00 0.00 ? 287 TRP B CD2 1 
ATOM 5247  N NE1 . TRP B 1 292 ? -22.494  197.421 7.115   1.00 0.00 ? 287 TRP B NE1 1 
ATOM 5248  C CE2 . TRP B 1 292 ? -22.444  197.959 5.796   1.00 0.00 ? 287 TRP B CE2 1 
ATOM 5249  C CE3 . TRP B 1 292 ? -21.152  197.519 3.752   1.00 0.00 ? 287 TRP B CE3 1 
ATOM 5250  C CZ2 . TRP B 1 292 ? -22.994  199.126 5.246   1.00 0.00 ? 287 TRP B CZ2 1 
ATOM 5251  C CZ3 . TRP B 1 292 ? -21.623  198.770 3.219   1.00 0.00 ? 287 TRP B CZ3 1 
ATOM 5252  C CH2 . TRP B 1 292 ? -22.522  199.551 3.944   1.00 0.00 ? 287 TRP B CH2 1 
ATOM 5253  N N   . PHE B 1 293 ? -18.082  196.029 7.825   1.00 0.00 ? 288 PHE B N   1 
ATOM 5254  C CA  . PHE B 1 293 ? -17.721  196.370 9.244   1.00 0.00 ? 288 PHE B CA  1 
ATOM 5255  C C   . PHE B 1 293 ? -18.491  197.526 9.813   1.00 0.00 ? 288 PHE B C   1 
ATOM 5256  O O   . PHE B 1 293 ? -18.665  198.548 9.151   1.00 0.00 ? 288 PHE B O   1 
ATOM 5257  C CB  . PHE B 1 293 ? -16.223  196.761 9.309   1.00 0.00 ? 288 PHE B CB  1 
ATOM 5258  C CG  . PHE B 1 293 ? -15.300  195.606 9.196   1.00 0.00 ? 288 PHE B CG  1 
ATOM 5259  C CD1 . PHE B 1 293 ? -14.984  195.283 7.796   1.00 0.00 ? 288 PHE B CD1 1 
ATOM 5260  C CD2 . PHE B 1 293 ? -14.743  195.044 10.330  1.00 0.00 ? 288 PHE B CD2 1 
ATOM 5261  C CE1 . PHE B 1 293 ? -13.997  194.331 7.589   1.00 0.00 ? 288 PHE B CE1 1 
ATOM 5262  C CE2 . PHE B 1 293 ? -13.803  193.966 10.025  1.00 0.00 ? 288 PHE B CE2 1 
ATOM 5263  C CZ  . PHE B 1 293 ? -13.452  193.651 8.750   1.00 0.00 ? 288 PHE B CZ  1 
ATOM 5264  N N   . THR B 1 294 ? -18.901  197.329 11.103  1.00 0.00 ? 289 THR B N   1 
ATOM 5265  C CA  . THR B 1 294 ? -19.613  198.339 11.888  1.00 0.00 ? 289 THR B CA  1 
ATOM 5266  C C   . THR B 1 294 ? -18.869  198.784 13.157  1.00 0.00 ? 289 THR B C   1 
ATOM 5267  O O   . THR B 1 294 ? -18.515  197.952 13.881  1.00 0.00 ? 289 THR B O   1 
ATOM 5268  C CB  . THR B 1 294 ? -20.973  197.743 12.222  1.00 0.00 ? 289 THR B CB  1 
ATOM 5269  O OG1 . THR B 1 294 ? -21.826  197.516 11.063  1.00 0.00 ? 289 THR B OG1 1 
ATOM 5270  C CG2 . THR B 1 294 ? -21.864  198.648 13.109  1.00 0.00 ? 289 THR B CG2 1 
ATOM 5271  N N   . ILE B 1 295 ? -18.740  200.128 13.399  1.00 0.00 ? 290 ILE B N   1 
ATOM 5272  C CA  . ILE B 1 295 ? -18.273  200.672 14.674  1.00 0.00 ? 290 ILE B CA  1 
ATOM 5273  C C   . ILE B 1 295 ? -19.556  201.103 15.413  1.00 0.00 ? 290 ILE B C   1 
ATOM 5274  O O   . ILE B 1 295 ? -20.335  201.961 14.835  1.00 0.00 ? 290 ILE B O   1 
ATOM 5275  C CB  . ILE B 1 295 ? -17.443  201.910 14.441  1.00 0.00 ? 290 ILE B CB  1 
ATOM 5276  C CG1 . ILE B 1 295 ? -16.462  201.734 13.215  1.00 0.00 ? 290 ILE B CG1 1 
ATOM 5277  C CG2 . ILE B 1 295 ? -16.895  202.428 15.800  1.00 0.00 ? 290 ILE B CG2 1 
ATOM 5278  C CD1 . ILE B 1 295 ? -15.705  203.020 13.014  1.00 0.00 ? 290 ILE B CD1 1 
ATOM 5279  N N   . GLN B 1 296 ? -19.840  200.553 16.570  1.00 0.00 ? 291 GLN B N   1 
ATOM 5280  C CA  . GLN B 1 296 ? -20.949  200.910 17.434  1.00 0.00 ? 291 GLN B CA  1 
ATOM 5281  C C   . GLN B 1 296 ? -20.687  200.564 18.906  1.00 0.00 ? 291 GLN B C   1 
ATOM 5282  O O   . GLN B 1 296 ? -20.066  199.495 19.180  1.00 0.00 ? 291 GLN B O   1 
ATOM 5283  C CB  . GLN B 1 296 ? -22.240  200.223 17.030  1.00 0.00 ? 291 GLN B CB  1 
ATOM 5284  C CG  . GLN B 1 296 ? -22.128  198.664 16.925  1.00 0.00 ? 291 GLN B CG  1 
ATOM 5285  C CD  . GLN B 1 296 ? -23.466  198.000 16.657  1.00 0.00 ? 291 GLN B CD  1 
ATOM 5286  O OE1 . GLN B 1 296 ? -23.761  197.597 15.541  1.00 0.00 ? 291 GLN B OE1 1 
ATOM 5287  N NE2 . GLN B 1 296 ? -24.287  197.827 17.713  1.00 0.00 ? 291 GLN B NE2 1 
ATOM 5288  N N   . SER B 1 297 ? -21.166  201.364 19.867  1.00 0.00 ? 292 SER B N   1 
ATOM 5289  C CA  . SER B 1 297 ? -20.944  201.162 21.315  1.00 0.00 ? 292 SER B CA  1 
ATOM 5290  C C   . SER B 1 297 ? -19.626  200.695 21.812  1.00 0.00 ? 292 SER B C   1 
ATOM 5291  O O   . SER B 1 297 ? -19.442  199.799 22.636  1.00 0.00 ? 292 SER B O   1 
ATOM 5292  C CB  . SER B 1 297 ? -22.156  200.701 22.191  1.00 0.00 ? 292 SER B CB  1 
ATOM 5293  O OG  . SER B 1 297 ? -23.335  201.334 21.708  1.00 0.00 ? 292 SER B OG  1 
ATOM 5294  N N   . ASN B 1 298 ? -18.568  201.432 21.297  1.00 0.00 ? 293 ASN B N   1 
ATOM 5295  C CA  . ASN B 1 298 ? -17.168  201.160 21.653  1.00 0.00 ? 293 ASN B CA  1 
ATOM 5296  C C   . ASN B 1 298 ? -16.702  199.781 21.336  1.00 0.00 ? 293 ASN B C   1 
ATOM 5297  O O   . ASN B 1 298 ? -15.948  199.210 22.125  1.00 0.00 ? 293 ASN B O   1 
ATOM 5298  C CB  . ASN B 1 298 ? -16.818  201.502 23.127  1.00 0.00 ? 293 ASN B CB  1 
ATOM 5299  C CG  . ASN B 1 298 ? -17.417  202.880 23.422  1.00 0.00 ? 293 ASN B CG  1 
ATOM 5300  O OD1 . ASN B 1 298 ? -17.204  203.789 22.606  1.00 0.00 ? 293 ASN B OD1 1 
ATOM 5301  N ND2 . ASN B 1 298 ? -18.068  202.965 24.613  1.00 0.00 ? 293 ASN B ND2 1 
ATOM 5302  N N   . GLN B 1 299 ? -17.136  199.309 20.158  1.00 0.00 ? 294 GLN B N   1 
ATOM 5303  C CA  . GLN B 1 299 ? -16.904  197.947 19.655  1.00 0.00 ? 294 GLN B CA  1 
ATOM 5304  C C   . GLN B 1 299 ? -16.731  198.075 18.120  1.00 0.00 ? 294 GLN B C   1 
ATOM 5305  O O   . GLN B 1 299 ? -17.299  198.964 17.480  1.00 0.00 ? 294 GLN B O   1 
ATOM 5306  C CB  . GLN B 1 299 ? -17.947  196.979 20.237  1.00 0.00 ? 294 GLN B CB  1 
ATOM 5307  C CG  . GLN B 1 299 ? -17.743  195.501 19.907  1.00 0.00 ? 294 GLN B CG  1 
ATOM 5308  C CD  . GLN B 1 299 ? -18.609  194.627 20.728  1.00 0.00 ? 294 GLN B CD  1 
ATOM 5309  O OE1 . GLN B 1 299 ? -19.630  194.120 20.181  1.00 0.00 ? 294 GLN B OE1 1 
ATOM 5310  N NE2 . GLN B 1 299 ? -18.134  194.309 21.929  1.00 0.00 ? 294 GLN B NE2 1 
ATOM 5311  N N   . LEU B 1 300 ? -16.022  197.112 17.547  1.00 0.00 ? 295 LEU B N   1 
ATOM 5312  C CA  . LEU B 1 300 ? -15.914  196.887 16.071  1.00 0.00 ? 295 LEU B CA  1 
ATOM 5313  C C   . LEU B 1 300 ? -16.372  195.476 15.770  1.00 0.00 ? 295 LEU B C   1 
ATOM 5314  O O   . LEU B 1 300 ? -15.657  194.503 16.213  1.00 0.00 ? 295 LEU B O   1 
ATOM 5315  C CB  . LEU B 1 300 ? -14.550  197.051 15.435  1.00 0.00 ? 295 LEU B CB  1 
ATOM 5316  C CG  . LEU B 1 300 ? -14.495  197.009 13.897  1.00 0.00 ? 295 LEU B CG  1 
ATOM 5317  C CD1 . LEU B 1 300 ? -14.690  198.326 13.231  1.00 0.00 ? 295 LEU B CD1 1 
ATOM 5318  C CD2 . LEU B 1 300 ? -13.075  196.623 13.447  1.00 0.00 ? 295 LEU B CD2 1 
ATOM 5319  N N   . VAL B 1 301 ? -17.487  195.283 14.986  1.00 0.00 ? 296 VAL B N   1 
ATOM 5320  C CA  . VAL B 1 301 ? -17.968  193.938 14.556  1.00 0.00 ? 296 VAL B CA  1 
ATOM 5321  C C   . VAL B 1 301 ? -17.920  193.809 13.053  1.00 0.00 ? 296 VAL B C   1 
ATOM 5322  O O   . VAL B 1 301 ? -17.854  194.781 12.347  1.00 0.00 ? 296 VAL B O   1 
ATOM 5323  C CB  . VAL B 1 301 ? -19.373  193.862 15.096  1.00 0.00 ? 296 VAL B CB  1 
ATOM 5324  C CG1 . VAL B 1 301 ? -19.497  194.057 16.609  1.00 0.00 ? 296 VAL B CG1 1 
ATOM 5325  C CG2 . VAL B 1 301 ? -20.475  194.598 14.385  1.00 0.00 ? 296 VAL B CG2 1 
ATOM 5326  N N   . TYR B 1 302 ? -17.975  192.596 12.525  1.00 0.00 ? 297 TYR B N   1 
ATOM 5327  C CA  . TYR B 1 302 ? -18.016  192.326 11.115  1.00 0.00 ? 297 TYR B CA  1 
ATOM 5328  C C   . TYR B 1 302 ? -19.186  191.385 10.865  1.00 0.00 ? 297 TYR B C   1 
ATOM 5329  O O   . TYR B 1 302 ? -19.576  190.400 11.507  1.00 0.00 ? 297 TYR B O   1 
ATOM 5330  C CB  . TYR B 1 302 ? -16.579  191.932 10.574  1.00 0.00 ? 297 TYR B CB  1 
ATOM 5331  C CG  . TYR B 1 302 ? -16.408  190.420 10.442  1.00 0.00 ? 297 TYR B CG  1 
ATOM 5332  C CD1 . TYR B 1 302 ? -15.970  189.582 11.475  1.00 0.00 ? 297 TYR B CD1 1 
ATOM 5333  C CD2 . TYR B 1 302 ? -16.774  189.857 9.158   1.00 0.00 ? 297 TYR B CD2 1 
ATOM 5334  C CE1 . TYR B 1 302 ? -15.787  188.182 11.156  1.00 0.00 ? 297 TYR B CE1 1 
ATOM 5335  C CE2 . TYR B 1 302 ? -16.733  188.527 8.960   1.00 0.00 ? 297 TYR B CE2 1 
ATOM 5336  C CZ  . TYR B 1 302 ? -16.269  187.658 9.996   1.00 0.00 ? 297 TYR B CZ  1 
ATOM 5337  O OH  . TYR B 1 302 ? -16.130  186.281 9.679   1.00 0.00 ? 297 TYR B OH  1 
ATOM 5338  N N   . GLN B 1 303 ? -19.806  191.623 9.583   1.00 0.00 ? 298 GLN B N   1 
ATOM 5339  C CA  . GLN B 1 303 ? -21.004  190.972 9.297   1.00 0.00 ? 298 GLN B CA  1 
ATOM 5340  C C   . GLN B 1 303 ? -20.599  189.804 8.442   1.00 0.00 ? 298 GLN B C   1 
ATOM 5341  O O   . GLN B 1 303 ? -19.716  189.877 7.579   1.00 0.00 ? 298 GLN B O   1 
ATOM 5342  C CB  . GLN B 1 303 ? -21.931  191.957 8.501   1.00 0.00 ? 298 GLN B CB  1 
ATOM 5343  C CG  . GLN B 1 303 ? -23.229  191.418 7.972   1.00 0.00 ? 298 GLN B CG  1 
ATOM 5344  C CD  . GLN B 1 303 ? -24.155  192.627 7.575   1.00 0.00 ? 298 GLN B CD  1 
ATOM 5345  O OE1 . GLN B 1 303 ? -25.095  193.068 8.253   1.00 0.00 ? 298 GLN B OE1 1 
ATOM 5346  N NE2 . GLN B 1 303 ? -23.971  193.041 6.279   1.00 0.00 ? 298 GLN B NE2 1 
ATOM 5347  N N   . LYS B 1 304 ? -21.201  188.655 8.694   1.00 0.00 ? 299 LYS B N   1 
ATOM 5348  C CA  . LYS B 1 304 ? -20.795  187.405 8.087   1.00 0.00 ? 299 LYS B CA  1 
ATOM 5349  C C   . LYS B 1 304 ? -21.786  186.910 7.014   1.00 0.00 ? 299 LYS B C   1 
ATOM 5350  O O   . LYS B 1 304 ? -21.317  186.248 6.061   1.00 0.00 ? 299 LYS B O   1 
ATOM 5351  C CB  . LYS B 1 304 ? -20.454  186.339 9.237   1.00 0.00 ? 299 LYS B CB  1 
ATOM 5352  C CG  . LYS B 1 304 ? -21.554  185.602 9.951   1.00 0.00 ? 299 LYS B CG  1 
ATOM 5353  C CD  . LYS B 1 304 ? -21.110  185.045 11.246  1.00 0.00 ? 299 LYS B CD  1 
ATOM 5354  C CE  . LYS B 1 304 ? -22.133  184.123 11.970  1.00 0.00 ? 299 LYS B CE  1 
ATOM 5355  N NZ  . LYS B 1 304 ? -23.470  184.693 12.299  1.00 0.00 ? 299 LYS B NZ  1 
ATOM 5356  N N   . LYS B 1 305 ? -23.038  187.251 7.071   1.00 0.00 ? 300 LYS B N   1 
ATOM 5357  C CA  . LYS B 1 305 ? -24.008  187.248 6.050   1.00 0.00 ? 300 LYS B CA  1 
ATOM 5358  C C   . LYS B 1 305 ? -25.089  188.363 6.333   1.00 0.00 ? 300 LYS B C   1 
ATOM 5359  O O   . LYS B 1 305 ? -25.243  188.753 7.460   1.00 0.00 ? 300 LYS B O   1 
ATOM 5360  C CB  . LYS B 1 305 ? -24.546  185.771 5.921   1.00 0.00 ? 300 LYS B CB  1 
ATOM 5361  C CG  . LYS B 1 305 ? -25.691  185.546 4.987   1.00 0.00 ? 300 LYS B CG  1 
ATOM 5362  C CD  . LYS B 1 305 ? -26.264  184.070 5.009   1.00 0.00 ? 300 LYS B CD  1 
ATOM 5363  C CE  . LYS B 1 305 ? -27.548  183.844 4.176   1.00 0.00 ? 300 LYS B CE  1 
ATOM 5364  N NZ  . LYS B 1 305 ? -27.945  182.421 4.296   1.00 0.00 ? 300 LYS B NZ  1 
ATOM 5365  N N   . TYR B 1 306 ? -25.835  188.765 5.294   1.00 0.00 ? 301 TYR B N   1 
ATOM 5366  C CA  . TYR B 1 306 ? -26.939  189.704 5.470   1.00 0.00 ? 301 TYR B CA  1 
ATOM 5367  C C   . TYR B 1 306 ? -28.070  189.037 6.243   1.00 0.00 ? 301 TYR B C   1 
ATOM 5368  O O   . TYR B 1 306 ? -28.499  187.918 5.971   1.00 0.00 ? 301 TYR B O   1 
ATOM 5369  C CB  . TYR B 1 306 ? -27.374  190.199 4.120   1.00 0.00 ? 301 TYR B CB  1 
ATOM 5370  C CG  . TYR B 1 306 ? -28.388  191.293 4.131   1.00 0.00 ? 301 TYR B CG  1 
ATOM 5371  C CD1 . TYR B 1 306 ? -28.120  192.517 4.729   1.00 0.00 ? 301 TYR B CD1 1 
ATOM 5372  C CD2 . TYR B 1 306 ? -29.680  191.149 3.582   1.00 0.00 ? 301 TYR B CD2 1 
ATOM 5373  C CE1 . TYR B 1 306 ? -29.025  193.623 4.768   1.00 0.00 ? 301 TYR B CE1 1 
ATOM 5374  C CE2 . TYR B 1 306 ? -30.612  192.199 3.659   1.00 0.00 ? 301 TYR B CE2 1 
ATOM 5375  C CZ  . TYR B 1 306 ? -30.292  193.401 4.240   1.00 0.00 ? 301 TYR B CZ  1 
ATOM 5376  O OH  . TYR B 1 306 ? -31.216  194.413 4.453   1.00 0.00 ? 301 TYR B OH  1 
ATOM 5377  N N   . LYS B 1 307 ? -28.626  189.759 7.271   1.00 0.00 ? 302 LYS B N   1 
ATOM 5378  C CA  . LYS B 1 307 ? -29.646  189.156 8.138   1.00 0.00 ? 302 LYS B CA  1 
ATOM 5379  C C   . LYS B 1 307 ? -29.199  187.915 8.888   1.00 0.00 ? 302 LYS B C   1 
ATOM 5380  O O   . LYS B 1 307 ? -29.879  186.877 8.812   1.00 0.00 ? 302 LYS B O   1 
ATOM 5381  C CB  . LYS B 1 307 ? -30.994  188.854 7.462   1.00 0.00 ? 302 LYS B CB  1 
ATOM 5382  C CG  . LYS B 1 307 ? -31.542  190.147 6.838   1.00 0.00 ? 302 LYS B CG  1 
ATOM 5383  C CD  . LYS B 1 307 ? -31.829  191.250 7.850   1.00 0.00 ? 302 LYS B CD  1 
ATOM 5384  C CE  . LYS B 1 307 ? -32.439  192.481 7.178   1.00 0.00 ? 302 LYS B CE  1 
ATOM 5385  N NZ  . LYS B 1 307 ? -32.886  193.444 8.221   1.00 0.00 ? 302 LYS B NZ  1 
ATOM 5386  N N   . ASP B 1 308 ? -28.022  187.920 9.547   1.00 0.00 ? 303 ASP B N   1 
ATOM 5387  C CA  . ASP B 1 308 ? -27.600  186.783 10.334  1.00 0.00 ? 303 ASP B CA  1 
ATOM 5388  C C   . ASP B 1 308 ? -26.734  187.321 11.489  1.00 0.00 ? 303 ASP B C   1 
ATOM 5389  O O   . ASP B 1 308 ? -26.157  188.355 11.151  1.00 0.00 ? 303 ASP B O   1 
ATOM 5390  C CB  . ASP B 1 308 ? -26.634  186.050 9.257   1.00 0.00 ? 303 ASP B CB  1 
ATOM 5391  C CG  . ASP B 1 308 ? -25.975  184.714 9.678   1.00 0.00 ? 303 ASP B CG  1 
ATOM 5392  O OD1 . ASP B 1 308 ? -26.707  183.714 9.756   1.00 0.00 ? 303 ASP B OD1 1 
ATOM 5393  O OD2 . ASP B 1 308 ? -24.772  184.683 10.104  1.00 0.00 ? 303 ASP B OD2 1 
ATOM 5394  N N   . PRO B 1 309 ? -26.592  186.852 12.725  1.00 0.00 ? 304 PRO B N   1 
ATOM 5395  C CA  . PRO B 1 309 ? -25.745  187.407 13.782  1.00 0.00 ? 304 PRO B CA  1 
ATOM 5396  C C   . PRO B 1 309 ? -24.299  187.846 13.328  1.00 0.00 ? 304 PRO B C   1 
ATOM 5397  O O   . PRO B 1 309 ? -23.721  187.313 12.370  1.00 0.00 ? 304 PRO B O   1 
ATOM 5398  C CB  . PRO B 1 309 ? -25.623  186.134 14.665  1.00 0.00 ? 304 PRO B CB  1 
ATOM 5399  C CG  . PRO B 1 309 ? -27.009  185.515 14.553  1.00 0.00 ? 304 PRO B CG  1 
ATOM 5400  C CD  . PRO B 1 309 ? -27.484  185.733 13.119  1.00 0.00 ? 304 PRO B CD  1 
ATOM 5401  N N   . VAL B 1 310 ? -23.696  188.914 13.960  1.00 0.00 ? 305 VAL B N   1 
ATOM 5402  C CA  . VAL B 1 310 ? -22.429  189.495 13.609  1.00 0.00 ? 305 VAL B CA  1 
ATOM 5403  C C   . VAL B 1 310 ? -21.353  188.742 14.419  1.00 0.00 ? 305 VAL B C   1 
ATOM 5404  O O   . VAL B 1 310 ? -21.700  188.077 15.393  1.00 0.00 ? 305 VAL B O   1 
ATOM 5405  C CB  . VAL B 1 310 ? -22.322  190.935 13.896  1.00 0.00 ? 305 VAL B CB  1 
ATOM 5406  C CG1 . VAL B 1 310 ? -23.217  191.733 12.958  1.00 0.00 ? 305 VAL B CG1 1 
ATOM 5407  C CG2 . VAL B 1 310 ? -22.558  191.332 15.386  1.00 0.00 ? 305 VAL B CG2 1 
ATOM 5408  N N   . THR B 1 311 ? -20.020  188.924 14.066  1.00 0.00 ? 306 THR B N   1 
ATOM 5409  C CA  . THR B 1 311 ? -18.879  188.425 14.871  1.00 0.00 ? 306 THR B CA  1 
ATOM 5410  C C   . THR B 1 311 ? -18.040  189.678 15.270  1.00 0.00 ? 306 THR B C   1 
ATOM 5411  O O   . THR B 1 311 ? -17.933  190.620 14.453  1.00 0.00 ? 306 THR B O   1 
ATOM 5412  C CB  . THR B 1 311 ? -18.098  187.369 14.071  1.00 0.00 ? 306 THR B CB  1 
ATOM 5413  O OG1 . THR B 1 311 ? -18.936  186.250 13.816  1.00 0.00 ? 306 THR B OG1 1 
ATOM 5414  C CG2 . THR B 1 311 ? -16.841  186.895 14.811  1.00 0.00 ? 306 THR B CG2 1 
ATOM 5415  N N   . VAL B 1 312 ? -17.585  189.757 16.551  1.00 0.00 ? 307 VAL B N   1 
ATOM 5416  C CA  . VAL B 1 312 ? -16.702  190.772 17.134  1.00 0.00 ? 307 VAL B CA  1 
ATOM 5417  C C   . VAL B 1 312 ? -15.232  190.714 16.512  1.00 0.00 ? 307 VAL B C   1 
ATOM 5418  O O   . VAL B 1 312 ? -14.774  189.608 16.197  1.00 0.00 ? 307 VAL B O   1 
ATOM 5419  C CB  . VAL B 1 312 ? -16.654  190.880 18.701  1.00 0.00 ? 307 VAL B CB  1 
ATOM 5420  C CG1 . VAL B 1 312 ? -15.663  191.922 19.217  1.00 0.00 ? 307 VAL B CG1 1 
ATOM 5421  C CG2 . VAL B 1 312 ? -18.078  191.049 19.150  1.00 0.00 ? 307 VAL B CG2 1 
ATOM 5422  N N   . VAL B 1 313 ? -14.585  191.894 16.165  1.00 0.00 ? 308 VAL B N   1 
ATOM 5423  C CA  . VAL B 1 313 ? -13.281  191.933 15.619  1.00 0.00 ? 308 VAL B CA  1 
ATOM 5424  C C   . VAL B 1 313 ? -12.321  192.446 16.718  1.00 0.00 ? 308 VAL B C   1 
ATOM 5425  O O   . VAL B 1 313 ? -11.235  191.819 16.881  1.00 0.00 ? 308 VAL B O   1 
ATOM 5426  C CB  . VAL B 1 313 ? -13.222  192.931 14.448  1.00 0.00 ? 308 VAL B CB  1 
ATOM 5427  C CG1 . VAL B 1 313 ? -11.846  192.995 13.920  1.00 0.00 ? 308 VAL B CG1 1 
ATOM 5428  C CG2 . VAL B 1 313 ? -14.148  192.374 13.400  1.00 0.00 ? 308 VAL B CG2 1 
ATOM 5429  N N   . VAL B 1 314 ? -12.762  193.447 17.456  1.00 0.00 ? 309 VAL B N   1 
ATOM 5430  C CA  . VAL B 1 314 ? -11.947  193.845 18.636  1.00 0.00 ? 309 VAL B CA  1 
ATOM 5431  C C   . VAL B 1 314 ? -12.925  193.979 19.756  1.00 0.00 ? 309 VAL B C   1 
ATOM 5432  O O   . VAL B 1 314 ? -13.990  194.554 19.507  1.00 0.00 ? 309 VAL B O   1 
ATOM 5433  C CB  . VAL B 1 314 ? -11.085  195.153 18.480  1.00 0.00 ? 309 VAL B CB  1 
ATOM 5434  C CG1 . VAL B 1 314 ? -9.994   194.893 17.486  1.00 0.00 ? 309 VAL B CG1 1 
ATOM 5435  C CG2 . VAL B 1 314 ? -11.867  196.364 17.984  1.00 0.00 ? 309 VAL B CG2 1 
ATOM 5436  N N   . ASP B 1 315 ? -12.702  193.420 20.941  1.00 0.00 ? 310 ASP B N   1 
ATOM 5437  C CA  . ASP B 1 315 ? -13.602  193.415 22.086  1.00 0.00 ? 310 ASP B CA  1 
ATOM 5438  C C   . ASP B 1 315 ? -14.017  194.813 22.597  1.00 0.00 ? 310 ASP B C   1 
ATOM 5439  O O   . ASP B 1 315 ? -15.138  195.091 22.947  1.00 0.00 ? 310 ASP B O   1 
ATOM 5440  C CB  . ASP B 1 315 ? -12.825  192.817 23.290  1.00 0.00 ? 310 ASP B CB  1 
ATOM 5441  C CG  . ASP B 1 315 ? -12.789  191.237 23.298  1.00 0.00 ? 310 ASP B CG  1 
ATOM 5442  O OD1 . ASP B 1 315 ? -13.374  190.630 22.370  1.00 0.00 ? 310 ASP B OD1 1 
ATOM 5443  O OD2 . ASP B 1 315 ? -12.118  190.648 24.193  1.00 0.00 ? 310 ASP B OD2 1 
ATOM 5444  N N   . ASP B 1 316 ? -13.035  195.687 22.725  1.00 0.00 ? 311 ASP B N   1 
ATOM 5445  C CA  . ASP B 1 316 ? -13.194  197.121 23.055  1.00 0.00 ? 311 ASP B CA  1 
ATOM 5446  C C   . ASP B 1 316 ? -12.304  198.094 22.236  1.00 0.00 ? 311 ASP B C   1 
ATOM 5447  O O   . ASP B 1 316 ? -11.197  197.650 21.825  1.00 0.00 ? 311 ASP B O   1 
ATOM 5448  C CB  . ASP B 1 316 ? -12.859  197.319 24.531  1.00 0.00 ? 311 ASP B CB  1 
ATOM 5449  C CG  . ASP B 1 316 ? -13.684  198.459 25.231  1.00 0.00 ? 311 ASP B CG  1 
ATOM 5450  O OD1 . ASP B 1 316 ? -13.484  199.618 24.909  1.00 0.00 ? 311 ASP B OD1 1 
ATOM 5451  O OD2 . ASP B 1 316 ? -14.489  198.119 26.127  1.00 0.00 ? 311 ASP B OD2 1 
ATOM 5452  N N   . LEU B 1 317 ? -12.799  199.396 21.977  1.00 0.00 ? 312 LEU B N   1 
ATOM 5453  C CA  . LEU B 1 317 ? -12.055  200.377 21.212  1.00 0.00 ? 312 LEU B CA  1 
ATOM 5454  C C   . LEU B 1 317 ? -11.327  201.356 22.060  1.00 0.00 ? 312 LEU B C   1 
ATOM 5455  O O   . LEU B 1 317 ? -10.305  201.899 21.636  1.00 0.00 ? 312 LEU B O   1 
ATOM 5456  C CB  . LEU B 1 317 ? -12.809  201.062 20.069  1.00 0.00 ? 312 LEU B CB  1 
ATOM 5457  C CG  . LEU B 1 317 ? -13.503  200.148 19.064  1.00 0.00 ? 312 LEU B CG  1 
ATOM 5458  C CD1 . LEU B 1 317 ? -14.483  201.099 18.293  1.00 0.00 ? 312 LEU B CD1 1 
ATOM 5459  C CD2 . LEU B 1 317 ? -12.443  199.633 18.066  1.00 0.00 ? 312 LEU B CD2 1 
ATOM 5460  N N   . ARG B 1 318 ? -11.646  201.344 23.400  1.00 0.00 ? 313 ARG B N   1 
ATOM 5461  C CA  . ARG B 1 318 ? -11.093  202.376 24.340  1.00 0.00 ? 313 ARG B CA  1 
ATOM 5462  C C   . ARG B 1 318 ? -9.679   201.847 24.767  1.00 0.00 ? 313 ARG B C   1 
ATOM 5463  O O   . ARG B 1 318 ? -8.733   202.525 25.206  1.00 0.00 ? 313 ARG B O   1 
ATOM 5464  C CB  . ARG B 1 318 ? -12.105  202.271 25.529  1.00 0.00 ? 313 ARG B CB  1 
ATOM 5465  C CG  . ARG B 1 318 ? -13.447  202.840 25.001  1.00 0.00 ? 313 ARG B CG  1 
ATOM 5466  C CD  . ARG B 1 318 ? -14.563  202.752 26.097  1.00 0.00 ? 313 ARG B CD  1 
ATOM 5467  N NE  . ARG B 1 318 ? -15.085  201.414 26.150  1.00 0.00 ? 313 ARG B NE  1 
ATOM 5468  C CZ  . ARG B 1 318 ? -16.046  200.979 26.959  1.00 0.00 ? 313 ARG B CZ  1 
ATOM 5469  N NH1 . ARG B 1 318 ? -16.862  201.861 27.510  1.00 0.00 ? 313 ARG B NH1 1 
ATOM 5470  N NH2 . ARG B 1 318 ? -16.385  199.702 27.103  1.00 0.00 ? 313 ARG B NH2 1 
ATOM 5471  N N   . LEU B 1 319 ? -9.492   200.560 24.498  1.00 0.00 ? 314 LEU B N   1 
ATOM 5472  C CA  . LEU B 1 319 ? -8.244   199.818 24.719  1.00 0.00 ? 314 LEU B CA  1 
ATOM 5473  C C   . LEU B 1 319 ? -7.456   199.511 23.409  1.00 0.00 ? 314 LEU B C   1 
ATOM 5474  O O   . LEU B 1 319 ? -6.468   198.735 23.423  1.00 0.00 ? 314 LEU B O   1 
ATOM 5475  C CB  . LEU B 1 319 ? -8.542   198.440 25.431  1.00 0.00 ? 314 LEU B CB  1 
ATOM 5476  C CG  . LEU B 1 319 ? -9.394   198.548 26.759  1.00 0.00 ? 314 LEU B CG  1 
ATOM 5477  C CD1 . LEU B 1 319 ? -9.674   197.130 27.237  1.00 0.00 ? 314 LEU B CD1 1 
ATOM 5478  C CD2 . LEU B 1 319 ? -8.773   199.300 27.937  1.00 0.00 ? 314 LEU B CD2 1 
ATOM 5479  N N   . CYS B 1 320 ? -7.823   200.083 22.310  1.00 0.00 ? 315 CYS B N   1 
ATOM 5480  C CA  . CYS B 1 320 ? -7.181   199.954 21.028  1.00 0.00 ? 315 CYS B CA  1 
ATOM 5481  C C   . CYS B 1 320 ? -6.088   201.164 20.896  1.00 0.00 ? 315 CYS B C   1 
ATOM 5482  O O   . CYS B 1 320 ? -6.154   202.094 21.696  1.00 0.00 ? 315 CYS B O   1 
ATOM 5483  C CB  . CYS B 1 320 ? -8.255   199.982 19.875  1.00 0.00 ? 315 CYS B CB  1 
ATOM 5484  S SG  . CYS B 1 320 ? -7.794   199.135 18.351  1.00 0.00 ? 315 CYS B SG  1 
ATOM 5485  N N   . THR B 1 321 ? -5.156   200.947 19.904  1.00 0.00 ? 316 THR B N   1 
ATOM 5486  C CA  . THR B 1 321 ? -4.251   201.930 19.237  1.00 0.00 ? 316 THR B CA  1 
ATOM 5487  C C   . THR B 1 321 ? -4.411   201.729 17.756  1.00 0.00 ? 316 THR B C   1 
ATOM 5488  O O   . THR B 1 321 ? -4.892   200.711 17.280  1.00 0.00 ? 316 THR B O   1 
ATOM 5489  C CB  . THR B 1 321 ? -2.881   201.803 19.718  1.00 0.00 ? 316 THR B CB  1 
ATOM 5490  O OG1 . THR B 1 321 ? -2.114   202.923 19.339  1.00 0.00 ? 316 THR B OG1 1 
ATOM 5491  C CG2 . THR B 1 321 ? -2.144   200.528 19.311  1.00 0.00 ? 316 THR B CG2 1 
ATOM 5492  N N   . VAL B 1 322 ? -4.032   202.805 16.971  1.00 0.00 ? 317 VAL B N   1 
ATOM 5493  C CA  . VAL B 1 322 ? -4.372   202.867 15.555  1.00 0.00 ? 317 VAL B CA  1 
ATOM 5494  C C   . VAL B 1 322 ? -3.161   203.288 14.734  1.00 0.00 ? 317 VAL B C   1 
ATOM 5495  O O   . VAL B 1 322 ? -2.633   204.433 14.873  1.00 0.00 ? 317 VAL B O   1 
ATOM 5496  C CB  . VAL B 1 322 ? -5.674   203.675 15.217  1.00 0.00 ? 317 VAL B CB  1 
ATOM 5497  C CG1 . VAL B 1 322 ? -5.573   205.217 15.528  1.00 0.00 ? 317 VAL B CG1 1 
ATOM 5498  C CG2 . VAL B 1 322 ? -6.050   203.562 13.823  1.00 0.00 ? 317 VAL B CG2 1 
ATOM 5499  N N   . LYS B 1 323 ? -2.739   202.336 13.869  1.00 0.00 ? 318 LYS B N   1 
ATOM 5500  C CA  . LYS B 1 323 ? -1.479   202.372 13.111  1.00 0.00 ? 318 LYS B CA  1 
ATOM 5501  C C   . LYS B 1 323 ? -1.642   202.898 11.755  1.00 0.00 ? 318 LYS B C   1 
ATOM 5502  O O   . LYS B 1 323 ? -2.477   202.428 10.935  1.00 0.00 ? 318 LYS B O   1 
ATOM 5503  C CB  . LYS B 1 323 ? -0.919   200.932 13.038  1.00 0.00 ? 318 LYS B CB  1 
ATOM 5504  C CG  . LYS B 1 323 ? -0.428   200.441 14.330  1.00 0.00 ? 318 LYS B CG  1 
ATOM 5505  C CD  . LYS B 1 323 ? 0.158    199.094 14.150  1.00 0.00 ? 318 LYS B CD  1 
ATOM 5506  C CE  . LYS B 1 323 ? 0.946    198.587 15.387  1.00 0.00 ? 318 LYS B CE  1 
ATOM 5507  N NZ  . LYS B 1 323 ? 1.494    197.214 14.998  1.00 0.00 ? 318 LYS B NZ  1 
ATOM 5508  N N   . LEU B 1 324 ? -0.931   204.000 11.406  1.00 0.00 ? 319 LEU B N   1 
ATOM 5509  C CA  . LEU B 1 324 ? -1.119   204.654 10.133  1.00 0.00 ? 319 LEU B CA  1 
ATOM 5510  C C   . LEU B 1 324 ? -0.032   204.159 9.119   1.00 0.00 ? 319 LEU B C   1 
ATOM 5511  O O   . LEU B 1 324 ? -0.017   204.572 7.943   1.00 0.00 ? 319 LEU B O   1 
ATOM 5512  C CB  . LEU B 1 324 ? -0.792   206.200 10.189  1.00 0.00 ? 319 LEU B CB  1 
ATOM 5513  C CG  . LEU B 1 324 ? -1.961   207.010 10.892  1.00 0.00 ? 319 LEU B CG  1 
ATOM 5514  C CD1 . LEU B 1 324 ? -1.347   208.144 11.727  1.00 0.00 ? 319 LEU B CD1 1 
ATOM 5515  C CD2 . LEU B 1 324 ? -2.864   207.568 9.785   1.00 0.00 ? 319 LEU B CD2 1 
ATOM 5516  N N   . CYS B 1 325 ? 0.767    203.271 9.574   1.00 0.00 ? 320 CYS B N   1 
ATOM 5517  C CA  . CYS B 1 325 ? 1.546    202.439 8.727   1.00 0.00 ? 320 CYS B CA  1 
ATOM 5518  C C   . CYS B 1 325 ? 2.339    203.106 7.616   1.00 0.00 ? 320 CYS B C   1 
ATOM 5519  O O   . CYS B 1 325 ? 2.073    202.709 6.450   1.00 0.00 ? 320 CYS B O   1 
ATOM 5520  C CB  . CYS B 1 325 ? 0.544    201.367 8.106   1.00 0.00 ? 320 CYS B CB  1 
ATOM 5521  S SG  . CYS B 1 325 ? -0.086   200.229 9.396   1.00 0.00 ? 320 CYS B SG  1 
ATOM 5522  N N   . PRO B 1 326 ? 3.254    203.990 7.812   1.00 0.00 ? 321 PRO B N   1 
ATOM 5523  C CA  . PRO B 1 326 ? 3.802    204.784 6.705   1.00 0.00 ? 321 PRO B CA  1 
ATOM 5524  C C   . PRO B 1 326 ? 4.899    203.930 5.962   1.00 0.00 ? 321 PRO B C   1 
ATOM 5525  O O   . PRO B 1 326 ? 5.271    204.289 4.819   1.00 0.00 ? 321 PRO B O   1 
ATOM 5526  C CB  . PRO B 1 326 ? 4.465    205.954 7.540   1.00 0.00 ? 321 PRO B CB  1 
ATOM 5527  C CG  . PRO B 1 326 ? 4.874    205.317 8.864   1.00 0.00 ? 321 PRO B CG  1 
ATOM 5528  C CD  . PRO B 1 326 ? 3.748    204.359 9.186   1.00 0.00 ? 321 PRO B CD  1 
ATOM 5529  N N   . ASP B 1 327 ? 5.531    202.926 6.626   1.00 0.00 ? 322 ASP B N   1 
ATOM 5530  C CA  . ASP B 1 327 ? 6.588    202.152 6.065   1.00 0.00 ? 322 ASP B CA  1 
ATOM 5531  C C   . ASP B 1 327 ? 6.069    200.810 5.437   1.00 0.00 ? 322 ASP B C   1 
ATOM 5532  O O   . ASP B 1 327 ? 6.946    200.070 4.867   1.00 0.00 ? 322 ASP B O   1 
ATOM 5533  C CB  . ASP B 1 327 ? 7.544    201.910 7.252   1.00 0.00 ? 322 ASP B CB  1 
ATOM 5534  C CG  . ASP B 1 327 ? 8.422    203.048 7.648   1.00 0.00 ? 322 ASP B CG  1 
ATOM 5535  O OD1 . ASP B 1 327 ? 9.199    203.449 6.731   1.00 0.00 ? 322 ASP B OD1 1 
ATOM 5536  O OD2 . ASP B 1 327 ? 8.340    203.553 8.825   1.00 0.00 ? 322 ASP B OD2 1 
ATOM 5537  N N   . SER B 1 328 ? 4.769    200.479 5.617   1.00 0.00 ? 323 SER B N   1 
ATOM 5538  C CA  . SER B 1 328 ? 4.222    199.365 4.890   1.00 0.00 ? 323 SER B CA  1 
ATOM 5539  C C   . SER B 1 328 ? 4.249    199.423 3.320   1.00 0.00 ? 323 SER B C   1 
ATOM 5540  O O   . SER B 1 328 ? 4.099    200.455 2.674   1.00 0.00 ? 323 SER B O   1 
ATOM 5541  C CB  . SER B 1 328 ? 2.763    199.108 5.435   1.00 0.00 ? 323 SER B CB  1 
ATOM 5542  O OG  . SER B 1 328 ? 2.094    197.968 4.837   1.00 0.00 ? 323 SER B OG  1 
ATOM 5543  N N   . GLU B 1 329 ? 4.348    198.269 2.725   1.00 0.00 ? 324 GLU B N   1 
ATOM 5544  C CA  . GLU B 1 329 ? 4.270    198.057 1.254   1.00 0.00 ? 324 GLU B CA  1 
ATOM 5545  C C   . GLU B 1 329 ? 2.831    198.220 0.774   1.00 0.00 ? 324 GLU B C   1 
ATOM 5546  O O   . GLU B 1 329 ? 2.550    198.907 -0.211  1.00 0.00 ? 324 GLU B O   1 
ATOM 5547  C CB  . GLU B 1 329 ? 4.596    196.568 0.879   1.00 0.00 ? 324 GLU B CB  1 
ATOM 5548  C CG  . GLU B 1 329 ? 4.598    196.201 -0.624  1.00 0.00 ? 324 GLU B CG  1 
ATOM 5549  C CD  . GLU B 1 329 ? 5.942    196.460 -1.251  1.00 0.00 ? 324 GLU B CD  1 
ATOM 5550  O OE1 . GLU B 1 329 ? 6.563    197.548 -1.094  1.00 0.00 ? 324 GLU B OE1 1 
ATOM 5551  O OE2 . GLU B 1 329 ? 6.386    195.502 -1.911  1.00 0.00 ? 324 GLU B OE2 1 
ATOM 5552  N N   . ARG B 1 330 ? 1.833    197.658 1.540   1.00 0.00 ? 325 ARG B N   1 
ATOM 5553  C CA  . ARG B 1 330 ? 0.472    197.691 1.267   1.00 0.00 ? 325 ARG B CA  1 
ATOM 5554  C C   . ARG B 1 330 ? -0.077   199.105 1.301   1.00 0.00 ? 325 ARG B C   1 
ATOM 5555  O O   . ARG B 1 330 ? 0.273    199.840 2.211   1.00 0.00 ? 325 ARG B O   1 
ATOM 5556  C CB  . ARG B 1 330 ? -0.173   196.670 2.344   1.00 0.00 ? 325 ARG B CB  1 
ATOM 5557  C CG  . ARG B 1 330 ? -1.559   196.014 2.196   1.00 0.00 ? 325 ARG B CG  1 
ATOM 5558  C CD  . ARG B 1 330 ? -1.527   195.078 0.958   1.00 0.00 ? 325 ARG B CD  1 
ATOM 5559  N NE  . ARG B 1 330 ? -2.943   194.751 0.439   1.00 0.00 ? 325 ARG B NE  1 
ATOM 5560  C CZ  . ARG B 1 330 ? -3.221   193.877 -0.569  1.00 0.00 ? 325 ARG B CZ  1 
ATOM 5561  N NH1 . ARG B 1 330 ? -2.349   193.147 -1.200  1.00 0.00 ? 325 ARG B NH1 1 
ATOM 5562  N NH2 . ARG B 1 330 ? -4.509   193.786 -0.895  1.00 0.00 ? 325 ARG B NH2 1 
ATOM 5563  N N   . ARG B 1 331 ? -1.059   199.454 0.368   1.00 0.00 ? 326 ARG B N   1 
ATOM 5564  C CA  . ARG B 1 331 ? -1.514   200.766 0.134   1.00 0.00 ? 326 ARG B CA  1 
ATOM 5565  C C   . ARG B 1 331 ? -2.869   201.048 0.838   1.00 0.00 ? 326 ARG B C   1 
ATOM 5566  O O   . ARG B 1 331 ? -3.746   200.209 0.694   1.00 0.00 ? 326 ARG B O   1 
ATOM 5567  C CB  . ARG B 1 331 ? -1.792   200.928 -1.418  1.00 0.00 ? 326 ARG B CB  1 
ATOM 5568  C CG  . ARG B 1 331 ? -2.118   202.356 -1.746  1.00 0.00 ? 326 ARG B CG  1 
ATOM 5569  C CD  . ARG B 1 331 ? -2.041   202.695 -3.246  1.00 0.00 ? 326 ARG B CD  1 
ATOM 5570  N NE  . ARG B 1 331 ? -3.203   201.970 -3.885  1.00 0.00 ? 326 ARG B NE  1 
ATOM 5571  C CZ  . ARG B 1 331 ? -4.079   202.378 -4.868  1.00 0.00 ? 326 ARG B CZ  1 
ATOM 5572  N NH1 . ARG B 1 331 ? -3.829   203.444 -5.549  1.00 0.00 ? 326 ARG B NH1 1 
ATOM 5573  N NH2 . ARG B 1 331 ? -5.168   201.735 -5.092  1.00 0.00 ? 326 ARG B NH2 1 
ATOM 5574  N N   . PHE B 1 332 ? -3.090   202.167 1.538   1.00 0.00 ? 327 PHE B N   1 
ATOM 5575  C CA  . PHE B 1 332 ? -4.340   202.654 2.091   1.00 0.00 ? 327 PHE B CA  1 
ATOM 5576  C C   . PHE B 1 332 ? -4.637   201.783 3.283   1.00 0.00 ? 327 PHE B C   1 
ATOM 5577  O O   . PHE B 1 332 ? -5.802   201.642 3.697   1.00 0.00 ? 327 PHE B O   1 
ATOM 5578  C CB  . PHE B 1 332 ? -5.606   202.617 1.163   1.00 0.00 ? 327 PHE B CB  1 
ATOM 5579  C CG  . PHE B 1 332 ? -5.490   203.496 -0.121  1.00 0.00 ? 327 PHE B CG  1 
ATOM 5580  C CD1 . PHE B 1 332 ? -4.640   204.590 -0.237  1.00 0.00 ? 327 PHE B CD1 1 
ATOM 5581  C CD2 . PHE B 1 332 ? -6.314   203.125 -1.198  1.00 0.00 ? 327 PHE B CD2 1 
ATOM 5582  C CE1 . PHE B 1 332 ? -4.526   205.155 -1.508  1.00 0.00 ? 327 PHE B CE1 1 
ATOM 5583  C CE2 . PHE B 1 332 ? -6.179   203.742 -2.435  1.00 0.00 ? 327 PHE B CE2 1 
ATOM 5584  C CZ  . PHE B 1 332 ? -5.274   204.745 -2.655  1.00 0.00 ? 327 PHE B CZ  1 
ATOM 5585  N N   . CYS B 1 333 ? -3.646   201.157 3.910   1.00 0.00 ? 328 CYS B N   1 
ATOM 5586  C CA  . CYS B 1 333 ? -3.893   200.259 5.044   1.00 0.00 ? 328 CYS B CA  1 
ATOM 5587  C C   . CYS B 1 333 ? -3.711   200.865 6.394   1.00 0.00 ? 328 CYS B C   1 
ATOM 5588  O O   . CYS B 1 333 ? -2.943   201.806 6.627   1.00 0.00 ? 328 CYS B O   1 
ATOM 5589  C CB  . CYS B 1 333 ? -2.897   199.074 4.934   1.00 0.00 ? 328 CYS B CB  1 
ATOM 5590  S SG  . CYS B 1 333 ? -1.154   199.424 4.933   1.00 0.00 ? 328 CYS B SG  1 
ATOM 5591  N N   . PHE B 1 334 ? -4.400   200.310 7.384   1.00 0.00 ? 329 PHE B N   1 
ATOM 5592  C CA  . PHE B 1 334 ? -4.211   200.685 8.791   1.00 0.00 ? 329 PHE B CA  1 
ATOM 5593  C C   . PHE B 1 334 ? -4.209   199.409 9.563   1.00 0.00 ? 329 PHE B C   1 
ATOM 5594  O O   . PHE B 1 334 ? -4.727   198.328 9.090   1.00 0.00 ? 329 PHE B O   1 
ATOM 5595  C CB  . PHE B 1 334 ? -5.290   201.722 9.386   1.00 0.00 ? 329 PHE B CB  1 
ATOM 5596  C CG  . PHE B 1 334 ? -6.779   201.392 9.278   1.00 0.00 ? 329 PHE B CG  1 
ATOM 5597  C CD1 . PHE B 1 334 ? -7.393   201.399 7.999   1.00 0.00 ? 329 PHE B CD1 1 
ATOM 5598  C CD2 . PHE B 1 334 ? -7.577   201.039 10.386  1.00 0.00 ? 329 PHE B CD2 1 
ATOM 5599  C CE1 . PHE B 1 334 ? -8.788   201.118 7.852   1.00 0.00 ? 329 PHE B CE1 1 
ATOM 5600  C CE2 . PHE B 1 334 ? -8.968   200.905 10.261  1.00 0.00 ? 329 PHE B CE2 1 
ATOM 5601  C CZ  . PHE B 1 334 ? -9.533   200.877 9.003   1.00 0.00 ? 329 PHE B CZ  1 
ATOM 5602  N N   . GLU B 1 335 ? -3.748   199.437 10.780  1.00 0.00 ? 330 GLU B N   1 
ATOM 5603  C CA  . GLU B 1 335 ? -3.823   198.341 11.721  1.00 0.00 ? 330 GLU B CA  1 
ATOM 5604  C C   . GLU B 1 335 ? -4.443   198.786 13.083  1.00 0.00 ? 330 GLU B C   1 
ATOM 5605  O O   . GLU B 1 335 ? -4.015   199.719 13.748  1.00 0.00 ? 330 GLU B O   1 
ATOM 5606  C CB  . GLU B 1 335 ? -2.444   197.610 11.840  1.00 0.00 ? 330 GLU B CB  1 
ATOM 5607  C CG  . GLU B 1 335 ? -2.472   196.383 12.694  1.00 0.00 ? 330 GLU B CG  1 
ATOM 5608  C CD  . GLU B 1 335 ? -1.070   195.761 12.857  1.00 0.00 ? 330 GLU B CD  1 
ATOM 5609  O OE1 . GLU B 1 335 ? -0.570   195.283 11.802  1.00 0.00 ? 330 GLU B OE1 1 
ATOM 5610  O OE2 . GLU B 1 335 ? -0.462   195.647 13.956  1.00 0.00 ? 330 GLU B OE2 1 
ATOM 5611  N N   . VAL B 1 336 ? -5.451   198.029 13.557  1.00 0.00 ? 331 VAL B N   1 
ATOM 5612  C CA  . VAL B 1 336 ? -6.066   198.278 14.866  1.00 0.00 ? 331 VAL B CA  1 
ATOM 5613  C C   . VAL B 1 336 ? -5.601   197.115 15.768  1.00 0.00 ? 331 VAL B C   1 
ATOM 5614  O O   . VAL B 1 336 ? -5.750   195.932 15.520  1.00 0.00 ? 331 VAL B O   1 
ATOM 5615  C CB  . VAL B 1 336 ? -7.614   198.359 14.834  1.00 0.00 ? 331 VAL B CB  1 
ATOM 5616  C CG1 . VAL B 1 336 ? -7.997   199.856 14.409  1.00 0.00 ? 331 VAL B CG1 1 
ATOM 5617  C CG2 . VAL B 1 336 ? -8.264   197.366 13.862  1.00 0.00 ? 331 VAL B CG2 1 
ATOM 5618  N N   . VAL B 1 337 ? -4.897   197.520 16.782  1.00 0.00 ? 332 VAL B N   1 
ATOM 5619  C CA  . VAL B 1 337 ? -4.309   196.612 17.783  1.00 0.00 ? 332 VAL B CA  1 
ATOM 5620  C C   . VAL B 1 337 ? -4.873   196.785 19.156  1.00 0.00 ? 332 VAL B C   1 
ATOM 5621  O O   . VAL B 1 337 ? -4.785   197.857 19.790  1.00 0.00 ? 332 VAL B O   1 
ATOM 5622  C CB  . VAL B 1 337 ? -2.838   196.951 17.881  1.00 0.00 ? 332 VAL B CB  1 
ATOM 5623  C CG1 . VAL B 1 337 ? -2.171   195.775 18.758  1.00 0.00 ? 332 VAL B CG1 1 
ATOM 5624  C CG2 . VAL B 1 337 ? -2.159   196.979 16.479  1.00 0.00 ? 332 VAL B CG2 1 
ATOM 5625  N N   . SER B 1 338 ? -5.633   195.827 19.659  1.00 0.00 ? 333 SER B N   1 
ATOM 5626  C CA  . SER B 1 338 ? -6.335   195.931 21.016  1.00 0.00 ? 333 SER B CA  1 
ATOM 5627  C C   . SER B 1 338 ? -5.766   194.815 21.936  1.00 0.00 ? 333 SER B C   1 
ATOM 5628  O O   . SER B 1 338 ? -5.026   193.882 21.478  1.00 0.00 ? 333 SER B O   1 
ATOM 5629  C CB  . SER B 1 338 ? -7.871   195.742 20.814  1.00 0.00 ? 333 SER B CB  1 
ATOM 5630  O OG  . SER B 1 338 ? -8.548   196.431 21.858  1.00 0.00 ? 333 SER B OG  1 
ATOM 5631  N N   . THR B 1 339 ? -6.022   194.877 23.299  1.00 0.00 ? 334 THR B N   1 
ATOM 5632  C CA  . THR B 1 339 ? -5.478   193.884 24.183  1.00 0.00 ? 334 THR B CA  1 
ATOM 5633  C C   . THR B 1 339 ? -5.741   192.425 23.865  1.00 0.00 ? 334 THR B C   1 
ATOM 5634  O O   . THR B 1 339 ? -4.825   191.634 23.982  1.00 0.00 ? 334 THR B O   1 
ATOM 5635  C CB  . THR B 1 339 ? -5.906   194.131 25.681  1.00 0.00 ? 334 THR B CB  1 
ATOM 5636  O OG1 . THR B 1 339 ? -7.288   194.300 25.852  1.00 0.00 ? 334 THR B OG1 1 
ATOM 5637  C CG2 . THR B 1 339 ? -5.144   195.289 26.150  1.00 0.00 ? 334 THR B CG2 1 
ATOM 5638  N N   . SER B 1 340 ? -6.999   191.984 23.565  1.00 0.00 ? 335 SER B N   1 
ATOM 5639  C CA  . SER B 1 340 ? -7.218   190.614 23.294  1.00 0.00 ? 335 SER B CA  1 
ATOM 5640  C C   . SER B 1 340 ? -7.018   190.230 21.827  1.00 0.00 ? 335 SER B C   1 
ATOM 5641  O O   . SER B 1 340 ? -6.515   189.183 21.463  1.00 0.00 ? 335 SER B O   1 
ATOM 5642  C CB  . SER B 1 340 ? -8.621   190.215 23.734  1.00 0.00 ? 335 SER B CB  1 
ATOM 5643  O OG  . SER B 1 340 ? -9.603   191.001 23.156  1.00 0.00 ? 335 SER B OG  1 
ATOM 5644  N N   . LYS B 1 341 ? -7.259   191.230 20.933  1.00 0.00 ? 336 LYS B N   1 
ATOM 5645  C CA  . LYS B 1 341 ? -7.314   191.006 19.519  1.00 0.00 ? 336 LYS B CA  1 
ATOM 5646  C C   . LYS B 1 341 ? -6.790   192.189 18.669  1.00 0.00 ? 336 LYS B C   1 
ATOM 5647  O O   . LYS B 1 341 ? -6.925   193.332 18.928  1.00 0.00 ? 336 LYS B O   1 
ATOM 5648  C CB  . LYS B 1 341 ? -8.799   190.821 19.082  1.00 0.00 ? 336 LYS B CB  1 
ATOM 5649  C CG  . LYS B 1 341 ? -9.430   189.561 19.717  1.00 0.00 ? 336 LYS B CG  1 
ATOM 5650  C CD  . LYS B 1 341 ? -10.928  189.614 19.720  1.00 0.00 ? 336 LYS B CD  1 
ATOM 5651  C CE  . LYS B 1 341 ? -11.523  188.400 20.458  1.00 0.00 ? 336 LYS B CE  1 
ATOM 5652  N NZ  . LYS B 1 341 ? -12.951  188.366 20.662  1.00 0.00 ? 336 LYS B NZ  1 
ATOM 5653  N N   . SER B 1 342 ? -6.075   191.903 17.561  1.00 0.00 ? 337 SER B N   1 
ATOM 5654  C CA  . SER B 1 342 ? -5.655   192.771 16.488  1.00 0.00 ? 337 SER B CA  1 
ATOM 5655  C C   . SER B 1 342 ? -6.281   192.498 15.128  1.00 0.00 ? 337 SER B C   1 
ATOM 5656  O O   . SER B 1 342 ? -6.829   191.422 14.892  1.00 0.00 ? 337 SER B O   1 
ATOM 5657  C CB  . SER B 1 342 ? -4.003   192.729 16.392  1.00 0.00 ? 337 SER B CB  1 
ATOM 5658  O OG  . SER B 1 342 ? -3.548   193.884 15.692  1.00 0.00 ? 337 SER B OG  1 
ATOM 5659  N N   . CYS B 1 343 ? -6.294   193.477 14.170  1.00 0.00 ? 338 CYS B N   1 
ATOM 5660  C CA  . CYS B 1 343 ? -6.852   193.183 12.876  1.00 0.00 ? 338 CYS B CA  1 
ATOM 5661  C C   . CYS B 1 343 ? -6.077   194.209 11.939  1.00 0.00 ? 338 CYS B C   1 
ATOM 5662  O O   . CYS B 1 343 ? -6.054   195.430 12.178  1.00 0.00 ? 338 CYS B O   1 
ATOM 5663  C CB  . CYS B 1 343 ? -8.354   193.273 12.843  1.00 0.00 ? 338 CYS B CB  1 
ATOM 5664  S SG  . CYS B 1 343 ? -9.026   192.772 11.299  1.00 0.00 ? 338 CYS B SG  1 
ATOM 5665  N N   . LEU B 1 344 ? -5.472   193.715 10.833  1.00 0.00 ? 339 LEU B N   1 
ATOM 5666  C CA  . LEU B 1 344 ? -4.981   194.550 9.737   1.00 0.00 ? 339 LEU B CA  1 
ATOM 5667  C C   . LEU B 1 344 ? -6.201   194.880 8.888   1.00 0.00 ? 339 LEU B C   1 
ATOM 5668  O O   . LEU B 1 344 ? -7.101   194.064 8.737   1.00 0.00 ? 339 LEU B O   1 
ATOM 5669  C CB  . LEU B 1 344 ? -3.995   193.770 8.831   1.00 0.00 ? 339 LEU B CB  1 
ATOM 5670  C CG  . LEU B 1 344 ? -3.231   194.691 7.862   1.00 0.00 ? 339 LEU B CG  1 
ATOM 5671  C CD1 . LEU B 1 344 ? -2.318   195.699 8.544   1.00 0.00 ? 339 LEU B CD1 1 
ATOM 5672  C CD2 . LEU B 1 344 ? -2.394   193.870 6.939   1.00 0.00 ? 339 LEU B CD2 1 
ATOM 5673  N N   . LEU B 1 345 ? -6.279   196.032 8.259   1.00 0.00 ? 340 LEU B N   1 
ATOM 5674  C CA  . LEU B 1 345 ? -7.440   196.273 7.406   1.00 0.00 ? 340 LEU B CA  1 
ATOM 5675  C C   . LEU B 1 345 ? -6.880   197.197 6.356   1.00 0.00 ? 340 LEU B C   1 
ATOM 5676  O O   . LEU B 1 345 ? -5.773   197.778 6.467   1.00 0.00 ? 340 LEU B O   1 
ATOM 5677  C CB  . LEU B 1 345 ? -8.661   196.905 8.107   1.00 0.00 ? 340 LEU B CB  1 
ATOM 5678  C CG  . LEU B 1 345 ? -9.397   196.261 9.271   1.00 0.00 ? 340 LEU B CG  1 
ATOM 5679  C CD1 . LEU B 1 345 ? -9.746   197.237 10.352  1.00 0.00 ? 340 LEU B CD1 1 
ATOM 5680  C CD2 . LEU B 1 345 ? -10.577  195.431 8.813   1.00 0.00 ? 340 LEU B CD2 1 
ATOM 5681  N N   . GLN B 1 346 ? -7.661   197.305 5.212   1.00 0.00 ? 341 GLN B N   1 
ATOM 5682  C CA  . GLN B 1 346 ? -7.205   198.012 4.006   1.00 0.00 ? 341 GLN B CA  1 
ATOM 5683  C C   . GLN B 1 346 ? -8.520   198.647 3.369   1.00 0.00 ? 341 GLN B C   1 
ATOM 5684  O O   . GLN B 1 346 ? -9.577   198.041 3.299   1.00 0.00 ? 341 GLN B O   1 
ATOM 5685  C CB  . GLN B 1 346 ? -6.496   197.063 2.945   1.00 0.00 ? 341 GLN B CB  1 
ATOM 5686  C CG  . GLN B 1 346 ? -5.886   197.887 1.737   1.00 0.00 ? 341 GLN B CG  1 
ATOM 5687  C CD  . GLN B 1 346 ? -5.408   196.998 0.595   1.00 0.00 ? 341 GLN B CD  1 
ATOM 5688  O OE1 . GLN B 1 346 ? -5.670   195.793 0.725   1.00 0.00 ? 341 GLN B OE1 1 
ATOM 5689  N NE2 . GLN B 1 346 ? -4.607   197.551 -0.358  1.00 0.00 ? 341 GLN B NE2 1 
ATOM 5690  N N   . ALA B 1 347 ? -8.476   199.919 2.982   1.00 0.00 ? 342 ALA B N   1 
ATOM 5691  C CA  . ALA B 1 347 ? -9.648   200.689 2.459   1.00 0.00 ? 342 ALA B CA  1 
ATOM 5692  C C   . ALA B 1 347 ? -9.322   201.145 1.003   1.00 0.00 ? 342 ALA B C   1 
ATOM 5693  O O   . ALA B 1 347 ? -8.247   200.869 0.487   1.00 0.00 ? 342 ALA B O   1 
ATOM 5694  C CB  . ALA B 1 347 ? -9.890   201.959 3.380   1.00 0.00 ? 342 ALA B CB  1 
ATOM 5695  N N   . ASP B 1 348 ? -10.285  201.870 0.282   1.00 0.00 ? 343 ASP B N   1 
ATOM 5696  C CA  . ASP B 1 348 ? -10.294  202.009 -1.176  1.00 0.00 ? 343 ASP B CA  1 
ATOM 5697  C C   . ASP B 1 348 ? -9.747   203.333 -1.586  1.00 0.00 ? 343 ASP B C   1 
ATOM 5698  O O   . ASP B 1 348 ? -9.471   203.543 -2.758  1.00 0.00 ? 343 ASP B O   1 
ATOM 5699  C CB  . ASP B 1 348 ? -11.782  201.805 -1.694  1.00 0.00 ? 343 ASP B CB  1 
ATOM 5700  C CG  . ASP B 1 348 ? -12.476  200.542 -1.248  1.00 0.00 ? 343 ASP B CG  1 
ATOM 5701  O OD1 . ASP B 1 348 ? -12.050  199.508 -1.799  1.00 0.00 ? 343 ASP B OD1 1 
ATOM 5702  O OD2 . ASP B 1 348 ? -13.410  200.547 -0.467  1.00 0.00 ? 343 ASP B OD2 1 
ATOM 5703  N N   . SER B 1 349 ? -9.436   204.212 -0.648  1.00 0.00 ? 344 SER B N   1 
ATOM 5704  C CA  . SER B 1 349 ? -9.054   205.554 -0.943  1.00 0.00 ? 344 SER B CA  1 
ATOM 5705  C C   . SER B 1 349 ? -8.266   206.071 0.232   1.00 0.00 ? 344 SER B C   1 
ATOM 5706  O O   . SER B 1 349 ? -8.369   205.533 1.318   1.00 0.00 ? 344 SER B O   1 
ATOM 5707  C CB  . SER B 1 349 ? -10.200  206.500 -1.396  1.00 0.00 ? 344 SER B CB  1 
ATOM 5708  O OG  . SER B 1 349 ? -11.038  207.062 -0.369  1.00 0.00 ? 344 SER B OG  1 
ATOM 5709  N N   . GLU B 1 350 ? -7.474   207.171 0.094   1.00 0.00 ? 345 GLU B N   1 
ATOM 5710  C CA  . GLU B 1 350 ? -6.725   207.882 1.143   1.00 0.00 ? 345 GLU B CA  1 
ATOM 5711  C C   . GLU B 1 350 ? -7.786   208.625 2.014   1.00 0.00 ? 345 GLU B C   1 
ATOM 5712  O O   . GLU B 1 350 ? -7.712   208.610 3.288   1.00 0.00 ? 345 GLU B O   1 
ATOM 5713  C CB  . GLU B 1 350 ? -5.725   208.949 0.624   1.00 0.00 ? 345 GLU B CB  1 
ATOM 5714  C CG  . GLU B 1 350 ? -4.567   208.389 -0.293  1.00 0.00 ? 345 GLU B CG  1 
ATOM 5715  C CD  . GLU B 1 350 ? -3.335   209.310 -0.314  1.00 0.00 ? 345 GLU B CD  1 
ATOM 5716  O OE1 . GLU B 1 350 ? -2.581   209.283 0.671   1.00 0.00 ? 345 GLU B OE1 1 
ATOM 5717  O OE2 . GLU B 1 350 ? -3.135   209.996 -1.355  1.00 0.00 ? 345 GLU B OE2 1 
ATOM 5718  N N   . ARG B 1 351 ? -8.874   209.181 1.464   1.00 0.00 ? 346 ARG B N   1 
ATOM 5719  C CA  . ARG B 1 351 ? -10.002  209.623 2.222   1.00 0.00 ? 346 ARG B CA  1 
ATOM 5720  C C   . ARG B 1 351 ? -10.571  208.589 3.185   1.00 0.00 ? 346 ARG B C   1 
ATOM 5721  O O   . ARG B 1 351 ? -10.742  208.893 4.368   1.00 0.00 ? 346 ARG B O   1 
ATOM 5722  C CB  . ARG B 1 351 ? -11.096  210.224 1.307   1.00 0.00 ? 346 ARG B CB  1 
ATOM 5723  C CG  . ARG B 1 351 ? -12.455  210.517 1.983   1.00 0.00 ? 346 ARG B CG  1 
ATOM 5724  C CD  . ARG B 1 351 ? -12.403  211.579 3.185   1.00 0.00 ? 346 ARG B CD  1 
ATOM 5725  N NE  . ARG B 1 351 ? -13.773  211.949 3.678   1.00 0.00 ? 346 ARG B NE  1 
ATOM 5726  C CZ  . ARG B 1 351 ? -14.032  212.679 4.769   1.00 0.00 ? 346 ARG B CZ  1 
ATOM 5727  N NH1 . ARG B 1 351 ? -13.155  212.906 5.723   1.00 0.00 ? 346 ARG B NH1 1 
ATOM 5728  N NH2 . ARG B 1 351 ? -15.143  213.337 4.841   1.00 0.00 ? 346 ARG B NH2 1 
ATOM 5729  N N   . LEU B 1 352 ? -10.825  207.407 2.673   1.00 0.00 ? 347 LEU B N   1 
ATOM 5730  C CA  . LEU B 1 352 ? -11.390  206.375 3.545   1.00 0.00 ? 347 LEU B CA  1 
ATOM 5731  C C   . LEU B 1 352 ? -10.498  205.817 4.678   1.00 0.00 ? 347 LEU B C   1 
ATOM 5732  O O   . LEU B 1 352 ? -10.947  205.347 5.707   1.00 0.00 ? 347 LEU B O   1 
ATOM 5733  C CB  . LEU B 1 352 ? -11.911  205.211 2.646   1.00 0.00 ? 347 LEU B CB  1 
ATOM 5734  C CG  . LEU B 1 352 ? -13.112  205.606 1.749   1.00 0.00 ? 347 LEU B CG  1 
ATOM 5735  C CD1 . LEU B 1 352 ? -13.359  204.483 0.778   1.00 0.00 ? 347 LEU B CD1 1 
ATOM 5736  C CD2 . LEU B 1 352 ? -14.424  205.904 2.540   1.00 0.00 ? 347 LEU B CD2 1 
ATOM 5737  N N   . LEU B 1 353 ? -9.131   205.886 4.434   1.00 0.00 ? 348 LEU B N   1 
ATOM 5738  C CA  . LEU B 1 353 ? -8.173   205.503 5.436   1.00 0.00 ? 348 LEU B CA  1 
ATOM 5739  C C   . LEU B 1 353 ? -8.293   206.406 6.627   1.00 0.00 ? 348 LEU B C   1 
ATOM 5740  O O   . LEU B 1 353 ? -8.488   206.035 7.756   1.00 0.00 ? 348 LEU B O   1 
ATOM 5741  C CB  . LEU B 1 353 ? -6.759   205.590 4.857   1.00 0.00 ? 348 LEU B CB  1 
ATOM 5742  C CG  . LEU B 1 353 ? -5.552   205.555 5.857   1.00 0.00 ? 348 LEU B CG  1 
ATOM 5743  C CD1 . LEU B 1 353 ? -5.593   204.246 6.676   1.00 0.00 ? 348 LEU B CD1 1 
ATOM 5744  C CD2 . LEU B 1 353 ? -4.220   205.740 5.141   1.00 0.00 ? 348 LEU B CD2 1 
ATOM 5745  N N   . GLN B 1 354 ? -8.269   207.728 6.370   1.00 0.00 ? 349 GLN B N   1 
ATOM 5746  C CA  . GLN B 1 354 ? -8.201   208.798 7.326   1.00 0.00 ? 349 GLN B CA  1 
ATOM 5747  C C   . GLN B 1 354 ? -9.502   208.961 8.144   1.00 0.00 ? 349 GLN B C   1 
ATOM 5748  O O   . GLN B 1 354 ? -9.440   209.317 9.344   1.00 0.00 ? 349 GLN B O   1 
ATOM 5749  C CB  . GLN B 1 354 ? -8.036   210.180 6.596   1.00 0.00 ? 349 GLN B CB  1 
ATOM 5750  C CG  . GLN B 1 354 ? -6.648   210.256 5.948   1.00 0.00 ? 349 GLN B CG  1 
ATOM 5751  C CD  . GLN B 1 354 ? -6.458   211.580 5.274   1.00 0.00 ? 349 GLN B CD  1 
ATOM 5752  O OE1 . GLN B 1 354 ? -7.395   212.351 5.090   1.00 0.00 ? 349 GLN B OE1 1 
ATOM 5753  N NE2 . GLN B 1 354 ? -5.230   211.946 4.779   1.00 0.00 ? 349 GLN B NE2 1 
ATOM 5754  N N   . LEU B 1 355 ? -10.610  208.735 7.465   1.00 0.00 ? 350 LEU B N   1 
ATOM 5755  C CA  . LEU B 1 355 ? -11.948  208.670 8.012   1.00 0.00 ? 350 LEU B CA  1 
ATOM 5756  C C   . LEU B 1 355 ? -12.156  207.389 8.898   1.00 0.00 ? 350 LEU B C   1 
ATOM 5757  O O   . LEU B 1 355 ? -12.590  207.496 10.030  1.00 0.00 ? 350 LEU B O   1 
ATOM 5758  C CB  . LEU B 1 355 ? -12.962  208.666 6.845   1.00 0.00 ? 350 LEU B CB  1 
ATOM 5759  C CG  . LEU B 1 355 ? -14.370  208.875 7.364   1.00 0.00 ? 350 LEU B CG  1 
ATOM 5760  C CD1 . LEU B 1 355 ? -14.729  210.383 7.661   1.00 0.00 ? 350 LEU B CD1 1 
ATOM 5761  C CD2 . LEU B 1 355 ? -15.450  208.142 6.585   1.00 0.00 ? 350 LEU B CD2 1 
ATOM 5762  N N   . TRP B 1 356 ? -11.712  206.165 8.464   1.00 0.00 ? 351 TRP B N   1 
ATOM 5763  C CA  . TRP B 1 356 ? -11.703  204.945 9.336   1.00 0.00 ? 351 TRP B CA  1 
ATOM 5764  C C   . TRP B 1 356 ? -10.662  205.042 10.465  1.00 0.00 ? 351 TRP B C   1 
ATOM 5765  O O   . TRP B 1 356 ? -10.876  204.575 11.602  1.00 0.00 ? 351 TRP B O   1 
ATOM 5766  C CB  . TRP B 1 356 ? -11.442  203.699 8.464   1.00 0.00 ? 351 TRP B CB  1 
ATOM 5767  C CG  . TRP B 1 356 ? -12.701  203.206 7.755   1.00 0.00 ? 351 TRP B CG  1 
ATOM 5768  C CD1 . TRP B 1 356 ? -13.182  203.361 6.498   1.00 0.00 ? 351 TRP B CD1 1 
ATOM 5769  C CD2 . TRP B 1 356 ? -13.735  202.547 8.461   1.00 0.00 ? 351 TRP B CD2 1 
ATOM 5770  N NE1 . TRP B 1 356 ? -14.530  202.876 6.375   1.00 0.00 ? 351 TRP B NE1 1 
ATOM 5771  C CE2 . TRP B 1 356 ? -14.841  202.242 7.565   1.00 0.00 ? 351 TRP B CE2 1 
ATOM 5772  C CE3 . TRP B 1 356 ? -13.798  202.071 9.782   1.00 0.00 ? 351 TRP B CE3 1 
ATOM 5773  C CZ2 . TRP B 1 356 ? -15.946  201.531 7.945   1.00 0.00 ? 351 TRP B CZ2 1 
ATOM 5774  C CZ3 . TRP B 1 356 ? -14.785  201.060 10.014  1.00 0.00 ? 351 TRP B CZ3 1 
ATOM 5775  C CH2 . TRP B 1 356 ? -15.848  200.801 9.135   1.00 0.00 ? 351 TRP B CH2 1 
ATOM 5776  N N   . VAL B 1 357 ? -9.531   205.712 10.189  1.00 0.00 ? 352 VAL B N   1 
ATOM 5777  C CA  . VAL B 1 357 ? -8.522   205.903 11.281  1.00 0.00 ? 352 VAL B CA  1 
ATOM 5778  C C   . VAL B 1 357 ? -9.036   206.917 12.274  1.00 0.00 ? 352 VAL B C   1 
ATOM 5779  O O   . VAL B 1 357 ? -8.973   206.765 13.505  1.00 0.00 ? 352 VAL B O   1 
ATOM 5780  C CB  . VAL B 1 357 ? -7.171   206.240 10.722  1.00 0.00 ? 352 VAL B CB  1 
ATOM 5781  C CG1 . VAL B 1 357 ? -6.335   206.769 11.892  1.00 0.00 ? 352 VAL B CG1 1 
ATOM 5782  C CG2 . VAL B 1 357 ? -6.620   204.900 10.277  1.00 0.00 ? 352 VAL B CG2 1 
ATOM 5783  N N   . SER B 1 358 ? -9.668   208.047 11.806  1.00 0.00 ? 353 SER B N   1 
ATOM 5784  C CA  . SER B 1 358 ? -10.243  209.010 12.750  1.00 0.00 ? 353 SER B CA  1 
ATOM 5785  C C   . SER B 1 358 ? -11.425  208.456 13.521  1.00 0.00 ? 353 SER B C   1 
ATOM 5786  O O   . SER B 1 358 ? -11.601  208.688 14.725  1.00 0.00 ? 353 SER B O   1 
ATOM 5787  C CB  . SER B 1 358 ? -10.630  210.321 11.957  1.00 0.00 ? 353 SER B CB  1 
ATOM 5788  O OG  . SER B 1 358 ? -9.542   210.959 11.306  1.00 0.00 ? 353 SER B OG  1 
ATOM 5789  N N   . ALA B 1 359 ? -12.297  207.610 12.980  1.00 0.00 ? 354 ALA B N   1 
ATOM 5790  C CA  . ALA B 1 359 ? -13.390  207.024 13.694  1.00 0.00 ? 354 ALA B CA  1 
ATOM 5791  C C   . ALA B 1 359 ? -12.952  206.108 14.768  1.00 0.00 ? 354 ALA B C   1 
ATOM 5792  O O   . ALA B 1 359 ? -13.502  205.946 15.841  1.00 0.00 ? 354 ALA B O   1 
ATOM 5793  C CB  . ALA B 1 359 ? -14.356  206.382 12.695  1.00 0.00 ? 354 ALA B CB  1 
ATOM 5794  N N   . VAL B 1 360 ? -11.885  205.299 14.534  1.00 0.00 ? 355 VAL B N   1 
ATOM 5795  C CA  . VAL B 1 360 ? -11.360  204.498 15.588  1.00 0.00 ? 355 VAL B CA  1 
ATOM 5796  C C   . VAL B 1 360 ? -10.693  205.382 16.624  1.00 0.00 ? 355 VAL B C   1 
ATOM 5797  O O   . VAL B 1 360 ? -10.922  205.209 17.868  1.00 0.00 ? 355 VAL B O   1 
ATOM 5798  C CB  . VAL B 1 360 ? -10.325  203.400 14.970  1.00 0.00 ? 355 VAL B CB  1 
ATOM 5799  C CG1 . VAL B 1 360 ? -9.764   202.649 16.163  1.00 0.00 ? 355 VAL B CG1 1 
ATOM 5800  C CG2 . VAL B 1 360 ? -11.049  202.513 13.969  1.00 0.00 ? 355 VAL B CG2 1 
ATOM 5801  N N   . GLN B 1 361 ? -9.972   206.440 16.160  1.00 0.00 ? 356 GLN B N   1 
ATOM 5802  C CA  . GLN B 1 361 ? -9.343   207.362 17.105  1.00 0.00 ? 356 GLN B CA  1 
ATOM 5803  C C   . GLN B 1 361 ? -10.224  208.200 18.026  1.00 0.00 ? 356 GLN B C   1 
ATOM 5804  O O   . GLN B 1 361 ? -9.975   208.287 19.223  1.00 0.00 ? 356 GLN B O   1 
ATOM 5805  C CB  . GLN B 1 361 ? -8.381   208.113 16.250  1.00 0.00 ? 356 GLN B CB  1 
ATOM 5806  C CG  . GLN B 1 361 ? -7.650   209.242 16.977  1.00 0.00 ? 356 GLN B CG  1 
ATOM 5807  C CD  . GLN B 1 361 ? -8.412   210.538 16.811  1.00 0.00 ? 356 GLN B CD  1 
ATOM 5808  O OE1 . GLN B 1 361 ? -9.196   210.708 15.862  1.00 0.00 ? 356 GLN B OE1 1 
ATOM 5809  N NE2 . GLN B 1 361 ? -8.319   211.531 17.769  1.00 0.00 ? 356 GLN B NE2 1 
ATOM 5810  N N   . SER B 1 362 ? -11.384  208.618 17.540  1.00 0.00 ? 357 SER B N   1 
ATOM 5811  C CA  . SER B 1 362 ? -12.407  209.154 18.477  1.00 0.00 ? 357 SER B CA  1 
ATOM 5812  C C   . SER B 1 362 ? -12.939  208.114 19.392  1.00 0.00 ? 357 SER B C   1 
ATOM 5813  O O   . SER B 1 362 ? -13.111  208.417 20.609  1.00 0.00 ? 357 SER B O   1 
ATOM 5814  C CB  . SER B 1 362 ? -13.598  209.726 17.715  1.00 0.00 ? 357 SER B CB  1 
ATOM 5815  O OG  . SER B 1 362 ? -13.221  210.942 17.071  1.00 0.00 ? 357 SER B OG  1 
ATOM 5816  N N   . SER B 1 363 ? -13.140  206.888 18.916  1.00 0.00 ? 358 SER B N   1 
ATOM 5817  C CA  . SER B 1 363 ? -13.641  205.719 19.661  1.00 0.00 ? 358 SER B CA  1 
ATOM 5818  C C   . SER B 1 363 ? -12.655  205.325 20.846  1.00 0.00 ? 358 SER B C   1 
ATOM 5819  O O   . SER B 1 363 ? -13.011  204.898 21.931  1.00 0.00 ? 358 SER B O   1 
ATOM 5820  C CB  . SER B 1 363 ? -14.009  204.513 18.844  1.00 0.00 ? 358 SER B CB  1 
ATOM 5821  O OG  . SER B 1 363 ? -15.031  204.841 17.986  1.00 0.00 ? 358 SER B OG  1 
ATOM 5822  N N   . ILE B 1 364 ? -11.332  205.361 20.586  1.00 0.00 ? 359 ILE B N   1 
ATOM 5823  C CA  . ILE B 1 364 ? -10.288  205.114 21.547  1.00 0.00 ? 359 ILE B CA  1 
ATOM 5824  C C   . ILE B 1 364 ? -10.359  206.150 22.648  1.00 0.00 ? 359 ILE B C   1 
ATOM 5825  O O   . ILE B 1 364 ? -10.128  205.796 23.771  1.00 0.00 ? 359 ILE B O   1 
ATOM 5826  C CB  . ILE B 1 364 ? -8.839   205.200 21.053  1.00 0.00 ? 359 ILE B CB  1 
ATOM 5827  C CG1 . ILE B 1 364 ? -8.475   204.195 19.999  1.00 0.00 ? 359 ILE B CG1 1 
ATOM 5828  C CG2 . ILE B 1 364 ? -7.709   205.287 22.075  1.00 0.00 ? 359 ILE B CG2 1 
ATOM 5829  C CD1 . ILE B 1 364 ? -7.179   204.426 19.093  1.00 0.00 ? 359 ILE B CD1 1 
ATOM 5830  N N   . ALA B 1 365 ? -10.844  207.434 22.407  1.00 0.00 ? 360 ALA B N   1 
ATOM 5831  C CA  . ALA B 1 365 ? -11.109  208.382 23.432  1.00 0.00 ? 360 ALA B CA  1 
ATOM 5832  C C   . ALA B 1 365 ? -12.446  208.322 24.177  1.00 0.00 ? 360 ALA B C   1 
ATOM 5833  O O   . ALA B 1 365 ? -12.739  209.231 24.941  1.00 0.00 ? 360 ALA B O   1 
ATOM 5834  C CB  . ALA B 1 365 ? -10.961  209.793 22.812  1.00 0.00 ? 360 ALA B CB  1 
ATOM 5835  N N   . SER B 1 366 ? -13.300  207.287 23.969  1.00 0.00 ? 361 SER B N   1 
ATOM 5836  C CA  . SER B 1 366 ? -14.610  207.240 24.616  1.00 0.00 ? 361 SER B CA  1 
ATOM 5837  C C   . SER B 1 366 ? -14.639  206.937 26.105  1.00 0.00 ? 361 SER B C   1 
ATOM 5838  O O   . SER B 1 366 ? -15.699  207.323 26.720  1.00 0.00 ? 361 SER B O   1 
ATOM 5839  C CB  . SER B 1 366 ? -15.578  206.251 23.914  1.00 0.00 ? 361 SER B CB  1 
ATOM 5840  O OG  . SER B 1 366 ? -15.698  206.386 22.554  1.00 0.00 ? 361 SER B OG  1 
ATOM 5841  N N   . ALA B 1 367 ? -13.699  206.250 26.639  1.00 0.00 ? 362 ALA B N   1 
ATOM 5842  N N   . PRO C 1 2   ? -15.211  207.809 -46.746 1.00 0.00 ? -3  PRO C N   1 
ATOM 5843  C CA  . PRO C 1 2   ? -13.844  207.740 -46.115 1.00 0.00 ? -3  PRO C CA  1 
ATOM 5844  C C   . PRO C 1 2   ? -13.119  206.422 -46.432 1.00 0.00 ? -3  PRO C C   1 
ATOM 5845  O O   . PRO C 1 2   ? -13.627  205.709 -47.266 1.00 0.00 ? -3  PRO C O   1 
ATOM 5846  C CB  . PRO C 1 2   ? -14.128  207.993 -44.602 1.00 0.00 ? -3  PRO C CB  1 
ATOM 5847  C CG  . PRO C 1 2   ? -15.269  209.018 -44.739 1.00 0.00 ? -3  PRO C CG  1 
ATOM 5848  C CD  . PRO C 1 2   ? -16.152  208.577 -45.894 1.00 0.00 ? -3  PRO C CD  1 
ATOM 5849  N N   . LEU C 1 3   ? -11.975  206.154 -45.840 1.00 0.00 ? -2  LEU C N   1 
ATOM 5850  C CA  . LEU C 1 3   ? -11.097  205.158 -46.304 1.00 0.00 ? -2  LEU C CA  1 
ATOM 5851  C C   . LEU C 1 3   ? -11.097  203.904 -45.431 1.00 0.00 ? -2  LEU C C   1 
ATOM 5852  O O   . LEU C 1 3   ? -10.392  202.952 -45.787 1.00 0.00 ? -2  LEU C O   1 
ATOM 5853  C CB  . LEU C 1 3   ? -9.724   205.919 -46.319 1.00 0.00 ? -2  LEU C CB  1 
ATOM 5854  C CG  . LEU C 1 3   ? -8.543   205.165 -46.866 1.00 0.00 ? -2  LEU C CG  1 
ATOM 5855  C CD1 . LEU C 1 3   ? -8.697   204.884 -48.401 1.00 0.00 ? -2  LEU C CD1 1 
ATOM 5856  C CD2 . LEU C 1 3   ? -7.237   205.911 -46.564 1.00 0.00 ? -2  LEU C CD2 1 
ATOM 5857  N N   . GLY C 1 4   ? -11.856  203.825 -44.317 1.00 0.00 ? -1  GLY C N   1 
ATOM 5858  C CA  . GLY C 1 4   ? -11.858  202.689 -43.420 1.00 0.00 ? -1  GLY C CA  1 
ATOM 5859  C C   . GLY C 1 4   ? -12.305  201.323 -43.974 1.00 0.00 ? -1  GLY C C   1 
ATOM 5860  O O   . GLY C 1 4   ? -13.170  201.167 -44.791 1.00 0.00 ? -1  GLY C O   1 
ATOM 5861  N N   . SER C 1 5   ? -11.756  200.231 -43.432 1.00 0.00 ? 0   SER C N   1 
ATOM 5862  C CA  . SER C 1 5   ? -11.976  198.895 -44.060 1.00 0.00 ? 0   SER C CA  1 
ATOM 5863  C C   . SER C 1 5   ? -13.397  198.435 -43.858 1.00 0.00 ? 0   SER C C   1 
ATOM 5864  O O   . SER C 1 5   ? -14.038  197.928 -44.744 1.00 0.00 ? 0   SER C O   1 
ATOM 5865  C CB  . SER C 1 5   ? -10.889  197.786 -43.740 1.00 0.00 ? 0   SER C CB  1 
ATOM 5866  O OG  . SER C 1 5   ? -11.054  196.442 -44.273 1.00 0.00 ? 0   SER C OG  1 
ATOM 5867  N N   . MET C 1 6   ? -13.988  198.603 -42.642 1.00 0.00 ? 1   MET C N   1 
ATOM 5868  C CA  . MET C 1 6   ? -15.390  198.318 -42.483 1.00 0.00 ? 1   MET C CA  1 
ATOM 5869  C C   . MET C 1 6   ? -16.292  199.394 -42.961 1.00 0.00 ? 1   MET C C   1 
ATOM 5870  O O   . MET C 1 6   ? -17.434  199.137 -43.279 1.00 0.00 ? 1   MET C O   1 
ATOM 5871  C CB  . MET C 1 6   ? -15.628  197.993 -40.968 1.00 0.00 ? 1   MET C CB  1 
ATOM 5872  C CG  . MET C 1 6   ? -14.950  196.724 -40.569 1.00 0.00 ? 1   MET C CG  1 
ATOM 5873  S SD  . MET C 1 6   ? -15.330  196.236 -38.834 1.00 0.00 ? 1   MET C SD  1 
ATOM 5874  C CE  . MET C 1 6   ? -14.263  194.791 -38.421 1.00 0.00 ? 1   MET C CE  1 
ATOM 5875  N N   . THR C 1 7   ? -15.802  200.607 -43.087 1.00 0.00 ? 2   THR C N   1 
ATOM 5876  C CA  . THR C 1 7   ? -16.569  201.778 -43.570 1.00 0.00 ? 2   THR C CA  1 
ATOM 5877  C C   . THR C 1 7   ? -16.987  201.576 -44.995 1.00 0.00 ? 2   THR C C   1 
ATOM 5878  O O   . THR C 1 7   ? -18.164  201.766 -45.383 1.00 0.00 ? 2   THR C O   1 
ATOM 5879  C CB  . THR C 1 7   ? -15.896  203.163 -43.466 1.00 0.00 ? 2   THR C CB  1 
ATOM 5880  O OG1 . THR C 1 7   ? -15.219  203.210 -42.186 1.00 0.00 ? 2   THR C OG1 1 
ATOM 5881  C CG2 . THR C 1 7   ? -16.990  204.194 -43.381 1.00 0.00 ? 2   THR C CG2 1 
ATOM 5882  N N   . VAL C 1 8   ? -16.044  201.114 -45.878 1.00 0.00 ? 3   VAL C N   1 
ATOM 5883  C CA  . VAL C 1 8   ? -16.229  201.173 -47.287 1.00 0.00 ? 3   VAL C CA  1 
ATOM 5884  C C   . VAL C 1 8   ? -17.036  199.981 -47.747 1.00 0.00 ? 3   VAL C C   1 
ATOM 5885  O O   . VAL C 1 8   ? -17.346  199.868 -48.904 1.00 0.00 ? 3   VAL C O   1 
ATOM 5886  C CB  . VAL C 1 8   ? -14.914  201.157 -48.004 1.00 0.00 ? 3   VAL C CB  1 
ATOM 5887  C CG1 . VAL C 1 8   ? -14.092  202.418 -47.584 1.00 0.00 ? 3   VAL C CG1 1 
ATOM 5888  C CG2 . VAL C 1 8   ? -14.016  199.836 -47.728 1.00 0.00 ? 3   VAL C CG2 1 
ATOM 5889  N N   . LYS C 1 9   ? -17.470  199.025 -46.887 1.00 0.00 ? 4   LYS C N   1 
ATOM 5890  C CA  . LYS C 1 9   ? -18.212  197.868 -47.227 1.00 0.00 ? 4   LYS C CA  1 
ATOM 5891  C C   . LYS C 1 9   ? -19.429  197.713 -46.331 1.00 0.00 ? 4   LYS C C   1 
ATOM 5892  O O   . LYS C 1 9   ? -20.099  196.693 -46.256 1.00 0.00 ? 4   LYS C O   1 
ATOM 5893  C CB  . LYS C 1 9   ? -17.334  196.595 -47.179 1.00 0.00 ? 4   LYS C CB  1 
ATOM 5894  C CG  . LYS C 1 9   ? -16.823  196.136 -45.767 1.00 0.00 ? 4   LYS C CG  1 
ATOM 5895  C CD  . LYS C 1 9   ? -15.985  194.826 -45.669 1.00 0.00 ? 4   LYS C CD  1 
ATOM 5896  C CE  . LYS C 1 9   ? -14.679  194.794 -46.562 1.00 0.00 ? 4   LYS C CE  1 
ATOM 5897  N NZ  . LYS C 1 9   ? -13.546  195.469 -45.833 1.00 0.00 ? 4   LYS C NZ  1 
ATOM 5898  N N   . LEU C 1 10  ? -19.777  198.844 -45.637 1.00 0.00 ? 5   LEU C N   1 
ATOM 5899  C CA  . LEU C 1 10  ? -21.067  198.958 -44.932 1.00 0.00 ? 5   LEU C CA  1 
ATOM 5900  C C   . LEU C 1 10  ? -21.908  200.108 -45.492 1.00 0.00 ? 5   LEU C C   1 
ATOM 5901  O O   . LEU C 1 10  ? -21.256  201.111 -45.775 1.00 0.00 ? 5   LEU C O   1 
ATOM 5902  C CB  . LEU C 1 10  ? -20.768  199.026 -43.392 1.00 0.00 ? 5   LEU C CB  1 
ATOM 5903  C CG  . LEU C 1 10  ? -22.053  199.097 -42.443 1.00 0.00 ? 5   LEU C CG  1 
ATOM 5904  C CD1 . LEU C 1 10  ? -22.931  200.379 -42.525 1.00 0.00 ? 5   LEU C CD1 1 
ATOM 5905  C CD2 . LEU C 1 10  ? -22.885  197.755 -42.351 1.00 0.00 ? 5   LEU C CD2 1 
ATOM 5906  N N   . ASP C 1 11  ? -23.222  199.887 -45.781 1.00 0.00 ? 6   ASP C N   1 
ATOM 5907  C CA  . ASP C 1 11  ? -24.000  200.870 -46.457 1.00 0.00 ? 6   ASP C CA  1 
ATOM 5908  C C   . ASP C 1 11  ? -24.829  201.646 -45.390 1.00 0.00 ? 6   ASP C C   1 
ATOM 5909  O O   . ASP C 1 11  ? -25.896  201.245 -44.910 1.00 0.00 ? 6   ASP C O   1 
ATOM 5910  C CB  . ASP C 1 11  ? -24.904  200.216 -47.519 1.00 0.00 ? 6   ASP C CB  1 
ATOM 5911  C CG  . ASP C 1 11  ? -24.057  199.814 -48.662 1.00 0.00 ? 6   ASP C CG  1 
ATOM 5912  O OD1 . ASP C 1 11  ? -23.239  200.665 -49.071 1.00 0.00 ? 6   ASP C OD1 1 
ATOM 5913  O OD2 . ASP C 1 11  ? -24.155  198.743 -49.296 1.00 0.00 ? 6   ASP C OD2 1 
ATOM 5914  N N   . PHE C 1 12  ? -24.292  202.786 -44.960 1.00 0.00 ? 7   PHE C N   1 
ATOM 5915  C CA  . PHE C 1 12  ? -24.949  203.768 -44.115 1.00 0.00 ? 7   PHE C CA  1 
ATOM 5916  C C   . PHE C 1 12  ? -26.213  204.245 -44.775 1.00 0.00 ? 7   PHE C C   1 
ATOM 5917  O O   . PHE C 1 12  ? -27.245  204.393 -44.130 1.00 0.00 ? 7   PHE C O   1 
ATOM 5918  C CB  . PHE C 1 12  ? -23.873  204.876 -43.939 1.00 0.00 ? 7   PHE C CB  1 
ATOM 5919  C CG  . PHE C 1 12  ? -22.728  204.435 -43.147 1.00 0.00 ? 7   PHE C CG  1 
ATOM 5920  C CD1 . PHE C 1 12  ? -23.026  204.168 -41.769 1.00 0.00 ? 7   PHE C CD1 1 
ATOM 5921  C CD2 . PHE C 1 12  ? -21.493  204.023 -43.695 1.00 0.00 ? 7   PHE C CD2 1 
ATOM 5922  C CE1 . PHE C 1 12  ? -22.045  203.652 -40.907 1.00 0.00 ? 7   PHE C CE1 1 
ATOM 5923  C CE2 . PHE C 1 12  ? -20.463  203.516 -42.844 1.00 0.00 ? 7   PHE C CE2 1 
ATOM 5924  C CZ  . PHE C 1 12  ? -20.821  203.349 -41.497 1.00 0.00 ? 7   PHE C CZ  1 
ATOM 5925  N N   . GLU C 1 13  ? -26.167  204.500 -46.105 1.00 0.00 ? 8   GLU C N   1 
ATOM 5926  C CA  . GLU C 1 13  ? -27.155  205.099 -46.947 1.00 0.00 ? 8   GLU C CA  1 
ATOM 5927  C C   . GLU C 1 13  ? -28.463  204.279 -47.049 1.00 0.00 ? 8   GLU C C   1 
ATOM 5928  O O   . GLU C 1 13  ? -29.558  204.808 -47.094 1.00 0.00 ? 8   GLU C O   1 
ATOM 5929  C CB  . GLU C 1 13  ? -26.675  205.504 -48.350 1.00 0.00 ? 8   GLU C CB  1 
ATOM 5930  C CG  . GLU C 1 13  ? -26.405  204.425 -49.336 1.00 0.00 ? 8   GLU C CG  1 
ATOM 5931  C CD  . GLU C 1 13  ? -25.590  204.787 -50.604 1.00 0.00 ? 8   GLU C CD  1 
ATOM 5932  O OE1 . GLU C 1 13  ? -26.177  205.452 -51.480 1.00 0.00 ? 8   GLU C OE1 1 
ATOM 5933  O OE2 . GLU C 1 13  ? -24.438  204.363 -50.681 1.00 0.00 ? 8   GLU C OE2 1 
ATOM 5934  N N   . GLU C 1 14  ? -28.322  202.984 -46.956 1.00 0.00 ? 9   GLU C N   1 
ATOM 5935  C CA  . GLU C 1 14  ? -29.498  202.096 -47.022 1.00 0.00 ? 9   GLU C CA  1 
ATOM 5936  C C   . GLU C 1 14  ? -29.917  201.512 -45.614 1.00 0.00 ? 9   GLU C C   1 
ATOM 5937  O O   . GLU C 1 14  ? -30.717  200.657 -45.462 1.00 0.00 ? 9   GLU C O   1 
ATOM 5938  C CB  . GLU C 1 14  ? -29.116  200.842 -47.932 1.00 0.00 ? 9   GLU C CB  1 
ATOM 5939  C CG  . GLU C 1 14  ? -28.588  201.089 -49.389 1.00 0.00 ? 9   GLU C CG  1 
ATOM 5940  C CD  . GLU C 1 14  ? -29.551  201.759 -50.317 1.00 0.00 ? 9   GLU C CD  1 
ATOM 5941  O OE1 . GLU C 1 14  ? -30.505  201.058 -50.819 1.00 0.00 ? 9   GLU C OE1 1 
ATOM 5942  O OE2 . GLU C 1 14  ? -29.471  203.026 -50.512 1.00 0.00 ? 9   GLU C OE2 1 
ATOM 5943  N N   . CYS C 1 15  ? -29.252  202.049 -44.583 1.00 0.00 ? 10  CYS C N   1 
ATOM 5944  C CA  . CYS C 1 15  ? -29.369  201.548 -43.161 1.00 0.00 ? 10  CYS C CA  1 
ATOM 5945  C C   . CYS C 1 15  ? -30.723  201.782 -42.497 1.00 0.00 ? 10  CYS C C   1 
ATOM 5946  O O   . CYS C 1 15  ? -31.128  200.931 -41.781 1.00 0.00 ? 10  CYS C O   1 
ATOM 5947  C CB  . CYS C 1 15  ? -28.223  202.108 -42.249 1.00 0.00 ? 10  CYS C CB  1 
ATOM 5948  S SG  . CYS C 1 15  ? -27.955  201.389 -40.553 1.00 0.00 ? 10  CYS C SG  1 
ATOM 5949  N N   . LEU C 1 16  ? -31.447  202.823 -42.746 1.00 0.00 ? 11  LEU C N   1 
ATOM 5950  C CA  . LEU C 1 16  ? -32.900  202.926 -42.406 1.00 0.00 ? 11  LEU C CA  1 
ATOM 5951  C C   . LEU C 1 16  ? -33.894  202.215 -43.373 1.00 0.00 ? 11  LEU C C   1 
ATOM 5952  O O   . LEU C 1 16  ? -35.080  202.082 -43.115 1.00 0.00 ? 11  LEU C O   1 
ATOM 5953  C CB  . LEU C 1 16  ? -33.200  204.480 -42.246 1.00 0.00 ? 11  LEU C CB  1 
ATOM 5954  C CG  . LEU C 1 16  ? -32.409  205.223 -41.168 1.00 0.00 ? 11  LEU C CG  1 
ATOM 5955  C CD1 . LEU C 1 16  ? -32.292  206.698 -41.287 1.00 0.00 ? 11  LEU C CD1 1 
ATOM 5956  C CD2 . LEU C 1 16  ? -32.719  204.743 -39.762 1.00 0.00 ? 11  LEU C CD2 1 
ATOM 5957  N N   . LYS C 1 17  ? -33.369  201.884 -44.589 1.00 0.00 ? 12  LYS C N   1 
ATOM 5958  C CA  . LYS C 1 17  ? -34.162  201.581 -45.733 1.00 0.00 ? 12  LYS C CA  1 
ATOM 5959  C C   . LYS C 1 17  ? -34.319  200.070 -46.000 1.00 0.00 ? 12  LYS C C   1 
ATOM 5960  O O   . LYS C 1 17  ? -35.231  199.617 -46.701 1.00 0.00 ? 12  LYS C O   1 
ATOM 5961  C CB  . LYS C 1 17  ? -33.661  202.212 -47.039 1.00 0.00 ? 12  LYS C CB  1 
ATOM 5962  C CG  . LYS C 1 17  ? -34.642  202.360 -48.229 1.00 0.00 ? 12  LYS C CG  1 
ATOM 5963  C CD  . LYS C 1 17  ? -33.952  201.963 -49.555 1.00 0.00 ? 12  LYS C CD  1 
ATOM 5964  C CE  . LYS C 1 17  ? -32.993  203.030 -50.152 1.00 0.00 ? 12  LYS C CE  1 
ATOM 5965  N NZ  . LYS C 1 17  ? -32.570  202.577 -51.462 1.00 0.00 ? 12  LYS C NZ  1 
ATOM 5966  N N   . ASP C 1 18  ? -33.533  199.209 -45.431 1.00 0.00 ? 13  ASP C N   1 
ATOM 5967  C CA  . ASP C 1 18  ? -33.624  197.781 -45.378 1.00 0.00 ? 13  ASP C CA  1 
ATOM 5968  C C   . ASP C 1 18  ? -33.642  197.128 -46.777 1.00 0.00 ? 13  ASP C C   1 
ATOM 5969  O O   . ASP C 1 18  ? -34.526  196.309 -47.069 1.00 0.00 ? 13  ASP C O   1 
ATOM 5970  C CB  . ASP C 1 18  ? -34.683  197.432 -44.386 1.00 0.00 ? 13  ASP C CB  1 
ATOM 5971  C CG  . ASP C 1 18  ? -34.636  195.959 -44.066 1.00 0.00 ? 13  ASP C CG  1 
ATOM 5972  O OD1 . ASP C 1 18  ? -33.740  195.486 -43.351 1.00 0.00 ? 13  ASP C OD1 1 
ATOM 5973  O OD2 . ASP C 1 18  ? -35.539  195.212 -44.515 1.00 0.00 ? 13  ASP C OD2 1 
ATOM 5974  N N   . SER C 1 19  ? -32.760  197.423 -47.707 1.00 0.00 ? 14  SER C N   1 
ATOM 5975  C CA  . SER C 1 19  ? -32.682  196.696 -48.989 1.00 0.00 ? 14  SER C CA  1 
ATOM 5976  C C   . SER C 1 19  ? -31.878  195.450 -48.814 1.00 0.00 ? 14  SER C C   1 
ATOM 5977  O O   . SER C 1 19  ? -31.266  195.181 -47.763 1.00 0.00 ? 14  SER C O   1 
ATOM 5978  C CB  . SER C 1 19  ? -31.930  197.644 -49.986 1.00 0.00 ? 14  SER C CB  1 
ATOM 5979  O OG  . SER C 1 19  ? -30.758  198.131 -49.474 1.00 0.00 ? 14  SER C OG  1 
ATOM 5980  N N   . PRO C 1 20  ? -32.044  194.492 -49.734 1.00 0.00 ? 15  PRO C N   1 
ATOM 5981  C CA  . PRO C 1 20  ? -31.116  193.361 -49.871 1.00 0.00 ? 15  PRO C CA  1 
ATOM 5982  C C   . PRO C 1 20  ? -29.664  193.609 -49.936 1.00 0.00 ? 15  PRO C C   1 
ATOM 5983  O O   . PRO C 1 20  ? -28.894  192.754 -49.442 1.00 0.00 ? 15  PRO C O   1 
ATOM 5984  C CB  . PRO C 1 20  ? -31.718  192.583 -51.050 1.00 0.00 ? 15  PRO C CB  1 
ATOM 5985  C CG  . PRO C 1 20  ? -33.244  192.856 -50.954 1.00 0.00 ? 15  PRO C CG  1 
ATOM 5986  C CD  . PRO C 1 20  ? -33.240  194.411 -50.698 1.00 0.00 ? 15  PRO C CD  1 
ATOM 5987  N N   . ARG C 1 21  ? -29.247  194.757 -50.508 1.00 0.00 ? 16  ARG C N   1 
ATOM 5988  C CA  . ARG C 1 21  ? -28.000  195.395 -50.329 1.00 0.00 ? 16  ARG C CA  1 
ATOM 5989  C C   . ARG C 1 21  ? -27.612  195.599 -48.889 1.00 0.00 ? 16  ARG C C   1 
ATOM 5990  O O   . ARG C 1 21  ? -26.530  195.268 -48.475 1.00 0.00 ? 16  ARG C O   1 
ATOM 5991  C CB  . ARG C 1 21  ? -28.085  196.819 -51.007 1.00 0.00 ? 16  ARG C CB  1 
ATOM 5992  C CG  . ARG C 1 21  ? -26.897  197.721 -50.775 1.00 0.00 ? 16  ARG C CG  1 
ATOM 5993  C CD  . ARG C 1 21  ? -26.714  198.742 -51.933 1.00 0.00 ? 16  ARG C CD  1 
ATOM 5994  N NE  . ARG C 1 21  ? -25.713  199.705 -51.445 1.00 0.00 ? 16  ARG C NE  1 
ATOM 5995  C CZ  . ARG C 1 21  ? -25.507  200.961 -51.910 1.00 0.00 ? 16  ARG C CZ  1 
ATOM 5996  N NH1 . ARG C 1 21  ? -26.138  201.525 -52.910 1.00 0.00 ? 16  ARG C NH1 1 
ATOM 5997  N NH2 . ARG C 1 21  ? -24.506  201.654 -51.373 1.00 0.00 ? 16  ARG C NH2 1 
ATOM 5998  N N   . PHE C 1 22  ? -28.513  196.201 -48.059 1.00 0.00 ? 17  PHE C N   1 
ATOM 5999  C CA  . PHE C 1 22  ? -28.228  196.467 -46.658 1.00 0.00 ? 17  PHE C CA  1 
ATOM 6000  C C   . PHE C 1 22  ? -28.043  195.154 -45.892 1.00 0.00 ? 17  PHE C C   1 
ATOM 6001  O O   . PHE C 1 22  ? -27.021  195.025 -45.199 1.00 0.00 ? 17  PHE C O   1 
ATOM 6002  C CB  . PHE C 1 22  ? -29.305  197.436 -46.065 1.00 0.00 ? 17  PHE C CB  1 
ATOM 6003  C CG  . PHE C 1 22  ? -28.885  197.824 -44.712 1.00 0.00 ? 17  PHE C CG  1 
ATOM 6004  C CD1 . PHE C 1 22  ? -27.664  198.554 -44.534 1.00 0.00 ? 17  PHE C CD1 1 
ATOM 6005  C CD2 . PHE C 1 22  ? -29.621  197.451 -43.572 1.00 0.00 ? 17  PHE C CD2 1 
ATOM 6006  C CE1 . PHE C 1 22  ? -27.144  198.808 -43.226 1.00 0.00 ? 17  PHE C CE1 1 
ATOM 6007  C CE2 . PHE C 1 22  ? -29.182  197.807 -42.285 1.00 0.00 ? 17  PHE C CE2 1 
ATOM 6008  C CZ  . PHE C 1 22  ? -27.944  198.481 -42.127 1.00 0.00 ? 17  PHE C CZ  1 
ATOM 6009  N N   . ARG C 1 23  ? -28.932  194.133 -46.125 1.00 0.00 ? 18  ARG C N   1 
ATOM 6010  C CA  . ARG C 1 23  ? -28.805  192.811 -45.513 1.00 0.00 ? 18  ARG C CA  1 
ATOM 6011  C C   . ARG C 1 23  ? -27.526  192.026 -45.854 1.00 0.00 ? 18  ARG C C   1 
ATOM 6012  O O   . ARG C 1 23  ? -27.052  191.211 -45.035 1.00 0.00 ? 18  ARG C O   1 
ATOM 6013  C CB  . ARG C 1 23  ? -30.109  192.129 -46.103 1.00 0.00 ? 18  ARG C CB  1 
ATOM 6014  C CG  . ARG C 1 23  ? -31.462  192.636 -45.525 1.00 0.00 ? 18  ARG C CG  1 
ATOM 6015  C CD  . ARG C 1 23  ? -31.789  192.362 -44.117 1.00 0.00 ? 18  ARG C CD  1 
ATOM 6016  N NE  . ARG C 1 23  ? -33.178  192.877 -43.818 1.00 0.00 ? 18  ARG C NE  1 
ATOM 6017  C CZ  . ARG C 1 23  ? -34.183  192.084 -43.441 1.00 0.00 ? 18  ARG C CZ  1 
ATOM 6018  N NH1 . ARG C 1 23  ? -34.105  190.770 -43.301 1.00 0.00 ? 18  ARG C NH1 1 
ATOM 6019  N NH2 . ARG C 1 23  ? -35.250  192.732 -43.134 1.00 0.00 ? 18  ARG C NH2 1 
ATOM 6020  N N   . ALA C 1 24  ? -27.118  192.209 -47.120 1.00 0.00 ? 19  ALA C N   1 
ATOM 6021  C CA  . ALA C 1 24  ? -25.800  191.841 -47.671 1.00 0.00 ? 19  ALA C CA  1 
ATOM 6022  C C   . ALA C 1 24  ? -24.639  192.587 -47.019 1.00 0.00 ? 19  ALA C C   1 
ATOM 6023  O O   . ALA C 1 24  ? -23.693  191.932 -46.564 1.00 0.00 ? 19  ALA C O   1 
ATOM 6024  C CB  . ALA C 1 24  ? -25.797  191.922 -49.183 1.00 0.00 ? 19  ALA C CB  1 
ATOM 6025  N N   . SER C 1 25  ? -24.714  193.941 -46.729 1.00 0.00 ? 20  SER C N   1 
ATOM 6026  C CA  . SER C 1 25  ? -23.600  194.619 -46.092 1.00 0.00 ? 20  SER C CA  1 
ATOM 6027  C C   . SER C 1 25  ? -23.360  194.152 -44.621 1.00 0.00 ? 20  SER C C   1 
ATOM 6028  O O   . SER C 1 25  ? -22.235  193.831 -44.206 1.00 0.00 ? 20  SER C O   1 
ATOM 6029  C CB  . SER C 1 25  ? -23.570  196.200 -46.098 1.00 0.00 ? 20  SER C CB  1 
ATOM 6030  O OG  . SER C 1 25  ? -24.626  196.770 -45.331 1.00 0.00 ? 20  SER C OG  1 
ATOM 6031  N N   . ILE C 1 26  ? -24.495  194.015 -43.835 1.00 0.00 ? 21  ILE C N   1 
ATOM 6032  C CA  . ILE C 1 26  ? -24.563  193.509 -42.405 1.00 0.00 ? 21  ILE C CA  1 
ATOM 6033  C C   . ILE C 1 26  ? -23.940  192.172 -42.245 1.00 0.00 ? 21  ILE C C   1 
ATOM 6034  O O   . ILE C 1 26  ? -23.181  191.883 -41.296 1.00 0.00 ? 21  ILE C O   1 
ATOM 6035  C CB  . ILE C 1 26  ? -25.885  193.596 -41.678 1.00 0.00 ? 21  ILE C CB  1 
ATOM 6036  C CG1 . ILE C 1 26  ? -26.958  192.589 -42.272 1.00 0.00 ? 21  ILE C CG1 1 
ATOM 6037  C CG2 . ILE C 1 26  ? -26.302  195.024 -41.927 1.00 0.00 ? 21  ILE C CG2 1 
ATOM 6038  C CD1 . ILE C 1 26  ? -28.347  192.887 -41.703 1.00 0.00 ? 21  ILE C CD1 1 
ATOM 6039  N N   . GLU C 1 27  ? -24.197  191.302 -43.282 1.00 0.00 ? 22  GLU C N   1 
ATOM 6040  C CA  . GLU C 1 27  ? -23.559  190.017 -43.401 1.00 0.00 ? 22  GLU C CA  1 
ATOM 6041  C C   . GLU C 1 27  ? -22.093  190.012 -43.806 1.00 0.00 ? 22  GLU C C   1 
ATOM 6042  O O   . GLU C 1 27  ? -21.263  189.368 -43.172 1.00 0.00 ? 22  GLU C O   1 
ATOM 6043  C CB  . GLU C 1 27  ? -24.316  189.232 -44.468 1.00 0.00 ? 22  GLU C CB  1 
ATOM 6044  C CG  . GLU C 1 27  ? -23.931  187.777 -44.699 1.00 0.00 ? 22  GLU C CG  1 
ATOM 6045  C CD  . GLU C 1 27  ? -24.861  187.056 -45.646 1.00 0.00 ? 22  GLU C CD  1 
ATOM 6046  O OE1 . GLU C 1 27  ? -26.106  187.097 -45.333 1.00 0.00 ? 22  GLU C OE1 1 
ATOM 6047  O OE2 . GLU C 1 27  ? -24.442  186.592 -46.699 1.00 0.00 ? 22  GLU C OE2 1 
ATOM 6048  N N   . LEU C 1 28  ? -21.724  190.831 -44.827 1.00 0.00 ? 23  LEU C N   1 
ATOM 6049  C CA  . LEU C 1 28  ? -20.418  191.033 -45.403 1.00 0.00 ? 23  LEU C CA  1 
ATOM 6050  C C   . LEU C 1 28  ? -19.380  191.606 -44.479 1.00 0.00 ? 23  LEU C C   1 
ATOM 6051  O O   . LEU C 1 28  ? -18.246  191.100 -44.387 1.00 0.00 ? 23  LEU C O   1 
ATOM 6052  C CB  . LEU C 1 28  ? -20.618  191.988 -46.619 1.00 0.00 ? 23  LEU C CB  1 
ATOM 6053  C CG  . LEU C 1 28  ? -19.405  192.180 -47.436 1.00 0.00 ? 23  LEU C CG  1 
ATOM 6054  C CD1 . LEU C 1 28  ? -19.024  190.894 -48.019 1.00 0.00 ? 23  LEU C CD1 1 
ATOM 6055  C CD2 . LEU C 1 28  ? -19.624  193.310 -48.513 1.00 0.00 ? 23  LEU C CD2 1 
ATOM 6056  N N   . VAL C 1 29  ? -19.833  192.653 -43.685 1.00 0.00 ? 24  VAL C N   1 
ATOM 6057  C CA  . VAL C 1 29  ? -18.986  193.325 -42.725 1.00 0.00 ? 24  VAL C CA  1 
ATOM 6058  C C   . VAL C 1 29  ? -18.555  192.503 -41.538 1.00 0.00 ? 24  VAL C C   1 
ATOM 6059  O O   . VAL C 1 29  ? -17.392  192.555 -41.083 1.00 0.00 ? 24  VAL C O   1 
ATOM 6060  C CB  . VAL C 1 29  ? -19.617  194.716 -42.350 1.00 0.00 ? 24  VAL C CB  1 
ATOM 6061  C CG1 . VAL C 1 29  ? -20.516  194.705 -41.142 1.00 0.00 ? 24  VAL C CG1 1 
ATOM 6062  C CG2 . VAL C 1 29  ? -18.519  195.675 -41.990 1.00 0.00 ? 24  VAL C CG2 1 
ATOM 6063  N N   . GLU C 1 30  ? -19.423  191.597 -41.125 1.00 0.00 ? 25  GLU C N   1 
ATOM 6064  C CA  . GLU C 1 30  ? -19.288  190.616 -40.058 1.00 0.00 ? 25  GLU C CA  1 
ATOM 6065  C C   . GLU C 1 30  ? -18.101  189.620 -40.240 1.00 0.00 ? 25  GLU C C   1 
ATOM 6066  O O   . GLU C 1 30  ? -17.484  189.154 -39.328 1.00 0.00 ? 25  GLU C O   1 
ATOM 6067  C CB  . GLU C 1 30  ? -20.657  190.001 -39.809 1.00 0.00 ? 25  GLU C CB  1 
ATOM 6068  C CG  . GLU C 1 30  ? -20.594  189.079 -38.577 1.00 0.00 ? 25  GLU C CG  1 
ATOM 6069  C CD  . GLU C 1 30  ? -21.880  188.942 -37.804 1.00 0.00 ? 25  GLU C CD  1 
ATOM 6070  O OE1 . GLU C 1 30  ? -22.873  188.634 -38.521 1.00 0.00 ? 25  GLU C OE1 1 
ATOM 6071  O OE2 . GLU C 1 30  ? -21.995  189.130 -36.560 1.00 0.00 ? 25  GLU C OE2 1 
ATOM 6072  N N   . ALA C 1 31  ? -17.783  189.352 -41.520 1.00 0.00 ? 26  ALA C N   1 
ATOM 6073  C CA  . ALA C 1 31  ? -16.794  188.341 -41.890 1.00 0.00 ? 26  ALA C CA  1 
ATOM 6074  C C   . ALA C 1 31  ? -15.381  188.779 -41.477 1.00 0.00 ? 26  ALA C C   1 
ATOM 6075  O O   . ALA C 1 31  ? -14.562  188.123 -40.893 1.00 0.00 ? 26  ALA C O   1 
ATOM 6076  C CB  . ALA C 1 31  ? -16.842  188.199 -43.427 1.00 0.00 ? 26  ALA C CB  1 
ATOM 6077  N N   . GLU C 1 32  ? -15.166  190.138 -41.590 1.00 0.00 ? 27  GLU C N   1 
ATOM 6078  C CA  . GLU C 1 32  ? -14.021  190.896 -41.102 1.00 0.00 ? 27  GLU C CA  1 
ATOM 6079  C C   . GLU C 1 32  ? -13.997  190.936 -39.622 1.00 0.00 ? 27  GLU C C   1 
ATOM 6080  O O   . GLU C 1 32  ? -12.915  190.865 -39.018 1.00 0.00 ? 27  GLU C O   1 
ATOM 6081  C CB  . GLU C 1 32  ? -13.968  192.233 -41.821 1.00 0.00 ? 27  GLU C CB  1 
ATOM 6082  C CG  . GLU C 1 32  ? -12.569  192.837 -41.511 1.00 0.00 ? 27  GLU C CG  1 
ATOM 6083  C CD  . GLU C 1 32  ? -12.340  194.084 -42.398 1.00 0.00 ? 27  GLU C CD  1 
ATOM 6084  O OE1 . GLU C 1 32  ? -12.876  194.129 -43.578 1.00 0.00 ? 27  GLU C OE1 1 
ATOM 6085  O OE2 . GLU C 1 32  ? -11.576  194.977 -41.982 1.00 0.00 ? 27  GLU C OE2 1 
ATOM 6086  N N   . VAL C 1 33  ? -15.133  191.086 -38.968 1.00 0.00 ? 28  VAL C N   1 
ATOM 6087  C CA  . VAL C 1 33  ? -15.221  191.046 -37.508 1.00 0.00 ? 28  VAL C CA  1 
ATOM 6088  C C   . VAL C 1 33  ? -14.697  189.749 -36.923 1.00 0.00 ? 28  VAL C C   1 
ATOM 6089  O O   . VAL C 1 33  ? -13.893  189.766 -36.020 1.00 0.00 ? 28  VAL C O   1 
ATOM 6090  C CB  . VAL C 1 33  ? -16.672  191.281 -37.023 1.00 0.00 ? 28  VAL C CB  1 
ATOM 6091  C CG1 . VAL C 1 33  ? -16.740  191.193 -35.479 1.00 0.00 ? 28  VAL C CG1 1 
ATOM 6092  C CG2 . VAL C 1 33  ? -16.985  192.667 -37.486 1.00 0.00 ? 28  VAL C CG2 1 
ATOM 6093  N N   . SER C 1 34  ? -15.115  188.556 -37.474 1.00 0.00 ? 29  SER C N   1 
ATOM 6094  C CA  . SER C 1 34  ? -14.644  187.210 -37.090 1.00 0.00 ? 29  SER C CA  1 
ATOM 6095  C C   . SER C 1 34  ? -13.250  186.866 -37.398 1.00 0.00 ? 29  SER C C   1 
ATOM 6096  O O   . SER C 1 34  ? -12.563  186.181 -36.651 1.00 0.00 ? 29  SER C O   1 
ATOM 6097  C CB  . SER C 1 34  ? -15.510  186.134 -37.749 1.00 0.00 ? 29  SER C CB  1 
ATOM 6098  O OG  . SER C 1 34  ? -16.827  186.283 -37.361 1.00 0.00 ? 29  SER C OG  1 
ATOM 6099  N N   . GLU C 1 35  ? -12.861  187.478 -38.547 1.00 0.00 ? 30  GLU C N   1 
ATOM 6100  C CA  . GLU C 1 35  ? -11.452  187.474 -38.991 1.00 0.00 ? 30  GLU C CA  1 
ATOM 6101  C C   . GLU C 1 35  ? -10.454  188.119 -38.067 1.00 0.00 ? 30  GLU C C   1 
ATOM 6102  O O   . GLU C 1 35  ? -9.509   187.457 -37.537 1.00 0.00 ? 30  GLU C O   1 
ATOM 6103  C CB  . GLU C 1 35  ? -11.256  188.099 -40.398 1.00 0.00 ? 30  GLU C CB  1 
ATOM 6104  C CG  . GLU C 1 35  ? -9.953   187.711 -41.130 1.00 0.00 ? 30  GLU C CG  1 
ATOM 6105  C CD  . GLU C 1 35  ? -9.693   186.179 -41.167 1.00 0.00 ? 30  GLU C CD  1 
ATOM 6106  O OE1 . GLU C 1 35  ? -10.670  185.340 -41.148 1.00 0.00 ? 30  GLU C OE1 1 
ATOM 6107  O OE2 . GLU C 1 35  ? -8.528   185.758 -41.196 1.00 0.00 ? 30  GLU C OE2 1 
ATOM 6108  N N   . LEU C 1 36  ? -10.814  189.392 -37.686 1.00 0.00 ? 31  LEU C N   1 
ATOM 6109  C CA  . LEU C 1 36  ? -10.137  190.230 -36.757 1.00 0.00 ? 31  LEU C CA  1 
ATOM 6110  C C   . LEU C 1 36  ? -10.043  189.638 -35.363 1.00 0.00 ? 31  LEU C C   1 
ATOM 6111  O O   . LEU C 1 36  ? -8.937   189.618 -34.851 1.00 0.00 ? 31  LEU C O   1 
ATOM 6112  C CB  . LEU C 1 36  ? -10.849  191.576 -36.757 1.00 0.00 ? 31  LEU C CB  1 
ATOM 6113  C CG  . LEU C 1 36  ? -10.269  192.688 -35.812 1.00 0.00 ? 31  LEU C CG  1 
ATOM 6114  C CD1 . LEU C 1 36  ? -8.788   193.080 -36.112 1.00 0.00 ? 31  LEU C CD1 1 
ATOM 6115  C CD2 . LEU C 1 36  ? -11.164  193.935 -35.915 1.00 0.00 ? 31  LEU C CD2 1 
ATOM 6116  N N   . GLU C 1 37  ? -11.017  189.065 -34.859 1.00 0.00 ? 32  GLU C N   1 
ATOM 6117  C CA  . GLU C 1 37  ? -11.100  188.235 -33.565 1.00 0.00 ? 32  GLU C CA  1 
ATOM 6118  C C   . GLU C 1 37  ? -10.267  186.956 -33.505 1.00 0.00 ? 32  GLU C C   1 
ATOM 6119  O O   . GLU C 1 37  ? -9.679   186.666 -32.446 1.00 0.00 ? 32  GLU C O   1 
ATOM 6120  C CB  . GLU C 1 37  ? -12.608  187.838 -33.321 1.00 0.00 ? 32  GLU C CB  1 
ATOM 6121  C CG  . GLU C 1 37  ? -13.012  187.181 -31.985 1.00 0.00 ? 32  GLU C CG  1 
ATOM 6122  C CD  . GLU C 1 37  ? -14.482  186.633 -31.809 1.00 0.00 ? 32  GLU C CD  1 
ATOM 6123  O OE1 . GLU C 1 37  ? -15.082  186.267 -32.841 1.00 0.00 ? 32  GLU C OE1 1 
ATOM 6124  O OE2 . GLU C 1 37  ? -14.967  186.516 -30.680 1.00 0.00 ? 32  GLU C OE2 1 
ATOM 6125  N N   . THR C 1 38  ? -10.107  186.225 -34.657 1.00 0.00 ? 33  THR C N   1 
ATOM 6126  C CA  . THR C 1 38  ? -9.207   185.030 -34.714 1.00 0.00 ? 33  THR C CA  1 
ATOM 6127  C C   . THR C 1 38  ? -7.756   185.502 -34.756 1.00 0.00 ? 33  THR C C   1 
ATOM 6128  O O   . THR C 1 38  ? -6.903   184.968 -34.098 1.00 0.00 ? 33  THR C O   1 
ATOM 6129  C CB  . THR C 1 38  ? -9.515   184.139 -35.894 1.00 0.00 ? 33  THR C CB  1 
ATOM 6130  O OG1 . THR C 1 38  ? -10.761  183.532 -35.585 1.00 0.00 ? 33  THR C OG1 1 
ATOM 6131  C CG2 . THR C 1 38  ? -8.487   182.992 -36.097 1.00 0.00 ? 33  THR C CG2 1 
ATOM 6132  N N   . ARG C 1 39  ? -7.479   186.639 -35.564 1.00 0.00 ? 34  ARG C N   1 
ATOM 6133  C CA  . ARG C 1 39  ? -6.116   187.218 -35.646 1.00 0.00 ? 34  ARG C CA  1 
ATOM 6134  C C   . ARG C 1 39  ? -5.643   187.792 -34.325 1.00 0.00 ? 34  ARG C C   1 
ATOM 6135  O O   . ARG C 1 39  ? -4.535   187.518 -33.950 1.00 0.00 ? 34  ARG C O   1 
ATOM 6136  C CB  . ARG C 1 39  ? -6.042   188.261 -36.749 1.00 0.00 ? 34  ARG C CB  1 
ATOM 6137  C CG  . ARG C 1 39  ? -6.239   187.553 -38.078 1.00 0.00 ? 34  ARG C CG  1 
ATOM 6138  C CD  . ARG C 1 39  ? -6.222   188.498 -39.307 1.00 0.00 ? 34  ARG C CD  1 
ATOM 6139  N NE  . ARG C 1 39  ? -6.680   187.718 -40.467 1.00 0.00 ? 34  ARG C NE  1 
ATOM 6140  C CZ  . ARG C 1 39  ? -6.573   188.197 -41.710 1.00 0.00 ? 34  ARG C CZ  1 
ATOM 6141  N NH1 . ARG C 1 39  ? -5.855   189.231 -41.906 1.00 0.00 ? 34  ARG C NH1 1 
ATOM 6142  N NH2 . ARG C 1 39  ? -7.327   187.711 -42.634 1.00 0.00 ? 34  ARG C NH2 1 
ATOM 6143  N N   . LEU C 1 40  ? -6.540   188.464 -33.594 1.00 0.00 ? 35  LEU C N   1 
ATOM 6144  C CA  . LEU C 1 40  ? -6.310   188.882 -32.156 1.00 0.00 ? 35  LEU C CA  1 
ATOM 6145  C C   . LEU C 1 40  ? -5.998   187.722 -31.246 1.00 0.00 ? 35  LEU C C   1 
ATOM 6146  O O   . LEU C 1 40  ? -5.070   187.794 -30.456 1.00 0.00 ? 35  LEU C O   1 
ATOM 6147  C CB  . LEU C 1 40  ? -7.641   189.586 -31.509 1.00 0.00 ? 35  LEU C CB  1 
ATOM 6148  C CG  . LEU C 1 40  ? -8.035   190.895 -32.138 1.00 0.00 ? 35  LEU C CG  1 
ATOM 6149  C CD1 . LEU C 1 40  ? -9.363   191.369 -31.522 1.00 0.00 ? 35  LEU C CD1 1 
ATOM 6150  C CD2 . LEU C 1 40  ? -6.959   192.003 -31.957 1.00 0.00 ? 35  LEU C CD2 1 
ATOM 6151  N N   . GLU C 1 41  ? -6.689   186.594 -31.400 1.00 0.00 ? 36  GLU C N   1 
ATOM 6152  C CA  . GLU C 1 41  ? -6.448   185.365 -30.618 1.00 0.00 ? 36  GLU C CA  1 
ATOM 6153  C C   . GLU C 1 41  ? -5.151   184.689 -30.975 1.00 0.00 ? 36  GLU C C   1 
ATOM 6154  O O   . GLU C 1 41  ? -4.401   184.178 -30.132 1.00 0.00 ? 36  GLU C O   1 
ATOM 6155  C CB  . GLU C 1 41  ? -7.635   184.320 -30.621 1.00 0.00 ? 36  GLU C CB  1 
ATOM 6156  C CG  . GLU C 1 41  ? -7.425   183.085 -29.712 1.00 0.00 ? 36  GLU C CG  1 
ATOM 6157  C CD  . GLU C 1 41  ? -8.560   182.221 -29.922 1.00 0.00 ? 36  GLU C CD  1 
ATOM 6158  O OE1 . GLU C 1 41  ? -9.707   182.658 -29.626 1.00 0.00 ? 36  GLU C OE1 1 
ATOM 6159  O OE2 . GLU C 1 41  ? -8.344   181.111 -30.568 1.00 0.00 ? 36  GLU C OE2 1 
ATOM 6160  N N   . LYS C 1 42  ? -4.751   184.642 -32.262 1.00 0.00 ? 37  LYS C N   1 
ATOM 6161  C CA  . LYS C 1 42  ? -3.546   184.036 -32.733 1.00 0.00 ? 37  LYS C CA  1 
ATOM 6162  C C   . LYS C 1 42  ? -2.408   184.813 -32.140 1.00 0.00 ? 37  LYS C C   1 
ATOM 6163  O O   . LYS C 1 42  ? -1.330   184.298 -31.754 1.00 0.00 ? 37  LYS C O   1 
ATOM 6164  C CB  . LYS C 1 42  ? -3.431   184.004 -34.271 1.00 0.00 ? 37  LYS C CB  1 
ATOM 6165  C CG  . LYS C 1 42  ? -2.273   183.219 -34.906 1.00 0.00 ? 37  LYS C CG  1 
ATOM 6166  C CD  . LYS C 1 42  ? -1.935   181.819 -34.348 1.00 0.00 ? 37  LYS C CD  1 
ATOM 6167  C CE  . LYS C 1 42  ? -0.742   181.066 -34.985 1.00 0.00 ? 37  LYS C CE  1 
ATOM 6168  N NZ  . LYS C 1 42  ? -0.924   180.886 -36.443 1.00 0.00 ? 37  LYS C NZ  1 
ATOM 6169  N N   . LEU C 1 43  ? -2.594   186.153 -31.940 1.00 0.00 ? 38  LEU C N   1 
ATOM 6170  C CA  . LEU C 1 43  ? -1.544   187.078 -31.394 1.00 0.00 ? 38  LEU C CA  1 
ATOM 6171  C C   . LEU C 1 43  ? -1.360   186.843 -29.928 1.00 0.00 ? 38  LEU C C   1 
ATOM 6172  O O   . LEU C 1 43  ? -0.244   186.848 -29.394 1.00 0.00 ? 38  LEU C O   1 
ATOM 6173  C CB  . LEU C 1 43  ? -1.766   188.538 -31.918 1.00 0.00 ? 38  LEU C CB  1 
ATOM 6174  C CG  . LEU C 1 43  ? -0.690   189.593 -31.584 1.00 0.00 ? 38  LEU C CG  1 
ATOM 6175  C CD1 . LEU C 1 43  ? 0.701    189.108 -31.992 1.00 0.00 ? 38  LEU C CD1 1 
ATOM 6176  C CD2 . LEU C 1 43  ? -1.096   190.910 -32.246 1.00 0.00 ? 38  LEU C CD2 1 
ATOM 6177  N N   . LEU C 1 44  ? -2.384   186.583 -29.128 1.00 0.00 ? 39  LEU C N   1 
ATOM 6178  C CA  . LEU C 1 44  ? -2.285   186.148 -27.746 1.00 0.00 ? 39  LEU C CA  1 
ATOM 6179  C C   . LEU C 1 44  ? -1.594   184.779 -27.504 1.00 0.00 ? 39  LEU C C   1 
ATOM 6180  O O   . LEU C 1 44  ? -0.826   184.715 -26.560 1.00 0.00 ? 39  LEU C O   1 
ATOM 6181  C CB  . LEU C 1 44  ? -3.678   185.816 -27.136 1.00 0.00 ? 39  LEU C CB  1 
ATOM 6182  C CG  . LEU C 1 44  ? -4.626   187.000 -26.811 1.00 0.00 ? 39  LEU C CG  1 
ATOM 6183  C CD1 . LEU C 1 44  ? -6.056   186.608 -26.358 1.00 0.00 ? 39  LEU C CD1 1 
ATOM 6184  C CD2 . LEU C 1 44  ? -4.066   187.986 -25.766 1.00 0.00 ? 39  LEU C CD2 1 
ATOM 6185  N N   . LYS C 1 45  ? -1.794   183.713 -28.323 1.00 0.00 ? 40  LYS C N   1 
ATOM 6186  C CA  . LYS C 1 45  ? -1.165   182.470 -28.264 1.00 0.00 ? 40  LYS C CA  1 
ATOM 6187  C C   . LYS C 1 45  ? 0.367    182.522 -28.553 1.00 0.00 ? 40  LYS C C   1 
ATOM 6188  O O   . LYS C 1 45  ? 1.207    181.929 -27.833 1.00 0.00 ? 40  LYS C O   1 
ATOM 6189  C CB  . LYS C 1 45  ? -1.931   181.537 -29.222 1.00 0.00 ? 40  LYS C CB  1 
ATOM 6190  C CG  . LYS C 1 45  ? -3.355   181.140 -28.678 1.00 0.00 ? 40  LYS C CG  1 
ATOM 6191  C CD  . LYS C 1 45  ? -4.016   180.236 -29.652 1.00 0.00 ? 40  LYS C CD  1 
ATOM 6192  C CE  . LYS C 1 45  ? -5.278   179.661 -28.997 1.00 0.00 ? 40  LYS C CE  1 
ATOM 6193  N NZ  . LYS C 1 45  ? -6.272   179.093 -29.991 1.00 0.00 ? 40  LYS C NZ  1 
ATOM 6194  N N   . LEU C 1 46  ? 0.719    183.217 -29.609 1.00 0.00 ? 41  LEU C N   1 
ATOM 6195  C CA  . LEU C 1 46  ? 2.043    183.517 -29.947 1.00 0.00 ? 41  LEU C CA  1 
ATOM 6196  C C   . LEU C 1 46  ? 2.813    184.387 -28.836 1.00 0.00 ? 41  LEU C C   1 
ATOM 6197  O O   . LEU C 1 46  ? 3.996    184.281 -28.632 1.00 0.00 ? 41  LEU C O   1 
ATOM 6198  C CB  . LEU C 1 46  ? 2.048    184.302 -31.211 1.00 0.00 ? 41  LEU C CB  1 
ATOM 6199  C CG  . LEU C 1 46  ? 1.656    183.494 -32.523 1.00 0.00 ? 41  LEU C CG  1 
ATOM 6200  C CD1 . LEU C 1 46  ? 1.310    184.543 -33.599 1.00 0.00 ? 41  LEU C CD1 1 
ATOM 6201  C CD2 . LEU C 1 46  ? 2.803    182.565 -32.864 1.00 0.00 ? 41  LEU C CD2 1 
ATOM 6202  N N   . GLY C 1 47  ? 2.074    185.223 -28.143 1.00 0.00 ? 42  GLY C N   1 
ATOM 6203  C CA  . GLY C 1 47  ? 2.547    186.076 -27.101 1.00 0.00 ? 42  GLY C CA  1 
ATOM 6204  C C   . GLY C 1 47  ? 2.972    185.257 -25.951 1.00 0.00 ? 42  GLY C C   1 
ATOM 6205  O O   . GLY C 1 47  ? 4.090    185.512 -25.462 1.00 0.00 ? 42  GLY C O   1 
ATOM 6206  N N   . THR C 1 48  ? 2.143    184.194 -25.477 1.00 0.00 ? 43  THR C N   1 
ATOM 6207  C CA  . THR C 1 48  ? 2.691    183.273 -24.502 1.00 0.00 ? 43  THR C CA  1 
ATOM 6208  C C   . THR C 1 48  ? 3.830    182.345 -24.927 1.00 0.00 ? 43  THR C C   1 
ATOM 6209  O O   . THR C 1 48  ? 4.659    181.984 -24.081 1.00 0.00 ? 43  THR C O   1 
ATOM 6210  C CB  . THR C 1 48  ? 1.597    182.533 -23.669 1.00 0.00 ? 43  THR C CB  1 
ATOM 6211  O OG1 . THR C 1 48  ? 0.772    181.699 -24.516 1.00 0.00 ? 43  THR C OG1 1 
ATOM 6212  C CG2 . THR C 1 48  ? 0.569    183.437 -22.991 1.00 0.00 ? 43  THR C CG2 1 
ATOM 6213  N N   . GLY C 1 49  ? 3.886    181.977 -26.208 1.00 0.00 ? 44  GLY C N   1 
ATOM 6214  C CA  . GLY C 1 49  ? 4.990    181.230 -26.830 1.00 0.00 ? 44  GLY C CA  1 
ATOM 6215  C C   . GLY C 1 49  ? 6.188    182.047 -26.757 1.00 0.00 ? 44  GLY C C   1 
ATOM 6216  O O   . GLY C 1 49  ? 7.249    181.593 -26.396 1.00 0.00 ? 44  GLY C O   1 
ATOM 6217  N N   . LEU C 1 50  ? 6.118    183.358 -27.052 1.00 0.00 ? 45  LEU C N   1 
ATOM 6218  C CA  . LEU C 1 50  ? 7.267    184.229 -26.941 1.00 0.00 ? 45  LEU C CA  1 
ATOM 6219  C C   . LEU C 1 50  ? 7.660    184.438 -25.513 1.00 0.00 ? 45  LEU C C   1 
ATOM 6220  O O   . LEU C 1 50  ? 8.840    184.431 -25.158 1.00 0.00 ? 45  LEU C O   1 
ATOM 6221  C CB  . LEU C 1 50  ? 6.935    185.576 -27.611 1.00 0.00 ? 45  LEU C CB  1 
ATOM 6222  C CG  . LEU C 1 50  ? 7.926    186.750 -27.752 1.00 0.00 ? 45  LEU C CG  1 
ATOM 6223  C CD1 . LEU C 1 50  ? 9.177    186.276 -28.443 1.00 0.00 ? 45  LEU C CD1 1 
ATOM 6224  C CD2 . LEU C 1 50  ? 7.401    188.035 -28.444 1.00 0.00 ? 45  LEU C CD2 1 
ATOM 6225  N N   . LEU C 1 51  ? 6.703    184.533 -24.607 1.00 0.00 ? 46  LEU C N   1 
ATOM 6226  C CA  . LEU C 1 51  ? 7.011    184.584 -23.199 1.00 0.00 ? 46  LEU C CA  1 
ATOM 6227  C C   . LEU C 1 51  ? 7.699    183.270 -22.688 1.00 0.00 ? 46  LEU C C   1 
ATOM 6228  O O   . LEU C 1 51  ? 8.761    183.319 -21.985 1.00 0.00 ? 46  LEU C O   1 
ATOM 6229  C CB  . LEU C 1 51  ? 5.864    184.925 -22.249 1.00 0.00 ? 46  LEU C CB  1 
ATOM 6230  C CG  . LEU C 1 51  ? 5.203    186.329 -22.560 1.00 0.00 ? 46  LEU C CG  1 
ATOM 6231  C CD1 . LEU C 1 51  ? 3.772    186.291 -21.935 1.00 0.00 ? 46  LEU C CD1 1 
ATOM 6232  C CD2 . LEU C 1 51  ? 6.052    187.565 -22.208 1.00 0.00 ? 46  LEU C CD2 1 
ATOM 6233  N N   . GLU C 1 52  ? 7.236    182.078 -23.031 1.00 0.00 ? 47  GLU C N   1 
ATOM 6234  C CA  . GLU C 1 52  ? 7.800    180.801 -22.727 1.00 0.00 ? 47  GLU C CA  1 
ATOM 6235  C C   . GLU C 1 52  ? 9.214    180.564 -23.204 1.00 0.00 ? 47  GLU C C   1 
ATOM 6236  O O   . GLU C 1 52  ? 10.122   180.171 -22.498 1.00 0.00 ? 47  GLU C O   1 
ATOM 6237  C CB  . GLU C 1 52  ? 6.944    179.639 -23.406 1.00 0.00 ? 47  GLU C CB  1 
ATOM 6238  C CG  . GLU C 1 52  ? 7.348    178.117 -22.942 1.00 0.00 ? 47  GLU C CG  1 
ATOM 6239  C CD  . GLU C 1 52  ? 6.280    177.187 -23.334 1.00 0.00 ? 47  GLU C CD  1 
ATOM 6240  O OE1 . GLU C 1 52  ? 5.134    177.451 -22.891 1.00 0.00 ? 47  GLU C OE1 1 
ATOM 6241  O OE2 . GLU C 1 52  ? 6.530    176.182 -23.989 1.00 0.00 ? 47  GLU C OE2 1 
ATOM 6242  N N   . SER C 1 53  ? 9.489    180.801 -24.540 1.00 0.00 ? 48  SER C N   1 
ATOM 6243  C CA  . SER C 1 53  ? 10.838   180.711 -25.088 1.00 0.00 ? 48  SER C CA  1 
ATOM 6244  C C   . SER C 1 53  ? 11.850   181.772 -24.546 1.00 0.00 ? 48  SER C C   1 
ATOM 6245  O O   . SER C 1 53  ? 13.009   181.486 -24.310 1.00 0.00 ? 48  SER C O   1 
ATOM 6246  C CB  . SER C 1 53  ? 10.705   180.961 -26.569 1.00 0.00 ? 48  SER C CB  1 
ATOM 6247  O OG  . SER C 1 53  ? 11.690   180.475 -27.507 1.00 0.00 ? 48  SER C OG  1 
ATOM 6248  N N   . GLY C 1 54  ? 11.369   183.014 -24.325 1.00 0.00 ? 49  GLY C N   1 
ATOM 6249  C CA  . GLY C 1 54  ? 12.087   184.130 -23.730 1.00 0.00 ? 49  GLY C CA  1 
ATOM 6250  C C   . GLY C 1 54  ? 12.624   183.795 -22.419 1.00 0.00 ? 49  GLY C C   1 
ATOM 6251  O O   . GLY C 1 54  ? 13.806   184.024 -22.152 1.00 0.00 ? 49  GLY C O   1 
ATOM 6252  N N   . ARG C 1 55  ? 11.741   183.218 -21.554 1.00 0.00 ? 50  ARG C N   1 
ATOM 6253  C CA  . ARG C 1 55  ? 12.098   182.847 -20.200 1.00 0.00 ? 50  ARG C CA  1 
ATOM 6254  C C   . ARG C 1 55  ? 13.072   181.570 -20.151 1.00 0.00 ? 50  ARG C C   1 
ATOM 6255  O O   . ARG C 1 55  ? 13.993   181.554 -19.347 1.00 0.00 ? 50  ARG C O   1 
ATOM 6256  C CB  . ARG C 1 55  ? 10.894   182.680 -19.191 1.00 0.00 ? 50  ARG C CB  1 
ATOM 6257  C CG  . ARG C 1 55  ? 10.091   183.898 -18.953 1.00 0.00 ? 50  ARG C CG  1 
ATOM 6258  C CD  . ARG C 1 55  ? 8.862    183.628 -18.089 1.00 0.00 ? 50  ARG C CD  1 
ATOM 6259  N NE  . ARG C 1 55  ? 8.377    185.059 -17.839 1.00 0.00 ? 50  ARG C NE  1 
ATOM 6260  C CZ  . ARG C 1 55  ? 7.162    185.539 -18.288 1.00 0.00 ? 50  ARG C CZ  1 
ATOM 6261  N NH1 . ARG C 1 55  ? 6.175    184.749 -18.631 1.00 0.00 ? 50  ARG C NH1 1 
ATOM 6262  N NH2 . ARG C 1 55  ? 6.938    186.818 -18.289 1.00 0.00 ? 50  ARG C NH2 1 
ATOM 6263  N N   . HIS C 1 56  ? 12.841   180.586 -21.068 1.00 0.00 ? 51  HIS C N   1 
ATOM 6264  C CA  . HIS C 1 56  ? 13.904   179.575 -21.312 1.00 0.00 ? 51  HIS C CA  1 
ATOM 6265  C C   . HIS C 1 56  ? 15.227   180.031 -21.925 1.00 0.00 ? 51  HIS C C   1 
ATOM 6266  O O   . HIS C 1 56  ? 16.229   179.503 -21.437 1.00 0.00 ? 51  HIS C O   1 
ATOM 6267  C CB  . HIS C 1 56  ? 13.405   178.379 -22.108 1.00 0.00 ? 51  HIS C CB  1 
ATOM 6268  C CG  . HIS C 1 56  ? 12.277   177.630 -21.366 1.00 0.00 ? 51  HIS C CG  1 
ATOM 6269  N ND1 . HIS C 1 56  ? 11.542   176.623 -22.018 1.00 0.00 ? 51  HIS C ND1 1 
ATOM 6270  C CD2 . HIS C 1 56  ? 11.804   177.675 -20.066 1.00 0.00 ? 51  HIS C CD2 1 
ATOM 6271  C CE1 . HIS C 1 56  ? 10.602   176.192 -21.149 1.00 0.00 ? 51  HIS C CE1 1 
ATOM 6272  N NE2 . HIS C 1 56  ? 10.781   176.774 -19.944 1.00 0.00 ? 51  HIS C NE2 1 
ATOM 6273  N N   . TYR C 1 57  ? 15.280   180.999 -22.883 1.00 0.00 ? 52  TYR C N   1 
ATOM 6274  C CA  . TYR C 1 57  ? 16.510   181.613 -23.411 1.00 0.00 ? 52  TYR C CA  1 
ATOM 6275  C C   . TYR C 1 57  ? 17.287   182.348 -22.323 1.00 0.00 ? 52  TYR C C   1 
ATOM 6276  O O   . TYR C 1 57  ? 18.501   182.211 -22.214 1.00 0.00 ? 52  TYR C O   1 
ATOM 6277  C CB  . TYR C 1 57  ? 16.222   182.613 -24.575 1.00 0.00 ? 52  TYR C CB  1 
ATOM 6278  C CG  . TYR C 1 57  ? 17.428   183.276 -25.268 1.00 0.00 ? 52  TYR C CG  1 
ATOM 6279  C CD1 . TYR C 1 57  ? 18.659   182.663 -25.454 1.00 0.00 ? 52  TYR C CD1 1 
ATOM 6280  C CD2 . TYR C 1 57  ? 17.291   184.598 -25.792 1.00 0.00 ? 52  TYR C CD2 1 
ATOM 6281  C CE1 . TYR C 1 57  ? 19.664   183.184 -26.325 1.00 0.00 ? 52  TYR C CE1 1 
ATOM 6282  C CE2 . TYR C 1 57  ? 18.290   185.085 -26.650 1.00 0.00 ? 52  TYR C CE2 1 
ATOM 6283  C CZ  . TYR C 1 57  ? 19.481   184.425 -26.926 1.00 0.00 ? 52  TYR C CZ  1 
ATOM 6284  O OH  . TYR C 1 57  ? 20.408   184.984 -27.800 1.00 0.00 ? 52  TYR C OH  1 
ATOM 6285  N N   . LEU C 1 58  ? 16.610   183.082 -21.409 1.00 0.00 ? 53  LEU C N   1 
ATOM 6286  C CA  . LEU C 1 58  ? 17.300   183.627 -20.291 1.00 0.00 ? 53  LEU C CA  1 
ATOM 6287  C C   . LEU C 1 58  ? 17.670   182.709 -19.141 1.00 0.00 ? 53  LEU C C   1 
ATOM 6288  O O   . LEU C 1 58  ? 18.760   182.914 -18.504 1.00 0.00 ? 53  LEU C O   1 
ATOM 6289  C CB  . LEU C 1 58  ? 16.526   184.898 -19.777 1.00 0.00 ? 53  LEU C CB  1 
ATOM 6290  C CG  . LEU C 1 58  ? 16.279   185.992 -20.915 1.00 0.00 ? 53  LEU C CG  1 
ATOM 6291  C CD1 . LEU C 1 58  ? 15.362   187.039 -20.295 1.00 0.00 ? 53  LEU C CD1 1 
ATOM 6292  C CD2 . LEU C 1 58  ? 17.632   186.503 -21.404 1.00 0.00 ? 53  LEU C CD2 1 
ATOM 6293  N N   . ALA C 1 59  ? 16.988   181.604 -18.850 1.00 0.00 ? 54  ALA C N   1 
ATOM 6294  C CA  . ALA C 1 59  ? 17.402   180.599 -17.929 1.00 0.00 ? 54  ALA C CA  1 
ATOM 6295  C C   . ALA C 1 59  ? 18.730   179.950 -18.493 1.00 0.00 ? 54  ALA C C   1 
ATOM 6296  O O   . ALA C 1 59  ? 19.698   179.856 -17.798 1.00 0.00 ? 54  ALA C O   1 
ATOM 6297  C CB  . ALA C 1 59  ? 16.308   179.563 -17.701 1.00 0.00 ? 54  ALA C CB  1 
ATOM 6298  N N   . ALA C 1 60  ? 18.884   179.712 -19.829 1.00 0.00 ? 55  ALA C N   1 
ATOM 6299  C CA  . ALA C 1 60  ? 20.056   179.094 -20.462 1.00 0.00 ? 55  ALA C CA  1 
ATOM 6300  C C   . ALA C 1 60  ? 21.277   179.975 -20.448 1.00 0.00 ? 55  ALA C C   1 
ATOM 6301  O O   . ALA C 1 60  ? 22.329   179.554 -20.046 1.00 0.00 ? 55  ALA C O   1 
ATOM 6302  C CB  . ALA C 1 60  ? 19.675   178.712 -21.922 1.00 0.00 ? 55  ALA C CB  1 
ATOM 6303  N N   . SER C 1 61  ? 21.099   181.265 -20.722 1.00 0.00 ? 56  SER C N   1 
ATOM 6304  C CA  . SER C 1 61  ? 21.963   182.459 -20.688 1.00 0.00 ? 56  SER C CA  1 
ATOM 6305  C C   . SER C 1 61  ? 22.497   182.663 -19.287 1.00 0.00 ? 56  SER C C   1 
ATOM 6306  O O   . SER C 1 61  ? 23.702   182.918 -19.006 1.00 0.00 ? 56  SER C O   1 
ATOM 6307  C CB  . SER C 1 61  ? 21.211   183.782 -21.129 1.00 0.00 ? 56  SER C CB  1 
ATOM 6308  O OG  . SER C 1 61  ? 20.886   183.757 -22.494 1.00 0.00 ? 56  SER C OG  1 
ATOM 6309  N N   . ARG C 1 62  ? 21.624   182.650 -18.256 1.00 0.00 ? 57  ARG C N   1 
ATOM 6310  C CA  . ARG C 1 62  ? 22.040   182.940 -16.830 1.00 0.00 ? 57  ARG C CA  1 
ATOM 6311  C C   . ARG C 1 62  ? 22.976   181.812 -16.259 1.00 0.00 ? 57  ARG C C   1 
ATOM 6312  O O   . ARG C 1 62  ? 24.032   182.036 -15.629 1.00 0.00 ? 57  ARG C O   1 
ATOM 6313  C CB  . ARG C 1 62  ? 20.733   183.058 -15.975 1.00 0.00 ? 57  ARG C CB  1 
ATOM 6314  C CG  . ARG C 1 62  ? 20.886   183.404 -14.496 1.00 0.00 ? 57  ARG C CG  1 
ATOM 6315  C CD  . ARG C 1 62  ? 21.308   184.856 -14.370 1.00 0.00 ? 57  ARG C CD  1 
ATOM 6316  N NE  . ARG C 1 62  ? 20.187   185.656 -14.899 1.00 0.00 ? 57  ARG C NE  1 
ATOM 6317  C CZ  . ARG C 1 62  ? 19.785   186.761 -14.220 1.00 0.00 ? 57  ARG C CZ  1 
ATOM 6318  N NH1 . ARG C 1 62  ? 20.596   187.510 -13.485 1.00 0.00 ? 57  ARG C NH1 1 
ATOM 6319  N NH2 . ARG C 1 62  ? 18.519   187.054 -14.375 1.00 0.00 ? 57  ARG C NH2 1 
ATOM 6320  N N   . ALA C 1 63  ? 22.700   180.509 -16.606 1.00 0.00 ? 58  ALA C N   1 
ATOM 6321  C CA  . ALA C 1 63  ? 23.546   179.351 -16.368 1.00 0.00 ? 58  ALA C CA  1 
ATOM 6322  C C   . ALA C 1 63  ? 24.849   179.499 -17.133 1.00 0.00 ? 58  ALA C C   1 
ATOM 6323  O O   . ALA C 1 63  ? 25.866   179.095 -16.555 1.00 0.00 ? 58  ALA C O   1 
ATOM 6324  C CB  . ALA C 1 63  ? 22.886   178.024 -16.901 1.00 0.00 ? 58  ALA C CB  1 
ATOM 6325  N N   . PHE C 1 64  ? 24.829   179.955 -18.349 1.00 0.00 ? 59  PHE C N   1 
ATOM 6326  C CA  . PHE C 1 64  ? 26.049   180.097 -19.122 1.00 0.00 ? 59  PHE C CA  1 
ATOM 6327  C C   . PHE C 1 64  ? 27.098   181.155 -18.504 1.00 0.00 ? 59  PHE C C   1 
ATOM 6328  O O   . PHE C 1 64  ? 28.330   180.933 -18.506 1.00 0.00 ? 59  PHE C O   1 
ATOM 6329  C CB  . PHE C 1 64  ? 25.590   180.577 -20.553 1.00 0.00 ? 59  PHE C CB  1 
ATOM 6330  C CG  . PHE C 1 64  ? 26.720   180.576 -21.516 1.00 0.00 ? 59  PHE C CG  1 
ATOM 6331  C CD1 . PHE C 1 64  ? 27.470   179.390 -21.700 1.00 0.00 ? 59  PHE C CD1 1 
ATOM 6332  C CD2 . PHE C 1 64  ? 27.169   181.862 -22.038 1.00 0.00 ? 59  PHE C CD2 1 
ATOM 6333  C CE1 . PHE C 1 64  ? 28.571   179.422 -22.600 1.00 0.00 ? 59  PHE C CE1 1 
ATOM 6334  C CE2 . PHE C 1 64  ? 28.221   181.854 -22.999 1.00 0.00 ? 59  PHE C CE2 1 
ATOM 6335  C CZ  . PHE C 1 64  ? 28.872   180.606 -23.256 1.00 0.00 ? 59  PHE C CZ  1 
ATOM 6336  N N   . VAL C 1 65  ? 26.586   182.237 -18.017 1.00 0.00 ? 60  VAL C N   1 
ATOM 6337  C CA  . VAL C 1 65  ? 27.357   183.359 -17.467 1.00 0.00 ? 60  VAL C CA  1 
ATOM 6338  C C   . VAL C 1 65  ? 28.043   183.006 -16.112 1.00 0.00 ? 60  VAL C C   1 
ATOM 6339  O O   . VAL C 1 65  ? 29.277   183.259 -15.945 1.00 0.00 ? 60  VAL C O   1 
ATOM 6340  C CB  . VAL C 1 65  ? 26.366   184.593 -17.339 1.00 0.00 ? 60  VAL C CB  1 
ATOM 6341  C CG1 . VAL C 1 65  ? 26.840   185.556 -16.299 1.00 0.00 ? 60  VAL C CG1 1 
ATOM 6342  C CG2 . VAL C 1 65  ? 26.249   185.121 -18.775 1.00 0.00 ? 60  VAL C CG2 1 
ATOM 6343  N N   . VAL C 1 66  ? 27.321   182.360 -15.189 1.00 0.00 ? 61  VAL C N   1 
ATOM 6344  C CA  . VAL C 1 66  ? 27.947   181.640 -14.082 1.00 0.00 ? 61  VAL C CA  1 
ATOM 6345  C C   . VAL C 1 66  ? 29.085   180.643 -14.435 1.00 0.00 ? 61  VAL C C   1 
ATOM 6346  O O   . VAL C 1 66  ? 30.018   180.593 -13.720 1.00 0.00 ? 61  VAL C O   1 
ATOM 6347  C CB  . VAL C 1 66  ? 27.080   181.137 -12.932 1.00 0.00 ? 61  VAL C CB  1 
ATOM 6348  C CG1 . VAL C 1 66  ? 26.147   180.035 -13.408 1.00 0.00 ? 61  VAL C CG1 1 
ATOM 6349  C CG2 . VAL C 1 66  ? 27.775   180.689 -11.691 1.00 0.00 ? 61  VAL C CG2 1 
ATOM 6350  N N   . GLY C 1 67  ? 28.899   179.925 -15.618 1.00 0.00 ? 62  GLY C N   1 
ATOM 6351  C CA  . GLY C 1 67  ? 29.650   178.772 -16.019 1.00 0.00 ? 62  GLY C CA  1 
ATOM 6352  C C   . GLY C 1 67  ? 30.896   179.201 -16.733 1.00 0.00 ? 62  GLY C C   1 
ATOM 6353  O O   . GLY C 1 67  ? 31.902   178.571 -16.563 1.00 0.00 ? 62  GLY C O   1 
ATOM 6354  N N   . ILE C 1 68  ? 30.841   180.198 -17.576 1.00 0.00 ? 63  ILE C N   1 
ATOM 6355  C CA  . ILE C 1 68  ? 31.947   180.924 -18.161 1.00 0.00 ? 63  ILE C CA  1 
ATOM 6356  C C   . ILE C 1 68  ? 32.820   181.551 -17.196 1.00 0.00 ? 63  ILE C C   1 
ATOM 6357  O O   . ILE C 1 68  ? 34.049   181.476 -17.361 1.00 0.00 ? 63  ILE C O   1 
ATOM 6358  C CB  . ILE C 1 68  ? 31.809   181.941 -19.265 1.00 0.00 ? 63  ILE C CB  1 
ATOM 6359  C CG1 . ILE C 1 68  ? 31.141   183.287 -18.765 1.00 0.00 ? 63  ILE C CG1 1 
ATOM 6360  C CG2 . ILE C 1 68  ? 31.021   181.421 -20.438 1.00 0.00 ? 63  ILE C CG2 1 
ATOM 6361  C CD1 . ILE C 1 68  ? 31.207   184.515 -19.667 1.00 0.00 ? 63  ILE C CD1 1 
ATOM 6362  N N   . CYS C 1 69  ? 32.287   182.073 -16.101 1.00 0.00 ? 64  CYS C N   1 
ATOM 6363  C CA  . CYS C 1 69  ? 33.095   182.700 -15.063 1.00 0.00 ? 64  CYS C CA  1 
ATOM 6364  C C   . CYS C 1 69  ? 33.744   181.572 -14.247 1.00 0.00 ? 64  CYS C C   1 
ATOM 6365  O O   . CYS C 1 69  ? 34.906   181.567 -13.968 1.00 0.00 ? 64  CYS C O   1 
ATOM 6366  C CB  . CYS C 1 69  ? 32.291   183.707 -14.283 1.00 0.00 ? 64  CYS C CB  1 
ATOM 6367  S SG  . CYS C 1 69  ? 31.709   185.015 -15.340 1.00 0.00 ? 64  CYS C SG  1 
ATOM 6368  N N   . ASP C 1 70  ? 32.949   180.508 -13.850 1.00 0.00 ? 65  ASP C N   1 
ATOM 6369  C CA  . ASP C 1 70  ? 33.345   179.470 -12.869 1.00 0.00 ? 65  ASP C CA  1 
ATOM 6370  C C   . ASP C 1 70  ? 34.592   178.723 -13.403 1.00 0.00 ? 65  ASP C C   1 
ATOM 6371  O O   . ASP C 1 70  ? 35.441   178.297 -12.588 1.00 0.00 ? 65  ASP C O   1 
ATOM 6372  C CB  . ASP C 1 70  ? 32.193   178.489 -12.521 1.00 0.00 ? 65  ASP C CB  1 
ATOM 6373  C CG  . ASP C 1 70  ? 32.588   177.513 -11.457 1.00 0.00 ? 65  ASP C CG  1 
ATOM 6374  O OD1 . ASP C 1 70  ? 32.772   177.966 -10.311 1.00 0.00 ? 65  ASP C OD1 1 
ATOM 6375  O OD2 . ASP C 1 70  ? 32.670   176.313 -11.730 1.00 0.00 ? 65  ASP C OD2 1 
ATOM 6376  N N   . LEU C 1 71  ? 34.723   178.507 -14.723 1.00 0.00 ? 66  LEU C N   1 
ATOM 6377  C CA  . LEU C 1 71  ? 35.759   177.816 -15.450 1.00 0.00 ? 66  LEU C CA  1 
ATOM 6378  C C   . LEU C 1 71  ? 37.024   178.502 -15.475 1.00 0.00 ? 66  LEU C C   1 
ATOM 6379  O O   . LEU C 1 71  ? 38.104   177.936 -15.264 1.00 0.00 ? 66  LEU C O   1 
ATOM 6380  C CB  . LEU C 1 71  ? 35.394   177.471 -17.000 1.00 0.00 ? 66  LEU C CB  1 
ATOM 6381  C CG  . LEU C 1 71  ? 35.413   175.975 -17.282 1.00 0.00 ? 66  LEU C CG  1 
ATOM 6382  C CD1 . LEU C 1 71  ? 34.502   175.587 -18.520 1.00 0.00 ? 66  LEU C CD1 1 
ATOM 6383  C CD2 . LEU C 1 71  ? 36.860   175.467 -17.417 1.00 0.00 ? 66  LEU C CD2 1 
ATOM 6384  N N   . ALA C 1 72  ? 36.932   179.853 -15.729 1.00 0.00 ? 67  ALA C N   1 
ATOM 6385  C CA  . ALA C 1 72  ? 38.014   180.785 -15.500 1.00 0.00 ? 67  ALA C CA  1 
ATOM 6386  C C   . ALA C 1 72  ? 38.450   180.819 -14.055 1.00 0.00 ? 67  ALA C C   1 
ATOM 6387  O O   . ALA C 1 72  ? 39.676   180.800 -13.878 1.00 0.00 ? 67  ALA C O   1 
ATOM 6388  C CB  . ALA C 1 72  ? 37.588   182.187 -15.982 1.00 0.00 ? 67  ALA C CB  1 
ATOM 6389  N N   . ARG C 1 73  ? 37.496   180.873 -13.101 1.00 0.00 ? 68  ARG C N   1 
ATOM 6390  C CA  . ARG C 1 73  ? 37.765   180.725 -11.713 1.00 0.00 ? 68  ARG C CA  1 
ATOM 6391  C C   . ARG C 1 73  ? 38.442   179.373 -11.277 1.00 0.00 ? 68  ARG C C   1 
ATOM 6392  O O   . ARG C 1 73  ? 39.306   179.344 -10.412 1.00 0.00 ? 68  ARG C O   1 
ATOM 6393  C CB  . ARG C 1 73  ? 36.614   181.063 -10.683 1.00 0.00 ? 68  ARG C CB  1 
ATOM 6394  C CG  . ARG C 1 73  ? 36.008   182.470 -10.625 1.00 0.00 ? 68  ARG C CG  1 
ATOM 6395  C CD  . ARG C 1 73  ? 34.686   182.411 -9.939  1.00 0.00 ? 68  ARG C CD  1 
ATOM 6396  N NE  . ARG C 1 73  ? 34.143   183.800 -9.933  1.00 0.00 ? 68  ARG C NE  1 
ATOM 6397  C CZ  . ARG C 1 73  ? 32.882   184.242 -10.186 1.00 0.00 ? 68  ARG C CZ  1 
ATOM 6398  N NH1 . ARG C 1 73  ? 31.901   183.350 -10.442 1.00 0.00 ? 68  ARG C NH1 1 
ATOM 6399  N NH2 . ARG C 1 73  ? 32.550   185.512 -10.087 1.00 0.00 ? 68  ARG C NH2 1 
ATOM 6400  N N   . LEU C 1 74  ? 38.096   178.261 -11.932 1.00 0.00 ? 69  LEU C N   1 
ATOM 6401  C CA  . LEU C 1 74  ? 38.781   176.956 -11.783 1.00 0.00 ? 69  LEU C CA  1 
ATOM 6402  C C   . LEU C 1 74  ? 40.264   176.916 -12.316 1.00 0.00 ? 69  LEU C C   1 
ATOM 6403  O O   . LEU C 1 74  ? 41.004   176.004 -11.923 1.00 0.00 ? 69  LEU C O   1 
ATOM 6404  C CB  . LEU C 1 74  ? 37.897   175.932 -12.432 1.00 0.00 ? 69  LEU C CB  1 
ATOM 6405  C CG  . LEU C 1 74  ? 38.215   174.410 -12.230 1.00 0.00 ? 69  LEU C CG  1 
ATOM 6406  C CD1 . LEU C 1 74  ? 37.979   174.069 -10.712 1.00 0.00 ? 69  LEU C CD1 1 
ATOM 6407  C CD2 . LEU C 1 74  ? 37.253   173.689 -13.188 1.00 0.00 ? 69  LEU C CD2 1 
ATOM 6408  N N   . GLY C 1 75  ? 40.689   177.872 -13.122 1.00 0.00 ? 70  GLY C N   1 
ATOM 6409  C CA  . GLY C 1 75  ? 42.088   177.964 -13.667 1.00 0.00 ? 70  GLY C CA  1 
ATOM 6410  C C   . GLY C 1 75  ? 43.165   178.506 -12.807 1.00 0.00 ? 70  GLY C C   1 
ATOM 6411  O O   . GLY C 1 75  ? 42.901   178.944 -11.703 1.00 0.00 ? 70  GLY C O   1 
ATOM 6412  N N   . PRO C 1 76  ? 44.396   178.673 -13.265 1.00 0.00 ? 71  PRO C N   1 
ATOM 6413  C CA  . PRO C 1 76  ? 45.440   179.244 -12.497 1.00 0.00 ? 71  PRO C CA  1 
ATOM 6414  C C   . PRO C 1 76  ? 45.390   180.769 -12.600 1.00 0.00 ? 71  PRO C C   1 
ATOM 6415  O O   . PRO C 1 76  ? 44.913   181.321 -13.610 1.00 0.00 ? 71  PRO C O   1 
ATOM 6416  C CB  . PRO C 1 76  ? 46.686   178.558 -13.106 1.00 0.00 ? 71  PRO C CB  1 
ATOM 6417  C CG  . PRO C 1 76  ? 46.412   178.549 -14.623 1.00 0.00 ? 71  PRO C CG  1 
ATOM 6418  C CD  . PRO C 1 76  ? 44.917   178.090 -14.532 1.00 0.00 ? 71  PRO C CD  1 
ATOM 6419  N N   . PRO C 1 77  ? 45.716   181.602 -11.567 1.00 0.00 ? 72  PRO C N   1 
ATOM 6420  C CA  . PRO C 1 77  ? 45.011   182.772 -11.385 1.00 0.00 ? 72  PRO C CA  1 
ATOM 6421  C C   . PRO C 1 77  ? 45.707   183.891 -12.146 1.00 0.00 ? 72  PRO C C   1 
ATOM 6422  O O   . PRO C 1 77  ? 46.927   183.934 -12.229 1.00 0.00 ? 72  PRO C O   1 
ATOM 6423  C CB  . PRO C 1 77  ? 45.086   182.991 -9.907  1.00 0.00 ? 72  PRO C CB  1 
ATOM 6424  C CG  . PRO C 1 77  ? 46.362   182.175 -9.429  1.00 0.00 ? 72  PRO C CG  1 
ATOM 6425  C CD  . PRO C 1 77  ? 46.541   181.098 -10.525 1.00 0.00 ? 72  PRO C CD  1 
ATOM 6426  N N   . GLU C 1 78  ? 44.989   184.874 -12.750 1.00 0.00 ? 73  GLU C N   1 
ATOM 6427  C CA  . GLU C 1 78  ? 45.571   186.112 -13.324 1.00 0.00 ? 73  GLU C CA  1 
ATOM 6428  C C   . GLU C 1 78  ? 44.967   187.390 -12.821 1.00 0.00 ? 73  GLU C C   1 
ATOM 6429  O O   . GLU C 1 78  ? 43.764   187.552 -13.027 1.00 0.00 ? 73  GLU C O   1 
ATOM 6430  C CB  . GLU C 1 78  ? 45.426   186.173 -14.902 1.00 0.00 ? 73  GLU C CB  1 
ATOM 6431  C CG  . GLU C 1 78  ? 46.228   187.254 -15.581 1.00 0.00 ? 73  GLU C CG  1 
ATOM 6432  C CD  . GLU C 1 78  ? 47.740   187.032 -15.367 1.00 0.00 ? 73  GLU C CD  1 
ATOM 6433  O OE1 . GLU C 1 78  ? 48.154   185.876 -15.407 1.00 0.00 ? 73  GLU C OE1 1 
ATOM 6434  O OE2 . GLU C 1 78  ? 48.465   188.051 -14.986 1.00 0.00 ? 73  GLU C OE2 1 
ATOM 6435  N N   . PRO C 1 79  ? 45.670   188.348 -12.068 1.00 0.00 ? 74  PRO C N   1 
ATOM 6436  C CA  . PRO C 1 79  ? 44.905   189.301 -11.335 1.00 0.00 ? 74  PRO C CA  1 
ATOM 6437  C C   . PRO C 1 79  ? 43.980   190.278 -12.142 1.00 0.00 ? 74  PRO C C   1 
ATOM 6438  O O   . PRO C 1 79  ? 42.915   190.730 -11.646 1.00 0.00 ? 74  PRO C O   1 
ATOM 6439  C CB  . PRO C 1 79  ? 45.968   190.005 -10.643 1.00 0.00 ? 74  PRO C CB  1 
ATOM 6440  C CG  . PRO C 1 79  ? 46.959   188.888 -10.278 1.00 0.00 ? 74  PRO C CG  1 
ATOM 6441  C CD  . PRO C 1 79  ? 46.955   188.041 -11.459 1.00 0.00 ? 74  PRO C CD  1 
ATOM 6442  N N   . MET C 1 80  ? 44.285   190.574 -13.393 1.00 0.00 ? 75  MET C N   1 
ATOM 6443  C CA  . MET C 1 80  ? 43.458   191.585 -14.157 1.00 0.00 ? 75  MET C CA  1 
ATOM 6444  C C   . MET C 1 80  ? 42.193   190.889 -14.503 1.00 0.00 ? 75  MET C C   1 
ATOM 6445  O O   . MET C 1 80  ? 41.208   191.532 -14.658 1.00 0.00 ? 75  MET C O   1 
ATOM 6446  C CB  . MET C 1 80  ? 44.176   191.910 -15.467 1.00 0.00 ? 75  MET C CB  1 
ATOM 6447  C CG  . MET C 1 80  ? 43.556   192.967 -16.336 1.00 0.00 ? 75  MET C CG  1 
ATOM 6448  S SD  . MET C 1 80  ? 43.621   194.638 -15.630 1.00 0.00 ? 75  MET C SD  1 
ATOM 6449  C CE  . MET C 1 80  ? 45.391   194.895 -16.051 1.00 0.00 ? 75  MET C CE  1 
ATOM 6450  N N   . MET C 1 81  ? 42.215   189.551 -14.604 1.00 0.00 ? 76  MET C N   1 
ATOM 6451  C CA  . MET C 1 81  ? 41.088   188.841 -14.925 1.00 0.00 ? 76  MET C CA  1 
ATOM 6452  C C   . MET C 1 81  ? 40.146   188.731 -13.732 1.00 0.00 ? 76  MET C C   1 
ATOM 6453  O O   . MET C 1 81  ? 38.968   188.916 -13.875 1.00 0.00 ? 76  MET C O   1 
ATOM 6454  C CB  . MET C 1 81  ? 41.467   187.491 -15.570 1.00 0.00 ? 76  MET C CB  1 
ATOM 6455  C CG  . MET C 1 81  ? 40.187   186.638 -15.953 1.00 0.00 ? 76  MET C CG  1 
ATOM 6456  S SD  . MET C 1 81  ? 39.208   187.321 -17.268 1.00 0.00 ? 76  MET C SD  1 
ATOM 6457  C CE  . MET C 1 81  ? 38.607   185.819 -18.027 1.00 0.00 ? 76  MET C CE  1 
ATOM 6458  N N   . ALA C 1 82  ? 40.771   188.624 -12.495 1.00 0.00 ? 77  ALA C N   1 
ATOM 6459  C CA  . ALA C 1 82  ? 40.090   188.550 -11.258 1.00 0.00 ? 77  ALA C CA  1 
ATOM 6460  C C   . ALA C 1 82  ? 39.200   189.784 -11.051 1.00 0.00 ? 77  ALA C C   1 
ATOM 6461  O O   . ALA C 1 82  ? 38.081   189.589 -10.585 1.00 0.00 ? 77  ALA C O   1 
ATOM 6462  C CB  . ALA C 1 82  ? 41.064   188.292 -10.018 1.00 0.00 ? 77  ALA C CB  1 
ATOM 6463  N N   . GLU C 1 83  ? 39.719   190.999 -11.340 1.00 0.00 ? 78  GLU C N   1 
ATOM 6464  C CA  . GLU C 1 83  ? 38.805   192.147 -11.276 1.00 0.00 ? 78  GLU C CA  1 
ATOM 6465  C C   . GLU C 1 83  ? 37.888   192.384 -12.516 1.00 0.00 ? 78  GLU C C   1 
ATOM 6466  O O   . GLU C 1 83  ? 36.682   192.639 -12.350 1.00 0.00 ? 78  GLU C O   1 
ATOM 6467  C CB  . GLU C 1 83  ? 39.623   193.487 -11.112 1.00 0.00 ? 78  GLU C CB  1 
ATOM 6468  C CG  . GLU C 1 83  ? 38.674   194.714 -10.689 1.00 0.00 ? 78  GLU C CG  1 
ATOM 6469  C CD  . GLU C 1 83  ? 39.502   195.947 -10.384 1.00 0.00 ? 78  GLU C CD  1 
ATOM 6470  O OE1 . GLU C 1 83  ? 39.887   196.097 -9.192  1.00 0.00 ? 78  GLU C OE1 1 
ATOM 6471  O OE2 . GLU C 1 83  ? 39.652   196.893 -11.227 1.00 0.00 ? 78  GLU C OE2 1 
ATOM 6472  N N   . CYS C 1 84  ? 38.405   192.220 -13.767 1.00 0.00 ? 79  CYS C N   1 
ATOM 6473  C CA  . CYS C 1 84  ? 37.625   192.452 -14.987 1.00 0.00 ? 79  CYS C CA  1 
ATOM 6474  C C   . CYS C 1 84  ? 36.418   191.455 -15.010 1.00 0.00 ? 79  CYS C C   1 
ATOM 6475  O O   . CYS C 1 84  ? 35.350   191.814 -15.403 1.00 0.00 ? 79  CYS C O   1 
ATOM 6476  C CB  . CYS C 1 84  ? 38.400   192.145 -16.250 1.00 0.00 ? 79  CYS C CB  1 
ATOM 6477  S SG  . CYS C 1 84  ? 39.679   193.420 -16.638 1.00 0.00 ? 79  CYS C SG  1 
ATOM 6478  N N   . LEU C 1 85  ? 36.613   190.159 -14.555 1.00 0.00 ? 80  LEU C N   1 
ATOM 6479  C CA  . LEU C 1 85  ? 35.623   189.064 -14.648 1.00 0.00 ? 80  LEU C CA  1 
ATOM 6480  C C   . LEU C 1 85  ? 34.405   189.346 -13.731 1.00 0.00 ? 80  LEU C C   1 
ATOM 6481  O O   . LEU C 1 85  ? 33.232   189.083 -14.147 1.00 0.00 ? 80  LEU C O   1 
ATOM 6482  C CB  . LEU C 1 85  ? 36.258   187.731 -14.231 1.00 0.00 ? 80  LEU C CB  1 
ATOM 6483  C CG  . LEU C 1 85  ? 35.350   186.472 -14.382 1.00 0.00 ? 80  LEU C CG  1 
ATOM 6484  C CD1 . LEU C 1 85  ? 34.979   186.317 -15.883 1.00 0.00 ? 80  LEU C CD1 1 
ATOM 6485  C CD2 . LEU C 1 85  ? 35.957   185.128 -13.800 1.00 0.00 ? 80  LEU C CD2 1 
ATOM 6486  N N   . GLU C 1 86  ? 34.690   189.924 -12.635 1.00 0.00 ? 81  GLU C N   1 
ATOM 6487  C CA  . GLU C 1 86  ? 33.731   190.575 -11.767 1.00 0.00 ? 81  GLU C CA  1 
ATOM 6488  C C   . GLU C 1 86  ? 32.943   191.793 -12.299 1.00 0.00 ? 81  GLU C C   1 
ATOM 6489  O O   . GLU C 1 86  ? 31.719   191.918 -12.171 1.00 0.00 ? 81  GLU C O   1 
ATOM 6490  C CB  . GLU C 1 86  ? 34.435   190.946 -10.415 1.00 0.00 ? 81  GLU C CB  1 
ATOM 6491  C CG  . GLU C 1 86  ? 34.921   189.738 -9.483  1.00 0.00 ? 81  GLU C CG  1 
ATOM 6492  C CD  . GLU C 1 86  ? 33.790   188.948 -8.874  1.00 0.00 ? 81  GLU C CD  1 
ATOM 6493  O OE1 . GLU C 1 86  ? 32.835   189.579 -8.416  1.00 0.00 ? 81  GLU C OE1 1 
ATOM 6494  O OE2 . GLU C 1 86  ? 33.791   187.757 -9.013  1.00 0.00 ? 81  GLU C OE2 1 
ATOM 6495  N N   . LYS C 1 87  ? 33.618   192.712 -13.023 1.00 0.00 ? 82  LYS C N   1 
ATOM 6496  C CA  . LYS C 1 87  ? 32.912   193.723 -13.739 1.00 0.00 ? 82  LYS C CA  1 
ATOM 6497  C C   . LYS C 1 87  ? 32.061   193.083 -14.843 1.00 0.00 ? 82  LYS C C   1 
ATOM 6498  O O   . LYS C 1 87  ? 30.886   193.420 -15.062 1.00 0.00 ? 82  LYS C O   1 
ATOM 6499  C CB  . LYS C 1 87  ? 33.881   194.741 -14.415 1.00 0.00 ? 82  LYS C CB  1 
ATOM 6500  C CG  . LYS C 1 87  ? 34.982   195.337 -13.441 1.00 0.00 ? 82  LYS C CG  1 
ATOM 6501  C CD  . LYS C 1 87  ? 34.482   196.479 -12.554 1.00 0.00 ? 82  LYS C CD  1 
ATOM 6502  C CE  . LYS C 1 87  ? 35.569   196.902 -11.539 1.00 0.00 ? 82  LYS C CE  1 
ATOM 6503  N NZ  . LYS C 1 87  ? 34.986   198.059 -10.769 1.00 0.00 ? 82  LYS C NZ  1 
ATOM 6504  N N   . PHE C 1 88  ? 32.597   192.096 -15.629 1.00 0.00 ? 83  PHE C N   1 
ATOM 6505  C CA  . PHE C 1 88  ? 31.853   191.466 -16.730 1.00 0.00 ? 83  PHE C CA  1 
ATOM 6506  C C   . PHE C 1 88  ? 30.593   190.789 -16.192 1.00 0.00 ? 83  PHE C C   1 
ATOM 6507  O O   . PHE C 1 88  ? 29.477   190.929 -16.656 1.00 0.00 ? 83  PHE C O   1 
ATOM 6508  C CB  . PHE C 1 88  ? 32.530   190.394 -17.503 1.00 0.00 ? 83  PHE C CB  1 
ATOM 6509  C CG  . PHE C 1 88  ? 33.718   190.873 -18.330 1.00 0.00 ? 83  PHE C CG  1 
ATOM 6510  C CD1 . PHE C 1 88  ? 34.068   192.219 -18.540 1.00 0.00 ? 83  PHE C CD1 1 
ATOM 6511  C CD2 . PHE C 1 88  ? 34.542   189.893 -19.000 1.00 0.00 ? 83  PHE C CD2 1 
ATOM 6512  C CE1 . PHE C 1 88  ? 35.171   192.604 -19.335 1.00 0.00 ? 83  PHE C CE1 1 
ATOM 6513  C CE2 . PHE C 1 88  ? 35.724   190.268 -19.678 1.00 0.00 ? 83  PHE C CE2 1 
ATOM 6514  C CZ  . PHE C 1 88  ? 35.980   191.614 -19.900 1.00 0.00 ? 83  PHE C CZ  1 
ATOM 6515  N N   . THR C 1 89  ? 30.772   190.012 -15.096 1.00 0.00 ? 84  THR C N   1 
ATOM 6516  C CA  . THR C 1 89  ? 29.710   189.258 -14.405 1.00 0.00 ? 84  THR C CA  1 
ATOM 6517  C C   . THR C 1 89  ? 28.542   190.098 -13.928 1.00 0.00 ? 84  THR C C   1 
ATOM 6518  O O   . THR C 1 89  ? 27.427   189.787 -14.315 1.00 0.00 ? 84  THR C O   1 
ATOM 6519  C CB  . THR C 1 89  ? 30.181   188.452 -13.140 1.00 0.00 ? 84  THR C CB  1 
ATOM 6520  O OG1 . THR C 1 89  ? 31.127   187.479 -13.444 1.00 0.00 ? 84  THR C OG1 1 
ATOM 6521  C CG2 . THR C 1 89  ? 29.035   187.727 -12.427 1.00 0.00 ? 84  THR C CG2 1 
ATOM 6522  N N   . VAL C 1 90  ? 28.755   191.217 -13.223 1.00 0.00 ? 85  VAL C N   1 
ATOM 6523  C CA  . VAL C 1 90  ? 27.668   191.983 -12.719 1.00 0.00 ? 85  VAL C CA  1 
ATOM 6524  C C   . VAL C 1 90  ? 26.917   192.593 -13.953 1.00 0.00 ? 85  VAL C C   1 
ATOM 6525  O O   . VAL C 1 90  ? 25.722   192.481 -14.037 1.00 0.00 ? 85  VAL C O   1 
ATOM 6526  C CB  . VAL C 1 90  ? 28.032   193.048 -11.679 1.00 0.00 ? 85  VAL C CB  1 
ATOM 6527  C CG1 . VAL C 1 90  ? 28.833   194.178 -12.406 1.00 0.00 ? 85  VAL C CG1 1 
ATOM 6528  C CG2 . VAL C 1 90  ? 26.817   193.817 -11.095 1.00 0.00 ? 85  VAL C CG2 1 
ATOM 6529  N N   . SER C 1 91  ? 27.584   193.156 -15.011 1.00 0.00 ? 86  SER C N   1 
ATOM 6530  C CA  . SER C 1 91  ? 27.110   193.695 -16.270 1.00 0.00 ? 86  SER C CA  1 
ATOM 6531  C C   . SER C 1 91  ? 26.313   192.666 -17.159 1.00 0.00 ? 86  SER C C   1 
ATOM 6532  O O   . SER C 1 91  ? 25.227   192.917 -17.669 1.00 0.00 ? 86  SER C O   1 
ATOM 6533  C CB  . SER C 1 91  ? 28.291   194.215 -17.088 1.00 0.00 ? 86  SER C CB  1 
ATOM 6534  O OG  . SER C 1 91  ? 27.880   194.970 -18.185 1.00 0.00 ? 86  SER C OG  1 
ATOM 6535  N N   . LEU C 1 92  ? 26.826   191.411 -17.330 1.00 0.00 ? 87  LEU C N   1 
ATOM 6536  C CA  . LEU C 1 92  ? 26.195   190.373 -18.099 1.00 0.00 ? 87  LEU C CA  1 
ATOM 6537  C C   . LEU C 1 92  ? 24.876   189.981 -17.518 1.00 0.00 ? 87  LEU C C   1 
ATOM 6538  O O   . LEU C 1 92  ? 23.889   189.848 -18.227 1.00 0.00 ? 87  LEU C O   1 
ATOM 6539  C CB  . LEU C 1 92  ? 27.118   189.103 -18.100 1.00 0.00 ? 87  LEU C CB  1 
ATOM 6540  C CG  . LEU C 1 92  ? 28.324   189.155 -19.019 1.00 0.00 ? 87  LEU C CG  1 
ATOM 6541  C CD1 . LEU C 1 92  ? 29.256   188.031 -18.505 1.00 0.00 ? 87  LEU C CD1 1 
ATOM 6542  C CD2 . LEU C 1 92  ? 27.851   188.763 -20.444 1.00 0.00 ? 87  LEU C CD2 1 
ATOM 6543  N N   . ASN C 1 93  ? 24.828   189.729 -16.228 1.00 0.00 ? 88  ASN C N   1 
ATOM 6544  C CA  . ASN C 1 93  ? 23.561   189.393 -15.443 1.00 0.00 ? 88  ASN C CA  1 
ATOM 6545  C C   . ASN C 1 93  ? 22.595   190.553 -15.495 1.00 0.00 ? 88  ASN C C   1 
ATOM 6546  O O   . ASN C 1 93  ? 21.382   190.339 -15.677 1.00 0.00 ? 88  ASN C O   1 
ATOM 6547  C CB  . ASN C 1 93  ? 23.971   189.175 -13.910 1.00 0.00 ? 88  ASN C CB  1 
ATOM 6548  C CG  . ASN C 1 93  ? 24.377   187.706 -13.695 1.00 0.00 ? 88  ASN C CG  1 
ATOM 6549  O OD1 . ASN C 1 93  ? 23.664   186.755 -14.010 1.00 0.00 ? 88  ASN C OD1 1 
ATOM 6550  N ND2 . ASN C 1 93  ? 25.610   187.452 -13.309 1.00 0.00 ? 88  ASN C ND2 1 
ATOM 6551  N N   . HIS C 1 94  ? 23.195   191.746 -15.529 1.00 0.00 ? 89  HIS C N   1 
ATOM 6552  C CA  . HIS C 1 94  ? 22.415   193.022 -15.519 1.00 0.00 ? 89  HIS C CA  1 
ATOM 6553  C C   . HIS C 1 94  ? 21.622   193.121 -16.826 1.00 0.00 ? 89  HIS C C   1 
ATOM 6554  O O   . HIS C 1 94  ? 20.425   193.395 -16.784 1.00 0.00 ? 89  HIS C O   1 
ATOM 6555  C CB  . HIS C 1 94  ? 23.295   194.289 -15.337 1.00 0.00 ? 89  HIS C CB  1 
ATOM 6556  C CG  . HIS C 1 94  ? 22.624   195.651 -15.176 1.00 0.00 ? 89  HIS C CG  1 
ATOM 6557  N ND1 . HIS C 1 94  ? 23.188   196.860 -15.472 1.00 0.00 ? 89  HIS C ND1 1 
ATOM 6558  C CD2 . HIS C 1 94  ? 21.471   195.937 -14.516 1.00 0.00 ? 89  HIS C CD2 1 
ATOM 6559  C CE1 . HIS C 1 94  ? 22.375   197.803 -15.053 1.00 0.00 ? 89  HIS C CE1 1 
ATOM 6560  N NE2 . HIS C 1 94  ? 21.286   197.316 -14.410 1.00 0.00 ? 89  HIS C NE2 1 
ATOM 6561  N N   . LYS C 1 95  ? 22.169   192.696 -17.975 1.00 0.00 ? 90  LYS C N   1 
ATOM 6562  C CA  . LYS C 1 95  ? 21.391   192.609 -19.183 1.00 0.00 ? 90  LYS C CA  1 
ATOM 6563  C C   . LYS C 1 95  ? 20.238   191.531 -19.069 1.00 0.00 ? 90  LYS C C   1 
ATOM 6564  O O   . LYS C 1 95  ? 19.113   191.678 -19.647 1.00 0.00 ? 90  LYS C O   1 
ATOM 6565  C CB  . LYS C 1 95  ? 22.293   192.295 -20.365 1.00 0.00 ? 90  LYS C CB  1 
ATOM 6566  C CG  . LYS C 1 95  ? 23.300   193.452 -20.619 1.00 0.00 ? 90  LYS C CG  1 
ATOM 6567  C CD  . LYS C 1 95  ? 24.254   193.159 -21.767 1.00 0.00 ? 90  LYS C CD  1 
ATOM 6568  C CE  . LYS C 1 95  ? 25.224   194.321 -22.016 1.00 0.00 ? 90  LYS C CE  1 
ATOM 6569  N NZ  . LYS C 1 95  ? 26.027   194.683 -20.828 1.00 0.00 ? 90  LYS C NZ  1 
ATOM 6570  N N   . LEU C 1 96  ? 20.468   190.381 -18.356 1.00 0.00 ? 91  LEU C N   1 
ATOM 6571  C CA  . LEU C 1 96  ? 19.441   189.306 -18.319 1.00 0.00 ? 91  LEU C CA  1 
ATOM 6572  C C   . LEU C 1 96  ? 18.245   189.701 -17.432 1.00 0.00 ? 91  LEU C C   1 
ATOM 6573  O O   . LEU C 1 96  ? 17.092   189.464 -17.908 1.00 0.00 ? 91  LEU C O   1 
ATOM 6574  C CB  . LEU C 1 96  ? 20.184   188.045 -17.732 1.00 0.00 ? 91  LEU C CB  1 
ATOM 6575  C CG  . LEU C 1 96  ? 21.337   187.409 -18.491 1.00 0.00 ? 91  LEU C CG  1 
ATOM 6576  C CD1 . LEU C 1 96  ? 21.815   186.180 -17.834 1.00 0.00 ? 91  LEU C CD1 1 
ATOM 6577  C CD2 . LEU C 1 96  ? 20.970   187.155 -19.960 1.00 0.00 ? 91  LEU C CD2 1 
ATOM 6578  N N   . ASP C 1 97  ? 18.448   190.398 -16.282 1.00 0.00 ? 92  ASP C N   1 
ATOM 6579  C CA  . ASP C 1 97  ? 17.385   190.864 -15.479 1.00 0.00 ? 92  ASP C CA  1 
ATOM 6580  C C   . ASP C 1 97  ? 16.606   192.060 -16.143 1.00 0.00 ? 92  ASP C C   1 
ATOM 6581  O O   . ASP C 1 97  ? 15.451   192.275 -15.930 1.00 0.00 ? 92  ASP C O   1 
ATOM 6582  C CB  . ASP C 1 97  ? 17.879   191.290 -14.054 1.00 0.00 ? 92  ASP C CB  1 
ATOM 6583  C CG  . ASP C 1 97  ? 18.195   190.017 -13.400 1.00 0.00 ? 92  ASP C CG  1 
ATOM 6584  O OD1 . ASP C 1 97  ? 17.316   189.155 -13.100 1.00 0.00 ? 92  ASP C OD1 1 
ATOM 6585  O OD2 . ASP C 1 97  ? 19.338   189.794 -13.067 1.00 0.00 ? 92  ASP C OD2 1 
ATOM 6586  N N   . SER C 1 98  ? 17.281   192.922 -16.819 1.00 0.00 ? 93  SER C N   1 
ATOM 6587  C CA  . SER C 1 98  ? 16.616   193.829 -17.693 1.00 0.00 ? 93  SER C CA  1 
ATOM 6588  C C   . SER C 1 98  ? 15.810   193.123 -18.832 1.00 0.00 ? 93  SER C C   1 
ATOM 6589  O O   . SER C 1 98  ? 14.658   193.475 -19.046 1.00 0.00 ? 93  SER C O   1 
ATOM 6590  C CB  . SER C 1 98  ? 17.687   194.724 -18.318 1.00 0.00 ? 93  SER C CB  1 
ATOM 6591  O OG  . SER C 1 98  ? 17.327   195.633 -19.348 1.00 0.00 ? 93  SER C OG  1 
ATOM 6592  N N   . HIS C 1 99  ? 16.254   192.016 -19.474 1.00 0.00 ? 94  HIS C N   1 
ATOM 6593  C CA  . HIS C 1 99  ? 15.567   191.476 -20.596 1.00 0.00 ? 94  HIS C CA  1 
ATOM 6594  C C   . HIS C 1 99  ? 14.427   190.644 -20.121 1.00 0.00 ? 94  HIS C C   1 
ATOM 6595  O O   . HIS C 1 99  ? 13.319   190.553 -20.687 1.00 0.00 ? 94  HIS C O   1 
ATOM 6596  C CB  . HIS C 1 99  ? 16.525   190.672 -21.491 1.00 0.00 ? 94  HIS C CB  1 
ATOM 6597  C CG  . HIS C 1 99  ? 15.972   190.459 -22.945 1.00 0.00 ? 94  HIS C CG  1 
ATOM 6598  N ND1 . HIS C 1 99  ? 16.219   191.351 -23.959 1.00 0.00 ? 94  HIS C ND1 1 
ATOM 6599  C CD2 . HIS C 1 99  ? 15.272   189.442 -23.519 1.00 0.00 ? 94  HIS C CD2 1 
ATOM 6600  C CE1 . HIS C 1 99  ? 15.687   190.867 -25.087 1.00 0.00 ? 94  HIS C CE1 1 
ATOM 6601  N NE2 . HIS C 1 99  ? 15.163   189.673 -24.899 1.00 0.00 ? 94  HIS C NE2 1 
ATOM 6602  N N   . ALA C 1 100 ? 14.535   190.220 -18.821 1.00 0.00 ? 95  ALA C N   1 
ATOM 6603  C CA  . ALA C 1 100 ? 13.437   189.444 -18.102 1.00 0.00 ? 95  ALA C CA  1 
ATOM 6604  C C   . ALA C 1 100 ? 12.297   190.314 -17.712 1.00 0.00 ? 95  ALA C C   1 
ATOM 6605  O O   . ALA C 1 100 ? 11.168   189.936 -17.939 1.00 0.00 ? 95  ALA C O   1 
ATOM 6606  C CB  . ALA C 1 100 ? 14.017   188.721 -16.889 1.00 0.00 ? 95  ALA C CB  1 
ATOM 6607  N N   . GLU C 1 101 ? 12.609   191.597 -17.252 1.00 0.00 ? 96  GLU C N   1 
ATOM 6608  C CA  . GLU C 1 101 ? 11.720   192.710 -17.134 1.00 0.00 ? 96  GLU C CA  1 
ATOM 6609  C C   . GLU C 1 101 ? 11.012   193.072 -18.460 1.00 0.00 ? 96  GLU C C   1 
ATOM 6610  O O   . GLU C 1 101 ? 9.811    193.301 -18.562 1.00 0.00 ? 96  GLU C O   1 
ATOM 6611  C CB  . GLU C 1 101 ? 12.411   194.044 -16.732 1.00 0.00 ? 96  GLU C CB  1 
ATOM 6612  C CG  . GLU C 1 101 ? 11.511   195.110 -16.137 1.00 0.00 ? 96  GLU C CG  1 
ATOM 6613  C CD  . GLU C 1 101 ? 12.277   196.266 -15.589 1.00 0.00 ? 96  GLU C CD  1 
ATOM 6614  O OE1 . GLU C 1 101 ? 13.484   196.405 -15.844 1.00 0.00 ? 96  GLU C OE1 1 
ATOM 6615  O OE2 . GLU C 1 101 ? 11.721   197.098 -14.879 1.00 0.00 ? 96  GLU C OE2 1 
ATOM 6616  N N   . LEU C 1 102 ? 11.756   193.026 -19.606 1.00 0.00 ? 97  LEU C N   1 
ATOM 6617  C CA  . LEU C 1 102 ? 11.164   193.259 -20.903 1.00 0.00 ? 97  LEU C CA  1 
ATOM 6618  C C   . LEU C 1 102 ? 10.018   192.205 -21.182 1.00 0.00 ? 97  LEU C C   1 
ATOM 6619  O O   . LEU C 1 102 ? 9.031    192.459 -21.856 1.00 0.00 ? 97  LEU C O   1 
ATOM 6620  C CB  . LEU C 1 102 ? 12.265   193.222 -21.865 1.00 0.00 ? 97  LEU C CB  1 
ATOM 6621  C CG  . LEU C 1 102 ? 11.811   193.370 -23.378 1.00 0.00 ? 97  LEU C CG  1 
ATOM 6622  C CD1 . LEU C 1 102 ? 12.953   194.021 -24.177 1.00 0.00 ? 97  LEU C CD1 1 
ATOM 6623  C CD2 . LEU C 1 102 ? 11.530   192.094 -24.134 1.00 0.00 ? 97  LEU C CD2 1 
ATOM 6624  N N   . LEU C 1 103 ? 10.133   190.962 -20.750 1.00 0.00 ? 98  LEU C N   1 
ATOM 6625  C CA  . LEU C 1 103 ? 9.042    189.903 -20.882 1.00 0.00 ? 98  LEU C CA  1 
ATOM 6626  C C   . LEU C 1 103 ? 7.892    190.142 -20.064 1.00 0.00 ? 98  LEU C C   1 
ATOM 6627  O O   . LEU C 1 103 ? 6.773    190.083 -20.505 1.00 0.00 ? 98  LEU C O   1 
ATOM 6628  C CB  . LEU C 1 103 ? 9.445    188.417 -20.770 1.00 0.00 ? 98  LEU C CB  1 
ATOM 6629  C CG  . LEU C 1 103 ? 10.488   188.080 -21.800 1.00 0.00 ? 98  LEU C CG  1 
ATOM 6630  C CD1 . LEU C 1 103 ? 11.199   186.799 -21.397 1.00 0.00 ? 98  LEU C CD1 1 
ATOM 6631  C CD2 . LEU C 1 103 ? 9.930    187.814 -23.224 1.00 0.00 ? 98  LEU C CD2 1 
ATOM 6632  N N   . ASP C 1 104 ? 8.186    190.525 -18.825 1.00 0.00 ? 99  ASP C N   1 
ATOM 6633  C CA  . ASP C 1 104 ? 7.099    190.816 -17.934 1.00 0.00 ? 99  ASP C CA  1 
ATOM 6634  C C   . ASP C 1 104 ? 6.334    192.016 -18.418 1.00 0.00 ? 99  ASP C C   1 
ATOM 6635  O O   . ASP C 1 104 ? 5.080    192.102 -18.386 1.00 0.00 ? 99  ASP C O   1 
ATOM 6636  C CB  . ASP C 1 104 ? 7.646    190.997 -16.483 1.00 0.00 ? 99  ASP C CB  1 
ATOM 6637  C CG  . ASP C 1 104 ? 7.807    189.631 -15.735 1.00 0.00 ? 99  ASP C CG  1 
ATOM 6638  O OD1 . ASP C 1 104 ? 7.532    188.568 -16.300 1.00 0.00 ? 99  ASP C OD1 1 
ATOM 6639  O OD2 . ASP C 1 104 ? 8.076    189.715 -14.534 1.00 0.00 ? 99  ASP C OD2 1 
ATOM 6640  N N   . ALA C 1 105 ? 7.059    192.992 -18.998 1.00 0.00 ? 100 ALA C N   1 
ATOM 6641  C CA  . ALA C 1 105 ? 6.468    194.034 -19.705 1.00 0.00 ? 100 ALA C CA  1 
ATOM 6642  C C   . ALA C 1 105 ? 5.640    193.752 -20.929 1.00 0.00 ? 100 ALA C C   1 
ATOM 6643  O O   . ALA C 1 105 ? 4.548    194.216 -21.125 1.00 0.00 ? 100 ALA C O   1 
ATOM 6644  C CB  . ALA C 1 105 ? 7.623    195.021 -20.032 1.00 0.00 ? 100 ALA C CB  1 
ATOM 6645  N N   . THR C 1 106 ? 6.126    192.798 -21.719 1.00 0.00 ? 101 THR C N   1 
ATOM 6646  C CA  . THR C 1 106 ? 5.443    192.154 -22.768 1.00 0.00 ? 101 THR C CA  1 
ATOM 6647  C C   . THR C 1 106 ? 4.109    191.498 -22.347 1.00 0.00 ? 101 THR C C   1 
ATOM 6648  O O   . THR C 1 106 ? 3.112    191.580 -23.050 1.00 0.00 ? 101 THR C O   1 
ATOM 6649  C CB  . THR C 1 106 ? 6.290    191.246 -23.592 1.00 0.00 ? 101 THR C CB  1 
ATOM 6650  O OG1 . THR C 1 106 ? 7.628    191.730 -23.986 1.00 0.00 ? 101 THR C OG1 1 
ATOM 6651  C CG2 . THR C 1 106 ? 5.556    190.924 -24.818 1.00 0.00 ? 101 THR C CG2 1 
ATOM 6652  N N   . GLN C 1 107 ? 4.151    190.681 -21.283 1.00 0.00 ? 102 GLN C N   1 
ATOM 6653  C CA  . GLN C 1 107 ? 3.041    190.004 -20.651 1.00 0.00 ? 102 GLN C CA  1 
ATOM 6654  C C   . GLN C 1 107 ? 2.047    191.033 -20.251 1.00 0.00 ? 102 GLN C C   1 
ATOM 6655  O O   . GLN C 1 107 ? 0.854    190.873 -20.570 1.00 0.00 ? 102 GLN C O   1 
ATOM 6656  C CB  . GLN C 1 107 ? 3.539    189.059 -19.515 1.00 0.00 ? 102 GLN C CB  1 
ATOM 6657  C CG  . GLN C 1 107 ? 2.433    188.065 -19.030 1.00 0.00 ? 102 GLN C CG  1 
ATOM 6658  C CD  . GLN C 1 107 ? 3.064    186.910 -18.337 1.00 0.00 ? 102 GLN C CD  1 
ATOM 6659  O OE1 . GLN C 1 107 ? 4.310    186.868 -18.266 1.00 0.00 ? 102 GLN C OE1 1 
ATOM 6660  N NE2 . GLN C 1 107 ? 2.199    185.917 -17.838 1.00 0.00 ? 102 GLN C NE2 1 
ATOM 6661  N N   . HIS C 1 108 ? 2.442    192.082 -19.594 1.00 0.00 ? 103 HIS C N   1 
ATOM 6662  C CA  . HIS C 1 108 ? 1.558    193.164 -19.211 1.00 0.00 ? 103 HIS C CA  1 
ATOM 6663  C C   . HIS C 1 108 ? 0.760    193.950 -20.240 1.00 0.00 ? 103 HIS C C   1 
ATOM 6664  O O   . HIS C 1 108 ? -0.424   194.207 -20.183 1.00 0.00 ? 103 HIS C O   1 
ATOM 6665  C CB  . HIS C 1 108 ? 2.337    194.143 -18.327 1.00 0.00 ? 103 HIS C CB  1 
ATOM 6666  C CG  . HIS C 1 108 ? 1.560    195.226 -17.594 1.00 0.00 ? 103 HIS C CG  1 
ATOM 6667  N ND1 . HIS C 1 108 ? 1.462    196.534 -18.077 1.00 0.00 ? 103 HIS C ND1 1 
ATOM 6668  C CD2 . HIS C 1 108 ? 0.872    195.194 -16.379 1.00 0.00 ? 103 HIS C CD2 1 
ATOM 6669  C CE1 . HIS C 1 108 ? 0.861    197.238 -17.096 1.00 0.00 ? 103 HIS C CE1 1 
ATOM 6670  N NE2 . HIS C 1 108 ? 0.522    196.448 -16.052 1.00 0.00 ? 103 HIS C NE2 1 
ATOM 6671  N N   . THR C 1 109 ? 1.523    194.321 -21.305 1.00 0.00 ? 104 THR C N   1 
ATOM 6672  C CA  . THR C 1 109 ? 0.923    195.041 -22.425 1.00 0.00 ? 104 THR C CA  1 
ATOM 6673  C C   . THR C 1 109 ? -0.134   194.162 -23.173 1.00 0.00 ? 104 THR C C   1 
ATOM 6674  O O   . THR C 1 109 ? -1.250   194.632 -23.463 1.00 0.00 ? 104 THR C O   1 
ATOM 6675  C CB  . THR C 1 109 ? 1.949    195.723 -23.394 1.00 0.00 ? 104 THR C CB  1 
ATOM 6676  O OG1 . THR C 1 109 ? 1.350    196.436 -24.427 1.00 0.00 ? 104 THR C OG1 1 
ATOM 6677  C CG2 . THR C 1 109 ? 2.897    194.690 -23.931 1.00 0.00 ? 104 THR C CG2 1 
ATOM 6678  N N   . LEU C 1 110 ? 0.187    192.833 -23.367 1.00 0.00 ? 105 LEU C N   1 
ATOM 6679  C CA  . LEU C 1 110 ? -0.762   191.891 -23.929 1.00 0.00 ? 105 LEU C CA  1 
ATOM 6680  C C   . LEU C 1 110 ? -2.028   191.838 -23.106 1.00 0.00 ? 105 LEU C C   1 
ATOM 6681  O O   . LEU C 1 110 ? -3.090   191.627 -23.692 1.00 0.00 ? 105 LEU C O   1 
ATOM 6682  C CB  . LEU C 1 110 ? -0.004   190.509 -23.919 1.00 0.00 ? 105 LEU C CB  1 
ATOM 6683  C CG  . LEU C 1 110 ? -0.711   189.432 -24.777 1.00 0.00 ? 105 LEU C CG  1 
ATOM 6684  C CD1 . LEU C 1 110 ? -0.341   189.733 -26.231 1.00 0.00 ? 105 LEU C CD1 1 
ATOM 6685  C CD2 . LEU C 1 110 ? -0.098   188.070 -24.402 1.00 0.00 ? 105 LEU C CD2 1 
ATOM 6686  N N   . GLN C 1 111 ? -1.976   191.914 -21.739 1.00 0.00 ? 106 GLN C N   1 
ATOM 6687  C CA  . GLN C 1 111 ? -3.156   191.898 -20.896 1.00 0.00 ? 106 GLN C CA  1 
ATOM 6688  C C   . GLN C 1 111 ? -3.962   193.237 -20.987 1.00 0.00 ? 106 GLN C C   1 
ATOM 6689  O O   . GLN C 1 111 ? -5.138   193.275 -21.313 1.00 0.00 ? 106 GLN C O   1 
ATOM 6690  C CB  . GLN C 1 111 ? -2.733   191.633 -19.368 1.00 0.00 ? 106 GLN C CB  1 
ATOM 6691  C CG  . GLN C 1 111 ? -3.793   191.442 -18.286 1.00 0.00 ? 106 GLN C CG  1 
ATOM 6692  C CD  . GLN C 1 111 ? -4.669   190.168 -18.485 1.00 0.00 ? 106 GLN C CD  1 
ATOM 6693  O OE1 . GLN C 1 111 ? -5.885   190.377 -18.748 1.00 0.00 ? 106 GLN C OE1 1 
ATOM 6694  N NE2 . GLN C 1 111 ? -4.094   188.924 -18.332 1.00 0.00 ? 106 GLN C NE2 1 
ATOM 6695  N N   . GLN C 1 112 ? -3.235   194.418 -20.920 1.00 0.00 ? 107 GLN C N   1 
ATOM 6696  C CA  . GLN C 1 112 ? -3.812   195.745 -20.944 1.00 0.00 ? 107 GLN C CA  1 
ATOM 6697  C C   . GLN C 1 112 ? -4.506   196.035 -22.195 1.00 0.00 ? 107 GLN C C   1 
ATOM 6698  O O   . GLN C 1 112 ? -5.585   196.591 -22.261 1.00 0.00 ? 107 GLN C O   1 
ATOM 6699  C CB  . GLN C 1 112 ? -2.658   196.744 -20.492 1.00 0.00 ? 107 GLN C CB  1 
ATOM 6700  C CG  . GLN C 1 112 ? -3.269   198.188 -20.168 1.00 0.00 ? 107 GLN C CG  1 
ATOM 6701  C CD  . GLN C 1 112 ? -2.234   199.273 -19.788 1.00 0.00 ? 107 GLN C CD  1 
ATOM 6702  O OE1 . GLN C 1 112 ? -1.372   199.612 -20.602 1.00 0.00 ? 107 GLN C OE1 1 
ATOM 6703  N NE2 . GLN C 1 112 ? -2.208   199.763 -18.478 1.00 0.00 ? 107 GLN C NE2 1 
ATOM 6704  N N   . GLN C 1 113 ? -3.839   195.625 -23.308 1.00 0.00 ? 108 GLN C N   1 
ATOM 6705  C CA  . GLN C 1 113 ? -4.298   195.818 -24.672 1.00 0.00 ? 108 GLN C CA  1 
ATOM 6706  C C   . GLN C 1 113 ? -5.058   194.653 -25.239 1.00 0.00 ? 108 GLN C C   1 
ATOM 6707  O O   . GLN C 1 113 ? -6.278   194.751 -25.198 1.00 0.00 ? 108 GLN C O   1 
ATOM 6708  C CB  . GLN C 1 113 ? -3.166   196.170 -25.738 1.00 0.00 ? 108 GLN C CB  1 
ATOM 6709  C CG  . GLN C 1 113 ? -2.514   197.584 -25.560 1.00 0.00 ? 108 GLN C CG  1 
ATOM 6710  C CD  . GLN C 1 113 ? -2.133   198.126 -24.162 1.00 0.00 ? 108 GLN C CD  1 
ATOM 6711  O OE1 . GLN C 1 113 ? -1.132   197.939 -23.527 1.00 0.00 ? 108 GLN C OE1 1 
ATOM 6712  N NE2 . GLN C 1 113 ? -3.041   198.923 -23.611 1.00 0.00 ? 108 GLN C NE2 1 
ATOM 6713  N N   . ILE C 1 114 ? -4.485   193.649 -25.943 1.00 0.00 ? 109 ILE C N   1 
ATOM 6714  C CA  . ILE C 1 114 ? -5.118   192.603 -26.722 1.00 0.00 ? 109 ILE C CA  1 
ATOM 6715  C C   . ILE C 1 114 ? -6.157   191.775 -25.964 1.00 0.00 ? 109 ILE C C   1 
ATOM 6716  O O   . ILE C 1 114 ? -7.246   191.667 -26.475 1.00 0.00 ? 109 ILE C O   1 
ATOM 6717  C CB  . ILE C 1 114 ? -4.077   191.750 -27.399 1.00 0.00 ? 109 ILE C CB  1 
ATOM 6718  C CG1 . ILE C 1 114 ? -3.136   192.589 -28.265 1.00 0.00 ? 109 ILE C CG1 1 
ATOM 6719  C CG2 . ILE C 1 114 ? -4.702   190.584 -28.271 1.00 0.00 ? 109 ILE C CG2 1 
ATOM 6720  C CD1 . ILE C 1 114 ? -3.755   193.604 -29.238 1.00 0.00 ? 109 ILE C CD1 1 
ATOM 6721  N N   . GLN C 1 115 ? -5.860   191.306 -24.770 1.00 0.00 ? 110 GLN C N   1 
ATOM 6722  C CA  . GLN C 1 115 ? -6.865   190.590 -24.015 1.00 0.00 ? 110 GLN C CA  1 
ATOM 6723  C C   . GLN C 1 115 ? -8.134   191.415 -23.611 1.00 0.00 ? 110 GLN C C   1 
ATOM 6724  O O   . GLN C 1 115 ? -9.265   190.936 -23.820 1.00 0.00 ? 110 GLN C O   1 
ATOM 6725  C CB  . GLN C 1 115 ? -6.158   189.838 -22.894 1.00 0.00 ? 110 GLN C CB  1 
ATOM 6726  C CG  . GLN C 1 115 ? -7.205   189.142 -22.067 1.00 0.00 ? 110 GLN C CG  1 
ATOM 6727  C CD  . GLN C 1 115 ? -8.124   188.129 -22.679 1.00 0.00 ? 110 GLN C CD  1 
ATOM 6728  O OE1 . GLN C 1 115 ? -9.300   187.992 -22.305 1.00 0.00 ? 110 GLN C OE1 1 
ATOM 6729  N NE2 . GLN C 1 115 ? -7.631   187.337 -23.652 1.00 0.00 ? 110 GLN C NE2 1 
ATOM 6730  N N   . THR C 1 116 ? -7.931   192.677 -23.113 1.00 0.00 ? 111 THR C N   1 
ATOM 6731  C CA  . THR C 1 116 ? -8.980   193.665 -22.873 1.00 0.00 ? 111 THR C CA  1 
ATOM 6732  C C   . THR C 1 116 ? -9.818   193.853 -24.138 1.00 0.00 ? 111 THR C C   1 
ATOM 6733  O O   . THR C 1 116 ? -11.011  193.977 -24.122 1.00 0.00 ? 111 THR C O   1 
ATOM 6734  C CB  . THR C 1 116 ? -8.475   195.025 -22.438 1.00 0.00 ? 111 THR C CB  1 
ATOM 6735  O OG1 . THR C 1 116 ? -7.640   194.967 -21.328 1.00 0.00 ? 111 THR C OG1 1 
ATOM 6736  C CG2 . THR C 1 116 ? -9.521   196.094 -22.141 1.00 0.00 ? 111 THR C CG2 1 
ATOM 6737  N N   . LEU C 1 117 ? -9.129   193.963 -25.294 1.00 0.00 ? 112 LEU C N   1 
ATOM 6738  C CA  . LEU C 1 117 ? -9.714   194.113 -26.582 1.00 0.00 ? 112 LEU C CA  1 
ATOM 6739  C C   . LEU C 1 117 ? -10.669  192.997 -27.103 1.00 0.00 ? 112 LEU C C   1 
ATOM 6740  O O   . LEU C 1 117 ? -11.821  193.221 -27.460 1.00 0.00 ? 112 LEU C O   1 
ATOM 6741  C CB  . LEU C 1 117 ? -8.596   194.583 -27.618 1.00 0.00 ? 112 LEU C CB  1 
ATOM 6742  C CG  . LEU C 1 117 ? -9.171   195.225 -28.944 1.00 0.00 ? 112 LEU C CG  1 
ATOM 6743  C CD1 . LEU C 1 117 ? -9.713   196.619 -28.628 1.00 0.00 ? 112 LEU C CD1 1 
ATOM 6744  C CD2 . LEU C 1 117 ? -8.037   195.455 -30.016 1.00 0.00 ? 112 LEU C CD2 1 
ATOM 6745  N N   . VAL C 1 118 ? -10.336  191.732 -26.979 1.00 0.00 ? 113 VAL C N   1 
ATOM 6746  C CA  . VAL C 1 118 ? -11.141  190.621 -27.386 1.00 0.00 ? 113 VAL C CA  1 
ATOM 6747  C C   . VAL C 1 118 ? -12.227  190.375 -26.312 1.00 0.00 ? 113 VAL C C   1 
ATOM 6748  O O   . VAL C 1 118 ? -13.439  190.217 -26.584 1.00 0.00 ? 113 VAL C O   1 
ATOM 6749  C CB  . VAL C 1 118 ? -10.309  189.353 -27.734 1.00 0.00 ? 113 VAL C CB  1 
ATOM 6750  C CG1 . VAL C 1 118 ? -9.762   188.600 -26.472 1.00 0.00 ? 113 VAL C CG1 1 
ATOM 6751  C CG2 . VAL C 1 118 ? -10.996  188.436 -28.691 1.00 0.00 ? 113 VAL C CG2 1 
ATOM 6752  N N   . LYS C 1 119 ? -11.886  190.532 -25.023 1.00 0.00 ? 114 LYS C N   1 
ATOM 6753  C CA  . LYS C 1 119 ? -12.756  190.416 -23.841 1.00 0.00 ? 114 LYS C CA  1 
ATOM 6754  C C   . LYS C 1 119 ? -13.843  191.512 -23.811 1.00 0.00 ? 114 LYS C C   1 
ATOM 6755  O O   . LYS C 1 119 ? -14.999  191.194 -23.762 1.00 0.00 ? 114 LYS C O   1 
ATOM 6756  C CB  . LYS C 1 119 ? -11.904  190.465 -22.557 1.00 0.00 ? 114 LYS C CB  1 
ATOM 6757  C CG  . LYS C 1 119 ? -12.738  189.954 -21.370 1.00 0.00 ? 114 LYS C CG  1 
ATOM 6758  C CD  . LYS C 1 119 ? -12.002  189.793 -20.066 1.00 0.00 ? 114 LYS C CD  1 
ATOM 6759  C CE  . LYS C 1 119 ? -12.108  191.101 -19.196 1.00 0.00 ? 114 LYS C CE  1 
ATOM 6760  N NZ  . LYS C 1 119 ? -13.457  191.417 -18.752 1.00 0.00 ? 114 LYS C NZ  1 
ATOM 6761  N N   . GLU C 1 120 ? -13.562  192.786 -23.876 1.00 0.00 ? 115 GLU C N   1 
ATOM 6762  C CA  . GLU C 1 120 ? -14.518  193.862 -23.722 1.00 0.00 ? 115 GLU C CA  1 
ATOM 6763  C C   . GLU C 1 120 ? -15.052  194.257 -25.111 1.00 0.00 ? 115 GLU C C   1 
ATOM 6764  O O   . GLU C 1 120 ? -16.220  194.508 -25.297 1.00 0.00 ? 115 GLU C O   1 
ATOM 6765  C CB  . GLU C 1 120 ? -13.821  195.035 -22.998 1.00 0.00 ? 115 GLU C CB  1 
ATOM 6766  C CG  . GLU C 1 120 ? -13.496  194.599 -21.496 1.00 0.00 ? 115 GLU C CG  1 
ATOM 6767  C CD  . GLU C 1 120 ? -14.724  194.157 -20.670 1.00 0.00 ? 115 GLU C CD  1 
ATOM 6768  O OE1 . GLU C 1 120 ? -15.608  194.979 -20.411 1.00 0.00 ? 115 GLU C OE1 1 
ATOM 6769  O OE2 . GLU C 1 120 ? -14.806  192.951 -20.252 1.00 0.00 ? 115 GLU C OE2 1 
ATOM 6770  N N   . GLY C 1 121 ? -14.225  194.278 -26.164 1.00 0.00 ? 116 GLY C N   1 
ATOM 6771  C CA  . GLY C 1 121 ? -14.459  195.237 -27.194 1.00 0.00 ? 116 GLY C CA  1 
ATOM 6772  C C   . GLY C 1 121 ? -15.444  194.789 -28.230 1.00 0.00 ? 116 GLY C C   1 
ATOM 6773  O O   . GLY C 1 121 ? -15.750  195.635 -29.056 1.00 0.00 ? 116 GLY C O   1 
ATOM 6774  N N   . LEU C 1 122 ? -15.966  193.492 -28.210 1.00 0.00 ? 117 LEU C N   1 
ATOM 6775  C CA  . LEU C 1 122 ? -16.983  193.148 -29.242 1.00 0.00 ? 117 LEU C CA  1 
ATOM 6776  C C   . LEU C 1 122 ? -18.367  192.905 -28.597 1.00 0.00 ? 117 LEU C C   1 
ATOM 6777  O O   . LEU C 1 122 ? -19.311  192.562 -29.277 1.00 0.00 ? 117 LEU C O   1 
ATOM 6778  C CB  . LEU C 1 122 ? -16.640  191.978 -30.172 1.00 0.00 ? 117 LEU C CB  1 
ATOM 6779  C CG  . LEU C 1 122 ? -15.428  192.249 -31.175 1.00 0.00 ? 117 LEU C CG  1 
ATOM 6780  C CD1 . LEU C 1 122 ? -14.729  191.016 -31.696 1.00 0.00 ? 117 LEU C CD1 1 
ATOM 6781  C CD2 . LEU C 1 122 ? -15.914  193.117 -32.341 1.00 0.00 ? 117 LEU C CD2 1 
ATOM 6782  N N   . ARG C 1 123 ? -18.495  193.031 -27.216 1.00 0.00 ? 118 ARG C N   1 
ATOM 6783  C CA  . ARG C 1 123 ? -19.645  192.749 -26.364 1.00 0.00 ? 118 ARG C CA  1 
ATOM 6784  C C   . ARG C 1 123 ? -20.848  193.613 -26.777 1.00 0.00 ? 118 ARG C C   1 
ATOM 6785  O O   . ARG C 1 123 ? -21.908  193.047 -26.970 1.00 0.00 ? 118 ARG C O   1 
ATOM 6786  C CB  . ARG C 1 123 ? -19.312  193.113 -24.855 1.00 0.00 ? 118 ARG C CB  1 
ATOM 6787  C CG  . ARG C 1 123 ? -20.410  192.671 -23.927 1.00 0.00 ? 118 ARG C CG  1 
ATOM 6788  C CD  . ARG C 1 123 ? -20.227  193.035 -22.488 1.00 0.00 ? 118 ARG C CD  1 
ATOM 6789  N NE  . ARG C 1 123 ? -19.122  192.197 -21.968 1.00 0.00 ? 118 ARG C NE  1 
ATOM 6790  C CZ  . ARG C 1 123 ? -18.041  192.794 -21.482 1.00 0.00 ? 118 ARG C CZ  1 
ATOM 6791  N NH1 . ARG C 1 123 ? -17.740  194.078 -21.618 1.00 0.00 ? 118 ARG C NH1 1 
ATOM 6792  N NH2 . ARG C 1 123 ? -17.087  191.985 -21.047 1.00 0.00 ? 118 ARG C NH2 1 
ATOM 6793  N N   . GLY C 1 124 ? -20.688  194.938 -26.780 1.00 0.00 ? 119 GLY C N   1 
ATOM 6794  C CA  . GLY C 1 124 ? -21.756  195.847 -27.044 1.00 0.00 ? 119 GLY C CA  1 
ATOM 6795  C C   . GLY C 1 124 ? -22.301  195.841 -28.512 1.00 0.00 ? 119 GLY C C   1 
ATOM 6796  O O   . GLY C 1 124 ? -23.492  195.913 -28.712 1.00 0.00 ? 119 GLY C O   1 
ATOM 6797  N N   . PHE C 1 125 ? -21.405  195.702 -29.511 1.00 0.00 ? 120 PHE C N   1 
ATOM 6798  C CA  . PHE C 1 125 ? -21.762  195.303 -30.895 1.00 0.00 ? 120 PHE C CA  1 
ATOM 6799  C C   . PHE C 1 125 ? -22.446  193.959 -31.049 1.00 0.00 ? 120 PHE C C   1 
ATOM 6800  O O   . PHE C 1 125 ? -23.519  193.887 -31.632 1.00 0.00 ? 120 PHE C O   1 
ATOM 6801  C CB  . PHE C 1 125 ? -20.499  195.311 -31.735 1.00 0.00 ? 120 PHE C CB  1 
ATOM 6802  C CG  . PHE C 1 125 ? -20.840  195.188 -33.260 1.00 0.00 ? 120 PHE C CG  1 
ATOM 6803  C CD1 . PHE C 1 125 ? -21.810  195.947 -33.887 1.00 0.00 ? 120 PHE C CD1 1 
ATOM 6804  C CD2 . PHE C 1 125 ? -19.975  194.381 -34.094 1.00 0.00 ? 120 PHE C CD2 1 
ATOM 6805  C CE1 . PHE C 1 125 ? -22.041  195.866 -35.253 1.00 0.00 ? 120 PHE C CE1 1 
ATOM 6806  C CE2 . PHE C 1 125 ? -20.245  194.287 -35.460 1.00 0.00 ? 120 PHE C CE2 1 
ATOM 6807  C CZ  . PHE C 1 125 ? -21.277  195.010 -36.097 1.00 0.00 ? 120 PHE C CZ  1 
ATOM 6808  N N   . ARG C 1 126 ? -22.020  192.831 -30.492 1.00 0.00 ? 121 ARG C N   1 
ATOM 6809  C CA  . ARG C 1 126 ? -22.749  191.542 -30.551 1.00 0.00 ? 121 ARG C CA  1 
ATOM 6810  C C   . ARG C 1 126 ? -24.152  191.548 -29.825 1.00 0.00 ? 121 ARG C C   1 
ATOM 6811  O O   . ARG C 1 126 ? -25.127  191.031 -30.276 1.00 0.00 ? 121 ARG C O   1 
ATOM 6812  C CB  . ARG C 1 126 ? -21.784  190.429 -30.046 1.00 0.00 ? 121 ARG C CB  1 
ATOM 6813  C CG  . ARG C 1 126 ? -20.776  190.118 -31.171 1.00 0.00 ? 121 ARG C CG  1 
ATOM 6814  C CD  . ARG C 1 126 ? -19.562  189.347 -30.761 1.00 0.00 ? 121 ARG C CD  1 
ATOM 6815  N NE  . ARG C 1 126 ? -18.785  189.059 -31.995 1.00 0.00 ? 121 ARG C NE  1 
ATOM 6816  C CZ  . ARG C 1 126 ? -17.639  188.409 -32.086 1.00 0.00 ? 121 ARG C CZ  1 
ATOM 6817  N NH1 . ARG C 1 126 ? -16.937  188.233 -30.973 1.00 0.00 ? 121 ARG C NH1 1 
ATOM 6818  N NH2 . ARG C 1 126 ? -17.161  188.058 -33.240 1.00 0.00 ? 121 ARG C NH2 1 
ATOM 6819  N N   . GLU C 1 127 ? -24.287  192.245 -28.653 1.00 0.00 ? 122 GLU C N   1 
ATOM 6820  C CA  . GLU C 1 127 ? -25.597  192.503 -28.066 1.00 0.00 ? 122 GLU C CA  1 
ATOM 6821  C C   . GLU C 1 127 ? -26.501  193.398 -28.926 1.00 0.00 ? 122 GLU C C   1 
ATOM 6822  O O   . GLU C 1 127 ? -27.727  193.175 -28.864 1.00 0.00 ? 122 GLU C O   1 
ATOM 6823  C CB  . GLU C 1 127 ? -25.442  193.174 -26.741 1.00 0.00 ? 122 GLU C CB  1 
ATOM 6824  C CG  . GLU C 1 127 ? -25.044  192.026 -25.735 1.00 0.00 ? 122 GLU C CG  1 
ATOM 6825  C CD  . GLU C 1 127 ? -26.193  191.210 -25.449 1.00 0.00 ? 122 GLU C CD  1 
ATOM 6826  O OE1 . GLU C 1 127 ? -27.048  191.666 -24.622 1.00 0.00 ? 122 GLU C OE1 1 
ATOM 6827  O OE2 . GLU C 1 127 ? -26.306  190.116 -26.033 1.00 0.00 ? 122 GLU C OE2 1 
ATOM 6828  N N   . ALA C 1 128 ? -26.000  194.392 -29.656 1.00 0.00 ? 123 ALA C N   1 
ATOM 6829  C CA  . ALA C 1 128 ? -26.737  195.147 -30.642 1.00 0.00 ? 123 ALA C CA  1 
ATOM 6830  C C   . ALA C 1 128 ? -27.132  194.334 -31.886 1.00 0.00 ? 123 ALA C C   1 
ATOM 6831  O O   . ALA C 1 128 ? -28.257  194.352 -32.354 1.00 0.00 ? 123 ALA C O   1 
ATOM 6832  C CB  . ALA C 1 128 ? -25.864  196.433 -31.142 1.00 0.00 ? 123 ALA C CB  1 
ATOM 6833  N N   . ARG C 1 129 ? -26.242  193.405 -32.346 1.00 0.00 ? 124 ARG C N   1 
ATOM 6834  C CA  . ARG C 1 129 ? -26.466  192.394 -33.372 1.00 0.00 ? 124 ARG C CA  1 
ATOM 6835  C C   . ARG C 1 129 ? -27.580  191.451 -32.950 1.00 0.00 ? 124 ARG C C   1 
ATOM 6836  O O   . ARG C 1 129 ? -28.360  190.998 -33.754 1.00 0.00 ? 124 ARG C O   1 
ATOM 6837  C CB  . ARG C 1 129 ? -25.185  191.636 -33.568 1.00 0.00 ? 124 ARG C CB  1 
ATOM 6838  C CG  . ARG C 1 129 ? -24.952  190.780 -34.827 1.00 0.00 ? 124 ARG C CG  1 
ATOM 6839  C CD  . ARG C 1 129 ? -25.416  189.281 -34.770 1.00 0.00 ? 124 ARG C CD  1 
ATOM 6840  N NE  . ARG C 1 129 ? -24.519  188.432 -35.626 1.00 0.00 ? 124 ARG C NE  1 
ATOM 6841  C CZ  . ARG C 1 129 ? -24.920  187.205 -36.039 1.00 0.00 ? 124 ARG C CZ  1 
ATOM 6842  N NH1 . ARG C 1 129 ? -25.870  186.506 -35.421 1.00 0.00 ? 124 ARG C NH1 1 
ATOM 6843  N NH2 . ARG C 1 129 ? -24.229  186.712 -37.010 1.00 0.00 ? 124 ARG C NH2 1 
ATOM 6844  N N   . ARG C 1 130 ? -27.674  191.019 -31.652 1.00 0.00 ? 125 ARG C N   1 
ATOM 6845  C CA  . ARG C 1 130 ? -28.639  190.064 -31.198 1.00 0.00 ? 125 ARG C CA  1 
ATOM 6846  C C   . ARG C 1 130 ? -30.092  190.556 -31.295 1.00 0.00 ? 125 ARG C C   1 
ATOM 6847  O O   . ARG C 1 130 ? -30.969  189.947 -31.912 1.00 0.00 ? 125 ARG C O   1 
ATOM 6848  C CB  . ARG C 1 130 ? -28.298  189.679 -29.761 1.00 0.00 ? 125 ARG C CB  1 
ATOM 6849  C CG  . ARG C 1 130 ? -29.161  188.506 -29.219 1.00 0.00 ? 125 ARG C CG  1 
ATOM 6850  C CD  . ARG C 1 130 ? -28.566  187.821 -27.996 1.00 0.00 ? 125 ARG C CD  1 
ATOM 6851  N NE  . ARG C 1 130 ? -28.455  188.888 -26.971 1.00 0.00 ? 125 ARG C NE  1 
ATOM 6852  C CZ  . ARG C 1 130 ? -29.469  189.455 -26.269 1.00 0.00 ? 125 ARG C CZ  1 
ATOM 6853  N NH1 . ARG C 1 130 ? -30.757  189.262 -26.520 1.00 0.00 ? 125 ARG C NH1 1 
ATOM 6854  N NH2 . ARG C 1 130 ? -29.173  190.306 -25.276 1.00 0.00 ? 125 ARG C NH2 1 
ATOM 6855  N N   . ASP C 1 131 ? -30.370  191.678 -30.661 1.00 0.00 ? 126 ASP C N   1 
ATOM 6856  C CA  . ASP C 1 131 ? -31.599  192.506 -30.730 1.00 0.00 ? 126 ASP C CA  1 
ATOM 6857  C C   . ASP C 1 131 ? -31.988  193.010 -32.135 1.00 0.00 ? 126 ASP C C   1 
ATOM 6858  O O   . ASP C 1 131 ? -33.102  192.831 -32.585 1.00 0.00 ? 126 ASP C O   1 
ATOM 6859  C CB  . ASP C 1 131 ? -31.408  193.593 -29.693 1.00 0.00 ? 126 ASP C CB  1 
ATOM 6860  C CG  . ASP C 1 131 ? -32.774  194.065 -29.234 1.00 0.00 ? 126 ASP C CG  1 
ATOM 6861  O OD1 . ASP C 1 131 ? -33.632  193.200 -28.864 1.00 0.00 ? 126 ASP C OD1 1 
ATOM 6862  O OD2 . ASP C 1 131 ? -33.057  195.310 -29.200 1.00 0.00 ? 126 ASP C OD2 1 
ATOM 6863  N N   . PHE C 1 132 ? -30.997  193.430 -33.024 1.00 0.00 ? 127 PHE C N   1 
ATOM 6864  C CA  . PHE C 1 132 ? -31.232  193.784 -34.410 1.00 0.00 ? 127 PHE C CA  1 
ATOM 6865  C C   . PHE C 1 132 ? -31.772  192.641 -35.204 1.00 0.00 ? 127 PHE C C   1 
ATOM 6866  O O   . PHE C 1 132 ? -32.607  192.829 -36.048 1.00 0.00 ? 127 PHE C O   1 
ATOM 6867  C CB  . PHE C 1 132 ? -29.861  194.262 -34.972 1.00 0.00 ? 127 PHE C CB  1 
ATOM 6868  C CG  . PHE C 1 132 ? -29.706  194.775 -36.369 1.00 0.00 ? 127 PHE C CG  1 
ATOM 6869  C CD1 . PHE C 1 132 ? -30.531  195.751 -36.927 1.00 0.00 ? 127 PHE C CD1 1 
ATOM 6870  C CD2 . PHE C 1 132 ? -28.720  194.173 -37.212 1.00 0.00 ? 127 PHE C CD2 1 
ATOM 6871  C CE1 . PHE C 1 132 ? -30.390  196.168 -38.275 1.00 0.00 ? 127 PHE C CE1 1 
ATOM 6872  C CE2 . PHE C 1 132 ? -28.653  194.542 -38.567 1.00 0.00 ? 127 PHE C CE2 1 
ATOM 6873  C CZ  . PHE C 1 132 ? -29.437  195.572 -39.053 1.00 0.00 ? 127 PHE C CZ  1 
ATOM 6874  N N   . TRP C 1 133 ? -31.277  191.387 -35.009 1.00 0.00 ? 128 TRP C N   1 
ATOM 6875  C CA  . TRP C 1 133 ? -31.808  190.278 -35.721 1.00 0.00 ? 128 TRP C CA  1 
ATOM 6876  C C   . TRP C 1 133 ? -33.098  189.657 -35.135 1.00 0.00 ? 128 TRP C C   1 
ATOM 6877  O O   . TRP C 1 133 ? -33.945  189.147 -35.783 1.00 0.00 ? 128 TRP C O   1 
ATOM 6878  C CB  . TRP C 1 133 ? -30.809  189.111 -35.754 1.00 0.00 ? 128 TRP C CB  1 
ATOM 6879  C CG  . TRP C 1 133 ? -29.582  189.225 -36.668 1.00 0.00 ? 128 TRP C CG  1 
ATOM 6880  C CD1 . TRP C 1 133 ? -28.911  190.298 -37.198 1.00 0.00 ? 128 TRP C CD1 1 
ATOM 6881  C CD2 . TRP C 1 133 ? -29.040  188.059 -37.429 1.00 0.00 ? 128 TRP C CD2 1 
ATOM 6882  N NE1 . TRP C 1 133 ? -27.918  189.910 -38.117 1.00 0.00 ? 128 TRP C NE1 1 
ATOM 6883  C CE2 . TRP C 1 133 ? -28.003  188.559 -38.245 1.00 0.00 ? 128 TRP C CE2 1 
ATOM 6884  C CE3 . TRP C 1 133 ? -29.326  186.691 -37.364 1.00 0.00 ? 128 TRP C CE3 1 
ATOM 6885  C CZ2 . TRP C 1 133 ? -27.514  187.731 -39.211 1.00 0.00 ? 128 TRP C CZ2 1 
ATOM 6886  C CZ3 . TRP C 1 133 ? -28.727  185.797 -38.219 1.00 0.00 ? 128 TRP C CZ3 1 
ATOM 6887  C CH2 . TRP C 1 133 ? -27.894  186.338 -39.193 1.00 0.00 ? 128 TRP C CH2 1 
ATOM 6888  N N   . ARG C 1 134 ? -33.223  189.886 -33.799 1.00 0.00 ? 129 ARG C N   1 
ATOM 6889  C CA  . ARG C 1 134 ? -34.563  189.710 -33.136 1.00 0.00 ? 129 ARG C CA  1 
ATOM 6890  C C   . ARG C 1 134 ? -35.725  190.575 -33.601 1.00 0.00 ? 129 ARG C C   1 
ATOM 6891  O O   . ARG C 1 134 ? -36.860  190.142 -33.710 1.00 0.00 ? 129 ARG C O   1 
ATOM 6892  C CB  . ARG C 1 134 ? -34.364  189.922 -31.593 1.00 0.00 ? 129 ARG C CB  1 
ATOM 6893  C CG  . ARG C 1 134 ? -35.507  189.377 -30.741 1.00 0.00 ? 129 ARG C CG  1 
ATOM 6894  C CD  . ARG C 1 134 ? -35.037  188.964 -29.378 1.00 0.00 ? 129 ARG C CD  1 
ATOM 6895  N NE  . ARG C 1 134 ? -34.878  190.296 -28.677 1.00 0.00 ? 129 ARG C NE  1 
ATOM 6896  C CZ  . ARG C 1 134 ? -35.210  190.617 -27.379 1.00 0.00 ? 129 ARG C CZ  1 
ATOM 6897  N NH1 . ARG C 1 134 ? -35.833  189.781 -26.611 1.00 0.00 ? 129 ARG C NH1 1 
ATOM 6898  N NH2 . ARG C 1 134 ? -34.777  191.759 -26.883 1.00 0.00 ? 129 ARG C NH2 1 
ATOM 6899  N N   . GLY C 1 135 ? -35.375  191.820 -33.977 1.00 0.00 ? 130 GLY C N   1 
ATOM 6900  C CA  . GLY C 1 135 ? -36.166  192.888 -34.585 1.00 0.00 ? 130 GLY C CA  1 
ATOM 6901  C C   . GLY C 1 135 ? -36.428  192.676 -36.009 1.00 0.00 ? 130 GLY C C   1 
ATOM 6902  O O   . GLY C 1 135 ? -37.471  193.179 -36.458 1.00 0.00 ? 130 GLY C O   1 
ATOM 6903  N N   . ALA C 1 136 ? -35.506  191.982 -36.711 1.00 0.00 ? 131 ALA C N   1 
ATOM 6904  C CA  . ALA C 1 136 ? -35.730  191.491 -37.973 1.00 0.00 ? 131 ALA C CA  1 
ATOM 6905  C C   . ALA C 1 136 ? -36.758  190.414 -38.089 1.00 0.00 ? 131 ALA C C   1 
ATOM 6906  O O   . ALA C 1 136 ? -37.728  190.457 -38.824 1.00 0.00 ? 131 ALA C O   1 
ATOM 6907  C CB  . ALA C 1 136 ? -34.465  191.017 -38.639 1.00 0.00 ? 131 ALA C CB  1 
ATOM 6908  N N   . GLU C 1 137 ? -36.678  189.527 -37.086 1.00 0.00 ? 132 GLU C N   1 
ATOM 6909  C CA  . GLU C 1 137 ? -37.569  188.474 -36.809 1.00 0.00 ? 132 GLU C CA  1 
ATOM 6910  C C   . GLU C 1 137 ? -38.998  189.000 -36.526 1.00 0.00 ? 132 GLU C C   1 
ATOM 6911  O O   . GLU C 1 137 ? -40.012  188.497 -36.967 1.00 0.00 ? 132 GLU C O   1 
ATOM 6912  C CB  . GLU C 1 137 ? -37.037  187.483 -35.748 1.00 0.00 ? 132 GLU C CB  1 
ATOM 6913  C CG  . GLU C 1 137 ? -38.041  186.335 -35.608 1.00 0.00 ? 132 GLU C CG  1 
ATOM 6914  C CD  . GLU C 1 137 ? -37.576  185.281 -34.693 1.00 0.00 ? 132 GLU C CD  1 
ATOM 6915  O OE1 . GLU C 1 137 ? -37.472  185.585 -33.494 1.00 0.00 ? 132 GLU C OE1 1 
ATOM 6916  O OE2 . GLU C 1 137 ? -37.351  184.150 -35.142 1.00 0.00 ? 132 GLU C OE2 1 
ATOM 6917  N N   . SER C 1 138 ? -39.057  190.004 -35.640 1.00 0.00 ? 133 SER C N   1 
ATOM 6918  C CA  . SER C 1 138 ? -40.210  190.732 -35.263 1.00 0.00 ? 133 SER C CA  1 
ATOM 6919  C C   . SER C 1 138 ? -40.827  191.449 -36.422 1.00 0.00 ? 133 SER C C   1 
ATOM 6920  O O   . SER C 1 138 ? -42.046  191.519 -36.613 1.00 0.00 ? 133 SER C O   1 
ATOM 6921  C CB  . SER C 1 138 ? -40.018  191.713 -34.052 1.00 0.00 ? 133 SER C CB  1 
ATOM 6922  O OG  . SER C 1 138 ? -41.246  192.247 -33.641 1.00 0.00 ? 133 SER C OG  1 
ATOM 6923  N N   . LEU C 1 139 ? -39.996  192.105 -37.281 1.00 0.00 ? 134 LEU C N   1 
ATOM 6924  C CA  . LEU C 1 139 ? -40.409  192.732 -38.523 1.00 0.00 ? 134 LEU C CA  1 
ATOM 6925  C C   . LEU C 1 139 ? -40.979  191.706 -39.464 1.00 0.00 ? 134 LEU C C   1 
ATOM 6926  O O   . LEU C 1 139 ? -42.042  192.007 -40.089 1.00 0.00 ? 134 LEU C O   1 
ATOM 6927  C CB  . LEU C 1 139 ? -39.289  193.491 -39.231 1.00 0.00 ? 134 LEU C CB  1 
ATOM 6928  C CG  . LEU C 1 139 ? -39.731  194.319 -40.503 1.00 0.00 ? 134 LEU C CG  1 
ATOM 6929  C CD1 . LEU C 1 139 ? -40.651  195.526 -40.241 1.00 0.00 ? 134 LEU C CD1 1 
ATOM 6930  C CD2 . LEU C 1 139 ? -38.512  194.699 -41.277 1.00 0.00 ? 134 LEU C CD2 1 
ATOM 6931  N N   . GLU C 1 140 ? -40.361  190.514 -39.661 1.00 0.00 ? 135 GLU C N   1 
ATOM 6932  C CA  . GLU C 1 140 ? -40.891  189.545 -40.601 1.00 0.00 ? 135 GLU C CA  1 
ATOM 6933  C C   . GLU C 1 140 ? -42.266  189.016 -40.166 1.00 0.00 ? 135 GLU C C   1 
ATOM 6934  O O   . GLU C 1 140 ? -43.200  188.896 -41.025 1.00 0.00 ? 135 GLU C O   1 
ATOM 6935  C CB  . GLU C 1 140 ? -39.880  188.446 -40.850 1.00 0.00 ? 135 GLU C CB  1 
ATOM 6936  C CG  . GLU C 1 140 ? -40.154  187.528 -42.024 1.00 0.00 ? 135 GLU C CG  1 
ATOM 6937  C CD  . GLU C 1 140 ? -38.987  186.476 -42.132 1.00 0.00 ? 135 GLU C CD  1 
ATOM 6938  O OE1 . GLU C 1 140 ? -37.844  186.899 -42.241 1.00 0.00 ? 135 GLU C OE1 1 
ATOM 6939  O OE2 . GLU C 1 140 ? -39.337  185.249 -42.296 1.00 0.00 ? 135 GLU C OE2 1 
ATOM 6940  N N   . ALA C 1 141 ? -42.505  188.680 -38.869 1.00 0.00 ? 136 ALA C N   1 
ATOM 6941  C CA  . ALA C 1 141 ? -43.846  188.358 -38.486 1.00 0.00 ? 136 ALA C CA  1 
ATOM 6942  C C   . ALA C 1 141 ? -44.921  189.453 -38.446 1.00 0.00 ? 136 ALA C C   1 
ATOM 6943  O O   . ALA C 1 141 ? -46.121  189.266 -38.761 1.00 0.00 ? 136 ALA C O   1 
ATOM 6944  C CB  . ALA C 1 141 ? -43.804  187.649 -37.136 1.00 0.00 ? 136 ALA C CB  1 
ATOM 6945  N N   . ALA C 1 142 ? -44.436  190.657 -38.201 1.00 0.00 ? 137 ALA C N   1 
ATOM 6946  C CA  . ALA C 1 142 ? -45.116  191.902 -38.405 1.00 0.00 ? 137 ALA C CA  1 
ATOM 6947  C C   . ALA C 1 142 ? -45.616  192.148 -39.783 1.00 0.00 ? 137 ALA C C   1 
ATOM 6948  O O   . ALA C 1 142 ? -46.720  192.530 -40.117 1.00 0.00 ? 137 ALA C O   1 
ATOM 6949  C CB  . ALA C 1 142 ? -44.298  193.069 -37.848 1.00 0.00 ? 137 ALA C CB  1 
ATOM 6950  N N   . LEU C 1 143 ? -44.725  191.909 -40.809 1.00 0.00 ? 138 LEU C N   1 
ATOM 6951  C CA  . LEU C 1 143 ? -45.139  191.889 -42.239 1.00 0.00 ? 138 LEU C CA  1 
ATOM 6952  C C   . LEU C 1 143 ? -46.152  190.719 -42.479 1.00 0.00 ? 138 LEU C C   1 
ATOM 6953  O O   . LEU C 1 143 ? -47.120  190.823 -43.247 1.00 0.00 ? 138 LEU C O   1 
ATOM 6954  C CB  . LEU C 1 143 ? -43.971  191.720 -43.227 1.00 0.00 ? 138 LEU C CB  1 
ATOM 6955  C CG  . LEU C 1 143 ? -42.859  192.793 -43.283 1.00 0.00 ? 138 LEU C CG  1 
ATOM 6956  C CD1 . LEU C 1 143 ? -41.664  192.244 -44.008 1.00 0.00 ? 138 LEU C CD1 1 
ATOM 6957  C CD2 . LEU C 1 143 ? -43.394  194.132 -43.787 1.00 0.00 ? 138 LEU C CD2 1 
ATOM 6958  N N   . THR C 1 144 ? -45.894  189.507 -41.887 1.00 0.00 ? 139 THR C N   1 
ATOM 6959  C CA  . THR C 1 144 ? -46.646  188.303 -42.032 1.00 0.00 ? 139 THR C CA  1 
ATOM 6960  C C   . THR C 1 144 ? -48.090  188.402 -41.575 1.00 0.00 ? 139 THR C C   1 
ATOM 6961  O O   . THR C 1 144 ? -49.063  188.243 -42.231 1.00 0.00 ? 139 THR C O   1 
ATOM 6962  C CB  . THR C 1 144 ? -46.020  187.065 -41.373 1.00 0.00 ? 139 THR C CB  1 
ATOM 6963  O OG1 . THR C 1 144 ? -44.659  186.743 -41.760 1.00 0.00 ? 139 THR C OG1 1 
ATOM 6964  C CG2 . THR C 1 144 ? -46.854  185.786 -41.590 1.00 0.00 ? 139 THR C CG2 1 
ATOM 6965  N N   . HIS C 1 145 ? -48.214  189.046 -40.430 1.00 0.00 ? 140 HIS C N   1 
ATOM 6966  C CA  . HIS C 1 145 ? -49.519  189.386 -39.844 1.00 0.00 ? 140 HIS C CA  1 
ATOM 6967  C C   . HIS C 1 145 ? -50.218  190.558 -40.448 1.00 0.00 ? 140 HIS C C   1 
ATOM 6968  O O   . HIS C 1 145 ? -51.427  190.628 -40.512 1.00 0.00 ? 140 HIS C O   1 
ATOM 6969  C CB  . HIS C 1 145 ? -49.477  189.513 -38.307 1.00 0.00 ? 140 HIS C CB  1 
ATOM 6970  C CG  . HIS C 1 145 ? -49.221  188.186 -37.595 1.00 0.00 ? 140 HIS C CG  1 
ATOM 6971  N ND1 . HIS C 1 145 ? -50.126  187.125 -37.592 1.00 0.00 ? 140 HIS C ND1 1 
ATOM 6972  C CD2 . HIS C 1 145 ? -48.140  187.730 -36.880 1.00 0.00 ? 140 HIS C CD2 1 
ATOM 6973  C CE1 . HIS C 1 145 ? -49.627  186.154 -36.800 1.00 0.00 ? 140 HIS C CE1 1 
ATOM 6974  N NE2 . HIS C 1 145 ? -48.427  186.515 -36.290 1.00 0.00 ? 140 HIS C NE2 1 
ATOM 6975  N N   . ASN C 1 146 ? -49.434  191.480 -41.072 1.00 0.00 ? 141 ASN C N   1 
ATOM 6976  C CA  . ASN C 1 146 ? -49.969  192.563 -41.873 1.00 0.00 ? 141 ASN C CA  1 
ATOM 6977  C C   . ASN C 1 146 ? -50.517  192.102 -43.252 1.00 0.00 ? 141 ASN C C   1 
ATOM 6978  O O   . ASN C 1 146 ? -51.507  192.446 -43.864 1.00 0.00 ? 141 ASN C O   1 
ATOM 6979  C CB  . ASN C 1 146 ? -48.990  193.820 -42.026 1.00 0.00 ? 141 ASN C CB  1 
ATOM 6980  C CG  . ASN C 1 146 ? -49.584  195.082 -42.641 1.00 0.00 ? 141 ASN C CG  1 
ATOM 6981  O OD1 . ASN C 1 146 ? -50.555  195.709 -42.167 1.00 0.00 ? 141 ASN C OD1 1 
ATOM 6982  N ND2 . ASN C 1 146 ? -49.002  195.484 -43.787 1.00 0.00 ? 141 ASN C ND2 1 
ATOM 6983  N N   . ALA C 1 147 ? -49.803  191.168 -43.898 1.00 0.00 ? 142 ALA C N   1 
ATOM 6984  C CA  . ALA C 1 147 ? -50.279  190.631 -45.144 1.00 0.00 ? 142 ALA C CA  1 
ATOM 6985  C C   . ALA C 1 147 ? -51.436  189.612 -45.053 1.00 0.00 ? 142 ALA C C   1 
ATOM 6986  O O   . ALA C 1 147 ? -52.198  189.637 -45.990 1.00 0.00 ? 142 ALA C O   1 
ATOM 6987  C CB  . ALA C 1 147 ? -49.120  190.074 -45.927 1.00 0.00 ? 142 ALA C CB  1 
ATOM 6988  N N   . GLU C 1 148 ? -51.517  188.713 -44.022 1.00 0.00 ? 143 GLU C N   1 
ATOM 6989  C CA  . GLU C 1 148 ? -52.485  187.649 -44.146 1.00 0.00 ? 143 GLU C CA  1 
ATOM 6990  C C   . GLU C 1 148 ? -53.922  187.961 -43.655 1.00 0.00 ? 143 GLU C C   1 
ATOM 6991  O O   . GLU C 1 148 ? -54.832  187.206 -43.864 1.00 0.00 ? 143 GLU C O   1 
ATOM 6992  C CB  . GLU C 1 148 ? -52.060  186.371 -43.305 1.00 0.00 ? 143 GLU C CB  1 
ATOM 6993  C CG  . GLU C 1 148 ? -50.735  185.729 -43.906 1.00 0.00 ? 143 GLU C CG  1 
ATOM 6994  C CD  . GLU C 1 148 ? -50.942  185.019 -45.295 1.00 0.00 ? 143 GLU C CD  1 
ATOM 6995  O OE1 . GLU C 1 148 ? -51.923  184.216 -45.479 1.00 0.00 ? 143 GLU C OE1 1 
ATOM 6996  O OE2 . GLU C 1 148 ? -50.129  185.358 -46.167 1.00 0.00 ? 143 GLU C OE2 1 
ATOM 6997  N N   . VAL C 1 149 ? -54.259  189.150 -43.088 1.00 0.00 ? 144 VAL C N   1 
ATOM 6998  C CA  . VAL C 1 149 ? -55.517  189.552 -42.689 1.00 0.00 ? 144 VAL C CA  1 
ATOM 6999  C C   . VAL C 1 149 ? -56.484  189.726 -43.909 1.00 0.00 ? 144 VAL C C   1 
ATOM 7000  O O   . VAL C 1 149 ? -56.102  190.264 -44.916 1.00 0.00 ? 144 VAL C O   1 
ATOM 7001  C CB  . VAL C 1 149 ? -55.454  190.820 -41.839 1.00 0.00 ? 144 VAL C CB  1 
ATOM 7002  C CG1 . VAL C 1 149 ? -55.036  192.033 -42.697 1.00 0.00 ? 144 VAL C CG1 1 
ATOM 7003  C CG2 . VAL C 1 149 ? -56.832  191.028 -41.183 1.00 0.00 ? 144 VAL C CG2 1 
ATOM 7004  N N   . PRO C 1 150 ? -57.804  189.326 -43.887 1.00 0.00 ? 145 PRO C N   1 
ATOM 7005  C CA  . PRO C 1 150 ? -58.721  189.728 -44.919 1.00 0.00 ? 145 PRO C CA  1 
ATOM 7006  C C   . PRO C 1 150 ? -59.272  191.148 -44.813 1.00 0.00 ? 145 PRO C C   1 
ATOM 7007  O O   . PRO C 1 150 ? -59.612  191.708 -43.745 1.00 0.00 ? 145 PRO C O   1 
ATOM 7008  C CB  . PRO C 1 150 ? -59.939  188.788 -44.724 1.00 0.00 ? 145 PRO C CB  1 
ATOM 7009  C CG  . PRO C 1 150 ? -59.333  187.577 -44.102 1.00 0.00 ? 145 PRO C CG  1 
ATOM 7010  C CD  . PRO C 1 150 ? -58.348  188.205 -43.151 1.00 0.00 ? 145 PRO C CD  1 
ATOM 7011  N N   . ARG C 1 151 ? -59.481  191.864 -45.954 1.00 0.00 ? 146 ARG C N   1 
ATOM 7012  C CA  . ARG C 1 151 ? -59.890  193.215 -46.040 1.00 0.00 ? 146 ARG C CA  1 
ATOM 7013  C C   . ARG C 1 151 ? -61.241  193.556 -45.379 1.00 0.00 ? 146 ARG C C   1 
ATOM 7014  O O   . ARG C 1 151 ? -61.512  194.707 -45.062 1.00 0.00 ? 146 ARG C O   1 
ATOM 7015  C CB  . ARG C 1 151 ? -59.892  193.766 -47.477 1.00 0.00 ? 146 ARG C CB  1 
ATOM 7016  C CG  . ARG C 1 151 ? -60.818  193.010 -48.436 1.00 0.00 ? 146 ARG C CG  1 
ATOM 7017  C CD  . ARG C 1 151 ? -61.032  193.626 -49.824 1.00 0.00 ? 146 ARG C CD  1 
ATOM 7018  N NE  . ARG C 1 151 ? -59.764  193.398 -50.572 1.00 0.00 ? 146 ARG C NE  1 
ATOM 7019  C CZ  . ARG C 1 151 ? -59.372  193.978 -51.729 1.00 0.00 ? 146 ARG C CZ  1 
ATOM 7020  N NH1 . ARG C 1 151 ? -59.977  195.086 -52.180 1.00 0.00 ? 146 ARG C NH1 1 
ATOM 7021  N NH2 . ARG C 1 151 ? -58.313  193.566 -52.362 1.00 0.00 ? 146 ARG C NH2 1 
ATOM 7022  N N   . ARG C 1 152 ? -62.095  192.520 -45.218 1.00 0.00 ? 147 ARG C N   1 
ATOM 7023  C CA  . ARG C 1 152 ? -63.339  192.687 -44.499 1.00 0.00 ? 147 ARG C CA  1 
ATOM 7024  C C   . ARG C 1 152 ? -63.196  192.918 -42.928 1.00 0.00 ? 147 ARG C C   1 
ATOM 7025  O O   . ARG C 1 152 ? -63.999  193.604 -42.272 1.00 0.00 ? 147 ARG C O   1 
ATOM 7026  C CB  . ARG C 1 152 ? -64.233  191.404 -44.743 1.00 0.00 ? 147 ARG C CB  1 
ATOM 7027  C CG  . ARG C 1 152 ? -63.770  190.060 -44.307 1.00 0.00 ? 147 ARG C CG  1 
ATOM 7028  C CD  . ARG C 1 152 ? -64.450  188.796 -44.836 1.00 0.00 ? 147 ARG C CD  1 
ATOM 7029  N NE  . ARG C 1 152 ? -63.579  187.689 -44.980 1.00 0.00 ? 147 ARG C NE  1 
ATOM 7030  C CZ  . ARG C 1 152 ? -63.384  186.647 -44.104 1.00 0.00 ? 147 ARG C CZ  1 
ATOM 7031  N NH1 . ARG C 1 152 ? -64.138  186.483 -43.065 1.00 0.00 ? 147 ARG C NH1 1 
ATOM 7032  N NH2 . ARG C 1 152 ? -62.451  185.699 -44.355 1.00 0.00 ? 147 ARG C NH2 1 
ATOM 7033  N N   . ARG C 1 153 ? -62.121  192.345 -42.378 1.00 0.00 ? 148 ARG C N   1 
ATOM 7034  C CA  . ARG C 1 153 ? -61.802  192.486 -40.970 1.00 0.00 ? 148 ARG C CA  1 
ATOM 7035  C C   . ARG C 1 153 ? -60.908  193.662 -40.608 1.00 0.00 ? 148 ARG C C   1 
ATOM 7036  O O   . ARG C 1 153 ? -59.835  193.493 -40.059 1.00 0.00 ? 148 ARG C O   1 
ATOM 7037  C CB  . ARG C 1 153 ? -61.153  191.210 -40.346 1.00 0.00 ? 148 ARG C CB  1 
ATOM 7038  C CG  . ARG C 1 153 ? -62.011  189.937 -40.354 1.00 0.00 ? 148 ARG C CG  1 
ATOM 7039  C CD  . ARG C 1 153 ? -61.288  188.623 -40.080 1.00 0.00 ? 148 ARG C CD  1 
ATOM 7040  N NE  . ARG C 1 153 ? -61.157  188.448 -38.557 1.00 0.00 ? 148 ARG C NE  1 
ATOM 7041  C CZ  . ARG C 1 153 ? -60.959  187.272 -37.966 1.00 0.00 ? 148 ARG C CZ  1 
ATOM 7042  N NH1 . ARG C 1 153 ? -60.875  186.081 -38.617 1.00 0.00 ? 148 ARG C NH1 1 
ATOM 7043  N NH2 . ARG C 1 153 ? -60.826  187.184 -36.619 1.00 0.00 ? 148 ARG C NH2 1 
ATOM 7044  N N   . ALA C 1 154 ? -61.363  194.844 -41.114 1.00 0.00 ? 149 ALA C N   1 
ATOM 7045  C CA  . ALA C 1 154 ? -60.758  196.134 -40.941 1.00 0.00 ? 149 ALA C CA  1 
ATOM 7046  C C   . ALA C 1 154 ? -60.124  196.574 -39.615 1.00 0.00 ? 149 ALA C C   1 
ATOM 7047  O O   . ALA C 1 154 ? -59.021  197.090 -39.526 1.00 0.00 ? 149 ALA C O   1 
ATOM 7048  C CB  . ALA C 1 154 ? -61.786  197.214 -41.136 1.00 0.00 ? 149 ALA C CB  1 
ATOM 7049  N N   . GLN C 1 155 ? -60.832  196.421 -38.485 1.00 0.00 ? 150 GLN C N   1 
ATOM 7050  C CA  . GLN C 1 155 ? -60.352  196.781 -37.130 1.00 0.00 ? 150 GLN C CA  1 
ATOM 7051  C C   . GLN C 1 155 ? -59.098  195.978 -36.792 1.00 0.00 ? 150 GLN C C   1 
ATOM 7052  O O   . GLN C 1 155 ? -58.130  196.477 -36.230 1.00 0.00 ? 150 GLN C O   1 
ATOM 7053  C CB  . GLN C 1 155 ? -61.482  196.573 -36.061 1.00 0.00 ? 150 GLN C CB  1 
ATOM 7054  C CG  . GLN C 1 155 ? -62.778  197.413 -36.311 1.00 0.00 ? 150 GLN C CG  1 
ATOM 7055  C CD  . GLN C 1 155 ? -63.781  197.003 -35.195 1.00 0.00 ? 150 GLN C CD  1 
ATOM 7056  O OE1 . GLN C 1 155 ? -63.316  196.457 -34.202 1.00 0.00 ? 150 GLN C OE1 1 
ATOM 7057  N NE2 . GLN C 1 155 ? -65.050  197.438 -35.342 1.00 0.00 ? 150 GLN C NE2 1 
ATOM 7058  N N   . GLU C 1 156 ? -59.105  194.646 -37.017 1.00 0.00 ? 151 GLU C N   1 
ATOM 7059  C CA  . GLU C 1 156 ? -58.100  193.655 -36.741 1.00 0.00 ? 151 GLU C CA  1 
ATOM 7060  C C   . GLU C 1 156 ? -56.878  193.876 -37.552 1.00 0.00 ? 151 GLU C C   1 
ATOM 7061  O O   . GLU C 1 156 ? -55.779  193.755 -37.040 1.00 0.00 ? 151 GLU C O   1 
ATOM 7062  C CB  . GLU C 1 156 ? -58.582  192.199 -36.872 1.00 0.00 ? 151 GLU C CB  1 
ATOM 7063  C CG  . GLU C 1 156 ? -59.577  191.800 -35.717 1.00 0.00 ? 151 GLU C CG  1 
ATOM 7064  C CD  . GLU C 1 156 ? -60.343  190.516 -35.895 1.00 0.00 ? 151 GLU C CD  1 
ATOM 7065  O OE1 . GLU C 1 156 ? -61.428  190.538 -36.621 1.00 0.00 ? 151 GLU C OE1 1 
ATOM 7066  O OE2 . GLU C 1 156 ? -60.004  189.453 -35.344 1.00 0.00 ? 151 GLU C OE2 1 
ATOM 7067  N N   . ALA C 1 157 ? -57.088  194.210 -38.855 1.00 0.00 ? 152 ALA C N   1 
ATOM 7068  C CA  . ALA C 1 157 ? -56.027  194.566 -39.746 1.00 0.00 ? 152 ALA C CA  1 
ATOM 7069  C C   . ALA C 1 157 ? -55.312  195.898 -39.324 1.00 0.00 ? 152 ALA C C   1 
ATOM 7070  O O   . ALA C 1 157 ? -54.101  195.951 -39.417 1.00 0.00 ? 152 ALA C O   1 
ATOM 7071  C CB  . ALA C 1 157 ? -56.743  194.822 -41.040 1.00 0.00 ? 152 ALA C CB  1 
ATOM 7072  N N   . GLU C 1 158 ? -56.105  196.911 -38.870 1.00 0.00 ? 153 GLU C N   1 
ATOM 7073  C CA  . GLU C 1 158 ? -55.563  198.202 -38.399 1.00 0.00 ? 153 GLU C CA  1 
ATOM 7074  C C   . GLU C 1 158 ? -54.677  198.038 -37.175 1.00 0.00 ? 153 GLU C C   1 
ATOM 7075  O O   . GLU C 1 158 ? -53.604  198.614 -37.106 1.00 0.00 ? 153 GLU C O   1 
ATOM 7076  C CB  . GLU C 1 158 ? -56.744  199.138 -38.060 1.00 0.00 ? 153 GLU C CB  1 
ATOM 7077  C CG  . GLU C 1 158 ? -56.453  200.675 -37.887 1.00 0.00 ? 153 GLU C CG  1 
ATOM 7078  C CD  . GLU C 1 158 ? -56.333  201.342 -39.262 1.00 0.00 ? 153 GLU C CD  1 
ATOM 7079  O OE1 . GLU C 1 158 ? -57.386  201.380 -39.893 1.00 0.00 ? 153 GLU C OE1 1 
ATOM 7080  O OE2 . GLU C 1 158 ? -55.240  201.811 -39.704 1.00 0.00 ? 153 GLU C OE2 1 
ATOM 7081  N N   . GLU C 1 159 ? -55.104  197.194 -36.220 1.00 0.00 ? 154 GLU C N   1 
ATOM 7082  C CA  . GLU C 1 159 ? -54.365  196.693 -35.069 1.00 0.00 ? 154 GLU C CA  1 
ATOM 7083  C C   . GLU C 1 159 ? -53.050  195.919 -35.451 1.00 0.00 ? 154 GLU C C   1 
ATOM 7084  O O   . GLU C 1 159 ? -51.964  196.258 -34.999 1.00 0.00 ? 154 GLU C O   1 
ATOM 7085  C CB  . GLU C 1 159 ? -55.411  195.825 -34.354 1.00 0.00 ? 154 GLU C CB  1 
ATOM 7086  C CG  . GLU C 1 159 ? -54.869  195.001 -33.156 1.00 0.00 ? 154 GLU C CG  1 
ATOM 7087  C CD  . GLU C 1 159 ? -56.056  194.315 -32.454 1.00 0.00 ? 154 GLU C CD  1 
ATOM 7088  O OE1 . GLU C 1 159 ? -56.899  193.862 -33.269 1.00 0.00 ? 154 GLU C OE1 1 
ATOM 7089  O OE2 . GLU C 1 159 ? -56.304  194.293 -31.225 1.00 0.00 ? 154 GLU C OE2 1 
ATOM 7090  N N   . ALA C 1 160 ? -53.204  195.049 -36.447 1.00 0.00 ? 155 ALA C N   1 
ATOM 7091  C CA  . ALA C 1 160 ? -51.999  194.441 -36.899 1.00 0.00 ? 155 ALA C CA  1 
ATOM 7092  C C   . ALA C 1 160 ? -50.915  195.408 -37.613 1.00 0.00 ? 155 ALA C C   1 
ATOM 7093  O O   . ALA C 1 160 ? -49.681  195.313 -37.427 1.00 0.00 ? 155 ALA C O   1 
ATOM 7094  C CB  . ALA C 1 160 ? -52.333  193.365 -37.820 1.00 0.00 ? 155 ALA C CB  1 
ATOM 7095  N N   . GLY C 1 161 ? -51.427  196.377 -38.433 1.00 0.00 ? 156 GLY C N   1 
ATOM 7096  C CA  . GLY C 1 161 ? -50.611  197.434 -39.031 1.00 0.00 ? 156 GLY C CA  1 
ATOM 7097  C C   . GLY C 1 161 ? -50.007  198.433 -38.041 1.00 0.00 ? 156 GLY C C   1 
ATOM 7098  O O   . GLY C 1 161 ? -48.932  198.981 -38.314 1.00 0.00 ? 156 GLY C O   1 
ATOM 7099  N N   . ALA C 1 162 ? -50.664  198.706 -36.883 1.00 0.00 ? 157 ALA C N   1 
ATOM 7100  C CA  . ALA C 1 162 ? -50.170  199.507 -35.799 1.00 0.00 ? 157 ALA C CA  1 
ATOM 7101  C C   . ALA C 1 162 ? -48.966  198.787 -35.180 1.00 0.00 ? 157 ALA C C   1 
ATOM 7102  O O   . ALA C 1 162 ? -47.926  199.417 -35.043 1.00 0.00 ? 157 ALA C O   1 
ATOM 7103  C CB  . ALA C 1 162 ? -51.276  199.402 -34.697 1.00 0.00 ? 157 ALA C CB  1 
ATOM 7104  N N   . ALA C 1 163 ? -48.955  197.454 -34.905 1.00 0.00 ? 158 ALA C N   1 
ATOM 7105  C CA  . ALA C 1 163 ? -47.817  196.703 -34.495 1.00 0.00 ? 158 ALA C CA  1 
ATOM 7106  C C   . ALA C 1 163 ? -46.652  196.750 -35.518 1.00 0.00 ? 158 ALA C C   1 
ATOM 7107  O O   . ALA C 1 163 ? -45.466  196.722 -35.225 1.00 0.00 ? 158 ALA C O   1 
ATOM 7108  C CB  . ALA C 1 163 ? -48.221  195.204 -34.298 1.00 0.00 ? 158 ALA C CB  1 
ATOM 7109  N N   . LEU C 1 164 ? -46.954  196.673 -36.855 1.00 0.00 ? 159 LEU C N   1 
ATOM 7110  C CA  . LEU C 1 164 ? -45.993  196.925 -37.947 1.00 0.00 ? 159 LEU C CA  1 
ATOM 7111  C C   . LEU C 1 164 ? -45.379  198.328 -37.959 1.00 0.00 ? 159 LEU C C   1 
ATOM 7112  O O   . LEU C 1 164 ? -44.169  198.422 -38.114 1.00 0.00 ? 159 LEU C O   1 
ATOM 7113  C CB  . LEU C 1 164 ? -46.637  196.632 -39.291 1.00 0.00 ? 159 LEU C CB  1 
ATOM 7114  C CG  . LEU C 1 164 ? -45.743  196.944 -40.476 1.00 0.00 ? 159 LEU C CG  1 
ATOM 7115  C CD1 . LEU C 1 164 ? -44.441  196.147 -40.382 1.00 0.00 ? 159 LEU C CD1 1 
ATOM 7116  C CD2 . LEU C 1 164 ? -46.437  196.816 -41.886 1.00 0.00 ? 159 LEU C CD2 1 
ATOM 7117  N N   . ARG C 1 165 ? -46.129  199.328 -37.615 1.00 0.00 ? 160 ARG C N   1 
ATOM 7118  C CA  . ARG C 1 165 ? -45.529  200.630 -37.387 1.00 0.00 ? 160 ARG C CA  1 
ATOM 7119  C C   . ARG C 1 165 ? -44.556  200.678 -36.220 1.00 0.00 ? 160 ARG C C   1 
ATOM 7120  O O   . ARG C 1 165 ? -43.526  201.295 -36.221 1.00 0.00 ? 160 ARG C O   1 
ATOM 7121  C CB  . ARG C 1 165 ? -46.580  201.700 -37.099 1.00 0.00 ? 160 ARG C CB  1 
ATOM 7122  C CG  . ARG C 1 165 ? -47.621  201.971 -38.247 1.00 0.00 ? 160 ARG C CG  1 
ATOM 7123  C CD  . ARG C 1 165 ? -47.110  202.166 -39.655 1.00 0.00 ? 160 ARG C CD  1 
ATOM 7124  N NE  . ARG C 1 165 ? -48.134  202.672 -40.540 1.00 0.00 ? 160 ARG C NE  1 
ATOM 7125  C CZ  . ARG C 1 165 ? -47.907  202.821 -41.817 1.00 0.00 ? 160 ARG C CZ  1 
ATOM 7126  N NH1 . ARG C 1 165 ? -46.869  202.279 -42.403 1.00 0.00 ? 160 ARG C NH1 1 
ATOM 7127  N NH2 . ARG C 1 165 ? -48.794  203.589 -42.543 1.00 0.00 ? 160 ARG C NH2 1 
ATOM 7128  N N   . THR C 1 166 ? -44.880  199.877 -35.195 1.00 0.00 ? 161 THR C N   1 
ATOM 7129  C CA  . THR C 1 166 ? -43.963  199.460 -34.015 1.00 0.00 ? 161 THR C CA  1 
ATOM 7130  C C   . THR C 1 166 ? -42.631  198.771 -34.412 1.00 0.00 ? 161 THR C C   1 
ATOM 7131  O O   . THR C 1 166 ? -41.495  199.149 -34.084 1.00 0.00 ? 161 THR C O   1 
ATOM 7132  C CB  . THR C 1 166 ? -44.696  198.800 -32.881 1.00 0.00 ? 161 THR C CB  1 
ATOM 7133  O OG1 . THR C 1 166 ? -45.835  199.507 -32.555 1.00 0.00 ? 161 THR C OG1 1 
ATOM 7134  C CG2 . THR C 1 166 ? -43.839  198.965 -31.555 1.00 0.00 ? 161 THR C CG2 1 
ATOM 7135  N N   . ALA C 1 167 ? -42.757  197.592 -35.159 1.00 0.00 ? 162 ALA C N   1 
ATOM 7136  C CA  . ALA C 1 167 ? -41.705  196.700 -35.679 1.00 0.00 ? 162 ALA C CA  1 
ATOM 7137  C C   . ALA C 1 167 ? -40.760  197.503 -36.526 1.00 0.00 ? 162 ALA C C   1 
ATOM 7138  O O   . ALA C 1 167 ? -39.570  197.475 -36.223 1.00 0.00 ? 162 ALA C O   1 
ATOM 7139  C CB  . ALA C 1 167 ? -42.381  195.567 -36.383 1.00 0.00 ? 162 ALA C CB  1 
ATOM 7140  N N   . ARG C 1 168 ? -41.349  198.212 -37.546 1.00 0.00 ? 163 ARG C N   1 
ATOM 7141  C CA  . ARG C 1 168 ? -40.528  198.984 -38.539 1.00 0.00 ? 163 ARG C CA  1 
ATOM 7142  C C   . ARG C 1 168 ? -39.757  200.070 -38.004 1.00 0.00 ? 163 ARG C C   1 
ATOM 7143  O O   . ARG C 1 168 ? -38.542  200.304 -38.251 1.00 0.00 ? 163 ARG C O   1 
ATOM 7144  C CB  . ARG C 1 168 ? -41.501  199.546 -39.571 1.00 0.00 ? 163 ARG C CB  1 
ATOM 7145  C CG  . ARG C 1 168 ? -40.846  200.365 -40.781 1.00 0.00 ? 163 ARG C CG  1 
ATOM 7146  C CD  . ARG C 1 168 ? -39.890  199.733 -41.725 1.00 0.00 ? 163 ARG C CD  1 
ATOM 7147  N NE  . ARG C 1 168 ? -40.601  198.765 -42.563 1.00 0.00 ? 163 ARG C NE  1 
ATOM 7148  C CZ  . ARG C 1 168 ? -39.913  197.806 -43.122 1.00 0.00 ? 163 ARG C CZ  1 
ATOM 7149  N NH1 . ARG C 1 168 ? -38.616  197.594 -43.079 1.00 0.00 ? 163 ARG C NH1 1 
ATOM 7150  N NH2 . ARG C 1 168 ? -40.523  196.847 -43.871 1.00 0.00 ? 163 ARG C NH2 1 
ATOM 7151  N N   . ALA C 1 169 ? -40.417  200.962 -37.171 1.00 0.00 ? 164 ALA C N   1 
ATOM 7152  C CA  . ALA C 1 169 ? -39.764  202.013 -36.373 1.00 0.00 ? 164 ALA C CA  1 
ATOM 7153  C C   . ALA C 1 169 ? -38.666  201.433 -35.453 1.00 0.00 ? 164 ALA C C   1 
ATOM 7154  O O   . ALA C 1 169 ? -37.534  201.947 -35.474 1.00 0.00 ? 164 ALA C O   1 
ATOM 7155  C CB  . ALA C 1 169 ? -40.870  202.758 -35.574 1.00 0.00 ? 164 ALA C CB  1 
ATOM 7156  N N   . GLY C 1 170 ? -39.025  200.431 -34.675 1.00 0.00 ? 165 GLY C N   1 
ATOM 7157  C CA  . GLY C 1 170 ? -38.032  200.103 -33.649 1.00 0.00 ? 165 GLY C CA  1 
ATOM 7158  C C   . GLY C 1 170 ? -36.900  199.318 -34.284 1.00 0.00 ? 165 GLY C C   1 
ATOM 7159  O O   . GLY C 1 170 ? -35.761  199.345 -33.871 1.00 0.00 ? 165 GLY C O   1 
ATOM 7160  N N   . TYR C 1 171 ? -37.193  198.628 -35.415 1.00 0.00 ? 166 TYR C N   1 
ATOM 7161  C CA  . TYR C 1 171 ? -36.090  198.107 -36.240 1.00 0.00 ? 166 TYR C CA  1 
ATOM 7162  C C   . TYR C 1 171 ? -35.130  199.161 -36.853 1.00 0.00 ? 166 TYR C C   1 
ATOM 7163  O O   . TYR C 1 171 ? -33.897  198.968 -37.008 1.00 0.00 ? 166 TYR C O   1 
ATOM 7164  C CB  . TYR C 1 171 ? -36.696  197.134 -37.299 1.00 0.00 ? 166 TYR C CB  1 
ATOM 7165  C CG  . TYR C 1 171 ? -35.695  196.458 -38.251 1.00 0.00 ? 166 TYR C CG  1 
ATOM 7166  C CD1 . TYR C 1 171 ? -34.886  195.442 -37.840 1.00 0.00 ? 166 TYR C CD1 1 
ATOM 7167  C CD2 . TYR C 1 171 ? -35.594  196.916 -39.590 1.00 0.00 ? 166 TYR C CD2 1 
ATOM 7168  C CE1 . TYR C 1 171 ? -34.044  194.822 -38.727 1.00 0.00 ? 166 TYR C CE1 1 
ATOM 7169  C CE2 . TYR C 1 171 ? -34.669  196.329 -40.451 1.00 0.00 ? 166 TYR C CE2 1 
ATOM 7170  C CZ  . TYR C 1 171 ? -33.864  195.327 -40.049 1.00 0.00 ? 166 TYR C CZ  1 
ATOM 7171  O OH  . TYR C 1 171 ? -32.932  194.746 -40.949 1.00 0.00 ? 166 TYR C OH  1 
ATOM 7172  N N   . ARG C 1 172 ? -35.624  200.328 -37.280 1.00 0.00 ? 167 ARG C N   1 
ATOM 7173  C CA  . ARG C 1 172 ? -34.799  201.476 -37.653 1.00 0.00 ? 167 ARG C CA  1 
ATOM 7174  C C   . ARG C 1 172 ? -33.890  201.981 -36.537 1.00 0.00 ? 167 ARG C C   1 
ATOM 7175  O O   . ARG C 1 172 ? -32.695  202.224 -36.577 1.00 0.00 ? 167 ARG C O   1 
ATOM 7176  C CB  . ARG C 1 172 ? -35.672  202.721 -38.108 1.00 0.00 ? 167 ARG C CB  1 
ATOM 7177  C CG  . ARG C 1 172 ? -36.032  202.601 -39.618 1.00 0.00 ? 167 ARG C CG  1 
ATOM 7178  C CD  . ARG C 1 172 ? -37.180  203.472 -40.094 1.00 0.00 ? 167 ARG C CD  1 
ATOM 7179  N NE  . ARG C 1 172 ? -37.277  203.163 -41.609 1.00 0.00 ? 167 ARG C NE  1 
ATOM 7180  C CZ  . ARG C 1 172 ? -38.405  203.276 -42.325 1.00 0.00 ? 167 ARG C CZ  1 
ATOM 7181  N NH1 . ARG C 1 172 ? -39.510  203.605 -41.672 1.00 0.00 ? 167 ARG C NH1 1 
ATOM 7182  N NH2 . ARG C 1 172 ? -38.302  203.157 -43.649 1.00 0.00 ? 167 ARG C NH2 1 
ATOM 7183  N N   . GLY C 1 173 ? -34.519  202.090 -35.371 1.00 0.00 ? 168 GLY C N   1 
ATOM 7184  C CA  . GLY C 1 173 ? -33.891  202.292 -33.961 1.00 0.00 ? 168 GLY C CA  1 
ATOM 7185  C C   . GLY C 1 173 ? -32.784  201.295 -33.614 1.00 0.00 ? 168 GLY C C   1 
ATOM 7186  O O   . GLY C 1 173 ? -31.683  201.742 -33.355 1.00 0.00 ? 168 GLY C O   1 
ATOM 7187  N N   . ARG C 1 174 ? -33.023  199.972 -33.735 1.00 0.00 ? 169 ARG C N   1 
ATOM 7188  C CA  . ARG C 1 174 ? -32.018  198.895 -33.659 1.00 0.00 ? 169 ARG C CA  1 
ATOM 7189  C C   . ARG C 1 174 ? -30.912  198.938 -34.715 1.00 0.00 ? 169 ARG C C   1 
ATOM 7190  O O   . ARG C 1 174 ? -29.748  198.734 -34.432 1.00 0.00 ? 169 ARG C O   1 
ATOM 7191  C CB  . ARG C 1 174 ? -32.708  197.467 -33.662 1.00 0.00 ? 169 ARG C CB  1 
ATOM 7192  C CG  . ARG C 1 174 ? -33.452  197.186 -32.332 1.00 0.00 ? 169 ARG C CG  1 
ATOM 7193  C CD  . ARG C 1 174 ? -34.629  196.177 -32.531 1.00 0.00 ? 169 ARG C CD  1 
ATOM 7194  N NE  . ARG C 1 174 ? -34.843  195.575 -31.235 1.00 0.00 ? 169 ARG C NE  1 
ATOM 7195  C CZ  . ARG C 1 174 ? -35.937  194.852 -30.829 1.00 0.00 ? 169 ARG C CZ  1 
ATOM 7196  N NH1 . ARG C 1 174 ? -36.926  194.745 -31.712 1.00 0.00 ? 169 ARG C NH1 1 
ATOM 7197  N NH2 . ARG C 1 174 ? -35.924  194.189 -29.688 1.00 0.00 ? 169 ARG C NH2 1 
ATOM 7198  N N   . ALA C 1 175 ? -31.217  199.380 -35.953 1.00 0.00 ? 170 ALA C N   1 
ATOM 7199  C CA  . ALA C 1 175 ? -30.328  199.478 -37.102 1.00 0.00 ? 170 ALA C CA  1 
ATOM 7200  C C   . ALA C 1 175 ? -29.290  200.581 -36.872 1.00 0.00 ? 170 ALA C C   1 
ATOM 7201  O O   . ALA C 1 175 ? -28.103  200.403 -37.136 1.00 0.00 ? 170 ALA C O   1 
ATOM 7202  C CB  . ALA C 1 175 ? -30.969  199.860 -38.482 1.00 0.00 ? 170 ALA C CB  1 
ATOM 7203  N N   . LEU C 1 176 ? -29.729  201.783 -36.397 1.00 0.00 ? 171 LEU C N   1 
ATOM 7204  C CA  . LEU C 1 176 ? -28.887  202.930 -35.965 1.00 0.00 ? 171 LEU C CA  1 
ATOM 7205  C C   . LEU C 1 176 ? -27.826  202.501 -34.917 1.00 0.00 ? 171 LEU C C   1 
ATOM 7206  O O   . LEU C 1 176 ? -26.691  203.007 -34.920 1.00 0.00 ? 171 LEU C O   1 
ATOM 7207  C CB  . LEU C 1 176 ? -29.628  204.188 -35.446 1.00 0.00 ? 171 LEU C CB  1 
ATOM 7208  C CG  . LEU C 1 176 ? -30.566  204.919 -36.501 1.00 0.00 ? 171 LEU C CG  1 
ATOM 7209  C CD1 . LEU C 1 176 ? -31.666  205.738 -35.848 1.00 0.00 ? 171 LEU C CD1 1 
ATOM 7210  C CD2 . LEU C 1 176 ? -29.696  205.724 -37.563 1.00 0.00 ? 171 LEU C CD2 1 
ATOM 7211  N N   . ASP C 1 177 ? -28.193  201.624 -33.952 1.00 0.00 ? 172 ASP C N   1 
ATOM 7212  C CA  . ASP C 1 177 ? -27.302  201.222 -32.866 1.00 0.00 ? 172 ASP C CA  1 
ATOM 7213  C C   . ASP C 1 177 ? -26.144  200.334 -33.356 1.00 0.00 ? 172 ASP C C   1 
ATOM 7214  O O   . ASP C 1 177 ? -24.940  200.436 -32.966 1.00 0.00 ? 172 ASP C O   1 
ATOM 7215  C CB  . ASP C 1 177 ? -28.034  200.347 -31.846 1.00 0.00 ? 172 ASP C CB  1 
ATOM 7216  C CG  . ASP C 1 177 ? -29.196  201.162 -31.234 1.00 0.00 ? 172 ASP C CG  1 
ATOM 7217  O OD1 . ASP C 1 177 ? -29.166  202.424 -31.182 1.00 0.00 ? 172 ASP C OD1 1 
ATOM 7218  O OD2 . ASP C 1 177 ? -30.144  200.513 -30.733 1.00 0.00 ? 172 ASP C OD2 1 
ATOM 7219  N N   . TYR C 1 178 ? -26.511  199.447 -34.302 1.00 0.00 ? 173 TYR C N   1 
ATOM 7220  C CA  . TYR C 1 178 ? -25.592  198.656 -35.076 1.00 0.00 ? 173 TYR C CA  1 
ATOM 7221  C C   . TYR C 1 178 ? -24.653  199.552 -35.883 1.00 0.00 ? 173 TYR C C   1 
ATOM 7222  O O   . TYR C 1 178 ? -23.405  199.341 -35.941 1.00 0.00 ? 173 TYR C O   1 
ATOM 7223  C CB  . TYR C 1 178 ? -26.364  197.554 -35.822 1.00 0.00 ? 173 TYR C CB  1 
ATOM 7224  C CG  . TYR C 1 178 ? -25.498  196.734 -36.681 1.00 0.00 ? 173 TYR C CG  1 
ATOM 7225  C CD1 . TYR C 1 178 ? -24.816  197.230 -37.878 1.00 0.00 ? 173 TYR C CD1 1 
ATOM 7226  C CD2 . TYR C 1 178 ? -25.247  195.448 -36.300 1.00 0.00 ? 173 TYR C CD2 1 
ATOM 7227  C CE1 . TYR C 1 178 ? -24.004  196.428 -38.674 1.00 0.00 ? 173 TYR C CE1 1 
ATOM 7228  C CE2 . TYR C 1 178 ? -24.543  194.561 -37.135 1.00 0.00 ? 173 TYR C CE2 1 
ATOM 7229  C CZ  . TYR C 1 178 ? -23.925  195.027 -38.342 1.00 0.00 ? 173 TYR C CZ  1 
ATOM 7230  O OH  . TYR C 1 178 ? -23.101  194.162 -38.947 1.00 0.00 ? 173 TYR C OH  1 
ATOM 7231  N N   . ALA C 1 179 ? -25.152  200.599 -36.551 1.00 0.00 ? 174 ALA C N   1 
ATOM 7232  C CA  . ALA C 1 179 ? -24.432  201.605 -37.220 1.00 0.00 ? 174 ALA C CA  1 
ATOM 7233  C C   . ALA C 1 179 ? -23.455  202.440 -36.401 1.00 0.00 ? 174 ALA C C   1 
ATOM 7234  O O   . ALA C 1 179 ? -22.340  202.651 -36.838 1.00 0.00 ? 174 ALA C O   1 
ATOM 7235  C CB  . ALA C 1 179 ? -25.530  202.470 -37.799 1.00 0.00 ? 174 ALA C CB  1 
ATOM 7236  N N   . LEU C 1 180 ? -23.867  202.826 -35.195 1.00 0.00 ? 175 LEU C N   1 
ATOM 7237  C CA  . LEU C 1 180 ? -23.046  203.481 -34.223 1.00 0.00 ? 175 LEU C CA  1 
ATOM 7238  C C   . LEU C 1 180 ? -21.901  202.610 -33.868 1.00 0.00 ? 175 LEU C C   1 
ATOM 7239  O O   . LEU C 1 180 ? -20.725  202.998 -33.918 1.00 0.00 ? 175 LEU C O   1 
ATOM 7240  C CB  . LEU C 1 180 ? -23.809  203.866 -32.871 1.00 0.00 ? 175 LEU C CB  1 
ATOM 7241  C CG  . LEU C 1 180 ? -22.988  204.545 -31.736 1.00 0.00 ? 175 LEU C CG  1 
ATOM 7242  C CD1 . LEU C 1 180 ? -22.395  205.884 -32.183 1.00 0.00 ? 175 LEU C CD1 1 
ATOM 7243  C CD2 . LEU C 1 180 ? -23.915  204.775 -30.503 1.00 0.00 ? 175 LEU C CD2 1 
ATOM 7244  N N   . GLN C 1 181 ? -22.190  201.310 -33.608 1.00 0.00 ? 176 GLN C N   1 
ATOM 7245  C CA  . GLN C 1 181 ? -21.247  200.439 -32.956 1.00 0.00 ? 176 GLN C CA  1 
ATOM 7246  C C   . GLN C 1 181 ? -20.145  199.798 -33.842 1.00 0.00 ? 176 GLN C C   1 
ATOM 7247  O O   . GLN C 1 181 ? -18.994  199.754 -33.404 1.00 0.00 ? 176 GLN C O   1 
ATOM 7248  C CB  . GLN C 1 181 ? -22.057  199.322 -32.173 1.00 0.00 ? 176 GLN C CB  1 
ATOM 7249  C CG  . GLN C 1 181 ? -22.803  199.706 -30.842 1.00 0.00 ? 176 GLN C CG  1 
ATOM 7250  C CD  . GLN C 1 181 ? -21.810  199.748 -29.636 1.00 0.00 ? 176 GLN C CD  1 
ATOM 7251  O OE1 . GLN C 1 181 ? -20.577  199.814 -29.833 1.00 0.00 ? 176 GLN C OE1 1 
ATOM 7252  N NE2 . GLN C 1 181 ? -22.369  199.758 -28.421 1.00 0.00 ? 176 GLN C NE2 1 
ATOM 7253  N N   . ILE C 1 182 ? -20.479  199.368 -35.049 1.00 0.00 ? 177 ILE C N   1 
ATOM 7254  C CA  . ILE C 1 182 ? -19.558  199.194 -36.151 1.00 0.00 ? 177 ILE C CA  1 
ATOM 7255  C C   . ILE C 1 182 ? -18.726  200.447 -36.435 1.00 0.00 ? 177 ILE C C   1 
ATOM 7256  O O   . ILE C 1 182 ? -17.557  200.472 -36.666 1.00 0.00 ? 177 ILE C O   1 
ATOM 7257  C CB  . ILE C 1 182 ? -20.489  198.693 -37.261 1.00 0.00 ? 177 ILE C CB  1 
ATOM 7258  C CG1 . ILE C 1 182 ? -19.749  197.514 -37.974 1.00 0.00 ? 177 ILE C CG1 1 
ATOM 7259  C CG2 . ILE C 1 182 ? -20.985  199.742 -38.281 1.00 0.00 ? 177 ILE C CG2 1 
ATOM 7260  C CD1 . ILE C 1 182 ? -18.542  197.930 -38.855 1.00 0.00 ? 177 ILE C CD1 1 
ATOM 7261  N N   . ASN C 1 183 ? -19.328  201.683 -36.420 1.00 0.00 ? 178 ASN C N   1 
ATOM 7262  C CA  . ASN C 1 183 ? -18.609  202.979 -36.713 1.00 0.00 ? 178 ASN C CA  1 
ATOM 7263  C C   . ASN C 1 183 ? -17.511  203.285 -35.603 1.00 0.00 ? 178 ASN C C   1 
ATOM 7264  O O   . ASN C 1 183 ? -16.427  203.810 -35.881 1.00 0.00 ? 178 ASN C O   1 
ATOM 7265  C CB  . ASN C 1 183 ? -19.610  204.115 -36.806 1.00 0.00 ? 178 ASN C CB  1 
ATOM 7266  C CG  . ASN C 1 183 ? -19.105  205.400 -37.611 1.00 0.00 ? 178 ASN C CG  1 
ATOM 7267  O OD1 . ASN C 1 183 ? -18.251  206.156 -37.097 1.00 0.00 ? 178 ASN C OD1 1 
ATOM 7268  N ND2 . ASN C 1 183 ? -19.631  205.619 -38.870 1.00 0.00 ? 178 ASN C ND2 1 
ATOM 7269  N N   . VAL C 1 184 ? -17.791  202.940 -34.349 1.00 0.00 ? 179 VAL C N   1 
ATOM 7270  C CA  . VAL C 1 184 ? -16.752  202.951 -33.272 1.00 0.00 ? 179 VAL C CA  1 
ATOM 7271  C C   . VAL C 1 184 ? -15.602  201.942 -33.561 1.00 0.00 ? 179 VAL C C   1 
ATOM 7272  O O   . VAL C 1 184 ? -14.409  202.234 -33.344 1.00 0.00 ? 179 VAL C O   1 
ATOM 7273  C CB  . VAL C 1 184 ? -17.389  202.467 -31.974 1.00 0.00 ? 179 VAL C CB  1 
ATOM 7274  C CG1 . VAL C 1 184 ? -16.375  202.102 -30.863 1.00 0.00 ? 179 VAL C CG1 1 
ATOM 7275  C CG2 . VAL C 1 184 ? -18.243  203.732 -31.476 1.00 0.00 ? 179 VAL C CG2 1 
ATOM 7276  N N   . ILE C 1 185 ? -15.802  200.650 -34.015 1.00 0.00 ? 180 ILE C N   1 
ATOM 7277  C CA  . ILE C 1 185 ? -14.775  199.672 -34.053 1.00 0.00 ? 180 ILE C CA  1 
ATOM 7278  C C   . ILE C 1 185 ? -13.789  199.874 -35.220 1.00 0.00 ? 180 ILE C C   1 
ATOM 7279  O O   . ILE C 1 185 ? -12.561  199.677 -35.148 1.00 0.00 ? 180 ILE C O   1 
ATOM 7280  C CB  . ILE C 1 185 ? -15.294  198.238 -33.959 1.00 0.00 ? 180 ILE C CB  1 
ATOM 7281  C CG1 . ILE C 1 185 ? -14.194  197.168 -33.715 1.00 0.00 ? 180 ILE C CG1 1 
ATOM 7282  C CG2 . ILE C 1 185 ? -16.081  197.838 -35.310 1.00 0.00 ? 180 ILE C CG2 1 
ATOM 7283  C CD1 . ILE C 1 185 ? -13.306  197.346 -32.436 1.00 0.00 ? 180 ILE C CD1 1 
ATOM 7284  N N   . GLU C 1 186 ? -14.261  200.482 -36.351 1.00 0.00 ? 181 GLU C N   1 
ATOM 7285  C CA  . GLU C 1 186 ? -13.391  200.902 -37.417 1.00 0.00 ? 181 GLU C CA  1 
ATOM 7286  C C   . GLU C 1 186 ? -12.298  201.935 -36.991 1.00 0.00 ? 181 GLU C C   1 
ATOM 7287  O O   . GLU C 1 186 ? -11.131  201.759 -37.242 1.00 0.00 ? 181 GLU C O   1 
ATOM 7288  C CB  . GLU C 1 186 ? -14.123  201.267 -38.658 1.00 0.00 ? 181 GLU C CB  1 
ATOM 7289  C CG  . GLU C 1 186 ? -13.314  201.784 -39.893 1.00 0.00 ? 181 GLU C CG  1 
ATOM 7290  C CD  . GLU C 1 186 ? -12.188  200.760 -40.314 1.00 0.00 ? 181 GLU C CD  1 
ATOM 7291  O OE1 . GLU C 1 186 ? -12.519  199.559 -40.406 1.00 0.00 ? 181 GLU C OE1 1 
ATOM 7292  O OE2 . GLU C 1 186 ? -11.051  201.185 -40.580 1.00 0.00 ? 181 GLU C OE2 1 
ATOM 7293  N N   . ASP C 1 187 ? -12.677  202.987 -36.231 1.00 0.00 ? 182 ASP C N   1 
ATOM 7294  C CA  . ASP C 1 187 ? -11.672  203.860 -35.693 1.00 0.00 ? 182 ASP C CA  1 
ATOM 7295  C C   . ASP C 1 187 ? -10.838  203.167 -34.579 1.00 0.00 ? 182 ASP C C   1 
ATOM 7296  O O   . ASP C 1 187 ? -9.597   203.217 -34.600 1.00 0.00 ? 182 ASP C O   1 
ATOM 7297  C CB  . ASP C 1 187 ? -12.367  205.197 -35.259 1.00 0.00 ? 182 ASP C CB  1 
ATOM 7298  C CG  . ASP C 1 187 ? -12.493  206.115 -36.432 1.00 0.00 ? 182 ASP C CG  1 
ATOM 7299  O OD1 . ASP C 1 187 ? -13.523  205.951 -37.200 1.00 0.00 ? 182 ASP C OD1 1 
ATOM 7300  O OD2 . ASP C 1 187 ? -11.678  207.071 -36.567 1.00 0.00 ? 182 ASP C OD2 1 
ATOM 7301  N N   . LYS C 1 188 ? -11.505  202.472 -33.646 1.00 0.00 ? 183 LYS C N   1 
ATOM 7302  C CA  . LYS C 1 188 ? -10.846  201.836 -32.481 1.00 0.00 ? 183 LYS C CA  1 
ATOM 7303  C C   . LYS C 1 188 ? -9.777   200.746 -32.743 1.00 0.00 ? 183 LYS C C   1 
ATOM 7304  O O   . LYS C 1 188 ? -8.724   200.704 -32.143 1.00 0.00 ? 183 LYS C O   1 
ATOM 7305  C CB  . LYS C 1 188 ? -11.857  201.545 -31.295 1.00 0.00 ? 183 LYS C CB  1 
ATOM 7306  C CG  . LYS C 1 188 ? -11.201  201.194 -29.913 1.00 0.00 ? 183 LYS C CG  1 
ATOM 7307  C CD  . LYS C 1 188 ? -12.232  200.595 -29.063 1.00 0.00 ? 183 LYS C CD  1 
ATOM 7308  C CE  . LYS C 1 188 ? -11.722  199.947 -27.784 1.00 0.00 ? 183 LYS C CE  1 
ATOM 7309  N NZ  . LYS C 1 188 ? -10.697  200.765 -27.159 1.00 0.00 ? 183 LYS C NZ  1 
ATOM 7310  N N   . ARG C 1 189 ? -10.037  199.788 -33.728 1.00 0.00 ? 184 ARG C N   1 
ATOM 7311  C CA  . ARG C 1 189 ? -9.155   198.667 -34.058 1.00 0.00 ? 184 ARG C CA  1 
ATOM 7312  C C   . ARG C 1 189 ? -7.716   199.135 -34.347 1.00 0.00 ? 184 ARG C C   1 
ATOM 7313  O O   . ARG C 1 189 ? -6.740   198.445 -34.073 1.00 0.00 ? 184 ARG C O   1 
ATOM 7314  C CB  . ARG C 1 189 ? -9.811   197.897 -35.201 1.00 0.00 ? 184 ARG C CB  1 
ATOM 7315  C CG  . ARG C 1 189 ? -9.912   198.634 -36.559 1.00 0.00 ? 184 ARG C CG  1 
ATOM 7316  C CD  . ARG C 1 189 ? -10.826  198.126 -37.594 1.00 0.00 ? 184 ARG C CD  1 
ATOM 7317  N NE  . ARG C 1 189 ? -10.272  196.852 -38.219 1.00 0.00 ? 184 ARG C NE  1 
ATOM 7318  C CZ  . ARG C 1 189 ? -10.632  196.354 -39.393 1.00 0.00 ? 184 ARG C CZ  1 
ATOM 7319  N NH1 . ARG C 1 189 ? -11.458  196.906 -40.222 1.00 0.00 ? 184 ARG C NH1 1 
ATOM 7320  N NH2 . ARG C 1 189 ? -10.139  195.173 -39.730 1.00 0.00 ? 184 ARG C NH2 1 
ATOM 7321  N N   . LYS C 1 190 ? -7.597   200.265 -35.123 1.00 0.00 ? 185 LYS C N   1 
ATOM 7322  C CA  . LYS C 1 190 ? -6.273   200.722 -35.614 1.00 0.00 ? 185 LYS C CA  1 
ATOM 7323  C C   . LYS C 1 190 ? -5.284   201.253 -34.478 1.00 0.00 ? 185 LYS C C   1 
ATOM 7324  O O   . LYS C 1 190 ? -4.106   200.943 -34.408 1.00 0.00 ? 185 LYS C O   1 
ATOM 7325  C CB  . LYS C 1 190 ? -6.350   201.755 -36.854 1.00 0.00 ? 185 LYS C CB  1 
ATOM 7326  C CG  . LYS C 1 190 ? -7.267   202.901 -36.583 1.00 0.00 ? 185 LYS C CG  1 
ATOM 7327  C CD  . LYS C 1 190 ? -7.418   203.714 -37.895 1.00 0.00 ? 185 LYS C CD  1 
ATOM 7328  C CE  . LYS C 1 190 ? -8.320   204.928 -37.724 1.00 0.00 ? 185 LYS C CE  1 
ATOM 7329  N NZ  . LYS C 1 190 ? -8.709   205.444 -39.079 1.00 0.00 ? 185 LYS C NZ  1 
ATOM 7330  N N   . PHE C 1 191 ? -5.935   201.981 -33.595 1.00 0.00 ? 186 PHE C N   1 
ATOM 7331  C CA  . PHE C 1 191 ? -5.281   202.727 -32.468 1.00 0.00 ? 186 PHE C CA  1 
ATOM 7332  C C   . PHE C 1 191 ? -4.773   201.771 -31.468 1.00 0.00 ? 186 PHE C C   1 
ATOM 7333  O O   . PHE C 1 191 ? -3.655   201.954 -31.051 1.00 0.00 ? 186 PHE C O   1 
ATOM 7334  C CB  . PHE C 1 191 ? -6.329   203.595 -31.743 1.00 0.00 ? 186 PHE C CB  1 
ATOM 7335  C CG  . PHE C 1 191 ? -6.949   204.685 -32.609 1.00 0.00 ? 186 PHE C CG  1 
ATOM 7336  C CD1 . PHE C 1 191 ? -6.361   205.220 -33.753 1.00 0.00 ? 186 PHE C CD1 1 
ATOM 7337  C CD2 . PHE C 1 191 ? -8.244   205.100 -32.305 1.00 0.00 ? 186 PHE C CD2 1 
ATOM 7338  C CE1 . PHE C 1 191 ? -7.152   206.098 -34.576 1.00 0.00 ? 186 PHE C CE1 1 
ATOM 7339  C CE2 . PHE C 1 191 ? -8.998   205.966 -33.062 1.00 0.00 ? 186 PHE C CE2 1 
ATOM 7340  C CZ  . PHE C 1 191 ? -8.530   206.417 -34.302 1.00 0.00 ? 186 PHE C CZ  1 
ATOM 7341  N N   . ASP C 1 192 ? -5.583   200.807 -31.023 1.00 0.00 ? 187 ASP C N   1 
ATOM 7342  C CA  . ASP C 1 192 ? -5.259   199.905 -29.930 1.00 0.00 ? 187 ASP C CA  1 
ATOM 7343  C C   . ASP C 1 192 ? -4.066   199.045 -30.222 1.00 0.00 ? 187 ASP C C   1 
ATOM 7344  O O   . ASP C 1 192 ? -3.078   198.884 -29.504 1.00 0.00 ? 187 ASP C O   1 
ATOM 7345  C CB  . ASP C 1 192 ? -6.539   199.173 -29.360 1.00 0.00 ? 187 ASP C CB  1 
ATOM 7346  C CG  . ASP C 1 192 ? -7.372   199.843 -28.289 1.00 0.00 ? 187 ASP C CG  1 
ATOM 7347  O OD1 . ASP C 1 192 ? -6.787   200.212 -27.205 1.00 0.00 ? 187 ASP C OD1 1 
ATOM 7348  O OD2 . ASP C 1 192 ? -8.603   199.938 -28.439 1.00 0.00 ? 187 ASP C OD2 1 
ATOM 7349  N N   . ILE C 1 193 ? -4.058   198.466 -31.462 1.00 0.00 ? 188 ILE C N   1 
ATOM 7350  C CA  . ILE C 1 193 ? -2.939   197.704 -32.004 1.00 0.00 ? 188 ILE C CA  1 
ATOM 7351  C C   . ILE C 1 193 ? -1.748   198.583 -32.363 1.00 0.00 ? 188 ILE C C   1 
ATOM 7352  O O   . ILE C 1 193 ? -0.628   198.154 -32.203 1.00 0.00 ? 188 ILE C O   1 
ATOM 7353  C CB  . ILE C 1 193 ? -3.297   196.699 -33.089 1.00 0.00 ? 188 ILE C CB  1 
ATOM 7354  C CG1 . ILE C 1 193 ? -3.757   197.439 -34.448 1.00 0.00 ? 188 ILE C CG1 1 
ATOM 7355  C CG2 . ILE C 1 193 ? -4.547   195.791 -32.680 1.00 0.00 ? 188 ILE C CG2 1 
ATOM 7356  C CD1 . ILE C 1 193 ? -2.566   197.573 -35.400 1.00 0.00 ? 188 ILE C CD1 1 
ATOM 7357  N N   . MET C 1 194 ? -1.934   199.805 -32.884 1.00 0.00 ? 189 MET C N   1 
ATOM 7358  C CA  . MET C 1 194 ? -0.831   200.767 -32.850 1.00 0.00 ? 189 MET C CA  1 
ATOM 7359  C C   . MET C 1 194 ? -0.222   201.041 -31.479 1.00 0.00 ? 189 MET C C   1 
ATOM 7360  O O   . MET C 1 194 ? 1.017    201.100 -31.379 1.00 0.00 ? 189 MET C O   1 
ATOM 7361  C CB  . MET C 1 194 ? -1.263   202.185 -33.517 1.00 0.00 ? 189 MET C CB  1 
ATOM 7362  C CG  . MET C 1 194 ? -0.218   203.275 -33.591 1.00 0.00 ? 189 MET C CG  1 
ATOM 7363  S SD  . MET C 1 194 ? 1.396    203.006 -34.371 1.00 0.00 ? 189 MET C SD  1 
ATOM 7364  C CE  . MET C 1 194 ? 1.081    203.392 -36.026 1.00 0.00 ? 189 MET C CE  1 
ATOM 7365  N N   . GLU C 1 195 ? -0.978   201.159 -30.441 1.00 0.00 ? 190 GLU C N   1 
ATOM 7366  C CA  . GLU C 1 195 ? -0.611   201.329 -29.067 1.00 0.00 ? 190 GLU C CA  1 
ATOM 7367  C C   . GLU C 1 195 ? 0.226    200.158 -28.593 1.00 0.00 ? 190 GLU C C   1 
ATOM 7368  O O   . GLU C 1 195 ? 1.217    200.353 -27.910 1.00 0.00 ? 190 GLU C O   1 
ATOM 7369  C CB  . GLU C 1 195 ? -1.850   201.603 -28.230 1.00 0.00 ? 190 GLU C CB  1 
ATOM 7370  C CG  . GLU C 1 195 ? -1.480   201.750 -26.724 1.00 0.00 ? 190 GLU C CG  1 
ATOM 7371  C CD  . GLU C 1 195 ? -2.583   202.174 -25.828 1.00 0.00 ? 190 GLU C CD  1 
ATOM 7372  O OE1 . GLU C 1 195 ? -3.715   202.470 -26.300 1.00 0.00 ? 190 GLU C OE1 1 
ATOM 7373  O OE2 . GLU C 1 195 ? -2.428   202.120 -24.568 1.00 0.00 ? 190 GLU C OE2 1 
ATOM 7374  N N   . PHE C 1 196 ? -0.196   198.935 -29.050 1.00 0.00 ? 191 PHE C N   1 
ATOM 7375  C CA  . PHE C 1 196 ? 0.423    197.659 -28.677 1.00 0.00 ? 191 PHE C CA  1 
ATOM 7376  C C   . PHE C 1 196 ? 1.833    197.693 -29.294 1.00 0.00 ? 191 PHE C C   1 
ATOM 7377  O O   . PHE C 1 196 ? 2.791    197.223 -28.661 1.00 0.00 ? 191 PHE C O   1 
ATOM 7378  C CB  . PHE C 1 196 ? -0.416   196.474 -29.188 1.00 0.00 ? 191 PHE C CB  1 
ATOM 7379  C CG  . PHE C 1 196 ? 0.136    195.281 -28.604 1.00 0.00 ? 191 PHE C CG  1 
ATOM 7380  C CD1 . PHE C 1 196 ? 0.156    195.102 -27.249 1.00 0.00 ? 191 PHE C CD1 1 
ATOM 7381  C CD2 . PHE C 1 196 ? 0.693    194.220 -29.429 1.00 0.00 ? 191 PHE C CD2 1 
ATOM 7382  C CE1 . PHE C 1 196 ? 0.665    193.903 -26.700 1.00 0.00 ? 191 PHE C CE1 1 
ATOM 7383  C CE2 . PHE C 1 196 ? 1.248    193.031 -28.918 1.00 0.00 ? 191 PHE C CE2 1 
ATOM 7384  C CZ  . PHE C 1 196 ? 1.310    192.943 -27.483 1.00 0.00 ? 191 PHE C CZ  1 
ATOM 7385  N N   . VAL C 1 197 ? 1.956    198.089 -30.498 1.00 0.00 ? 192 VAL C N   1 
ATOM 7386  C CA  . VAL C 1 197 ? 3.292    198.128 -31.227 1.00 0.00 ? 192 VAL C CA  1 
ATOM 7387  C C   . VAL C 1 197 ? 4.178    199.221 -30.630 1.00 0.00 ? 192 VAL C C   1 
ATOM 7388  O O   . VAL C 1 197 ? 5.377    199.050 -30.479 1.00 0.00 ? 192 VAL C O   1 
ATOM 7389  C CB  . VAL C 1 197 ? 3.012    198.352 -32.740 1.00 0.00 ? 192 VAL C CB  1 
ATOM 7390  C CG1 . VAL C 1 197 ? 4.269    198.718 -33.505 1.00 0.00 ? 192 VAL C CG1 1 
ATOM 7391  C CG2 . VAL C 1 197 ? 2.503    197.040 -33.404 1.00 0.00 ? 192 VAL C CG2 1 
ATOM 7392  N N   . LEU C 1 198 ? 3.553    200.364 -30.266 1.00 0.00 ? 193 LEU C N   1 
ATOM 7393  C CA  . LEU C 1 198 ? 4.227    201.496 -29.499 1.00 0.00 ? 193 LEU C CA  1 
ATOM 7394  C C   . LEU C 1 198 ? 4.917    200.975 -28.294 1.00 0.00 ? 193 LEU C C   1 
ATOM 7395  O O   . LEU C 1 198 ? 6.104    201.178 -28.074 1.00 0.00 ? 193 LEU C O   1 
ATOM 7396  C CB  . LEU C 1 198 ? 3.293    202.712 -29.161 1.00 0.00 ? 193 LEU C CB  1 
ATOM 7397  C CG  . LEU C 1 198 ? 2.906    203.611 -30.416 1.00 0.00 ? 193 LEU C CG  1 
ATOM 7398  C CD1 . LEU C 1 198 ? 2.023    204.743 -29.762 1.00 0.00 ? 193 LEU C CD1 1 
ATOM 7399  C CD2 . LEU C 1 198 ? 4.054    204.200 -31.109 1.00 0.00 ? 193 LEU C CD2 1 
ATOM 7400  N N   . ARG C 1 199 ? 4.152    200.182 -27.424 1.00 0.00 ? 194 ARG C N   1 
ATOM 7401  C CA  . ARG C 1 199 ? 4.604    199.568 -26.187 1.00 0.00 ? 194 ARG C CA  1 
ATOM 7402  C C   . ARG C 1 199 ? 5.614    198.497 -26.426 1.00 0.00 ? 194 ARG C C   1 
ATOM 7403  O O   . ARG C 1 199 ? 6.555    198.386 -25.651 1.00 0.00 ? 194 ARG C O   1 
ATOM 7404  C CB  . ARG C 1 199 ? 3.471    198.753 -25.512 1.00 0.00 ? 194 ARG C CB  1 
ATOM 7405  C CG  . ARG C 1 199 ? 2.518    199.494 -24.646 1.00 0.00 ? 194 ARG C CG  1 
ATOM 7406  C CD  . ARG C 1 199 ? 3.076    200.041 -23.250 1.00 0.00 ? 194 ARG C CD  1 
ATOM 7407  N NE  . ARG C 1 199 ? 3.868    201.377 -23.470 1.00 0.00 ? 194 ARG C NE  1 
ATOM 7408  C CZ  . ARG C 1 199 ? 3.159    202.491 -23.728 1.00 0.00 ? 194 ARG C CZ  1 
ATOM 7409  N NH1 . ARG C 1 199 ? 1.831    202.504 -23.763 1.00 0.00 ? 194 ARG C NH1 1 
ATOM 7410  N NH2 . ARG C 1 199 ? 3.730    203.679 -23.655 1.00 0.00 ? 194 ARG C NH2 1 
ATOM 7411  N N   . LEU C 1 200 ? 5.503    197.665 -27.455 1.00 0.00 ? 195 LEU C N   1 
ATOM 7412  C CA  . LEU C 1 200 ? 6.609    196.804 -27.871 1.00 0.00 ? 195 LEU C CA  1 
ATOM 7413  C C   . LEU C 1 200 ? 7.961    197.547 -28.087 1.00 0.00 ? 195 LEU C C   1 
ATOM 7414  O O   . LEU C 1 200 ? 8.964    197.245 -27.405 1.00 0.00 ? 195 LEU C O   1 
ATOM 7415  C CB  . LEU C 1 200 ? 6.287    195.907 -29.014 1.00 0.00 ? 195 LEU C CB  1 
ATOM 7416  C CG  . LEU C 1 200 ? 5.170    194.873 -28.700 1.00 0.00 ? 195 LEU C CG  1 
ATOM 7417  C CD1 . LEU C 1 200 ? 4.719    194.138 -30.003 1.00 0.00 ? 195 LEU C CD1 1 
ATOM 7418  C CD2 . LEU C 1 200 ? 5.583    193.824 -27.687 1.00 0.00 ? 195 LEU C CD2 1 
ATOM 7419  N N   . VAL C 1 201 ? 8.079    198.496 -29.033 1.00 0.00 ? 196 VAL C N   1 
ATOM 7420  C CA  . VAL C 1 201 ? 9.393    199.084 -29.356 1.00 0.00 ? 196 VAL C CA  1 
ATOM 7421  C C   . VAL C 1 201 ? 9.890    200.038 -28.352 1.00 0.00 ? 196 VAL C C   1 
ATOM 7422  O O   . VAL C 1 201 ? 11.111   200.353 -28.209 1.00 0.00 ? 196 VAL C O   1 
ATOM 7423  C CB  . VAL C 1 201 ? 9.381    199.810 -30.705 1.00 0.00 ? 196 VAL C CB  1 
ATOM 7424  C CG1 . VAL C 1 201 ? 8.870    198.903 -31.762 1.00 0.00 ? 196 VAL C CG1 1 
ATOM 7425  C CG2 . VAL C 1 201 ? 8.547    201.059 -30.679 1.00 0.00 ? 196 VAL C CG2 1 
ATOM 7426  N N   . GLU C 1 202 ? 9.006    200.552 -27.492 1.00 0.00 ? 197 GLU C N   1 
ATOM 7427  C CA  . GLU C 1 202 ? 9.309    201.273 -26.256 1.00 0.00 ? 197 GLU C CA  1 
ATOM 7428  C C   . GLU C 1 202 ? 10.190   200.477 -25.260 1.00 0.00 ? 197 GLU C C   1 
ATOM 7429  O O   . GLU C 1 202 ? 11.252   200.905 -24.867 1.00 0.00 ? 197 GLU C O   1 
ATOM 7430  C CB  . GLU C 1 202 ? 7.904    201.656 -25.605 1.00 0.00 ? 197 GLU C CB  1 
ATOM 7431  C CG  . GLU C 1 202 ? 8.087    202.706 -24.478 1.00 0.00 ? 197 GLU C CG  1 
ATOM 7432  C CD  . GLU C 1 202 ? 6.897    203.004 -23.549 1.00 0.00 ? 197 GLU C CD  1 
ATOM 7433  O OE1 . GLU C 1 202 ? 6.545    201.978 -22.927 1.00 0.00 ? 197 GLU C OE1 1 
ATOM 7434  O OE2 . GLU C 1 202 ? 6.335    204.153 -23.440 1.00 0.00 ? 197 GLU C OE2 1 
ATOM 7435  N N   . ALA C 1 203 ? 9.791    199.203 -24.911 1.00 0.00 ? 198 ALA C N   1 
ATOM 7436  C CA  . ALA C 1 203 ? 10.522   198.335 -24.025 1.00 0.00 ? 198 ALA C CA  1 
ATOM 7437  C C   . ALA C 1 203 ? 11.829   197.943 -24.609 1.00 0.00 ? 198 ALA C C   1 
ATOM 7438  O O   . ALA C 1 203 ? 12.815   197.899 -23.846 1.00 0.00 ? 198 ALA C O   1 
ATOM 7439  C CB  . ALA C 1 203 ? 9.620    197.077 -23.647 1.00 0.00 ? 198 ALA C CB  1 
ATOM 7440  N N   . GLN C 1 204 ? 11.961   197.755 -25.953 1.00 0.00 ? 199 GLN C N   1 
ATOM 7441  C CA  . GLN C 1 204 ? 13.199   197.568 -26.625 1.00 0.00 ? 199 GLN C CA  1 
ATOM 7442  C C   . GLN C 1 204 ? 14.135   198.778 -26.496 1.00 0.00 ? 199 GLN C C   1 
ATOM 7443  O O   . GLN C 1 204 ? 15.317   198.616 -26.175 1.00 0.00 ? 199 GLN C O   1 
ATOM 7444  C CB  . GLN C 1 204 ? 12.883   197.163 -28.145 1.00 0.00 ? 199 GLN C CB  1 
ATOM 7445  C CG  . GLN C 1 204 ? 14.098   196.587 -28.856 1.00 0.00 ? 199 GLN C CG  1 
ATOM 7446  C CD  . GLN C 1 204 ? 13.823   195.901 -30.204 1.00 0.00 ? 199 GLN C CD  1 
ATOM 7447  O OE1 . GLN C 1 204 ? 13.372   196.542 -31.214 1.00 0.00 ? 199 GLN C OE1 1 
ATOM 7448  N NE2 . GLN C 1 204 ? 14.173   194.602 -30.211 1.00 0.00 ? 199 GLN C NE2 1 
ATOM 7449  N N   . ALA C 1 205 ? 13.582   199.986 -26.779 1.00 0.00 ? 200 ALA C N   1 
ATOM 7450  C CA  . ALA C 1 205 ? 14.410   201.162 -26.606 1.00 0.00 ? 200 ALA C CA  1 
ATOM 7451  C C   . ALA C 1 205 ? 14.884   201.311 -25.173 1.00 0.00 ? 200 ALA C C   1 
ATOM 7452  O O   . ALA C 1 205 ? 16.067   201.653 -24.893 1.00 0.00 ? 200 ALA C O   1 
ATOM 7453  C CB  . ALA C 1 205 ? 13.618   202.382 -27.134 1.00 0.00 ? 200 ALA C CB  1 
ATOM 7454  N N   . THR C 1 206 ? 14.025   200.956 -24.263 1.00 0.00 ? 201 THR C N   1 
ATOM 7455  C CA  . THR C 1 206 ? 14.429   201.044 -22.890 1.00 0.00 ? 201 THR C CA  1 
ATOM 7456  C C   . THR C 1 206 ? 15.515   200.019 -22.480 1.00 0.00 ? 201 THR C C   1 
ATOM 7457  O O   . THR C 1 206 ? 16.522   200.343 -21.897 1.00 0.00 ? 201 THR C O   1 
ATOM 7458  C CB  . THR C 1 206 ? 13.414   200.910 -21.834 1.00 0.00 ? 201 THR C CB  1 
ATOM 7459  O OG1 . THR C 1 206 ? 12.464   202.001 -21.811 1.00 0.00 ? 201 THR C OG1 1 
ATOM 7460  C CG2 . THR C 1 206 ? 13.911   200.776 -20.419 1.00 0.00 ? 201 THR C CG2 1 
ATOM 7461  N N   . HIS C 1 207 ? 15.382   198.740 -22.942 1.00 0.00 ? 202 HIS C N   1 
ATOM 7462  C CA  . HIS C 1 207 ? 16.431   197.707 -22.822 1.00 0.00 ? 202 HIS C CA  1 
ATOM 7463  C C   . HIS C 1 207 ? 17.782   198.004 -23.526 1.00 0.00 ? 202 HIS C C   1 
ATOM 7464  O O   . HIS C 1 207 ? 18.806   197.729 -22.881 1.00 0.00 ? 202 HIS C O   1 
ATOM 7465  C CB  . HIS C 1 207 ? 15.867   196.390 -23.471 1.00 0.00 ? 202 HIS C CB  1 
ATOM 7466  C CG  . HIS C 1 207 ? 16.709   195.140 -23.375 1.00 0.00 ? 202 HIS C CG  1 
ATOM 7467  N ND1 . HIS C 1 207 ? 17.096   194.735 -22.114 1.00 0.00 ? 202 HIS C ND1 1 
ATOM 7468  C CD2 . HIS C 1 207 ? 17.551   194.482 -24.254 1.00 0.00 ? 202 HIS C CD2 1 
ATOM 7469  C CE1 . HIS C 1 207 ? 18.048   193.777 -22.279 1.00 0.00 ? 202 HIS C CE1 1 
ATOM 7470  N NE2 . HIS C 1 207 ? 18.322   193.561 -23.575 1.00 0.00 ? 202 HIS C NE2 1 
ATOM 7471  N N   . PHE C 1 208 ? 17.865   198.516 -24.752 1.00 0.00 ? 203 PHE C N   1 
ATOM 7472  C CA  . PHE C 1 208 ? 19.180   198.748 -25.288 1.00 0.00 ? 203 PHE C CA  1 
ATOM 7473  C C   . PHE C 1 208 ? 19.860   199.899 -24.637 1.00 0.00 ? 203 PHE C C   1 
ATOM 7474  O O   . PHE C 1 208 ? 21.122   199.939 -24.553 1.00 0.00 ? 203 PHE C O   1 
ATOM 7475  C CB  . PHE C 1 208 ? 19.092   198.910 -26.812 1.00 0.00 ? 203 PHE C CB  1 
ATOM 7476  C CG  . PHE C 1 208 ? 19.013   197.572 -27.638 1.00 0.00 ? 203 PHE C CG  1 
ATOM 7477  C CD1 . PHE C 1 208 ? 18.000   196.657 -27.368 1.00 0.00 ? 203 PHE C CD1 1 
ATOM 7478  C CD2 . PHE C 1 208 ? 19.960   197.255 -28.660 1.00 0.00 ? 203 PHE C CD2 1 
ATOM 7479  C CE1 . PHE C 1 208 ? 17.913   195.449 -28.066 1.00 0.00 ? 203 PHE C CE1 1 
ATOM 7480  C CE2 . PHE C 1 208 ? 19.934   195.969 -29.284 1.00 0.00 ? 203 PHE C CE2 1 
ATOM 7481  C CZ  . PHE C 1 208 ? 18.883   195.054 -28.946 1.00 0.00 ? 203 PHE C CZ  1 
ATOM 7482  N N   . GLN C 1 209 ? 19.100   200.797 -24.109 1.00 0.00 ? 204 GLN C N   1 
ATOM 7483  C CA  . GLN C 1 209 ? 19.729   202.007 -23.536 1.00 0.00 ? 204 GLN C CA  1 
ATOM 7484  C C   . GLN C 1 209 ? 20.358   201.700 -22.246 1.00 0.00 ? 204 GLN C C   1 
ATOM 7485  O O   . GLN C 1 209 ? 21.501   202.156 -22.096 1.00 0.00 ? 204 GLN C O   1 
ATOM 7486  C CB  . GLN C 1 209 ? 18.760   203.191 -23.580 1.00 0.00 ? 204 GLN C CB  1 
ATOM 7487  C CG  . GLN C 1 209 ? 19.453   204.519 -23.466 1.00 0.00 ? 204 GLN C CG  1 
ATOM 7488  C CD  . GLN C 1 209 ? 18.465   205.686 -23.264 1.00 0.00 ? 204 GLN C CD  1 
ATOM 7489  O OE1 . GLN C 1 209 ? 17.469   205.920 -24.048 1.00 0.00 ? 204 GLN C OE1 1 
ATOM 7490  N NE2 . GLN C 1 209 ? 18.695   206.481 -22.182 1.00 0.00 ? 204 GLN C NE2 1 
ATOM 7491  N N   . GLN C 1 210 ? 19.706   200.860 -21.306 1.00 0.00 ? 205 GLN C N   1 
ATOM 7492  C CA  . GLN C 1 210 ? 20.400   200.394 -20.057 1.00 0.00 ? 205 GLN C CA  1 
ATOM 7493  C C   . GLN C 1 210 ? 21.768   199.660 -20.304 1.00 0.00 ? 205 GLN C C   1 
ATOM 7494  O O   . GLN C 1 210 ? 22.810   199.898 -19.642 1.00 0.00 ? 205 GLN C O   1 
ATOM 7495  C CB  . GLN C 1 210 ? 19.543   199.526 -19.166 1.00 0.00 ? 205 GLN C CB  1 
ATOM 7496  C CG  . GLN C 1 210 ? 18.167   200.162 -18.906 1.00 0.00 ? 205 GLN C CG  1 
ATOM 7497  C CD  . GLN C 1 210 ? 17.341   199.362 -17.947 1.00 0.00 ? 205 GLN C CD  1 
ATOM 7498  O OE1 . GLN C 1 210 ? 17.502   198.165 -17.675 1.00 0.00 ? 205 GLN C OE1 1 
ATOM 7499  N NE2 . GLN C 1 210 ? 16.380   200.077 -17.277 1.00 0.00 ? 205 GLN C NE2 1 
ATOM 7500  N N   . GLY C 1 211 ? 21.774   198.878 -21.400 1.00 0.00 ? 206 GLY C N   1 
ATOM 7501  C CA  . GLY C 1 211 ? 22.944   198.131 -21.838 1.00 0.00 ? 206 GLY C CA  1 
ATOM 7502  C C   . GLY C 1 211 ? 23.998   198.942 -22.637 1.00 0.00 ? 206 GLY C C   1 
ATOM 7503  O O   . GLY C 1 211 ? 25.075   198.441 -22.874 1.00 0.00 ? 206 GLY C O   1 
ATOM 7504  N N   . HIS C 1 212 ? 23.637   200.133 -23.054 1.00 0.00 ? 207 HIS C N   1 
ATOM 7505  C CA  . HIS C 1 212 ? 24.451   201.016 -23.816 1.00 0.00 ? 207 HIS C CA  1 
ATOM 7506  C C   . HIS C 1 212 ? 25.139   202.014 -22.863 1.00 0.00 ? 207 HIS C C   1 
ATOM 7507  O O   . HIS C 1 212 ? 26.210   202.568 -23.084 1.00 0.00 ? 207 HIS C O   1 
ATOM 7508  C CB  . HIS C 1 212 ? 23.537   201.975 -24.682 1.00 0.00 ? 207 HIS C CB  1 
ATOM 7509  C CG  . HIS C 1 212 ? 24.302   202.834 -25.678 1.00 0.00 ? 207 HIS C CG  1 
ATOM 7510  N ND1 . HIS C 1 212 ? 24.666   204.125 -25.510 1.00 0.00 ? 207 HIS C ND1 1 
ATOM 7511  C CD2 . HIS C 1 212 ? 25.001   202.394 -26.701 1.00 0.00 ? 207 HIS C CD2 1 
ATOM 7512  C CE1 . HIS C 1 212 ? 25.380   204.436 -26.583 1.00 0.00 ? 207 HIS C CE1 1 
ATOM 7513  N NE2 . HIS C 1 212 ? 25.710   203.385 -27.347 1.00 0.00 ? 207 HIS C NE2 1 
ATOM 7514  N N   . GLU C 1 213 ? 24.434   202.240 -21.728 1.00 0.00 ? 208 GLU C N   1 
ATOM 7515  C CA  . GLU C 1 213 ? 24.718   203.252 -20.674 1.00 0.00 ? 208 GLU C CA  1 
ATOM 7516  C C   . GLU C 1 213 ? 25.970   202.934 -19.881 1.00 0.00 ? 208 GLU C C   1 
ATOM 7517  O O   . GLU C 1 213 ? 26.847   203.805 -19.667 1.00 0.00 ? 208 GLU C O   1 
ATOM 7518  C CB  . GLU C 1 213 ? 23.545   203.518 -19.727 1.00 0.00 ? 208 GLU C CB  1 
ATOM 7519  C CG  . GLU C 1 213 ? 23.716   204.571 -18.581 1.00 0.00 ? 208 GLU C CG  1 
ATOM 7520  C CD  . GLU C 1 213 ? 22.569   204.517 -17.637 1.00 0.00 ? 208 GLU C CD  1 
ATOM 7521  O OE1 . GLU C 1 213 ? 22.352   203.542 -16.883 1.00 0.00 ? 208 GLU C OE1 1 
ATOM 7522  O OE2 . GLU C 1 213 ? 21.785   205.492 -17.735 1.00 0.00 ? 208 GLU C OE2 1 
ATOM 7523  N N   . GLU C 1 214 ? 26.241   201.666 -19.503 1.00 0.00 ? 209 GLU C N   1 
ATOM 7524  C CA  . GLU C 1 214 ? 27.490   201.221 -18.880 1.00 0.00 ? 209 GLU C CA  1 
ATOM 7525  C C   . GLU C 1 214 ? 28.588   200.767 -19.937 1.00 0.00 ? 209 GLU C C   1 
ATOM 7526  O O   . GLU C 1 214 ? 29.638   200.390 -19.528 1.00 0.00 ? 209 GLU C O   1 
ATOM 7527  C CB  . GLU C 1 214 ? 27.268   200.169 -17.739 1.00 0.00 ? 209 GLU C CB  1 
ATOM 7528  C CG  . GLU C 1 214 ? 26.972   198.754 -18.245 1.00 0.00 ? 209 GLU C CG  1 
ATOM 7529  C CD  . GLU C 1 214 ? 26.740   197.761 -17.158 1.00 0.00 ? 209 GLU C CD  1 
ATOM 7530  O OE1 . GLU C 1 214 ? 27.841   197.251 -16.762 1.00 0.00 ? 209 GLU C OE1 1 
ATOM 7531  O OE2 . GLU C 1 214 ? 25.645   197.503 -16.689 1.00 0.00 ? 209 GLU C OE2 1 
ATOM 7532  N N   . LEU C 1 215 ? 28.274   200.752 -21.270 1.00 0.00 ? 210 LEU C N   1 
ATOM 7533  C CA  . LEU C 1 215 ? 29.157   200.334 -22.390 1.00 0.00 ? 210 LEU C CA  1 
ATOM 7534  C C   . LEU C 1 215 ? 30.516   200.899 -22.242 1.00 0.00 ? 210 LEU C C   1 
ATOM 7535  O O   . LEU C 1 215 ? 31.522   200.197 -22.361 1.00 0.00 ? 210 LEU C O   1 
ATOM 7536  C CB  . LEU C 1 215 ? 28.372   200.509 -23.749 1.00 0.00 ? 210 LEU C CB  1 
ATOM 7537  C CG  . LEU C 1 215 ? 28.969   199.855 -24.899 1.00 0.00 ? 210 LEU C CG  1 
ATOM 7538  C CD1 . LEU C 1 215 ? 28.184   198.598 -25.215 1.00 0.00 ? 210 LEU C CD1 1 
ATOM 7539  C CD2 . LEU C 1 215 ? 29.099   200.751 -26.103 1.00 0.00 ? 210 LEU C CD2 1 
ATOM 7540  N N   . SER C 1 216 ? 30.706   202.217 -21.906 1.00 0.00 ? 211 SER C N   1 
ATOM 7541  C CA  . SER C 1 216 ? 32.008   202.723 -21.537 1.00 0.00 ? 211 SER C CA  1 
ATOM 7542  C C   . SER C 1 216 ? 32.860   202.074 -20.452 1.00 0.00 ? 211 SER C C   1 
ATOM 7543  O O   . SER C 1 216 ? 34.094   201.844 -20.580 1.00 0.00 ? 211 SER C O   1 
ATOM 7544  C CB  . SER C 1 216 ? 31.910   204.200 -21.084 1.00 0.00 ? 211 SER C CB  1 
ATOM 7545  O OG  . SER C 1 216 ? 30.978   204.483 -20.056 1.00 0.00 ? 211 SER C OG  1 
ATOM 7546  N N   . ARG C 1 217 ? 32.299   201.745 -19.303 1.00 0.00 ? 212 ARG C N   1 
ATOM 7547  C CA  . ARG C 1 217 ? 32.872   200.907 -18.207 1.00 0.00 ? 212 ARG C CA  1 
ATOM 7548  C C   . ARG C 1 217 ? 33.238   199.541 -18.767 1.00 0.00 ? 212 ARG C C   1 
ATOM 7549  O O   . ARG C 1 217 ? 34.306   198.976 -18.432 1.00 0.00 ? 212 ARG C O   1 
ATOM 7550  C CB  . ARG C 1 217 ? 32.091   200.821 -16.892 1.00 0.00 ? 212 ARG C CB  1 
ATOM 7551  C CG  . ARG C 1 217 ? 31.055   199.751 -16.655 1.00 0.00 ? 212 ARG C CG  1 
ATOM 7552  C CD  . ARG C 1 217 ? 30.401   199.859 -15.283 1.00 0.00 ? 212 ARG C CD  1 
ATOM 7553  N NE  . ARG C 1 217 ? 29.468   198.670 -15.152 1.00 0.00 ? 212 ARG C NE  1 
ATOM 7554  C CZ  . ARG C 1 217 ? 28.902   198.307 -14.023 1.00 0.00 ? 212 ARG C CZ  1 
ATOM 7555  N NH1 . ARG C 1 217 ? 29.152   198.881 -12.874 1.00 0.00 ? 212 ARG C NH1 1 
ATOM 7556  N NH2 . ARG C 1 217 ? 28.074   197.231 -14.085 1.00 0.00 ? 212 ARG C NH2 1 
ATOM 7557  N N   . LEU C 1 218 ? 32.482   198.903 -19.643 1.00 0.00 ? 213 LEU C N   1 
ATOM 7558  C CA  . LEU C 1 218 ? 32.772   197.549 -20.106 1.00 0.00 ? 213 LEU C CA  1 
ATOM 7559  C C   . LEU C 1 218 ? 34.026   197.570 -21.029 1.00 0.00 ? 213 LEU C C   1 
ATOM 7560  O O   . LEU C 1 218 ? 34.855   196.621 -21.057 1.00 0.00 ? 213 LEU C O   1 
ATOM 7561  C CB  . LEU C 1 218 ? 31.490   196.938 -20.722 1.00 0.00 ? 213 LEU C CB  1 
ATOM 7562  C CG  . LEU C 1 218 ? 31.597   195.369 -20.811 1.00 0.00 ? 213 LEU C CG  1 
ATOM 7563  C CD1 . LEU C 1 218 ? 31.359   194.635 -19.526 1.00 0.00 ? 213 LEU C CD1 1 
ATOM 7564  C CD2 . LEU C 1 218 ? 30.420   194.983 -21.822 1.00 0.00 ? 213 LEU C CD2 1 
ATOM 7565  N N   . SER C 1 219 ? 34.120   198.619 -21.899 1.00 0.00 ? 214 SER C N   1 
ATOM 7566  C CA  . SER C 1 219 ? 35.068   198.897 -22.931 1.00 0.00 ? 214 SER C CA  1 
ATOM 7567  C C   . SER C 1 219 ? 36.437   199.158 -22.403 1.00 0.00 ? 214 SER C C   1 
ATOM 7568  O O   . SER C 1 219 ? 37.418   198.588 -22.971 1.00 0.00 ? 214 SER C O   1 
ATOM 7569  C CB  . SER C 1 219 ? 34.638   200.153 -23.786 1.00 0.00 ? 214 SER C CB  1 
ATOM 7570  O OG  . SER C 1 219 ? 33.341   199.966 -24.327 1.00 0.00 ? 214 SER C OG  1 
ATOM 7571  N N   . GLN C 1 220 ? 36.686   199.953 -21.335 1.00 0.00 ? 215 GLN C N   1 
ATOM 7572  C CA  . GLN C 1 220 ? 37.904   200.005 -20.582 1.00 0.00 ? 215 GLN C CA  1 
ATOM 7573  C C   . GLN C 1 220 ? 38.379   198.675 -20.113 1.00 0.00 ? 215 GLN C C   1 
ATOM 7574  O O   . GLN C 1 220 ? 39.542   198.363 -20.358 1.00 0.00 ? 215 GLN C O   1 
ATOM 7575  C CB  . GLN C 1 220 ? 37.740   200.909 -19.382 1.00 0.00 ? 215 GLN C CB  1 
ATOM 7576  C CG  . GLN C 1 220 ? 39.099   201.475 -18.728 1.00 0.00 ? 215 GLN C CG  1 
ATOM 7577  C CD  . GLN C 1 220 ? 39.898   202.460 -19.556 1.00 0.00 ? 215 GLN C CD  1 
ATOM 7578  O OE1 . GLN C 1 220 ? 39.567   203.622 -19.803 1.00 0.00 ? 215 GLN C OE1 1 
ATOM 7579  N NE2 . GLN C 1 220 ? 41.117   202.033 -19.971 1.00 0.00 ? 215 GLN C NE2 1 
ATOM 7580  N N   . TYR C 1 221 ? 37.577   197.767 -19.572 1.00 0.00 ? 216 TYR C N   1 
ATOM 7581  C CA  . TYR C 1 221 ? 38.073   196.467 -19.200 1.00 0.00 ? 216 TYR C CA  1 
ATOM 7582  C C   . TYR C 1 221 ? 38.446   195.530 -20.394 1.00 0.00 ? 216 TYR C C   1 
ATOM 7583  O O   . TYR C 1 221 ? 39.394   194.779 -20.241 1.00 0.00 ? 216 TYR C O   1 
ATOM 7584  C CB  . TYR C 1 221 ? 37.172   195.737 -18.171 1.00 0.00 ? 216 TYR C CB  1 
ATOM 7585  C CG  . TYR C 1 221 ? 36.948   196.598 -16.944 1.00 0.00 ? 216 TYR C CG  1 
ATOM 7586  C CD1 . TYR C 1 221 ? 38.022   196.912 -16.077 1.00 0.00 ? 216 TYR C CD1 1 
ATOM 7587  C CD2 . TYR C 1 221 ? 35.703   197.162 -16.695 1.00 0.00 ? 216 TYR C CD2 1 
ATOM 7588  C CE1 . TYR C 1 221 ? 37.951   198.004 -15.186 1.00 0.00 ? 216 TYR C CE1 1 
ATOM 7589  C CE2 . TYR C 1 221 ? 35.575   198.160 -15.740 1.00 0.00 ? 216 TYR C CE2 1 
ATOM 7590  C CZ  . TYR C 1 221 ? 36.712   198.587 -14.947 1.00 0.00 ? 216 TYR C CZ  1 
ATOM 7591  O OH  . TYR C 1 221 ? 36.488   199.625 -14.018 1.00 0.00 ? 216 TYR C OH  1 
ATOM 7592  N N   . ARG C 1 222 ? 37.735   195.645 -21.501 1.00 0.00 ? 217 ARG C N   1 
ATOM 7593  C CA  . ARG C 1 222 ? 37.896   194.839 -22.687 1.00 0.00 ? 217 ARG C CA  1 
ATOM 7594  C C   . ARG C 1 222 ? 39.299   195.181 -23.202 1.00 0.00 ? 217 ARG C C   1 
ATOM 7595  O O   . ARG C 1 222 ? 40.107   194.262 -23.449 1.00 0.00 ? 217 ARG C O   1 
ATOM 7596  C CB  . ARG C 1 222 ? 36.893   195.351 -23.715 1.00 0.00 ? 217 ARG C CB  1 
ATOM 7597  C CG  . ARG C 1 222 ? 36.949   194.722 -25.140 1.00 0.00 ? 217 ARG C CG  1 
ATOM 7598  C CD  . ARG C 1 222 ? 36.162   195.578 -26.178 1.00 0.00 ? 217 ARG C CD  1 
ATOM 7599  N NE  . ARG C 1 222 ? 36.447   195.183 -27.602 1.00 0.00 ? 217 ARG C NE  1 
ATOM 7600  C CZ  . ARG C 1 222 ? 35.965   195.857 -28.618 1.00 0.00 ? 217 ARG C CZ  1 
ATOM 7601  N NH1 . ARG C 1 222 ? 35.042   196.799 -28.569 1.00 0.00 ? 217 ARG C NH1 1 
ATOM 7602  N NH2 . ARG C 1 222 ? 36.488   195.538 -29.818 1.00 0.00 ? 217 ARG C NH2 1 
ATOM 7603  N N   . LYS C 1 223 ? 39.607   196.469 -23.401 1.00 0.00 ? 218 LYS C N   1 
ATOM 7604  C CA  . LYS C 1 223 ? 40.987   196.913 -23.715 1.00 0.00 ? 218 LYS C CA  1 
ATOM 7605  C C   . LYS C 1 223 ? 41.950   196.423 -22.649 1.00 0.00 ? 218 LYS C C   1 
ATOM 7606  O O   . LYS C 1 223 ? 42.945   195.870 -22.929 1.00 0.00 ? 218 LYS C O   1 
ATOM 7607  C CB  . LYS C 1 223 ? 40.913   198.507 -23.768 1.00 0.00 ? 218 LYS C CB  1 
ATOM 7608  C CG  . LYS C 1 223 ? 42.285   199.190 -24.025 1.00 0.00 ? 218 LYS C CG  1 
ATOM 7609  C CD  . LYS C 1 223 ? 42.924   199.723 -22.745 1.00 0.00 ? 218 LYS C CD  1 
ATOM 7610  C CE  . LYS C 1 223 ? 44.407   199.940 -23.098 1.00 0.00 ? 218 LYS C CE  1 
ATOM 7611  N NZ  . LYS C 1 223 ? 45.173   200.702 -21.973 1.00 0.00 ? 218 LYS C NZ  1 
ATOM 7612  N N   . GLU C 1 224 ? 41.816   196.717 -21.345 1.00 0.00 ? 219 GLU C N   1 
ATOM 7613  C CA  . GLU C 1 224 ? 42.889   196.449 -20.313 1.00 0.00 ? 219 GLU C CA  1 
ATOM 7614  C C   . GLU C 1 224 ? 43.095   194.960 -20.091 1.00 0.00 ? 219 GLU C C   1 
ATOM 7615  O O   . GLU C 1 224 ? 44.200   194.438 -19.862 1.00 0.00 ? 219 GLU C O   1 
ATOM 7616  C CB  . GLU C 1 224 ? 42.401   196.970 -18.929 1.00 0.00 ? 219 GLU C CB  1 
ATOM 7617  C CG  . GLU C 1 224 ? 42.387   198.518 -18.771 1.00 0.00 ? 219 GLU C CG  1 
ATOM 7618  C CD  . GLU C 1 224 ? 43.767   199.073 -18.769 1.00 0.00 ? 219 GLU C CD  1 
ATOM 7619  O OE1 . GLU C 1 224 ? 44.413   199.032 -17.714 1.00 0.00 ? 219 GLU C OE1 1 
ATOM 7620  O OE2 . GLU C 1 224 ? 44.207   199.681 -19.770 1.00 0.00 ? 219 GLU C OE2 1 
ATOM 7621  N N   . LEU C 1 225 ? 42.048   194.124 -20.172 1.00 0.00 ? 220 LEU C N   1 
ATOM 7622  C CA  . LEU C 1 225 ? 42.289   192.729 -20.236 1.00 0.00 ? 220 LEU C CA  1 
ATOM 7623  C C   . LEU C 1 225 ? 43.086   192.246 -21.463 1.00 0.00 ? 220 LEU C C   1 
ATOM 7624  O O   . LEU C 1 225 ? 43.874   191.306 -21.377 1.00 0.00 ? 220 LEU C O   1 
ATOM 7625  C CB  . LEU C 1 225 ? 40.872   192.024 -20.207 1.00 0.00 ? 220 LEU C CB  1 
ATOM 7626  C CG  . LEU C 1 225 ? 40.864   190.451 -19.899 1.00 0.00 ? 220 LEU C CG  1 
ATOM 7627  C CD1 . LEU C 1 225 ? 41.097   190.294 -18.498 1.00 0.00 ? 220 LEU C CD1 1 
ATOM 7628  C CD2 . LEU C 1 225 ? 39.527   189.735 -20.122 1.00 0.00 ? 220 LEU C CD2 1 
ATOM 7629  N N   . GLY C 1 226 ? 42.808   192.847 -22.708 1.00 0.00 ? 221 GLY C N   1 
ATOM 7630  C CA  . GLY C 1 226 ? 43.297   192.587 -24.066 1.00 0.00 ? 221 GLY C CA  1 
ATOM 7631  C C   . GLY C 1 226 ? 44.769   192.971 -24.166 1.00 0.00 ? 221 GLY C C   1 
ATOM 7632  O O   . GLY C 1 226 ? 45.575   192.252 -24.767 1.00 0.00 ? 221 GLY C O   1 
ATOM 7633  N N   . ALA C 1 227 ? 45.188   194.184 -23.691 1.00 0.00 ? 222 ALA C N   1 
ATOM 7634  C CA  . ALA C 1 227 ? 46.585   194.641 -23.753 1.00 0.00 ? 222 ALA C CA  1 
ATOM 7635  C C   . ALA C 1 227 ? 47.506   193.797 -22.961 1.00 0.00 ? 222 ALA C C   1 
ATOM 7636  O O   . ALA C 1 227 ? 48.656   193.489 -23.320 1.00 0.00 ? 222 ALA C O   1 
ATOM 7637  C CB  . ALA C 1 227 ? 46.767   196.107 -23.357 1.00 0.00 ? 222 ALA C CB  1 
ATOM 7638  N N   . GLN C 1 228 ? 46.940   193.302 -21.791 1.00 0.00 ? 223 GLN C N   1 
ATOM 7639  C CA  . GLN C 1 228 ? 47.539   192.375 -20.897 1.00 0.00 ? 223 GLN C CA  1 
ATOM 7640  C C   . GLN C 1 228 ? 47.629   190.965 -21.443 1.00 0.00 ? 223 GLN C C   1 
ATOM 7641  O O   . GLN C 1 228 ? 48.751   190.415 -21.313 1.00 0.00 ? 223 GLN C O   1 
ATOM 7642  C CB  . GLN C 1 228 ? 46.692   192.458 -19.556 1.00 0.00 ? 223 GLN C CB  1 
ATOM 7643  C CG  . GLN C 1 228 ? 47.156   191.546 -18.428 1.00 0.00 ? 223 GLN C CG  1 
ATOM 7644  C CD  . GLN C 1 228 ? 48.554   191.849 -17.828 1.00 0.00 ? 223 GLN C CD  1 
ATOM 7645  O OE1 . GLN C 1 228 ? 48.649   192.862 -17.107 1.00 0.00 ? 223 GLN C OE1 1 
ATOM 7646  N NE2 . GLN C 1 228 ? 49.604   191.151 -18.223 1.00 0.00 ? 223 GLN C NE2 1 
ATOM 7647  N N   . LEU C 1 229 ? 46.586   190.433 -22.090 1.00 0.00 ? 224 LEU C N   1 
ATOM 7648  C CA  . LEU C 1 229 ? 46.681   189.184 -22.742 1.00 0.00 ? 224 LEU C CA  1 
ATOM 7649  C C   . LEU C 1 229 ? 47.693   189.129 -23.846 1.00 0.00 ? 224 LEU C C   1 
ATOM 7650  O O   . LEU C 1 229 ? 48.431   188.115 -24.052 1.00 0.00 ? 224 LEU C O   1 
ATOM 7651  C CB  . LEU C 1 229 ? 45.221   188.845 -23.284 1.00 0.00 ? 224 LEU C CB  1 
ATOM 7652  C CG  . LEU C 1 229 ? 45.156   187.486 -23.992 1.00 0.00 ? 224 LEU C CG  1 
ATOM 7653  C CD1 . LEU C 1 229 ? 45.364   186.361 -22.958 1.00 0.00 ? 224 LEU C CD1 1 
ATOM 7654  C CD2 . LEU C 1 229 ? 43.821   187.380 -24.683 1.00 0.00 ? 224 LEU C CD2 1 
ATOM 7655  N N   . HIS C 1 230 ? 47.864   190.162 -24.697 1.00 0.00 ? 225 HIS C N   1 
ATOM 7656  C CA  . HIS C 1 230 ? 48.965   190.237 -25.681 1.00 0.00 ? 225 HIS C CA  1 
ATOM 7657  C C   . HIS C 1 230 ? 50.356   190.406 -25.241 1.00 0.00 ? 225 HIS C C   1 
ATOM 7658  O O   . HIS C 1 230 ? 51.314   189.820 -25.753 1.00 0.00 ? 225 HIS C O   1 
ATOM 7659  C CB  . HIS C 1 230 ? 48.773   191.496 -26.613 1.00 0.00 ? 225 HIS C CB  1 
ATOM 7660  C CG  . HIS C 1 230 ? 47.622   191.580 -27.567 1.00 0.00 ? 225 HIS C CG  1 
ATOM 7661  N ND1 . HIS C 1 230 ? 47.568   190.739 -28.657 1.00 0.00 ? 225 HIS C ND1 1 
ATOM 7662  C CD2 . HIS C 1 230 ? 46.587   192.445 -27.696 1.00 0.00 ? 225 HIS C CD2 1 
ATOM 7663  C CE1 . HIS C 1 230 ? 46.456   191.107 -29.330 1.00 0.00 ? 225 HIS C CE1 1 
ATOM 7664  N NE2 . HIS C 1 230 ? 45.872   192.115 -28.795 1.00 0.00 ? 225 HIS C NE2 1 
ATOM 7665  N N   . GLN C 1 231 ? 50.624   191.093 -24.097 1.00 0.00 ? 226 GLN C N   1 
ATOM 7666  C CA  . GLN C 1 231 ? 51.829   190.948 -23.374 1.00 0.00 ? 226 GLN C CA  1 
ATOM 7667  C C   . GLN C 1 231 ? 51.988   189.603 -22.749 1.00 0.00 ? 226 GLN C C   1 
ATOM 7668  O O   . GLN C 1 231 ? 52.980   188.996 -22.867 1.00 0.00 ? 226 GLN C O   1 
ATOM 7669  C CB  . GLN C 1 231 ? 51.697   192.071 -22.288 1.00 0.00 ? 226 GLN C CB  1 
ATOM 7670  C CG  . GLN C 1 231 ? 53.027   192.280 -21.578 1.00 0.00 ? 226 GLN C CG  1 
ATOM 7671  C CD  . GLN C 1 231 ? 53.024   193.457 -20.552 1.00 0.00 ? 226 GLN C CD  1 
ATOM 7672  O OE1 . GLN C 1 231 ? 52.902   194.642 -20.888 1.00 0.00 ? 226 GLN C OE1 1 
ATOM 7673  N NE2 . GLN C 1 231 ? 53.124   193.156 -19.246 1.00 0.00 ? 226 GLN C NE2 1 
ATOM 7674  N N   . LEU C 1 232 ? 50.974   189.051 -22.110 1.00 0.00 ? 227 LEU C N   1 
ATOM 7675  C CA  . LEU C 1 232 ? 51.125   187.645 -21.652 1.00 0.00 ? 227 LEU C CA  1 
ATOM 7676  C C   . LEU C 1 232 ? 51.510   186.568 -22.665 1.00 0.00 ? 227 LEU C C   1 
ATOM 7677  O O   . LEU C 1 232 ? 52.346   185.720 -22.378 1.00 0.00 ? 227 LEU C O   1 
ATOM 7678  C CB  . LEU C 1 232 ? 49.857   187.107 -20.922 1.00 0.00 ? 227 LEU C CB  1 
ATOM 7679  C CG  . LEU C 1 232 ? 49.603   187.808 -19.612 1.00 0.00 ? 227 LEU C CG  1 
ATOM 7680  C CD1 . LEU C 1 232 ? 48.265   187.219 -18.987 1.00 0.00 ? 227 LEU C CD1 1 
ATOM 7681  C CD2 . LEU C 1 232 ? 50.651   187.723 -18.473 1.00 0.00 ? 227 LEU C CD2 1 
ATOM 7682  N N   . VAL C 1 233 ? 50.830   186.588 -23.860 1.00 0.00 ? 228 VAL C N   1 
ATOM 7683  C CA  . VAL C 1 233 ? 51.197   185.681 -24.906 1.00 0.00 ? 228 VAL C CA  1 
ATOM 7684  C C   . VAL C 1 233 ? 52.687   185.889 -25.374 1.00 0.00 ? 228 VAL C C   1 
ATOM 7685  O O   . VAL C 1 233 ? 53.428   184.933 -25.479 1.00 0.00 ? 228 VAL C O   1 
ATOM 7686  C CB  . VAL C 1 233 ? 50.185   185.706 -26.081 1.00 0.00 ? 228 VAL C CB  1 
ATOM 7687  C CG1 . VAL C 1 233 ? 50.776   184.884 -27.247 1.00 0.00 ? 228 VAL C CG1 1 
ATOM 7688  C CG2 . VAL C 1 233 ? 48.921   185.029 -25.594 1.00 0.00 ? 228 VAL C CG2 1 
ATOM 7689  N N   . LEU C 1 234 ? 53.211   187.085 -25.713 1.00 0.00 ? 229 LEU C N   1 
ATOM 7690  C CA  . LEU C 1 234 ? 54.535   187.337 -26.002 1.00 0.00 ? 229 LEU C CA  1 
ATOM 7691  C C   . LEU C 1 234 ? 55.425   186.947 -24.879 1.00 0.00 ? 229 LEU C C   1 
ATOM 7692  O O   . LEU C 1 234 ? 56.532   186.338 -25.073 1.00 0.00 ? 229 LEU C O   1 
ATOM 7693  C CB  . LEU C 1 234 ? 54.724   188.876 -26.424 1.00 0.00 ? 229 LEU C CB  1 
ATOM 7694  C CG  . LEU C 1 234 ? 56.165   189.138 -27.005 1.00 0.00 ? 229 LEU C CG  1 
ATOM 7695  C CD1 . LEU C 1 234 ? 56.343   188.368 -28.402 1.00 0.00 ? 229 LEU C CD1 1 
ATOM 7696  C CD2 . LEU C 1 234 ? 56.439   190.615 -27.295 1.00 0.00 ? 229 LEU C CD2 1 
ATOM 7697  N N   . ASN C 1 235 ? 55.046   187.168 -23.613 1.00 0.00 ? 230 ASN C N   1 
ATOM 7698  C CA  . ASN C 1 235 ? 55.794   186.701 -22.419 1.00 0.00 ? 230 ASN C CA  1 
ATOM 7699  C C   . ASN C 1 235 ? 55.819   185.217 -22.322 1.00 0.00 ? 230 ASN C C   1 
ATOM 7700  O O   . ASN C 1 235 ? 56.882   184.720 -22.001 1.00 0.00 ? 230 ASN C O   1 
ATOM 7701  C CB  . ASN C 1 235 ? 55.355   187.265 -21.082 1.00 0.00 ? 230 ASN C CB  1 
ATOM 7702  C CG  . ASN C 1 235 ? 55.618   188.763 -21.013 1.00 0.00 ? 230 ASN C CG  1 
ATOM 7703  O OD1 . ASN C 1 235 ? 56.442   189.225 -21.791 1.00 0.00 ? 230 ASN C OD1 1 
ATOM 7704  N ND2 . ASN C 1 235 ? 55.099   189.465 -19.992 1.00 0.00 ? 230 ASN C ND2 1 
ATOM 7705  N N   . SER C 1 236 ? 54.759   184.442 -22.574 1.00 0.00 ? 231 SER C N   1 
ATOM 7706  C CA  . SER C 1 236 ? 54.697   182.987 -22.585 1.00 0.00 ? 231 SER C CA  1 
ATOM 7707  C C   . SER C 1 236 ? 55.496   182.324 -23.717 1.00 0.00 ? 231 SER C C   1 
ATOM 7708  O O   . SER C 1 236 ? 56.180   181.365 -23.538 1.00 0.00 ? 231 SER C O   1 
ATOM 7709  C CB  . SER C 1 236 ? 53.173   182.703 -22.915 1.00 0.00 ? 231 SER C CB  1 
ATOM 7710  O OG  . SER C 1 236 ? 52.861   181.301 -22.744 1.00 0.00 ? 231 SER C OG  1 
ATOM 7711  N N   . ALA C 1 237 ? 55.440   182.978 -24.929 1.00 0.00 ? 232 ALA C N   1 
ATOM 7712  C CA  . ALA C 1 237 ? 56.236   182.606 -26.067 1.00 0.00 ? 232 ALA C CA  1 
ATOM 7713  C C   . ALA C 1 237 ? 57.655   182.553 -25.705 1.00 0.00 ? 232 ALA C C   1 
ATOM 7714  O O   . ALA C 1 237 ? 58.347   181.525 -25.726 1.00 0.00 ? 232 ALA C O   1 
ATOM 7715  C CB  . ALA C 1 237 ? 55.992   183.546 -27.257 1.00 0.00 ? 232 ALA C CB  1 
ATOM 7716  N N   . ARG C 1 238 ? 58.197   183.691 -25.192 1.00 0.00 ? 233 ARG C N   1 
ATOM 7717  C CA  . ARG C 1 238 ? 59.551   183.813 -24.634 1.00 0.00 ? 233 ARG C CA  1 
ATOM 7718  C C   . ARG C 1 238 ? 59.961   182.881 -23.482 1.00 0.00 ? 233 ARG C C   1 
ATOM 7719  O O   . ARG C 1 238 ? 61.062   182.273 -23.556 1.00 0.00 ? 233 ARG C O   1 
ATOM 7720  C CB  . ARG C 1 238 ? 59.903   185.300 -24.163 1.00 0.00 ? 233 ARG C CB  1 
ATOM 7721  C CG  . ARG C 1 238 ? 59.750   186.462 -25.169 1.00 0.00 ? 233 ARG C CG  1 
ATOM 7722  C CD  . ARG C 1 238 ? 59.748   187.865 -24.590 1.00 0.00 ? 233 ARG C CD  1 
ATOM 7723  N NE  . ARG C 1 238 ? 59.641   188.847 -25.787 1.00 0.00 ? 233 ARG C NE  1 
ATOM 7724  C CZ  . ARG C 1 238 ? 59.520   190.195 -25.728 1.00 0.00 ? 233 ARG C CZ  1 
ATOM 7725  N NH1 . ARG C 1 238 ? 59.373   190.763 -24.598 1.00 0.00 ? 233 ARG C NH1 1 
ATOM 7726  N NH2 . ARG C 1 238 ? 59.456   190.880 -26.838 1.00 0.00 ? 233 ARG C NH2 1 
ATOM 7727  N N   . GLU C 1 239 ? 59.144   182.656 -22.444 1.00 0.00 ? 234 GLU C N   1 
ATOM 7728  C CA  . GLU C 1 239 ? 59.278   181.791 -21.348 1.00 0.00 ? 234 GLU C CA  1 
ATOM 7729  C C   . GLU C 1 239 ? 59.317   180.305 -21.819 1.00 0.00 ? 234 GLU C C   1 
ATOM 7730  O O   . GLU C 1 239 ? 60.211   179.558 -21.468 1.00 0.00 ? 234 GLU C O   1 
ATOM 7731  C CB  . GLU C 1 239 ? 58.055   182.030 -20.416 1.00 0.00 ? 234 GLU C CB  1 
ATOM 7732  C CG  . GLU C 1 239 ? 58.292   181.227 -19.201 1.00 0.00 ? 234 GLU C CG  1 
ATOM 7733  C CD  . GLU C 1 239 ? 57.154   181.334 -18.126 1.00 0.00 ? 234 GLU C CD  1 
ATOM 7734  O OE1 . GLU C 1 239 ? 56.033   180.694 -18.353 1.00 0.00 ? 234 GLU C OE1 1 
ATOM 7735  O OE2 . GLU C 1 239 ? 57.229   181.905 -17.013 1.00 0.00 ? 234 GLU C OE2 1 
ATOM 7736  N N   . LYS C 1 240 ? 58.472   179.942 -22.761 1.00 0.00 ? 235 LYS C N   1 
ATOM 7737  C CA  . LYS C 1 240 ? 58.444   178.627 -23.347 1.00 0.00 ? 235 LYS C CA  1 
ATOM 7738  C C   . LYS C 1 240 ? 59.572   178.432 -24.346 1.00 0.00 ? 235 LYS C C   1 
ATOM 7739  O O   . LYS C 1 240 ? 60.050   177.284 -24.425 1.00 0.00 ? 235 LYS C O   1 
ATOM 7740  C CB  . LYS C 1 240 ? 57.039   178.213 -23.816 1.00 0.00 ? 235 LYS C CB  1 
ATOM 7741  C CG  . LYS C 1 240 ? 56.095   177.498 -22.802 1.00 0.00 ? 235 LYS C CG  1 
ATOM 7742  C CD  . LYS C 1 240 ? 55.793   178.398 -21.598 1.00 0.00 ? 235 LYS C CD  1 
ATOM 7743  C CE  . LYS C 1 240 ? 54.840   177.728 -20.692 1.00 0.00 ? 235 LYS C CE  1 
ATOM 7744  N NZ  . LYS C 1 240 ? 54.694   178.569 -19.480 1.00 0.00 ? 235 LYS C NZ  1 
ATOM 7745  N N   . ARG C 1 241 ? 60.121   179.498 -25.065 1.00 0.00 ? 236 ARG C N   1 
ATOM 7746  C CA  . ARG C 1 241 ? 61.244   179.423 -25.864 1.00 0.00 ? 236 ARG C CA  1 
ATOM 7747  C C   . ARG C 1 241 ? 62.405   179.060 -24.948 1.00 0.00 ? 236 ARG C C   1 
ATOM 7748  O O   . ARG C 1 241 ? 63.247   178.256 -25.222 1.00 0.00 ? 236 ARG C O   1 
ATOM 7749  C CB  . ARG C 1 241 ? 61.454   180.753 -26.632 1.00 0.00 ? 236 ARG C CB  1 
ATOM 7750  C CG  . ARG C 1 241 ? 62.747   180.792 -27.506 1.00 0.00 ? 236 ARG C CG  1 
ATOM 7751  C CD  . ARG C 1 241 ? 62.881   179.710 -28.491 1.00 0.00 ? 236 ARG C CD  1 
ATOM 7752  N NE  . ARG C 1 241 ? 64.097   180.084 -29.303 1.00 0.00 ? 236 ARG C NE  1 
ATOM 7753  C CZ  . ARG C 1 241 ? 64.903   179.190 -29.862 1.00 0.00 ? 236 ARG C CZ  1 
ATOM 7754  N NH1 . ARG C 1 241 ? 64.570   177.881 -29.838 1.00 0.00 ? 236 ARG C NH1 1 
ATOM 7755  N NH2 . ARG C 1 241 ? 66.103   179.530 -30.140 1.00 0.00 ? 236 ARG C NH2 1 
ATOM 7756  N N   . ASP C 1 242 ? 62.475   179.800 -23.809 1.00 0.00 ? 237 ASP C N   1 
ATOM 7757  C CA  . ASP C 1 242 ? 63.531   179.711 -22.880 1.00 0.00 ? 237 ASP C CA  1 
ATOM 7758  C C   . ASP C 1 242 ? 63.592   178.350 -22.199 1.00 0.00 ? 237 ASP C C   1 
ATOM 7759  O O   . ASP C 1 242 ? 64.664   177.739 -22.241 1.00 0.00 ? 237 ASP C O   1 
ATOM 7760  C CB  . ASP C 1 242 ? 63.378   180.818 -21.838 1.00 0.00 ? 237 ASP C CB  1 
ATOM 7761  C CG  . ASP C 1 242 ? 64.583   181.039 -20.981 1.00 0.00 ? 237 ASP C CG  1 
ATOM 7762  O OD1 . ASP C 1 242 ? 64.742   180.308 -19.965 1.00 0.00 ? 237 ASP C OD1 1 
ATOM 7763  O OD2 . ASP C 1 242 ? 65.368   181.923 -21.297 1.00 0.00 ? 237 ASP C OD2 1 
ATOM 7764  N N   . MET C 1 243 ? 62.432   177.802 -21.736 1.00 0.00 ? 238 MET C N   1 
ATOM 7765  C CA  . MET C 1 243 ? 62.098   176.465 -21.294 1.00 0.00 ? 238 MET C CA  1 
ATOM 7766  C C   . MET C 1 243 ? 62.386   175.331 -22.396 1.00 0.00 ? 238 MET C C   1 
ATOM 7767  O O   . MET C 1 243 ? 62.960   174.308 -21.995 1.00 0.00 ? 238 MET C O   1 
ATOM 7768  C CB  . MET C 1 243 ? 60.603   176.307 -20.851 1.00 0.00 ? 238 MET C CB  1 
ATOM 7769  C CG  . MET C 1 243 ? 60.362   175.301 -19.754 1.00 0.00 ? 238 MET C CG  1 
ATOM 7770  S SD  . MET C 1 243 ? 60.334   175.898 -18.003 1.00 0.00 ? 238 MET C SD  1 
ATOM 7771  C CE  . MET C 1 243 ? 59.735   174.434 -17.070 1.00 0.00 ? 238 MET C CE  1 
ATOM 7772  N N   . GLU C 1 244 ? 62.058   175.519 -23.738 1.00 0.00 ? 239 GLU C N   1 
ATOM 7773  C CA  . GLU C 1 244 ? 62.402   174.507 -24.824 1.00 0.00 ? 239 GLU C CA  1 
ATOM 7774  C C   . GLU C 1 244 ? 63.906   174.421 -24.982 1.00 0.00 ? 239 GLU C C   1 
ATOM 7775  O O   . GLU C 1 244 ? 64.502   173.376 -25.112 1.00 0.00 ? 239 GLU C O   1 
ATOM 7776  C CB  . GLU C 1 244 ? 61.763   174.880 -26.148 1.00 0.00 ? 239 GLU C CB  1 
ATOM 7777  C CG  . GLU C 1 244 ? 61.737   173.626 -27.224 1.00 0.00 ? 239 GLU C CG  1 
ATOM 7778  C CD  . GLU C 1 244 ? 60.890   174.049 -28.373 1.00 0.00 ? 239 GLU C CD  1 
ATOM 7779  O OE1 . GLU C 1 244 ? 60.401   175.236 -28.435 1.00 0.00 ? 239 GLU C OE1 1 
ATOM 7780  O OE2 . GLU C 1 244 ? 60.870   173.222 -29.276 1.00 0.00 ? 239 GLU C OE2 1 
ATOM 7781  N N   . GLN C 1 245 ? 64.566   175.612 -24.987 1.00 0.00 ? 240 GLN C N   1 
ATOM 7782  C CA  . GLN C 1 245 ? 66.021   175.517 -25.135 1.00 0.00 ? 240 GLN C CA  1 
ATOM 7783  C C   . GLN C 1 245 ? 66.779   174.859 -23.973 1.00 0.00 ? 240 GLN C C   1 
ATOM 7784  O O   . GLN C 1 245 ? 67.692   174.063 -24.151 1.00 0.00 ? 240 GLN C O   1 
ATOM 7785  C CB  . GLN C 1 245 ? 66.578   176.913 -25.465 1.00 0.00 ? 240 GLN C CB  1 
ATOM 7786  C CG  . GLN C 1 245 ? 66.433   177.195 -26.962 1.00 0.00 ? 240 GLN C CG  1 
ATOM 7787  C CD  . GLN C 1 245 ? 67.028   178.571 -27.141 1.00 0.00 ? 240 GLN C CD  1 
ATOM 7788  O OE1 . GLN C 1 245 ? 66.406   179.578 -26.863 1.00 0.00 ? 240 GLN C OE1 1 
ATOM 7789  N NE2 . GLN C 1 245 ? 68.239   178.587 -27.745 1.00 0.00 ? 240 GLN C NE2 1 
ATOM 7790  N N   . ARG C 1 246 ? 66.340   175.165 -22.747 1.00 0.00 ? 241 ARG C N   1 
ATOM 7791  C CA  . ARG C 1 246 ? 66.861   174.470 -21.466 1.00 0.00 ? 241 ARG C CA  1 
ATOM 7792  C C   . ARG C 1 246 ? 66.553   173.018 -21.267 1.00 0.00 ? 241 ARG C C   1 
ATOM 7793  O O   . ARG C 1 246 ? 67.262   172.170 -20.833 1.00 0.00 ? 241 ARG C O   1 
ATOM 7794  C CB  . ARG C 1 246 ? 66.446   175.290 -20.195 1.00 0.00 ? 241 ARG C CB  1 
ATOM 7795  C CG  . ARG C 1 246 ? 67.148   174.877 -18.857 1.00 0.00 ? 241 ARG C CG  1 
ATOM 7796  C CD  . ARG C 1 246 ? 67.055   175.934 -17.737 1.00 0.00 ? 241 ARG C CD  1 
ATOM 7797  N NE  . ARG C 1 246 ? 65.608   176.286 -17.524 1.00 0.00 ? 241 ARG C NE  1 
ATOM 7798  C CZ  . ARG C 1 246 ? 64.762   175.719 -16.668 1.00 0.00 ? 241 ARG C CZ  1 
ATOM 7799  N NH1 . ARG C 1 246 ? 64.938   174.548 -16.086 1.00 0.00 ? 241 ARG C NH1 1 
ATOM 7800  N NH2 . ARG C 1 246 ? 63.599   176.287 -16.474 1.00 0.00 ? 241 ARG C NH2 1 
ATOM 7801  N N   . HIS C 1 247 ? 65.343   172.603 -21.785 1.00 0.00 ? 242 HIS C N   1 
ATOM 7802  C CA  . HIS C 1 247 ? 64.786   171.232 -21.999 1.00 0.00 ? 242 HIS C CA  1 
ATOM 7803  C C   . HIS C 1 247 ? 65.706   170.439 -22.925 1.00 0.00 ? 242 HIS C C   1 
ATOM 7804  O O   . HIS C 1 247 ? 66.118   169.331 -22.618 1.00 0.00 ? 242 HIS C O   1 
ATOM 7805  C CB  . HIS C 1 247 ? 63.355   171.268 -22.582 1.00 0.00 ? 242 HIS C CB  1 
ATOM 7806  C CG  . HIS C 1 247 ? 62.733   170.010 -22.982 1.00 0.00 ? 242 HIS C CG  1 
ATOM 7807  N ND1 . HIS C 1 247 ? 61.788   169.374 -22.241 1.00 0.00 ? 242 HIS C ND1 1 
ATOM 7808  C CD2 . HIS C 1 247 ? 62.903   169.286 -24.147 1.00 0.00 ? 242 HIS C CD2 1 
ATOM 7809  C CE1 . HIS C 1 247 ? 61.311   168.361 -23.009 1.00 0.00 ? 242 HIS C CE1 1 
ATOM 7810  N NE2 . HIS C 1 247 ? 61.983   168.265 -24.133 1.00 0.00 ? 242 HIS C NE2 1 
ATOM 7811  N N   . VAL C 1 248 ? 66.134   171.049 -24.046 1.00 0.00 ? 243 VAL C N   1 
ATOM 7812  C CA  . VAL C 1 248 ? 67.061   170.636 -25.076 1.00 0.00 ? 243 VAL C CA  1 
ATOM 7813  C C   . VAL C 1 248 ? 68.380   170.341 -24.387 1.00 0.00 ? 243 VAL C C   1 
ATOM 7814  O O   . VAL C 1 248 ? 69.017   169.314 -24.617 1.00 0.00 ? 243 VAL C O   1 
ATOM 7815  C CB  . VAL C 1 248 ? 67.174   171.531 -26.326 1.00 0.00 ? 243 VAL C CB  1 
ATOM 7816  C CG1 . VAL C 1 248 ? 68.366   171.107 -27.236 1.00 0.00 ? 243 VAL C CG1 1 
ATOM 7817  C CG2 . VAL C 1 248 ? 65.841   171.569 -27.096 1.00 0.00 ? 243 VAL C CG2 1 
ATOM 7818  N N   . LEU C 1 249 ? 68.842   171.299 -23.548 1.00 0.00 ? 244 LEU C N   1 
ATOM 7819  C CA  . LEU C 1 249 ? 70.199   171.335 -23.008 1.00 0.00 ? 244 LEU C CA  1 
ATOM 7820  C C   . LEU C 1 249 ? 70.491   170.084 -22.132 1.00 0.00 ? 244 LEU C C   1 
ATOM 7821  O O   . LEU C 1 249 ? 71.540   169.447 -22.160 1.00 0.00 ? 244 LEU C O   1 
ATOM 7822  C CB  . LEU C 1 249 ? 70.346   172.711 -22.183 1.00 0.00 ? 244 LEU C CB  1 
ATOM 7823  C CG  . LEU C 1 249 ? 71.765   173.086 -21.648 1.00 0.00 ? 244 LEU C CG  1 
ATOM 7824  C CD1 . LEU C 1 249 ? 72.667   173.335 -22.803 1.00 0.00 ? 244 LEU C CD1 1 
ATOM 7825  C CD2 . LEU C 1 249 ? 71.489   174.266 -20.629 1.00 0.00 ? 244 LEU C CD2 1 
ATOM 7826  N N   . LEU C 1 250 ? 69.476   169.702 -21.262 1.00 0.00 ? 245 LEU C N   1 
ATOM 7827  C CA  . LEU C 1 250 ? 69.542   168.624 -20.235 1.00 0.00 ? 245 LEU C CA  1 
ATOM 7828  C C   . LEU C 1 250 ? 69.731   167.234 -20.901 1.00 0.00 ? 245 LEU C C   1 
ATOM 7829  O O   . LEU C 1 250 ? 70.462   166.345 -20.399 1.00 0.00 ? 245 LEU C O   1 
ATOM 7830  C CB  . LEU C 1 250 ? 68.351   168.589 -19.331 1.00 0.00 ? 245 LEU C CB  1 
ATOM 7831  C CG  . LEU C 1 250 ? 68.018   169.903 -18.564 1.00 0.00 ? 245 LEU C CG  1 
ATOM 7832  C CD1 . LEU C 1 250 ? 66.575   170.012 -17.972 1.00 0.00 ? 245 LEU C CD1 1 
ATOM 7833  C CD2 . LEU C 1 250 ? 69.091   170.075 -17.448 1.00 0.00 ? 245 LEU C CD2 1 
ATOM 7834  N N   . LYS C 1 251 ? 69.007   167.082 -22.024 1.00 0.00 ? 246 LYS C N   1 
ATOM 7835  C CA  . LYS C 1 251 ? 69.055   165.897 -22.836 1.00 0.00 ? 246 LYS C CA  1 
ATOM 7836  C C   . LYS C 1 251 ? 70.429   165.786 -23.656 1.00 0.00 ? 246 LYS C C   1 
ATOM 7837  O O   . LYS C 1 251 ? 70.819   164.662 -24.029 1.00 0.00 ? 246 LYS C O   1 
ATOM 7838  C CB  . LYS C 1 251 ? 67.847   165.946 -23.776 1.00 0.00 ? 246 LYS C CB  1 
ATOM 7839  C CG  . LYS C 1 251 ? 66.433   165.676 -23.106 1.00 0.00 ? 246 LYS C CG  1 
ATOM 7840  C CD  . LYS C 1 251 ? 65.260   165.721 -24.174 1.00 0.00 ? 246 LYS C CD  1 
ATOM 7841  C CE  . LYS C 1 251 ? 63.880   165.408 -23.685 1.00 0.00 ? 246 LYS C CE  1 
ATOM 7842  N NZ  . LYS C 1 251 ? 62.894   165.534 -24.691 1.00 0.00 ? 246 LYS C NZ  1 
ATOM 7843  N N   . GLN C 1 252 ? 71.085   166.964 -23.926 1.00 0.00 ? 247 GLN C N   1 
ATOM 7844  C CA  . GLN C 1 252 ? 72.316   167.046 -24.658 1.00 0.00 ? 247 GLN C CA  1 
ATOM 7845  C C   . GLN C 1 252 ? 73.500   166.416 -23.984 1.00 0.00 ? 247 GLN C C   1 
ATOM 7846  O O   . GLN C 1 252 ? 74.273   165.622 -24.584 1.00 0.00 ? 247 GLN C O   1 
ATOM 7847  C CB  . GLN C 1 252 ? 72.631   168.542 -24.915 1.00 0.00 ? 247 GLN C CB  1 
ATOM 7848  C CG  . GLN C 1 252 ? 73.627   168.693 -26.017 1.00 0.00 ? 247 GLN C CG  1 
ATOM 7849  C CD  . GLN C 1 252 ? 73.557   170.129 -26.562 1.00 0.00 ? 247 GLN C CD  1 
ATOM 7850  O OE1 . GLN C 1 252 ? 74.315   170.991 -26.141 1.00 0.00 ? 247 GLN C OE1 1 
ATOM 7851  N NE2 . GLN C 1 252 ? 72.540   170.387 -27.390 1.00 0.00 ? 247 GLN C NE2 1 
ATOM 7852  N N   . LYS C 1 253 ? 73.643   166.743 -22.620 1.00 0.00 ? 248 LYS C N   1 
ATOM 7853  C CA  . LYS C 1 253 ? 74.968   166.335 -22.137 1.00 0.00 ? 248 LYS C CA  1 
ATOM 7854  C C   . LYS C 1 253 ? 75.048   166.163 -20.581 1.00 0.00 ? 248 LYS C C   1 
ATOM 7855  O O   . LYS C 1 253 ? 76.149   165.985 -20.111 1.00 0.00 ? 248 LYS C O   1 
ATOM 7856  C CB  . LYS C 1 253 ? 76.015   167.433 -22.454 1.00 0.00 ? 248 LYS C CB  1 
ATOM 7857  C CG  . LYS C 1 253 ? 75.636   168.752 -21.924 1.00 0.00 ? 248 LYS C CG  1 
ATOM 7858  C CD  . LYS C 1 253 ? 76.727   169.829 -22.215 1.00 0.00 ? 248 LYS C CD  1 
ATOM 7859  C CE  . LYS C 1 253 ? 76.432   171.257 -21.854 1.00 0.00 ? 248 LYS C CE  1 
ATOM 7860  N NZ  . LYS C 1 253 ? 76.296   171.545 -20.483 1.00 0.00 ? 248 LYS C NZ  1 
ATOM 7861  N N   . GLU C 1 254 ? 73.950   166.174 -19.815 1.00 0.00 ? 249 GLU C N   1 
ATOM 7862  C CA  . GLU C 1 254 ? 74.091   166.342 -18.351 1.00 0.00 ? 249 GLU C CA  1 
ATOM 7863  C C   . GLU C 1 254 ? 72.972   165.708 -17.608 1.00 0.00 ? 249 GLU C C   1 
ATOM 7864  O O   . GLU C 1 254 ? 72.869   165.937 -16.382 1.00 0.00 ? 249 GLU C O   1 
ATOM 7865  C CB  . GLU C 1 254 ? 74.210   167.849 -18.111 1.00 0.00 ? 249 GLU C CB  1 
ATOM 7866  C CG  . GLU C 1 254 ? 72.999   168.609 -18.685 1.00 0.00 ? 249 GLU C CG  1 
ATOM 7867  C CD  . GLU C 1 254 ? 73.304   170.062 -18.698 1.00 0.00 ? 249 GLU C CD  1 
ATOM 7868  O OE1 . GLU C 1 254 ? 74.120   170.558 -19.511 1.00 0.00 ? 249 GLU C OE1 1 
ATOM 7869  O OE2 . GLU C 1 254 ? 72.729   170.776 -17.821 1.00 0.00 ? 249 GLU C OE2 1 
ATOM 7870  N N   . LEU C 1 255 ? 72.151   164.867 -18.262 1.00 0.00 ? 250 LEU C N   1 
ATOM 7871  C CA  . LEU C 1 255 ? 70.885   164.272 -17.711 1.00 0.00 ? 250 LEU C CA  1 
ATOM 7872  C C   . LEU C 1 255 ? 71.116   163.239 -16.596 1.00 0.00 ? 250 LEU C C   1 
ATOM 7873  O O   . LEU C 1 255 ? 70.439   163.137 -15.583 1.00 0.00 ? 250 LEU C O   1 
ATOM 7874  C CB  . LEU C 1 255 ? 70.244   163.493 -18.892 1.00 0.00 ? 250 LEU C CB  1 
ATOM 7875  C CG  . LEU C 1 255 ? 68.779   163.142 -18.714 1.00 0.00 ? 250 LEU C CG  1 
ATOM 7876  C CD1 . LEU C 1 255 ? 67.899   164.419 -18.750 1.00 0.00 ? 250 LEU C CD1 1 
ATOM 7877  C CD2 . LEU C 1 255 ? 68.269   162.060 -19.666 1.00 0.00 ? 250 LEU C CD2 1 
ATOM 7878  N N   . GLY C 1 256 ? 72.154   162.395 -16.767 1.00 0.00 ? 251 GLY C N   1 
ATOM 7879  C CA  . GLY C 1 256 ? 72.642   161.309 -15.964 1.00 0.00 ? 251 GLY C CA  1 
ATOM 7880  C C   . GLY C 1 256 ? 71.808   160.072 -15.950 1.00 0.00 ? 251 GLY C C   1 
ATOM 7881  O O   . GLY C 1 256 ? 70.584   160.044 -16.216 1.00 0.00 ? 251 GLY C O   1 
ATOM 7882  N N   . GLY C 1 257 ? 72.560   158.953 -15.748 1.00 0.00 ? 252 GLY C N   1 
ATOM 7883  C CA  . GLY C 1 257 ? 72.103   157.553 -15.879 1.00 0.00 ? 252 GLY C CA  1 
ATOM 7884  C C   . GLY C 1 257 ? 72.049   156.884 -14.451 1.00 0.00 ? 252 GLY C C   1 
ATOM 7885  O O   . GLY C 1 257 ? 71.176   156.026 -14.289 1.00 0.00 ? 252 GLY C O   1 
ATOM 7886  N N   . GLU C 1 258 ? 72.899   157.357 -13.503 1.00 0.00 ? 253 GLU C N   1 
ATOM 7887  C CA  . GLU C 1 258 ? 72.847   156.890 -12.137 1.00 0.00 ? 253 GLU C CA  1 
ATOM 7888  C C   . GLU C 1 258 ? 71.584   157.266 -11.385 1.00 0.00 ? 253 GLU C C   1 
ATOM 7889  O O   . GLU C 1 258 ? 71.020   158.365 -11.573 1.00 0.00 ? 253 GLU C O   1 
ATOM 7890  C CB  . GLU C 1 258 ? 74.141   157.328 -11.454 1.00 0.00 ? 253 GLU C CB  1 
ATOM 7891  C CG  . GLU C 1 258 ? 74.455   156.743 -10.071 1.00 0.00 ? 253 GLU C CG  1 
ATOM 7892  C CD  . GLU C 1 258 ? 74.575   155.198 -10.068 1.00 0.00 ? 253 GLU C CD  1 
ATOM 7893  O OE1 . GLU C 1 258 ? 75.450   154.584 -10.749 1.00 0.00 ? 253 GLU C OE1 1 
ATOM 7894  O OE2 . GLU C 1 258 ? 73.709   154.547 -9.395  1.00 0.00 ? 253 GLU C OE2 1 
ATOM 7895  N N   . GLU C 1 259 ? 71.133   156.377 -10.468 1.00 0.00 ? 254 GLU C N   1 
ATOM 7896  C CA  . GLU C 1 259 ? 70.051   156.631 -9.573  1.00 0.00 ? 254 GLU C CA  1 
ATOM 7897  C C   . GLU C 1 259 ? 70.222   157.836 -8.777  1.00 0.00 ? 254 GLU C C   1 
ATOM 7898  O O   . GLU C 1 259 ? 71.344   158.141 -8.261  1.00 0.00 ? 254 GLU C O   1 
ATOM 7899  C CB  . GLU C 1 259 ? 69.727   155.471 -8.660  1.00 0.00 ? 254 GLU C CB  1 
ATOM 7900  C CG  . GLU C 1 259 ? 69.504   154.062 -9.324  1.00 0.00 ? 254 GLU C CG  1 
ATOM 7901  C CD  . GLU C 1 259 ? 68.231   153.983 -9.999  1.00 0.00 ? 254 GLU C CD  1 
ATOM 7902  O OE1 . GLU C 1 259 ? 67.205   153.764 -9.336  1.00 0.00 ? 254 GLU C OE1 1 
ATOM 7903  O OE2 . GLU C 1 259 ? 68.211   154.209 -11.255 1.00 0.00 ? 254 GLU C OE2 1 
ATOM 7904  N N   . PRO C 1 260 ? 69.177   158.657 -8.605  1.00 0.00 ? 255 PRO C N   1 
ATOM 7905  C CA  . PRO C 1 260 ? 69.215   159.864 -7.760  1.00 0.00 ? 255 PRO C CA  1 
ATOM 7906  C C   . PRO C 1 260 ? 69.251   159.466 -6.321  1.00 0.00 ? 255 PRO C C   1 
ATOM 7907  O O   . PRO C 1 260 ? 68.829   158.372 -5.977  1.00 0.00 ? 255 PRO C O   1 
ATOM 7908  C CB  . PRO C 1 260 ? 67.900   160.620 -8.111  1.00 0.00 ? 255 PRO C CB  1 
ATOM 7909  C CG  . PRO C 1 260 ? 66.915   159.631 -8.617  1.00 0.00 ? 255 PRO C CG  1 
ATOM 7910  C CD  . PRO C 1 260 ? 67.785   158.467 -9.155  1.00 0.00 ? 255 PRO C CD  1 
ATOM 7911  N N   . GLU C 1 261 ? 69.769   160.340 -5.460  1.00 0.00 ? 256 GLU C N   1 
ATOM 7912  C CA  . GLU C 1 261 ? 70.065   160.108 -4.048  1.00 0.00 ? 256 GLU C CA  1 
ATOM 7913  C C   . GLU C 1 261 ? 68.984   160.645 -3.112  1.00 0.00 ? 256 GLU C C   1 
ATOM 7914  O O   . GLU C 1 261 ? 68.623   161.820 -3.274  1.00 0.00 ? 256 GLU C O   1 
ATOM 7915  C CB  . GLU C 1 261 ? 71.407   160.931 -3.893  1.00 0.00 ? 256 GLU C CB  1 
ATOM 7916  C CG  . GLU C 1 261 ? 71.953   160.535 -2.496  1.00 0.00 ? 256 GLU C CG  1 
ATOM 7917  C CD  . GLU C 1 261 ? 73.282   161.011 -2.155  1.00 0.00 ? 256 GLU C CD  1 
ATOM 7918  O OE1 . GLU C 1 261 ? 74.255   160.514 -2.715  1.00 0.00 ? 256 GLU C OE1 1 
ATOM 7919  O OE2 . GLU C 1 261 ? 73.503   161.924 -1.319  1.00 0.00 ? 256 GLU C OE2 1 
ATOM 7920  N N   . PRO C 1 262 ? 68.416   159.774 -2.096  1.00 0.00 ? 257 PRO C N   1 
ATOM 7921  C CA  . PRO C 1 262 ? 67.600   160.219 -1.068  1.00 0.00 ? 257 PRO C CA  1 
ATOM 7922  C C   . PRO C 1 262 ? 68.277   161.198 -0.160  1.00 0.00 ? 257 PRO C C   1 
ATOM 7923  O O   . PRO C 1 262 ? 69.442   160.930 0.261   1.00 0.00 ? 257 PRO C O   1 
ATOM 7924  C CB  . PRO C 1 262 ? 67.252   158.979 -0.275  1.00 0.00 ? 257 PRO C CB  1 
ATOM 7925  C CG  . PRO C 1 262 ? 67.521   157.766 -1.244  1.00 0.00 ? 257 PRO C CG  1 
ATOM 7926  C CD  . PRO C 1 262 ? 68.518   158.355 -2.216  1.00 0.00 ? 257 PRO C CD  1 
ATOM 7927  N N   . SER C 1 263 ? 67.525   162.320 0.026   1.00 0.00 ? 258 SER C N   1 
ATOM 7928  C CA  . SER C 1 263 ? 67.964   163.546 0.735   1.00 0.00 ? 258 SER C CA  1 
ATOM 7929  C C   . SER C 1 263 ? 67.536   163.722 2.168   1.00 0.00 ? 258 SER C C   1 
ATOM 7930  O O   . SER C 1 263 ? 66.350   163.796 2.448   1.00 0.00 ? 258 SER C O   1 
ATOM 7931  C CB  . SER C 1 263 ? 67.422   164.699 -0.071  1.00 0.00 ? 258 SER C CB  1 
ATOM 7932  O OG  . SER C 1 263 ? 67.604   166.032 0.415   1.00 0.00 ? 258 SER C OG  1 
ATOM 7933  N N   . LEU C 1 264 ? 68.492   163.563 3.098   1.00 0.00 ? 259 LEU C N   1 
ATOM 7934  C CA  . LEU C 1 264 ? 68.151   163.620 4.495   1.00 0.00 ? 259 LEU C CA  1 
ATOM 7935  C C   . LEU C 1 264 ? 67.979   165.023 4.953   1.00 0.00 ? 259 LEU C C   1 
ATOM 7936  O O   . LEU C 1 264 ? 68.650   165.928 4.515   1.00 0.00 ? 259 LEU C O   1 
ATOM 7937  C CB  . LEU C 1 264 ? 69.117   162.764 5.384   1.00 0.00 ? 259 LEU C CB  1 
ATOM 7938  C CG  . LEU C 1 264 ? 70.581   163.147 5.303   1.00 0.00 ? 259 LEU C CG  1 
ATOM 7939  C CD1 . LEU C 1 264 ? 70.895   164.086 6.556   1.00 0.00 ? 259 LEU C CD1 1 
ATOM 7940  C CD2 . LEU C 1 264 ? 71.495   161.929 5.157   1.00 0.00 ? 259 LEU C CD2 1 
ATOM 7941  N N   . ARG C 1 265 ? 67.003   165.257 5.897   1.00 0.00 ? 260 ARG C N   1 
ATOM 7942  C CA  . ARG C 1 265 ? 66.841   166.545 6.503   1.00 0.00 ? 260 ARG C CA  1 
ATOM 7943  C C   . ARG C 1 265 ? 66.401   166.484 7.928   1.00 0.00 ? 260 ARG C C   1 
ATOM 7944  O O   . ARG C 1 265 ? 66.055   165.420 8.424   1.00 0.00 ? 260 ARG C O   1 
ATOM 7945  C CB  . ARG C 1 265 ? 66.063   167.540 5.648   1.00 0.00 ? 260 ARG C CB  1 
ATOM 7946  C CG  . ARG C 1 265 ? 64.556   167.118 5.189   1.00 0.00 ? 260 ARG C CG  1 
ATOM 7947  C CD  . ARG C 1 265 ? 64.506   166.057 4.119   1.00 0.00 ? 260 ARG C CD  1 
ATOM 7948  N NE  . ARG C 1 265 ? 63.094   165.759 3.906   1.00 0.00 ? 260 ARG C NE  1 
ATOM 7949  C CZ  . ARG C 1 265 ? 62.662   164.675 3.333   1.00 0.00 ? 260 ARG C CZ  1 
ATOM 7950  N NH1 . ARG C 1 265 ? 63.500   163.770 2.735   1.00 0.00 ? 260 ARG C NH1 1 
ATOM 7951  N NH2 . ARG C 1 265 ? 61.395   164.454 3.173   1.00 0.00 ? 260 ARG C NH2 1 
ATOM 7952  N N   . GLU C 1 266 ? 66.367   167.672 8.578   1.00 0.00 ? 261 GLU C N   1 
ATOM 7953  C CA  . GLU C 1 266 ? 65.971   167.772 9.959   1.00 0.00 ? 261 GLU C CA  1 
ATOM 7954  C C   . GLU C 1 266 ? 66.835   166.958 10.989  1.00 0.00 ? 261 GLU C C   1 
ATOM 7955  O O   . GLU C 1 266 ? 66.372   166.468 11.972  1.00 0.00 ? 261 GLU C O   1 
ATOM 7956  C CB  . GLU C 1 266 ? 64.447   167.477 10.221  1.00 0.00 ? 261 GLU C CB  1 
ATOM 7957  C CG  . GLU C 1 266 ? 63.494   168.445 9.570   1.00 0.00 ? 261 GLU C CG  1 
ATOM 7958  C CD  . GLU C 1 266 ? 62.071   168.221 10.094  1.00 0.00 ? 261 GLU C CD  1 
ATOM 7959  O OE1 . GLU C 1 266 ? 61.796   168.485 11.275  1.00 0.00 ? 261 GLU C OE1 1 
ATOM 7960  O OE2 . GLU C 1 266 ? 61.254   167.736 9.286   1.00 0.00 ? 261 GLU C OE2 1 
ATOM 7961  N N   . GLY C 1 267 ? 68.189   166.883 10.712  1.00 0.00 ? 262 GLY C N   1 
ATOM 7962  C CA  . GLY C 1 267 ? 69.329   166.233 11.463  1.00 0.00 ? 262 GLY C CA  1 
ATOM 7963  C C   . GLY C 1 267 ? 68.979   164.824 11.824  1.00 0.00 ? 262 GLY C C   1 
ATOM 7964  O O   . GLY C 1 267 ? 68.114   164.228 11.248  1.00 0.00 ? 262 GLY C O   1 
ATOM 7965  N N   . PRO C 1 268 ? 69.730   164.242 12.674  1.00 0.00 ? 263 PRO C N   1 
ATOM 7966  C CA  . PRO C 1 268 ? 69.687   162.747 12.914  1.00 0.00 ? 263 PRO C CA  1 
ATOM 7967  C C   . PRO C 1 268 ? 68.513   162.388 13.824  1.00 0.00 ? 263 PRO C C   1 
ATOM 7968  O O   . PRO C 1 268 ? 68.160   161.196 13.783  1.00 0.00 ? 263 PRO C O   1 
ATOM 7969  C CB  . PRO C 1 268 ? 71.060   162.397 13.498  1.00 0.00 ? 263 PRO C CB  1 
ATOM 7970  C CG  . PRO C 1 268 ? 71.438   163.654 14.306  1.00 0.00 ? 263 PRO C CG  1 
ATOM 7971  C CD  . PRO C 1 268 ? 70.950   164.761 13.306  1.00 0.00 ? 263 PRO C CD  1 
ATOM 7972  N N   . GLY C 1 269 ? 67.774   163.331 14.371  1.00 0.00 ? 264 GLY C N   1 
ATOM 7973  C CA  . GLY C 1 269 ? 66.809   162.983 15.380  1.00 0.00 ? 264 GLY C CA  1 
ATOM 7974  C C   . GLY C 1 269 ? 65.409   163.136 14.816  1.00 0.00 ? 264 GLY C C   1 
ATOM 7975  O O   . GLY C 1 269 ? 64.390   162.640 15.277  1.00 0.00 ? 264 GLY C O   1 
ATOM 7976  N N   . GLY C 1 270 ? 65.313   163.920 13.740  1.00 0.00 ? 265 GLY C N   1 
ATOM 7977  C CA  . GLY C 1 270 ? 64.144   163.773 12.847  1.00 0.00 ? 265 GLY C CA  1 
ATOM 7978  C C   . GLY C 1 270 ? 64.484   162.878 11.705  1.00 0.00 ? 265 GLY C C   1 
ATOM 7979  O O   . GLY C 1 270 ? 63.712   162.021 11.378  1.00 0.00 ? 265 GLY C O   1 
ATOM 7980  N N   . LEU C 1 271 ? 65.679   163.074 11.213  1.00 0.00 ? 266 LEU C N   1 
ATOM 7981  C CA  . LEU C 1 271 ? 66.249   162.275 10.082  1.00 0.00 ? 266 LEU C CA  1 
ATOM 7982  C C   . LEU C 1 271 ? 65.319   161.892 8.933   1.00 0.00 ? 266 LEU C C   1 
ATOM 7983  O O   . LEU C 1 271 ? 65.055   160.751 8.693   1.00 0.00 ? 266 LEU C O   1 
ATOM 7984  C CB  . LEU C 1 271 ? 67.154   161.114 10.591  1.00 0.00 ? 266 LEU C CB  1 
ATOM 7985  C CG  . LEU C 1 271 ? 68.255   160.636 9.616   1.00 0.00 ? 266 LEU C CG  1 
ATOM 7986  C CD1 . LEU C 1 271 ? 69.288   161.559 9.107   1.00 0.00 ? 266 LEU C CD1 1 
ATOM 7987  C CD2 . LEU C 1 271 ? 68.919   159.277 9.999   1.00 0.00 ? 266 LEU C CD2 1 
ATOM 7988  N N   . VAL C 1 272 ? 64.795   162.903 8.148   1.00 0.00 ? 267 VAL C N   1 
ATOM 7989  C CA  . VAL C 1 272 ? 63.683   162.646 7.267   1.00 0.00 ? 267 VAL C CA  1 
ATOM 7990  C C   . VAL C 1 272 ? 64.260   162.203 5.955   1.00 0.00 ? 267 VAL C C   1 
ATOM 7991  O O   . VAL C 1 272 ? 64.993   162.941 5.305   1.00 0.00 ? 267 VAL C O   1 
ATOM 7992  C CB  . VAL C 1 272 ? 62.638   163.763 7.208   1.00 0.00 ? 267 VAL C CB  1 
ATOM 7993  C CG1 . VAL C 1 272 ? 61.390   163.167 6.549   1.00 0.00 ? 267 VAL C CG1 1 
ATOM 7994  C CG2 . VAL C 1 272 ? 62.269   164.151 8.668   1.00 0.00 ? 267 VAL C CG2 1 
ATOM 7995  N N   . MET C 1 273 ? 63.967   160.941 5.523   1.00 0.00 ? 268 MET C N   1 
ATOM 7996  C CA  . MET C 1 273 ? 64.452   160.310 4.309   1.00 0.00 ? 268 MET C CA  1 
ATOM 7997  C C   . MET C 1 273 ? 63.550   159.225 3.765   1.00 0.00 ? 268 MET C C   1 
ATOM 7998  O O   . MET C 1 273 ? 63.114   158.378 4.512   1.00 0.00 ? 268 MET C O   1 
ATOM 7999  C CB  . MET C 1 273 ? 65.823   159.867 4.693   1.00 0.00 ? 268 MET C CB  1 
ATOM 8000  C CG  . MET C 1 273 ? 66.616   159.519 3.445   1.00 0.00 ? 268 MET C CG  1 
ATOM 8001  S SD  . MET C 1 273 ? 68.198   158.821 3.841   1.00 0.00 ? 268 MET C SD  1 
ATOM 8002  C CE  . MET C 1 273 ? 67.564   157.182 3.549   1.00 0.00 ? 268 MET C CE  1 
ATOM 8003  N N   . GLU C 1 274 ? 63.210   159.262 2.474   1.00 0.00 ? 269 GLU C N   1 
ATOM 8004  C CA  . GLU C 1 274 ? 62.188   158.370 1.867   1.00 0.00 ? 269 GLU C CA  1 
ATOM 8005  C C   . GLU C 1 274 ? 62.826   157.853 0.604   1.00 0.00 ? 269 GLU C C   1 
ATOM 8006  O O   . GLU C 1 274 ? 63.602   158.538 -0.080  1.00 0.00 ? 269 GLU C O   1 
ATOM 8007  C CB  . GLU C 1 274 ? 60.806   159.073 1.643   1.00 0.00 ? 269 GLU C CB  1 
ATOM 8008  C CG  . GLU C 1 274 ? 60.859   160.174 0.609   1.00 0.00 ? 269 GLU C CG  1 
ATOM 8009  C CD  . GLU C 1 274 ? 61.472   161.538 1.200   1.00 0.00 ? 269 GLU C CD  1 
ATOM 8010  O OE1 . GLU C 1 274 ? 62.672   161.748 1.293   1.00 0.00 ? 269 GLU C OE1 1 
ATOM 8011  O OE2 . GLU C 1 274 ? 60.602   162.410 1.580   1.00 0.00 ? 269 GLU C OE2 1 
ATOM 8012  N N   . GLY C 1 275 ? 62.420   156.602 0.235   1.00 0.00 ? 270 GLY C N   1 
ATOM 8013  C CA  . GLY C 1 275 ? 63.031   155.862 -0.902  1.00 0.00 ? 270 GLY C CA  1 
ATOM 8014  C C   . GLY C 1 275 ? 62.585   154.513 -0.931  1.00 0.00 ? 270 GLY C C   1 
ATOM 8015  O O   . GLY C 1 275 ? 62.179   153.966 0.095   1.00 0.00 ? 270 GLY C O   1 
ATOM 8016  N N   . HIS C 1 276 ? 62.643   153.873 -2.112  1.00 0.00 ? 271 HIS C N   1 
ATOM 8017  C CA  . HIS C 1 276 ? 62.128   152.453 -2.135  1.00 0.00 ? 271 HIS C CA  1 
ATOM 8018  C C   . HIS C 1 276 ? 63.222   151.443 -1.852  1.00 0.00 ? 271 HIS C C   1 
ATOM 8019  O O   . HIS C 1 276 ? 64.470   151.668 -1.991  1.00 0.00 ? 271 HIS C O   1 
ATOM 8020  C CB  . HIS C 1 276 ? 61.403   152.140 -3.449  1.00 0.00 ? 271 HIS C CB  1 
ATOM 8021  C CG  . HIS C 1 276 ? 60.255   152.968 -3.824  1.00 0.00 ? 271 HIS C CG  1 
ATOM 8022  N ND1 . HIS C 1 276 ? 60.349   154.311 -4.215  1.00 0.00 ? 271 HIS C ND1 1 
ATOM 8023  C CD2 . HIS C 1 276 ? 58.985   152.549 -4.104  1.00 0.00 ? 271 HIS C CD2 1 
ATOM 8024  C CE1 . HIS C 1 276 ? 59.159   154.663 -4.675  1.00 0.00 ? 271 HIS C CE1 1 
ATOM 8025  N NE2 . HIS C 1 276 ? 58.266   153.646 -4.640  1.00 0.00 ? 271 HIS C NE2 1 
ATOM 8026  N N   . LEU C 1 277 ? 62.819   150.234 -1.453  1.00 0.00 ? 272 LEU C N   1 
ATOM 8027  C CA  . LEU C 1 277 ? 63.787   149.185 -1.245  1.00 0.00 ? 272 LEU C CA  1 
ATOM 8028  C C   . LEU C 1 277 ? 62.953   147.891 -1.645  1.00 0.00 ? 272 LEU C C   1 
ATOM 8029  O O   . LEU C 1 277 ? 61.755   147.866 -1.812  1.00 0.00 ? 272 LEU C O   1 
ATOM 8030  C CB  . LEU C 1 277 ? 64.252   149.047 0.188   1.00 0.00 ? 272 LEU C CB  1 
ATOM 8031  C CG  . LEU C 1 277 ? 65.140   150.138 0.806   1.00 0.00 ? 272 LEU C CG  1 
ATOM 8032  C CD1 . LEU C 1 277 ? 65.136   150.046 2.328   1.00 0.00 ? 272 LEU C CD1 1 
ATOM 8033  C CD2 . LEU C 1 277 ? 66.647   150.172 0.347   1.00 0.00 ? 272 LEU C CD2 1 
ATOM 8034  N N   . PHE C 1 278 ? 63.706   146.796 -1.667  1.00 0.00 ? 273 PHE C N   1 
ATOM 8035  C CA  . PHE C 1 278 ? 63.127   145.450 -1.844  1.00 0.00 ? 273 PHE C CA  1 
ATOM 8036  C C   . PHE C 1 278 ? 63.247   144.829 -0.469  1.00 0.00 ? 273 PHE C C   1 
ATOM 8037  O O   . PHE C 1 278 ? 64.263   144.893 0.196   1.00 0.00 ? 273 PHE C O   1 
ATOM 8038  C CB  . PHE C 1 278 ? 63.804   144.531 -2.858  1.00 0.00 ? 273 PHE C CB  1 
ATOM 8039  C CG  . PHE C 1 278 ? 63.362   144.957 -4.186  1.00 0.00 ? 273 PHE C CG  1 
ATOM 8040  C CD1 . PHE C 1 278 ? 62.255   144.438 -4.858  1.00 0.00 ? 273 PHE C CD1 1 
ATOM 8041  C CD2 . PHE C 1 278 ? 64.273   145.695 -4.934  1.00 0.00 ? 273 PHE C CD2 1 
ATOM 8042  C CE1 . PHE C 1 278 ? 62.017   144.801 -6.201  1.00 0.00 ? 273 PHE C CE1 1 
ATOM 8043  C CE2 . PHE C 1 278 ? 64.028   146.117 -6.252  1.00 0.00 ? 273 PHE C CE2 1 
ATOM 8044  C CZ  . PHE C 1 278 ? 62.906   145.605 -6.909  1.00 0.00 ? 273 PHE C CZ  1 
ATOM 8045  N N   . LYS C 1 279 ? 62.141   144.260 0.079   1.00 0.00 ? 274 LYS C N   1 
ATOM 8046  C CA  . LYS C 1 279 ? 62.104   143.711 1.430   1.00 0.00 ? 274 LYS C CA  1 
ATOM 8047  C C   . LYS C 1 279 ? 61.819   142.225 1.319   1.00 0.00 ? 274 LYS C C   1 
ATOM 8048  O O   . LYS C 1 279 ? 61.091   141.818 0.424   1.00 0.00 ? 274 LYS C O   1 
ATOM 8049  C CB  . LYS C 1 279 ? 60.999   144.384 2.298   1.00 0.00 ? 274 LYS C CB  1 
ATOM 8050  C CG  . LYS C 1 279 ? 60.894   144.053 3.827   1.00 0.00 ? 274 LYS C CG  1 
ATOM 8051  C CD  . LYS C 1 279 ? 59.864   144.818 4.723   1.00 0.00 ? 274 LYS C CD  1 
ATOM 8052  C CE  . LYS C 1 279 ? 58.422   144.648 4.301   1.00 0.00 ? 274 LYS C CE  1 
ATOM 8053  N NZ  . LYS C 1 279 ? 57.968   143.274 4.504   1.00 0.00 ? 274 LYS C NZ  1 
ATOM 8054  N N   . ARG C 1 280 ? 62.319   141.415 2.274   1.00 0.00 ? 275 ARG C N   1 
ATOM 8055  C CA  . ARG C 1 280 ? 61.997   140.026 2.442   1.00 0.00 ? 275 ARG C CA  1 
ATOM 8056  C C   . ARG C 1 280 ? 61.891   139.606 3.873   1.00 0.00 ? 275 ARG C C   1 
ATOM 8057  O O   . ARG C 1 280 ? 62.654   139.992 4.751   1.00 0.00 ? 275 ARG C O   1 
ATOM 8058  C CB  . ARG C 1 280 ? 63.056   139.166 1.670   1.00 0.00 ? 275 ARG C CB  1 
ATOM 8059  C CG  . ARG C 1 280 ? 62.523   137.743 1.381   1.00 0.00 ? 275 ARG C CG  1 
ATOM 8060  C CD  . ARG C 1 280 ? 63.462   136.787 0.591   1.00 0.00 ? 275 ARG C CD  1 
ATOM 8061  N NE  . ARG C 1 280 ? 64.653   136.297 1.409   1.00 0.00 ? 275 ARG C NE  1 
ATOM 8062  C CZ  . ARG C 1 280 ? 65.610   135.603 0.835   1.00 0.00 ? 275 ARG C CZ  1 
ATOM 8063  N NH1 . ARG C 1 280 ? 65.538   135.189 -0.431  1.00 0.00 ? 275 ARG C NH1 1 
ATOM 8064  N NH2 . ARG C 1 280 ? 66.626   135.161 1.642   1.00 0.00 ? 275 ARG C NH2 1 
ATOM 8065  N N   . ALA C 1 281 ? 60.836   138.865 4.291   1.00 0.00 ? 276 ALA C N   1 
ATOM 8066  C CA  . ALA C 1 281 ? 60.703   138.464 5.724   1.00 0.00 ? 276 ALA C CA  1 
ATOM 8067  C C   . ALA C 1 281 ? 61.484   137.204 6.032   1.00 0.00 ? 276 ALA C C   1 
ATOM 8068  O O   . ALA C 1 281 ? 62.317   136.839 5.272   1.00 0.00 ? 276 ALA C O   1 
ATOM 8069  C CB  . ALA C 1 281 ? 59.248   138.362 5.924   1.00 0.00 ? 276 ALA C CB  1 
ATOM 8070  N N   . SER C 1 282 ? 61.278   136.525 7.157   1.00 0.00 ? 277 SER C N   1 
ATOM 8071  C CA  . SER C 1 282 ? 62.019   135.324 7.530   1.00 0.00 ? 277 SER C CA  1 
ATOM 8072  C C   . SER C 1 282 ? 61.155   134.074 7.504   1.00 0.00 ? 277 SER C C   1 
ATOM 8073  O O   . SER C 1 282 ? 61.385   133.144 8.324   1.00 0.00 ? 277 SER C O   1 
ATOM 8074  C CB  . SER C 1 282 ? 62.724   135.365 8.875   1.00 0.00 ? 277 SER C CB  1 
ATOM 8075  O OG  . SER C 1 282 ? 64.039   134.778 8.788   1.00 0.00 ? 277 SER C OG  1 
ATOM 8076  N N   . ASN C 1 283 ? 60.042   134.029 6.752   1.00 0.00 ? 278 ASN C N   1 
ATOM 8077  C CA  . ASN C 1 283 ? 59.176   132.877 6.728   1.00 0.00 ? 278 ASN C CA  1 
ATOM 8078  C C   . ASN C 1 283 ? 59.824   131.685 6.049   1.00 0.00 ? 278 ASN C C   1 
ATOM 8079  O O   . ASN C 1 283 ? 60.565   131.782 5.101   1.00 0.00 ? 278 ASN C O   1 
ATOM 8080  C CB  . ASN C 1 283 ? 57.804   133.102 6.028   1.00 0.00 ? 278 ASN C CB  1 
ATOM 8081  C CG  . ASN C 1 283 ? 57.155   134.120 6.921   1.00 0.00 ? 278 ASN C CG  1 
ATOM 8082  O OD1 . ASN C 1 283 ? 57.288   135.357 6.797   1.00 0.00 ? 278 ASN C OD1 1 
ATOM 8083  N ND2 . ASN C 1 283 ? 56.398   133.534 7.839   1.00 0.00 ? 278 ASN C ND2 1 
ATOM 8084  N N   . ALA C 1 284 ? 59.501   130.404 6.363   1.00 0.00 ? 279 ALA C N   1 
ATOM 8085  C CA  . ALA C 1 284 ? 60.058   129.361 5.541   1.00 0.00 ? 279 ALA C CA  1 
ATOM 8086  C C   . ALA C 1 284 ? 59.855   129.300 4.002   1.00 0.00 ? 279 ALA C C   1 
ATOM 8087  O O   . ALA C 1 284 ? 60.712   128.847 3.237   1.00 0.00 ? 279 ALA C O   1 
ATOM 8088  C CB  . ALA C 1 284 ? 59.379   128.055 6.086   1.00 0.00 ? 279 ALA C CB  1 
ATOM 8089  N N   . PHE C 1 285 ? 58.639   129.755 3.486   1.00 0.00 ? 280 PHE C N   1 
ATOM 8090  C CA  . PHE C 1 285 ? 58.419   130.042 2.125   1.00 0.00 ? 280 PHE C CA  1 
ATOM 8091  C C   . PHE C 1 285 ? 58.186   131.538 1.997   1.00 0.00 ? 280 PHE C C   1 
ATOM 8092  O O   . PHE C 1 285 ? 57.305   132.161 2.580   1.00 0.00 ? 280 PHE C O   1 
ATOM 8093  C CB  . PHE C 1 285 ? 57.227   129.156 1.556   1.00 0.00 ? 280 PHE C CB  1 
ATOM 8094  C CG  . PHE C 1 285 ? 57.377   127.798 1.733   1.00 0.00 ? 280 PHE C CG  1 
ATOM 8095  C CD1 . PHE C 1 285 ? 58.460   127.132 1.057   1.00 0.00 ? 280 PHE C CD1 1 
ATOM 8096  C CD2 . PHE C 1 285 ? 56.408   127.040 2.490   1.00 0.00 ? 280 PHE C CD2 1 
ATOM 8097  C CE1 . PHE C 1 285 ? 58.569   125.740 1.214   1.00 0.00 ? 280 PHE C CE1 1 
ATOM 8098  C CE2 . PHE C 1 285 ? 56.478   125.651 2.575   1.00 0.00 ? 280 PHE C CE2 1 
ATOM 8099  C CZ  . PHE C 1 285 ? 57.542   125.019 1.921   1.00 0.00 ? 280 PHE C CZ  1 
ATOM 8100  N N   . LYS C 1 286 ? 59.020   132.207 1.196   1.00 0.00 ? 281 LYS C N   1 
ATOM 8101  C CA  . LYS C 1 286 ? 59.271   133.662 1.431   1.00 0.00 ? 281 LYS C CA  1 
ATOM 8102  C C   . LYS C 1 286 ? 59.645   134.287 0.073   1.00 0.00 ? 281 LYS C C   1 
ATOM 8103  O O   . LYS C 1 286 ? 60.262   133.635 -0.715  1.00 0.00 ? 281 LYS C O   1 
ATOM 8104  C CB  . LYS C 1 286 ? 60.277   133.976 2.544   1.00 0.00 ? 281 LYS C CB  1 
ATOM 8105  C CG  . LYS C 1 286 ? 61.649   133.303 2.546   1.00 0.00 ? 281 LYS C CG  1 
ATOM 8106  C CD  . LYS C 1 286 ? 62.584   133.757 3.672   1.00 0.00 ? 281 LYS C CD  1 
ATOM 8107  C CE  . LYS C 1 286 ? 63.829   132.900 3.916   1.00 0.00 ? 281 LYS C CE  1 
ATOM 8108  N NZ  . LYS C 1 286 ? 63.434   131.629 4.542   1.00 0.00 ? 281 LYS C NZ  1 
ATOM 8109  N N   . THR C 1 287 ? 59.381   135.597 -0.236  1.00 0.00 ? 282 THR C N   1 
ATOM 8110  C CA  . THR C 1 287 ? 59.841   136.234 -1.413  1.00 0.00 ? 282 THR C CA  1 
ATOM 8111  C C   . THR C 1 287 ? 59.924   137.754 -1.271  1.00 0.00 ? 282 THR C C   1 
ATOM 8112  O O   . THR C 1 287 ? 59.554   138.388 -0.258  1.00 0.00 ? 282 THR C O   1 
ATOM 8113  C CB  . THR C 1 287 ? 59.196   135.767 -2.761  1.00 0.00 ? 282 THR C CB  1 
ATOM 8114  O OG1 . THR C 1 287 ? 59.901   136.172 -3.927  1.00 0.00 ? 282 THR C OG1 1 
ATOM 8115  C CG2 . THR C 1 287 ? 57.692   136.090 -2.842  1.00 0.00 ? 282 THR C CG2 1 
ATOM 8116  N N   . TRP C 1 288 ? 60.572   138.373 -2.261  1.00 0.00 ? 283 TRP C N   1 
ATOM 8117  C CA  . TRP C 1 288 ? 60.912   139.791 -2.362  1.00 0.00 ? 283 TRP C CA  1 
ATOM 8118  C C   . TRP C 1 288 ? 59.638   140.657 -2.841  1.00 0.00 ? 283 TRP C C   1 
ATOM 8119  O O   . TRP C 1 288 ? 58.882   140.223 -3.742  1.00 0.00 ? 283 TRP C O   1 
ATOM 8120  C CB  . TRP C 1 288 ? 62.202   140.093 -3.242  1.00 0.00 ? 283 TRP C CB  1 
ATOM 8121  C CG  . TRP C 1 288 ? 63.505   139.471 -2.702  1.00 0.00 ? 283 TRP C CG  1 
ATOM 8122  C CD1 . TRP C 1 288 ? 64.069   138.263 -3.060  1.00 0.00 ? 283 TRP C CD1 1 
ATOM 8123  C CD2 . TRP C 1 288 ? 64.504   140.097 -1.794  1.00 0.00 ? 283 TRP C CD2 1 
ATOM 8124  N NE1 . TRP C 1 288 ? 65.236   138.094 -2.466  1.00 0.00 ? 283 TRP C NE1 1 
ATOM 8125  C CE2 . TRP C 1 288 ? 65.602   139.232 -1.737  1.00 0.00 ? 283 TRP C CE2 1 
ATOM 8126  C CE3 . TRP C 1 288 ? 64.511   141.298 -1.131  1.00 0.00 ? 283 TRP C CE3 1 
ATOM 8127  C CZ2 . TRP C 1 288 ? 66.705   139.493 -1.057  1.00 0.00 ? 283 TRP C CZ2 1 
ATOM 8128  C CZ3 . TRP C 1 288 ? 65.743   141.645 -0.443  1.00 0.00 ? 283 TRP C CZ3 1 
ATOM 8129  C CH2 . TRP C 1 288 ? 66.740   140.634 -0.379  1.00 0.00 ? 283 TRP C CH2 1 
ATOM 8130  N N   . SER C 1 289 ? 59.467   141.846 -2.341  1.00 0.00 ? 284 SER C N   1 
ATOM 8131  C CA  . SER C 1 289 ? 58.583   142.822 -2.971  1.00 0.00 ? 284 SER C CA  1 
ATOM 8132  C C   . SER C 1 289 ? 59.130   144.160 -2.563  1.00 0.00 ? 284 SER C C   1 
ATOM 8133  O O   . SER C 1 289 ? 59.854   144.241 -1.578  1.00 0.00 ? 284 SER C O   1 
ATOM 8134  C CB  . SER C 1 289 ? 57.073   142.746 -2.661  1.00 0.00 ? 284 SER C CB  1 
ATOM 8135  O OG  . SER C 1 289 ? 57.011   142.714 -1.256  1.00 0.00 ? 284 SER C OG  1 
ATOM 8136  N N   . ARG C 1 290 ? 58.778   145.142 -3.364  1.00 0.00 ? 285 ARG C N   1 
ATOM 8137  C CA  . ARG C 1 290 ? 59.203   146.504 -3.162  1.00 0.00 ? 285 ARG C CA  1 
ATOM 8138  C C   . ARG C 1 290 ? 58.109   147.285 -2.500  1.00 0.00 ? 285 ARG C C   1 
ATOM 8139  O O   . ARG C 1 290 ? 56.918   147.206 -2.785  1.00 0.00 ? 285 ARG C O   1 
ATOM 8140  C CB  . ARG C 1 290 ? 59.466   147.038 -4.628  1.00 0.00 ? 285 ARG C CB  1 
ATOM 8141  C CG  . ARG C 1 290 ? 60.201   148.405 -4.752  1.00 0.00 ? 285 ARG C CG  1 
ATOM 8142  C CD  . ARG C 1 290 ? 60.689   148.547 -6.164  1.00 0.00 ? 285 ARG C CD  1 
ATOM 8143  N NE  . ARG C 1 290 ? 61.428   149.919 -6.306  1.00 0.00 ? 285 ARG C NE  1 
ATOM 8144  C CZ  . ARG C 1 290 ? 62.713   150.015 -6.127  1.00 0.00 ? 285 ARG C CZ  1 
ATOM 8145  N NH1 . ARG C 1 290 ? 63.476   148.994 -5.702  1.00 0.00 ? 285 ARG C NH1 1 
ATOM 8146  N NH2 . ARG C 1 290 ? 63.339   151.148 -6.513  1.00 0.00 ? 285 ARG C NH2 1 
ATOM 8147  N N   . ARG C 1 291 ? 58.483   148.161 -1.622  1.00 0.00 ? 286 ARG C N   1 
ATOM 8148  C CA  . ARG C 1 291 ? 57.665   149.036 -0.892  1.00 0.00 ? 286 ARG C CA  1 
ATOM 8149  C C   . ARG C 1 291 ? 58.345   150.343 -0.843  1.00 0.00 ? 286 ARG C C   1 
ATOM 8150  O O   . ARG C 1 291 ? 59.597   150.455 -0.993  1.00 0.00 ? 286 ARG C O   1 
ATOM 8151  C CB  . ARG C 1 291 ? 57.579   148.522 0.586   1.00 0.00 ? 286 ARG C CB  1 
ATOM 8152  C CG  . ARG C 1 291 ? 56.959   147.172 0.793   1.00 0.00 ? 286 ARG C CG  1 
ATOM 8153  C CD  . ARG C 1 291 ? 55.459   147.176 0.354   1.00 0.00 ? 286 ARG C CD  1 
ATOM 8154  N NE  . ARG C 1 291 ? 54.908   145.722 0.376   1.00 0.00 ? 286 ARG C NE  1 
ATOM 8155  C CZ  . ARG C 1 291 ? 54.104   145.157 -0.529  1.00 0.00 ? 286 ARG C CZ  1 
ATOM 8156  N NH1 . ARG C 1 291 ? 54.009   145.661 -1.761  1.00 0.00 ? 286 ARG C NH1 1 
ATOM 8157  N NH2 . ARG C 1 291 ? 53.360   144.143 -0.110  1.00 0.00 ? 286 ARG C NH2 1 
ATOM 8158  N N   . TRP C 1 292 ? 57.612   151.418 -0.585  1.00 0.00 ? 287 TRP C N   1 
ATOM 8159  C CA  . TRP C 1 292 ? 58.211   152.764 -0.428  1.00 0.00 ? 287 TRP C CA  1 
ATOM 8160  C C   . TRP C 1 292 ? 58.455   152.915 1.096   1.00 0.00 ? 287 TRP C C   1 
ATOM 8161  O O   . TRP C 1 292 ? 57.552   152.876 1.879   1.00 0.00 ? 287 TRP C O   1 
ATOM 8162  C CB  . TRP C 1 292 ? 57.320   153.950 -0.971  1.00 0.00 ? 287 TRP C CB  1 
ATOM 8163  C CG  . TRP C 1 292 ? 57.810   155.366 -0.973  1.00 0.00 ? 287 TRP C CG  1 
ATOM 8164  C CD1 . TRP C 1 292 ? 59.069   155.688 -1.232  1.00 0.00 ? 287 TRP C CD1 1 
ATOM 8165  C CD2 . TRP C 1 292 ? 57.054   156.589 -0.747  1.00 0.00 ? 287 TRP C CD2 1 
ATOM 8166  N NE1 . TRP C 1 292 ? 59.224   157.062 -1.144  1.00 0.00 ? 287 TRP C NE1 1 
ATOM 8167  C CE2 . TRP C 1 292 ? 57.955   157.633 -0.916  1.00 0.00 ? 287 TRP C CE2 1 
ATOM 8168  C CE3 . TRP C 1 292 ? 55.680   156.847 -0.473  1.00 0.00 ? 287 TRP C CE3 1 
ATOM 8169  C CZ2 . TRP C 1 292 ? 57.594   158.952 -0.632  1.00 0.00 ? 287 TRP C CZ2 1 
ATOM 8170  C CZ3 . TRP C 1 292 ? 55.346   158.150 -0.088  1.00 0.00 ? 287 TRP C CZ3 1 
ATOM 8171  C CH2 . TRP C 1 292 ? 56.321   159.191 -0.222  1.00 0.00 ? 287 TRP C CH2 1 
ATOM 8172  N N   . PHE C 1 293 ? 59.705   153.192 1.525   1.00 0.00 ? 288 PHE C N   1 
ATOM 8173  C CA  . PHE C 1 293 ? 60.143   153.249 2.893   1.00 0.00 ? 288 PHE C CA  1 
ATOM 8174  C C   . PHE C 1 293 ? 60.262   154.751 3.235   1.00 0.00 ? 288 PHE C C   1 
ATOM 8175  O O   . PHE C 1 293 ? 60.390   155.698 2.346   1.00 0.00 ? 288 PHE C O   1 
ATOM 8176  C CB  . PHE C 1 293 ? 61.482   152.515 3.308   1.00 0.00 ? 288 PHE C CB  1 
ATOM 8177  C CG  . PHE C 1 293 ? 61.252   151.066 3.309   1.00 0.00 ? 288 PHE C CG  1 
ATOM 8178  C CD1 . PHE C 1 293 ? 61.138   150.364 2.103   1.00 0.00 ? 288 PHE C CD1 1 
ATOM 8179  C CD2 . PHE C 1 293 ? 61.223   150.434 4.611   1.00 0.00 ? 288 PHE C CD2 1 
ATOM 8180  C CE1 . PHE C 1 293 ? 60.936   149.025 2.170   1.00 0.00 ? 288 PHE C CE1 1 
ATOM 8181  C CE2 . PHE C 1 293 ? 61.015   149.055 4.723   1.00 0.00 ? 288 PHE C CE2 1 
ATOM 8182  C CZ  . PHE C 1 293 ? 60.899   148.374 3.477   1.00 0.00 ? 288 PHE C CZ  1 
ATOM 8183  N N   . THR C 1 294 ? 60.139   155.034 4.540   1.00 0.00 ? 289 THR C N   1 
ATOM 8184  C CA  . THR C 1 294 ? 60.398   156.390 5.057   1.00 0.00 ? 289 THR C CA  1 
ATOM 8185  C C   . THR C 1 294 ? 60.953   156.318 6.477   1.00 0.00 ? 289 THR C C   1 
ATOM 8186  O O   . THR C 1 294 ? 60.315   155.685 7.317   1.00 0.00 ? 289 THR C O   1 
ATOM 8187  C CB  . THR C 1 294 ? 59.179   157.337 5.103   1.00 0.00 ? 289 THR C CB  1 
ATOM 8188  O OG1 . THR C 1 294 ? 58.605   157.459 3.767   1.00 0.00 ? 289 THR C OG1 1 
ATOM 8189  C CG2 . THR C 1 294 ? 59.618   158.759 5.548   1.00 0.00 ? 289 THR C CG2 1 
ATOM 8190  N N   . ILE C 1 295 ? 62.100   156.963 6.816   1.00 0.00 ? 290 ILE C N   1 
ATOM 8191  C CA  . ILE C 1 295 ? 62.552   157.147 8.193   1.00 0.00 ? 290 ILE C CA  1 
ATOM 8192  C C   . ILE C 1 295 ? 62.034   158.501 8.481   1.00 0.00 ? 290 ILE C C   1 
ATOM 8193  O O   . ILE C 1 295 ? 62.435   159.472 7.836   1.00 0.00 ? 290 ILE C O   1 
ATOM 8194  C CB  . ILE C 1 295 ? 64.055   157.297 8.385   1.00 0.00 ? 290 ILE C CB  1 
ATOM 8195  C CG1 . ILE C 1 295 ? 64.904   156.380 7.513   1.00 0.00 ? 290 ILE C CG1 1 
ATOM 8196  C CG2 . ILE C 1 295 ? 64.313   156.810 9.826   1.00 0.00 ? 290 ILE C CG2 1 
ATOM 8197  C CD1 . ILE C 1 295 ? 66.386   156.524 7.719   1.00 0.00 ? 290 ILE C CD1 1 
ATOM 8198  N N   . GLN C 1 296 ? 61.112   158.589 9.470   1.00 0.00 ? 291 GLN C N   1 
ATOM 8199  C CA  . GLN C 1 296 ? 60.636   159.864 9.953   1.00 0.00 ? 291 GLN C CA  1 
ATOM 8200  C C   . GLN C 1 296 ? 60.491   159.739 11.447  1.00 0.00 ? 291 GLN C C   1 
ATOM 8201  O O   . GLN C 1 296 ? 59.884   158.800 11.980  1.00 0.00 ? 291 GLN C O   1 
ATOM 8202  C CB  . GLN C 1 296 ? 59.304   160.473 9.390   1.00 0.00 ? 291 GLN C CB  1 
ATOM 8203  C CG  . GLN C 1 296 ? 59.107   162.036 9.697   1.00 0.00 ? 291 GLN C CG  1 
ATOM 8204  C CD  . GLN C 1 296 ? 57.980   162.664 8.813   1.00 0.00 ? 291 GLN C CD  1 
ATOM 8205  O OE1 . GLN C 1 296 ? 56.896   162.083 8.672   1.00 0.00 ? 291 GLN C OE1 1 
ATOM 8206  N NE2 . GLN C 1 296 ? 58.281   163.766 8.134   1.00 0.00 ? 291 GLN C NE2 1 
ATOM 8207  N N   . SER C 1 297 ? 61.131   160.712 12.199  1.00 0.00 ? 292 SER C N   1 
ATOM 8208  C CA  . SER C 1 297 ? 61.057   160.777 13.637  1.00 0.00 ? 292 SER C CA  1 
ATOM 8209  C C   . SER C 1 297 ? 61.542   159.541 14.407  1.00 0.00 ? 292 SER C C   1 
ATOM 8210  O O   . SER C 1 297 ? 61.072   159.060 15.408  1.00 0.00 ? 292 SER C O   1 
ATOM 8211  C CB  . SER C 1 297 ? 59.627   161.061 14.128  1.00 0.00 ? 292 SER C CB  1 
ATOM 8212  O OG  . SER C 1 297 ? 59.279   162.385 13.675  1.00 0.00 ? 292 SER C OG  1 
ATOM 8213  N N   . ASN C 1 298 ? 62.674   159.122 13.834  1.00 0.00 ? 293 ASN C N   1 
ATOM 8214  C CA  . ASN C 1 298 ? 63.333   157.839 14.191  1.00 0.00 ? 293 ASN C CA  1 
ATOM 8215  C C   . ASN C 1 298 ? 62.493   156.638 13.991  1.00 0.00 ? 293 ASN C C   1 
ATOM 8216  O O   . ASN C 1 298 ? 62.783   155.569 14.583  1.00 0.00 ? 293 ASN C O   1 
ATOM 8217  C CB  . ASN C 1 298 ? 64.236   157.987 15.419  1.00 0.00 ? 293 ASN C CB  1 
ATOM 8218  C CG  . ASN C 1 298 ? 65.243   159.130 15.189  1.00 0.00 ? 293 ASN C CG  1 
ATOM 8219  O OD1 . ASN C 1 298 ? 65.625   159.837 16.134  1.00 0.00 ? 293 ASN C OD1 1 
ATOM 8220  N ND2 . ASN C 1 298 ? 65.842   159.352 14.001  1.00 0.00 ? 293 ASN C ND2 1 
ATOM 8221  N N   . GLN C 1 299 ? 61.482   156.669 13.142  1.00 0.00 ? 294 GLN C N   1 
ATOM 8222  C CA  . GLN C 1 299 ? 60.606   155.584 12.983  1.00 0.00 ? 294 GLN C CA  1 
ATOM 8223  C C   . GLN C 1 299 ? 60.751   155.062 11.529  1.00 0.00 ? 294 GLN C C   1 
ATOM 8224  O O   . GLN C 1 299 ? 60.569   155.835 10.619  1.00 0.00 ? 294 GLN C O   1 
ATOM 8225  C CB  . GLN C 1 299 ? 59.129   156.039 13.355  1.00 0.00 ? 294 GLN C CB  1 
ATOM 8226  C CG  . GLN C 1 299 ? 58.105   154.906 13.533  1.00 0.00 ? 294 GLN C CG  1 
ATOM 8227  C CD  . GLN C 1 299 ? 58.383   154.338 14.928  1.00 0.00 ? 294 GLN C CD  1 
ATOM 8228  O OE1 . GLN C 1 299 ? 59.461   153.752 15.138  1.00 0.00 ? 294 GLN C OE1 1 
ATOM 8229  N NE2 . GLN C 1 299 ? 57.642   154.834 15.912  1.00 0.00 ? 294 GLN C NE2 1 
ATOM 8230  N N   . LEU C 1 300 ? 61.184   153.779 11.344  1.00 0.00 ? 295 LEU C N   1 
ATOM 8231  C CA  . LEU C 1 300 ? 61.275   153.163 10.070  1.00 0.00 ? 295 LEU C CA  1 
ATOM 8232  C C   . LEU C 1 300 ? 59.974   152.530 9.687   1.00 0.00 ? 295 LEU C C   1 
ATOM 8233  O O   . LEU C 1 300 ? 59.383   151.639 10.391  1.00 0.00 ? 295 LEU C O   1 
ATOM 8234  C CB  . LEU C 1 300 ? 62.488   152.114 10.023  1.00 0.00 ? 295 LEU C CB  1 
ATOM 8235  C CG  . LEU C 1 300 ? 62.715   151.409 8.704   1.00 0.00 ? 295 LEU C CG  1 
ATOM 8236  C CD1 . LEU C 1 300 ? 62.755   152.382 7.438   1.00 0.00 ? 295 LEU C CD1 1 
ATOM 8237  C CD2 . LEU C 1 300 ? 63.883   150.434 8.735   1.00 0.00 ? 295 LEU C CD2 1 
ATOM 8238  N N   . VAL C 1 301 ? 59.390   152.928 8.565   1.00 0.00 ? 296 VAL C N   1 
ATOM 8239  C CA  . VAL C 1 301 ? 57.966   152.607 8.104   1.00 0.00 ? 296 VAL C CA  1 
ATOM 8240  C C   . VAL C 1 301 ? 57.946   152.441 6.605   1.00 0.00 ? 296 VAL C C   1 
ATOM 8241  O O   . VAL C 1 301 ? 58.865   152.852 5.858   1.00 0.00 ? 296 VAL C O   1 
ATOM 8242  C CB  . VAL C 1 301 ? 57.051   153.787 8.597   1.00 0.00 ? 296 VAL C CB  1 
ATOM 8243  C CG1 . VAL C 1 301 ? 57.225   153.927 10.185  1.00 0.00 ? 296 VAL C CG1 1 
ATOM 8244  C CG2 . VAL C 1 301 ? 57.339   155.096 7.879   1.00 0.00 ? 296 VAL C CG2 1 
ATOM 8245  N N   . TYR C 1 302 ? 56.951   151.666 6.084   1.00 0.00 ? 297 TYR C N   1 
ATOM 8246  C CA  . TYR C 1 302 ? 56.724   151.334 4.654   1.00 0.00 ? 297 TYR C CA  1 
ATOM 8247  C C   . TYR C 1 302 ? 55.251   151.474 4.419   1.00 0.00 ? 297 TYR C C   1 
ATOM 8248  O O   . TYR C 1 302 ? 54.480   151.719 5.328   1.00 0.00 ? 297 TYR C O   1 
ATOM 8249  C CB  . TYR C 1 302 ? 57.214   149.951 4.142   1.00 0.00 ? 297 TYR C CB  1 
ATOM 8250  C CG  . TYR C 1 302 ? 56.502   148.793 4.787   1.00 0.00 ? 297 TYR C CG  1 
ATOM 8251  C CD1 . TYR C 1 302 ? 56.665   148.494 6.230   1.00 0.00 ? 297 TYR C CD1 1 
ATOM 8252  C CD2 . TYR C 1 302 ? 55.649   147.993 4.109   1.00 0.00 ? 297 TYR C CD2 1 
ATOM 8253  C CE1 . TYR C 1 302 ? 55.981   147.396 6.799   1.00 0.00 ? 297 TYR C CE1 1 
ATOM 8254  C CE2 . TYR C 1 302 ? 54.912   146.962 4.741   1.00 0.00 ? 297 TYR C CE2 1 
ATOM 8255  C CZ  . TYR C 1 302 ? 55.063   146.564 6.099   1.00 0.00 ? 297 TYR C CZ  1 
ATOM 8256  O OH  . TYR C 1 302 ? 54.482   145.362 6.708   1.00 0.00 ? 297 TYR C OH  1 
ATOM 8257  N N   . GLN C 1 303 ? 54.834   151.448 3.167   1.00 0.00 ? 298 GLN C N   1 
ATOM 8258  C CA  . GLN C 1 303 ? 53.459   151.593 2.792   1.00 0.00 ? 298 GLN C CA  1 
ATOM 8259  C C   . GLN C 1 303 ? 53.335   150.890 1.457   1.00 0.00 ? 298 GLN C C   1 
ATOM 8260  O O   . GLN C 1 303 ? 54.127   151.049 0.551   1.00 0.00 ? 298 GLN C O   1 
ATOM 8261  C CB  . GLN C 1 303 ? 52.970   153.105 2.684   1.00 0.00 ? 298 GLN C CB  1 
ATOM 8262  C CG  . GLN C 1 303 ? 54.006   154.083 2.124   1.00 0.00 ? 298 GLN C CG  1 
ATOM 8263  C CD  . GLN C 1 303 ? 53.544   155.484 1.955   1.00 0.00 ? 298 GLN C CD  1 
ATOM 8264  O OE1 . GLN C 1 303 ? 54.009   156.384 2.648   1.00 0.00 ? 298 GLN C OE1 1 
ATOM 8265  N NE2 . GLN C 1 303 ? 52.626   155.699 1.008   1.00 0.00 ? 298 GLN C NE2 1 
ATOM 8266  N N   . LYS C 1 304 ? 52.310   150.002 1.299   1.00 0.00 ? 299 LYS C N   1 
ATOM 8267  C CA  . LYS C 1 304 ? 52.074   149.056 0.240   1.00 0.00 ? 299 LYS C CA  1 
ATOM 8268  C C   . LYS C 1 304 ? 51.870   149.899 -1.092  1.00 0.00 ? 299 LYS C C   1 
ATOM 8269  O O   . LYS C 1 304 ? 52.196   149.440 -2.201  1.00 0.00 ? 299 LYS C O   1 
ATOM 8270  C CB  . LYS C 1 304 ? 50.843   148.221 0.563   1.00 0.00 ? 299 LYS C CB  1 
ATOM 8271  C CG  . LYS C 1 304 ? 51.039   146.999 1.423   1.00 0.00 ? 299 LYS C CG  1 
ATOM 8272  C CD  . LYS C 1 304 ? 49.805   146.293 2.050   1.00 0.00 ? 299 LYS C CD  1 
ATOM 8273  C CE  . LYS C 1 304 ? 48.943   147.206 2.994   1.00 0.00 ? 299 LYS C CE  1 
ATOM 8274  N NZ  . LYS C 1 304 ? 49.738   147.680 4.137   1.00 0.00 ? 299 LYS C NZ  1 
ATOM 8275  N N   . LYS C 1 305 ? 51.386   151.122 -0.910  1.00 0.00 ? 300 LYS C N   1 
ATOM 8276  C CA  . LYS C 1 305 ? 50.975   152.009 -1.993  1.00 0.00 ? 300 LYS C CA  1 
ATOM 8277  C C   . LYS C 1 305 ? 51.457   153.435 -1.708  1.00 0.00 ? 300 LYS C C   1 
ATOM 8278  O O   . LYS C 1 305 ? 51.853   153.692 -0.554  1.00 0.00 ? 300 LYS C O   1 
ATOM 8279  C CB  . LYS C 1 305 ? 49.452   152.170 -2.111  1.00 0.00 ? 300 LYS C CB  1 
ATOM 8280  C CG  . LYS C 1 305 ? 48.740   150.820 -2.519  1.00 0.00 ? 300 LYS C CG  1 
ATOM 8281  C CD  . LYS C 1 305 ? 47.202   150.940 -2.662  1.00 0.00 ? 300 LYS C CD  1 
ATOM 8282  C CE  . LYS C 1 305 ? 46.667   149.511 -2.584  1.00 0.00 ? 300 LYS C CE  1 
ATOM 8283  N NZ  . LYS C 1 305 ? 45.184   149.673 -2.513  1.00 0.00 ? 300 LYS C NZ  1 
ATOM 8284  N N   . TYR C 1 306 ? 51.437   154.382 -2.705  1.00 0.00 ? 301 TYR C N   1 
ATOM 8285  C CA  . TYR C 1 306 ? 51.639   155.825 -2.526  1.00 0.00 ? 301 TYR C CA  1 
ATOM 8286  C C   . TYR C 1 306 ? 50.614   156.436 -1.557  1.00 0.00 ? 301 TYR C C   1 
ATOM 8287  O O   . TYR C 1 306 ? 51.019   157.200 -0.665  1.00 0.00 ? 301 TYR C O   1 
ATOM 8288  C CB  . TYR C 1 306 ? 51.483   156.438 -3.885  1.00 0.00 ? 301 TYR C CB  1 
ATOM 8289  C CG  . TYR C 1 306 ? 51.761   157.903 -3.904  1.00 0.00 ? 301 TYR C CG  1 
ATOM 8290  C CD1 . TYR C 1 306 ? 52.954   158.300 -3.336  1.00 0.00 ? 301 TYR C CD1 1 
ATOM 8291  C CD2 . TYR C 1 306 ? 50.884   158.868 -4.478  1.00 0.00 ? 301 TYR C CD2 1 
ATOM 8292  C CE1 . TYR C 1 306 ? 53.317   159.715 -3.281  1.00 0.00 ? 301 TYR C CE1 1 
ATOM 8293  C CE2 . TYR C 1 306 ? 51.107   160.198 -4.231  1.00 0.00 ? 301 TYR C CE2 1 
ATOM 8294  C CZ  . TYR C 1 306 ? 52.382   160.663 -3.696  1.00 0.00 ? 301 TYR C CZ  1 
ATOM 8295  O OH  . TYR C 1 306 ? 52.661   162.018 -3.605  1.00 0.00 ? 301 TYR C OH  1 
ATOM 8296  N N   . LYS C 1 307 ? 49.296   156.148 -1.622  1.00 0.00 ? 302 LYS C N   1 
ATOM 8297  C CA  . LYS C 1 307 ? 48.250   156.789 -0.878  1.00 0.00 ? 302 LYS C CA  1 
ATOM 8298  C C   . LYS C 1 307 ? 47.834   155.945 0.350   1.00 0.00 ? 302 LYS C C   1 
ATOM 8299  O O   . LYS C 1 307 ? 46.796   156.204 0.910   1.00 0.00 ? 302 LYS C O   1 
ATOM 8300  C CB  . LYS C 1 307 ? 47.013   157.041 -1.803  1.00 0.00 ? 302 LYS C CB  1 
ATOM 8301  C CG  . LYS C 1 307 ? 47.394   157.917 -3.048  1.00 0.00 ? 302 LYS C CG  1 
ATOM 8302  C CD  . LYS C 1 307 ? 46.325   158.917 -3.568  1.00 0.00 ? 302 LYS C CD  1 
ATOM 8303  C CE  . LYS C 1 307 ? 46.103   160.085 -2.549  1.00 0.00 ? 302 LYS C CE  1 
ATOM 8304  N NZ  . LYS C 1 307 ? 47.285   160.912 -2.645  1.00 0.00 ? 302 LYS C NZ  1 
ATOM 8305  N N   . ASP C 1 308 ? 48.626   154.959 0.713   1.00 0.00 ? 303 ASP C N   1 
ATOM 8306  C CA  . ASP C 1 308 ? 48.323   154.170 1.914   1.00 0.00 ? 303 ASP C CA  1 
ATOM 8307  C C   . ASP C 1 308 ? 48.938   154.935 3.117   1.00 0.00 ? 303 ASP C C   1 
ATOM 8308  O O   . ASP C 1 308 ? 49.997   155.459 2.981   1.00 0.00 ? 303 ASP C O   1 
ATOM 8309  C CB  . ASP C 1 308 ? 48.960   152.790 1.602   1.00 0.00 ? 303 ASP C CB  1 
ATOM 8310  C CG  . ASP C 1 308 ? 48.740   151.778 2.731   1.00 0.00 ? 303 ASP C CG  1 
ATOM 8311  O OD1 . ASP C 1 308 ? 47.630   151.673 3.339   1.00 0.00 ? 303 ASP C OD1 1 
ATOM 8312  O OD2 . ASP C 1 308 ? 49.751   151.089 2.986   1.00 0.00 ? 303 ASP C OD2 1 
ATOM 8313  N N   . PRO C 1 309 ? 48.249   154.923 4.333   1.00 0.00 ? 304 PRO C N   1 
ATOM 8314  C CA  . PRO C 1 309 ? 48.911   155.314 5.573   1.00 0.00 ? 304 PRO C CA  1 
ATOM 8315  C C   . PRO C 1 309 ? 50.043   154.413 6.051   1.00 0.00 ? 304 PRO C C   1 
ATOM 8316  O O   . PRO C 1 309 ? 49.911   153.146 6.031   1.00 0.00 ? 304 PRO C O   1 
ATOM 8317  C CB  . PRO C 1 309 ? 47.721   155.334 6.534   1.00 0.00 ? 304 PRO C CB  1 
ATOM 8318  C CG  . PRO C 1 309 ? 46.438   155.688 5.728   1.00 0.00 ? 304 PRO C CG  1 
ATOM 8319  C CD  . PRO C 1 309 ? 46.800   154.939 4.435   1.00 0.00 ? 304 PRO C CD  1 
ATOM 8320  N N   . VAL C 1 310 ? 51.224   154.924 6.581   1.00 0.00 ? 305 VAL C N   1 
ATOM 8321  C CA  . VAL C 1 310 ? 52.397   154.152 6.899   1.00 0.00 ? 305 VAL C CA  1 
ATOM 8322  C C   . VAL C 1 310 ? 52.221   153.163 8.091   1.00 0.00 ? 305 VAL C C   1 
ATOM 8323  O O   . VAL C 1 310 ? 51.413   153.331 9.005   1.00 0.00 ? 305 VAL C O   1 
ATOM 8324  C CB  . VAL C 1 310 ? 53.676   154.929 7.109   1.00 0.00 ? 305 VAL C CB  1 
ATOM 8325  C CG1 . VAL C 1 310 ? 54.172   155.713 5.854   1.00 0.00 ? 305 VAL C CG1 1 
ATOM 8326  C CG2 . VAL C 1 310 ? 53.395   155.882 8.241   1.00 0.00 ? 305 VAL C CG2 1 
ATOM 8327  N N   . THR C 1 311 ? 52.978   152.034 8.051   1.00 0.00 ? 306 THR C N   1 
ATOM 8328  C CA  . THR C 1 311 ? 53.203   151.162 9.098   1.00 0.00 ? 306 THR C CA  1 
ATOM 8329  C C   . THR C 1 311 ? 54.633   150.828 9.510   1.00 0.00 ? 306 THR C C   1 
ATOM 8330  O O   . THR C 1 311 ? 55.441   150.915 8.673   1.00 0.00 ? 306 THR C O   1 
ATOM 8331  C CB  . THR C 1 311 ? 52.397   149.898 8.919   1.00 0.00 ? 306 THR C CB  1 
ATOM 8332  O OG1 . THR C 1 311 ? 52.383   149.073 10.077  1.00 0.00 ? 306 THR C OG1 1 
ATOM 8333  C CG2 . THR C 1 311 ? 52.926   149.118 7.669   1.00 0.00 ? 306 THR C CG2 1 
ATOM 8334  N N   . VAL C 1 312 ? 54.931   150.698 10.873  1.00 0.00 ? 307 VAL C N   1 
ATOM 8335  C CA  . VAL C 1 312 ? 56.215   150.425 11.397  1.00 0.00 ? 307 VAL C CA  1 
ATOM 8336  C C   . VAL C 1 312 ? 56.817   149.111 10.895  1.00 0.00 ? 307 VAL C C   1 
ATOM 8337  O O   . VAL C 1 312 ? 56.193   148.093 10.970  1.00 0.00 ? 307 VAL C O   1 
ATOM 8338  C CB  . VAL C 1 312 ? 56.276   150.676 12.964  1.00 0.00 ? 307 VAL C CB  1 
ATOM 8339  C CG1 . VAL C 1 312 ? 55.759   152.080 13.277  1.00 0.00 ? 307 VAL C CG1 1 
ATOM 8340  C CG2 . VAL C 1 312 ? 55.474   149.632 13.687  1.00 0.00 ? 307 VAL C CG2 1 
ATOM 8341  N N   . VAL C 1 313 ? 58.101   149.180 10.484  1.00 0.00 ? 308 VAL C N   1 
ATOM 8342  C CA  . VAL C 1 313 ? 58.926   148.026 10.173  1.00 0.00 ? 308 VAL C CA  1 
ATOM 8343  C C   . VAL C 1 313 ? 59.249   147.404 11.490  1.00 0.00 ? 308 VAL C C   1 
ATOM 8344  O O   . VAL C 1 313 ? 59.153   146.203 11.592  1.00 0.00 ? 308 VAL C O   1 
ATOM 8345  C CB  . VAL C 1 313 ? 60.160   148.520 9.360   1.00 0.00 ? 308 VAL C CB  1 
ATOM 8346  C CG1 . VAL C 1 313 ? 60.929   147.231 9.044   1.00 0.00 ? 308 VAL C CG1 1 
ATOM 8347  C CG2 . VAL C 1 313 ? 59.753   149.307 8.060   1.00 0.00 ? 308 VAL C CG2 1 
ATOM 8348  N N   . VAL C 1 314 ? 59.557   148.176 12.486  1.00 0.00 ? 309 VAL C N   1 
ATOM 8349  C CA  . VAL C 1 314 ? 59.753   147.669 13.804  1.00 0.00 ? 309 VAL C CA  1 
ATOM 8350  C C   . VAL C 1 314 ? 59.123   148.742 14.670  1.00 0.00 ? 309 VAL C C   1 
ATOM 8351  O O   . VAL C 1 314 ? 59.295   149.880 14.283  1.00 0.00 ? 309 VAL C O   1 
ATOM 8352  C CB  . VAL C 1 314 ? 61.273   147.538 14.225  1.00 0.00 ? 309 VAL C CB  1 
ATOM 8353  C CG1 . VAL C 1 314 ? 61.914   146.204 13.777  1.00 0.00 ? 309 VAL C CG1 1 
ATOM 8354  C CG2 . VAL C 1 314 ? 62.177   148.641 13.775  1.00 0.00 ? 309 VAL C CG2 1 
ATOM 8355  N N   . ASP C 1 315 ? 58.364   148.422 15.759  1.00 0.00 ? 310 ASP C N   1 
ATOM 8356  C CA  . ASP C 1 315 ? 57.682   149.289 16.697  1.00 0.00 ? 310 ASP C CA  1 
ATOM 8357  C C   . ASP C 1 315 ? 58.524   150.446 17.229  1.00 0.00 ? 310 ASP C C   1 
ATOM 8358  O O   . ASP C 1 315 ? 57.973   151.582 17.417  1.00 0.00 ? 310 ASP C O   1 
ATOM 8359  C CB  . ASP C 1 315 ? 57.089   148.502 17.904  1.00 0.00 ? 310 ASP C CB  1 
ATOM 8360  C CG  . ASP C 1 315 ? 56.128   147.466 17.366  1.00 0.00 ? 310 ASP C CG  1 
ATOM 8361  O OD1 . ASP C 1 315 ? 54.913   147.785 17.118  1.00 0.00 ? 310 ASP C OD1 1 
ATOM 8362  O OD2 . ASP C 1 315 ? 56.536   146.259 17.221  1.00 0.00 ? 310 ASP C OD2 1 
ATOM 8363  N N   . ASP C 1 316 ? 59.823   150.136 17.517  1.00 0.00 ? 311 ASP C N   1 
ATOM 8364  C CA  . ASP C 1 316 ? 60.759   151.020 18.167  1.00 0.00 ? 311 ASP C CA  1 
ATOM 8365  C C   . ASP C 1 316 ? 62.113   150.571 17.573  1.00 0.00 ? 311 ASP C C   1 
ATOM 8366  O O   . ASP C 1 316 ? 62.289   149.444 17.207  1.00 0.00 ? 311 ASP C O   1 
ATOM 8367  C CB  . ASP C 1 316 ? 60.688   151.061 19.746  1.00 0.00 ? 311 ASP C CB  1 
ATOM 8368  C CG  . ASP C 1 316 ? 61.184   152.367 20.350  1.00 0.00 ? 311 ASP C CG  1 
ATOM 8369  O OD1 . ASP C 1 316 ? 60.489   153.402 20.338  1.00 0.00 ? 311 ASP C OD1 1 
ATOM 8370  O OD2 . ASP C 1 316 ? 62.376   152.426 20.719  1.00 0.00 ? 311 ASP C OD2 1 
ATOM 8371  N N   . LEU C 1 317 ? 63.104   151.447 17.440  1.00 0.00 ? 312 LEU C N   1 
ATOM 8372  C CA  . LEU C 1 317 ? 64.308   151.248 16.789  1.00 0.00 ? 312 LEU C CA  1 
ATOM 8373  C C   . LEU C 1 317 ? 65.612   151.485 17.674  1.00 0.00 ? 312 LEU C C   1 
ATOM 8374  O O   . LEU C 1 317 ? 66.777   151.289 17.270  1.00 0.00 ? 312 LEU C O   1 
ATOM 8375  C CB  . LEU C 1 317 ? 64.238   152.331 15.549  1.00 0.00 ? 312 LEU C CB  1 
ATOM 8376  C CG  . LEU C 1 317 ? 65.382   152.288 14.494  1.00 0.00 ? 312 LEU C CG  1 
ATOM 8377  C CD1 . LEU C 1 317 ? 65.406   150.991 13.620  1.00 0.00 ? 312 LEU C CD1 1 
ATOM 8378  C CD2 . LEU C 1 317 ? 65.334   153.418 13.488  1.00 0.00 ? 312 LEU C CD2 1 
ATOM 8379  N N   . ARG C 1 318 ? 65.277   151.760 18.994  1.00 0.00 ? 313 ARG C N   1 
ATOM 8380  C CA  . ARG C 1 318 ? 66.177   151.869 20.099  1.00 0.00 ? 313 ARG C CA  1 
ATOM 8381  C C   . ARG C 1 318 ? 66.993   150.615 20.437  1.00 0.00 ? 313 ARG C C   1 
ATOM 8382  O O   . ARG C 1 318 ? 68.176   150.685 20.726  1.00 0.00 ? 313 ARG C O   1 
ATOM 8383  C CB  . ARG C 1 318 ? 65.404   152.346 21.389  1.00 0.00 ? 313 ARG C CB  1 
ATOM 8384  C CG  . ARG C 1 318 ? 66.265   152.966 22.586  1.00 0.00 ? 313 ARG C CG  1 
ATOM 8385  C CD  . ARG C 1 318 ? 65.431   153.440 23.787  1.00 0.00 ? 313 ARG C CD  1 
ATOM 8386  N NE  . ARG C 1 318 ? 66.417   153.710 24.901  1.00 0.00 ? 313 ARG C NE  1 
ATOM 8387  C CZ  . ARG C 1 318 ? 67.370   154.685 24.915  1.00 0.00 ? 313 ARG C CZ  1 
ATOM 8388  N NH1 . ARG C 1 318 ? 67.312   155.720 24.069  1.00 0.00 ? 313 ARG C NH1 1 
ATOM 8389  N NH2 . ARG C 1 318 ? 68.352   154.505 25.737  1.00 0.00 ? 313 ARG C NH2 1 
ATOM 8390  N N   . LEU C 1 319 ? 66.434   149.429 20.359  1.00 0.00 ? 314 LEU C N   1 
ATOM 8391  C CA  . LEU C 1 319 ? 67.140   148.213 20.763  1.00 0.00 ? 314 LEU C CA  1 
ATOM 8392  C C   . LEU C 1 319 ? 67.597   147.329 19.559  1.00 0.00 ? 314 LEU C C   1 
ATOM 8393  O O   . LEU C 1 319 ? 67.909   146.156 19.725  1.00 0.00 ? 314 LEU C O   1 
ATOM 8394  C CB  . LEU C 1 319 ? 66.223   147.189 21.634  1.00 0.00 ? 314 LEU C CB  1 
ATOM 8395  C CG  . LEU C 1 319 ? 65.465   147.705 22.871  1.00 0.00 ? 314 LEU C CG  1 
ATOM 8396  C CD1 . LEU C 1 319 ? 65.050   146.429 23.652  1.00 0.00 ? 314 LEU C CD1 1 
ATOM 8397  C CD2 . LEU C 1 319 ? 66.392   148.519 23.691  1.00 0.00 ? 314 LEU C CD2 1 
ATOM 8398  N N   . CYS C 1 320 ? 67.720   147.934 18.322  1.00 0.00 ? 315 CYS C N   1 
ATOM 8399  C CA  . CYS C 1 320 ? 67.804   147.216 17.049  1.00 0.00 ? 315 CYS C CA  1 
ATOM 8400  C C   . CYS C 1 320 ? 69.298   147.250 16.692  1.00 0.00 ? 315 CYS C C   1 
ATOM 8401  O O   . CYS C 1 320 ? 70.103   147.995 17.253  1.00 0.00 ? 315 CYS C O   1 
ATOM 8402  C CB  . CYS C 1 320 ? 66.933   147.969 15.962  1.00 0.00 ? 315 CYS C CB  1 
ATOM 8403  S SG  . CYS C 1 320 ? 66.614   147.202 14.295  1.00 0.00 ? 315 CYS C SG  1 
ATOM 8404  N N   . THR C 1 321 ? 69.761   146.462 15.774  1.00 0.00 ? 316 THR C N   1 
ATOM 8405  C CA  . THR C 1 321 ? 71.118   146.542 15.126  1.00 0.00 ? 316 THR C CA  1 
ATOM 8406  C C   . THR C 1 321 ? 71.028   146.101 13.619  1.00 0.00 ? 316 THR C C   1 
ATOM 8407  O O   . THR C 1 321 ? 70.245   145.233 13.304  1.00 0.00 ? 316 THR C O   1 
ATOM 8408  C CB  . THR C 1 321 ? 72.286   145.885 15.848  1.00 0.00 ? 316 THR C CB  1 
ATOM 8409  O OG1 . THR C 1 321 ? 73.534   146.386 15.425  1.00 0.00 ? 316 THR C OG1 1 
ATOM 8410  C CG2 . THR C 1 321 ? 72.233   144.341 15.576  1.00 0.00 ? 316 THR C CG2 1 
ATOM 8411  N N   . VAL C 1 322 ? 71.846   146.752 12.743  1.00 0.00 ? 317 VAL C N   1 
ATOM 8412  C CA  . VAL C 1 322 ? 71.914   146.539 11.278  1.00 0.00 ? 317 VAL C CA  1 
ATOM 8413  C C   . VAL C 1 322 ? 73.094   145.619 10.978  1.00 0.00 ? 317 VAL C C   1 
ATOM 8414  O O   . VAL C 1 322 ? 74.153   145.788 11.594  1.00 0.00 ? 317 VAL C O   1 
ATOM 8415  C CB  . VAL C 1 322 ? 71.902   147.798 10.411  1.00 0.00 ? 317 VAL C CB  1 
ATOM 8416  C CG1 . VAL C 1 322 ? 71.630   147.493 8.984   1.00 0.00 ? 317 VAL C CG1 1 
ATOM 8417  C CG2 . VAL C 1 322 ? 70.760   148.703 11.006  1.00 0.00 ? 317 VAL C CG2 1 
ATOM 8418  N N   . LYS C 1 323 ? 72.888   144.721 10.034  1.00 0.00 ? 318 LYS C N   1 
ATOM 8419  C CA  . LYS C 1 323 ? 73.924   143.786 9.616   1.00 0.00 ? 318 LYS C CA  1 
ATOM 8420  C C   . LYS C 1 323 ? 74.146   143.992 8.168   1.00 0.00 ? 318 LYS C C   1 
ATOM 8421  O O   . LYS C 1 323 ? 73.226   143.974 7.325   1.00 0.00 ? 318 LYS C O   1 
ATOM 8422  C CB  . LYS C 1 323 ? 73.402   142.282 9.848   1.00 0.00 ? 318 LYS C CB  1 
ATOM 8423  C CG  . LYS C 1 323 ? 73.260   141.722 11.261  1.00 0.00 ? 318 LYS C CG  1 
ATOM 8424  C CD  . LYS C 1 323 ? 72.286   140.570 11.462  1.00 0.00 ? 318 LYS C CD  1 
ATOM 8425  C CE  . LYS C 1 323 ? 72.789   139.162 10.998  1.00 0.00 ? 318 LYS C CE  1 
ATOM 8426  N NZ  . LYS C 1 323 ? 71.757   138.134 11.387  1.00 0.00 ? 318 LYS C NZ  1 
ATOM 8427  N N   . LEU C 1 324 ? 75.351   144.354 7.887   1.00 0.00 ? 319 LEU C N   1 
ATOM 8428  C CA  . LEU C 1 324 ? 75.679   144.496 6.485   1.00 0.00 ? 319 LEU C CA  1 
ATOM 8429  C C   . LEU C 1 324 ? 76.128   143.037 6.093   1.00 0.00 ? 319 LEU C C   1 
ATOM 8430  O O   . LEU C 1 324 ? 77.204   142.536 6.492   1.00 0.00 ? 319 LEU C O   1 
ATOM 8431  C CB  . LEU C 1 324 ? 76.770   145.514 6.218   1.00 0.00 ? 319 LEU C CB  1 
ATOM 8432  C CG  . LEU C 1 324 ? 77.182   145.754 4.750   1.00 0.00 ? 319 LEU C CG  1 
ATOM 8433  C CD1 . LEU C 1 324 ? 75.985   145.768 3.728   1.00 0.00 ? 319 LEU C CD1 1 
ATOM 8434  C CD2 . LEU C 1 324 ? 78.011   147.046 4.543   1.00 0.00 ? 319 LEU C CD2 1 
ATOM 8435  N N   . CYS C 1 325 ? 75.258   142.328 5.374   1.00 0.00 ? 320 CYS C N   1 
ATOM 8436  C CA  . CYS C 1 325 ? 75.475   140.925 5.074   1.00 0.00 ? 320 CYS C CA  1 
ATOM 8437  C C   . CYS C 1 325 ? 76.781   140.741 4.330   1.00 0.00 ? 320 CYS C C   1 
ATOM 8438  O O   . CYS C 1 325 ? 77.031   141.487 3.352   1.00 0.00 ? 320 CYS C O   1 
ATOM 8439  C CB  . CYS C 1 325 ? 74.310   140.429 4.279   1.00 0.00 ? 320 CYS C CB  1 
ATOM 8440  S SG  . CYS C 1 325 ? 72.651   140.893 5.063   1.00 0.00 ? 320 CYS C SG  1 
ATOM 8441  N N   . PRO C 1 326 ? 77.698   139.778 4.569   1.00 0.00 ? 321 PRO C N   1 
ATOM 8442  C CA  . PRO C 1 326 ? 78.766   139.423 3.717   1.00 0.00 ? 321 PRO C CA  1 
ATOM 8443  C C   . PRO C 1 326 ? 78.279   138.407 2.749   1.00 0.00 ? 321 PRO C C   1 
ATOM 8444  O O   . PRO C 1 326 ? 78.746   138.300 1.621   1.00 0.00 ? 321 PRO C O   1 
ATOM 8445  C CB  . PRO C 1 326 ? 79.917   139.084 4.633   1.00 0.00 ? 321 PRO C CB  1 
ATOM 8446  C CG  . PRO C 1 326 ? 79.320   138.622 5.904   1.00 0.00 ? 321 PRO C CG  1 
ATOM 8447  C CD  . PRO C 1 326 ? 78.066   139.506 5.994   1.00 0.00 ? 321 PRO C CD  1 
ATOM 8448  N N   . ASP C 1 327 ? 77.357   137.527 3.260   1.00 0.00 ? 322 ASP C N   1 
ATOM 8449  C CA  . ASP C 1 327 ? 76.802   136.424 2.454   1.00 0.00 ? 322 ASP C CA  1 
ATOM 8450  C C   . ASP C 1 327 ? 75.302   136.624 2.394   1.00 0.00 ? 322 ASP C C   1 
ATOM 8451  O O   . ASP C 1 327 ? 74.591   136.706 3.397   1.00 0.00 ? 322 ASP C O   1 
ATOM 8452  C CB  . ASP C 1 327 ? 76.968   135.125 3.163   1.00 0.00 ? 322 ASP C CB  1 
ATOM 8453  C CG  . ASP C 1 327 ? 78.426   134.681 3.239   1.00 0.00 ? 322 ASP C CG  1 
ATOM 8454  O OD1 . ASP C 1 327 ? 79.161   134.732 2.197   1.00 0.00 ? 322 ASP C OD1 1 
ATOM 8455  O OD2 . ASP C 1 327 ? 78.836   134.262 4.377   1.00 0.00 ? 322 ASP C OD2 1 
ATOM 8456  N N   . SER C 1 328 ? 74.811   136.801 1.141   1.00 0.00 ? 323 SER C N   1 
ATOM 8457  C CA  . SER C 1 328 ? 73.451   137.147 0.759   1.00 0.00 ? 323 SER C CA  1 
ATOM 8458  C C   . SER C 1 328 ? 73.322   136.608 -0.669  1.00 0.00 ? 323 SER C C   1 
ATOM 8459  O O   . SER C 1 328 ? 74.308   136.578 -1.489  1.00 0.00 ? 323 SER C O   1 
ATOM 8460  C CB  . SER C 1 328 ? 73.037   138.578 0.954   1.00 0.00 ? 323 SER C CB  1 
ATOM 8461  O OG  . SER C 1 328 ? 73.836   139.482 0.161   1.00 0.00 ? 323 SER C OG  1 
ATOM 8462  N N   . GLU C 1 329 ? 72.201   136.063 -1.003  1.00 0.00 ? 324 GLU C N   1 
ATOM 8463  C CA  . GLU C 1 329 ? 71.885   135.498 -2.357  1.00 0.00 ? 324 GLU C CA  1 
ATOM 8464  C C   . GLU C 1 329 ? 72.077   136.555 -3.463  1.00 0.00 ? 324 GLU C C   1 
ATOM 8465  O O   . GLU C 1 329 ? 72.656   136.439 -4.556  1.00 0.00 ? 324 GLU C O   1 
ATOM 8466  C CB  . GLU C 1 329 ? 70.397   134.967 -2.228  1.00 0.00 ? 324 GLU C CB  1 
ATOM 8467  C CG  . GLU C 1 329 ? 70.179   133.755 -1.216  1.00 0.00 ? 324 GLU C CG  1 
ATOM 8468  C CD  . GLU C 1 329 ? 68.766   133.813 -0.693  1.00 0.00 ? 324 GLU C CD  1 
ATOM 8469  O OE1 . GLU C 1 329 ? 67.800   133.806 -1.474  1.00 0.00 ? 324 GLU C OE1 1 
ATOM 8470  O OE2 . GLU C 1 329 ? 68.543   133.901 0.529   1.00 0.00 ? 324 GLU C OE2 1 
ATOM 8471  N N   . ARG C 1 330 ? 71.579   137.758 -3.166  1.00 0.00 ? 325 ARG C N   1 
ATOM 8472  C CA  . ARG C 1 330 ? 71.672   138.881 -3.999  1.00 0.00 ? 325 ARG C CA  1 
ATOM 8473  C C   . ARG C 1 330 ? 72.742   139.987 -3.532  1.00 0.00 ? 325 ARG C C   1 
ATOM 8474  O O   . ARG C 1 330 ? 72.892   140.158 -2.328  1.00 0.00 ? 325 ARG C O   1 
ATOM 8475  C CB  . ARG C 1 330 ? 70.263   139.520 -4.092  1.00 0.00 ? 325 ARG C CB  1 
ATOM 8476  C CG  . ARG C 1 330 ? 69.238   138.732 -4.891  1.00 0.00 ? 325 ARG C CG  1 
ATOM 8477  C CD  . ARG C 1 330 ? 67.843   139.293 -4.603  1.00 0.00 ? 325 ARG C CD  1 
ATOM 8478  N NE  . ARG C 1 330 ? 66.821   138.762 -5.561  1.00 0.00 ? 325 ARG C NE  1 
ATOM 8479  C CZ  . ARG C 1 330 ? 65.687   139.377 -5.929  1.00 0.00 ? 325 ARG C CZ  1 
ATOM 8480  N NH1 . ARG C 1 330 ? 65.347   140.542 -5.423  1.00 0.00 ? 325 ARG C NH1 1 
ATOM 8481  N NH2 . ARG C 1 330 ? 64.875   138.784 -6.864  1.00 0.00 ? 325 ARG C NH2 1 
ATOM 8482  N N   . ARG C 1 331 ? 73.379   140.664 -4.496  1.00 0.00 ? 326 ARG C N   1 
ATOM 8483  C CA  . ARG C 1 331 ? 74.063   141.895 -4.200  1.00 0.00 ? 326 ARG C CA  1 
ATOM 8484  C C   . ARG C 1 331 ? 73.198   143.041 -3.553  1.00 0.00 ? 326 ARG C C   1 
ATOM 8485  O O   . ARG C 1 331 ? 71.960   143.192 -3.755  1.00 0.00 ? 326 ARG C O   1 
ATOM 8486  C CB  . ARG C 1 331 ? 74.846   142.351 -5.496  1.00 0.00 ? 326 ARG C CB  1 
ATOM 8487  C CG  . ARG C 1 331 ? 73.939   143.135 -6.518  1.00 0.00 ? 326 ARG C CG  1 
ATOM 8488  C CD  . ARG C 1 331 ? 74.606   143.719 -7.742  1.00 0.00 ? 326 ARG C CD  1 
ATOM 8489  N NE  . ARG C 1 331 ? 73.490   144.163 -8.733  1.00 0.00 ? 326 ARG C NE  1 
ATOM 8490  C CZ  . ARG C 1 331 ? 73.578   145.044 -9.721  1.00 0.00 ? 326 ARG C CZ  1 
ATOM 8491  N NH1 . ARG C 1 331 ? 74.699   145.624 -10.119 1.00 0.00 ? 326 ARG C NH1 1 
ATOM 8492  N NH2 . ARG C 1 331 ? 72.376   145.441 -10.213 1.00 0.00 ? 326 ARG C NH2 1 
ATOM 8493  N N   . PHE C 1 332 ? 73.895   143.812 -2.689  1.00 0.00 ? 327 PHE C N   1 
ATOM 8494  C CA  . PHE C 1 332 ? 73.296   145.042 -2.105  1.00 0.00 ? 327 PHE C CA  1 
ATOM 8495  C C   . PHE C 1 332 ? 72.118   144.702 -1.174  1.00 0.00 ? 327 PHE C C   1 
ATOM 8496  O O   . PHE C 1 332 ? 71.106   145.382 -1.144  1.00 0.00 ? 327 PHE C O   1 
ATOM 8497  C CB  . PHE C 1 332 ? 72.926   146.165 -3.187  1.00 0.00 ? 327 PHE C CB  1 
ATOM 8498  C CG  . PHE C 1 332 ? 74.067   146.410 -4.142  1.00 0.00 ? 327 PHE C CG  1 
ATOM 8499  C CD1 . PHE C 1 332 ? 75.371   146.565 -3.658  1.00 0.00 ? 327 PHE C CD1 1 
ATOM 8500  C CD2 . PHE C 1 332 ? 73.849   146.520 -5.601  1.00 0.00 ? 327 PHE C CD2 1 
ATOM 8501  C CE1 . PHE C 1 332 ? 76.429   146.928 -4.527  1.00 0.00 ? 327 PHE C CE1 1 
ATOM 8502  C CE2 . PHE C 1 332 ? 74.858   146.910 -6.436  1.00 0.00 ? 327 PHE C CE2 1 
ATOM 8503  C CZ  . PHE C 1 332 ? 76.167   147.060 -5.882  1.00 0.00 ? 327 PHE C CZ  1 
ATOM 8504  N N   . CYS C 1 333 ? 72.376   143.800 -0.269  1.00 0.00 ? 328 CYS C N   1 
ATOM 8505  C CA  . CYS C 1 333 ? 71.366   143.408 0.697   1.00 0.00 ? 328 CYS C CA  1 
ATOM 8506  C C   . CYS C 1 333 ? 71.833   143.669 2.128   1.00 0.00 ? 328 CYS C C   1 
ATOM 8507  O O   . CYS C 1 333 ? 73.019   143.591 2.469   1.00 0.00 ? 328 CYS C O   1 
ATOM 8508  C CB  . CYS C 1 333 ? 70.996   141.867 0.519   1.00 0.00 ? 328 CYS C CB  1 
ATOM 8509  S SG  . CYS C 1 333 ? 70.167   141.528 -1.104  1.00 0.00 ? 328 CYS C SG  1 
ATOM 8510  N N   . PHE C 1 334 ? 70.903   144.114 3.042   1.00 0.00 ? 329 PHE C N   1 
ATOM 8511  C CA  . PHE C 1 334 ? 71.283   144.321 4.445   1.00 0.00 ? 329 PHE C CA  1 
ATOM 8512  C C   . PHE C 1 334 ? 70.122   143.849 5.354   1.00 0.00 ? 329 PHE C C   1 
ATOM 8513  O O   . PHE C 1 334 ? 68.995   143.587 4.914   1.00 0.00 ? 329 PHE C O   1 
ATOM 8514  C CB  . PHE C 1 334 ? 71.725   145.812 4.707   1.00 0.00 ? 329 PHE C CB  1 
ATOM 8515  C CG  . PHE C 1 334 ? 70.626   146.851 4.351   1.00 0.00 ? 329 PHE C CG  1 
ATOM 8516  C CD1 . PHE C 1 334 ? 70.296   147.149 3.003   1.00 0.00 ? 329 PHE C CD1 1 
ATOM 8517  C CD2 . PHE C 1 334 ? 70.033   147.606 5.409   1.00 0.00 ? 329 PHE C CD2 1 
ATOM 8518  C CE1 . PHE C 1 334 ? 69.349   148.124 2.724   1.00 0.00 ? 329 PHE C CE1 1 
ATOM 8519  C CE2 . PHE C 1 334 ? 69.075   148.599 5.143   1.00 0.00 ? 329 PHE C CE2 1 
ATOM 8520  C CZ  . PHE C 1 334 ? 68.743   148.803 3.850   1.00 0.00 ? 329 PHE C CZ  1 
ATOM 8521  N N   . GLU C 1 335 ? 70.456   143.648 6.632   1.00 0.00 ? 330 GLU C N   1 
ATOM 8522  C CA  . GLU C 1 335 ? 69.486   142.919 7.430   1.00 0.00 ? 330 GLU C CA  1 
ATOM 8523  C C   . GLU C 1 335 ? 69.259   143.700 8.722   1.00 0.00 ? 330 GLU C C   1 
ATOM 8524  O O   . GLU C 1 335 ? 70.145   144.388 9.212   1.00 0.00 ? 330 GLU C O   1 
ATOM 8525  C CB  . GLU C 1 335 ? 70.081   141.481 7.687   1.00 0.00 ? 330 GLU C CB  1 
ATOM 8526  C CG  . GLU C 1 335 ? 69.148   140.530 8.499   1.00 0.00 ? 330 GLU C CG  1 
ATOM 8527  C CD  . GLU C 1 335 ? 69.402   139.046 8.630   1.00 0.00 ? 330 GLU C CD  1 
ATOM 8528  O OE1 . GLU C 1 335 ? 69.100   138.425 7.599   1.00 0.00 ? 330 GLU C OE1 1 
ATOM 8529  O OE2 . GLU C 1 335 ? 69.971   138.504 9.613   1.00 0.00 ? 330 GLU C OE2 1 
ATOM 8530  N N   . VAL C 1 336 ? 68.099   143.772 9.301   1.00 0.00 ? 331 VAL C N   1 
ATOM 8531  C CA  . VAL C 1 336 ? 67.698   144.641 10.366  1.00 0.00 ? 331 VAL C CA  1 
ATOM 8532  C C   . VAL C 1 336 ? 66.963   143.820 11.413  1.00 0.00 ? 331 VAL C C   1 
ATOM 8533  O O   . VAL C 1 336 ? 65.927   143.192 11.180  1.00 0.00 ? 331 VAL C O   1 
ATOM 8534  C CB  . VAL C 1 336 ? 66.803   145.775 9.770   1.00 0.00 ? 331 VAL C CB  1 
ATOM 8535  C CG1 . VAL C 1 336 ? 66.508   146.803 10.862  1.00 0.00 ? 331 VAL C CG1 1 
ATOM 8536  C CG2 . VAL C 1 336 ? 67.474   146.482 8.589   1.00 0.00 ? 331 VAL C CG2 1 
ATOM 8537  N N   . VAL C 1 337 ? 67.672   143.688 12.586  1.00 0.00 ? 332 VAL C N   1 
ATOM 8538  C CA  . VAL C 1 337 ? 67.352   142.794 13.654  1.00 0.00 ? 332 VAL C CA  1 
ATOM 8539  C C   . VAL C 1 337 ? 66.964   143.353 15.052  1.00 0.00 ? 332 VAL C C   1 
ATOM 8540  O O   . VAL C 1 337 ? 67.538   144.285 15.517  1.00 0.00 ? 332 VAL C O   1 
ATOM 8541  C CB  . VAL C 1 337 ? 68.333   141.541 13.784  1.00 0.00 ? 332 VAL C CB  1 
ATOM 8542  C CG1 . VAL C 1 337 ? 68.465   140.804 12.410  1.00 0.00 ? 332 VAL C CG1 1 
ATOM 8543  C CG2 . VAL C 1 337 ? 69.685   142.010 14.285  1.00 0.00 ? 332 VAL C CG2 1 
ATOM 8544  N N   . SER C 1 338 ? 65.876   142.832 15.642  1.00 0.00 ? 333 SER C N   1 
ATOM 8545  C CA  . SER C 1 338 ? 65.122   143.539 16.796  1.00 0.00 ? 333 SER C CA  1 
ATOM 8546  C C   . SER C 1 338 ? 64.411   142.425 17.539  1.00 0.00 ? 333 SER C C   1 
ATOM 8547  O O   . SER C 1 338 ? 64.751   141.264 17.258  1.00 0.00 ? 333 SER C O   1 
ATOM 8548  C CB  . SER C 1 338 ? 64.132   144.604 16.245  1.00 0.00 ? 333 SER C CB  1 
ATOM 8549  O OG  . SER C 1 338 ? 63.628   145.633 17.136  1.00 0.00 ? 333 SER C OG  1 
ATOM 8550  N N   . THR C 1 339 ? 63.683   142.842 18.550  1.00 0.00 ? 334 THR C N   1 
ATOM 8551  C CA  . THR C 1 339 ? 62.893   141.928 19.389  1.00 0.00 ? 334 THR C CA  1 
ATOM 8552  C C   . THR C 1 339 ? 61.801   141.132 18.653  1.00 0.00 ? 334 THR C C   1 
ATOM 8553  O O   . THR C 1 339 ? 61.640   139.972 19.018  1.00 0.00 ? 334 THR C O   1 
ATOM 8554  C CB  . THR C 1 339 ? 62.315   142.546 20.709  1.00 0.00 ? 334 THR C CB  1 
ATOM 8555  O OG1 . THR C 1 339 ? 61.787   143.912 20.524  1.00 0.00 ? 334 THR C OG1 1 
ATOM 8556  C CG2 . THR C 1 339 ? 63.478   142.527 21.724  1.00 0.00 ? 334 THR C CG2 1 
ATOM 8557  N N   . SER C 1 340 ? 61.197   141.737 17.653  1.00 0.00 ? 335 SER C N   1 
ATOM 8558  C CA  . SER C 1 340 ? 60.313   141.031 16.766  1.00 0.00 ? 335 SER C CA  1 
ATOM 8559  C C   . SER C 1 340 ? 60.144   141.965 15.545  1.00 0.00 ? 335 SER C C   1 
ATOM 8560  O O   . SER C 1 340 ? 60.522   143.169 15.638  1.00 0.00 ? 335 SER C O   1 
ATOM 8561  C CB  . SER C 1 340 ? 58.919   140.664 17.414  1.00 0.00 ? 335 SER C CB  1 
ATOM 8562  O OG  . SER C 1 340 ? 58.210   139.701 16.574  1.00 0.00 ? 335 SER C OG  1 
ATOM 8563  N N   . LYS C 1 341 ? 59.737   141.393 14.412  1.00 0.00 ? 336 LYS C N   1 
ATOM 8564  C CA  . LYS C 1 341 ? 59.708   142.011 13.082  1.00 0.00 ? 336 LYS C CA  1 
ATOM 8565  C C   . LYS C 1 341 ? 61.003   142.148 12.293  1.00 0.00 ? 336 LYS C C   1 
ATOM 8566  O O   . LYS C 1 341 ? 61.131   142.884 11.283  1.00 0.00 ? 336 LYS C O   1 
ATOM 8567  C CB  . LYS C 1 341 ? 59.035   143.380 13.025  1.00 0.00 ? 336 LYS C CB  1 
ATOM 8568  C CG  . LYS C 1 341 ? 57.599   143.423 13.557  1.00 0.00 ? 336 LYS C CG  1 
ATOM 8569  C CD  . LYS C 1 341 ? 56.995   144.847 13.691  1.00 0.00 ? 336 LYS C CD  1 
ATOM 8570  C CE  . LYS C 1 341 ? 55.484   144.966 13.936  1.00 0.00 ? 336 LYS C CE  1 
ATOM 8571  N NZ  . LYS C 1 341 ? 55.171   144.586 15.359  1.00 0.00 ? 336 LYS C NZ  1 
ATOM 8572  N N   . SER C 1 342 ? 62.064   141.394 12.690  1.00 0.00 ? 337 SER C N   1 
ATOM 8573  C CA  . SER C 1 342 ? 63.359   141.355 12.027  1.00 0.00 ? 337 SER C CA  1 
ATOM 8574  C C   . SER C 1 342 ? 63.217   140.938 10.532  1.00 0.00 ? 337 SER C C   1 
ATOM 8575  O O   . SER C 1 342 ? 62.309   140.177 10.158  1.00 0.00 ? 337 SER C O   1 
ATOM 8576  C CB  . SER C 1 342 ? 64.298   140.413 12.686  1.00 0.00 ? 337 SER C CB  1 
ATOM 8577  O OG  . SER C 1 342 ? 64.314   140.710 14.098  1.00 0.00 ? 337 SER C OG  1 
ATOM 8578  N N   . CYS C 1 343 ? 64.087   141.481 9.699   1.00 0.00 ? 338 CYS C N   1 
ATOM 8579  C CA  . CYS C 1 343 ? 63.787   141.443 8.221   1.00 0.00 ? 338 CYS C CA  1 
ATOM 8580  C C   . CYS C 1 343 ? 65.068   141.706 7.386   1.00 0.00 ? 338 CYS C C   1 
ATOM 8581  O O   . CYS C 1 343 ? 66.115   142.075 7.905   1.00 0.00 ? 338 CYS C O   1 
ATOM 8582  C CB  . CYS C 1 343 ? 62.647   142.377 7.804   1.00 0.00 ? 338 CYS C CB  1 
ATOM 8583  S SG  . CYS C 1 343 ? 63.016   144.136 8.467   1.00 0.00 ? 338 CYS C SG  1 
ATOM 8584  N N   . LEU C 1 344 ? 64.968   141.469 6.070   1.00 0.00 ? 339 LEU C N   1 
ATOM 8585  C CA  . LEU C 1 344 ? 66.065   141.521 5.122   1.00 0.00 ? 339 LEU C CA  1 
ATOM 8586  C C   . LEU C 1 344 ? 65.615   142.651 4.157   1.00 0.00 ? 339 LEU C C   1 
ATOM 8587  O O   . LEU C 1 344 ? 64.490   142.768 3.703   1.00 0.00 ? 339 LEU C O   1 
ATOM 8588  C CB  . LEU C 1 344 ? 66.384   140.231 4.442   1.00 0.00 ? 339 LEU C CB  1 
ATOM 8589  C CG  . LEU C 1 344 ? 67.504   140.246 3.243   1.00 0.00 ? 339 LEU C CG  1 
ATOM 8590  C CD1 . LEU C 1 344 ? 68.881   140.256 3.858   1.00 0.00 ? 339 LEU C CD1 1 
ATOM 8591  C CD2 . LEU C 1 344 ? 67.251   138.911 2.469   1.00 0.00 ? 339 LEU C CD2 1 
ATOM 8592  N N   . LEU C 1 345 ? 66.532   143.490 3.759   1.00 0.00 ? 340 LEU C N   1 
ATOM 8593  C CA  . LEU C 1 345 ? 66.311   144.619 2.839   1.00 0.00 ? 340 LEU C CA  1 
ATOM 8594  C C   . LEU C 1 345 ? 67.329   144.610 1.596   1.00 0.00 ? 340 LEU C C   1 
ATOM 8595  O O   . LEU C 1 345 ? 68.459   144.114 1.696   1.00 0.00 ? 340 LEU C O   1 
ATOM 8596  C CB  . LEU C 1 345 ? 66.251   146.054 3.506   1.00 0.00 ? 340 LEU C CB  1 
ATOM 8597  C CG  . LEU C 1 345 ? 65.360   146.083 4.756   1.00 0.00 ? 340 LEU C CG  1 
ATOM 8598  C CD1 . LEU C 1 345 ? 65.815   147.266 5.692   1.00 0.00 ? 340 LEU C CD1 1 
ATOM 8599  C CD2 . LEU C 1 345 ? 63.837   146.314 4.517   1.00 0.00 ? 340 LEU C CD2 1 
ATOM 8600  N N   . GLN C 1 346 ? 66.989   145.138 0.444   1.00 0.00 ? 341 GLN C N   1 
ATOM 8601  C CA  . GLN C 1 346 ? 67.874   145.360 -0.713  1.00 0.00 ? 341 GLN C CA  1 
ATOM 8602  C C   . GLN C 1 346 ? 67.627   146.680 -1.374  1.00 0.00 ? 341 GLN C C   1 
ATOM 8603  O O   . GLN C 1 346 ? 66.507   147.189 -1.554  1.00 0.00 ? 341 GLN C O   1 
ATOM 8604  C CB  . GLN C 1 346 ? 67.666   144.194 -1.715  1.00 0.00 ? 341 GLN C CB  1 
ATOM 8605  C CG  . GLN C 1 346 ? 68.196   144.516 -3.116  1.00 0.00 ? 341 GLN C CG  1 
ATOM 8606  C CD  . GLN C 1 346 ? 68.102   143.229 -3.927  1.00 0.00 ? 341 GLN C CD  1 
ATOM 8607  O OE1 . GLN C 1 346 ? 67.022   142.542 -4.050  1.00 0.00 ? 341 GLN C OE1 1 
ATOM 8608  N NE2 . GLN C 1 346 ? 69.325   142.825 -4.430  1.00 0.00 ? 341 GLN C NE2 1 
ATOM 8609  N N   . ALA C 1 347 ? 68.691   147.390 -1.767  1.00 0.00 ? 342 ALA C N   1 
ATOM 8610  C CA  . ALA C 1 347 ? 68.689   148.652 -2.355  1.00 0.00 ? 342 ALA C CA  1 
ATOM 8611  C C   . ALA C 1 347 ? 69.207   148.513 -3.792  1.00 0.00 ? 342 ALA C C   1 
ATOM 8612  O O   . ALA C 1 347 ? 69.941   147.652 -4.171  1.00 0.00 ? 342 ALA C O   1 
ATOM 8613  C CB  . ALA C 1 347 ? 69.745   149.571 -1.614  1.00 0.00 ? 342 ALA C CB  1 
ATOM 8614  N N   . ASP C 1 348 ? 68.882   149.561 -4.565  1.00 0.00 ? 343 ASP C N   1 
ATOM 8615  C CA  . ASP C 1 348 ? 68.992   149.553 -6.103  1.00 0.00 ? 343 ASP C CA  1 
ATOM 8616  C C   . ASP C 1 348 ? 70.384   149.826 -6.713  1.00 0.00 ? 343 ASP C C   1 
ATOM 8617  O O   . ASP C 1 348 ? 70.729   149.577 -7.868  1.00 0.00 ? 343 ASP C O   1 
ATOM 8618  C CB  . ASP C 1 348 ? 67.989   150.504 -6.833  1.00 0.00 ? 343 ASP C CB  1 
ATOM 8619  C CG  . ASP C 1 348 ? 66.555   150.266 -6.410  1.00 0.00 ? 343 ASP C CG  1 
ATOM 8620  O OD1 . ASP C 1 348 ? 66.048   149.088 -6.441  1.00 0.00 ? 343 ASP C OD1 1 
ATOM 8621  O OD2 . ASP C 1 348 ? 65.935   151.178 -5.876  1.00 0.00 ? 343 ASP C OD2 1 
ATOM 8622  N N   . SER C 1 349 ? 71.372   150.342 -5.942  1.00 0.00 ? 344 SER C N   1 
ATOM 8623  C CA  . SER C 1 349 ? 72.639   150.709 -6.509  1.00 0.00 ? 344 SER C CA  1 
ATOM 8624  C C   . SER C 1 349 ? 73.543   150.984 -5.317  1.00 0.00 ? 344 SER C C   1 
ATOM 8625  O O   . SER C 1 349 ? 73.084   151.155 -4.182  1.00 0.00 ? 344 SER C O   1 
ATOM 8626  C CB  . SER C 1 349 ? 72.592   152.049 -7.283  1.00 0.00 ? 344 SER C CB  1 
ATOM 8627  O OG  . SER C 1 349 ? 73.852   152.450 -7.879  1.00 0.00 ? 344 SER C OG  1 
ATOM 8628  N N   . GLU C 1 350 ? 74.857   151.073 -5.531  1.00 0.00 ? 345 GLU C N   1 
ATOM 8629  C CA  . GLU C 1 350 ? 75.967   151.083 -4.603  1.00 0.00 ? 345 GLU C CA  1 
ATOM 8630  C C   . GLU C 1 350 ? 75.872   152.223 -3.605  1.00 0.00 ? 345 GLU C C   1 
ATOM 8631  O O   . GLU C 1 350 ? 76.216   152.062 -2.422  1.00 0.00 ? 345 GLU C O   1 
ATOM 8632  C CB  . GLU C 1 350 ? 77.234   151.259 -5.529  1.00 0.00 ? 345 GLU C CB  1 
ATOM 8633  C CG  . GLU C 1 350 ? 78.653   150.951 -4.858  1.00 0.00 ? 345 GLU C CG  1 
ATOM 8634  C CD  . GLU C 1 350 ? 79.819   150.961 -5.835  1.00 0.00 ? 345 GLU C CD  1 
ATOM 8635  O OE1 . GLU C 1 350 ? 79.947   151.880 -6.727  1.00 0.00 ? 345 GLU C OE1 1 
ATOM 8636  O OE2 . GLU C 1 350 ? 80.743   150.146 -5.603  1.00 0.00 ? 345 GLU C OE2 1 
ATOM 8637  N N   . ARG C 1 351 ? 75.439   153.463 -3.985  1.00 0.00 ? 346 ARG C N   1 
ATOM 8638  C CA  . ARG C 1 351 ? 75.372   154.594 -3.099  1.00 0.00 ? 346 ARG C CA  1 
ATOM 8639  C C   . ARG C 1 351 ? 74.039   154.588 -2.290  1.00 0.00 ? 346 ARG C C   1 
ATOM 8640  O O   . ARG C 1 351 ? 74.082   154.888 -1.114  1.00 0.00 ? 346 ARG C O   1 
ATOM 8641  C CB  . ARG C 1 351 ? 75.446   155.920 -3.906  1.00 0.00 ? 346 ARG C CB  1 
ATOM 8642  C CG  . ARG C 1 351 ? 75.273   157.224 -3.104  1.00 0.00 ? 346 ARG C CG  1 
ATOM 8643  C CD  . ARG C 1 351 ? 76.065   157.435 -1.825  1.00 0.00 ? 346 ARG C CD  1 
ATOM 8644  N NE  . ARG C 1 351 ? 75.469   158.680 -1.187  1.00 0.00 ? 346 ARG C NE  1 
ATOM 8645  C CZ  . ARG C 1 351 ? 75.727   159.282 0.000   1.00 0.00 ? 346 ARG C CZ  1 
ATOM 8646  N NH1 . ARG C 1 351 ? 76.488   158.702 0.921   1.00 0.00 ? 346 ARG C NH1 1 
ATOM 8647  N NH2 . ARG C 1 351 ? 75.308   160.556 0.239   1.00 0.00 ? 346 ARG C NH2 1 
ATOM 8648  N N   . LEU C 1 352 ? 72.938   154.101 -2.844  1.00 0.00 ? 347 LEU C N   1 
ATOM 8649  C CA  . LEU C 1 352 ? 71.768   153.896 -2.094  1.00 0.00 ? 347 LEU C CA  1 
ATOM 8650  C C   . LEU C 1 352 ? 71.888   152.819 -1.022  1.00 0.00 ? 347 LEU C C   1 
ATOM 8651  O O   . LEU C 1 352 ? 71.521   153.132 0.111   1.00 0.00 ? 347 LEU C O   1 
ATOM 8652  C CB  . LEU C 1 352 ? 70.576   153.598 -3.034  1.00 0.00 ? 347 LEU C CB  1 
ATOM 8653  C CG  . LEU C 1 352 ? 70.026   154.937 -3.661  1.00 0.00 ? 347 LEU C CG  1 
ATOM 8654  C CD1 . LEU C 1 352 ? 70.552   155.451 -5.030  1.00 0.00 ? 347 LEU C CD1 1 
ATOM 8655  C CD2 . LEU C 1 352 ? 68.484   154.853 -3.855  1.00 0.00 ? 347 LEU C CD2 1 
ATOM 8656  N N   . LEU C 1 353 ? 72.481   151.658 -1.260  1.00 0.00 ? 348 LEU C N   1 
ATOM 8657  C CA  . LEU C 1 353 ? 72.841   150.757 -0.225  1.00 0.00 ? 348 LEU C CA  1 
ATOM 8658  C C   . LEU C 1 353 ? 73.711   151.332 0.893   1.00 0.00 ? 348 LEU C C   1 
ATOM 8659  O O   . LEU C 1 353 ? 73.346   151.195 2.039   1.00 0.00 ? 348 LEU C O   1 
ATOM 8660  C CB  . LEU C 1 353 ? 73.696   149.675 -0.956  1.00 0.00 ? 348 LEU C CB  1 
ATOM 8661  C CG  . LEU C 1 353 ? 74.105   148.367 -0.240  1.00 0.00 ? 348 LEU C CG  1 
ATOM 8662  C CD1 . LEU C 1 353 ? 75.180   148.609 0.815   1.00 0.00 ? 348 LEU C CD1 1 
ATOM 8663  C CD2 . LEU C 1 353 ? 72.976   147.510 0.368   1.00 0.00 ? 348 LEU C CD2 1 
ATOM 8664  N N   . GLN C 1 354 ? 74.781   152.047 0.598   1.00 0.00 ? 349 GLN C N   1 
ATOM 8665  C CA  . GLN C 1 354 ? 75.683   152.565 1.540   1.00 0.00 ? 349 GLN C CA  1 
ATOM 8666  C C   . GLN C 1 354 ? 74.986   153.572 2.442   1.00 0.00 ? 349 GLN C C   1 
ATOM 8667  O O   . GLN C 1 354 ? 75.108   153.534 3.648   1.00 0.00 ? 349 GLN C O   1 
ATOM 8668  C CB  . GLN C 1 354 ? 76.782   153.287 0.693   1.00 0.00 ? 349 GLN C CB  1 
ATOM 8669  C CG  . GLN C 1 354 ? 77.885   153.784 1.609   1.00 0.00 ? 349 GLN C CG  1 
ATOM 8670  C CD  . GLN C 1 354 ? 78.480   155.097 1.099   1.00 0.00 ? 349 GLN C CD  1 
ATOM 8671  O OE1 . GLN C 1 354 ? 77.757   156.082 0.964   1.00 0.00 ? 349 GLN C OE1 1 
ATOM 8672  N NE2 . GLN C 1 354 ? 79.830   155.064 0.749   1.00 0.00 ? 349 GLN C NE2 1 
ATOM 8673  N N   . LEU C 1 355 ? 74.188   154.482 1.808   1.00 0.00 ? 350 LEU C N   1 
ATOM 8674  C CA  . LEU C 1 355 ? 73.476   155.508 2.505   1.00 0.00 ? 350 LEU C CA  1 
ATOM 8675  C C   . LEU C 1 355 ? 72.366   154.972 3.336   1.00 0.00 ? 350 LEU C C   1 
ATOM 8676  O O   . LEU C 1 355 ? 72.268   155.317 4.497   1.00 0.00 ? 350 LEU C O   1 
ATOM 8677  C CB  . LEU C 1 355 ? 72.898   156.494 1.399   1.00 0.00 ? 350 LEU C CB  1 
ATOM 8678  C CG  . LEU C 1 355 ? 71.916   157.658 1.660   1.00 0.00 ? 350 LEU C CG  1 
ATOM 8679  C CD1 . LEU C 1 355 ? 72.433   158.583 2.779   1.00 0.00 ? 350 LEU C CD1 1 
ATOM 8680  C CD2 . LEU C 1 355 ? 71.801   158.480 0.384   1.00 0.00 ? 350 LEU C CD2 1 
ATOM 8681  N N   . TRP C 1 356 ? 71.535   154.045 2.770   1.00 0.00 ? 351 TRP C N   1 
ATOM 8682  C CA  . TRP C 1 356 ? 70.423   153.532 3.464   1.00 0.00 ? 351 TRP C CA  1 
ATOM 8683  C C   . TRP C 1 356 ? 70.847   152.854 4.749   1.00 0.00 ? 351 TRP C C   1 
ATOM 8684  O O   . TRP C 1 356 ? 70.471   153.268 5.885   1.00 0.00 ? 351 TRP C O   1 
ATOM 8685  C CB  . TRP C 1 356 ? 69.571   152.489 2.616   1.00 0.00 ? 351 TRP C CB  1 
ATOM 8686  C CG  . TRP C 1 356 ? 68.388   153.211 1.953   1.00 0.00 ? 351 TRP C CG  1 
ATOM 8687  C CD1 . TRP C 1 356 ? 68.335   153.861 0.765   1.00 0.00 ? 351 TRP C CD1 1 
ATOM 8688  C CD2 . TRP C 1 356 ? 67.151   153.420 2.616   1.00 0.00 ? 351 TRP C CD2 1 
ATOM 8689  N NE1 . TRP C 1 356 ? 67.063   154.400 0.583   1.00 0.00 ? 351 TRP C NE1 1 
ATOM 8690  C CE2 . TRP C 1 356 ? 66.336   154.169 1.728   1.00 0.00 ? 351 TRP C CE2 1 
ATOM 8691  C CE3 . TRP C 1 356 ? 66.844   153.300 3.966   1.00 0.00 ? 351 TRP C CE3 1 
ATOM 8692  C CZ2 . TRP C 1 356 ? 65.093   154.657 2.134   1.00 0.00 ? 351 TRP C CZ2 1 
ATOM 8693  C CZ3 . TRP C 1 356 ? 65.547   153.709 4.342   1.00 0.00 ? 351 TRP C CZ3 1 
ATOM 8694  C CH2 . TRP C 1 356 ? 64.705   154.355 3.437   1.00 0.00 ? 351 TRP C CH2 1 
ATOM 8695  N N   . VAL C 1 357 ? 71.894   151.920 4.700   1.00 0.00 ? 352 VAL C N   1 
ATOM 8696  C CA  . VAL C 1 357 ? 72.524   151.303 5.881   1.00 0.00 ? 352 VAL C CA  1 
ATOM 8697  C C   . VAL C 1 357 ? 73.133   152.405 6.794   1.00 0.00 ? 352 VAL C C   1 
ATOM 8698  O O   . VAL C 1 357 ? 72.948   152.353 8.033   1.00 0.00 ? 352 VAL C O   1 
ATOM 8699  C CB  . VAL C 1 357 ? 73.710   150.371 5.373   1.00 0.00 ? 352 VAL C CB  1 
ATOM 8700  C CG1 . VAL C 1 357 ? 74.427   149.859 6.613   1.00 0.00 ? 352 VAL C CG1 1 
ATOM 8701  C CG2 . VAL C 1 357 ? 73.059   149.142 4.688   1.00 0.00 ? 352 VAL C CG2 1 
ATOM 8702  N N   . SER C 1 358 ? 73.742   153.507 6.241   1.00 0.00 ? 353 SER C N   1 
ATOM 8703  C CA  . SER C 1 358 ? 74.305   154.528 7.097   1.00 0.00 ? 353 SER C CA  1 
ATOM 8704  C C   . SER C 1 358 ? 73.306   155.298 7.911   1.00 0.00 ? 353 SER C C   1 
ATOM 8705  O O   . SER C 1 358 ? 73.420   155.452 9.147   1.00 0.00 ? 353 SER C O   1 
ATOM 8706  C CB  . SER C 1 358 ? 75.198   155.607 6.317   1.00 0.00 ? 353 SER C CB  1 
ATOM 8707  O OG  . SER C 1 358 ? 76.486   154.977 6.046   1.00 0.00 ? 353 SER C OG  1 
ATOM 8708  N N   . ALA C 1 359 ? 72.204   155.768 7.171   1.00 0.00 ? 354 ALA C N   1 
ATOM 8709  C CA  . ALA C 1 359 ? 71.117   156.533 7.702   1.00 0.00 ? 354 ALA C CA  1 
ATOM 8710  C C   . ALA C 1 359 ? 70.349   155.734 8.716   1.00 0.00 ? 354 ALA C C   1 
ATOM 8711  O O   . ALA C 1 359 ? 70.008   156.200 9.818   1.00 0.00 ? 354 ALA C O   1 
ATOM 8712  C CB  . ALA C 1 359 ? 70.235   157.043 6.583   1.00 0.00 ? 354 ALA C CB  1 
ATOM 8713  N N   . VAL C 1 360 ? 70.085   154.497 8.413   1.00 0.00 ? 355 VAL C N   1 
ATOM 8714  C CA  . VAL C 1 360 ? 69.347   153.590 9.337   1.00 0.00 ? 355 VAL C CA  1 
ATOM 8715  C C   . VAL C 1 360 ? 70.202   153.317 10.525  1.00 0.00 ? 355 VAL C C   1 
ATOM 8716  O O   . VAL C 1 360 ? 69.726   153.378 11.657  1.00 0.00 ? 355 VAL C O   1 
ATOM 8717  C CB  . VAL C 1 360 ? 68.624   152.332 8.816   1.00 0.00 ? 355 VAL C CB  1 
ATOM 8718  C CG1 . VAL C 1 360 ? 67.992   151.551 9.970   1.00 0.00 ? 355 VAL C CG1 1 
ATOM 8719  C CG2 . VAL C 1 360 ? 67.666   152.805 7.757   1.00 0.00 ? 355 VAL C CG2 1 
ATOM 8720  N N   . GLN C 1 361 ? 71.549   153.025 10.403  1.00 0.00 ? 356 GLN C N   1 
ATOM 8721  C CA  . GLN C 1 361 ? 72.429   152.918 11.564  1.00 0.00 ? 356 GLN C CA  1 
ATOM 8722  C C   . GLN C 1 361 ? 72.481   154.241 12.354  1.00 0.00 ? 356 GLN C C   1 
ATOM 8723  O O   . GLN C 1 361 ? 72.354   154.233 13.583  1.00 0.00 ? 356 GLN C O   1 
ATOM 8724  C CB  . GLN C 1 361 ? 73.837   152.481 11.302  1.00 0.00 ? 356 GLN C CB  1 
ATOM 8725  C CG  . GLN C 1 361 ? 73.733   151.000 10.796  1.00 0.00 ? 356 GLN C CG  1 
ATOM 8726  C CD  . GLN C 1 361 ? 75.176   150.370 10.582  1.00 0.00 ? 356 GLN C CD  1 
ATOM 8727  O OE1 . GLN C 1 361 ? 75.687   149.579 11.378  1.00 0.00 ? 356 GLN C OE1 1 
ATOM 8728  N NE2 . GLN C 1 361 ? 75.948   150.900 9.597   1.00 0.00 ? 356 GLN C NE2 1 
ATOM 8729  N N   . SER C 1 362 ? 72.561   155.417 11.682  1.00 0.00 ? 357 SER C N   1 
ATOM 8730  C CA  . SER C 1 362 ? 72.438   156.774 12.308  1.00 0.00 ? 357 SER C CA  1 
ATOM 8731  C C   . SER C 1 362 ? 71.137   156.925 13.109  1.00 0.00 ? 357 SER C C   1 
ATOM 8732  O O   . SER C 1 362 ? 71.114   157.299 14.273  1.00 0.00 ? 357 SER C O   1 
ATOM 8733  C CB  . SER C 1 362 ? 72.636   157.925 11.233  1.00 0.00 ? 357 SER C CB  1 
ATOM 8734  O OG  . SER C 1 362 ? 72.640   159.244 11.869  1.00 0.00 ? 357 SER C OG  1 
ATOM 8735  N N   . SER C 1 363 ? 70.003   156.613 12.593  1.00 0.00 ? 358 SER C N   1 
ATOM 8736  C CA  . SER C 1 363 ? 68.691   156.673 13.297  1.00 0.00 ? 358 SER C CA  1 
ATOM 8737  C C   . SER C 1 363 ? 68.600   155.832 14.606  1.00 0.00 ? 358 SER C C   1 
ATOM 8738  O O   . SER C 1 363 ? 68.068   156.273 15.607  1.00 0.00 ? 358 SER C O   1 
ATOM 8739  C CB  . SER C 1 363 ? 67.576   156.130 12.339  1.00 0.00 ? 358 SER C CB  1 
ATOM 8740  O OG  . SER C 1 363 ? 66.267   156.518 12.782  1.00 0.00 ? 358 SER C OG  1 
ATOM 8741  N N   . ILE C 1 364 ? 69.262   154.660 14.634  1.00 0.00 ? 359 ILE C N   1 
ATOM 8742  C CA  . ILE C 1 364 ? 69.497   153.809 15.757  1.00 0.00 ? 359 ILE C CA  1 
ATOM 8743  C C   . ILE C 1 364 ? 70.323   154.528 16.903  1.00 0.00 ? 359 ILE C C   1 
ATOM 8744  O O   . ILE C 1 364 ? 70.002   154.484 18.076  1.00 0.00 ? 359 ILE C O   1 
ATOM 8745  C CB  . ILE C 1 364 ? 70.088   152.386 15.416  1.00 0.00 ? 359 ILE C CB  1 
ATOM 8746  C CG1 . ILE C 1 364 ? 69.039   151.531 14.638  1.00 0.00 ? 359 ILE C CG1 1 
ATOM 8747  C CG2 . ILE C 1 364 ? 70.366   151.671 16.776  1.00 0.00 ? 359 ILE C CG2 1 
ATOM 8748  C CD1 . ILE C 1 364 ? 69.637   150.367 13.997  1.00 0.00 ? 359 ILE C CD1 1 
ATOM 8749  N N   . ALA C 1 365 ? 71.384   155.285 16.484  1.00 0.00 ? 360 ALA C N   1 
ATOM 8750  C CA  . ALA C 1 365 ? 72.104   156.143 17.398  1.00 0.00 ? 360 ALA C CA  1 
ATOM 8751  C C   . ALA C 1 365 ? 71.192   157.238 17.968  1.00 0.00 ? 360 ALA C C   1 
ATOM 8752  O O   . ALA C 1 365 ? 71.273   157.487 19.125  1.00 0.00 ? 360 ALA C O   1 
ATOM 8753  C CB  . ALA C 1 365 ? 73.416   156.777 16.822  1.00 0.00 ? 360 ALA C CB  1 
ATOM 8754  N N   . SER C 1 366 ? 70.380   157.919 17.201  1.00 0.00 ? 361 SER C N   1 
ATOM 8755  C CA  . SER C 1 366 ? 69.449   158.922 17.780  1.00 0.00 ? 361 SER C CA  1 
ATOM 8756  C C   . SER C 1 366 ? 68.531   158.408 18.816  1.00 0.00 ? 361 SER C C   1 
ATOM 8757  O O   . SER C 1 366 ? 68.257   159.002 19.864  1.00 0.00 ? 361 SER C O   1 
ATOM 8758  C CB  . SER C 1 366 ? 68.665   159.517 16.593  1.00 0.00 ? 361 SER C CB  1 
ATOM 8759  O OG  . SER C 1 366 ? 69.634   160.103 15.758  1.00 0.00 ? 361 SER C OG  1 
ATOM 8760  N N   . ALA C 1 367 ? 67.884   157.288 18.392  1.00 0.00 ? 362 ALA C N   1 
ATOM 8761  C CA  . ALA C 1 367 ? 66.896   156.610 19.071  1.00 0.00 ? 362 ALA C CA  1 
ATOM 8762  C C   . ALA C 1 367 ? 67.419   156.130 20.411  1.00 0.00 ? 362 ALA C C   1 
ATOM 8763  O O   . ALA C 1 367 ? 66.766   156.216 21.447  1.00 0.00 ? 362 ALA C O   1 
ATOM 8764  C CB  . ALA C 1 367 ? 66.355   155.570 18.128  1.00 0.00 ? 362 ALA C CB  1 
ATOM 8765  N N   . PHE C 1 368 ? 68.693   155.622 20.349  1.00 0.00 ? 363 PHE C N   1 
ATOM 8766  C CA  . PHE C 1 368 ? 69.458   155.032 21.460  1.00 0.00 ? 363 PHE C CA  1 
ATOM 8767  C C   . PHE C 1 368 ? 70.020   156.066 22.410  1.00 0.00 ? 363 PHE C C   1 
ATOM 8768  O O   . PHE C 1 368 ? 70.263   155.664 23.554  1.00 0.00 ? 363 PHE C O   1 
ATOM 8769  C CB  . PHE C 1 368 ? 70.503   153.978 20.997  1.00 0.00 ? 363 PHE C CB  1 
ATOM 8770  C CG  . PHE C 1 368 ? 71.123   153.295 22.142  1.00 0.00 ? 363 PHE C CG  1 
ATOM 8771  C CD1 . PHE C 1 368 ? 70.429   152.259 22.797  1.00 0.00 ? 363 PHE C CD1 1 
ATOM 8772  C CD2 . PHE C 1 368 ? 72.416   153.612 22.429  1.00 0.00 ? 363 PHE C CD2 1 
ATOM 8773  C CE1 . PHE C 1 368 ? 71.068   151.591 23.846  1.00 0.00 ? 363 PHE C CE1 1 
ATOM 8774  C CE2 . PHE C 1 368 ? 73.122   152.948 23.451  1.00 0.00 ? 363 PHE C CE2 1 
ATOM 8775  C CZ  . PHE C 1 368 ? 72.428   151.922 24.212  1.00 0.00 ? 363 PHE C CZ  1 
ATOM 8776  N N   . SER C 1 369 ? 70.108   157.286 21.900  1.00 0.00 ? 364 SER C N   1 
ATOM 8777  C CA  . SER C 1 369 ? 70.508   158.471 22.674  1.00 0.00 ? 364 SER C CA  1 
ATOM 8778  C C   . SER C 1 369 ? 69.471   158.900 23.703  1.00 0.00 ? 364 SER C C   1 
ATOM 8779  O O   . SER C 1 369 ? 68.704   158.121 24.345  1.00 0.00 ? 364 SER C O   1 
ATOM 8780  C CB  . SER C 1 369 ? 71.051   159.662 21.822  1.00 0.00 ? 364 SER C CB  1 
ATOM 8781  O OG  . SER C 1 369 ? 72.165   159.261 20.978  1.00 0.00 ? 364 SER C OG  1 
ATOM 8782  N N   . GLN C 1 370 ? 69.526   160.156 23.915  1.00 0.00 ? 365 GLN C N   1 
ATOM 8783  N N   . SER D 1 5   ? 45.670   171.998 -4.050  1.00 0.00 ? 0   SER D N   1 
ATOM 8784  C CA  . SER D 1 5   ? 46.257   171.286 -5.244  1.00 0.00 ? 0   SER D CA  1 
ATOM 8785  C C   . SER D 1 5   ? 47.748   171.673 -5.444  1.00 0.00 ? 0   SER D C   1 
ATOM 8786  O O   . SER D 1 5   ? 48.400   172.239 -4.560  1.00 0.00 ? 0   SER D O   1 
ATOM 8787  C CB  . SER D 1 5   ? 45.534   171.593 -6.578  1.00 0.00 ? 0   SER D CB  1 
ATOM 8788  O OG  . SER D 1 5   ? 45.447   170.522 -7.462  1.00 0.00 ? 0   SER D OG  1 
ATOM 8789  N N   . MET D 1 6   ? 48.393   171.367 -6.577  1.00 0.00 ? 1   MET D N   1 
ATOM 8790  C CA  . MET D 1 6   ? 49.868   171.483 -6.757  1.00 0.00 ? 1   MET D CA  1 
ATOM 8791  C C   . MET D 1 6   ? 50.219   172.936 -7.125  1.00 0.00 ? 1   MET D C   1 
ATOM 8792  O O   . MET D 1 6   ? 49.432   173.694 -7.614  1.00 0.00 ? 1   MET D O   1 
ATOM 8793  C CB  . MET D 1 6   ? 50.426   170.554 -7.856  1.00 0.00 ? 1   MET D CB  1 
ATOM 8794  C CG  . MET D 1 6   ? 50.056   170.854 -9.324  1.00 0.00 ? 1   MET D CG  1 
ATOM 8795  S SD  . MET D 1 6   ? 48.307   170.773 -9.740  1.00 0.00 ? 1   MET D SD  1 
ATOM 8796  C CE  . MET D 1 6   ? 48.603   171.378 -11.406 1.00 0.00 ? 1   MET D CE  1 
ATOM 8797  N N   . THR D 1 7   ? 51.559   173.236 -7.027  1.00 0.00 ? 2   THR D N   1 
ATOM 8798  C CA  . THR D 1 7   ? 52.218   174.519 -7.448  1.00 0.00 ? 2   THR D CA  1 
ATOM 8799  C C   . THR D 1 7   ? 52.437   174.662 -8.995  1.00 0.00 ? 2   THR D C   1 
ATOM 8800  O O   . THR D 1 7   ? 52.631   173.730 -9.732  1.00 0.00 ? 2   THR D O   1 
ATOM 8801  C CB  . THR D 1 7   ? 53.428   174.989 -6.579  1.00 0.00 ? 2   THR D CB  1 
ATOM 8802  O OG1 . THR D 1 7   ? 54.484   174.060 -6.630  1.00 0.00 ? 2   THR D OG1 1 
ATOM 8803  C CG2 . THR D 1 7   ? 52.847   175.212 -5.203  1.00 0.00 ? 2   THR D CG2 1 
ATOM 8804  N N   . VAL D 1 8   ? 52.370   175.911 -9.479  1.00 0.00 ? 3   VAL D N   1 
ATOM 8805  C CA  . VAL D 1 8   ? 52.500   176.390 -10.855 1.00 0.00 ? 3   VAL D CA  1 
ATOM 8806  C C   . VAL D 1 8   ? 53.904   176.467 -11.337 1.00 0.00 ? 3   VAL D C   1 
ATOM 8807  O O   . VAL D 1 8   ? 54.904   176.481 -10.569 1.00 0.00 ? 3   VAL D O   1 
ATOM 8808  C CB  . VAL D 1 8   ? 51.998   177.853 -10.897 1.00 0.00 ? 3   VAL D CB  1 
ATOM 8809  C CG1 . VAL D 1 8   ? 50.496   177.937 -10.448 1.00 0.00 ? 3   VAL D CG1 1 
ATOM 8810  C CG2 . VAL D 1 8   ? 52.894   178.642 -9.945  1.00 0.00 ? 3   VAL D CG2 1 
ATOM 8811  N N   . LYS D 1 9   ? 54.044   176.453 -12.691 1.00 0.00 ? 4   LYS D N   1 
ATOM 8812  C CA  . LYS D 1 9   ? 55.339   176.495 -13.414 1.00 0.00 ? 4   LYS D CA  1 
ATOM 8813  C C   . LYS D 1 9   ? 56.361   175.276 -13.170 1.00 0.00 ? 4   LYS D C   1 
ATOM 8814  O O   . LYS D 1 9   ? 57.541   175.420 -13.074 1.00 0.00 ? 4   LYS D O   1 
ATOM 8815  C CB  . LYS D 1 9   ? 55.990   177.892 -13.254 1.00 0.00 ? 4   LYS D CB  1 
ATOM 8816  C CG  . LYS D 1 9   ? 55.118   178.983 -13.899 1.00 0.00 ? 4   LYS D CG  1 
ATOM 8817  C CD  . LYS D 1 9   ? 55.966   180.243 -14.279 1.00 0.00 ? 4   LYS D CD  1 
ATOM 8818  C CE  . LYS D 1 9   ? 55.217   181.503 -14.407 1.00 0.00 ? 4   LYS D CE  1 
ATOM 8819  N NZ  . LYS D 1 9   ? 54.890   181.714 -15.792 1.00 0.00 ? 4   LYS D NZ  1 
ATOM 8820  N N   . LEU D 1 10  ? 55.890   174.063 -13.030 1.00 0.00 ? 5   LEU D N   1 
ATOM 8821  C CA  . LEU D 1 10  ? 56.687   172.818 -12.651 1.00 0.00 ? 5   LEU D CA  1 
ATOM 8822  C C   . LEU D 1 10  ? 57.988   172.640 -13.534 1.00 0.00 ? 5   LEU D C   1 
ATOM 8823  O O   . LEU D 1 10  ? 58.004   172.565 -14.792 1.00 0.00 ? 5   LEU D O   1 
ATOM 8824  C CB  . LEU D 1 10  ? 55.745   171.669 -12.869 1.00 0.00 ? 5   LEU D CB  1 
ATOM 8825  C CG  . LEU D 1 10  ? 56.476   170.287 -12.628 1.00 0.00 ? 5   LEU D CG  1 
ATOM 8826  C CD1 . LEU D 1 10  ? 56.990   170.245 -11.176 1.00 0.00 ? 5   LEU D CD1 1 
ATOM 8827  C CD2 . LEU D 1 10  ? 55.438   169.239 -12.914 1.00 0.00 ? 5   LEU D CD2 1 
ATOM 8828  N N   . ASP D 1 11  ? 59.167   172.739 -12.794 1.00 0.00 ? 6   ASP D N   1 
ATOM 8829  C CA  . ASP D 1 11  ? 60.419   172.853 -13.461 1.00 0.00 ? 6   ASP D CA  1 
ATOM 8830  C C   . ASP D 1 11  ? 61.184   171.536 -13.245 1.00 0.00 ? 6   ASP D C   1 
ATOM 8831  O O   . ASP D 1 11  ? 60.796   170.683 -12.450 1.00 0.00 ? 6   ASP D O   1 
ATOM 8832  C CB  . ASP D 1 11  ? 61.214   174.085 -12.840 1.00 0.00 ? 6   ASP D CB  1 
ATOM 8833  C CG  . ASP D 1 11  ? 62.076   174.632 -13.857 1.00 0.00 ? 6   ASP D CG  1 
ATOM 8834  O OD1 . ASP D 1 11  ? 63.005   173.993 -14.368 1.00 0.00 ? 6   ASP D OD1 1 
ATOM 8835  O OD2 . ASP D 1 11  ? 61.845   175.837 -14.132 1.00 0.00 ? 6   ASP D OD2 1 
ATOM 8836  N N   . PHE D 1 12  ? 62.281   171.325 -14.005 1.00 0.00 ? 7   PHE D N   1 
ATOM 8837  C CA  . PHE D 1 12  ? 62.884   170.104 -14.447 1.00 0.00 ? 7   PHE D CA  1 
ATOM 8838  C C   . PHE D 1 12  ? 63.642   169.456 -13.284 1.00 0.00 ? 7   PHE D C   1 
ATOM 8839  O O   . PHE D 1 12  ? 63.799   168.239 -13.249 1.00 0.00 ? 7   PHE D O   1 
ATOM 8840  C CB  . PHE D 1 12  ? 63.674   170.367 -15.765 1.00 0.00 ? 7   PHE D CB  1 
ATOM 8841  C CG  . PHE D 1 12  ? 62.956   170.842 -17.010 1.00 0.00 ? 7   PHE D CG  1 
ATOM 8842  C CD1 . PHE D 1 12  ? 61.688   170.288 -17.351 1.00 0.00 ? 7   PHE D CD1 1 
ATOM 8843  C CD2 . PHE D 1 12  ? 63.448   171.756 -17.958 1.00 0.00 ? 7   PHE D CD2 1 
ATOM 8844  C CE1 . PHE D 1 12  ? 60.997   170.536 -18.538 1.00 0.00 ? 7   PHE D CE1 1 
ATOM 8845  C CE2 . PHE D 1 12  ? 62.744   172.133 -19.127 1.00 0.00 ? 7   PHE D CE2 1 
ATOM 8846  C CZ  . PHE D 1 12  ? 61.531   171.495 -19.415 1.00 0.00 ? 7   PHE D CZ  1 
ATOM 8847  N N   . GLU D 1 13  ? 64.023   170.186 -12.236 1.00 0.00 ? 8   GLU D N   1 
ATOM 8848  C CA  . GLU D 1 13  ? 64.755   169.618 -11.134 1.00 0.00 ? 8   GLU D CA  1 
ATOM 8849  C C   . GLU D 1 13  ? 64.075   168.465 -10.477 1.00 0.00 ? 8   GLU D C   1 
ATOM 8850  O O   . GLU D 1 13  ? 64.659   167.383 -10.258 1.00 0.00 ? 8   GLU D O   1 
ATOM 8851  C CB  . GLU D 1 13  ? 65.221   170.721 -10.220 1.00 0.00 ? 8   GLU D CB  1 
ATOM 8852  C CG  . GLU D 1 13  ? 66.291   170.461 -9.169  1.00 0.00 ? 8   GLU D CG  1 
ATOM 8853  C CD  . GLU D 1 13  ? 67.651   169.909 -9.710  1.00 0.00 ? 8   GLU D CD  1 
ATOM 8854  O OE1 . GLU D 1 13  ? 68.381   170.716 -10.373 1.00 0.00 ? 8   GLU D OE1 1 
ATOM 8855  O OE2 . GLU D 1 13  ? 68.067   168.703 -9.489  1.00 0.00 ? 8   GLU D OE2 1 
ATOM 8856  N N   . GLU D 1 14  ? 62.780   168.679 -10.142 1.00 0.00 ? 9   GLU D N   1 
ATOM 8857  C CA  . GLU D 1 14  ? 61.960   167.687 -9.489  1.00 0.00 ? 9   GLU D CA  1 
ATOM 8858  C C   . GLU D 1 14  ? 61.601   166.494 -10.303 1.00 0.00 ? 9   GLU D C   1 
ATOM 8859  O O   . GLU D 1 14  ? 61.631   165.339 -9.859  1.00 0.00 ? 9   GLU D O   1 
ATOM 8860  C CB  . GLU D 1 14  ? 60.551   168.323 -9.082  1.00 0.00 ? 9   GLU D CB  1 
ATOM 8861  C CG  . GLU D 1 14  ? 60.599   169.621 -8.276  1.00 0.00 ? 9   GLU D CG  1 
ATOM 8862  C CD  . GLU D 1 14  ? 61.253   169.350 -6.945  1.00 0.00 ? 9   GLU D CD  1 
ATOM 8863  O OE1 . GLU D 1 14  ? 60.730   168.474 -6.190  1.00 0.00 ? 9   GLU D OE1 1 
ATOM 8864  O OE2 . GLU D 1 14  ? 62.185   170.051 -6.561  1.00 0.00 ? 9   GLU D OE2 1 
ATOM 8865  N N   . CYS D 1 15  ? 61.478   166.735 -11.601 1.00 0.00 ? 10  CYS D N   1 
ATOM 8866  C CA  . CYS D 1 15  ? 61.161   165.763 -12.587 1.00 0.00 ? 10  CYS D CA  1 
ATOM 8867  C C   . CYS D 1 15  ? 62.140   164.665 -12.790 1.00 0.00 ? 10  CYS D C   1 
ATOM 8868  O O   . CYS D 1 15  ? 61.808   163.455 -12.945 1.00 0.00 ? 10  CYS D O   1 
ATOM 8869  C CB  . CYS D 1 15  ? 60.853   166.492 -13.949 1.00 0.00 ? 10  CYS D CB  1 
ATOM 8870  S SG  . CYS D 1 15  ? 59.480   167.715 -13.676 1.00 0.00 ? 10  CYS D SG  1 
ATOM 8871  N N   . LEU D 1 16  ? 63.444   165.067 -12.841 1.00 0.00 ? 11  LEU D N   1 
ATOM 8872  C CA  . LEU D 1 16  ? 64.487   164.170 -13.139 1.00 0.00 ? 11  LEU D CA  1 
ATOM 8873  C C   . LEU D 1 16  ? 65.016   163.423 -11.879 1.00 0.00 ? 11  LEU D C   1 
ATOM 8874  O O   . LEU D 1 16  ? 65.737   162.410 -11.996 1.00 0.00 ? 11  LEU D O   1 
ATOM 8875  C CB  . LEU D 1 16  ? 65.724   164.995 -13.573 1.00 0.00 ? 11  LEU D CB  1 
ATOM 8876  C CG  . LEU D 1 16  ? 65.454   165.766 -14.883 1.00 0.00 ? 11  LEU D CG  1 
ATOM 8877  C CD1 . LEU D 1 16  ? 66.447   166.990 -15.017 1.00 0.00 ? 11  LEU D CD1 1 
ATOM 8878  C CD2 . LEU D 1 16  ? 65.556   164.783 -16.055 1.00 0.00 ? 11  LEU D CD2 1 
ATOM 8879  N N   . LYS D 1 17  ? 64.622   163.879 -10.634 1.00 0.00 ? 12  LYS D N   1 
ATOM 8880  C CA  . LYS D 1 17  ? 65.066   163.131 -9.485  1.00 0.00 ? 12  LYS D CA  1 
ATOM 8881  C C   . LYS D 1 17  ? 63.969   162.269 -8.895  1.00 0.00 ? 12  LYS D C   1 
ATOM 8882  O O   . LYS D 1 17  ? 64.145   161.508 -7.884  1.00 0.00 ? 12  LYS D O   1 
ATOM 8883  C CB  . LYS D 1 17  ? 65.495   164.174 -8.382  1.00 0.00 ? 12  LYS D CB  1 
ATOM 8884  C CG  . LYS D 1 17  ? 64.374   165.032 -7.793  1.00 0.00 ? 12  LYS D CG  1 
ATOM 8885  C CD  . LYS D 1 17  ? 64.938   165.898 -6.613  1.00 0.00 ? 12  LYS D CD  1 
ATOM 8886  C CE  . LYS D 1 17  ? 66.058   166.942 -6.983  1.00 0.00 ? 12  LYS D CE  1 
ATOM 8887  N NZ  . LYS D 1 17  ? 66.343   167.863 -5.782  1.00 0.00 ? 12  LYS D NZ  1 
ATOM 8888  N N   . ASP D 1 18  ? 62.745   162.255 -9.552  1.00 0.00 ? 13  ASP D N   1 
ATOM 8889  C CA  . ASP D 1 18  ? 61.603   161.450 -9.138  1.00 0.00 ? 13  ASP D CA  1 
ATOM 8890  C C   . ASP D 1 18  ? 61.162   161.766 -7.711  1.00 0.00 ? 13  ASP D C   1 
ATOM 8891  O O   . ASP D 1 18  ? 60.912   160.894 -6.833  1.00 0.00 ? 13  ASP D O   1 
ATOM 8892  C CB  . ASP D 1 18  ? 61.965   160.061 -9.580  1.00 0.00 ? 13  ASP D CB  1 
ATOM 8893  C CG  . ASP D 1 18  ? 60.722   159.205 -9.609  1.00 0.00 ? 13  ASP D CG  1 
ATOM 8894  O OD1 . ASP D 1 18  ? 59.672   159.551 -10.263 1.00 0.00 ? 13  ASP D OD1 1 
ATOM 8895  O OD2 . ASP D 1 18  ? 60.711   158.175 -8.859  1.00 0.00 ? 13  ASP D OD2 1 
ATOM 8896  N N   . SER D 1 19  ? 61.022   163.092 -7.430  1.00 0.00 ? 14  SER D N   1 
ATOM 8897  C CA  . SER D 1 19  ? 60.667   163.635 -6.086  1.00 0.00 ? 14  SER D CA  1 
ATOM 8898  C C   . SER D 1 19  ? 59.199   163.346 -5.766  1.00 0.00 ? 14  SER D C   1 
ATOM 8899  O O   . SER D 1 19  ? 58.346   163.344 -6.678  1.00 0.00 ? 14  SER D O   1 
ATOM 8900  C CB  . SER D 1 19  ? 60.950   165.193 -5.954  1.00 0.00 ? 14  SER D CB  1 
ATOM 8901  O OG  . SER D 1 19  ? 60.179   166.029 -6.794  1.00 0.00 ? 14  SER D OG  1 
ATOM 8902  N N   . PRO D 1 20  ? 58.797   163.420 -4.502  1.00 0.00 ? 15  PRO D N   1 
ATOM 8903  C CA  . PRO D 1 20  ? 57.443   163.255 -4.113  1.00 0.00 ? 15  PRO D CA  1 
ATOM 8904  C C   . PRO D 1 20  ? 56.691   164.515 -4.481  1.00 0.00 ? 15  PRO D C   1 
ATOM 8905  O O   . PRO D 1 20  ? 55.455   164.425 -4.611  1.00 0.00 ? 15  PRO D O   1 
ATOM 8906  C CB  . PRO D 1 20  ? 57.536   163.158 -2.553  1.00 0.00 ? 15  PRO D CB  1 
ATOM 8907  C CG  . PRO D 1 20  ? 58.938   162.577 -2.251  1.00 0.00 ? 15  PRO D CG  1 
ATOM 8908  C CD  . PRO D 1 20  ? 59.785   163.180 -3.380  1.00 0.00 ? 15  PRO D CD  1 
ATOM 8909  N N   . ARG D 1 21  ? 57.328   165.733 -4.548  1.00 0.00 ? 16  ARG D N   1 
ATOM 8910  C CA  . ARG D 1 21  ? 56.692   166.957 -5.087  1.00 0.00 ? 16  ARG D CA  1 
ATOM 8911  C C   . ARG D 1 21  ? 56.234   166.853 -6.608  1.00 0.00 ? 16  ARG D C   1 
ATOM 8912  O O   . ARG D 1 21  ? 55.074   167.028 -7.003  1.00 0.00 ? 16  ARG D O   1 
ATOM 8913  C CB  . ARG D 1 21  ? 57.633   168.143 -4.884  1.00 0.00 ? 16  ARG D CB  1 
ATOM 8914  C CG  . ARG D 1 21  ? 57.121   169.431 -5.600  1.00 0.00 ? 16  ARG D CG  1 
ATOM 8915  C CD  . ARG D 1 21  ? 57.523   170.773 -4.837  1.00 0.00 ? 16  ARG D CD  1 
ATOM 8916  N NE  . ARG D 1 21  ? 59.026   170.856 -4.812  1.00 0.00 ? 16  ARG D NE  1 
ATOM 8917  C CZ  . ARG D 1 21  ? 59.699   172.047 -4.889  1.00 0.00 ? 16  ARG D CZ  1 
ATOM 8918  N NH1 . ARG D 1 21  ? 59.087   173.171 -4.692  1.00 0.00 ? 16  ARG D NH1 1 
ATOM 8919  N NH2 . ARG D 1 21  ? 60.996   172.132 -5.187  1.00 0.00 ? 16  ARG D NH2 1 
ATOM 8920  N N   . PHE D 1 22  ? 57.172   166.393 -7.472  1.00 0.00 ? 17  PHE D N   1 
ATOM 8921  C CA  . PHE D 1 22  ? 56.773   165.787 -8.746  1.00 0.00 ? 17  PHE D CA  1 
ATOM 8922  C C   . PHE D 1 22  ? 55.671   164.724 -8.686  1.00 0.00 ? 17  PHE D C   1 
ATOM 8923  O O   . PHE D 1 22  ? 54.635   164.925 -9.296  1.00 0.00 ? 17  PHE D O   1 
ATOM 8924  C CB  . PHE D 1 22  ? 58.077   165.204 -9.405  1.00 0.00 ? 17  PHE D CB  1 
ATOM 8925  C CG  . PHE D 1 22  ? 57.739   164.530 -10.730 1.00 0.00 ? 17  PHE D CG  1 
ATOM 8926  C CD1 . PHE D 1 22  ? 57.124   165.248 -11.736 1.00 0.00 ? 17  PHE D CD1 1 
ATOM 8927  C CD2 . PHE D 1 22  ? 58.193   163.235 -11.133 1.00 0.00 ? 17  PHE D CD2 1 
ATOM 8928  C CE1 . PHE D 1 22  ? 56.959   164.845 -13.018 1.00 0.00 ? 17  PHE D CE1 1 
ATOM 8929  C CE2 . PHE D 1 22  ? 58.171   162.811 -12.482 1.00 0.00 ? 17  PHE D CE2 1 
ATOM 8930  C CZ  . PHE D 1 22  ? 57.531   163.647 -13.400 1.00 0.00 ? 17  PHE D CZ  1 
ATOM 8931  N N   . ARG D 1 23  ? 55.837   163.637 -7.899  1.00 0.00 ? 18  ARG D N   1 
ATOM 8932  C CA  . ARG D 1 23  ? 54.960   162.480 -7.691  1.00 0.00 ? 18  ARG D CA  1 
ATOM 8933  C C   . ARG D 1 23  ? 53.551   162.809 -7.293  1.00 0.00 ? 18  ARG D C   1 
ATOM 8934  O O   . ARG D 1 23  ? 52.578   162.321 -7.860  1.00 0.00 ? 18  ARG D O   1 
ATOM 8935  C CB  . ARG D 1 23  ? 55.470   161.541 -6.610  1.00 0.00 ? 18  ARG D CB  1 
ATOM 8936  C CG  . ARG D 1 23  ? 54.752   160.187 -6.532  1.00 0.00 ? 18  ARG D CG  1 
ATOM 8937  C CD  . ARG D 1 23  ? 54.599   159.427 -7.850  1.00 0.00 ? 18  ARG D CD  1 
ATOM 8938  N NE  . ARG D 1 23  ? 53.633   158.328 -7.601  1.00 0.00 ? 18  ARG D NE  1 
ATOM 8939  C CZ  . ARG D 1 23  ? 52.352   158.379 -7.720  1.00 0.00 ? 18  ARG D CZ  1 
ATOM 8940  N NH1 . ARG D 1 23  ? 51.645   159.420 -8.215  1.00 0.00 ? 18  ARG D NH1 1 
ATOM 8941  N NH2 . ARG D 1 23  ? 51.633   157.267 -7.419  1.00 0.00 ? 18  ARG D NH2 1 
ATOM 8942  N N   . ALA D 1 24  ? 53.372   163.839 -6.403  1.00 0.00 ? 19  ALA D N   1 
ATOM 8943  C CA  . ALA D 1 24  ? 52.071   164.424 -6.178  1.00 0.00 ? 19  ALA D CA  1 
ATOM 8944  C C   . ALA D 1 24  ? 51.579   165.408 -7.214  1.00 0.00 ? 19  ALA D C   1 
ATOM 8945  O O   . ALA D 1 24  ? 50.425   165.582 -7.590  1.00 0.00 ? 19  ALA D O   1 
ATOM 8946  C CB  . ALA D 1 24  ? 52.061   165.179 -4.772  1.00 0.00 ? 19  ALA D CB  1 
ATOM 8947  N N   . SER D 1 25  ? 52.430   166.208 -7.870  1.00 0.00 ? 20  SER D N   1 
ATOM 8948  C CA  . SER D 1 25  ? 52.008   167.163 -8.984  1.00 0.00 ? 20  SER D CA  1 
ATOM 8949  C C   . SER D 1 25  ? 51.487   166.493 -10.205 1.00 0.00 ? 20  SER D C   1 
ATOM 8950  O O   . SER D 1 25  ? 50.673   167.175 -10.935 1.00 0.00 ? 20  SER D O   1 
ATOM 8951  C CB  . SER D 1 25  ? 53.126   168.229 -9.324  1.00 0.00 ? 20  SER D CB  1 
ATOM 8952  O OG  . SER D 1 25  ? 53.461   168.923 -8.147  1.00 0.00 ? 20  SER D OG  1 
ATOM 8953  N N   . ILE D 1 26  ? 52.009   165.343 -10.552 1.00 0.00 ? 21  ILE D N   1 
ATOM 8954  C CA  . ILE D 1 26  ? 51.545   164.533 -11.605 1.00 0.00 ? 21  ILE D CA  1 
ATOM 8955  C C   . ILE D 1 26  ? 50.242   163.831 -11.213 1.00 0.00 ? 21  ILE D C   1 
ATOM 8956  O O   . ILE D 1 26  ? 49.284   163.694 -12.024 1.00 0.00 ? 21  ILE D O   1 
ATOM 8957  C CB  . ILE D 1 26  ? 52.614   163.506 -12.051 1.00 0.00 ? 21  ILE D CB  1 
ATOM 8958  C CG1 . ILE D 1 26  ? 53.057   162.369 -11.049 1.00 0.00 ? 21  ILE D CG1 1 
ATOM 8959  C CG2 . ILE D 1 26  ? 53.770   164.362 -12.638 1.00 0.00 ? 21  ILE D CG2 1 
ATOM 8960  C CD1 . ILE D 1 26  ? 54.054   161.301 -11.582 1.00 0.00 ? 21  ILE D CD1 1 
ATOM 8961  N N   . GLU D 1 27  ? 50.108   163.418 -9.933  1.00 0.00 ? 22  GLU D N   1 
ATOM 8962  C CA  . GLU D 1 27  ? 48.821   162.977 -9.396  1.00 0.00 ? 22  GLU D CA  1 
ATOM 8963  C C   . GLU D 1 27  ? 47.751   164.017 -9.503  1.00 0.00 ? 22  GLU D C   1 
ATOM 8964  O O   . GLU D 1 27  ? 46.675   163.664 -10.056 1.00 0.00 ? 22  GLU D O   1 
ATOM 8965  C CB  . GLU D 1 27  ? 49.023   162.456 -8.036  1.00 0.00 ? 22  GLU D CB  1 
ATOM 8966  C CG  . GLU D 1 27  ? 47.724   161.840 -7.454  1.00 0.00 ? 22  GLU D CG  1 
ATOM 8967  C CD  . GLU D 1 27  ? 47.933   160.785 -6.368  1.00 0.00 ? 22  GLU D CD  1 
ATOM 8968  O OE1 . GLU D 1 27  ? 48.152   159.549 -6.628  1.00 0.00 ? 22  GLU D OE1 1 
ATOM 8969  O OE2 . GLU D 1 27  ? 47.771   161.300 -5.166  1.00 0.00 ? 22  GLU D OE2 1 
ATOM 8970  N N   . LEU D 1 28  ? 47.936   165.241 -9.179  1.00 0.00 ? 23  LEU D N   1 
ATOM 8971  C CA  . LEU D 1 28  ? 46.943   166.258 -9.161  1.00 0.00 ? 23  LEU D CA  1 
ATOM 8972  C C   . LEU D 1 28  ? 46.767   166.873 -10.528 1.00 0.00 ? 23  LEU D C   1 
ATOM 8973  O O   . LEU D 1 28  ? 45.716   167.478 -10.773 1.00 0.00 ? 23  LEU D O   1 
ATOM 8974  C CB  . LEU D 1 28  ? 47.581   167.237 -8.246  1.00 0.00 ? 23  LEU D CB  1 
ATOM 8975  C CG  . LEU D 1 28  ? 47.469   166.885 -6.757  1.00 0.00 ? 23  LEU D CG  1 
ATOM 8976  C CD1 . LEU D 1 28  ? 48.301   167.746 -5.761  1.00 0.00 ? 23  LEU D CD1 1 
ATOM 8977  C CD2 . LEU D 1 28  ? 46.048   166.954 -6.263  1.00 0.00 ? 23  LEU D CD2 1 
ATOM 8978  N N   . VAL D 1 29  ? 47.729   166.934 -11.524 1.00 0.00 ? 24  VAL D N   1 
ATOM 8979  C CA  . VAL D 1 29  ? 47.454   167.631 -12.827 1.00 0.00 ? 24  VAL D CA  1 
ATOM 8980  C C   . VAL D 1 29  ? 46.555   166.814 -13.661 1.00 0.00 ? 24  VAL D C   1 
ATOM 8981  O O   . VAL D 1 29  ? 45.690   167.299 -14.461 1.00 0.00 ? 24  VAL D O   1 
ATOM 8982  C CB  . VAL D 1 29  ? 48.784   168.077 -13.477 1.00 0.00 ? 24  VAL D CB  1 
ATOM 8983  C CG1 . VAL D 1 29  ? 49.518   166.750 -13.882 1.00 0.00 ? 24  VAL D CG1 1 
ATOM 8984  C CG2 . VAL D 1 29  ? 48.471   169.002 -14.686 1.00 0.00 ? 24  VAL D CG2 1 
ATOM 8985  N N   . GLU D 1 30  ? 46.562   165.417 -13.556 1.00 0.00 ? 25  GLU D N   1 
ATOM 8986  C CA  . GLU D 1 30  ? 45.704   164.545 -14.292 1.00 0.00 ? 25  GLU D CA  1 
ATOM 8987  C C   . GLU D 1 30  ? 44.254   164.589 -13.880 1.00 0.00 ? 25  GLU D C   1 
ATOM 8988  O O   . GLU D 1 30  ? 43.354   164.527 -14.709 1.00 0.00 ? 25  GLU D O   1 
ATOM 8989  C CB  . GLU D 1 30  ? 46.129   163.061 -14.394 1.00 0.00 ? 25  GLU D CB  1 
ATOM 8990  C CG  . GLU D 1 30  ? 46.316   162.270 -13.046 1.00 0.00 ? 25  GLU D CG  1 
ATOM 8991  C CD  . GLU D 1 30  ? 46.588   160.775 -13.218 1.00 0.00 ? 25  GLU D CD  1 
ATOM 8992  O OE1 . GLU D 1 30  ? 47.485   160.474 -14.081 1.00 0.00 ? 25  GLU D OE1 1 
ATOM 8993  O OE2 . GLU D 1 30  ? 45.855   159.949 -12.653 1.00 0.00 ? 25  GLU D OE2 1 
ATOM 8994  N N   . ALA D 1 31  ? 44.037   164.742 -12.596 1.00 0.00 ? 26  ALA D N   1 
ATOM 8995  C CA  . ALA D 1 31  ? 42.739   164.921 -11.949 1.00 0.00 ? 26  ALA D CA  1 
ATOM 8996  C C   . ALA D 1 31  ? 42.236   166.316 -12.273 1.00 0.00 ? 26  ALA D C   1 
ATOM 8997  O O   . ALA D 1 31  ? 41.023   166.447 -12.571 1.00 0.00 ? 26  ALA D O   1 
ATOM 8998  C CB  . ALA D 1 31  ? 43.015   164.978 -10.430 1.00 0.00 ? 26  ALA D CB  1 
ATOM 8999  N N   . GLU D 1 32  ? 43.053   167.360 -12.350 1.00 0.00 ? 27  GLU D N   1 
ATOM 9000  C CA  . GLU D 1 32  ? 42.619   168.597 -12.876 1.00 0.00 ? 27  GLU D CA  1 
ATOM 9001  C C   . GLU D 1 32  ? 42.189   168.536 -14.377 1.00 0.00 ? 27  GLU D C   1 
ATOM 9002  O O   . GLU D 1 32  ? 41.204   169.137 -14.660 1.00 0.00 ? 27  GLU D O   1 
ATOM 9003  C CB  . GLU D 1 32  ? 43.749   169.669 -12.790 1.00 0.00 ? 27  GLU D CB  1 
ATOM 9004  C CG  . GLU D 1 32  ? 44.084   170.160 -11.333 1.00 0.00 ? 27  GLU D CG  1 
ATOM 9005  C CD  . GLU D 1 32  ? 43.103   171.218 -10.876 1.00 0.00 ? 27  GLU D CD  1 
ATOM 9006  O OE1 . GLU D 1 32  ? 42.798   172.176 -11.656 1.00 0.00 ? 27  GLU D OE1 1 
ATOM 9007  O OE2 . GLU D 1 32  ? 42.694   171.223 -9.674  1.00 0.00 ? 27  GLU D OE2 1 
ATOM 9008  N N   . VAL D 1 33  ? 42.868   167.794 -15.239 1.00 0.00 ? 28  VAL D N   1 
ATOM 9009  C CA  . VAL D 1 33  ? 42.535   167.580 -16.592 1.00 0.00 ? 28  VAL D CA  1 
ATOM 9010  C C   . VAL D 1 33  ? 41.197   166.872 -16.773 1.00 0.00 ? 28  VAL D C   1 
ATOM 9011  O O   . VAL D 1 33  ? 40.442   167.328 -17.630 1.00 0.00 ? 28  VAL D O   1 
ATOM 9012  C CB  . VAL D 1 33  ? 43.628   166.844 -17.374 1.00 0.00 ? 28  VAL D CB  1 
ATOM 9013  C CG1 . VAL D 1 33  ? 43.092   166.484 -18.763 1.00 0.00 ? 28  VAL D CG1 1 
ATOM 9014  C CG2 . VAL D 1 33  ? 44.779   167.801 -17.598 1.00 0.00 ? 28  VAL D CG2 1 
ATOM 9015  N N   . SER D 1 34  ? 40.837   165.852 -16.031 1.00 0.00 ? 29  SER D N   1 
ATOM 9016  C CA  . SER D 1 34  ? 39.460   165.265 -15.980 1.00 0.00 ? 29  SER D CA  1 
ATOM 9017  C C   . SER D 1 34  ? 38.359   166.180 -15.539 1.00 0.00 ? 29  SER D C   1 
ATOM 9018  O O   . SER D 1 34  ? 37.317   166.103 -16.146 1.00 0.00 ? 29  SER D O   1 
ATOM 9019  C CB  . SER D 1 34  ? 39.365   164.015 -14.999 1.00 0.00 ? 29  SER D CB  1 
ATOM 9020  O OG  . SER D 1 34  ? 40.293   163.013 -15.410 1.00 0.00 ? 29  SER D OG  1 
ATOM 9021  N N   . GLU D 1 35  ? 38.525   167.016 -14.501 1.00 0.00 ? 30  GLU D N   1 
ATOM 9022  C CA  . GLU D 1 35  ? 37.579   168.044 -14.122 1.00 0.00 ? 30  GLU D CA  1 
ATOM 9023  C C   . GLU D 1 35  ? 37.427   169.068 -15.288 1.00 0.00 ? 30  GLU D C   1 
ATOM 9024  O O   . GLU D 1 35  ? 36.357   169.506 -15.649 1.00 0.00 ? 30  GLU D O   1 
ATOM 9025  C CB  . GLU D 1 35  ? 38.141   168.819 -12.871 1.00 0.00 ? 30  GLU D CB  1 
ATOM 9026  C CG  . GLU D 1 35  ? 37.097   169.784 -12.176 1.00 0.00 ? 30  GLU D CG  1 
ATOM 9027  C CD  . GLU D 1 35  ? 35.812   169.153 -11.718 1.00 0.00 ? 30  GLU D CD  1 
ATOM 9028  O OE1 . GLU D 1 35  ? 35.825   168.021 -11.172 1.00 0.00 ? 30  GLU D OE1 1 
ATOM 9029  O OE2 . GLU D 1 35  ? 34.768   169.828 -11.908 1.00 0.00 ? 30  GLU D OE2 1 
ATOM 9030  N N   . LEU D 1 36  ? 38.611   169.495 -15.877 1.00 0.00 ? 31  LEU D N   1 
ATOM 9031  C CA  . LEU D 1 36  ? 38.610   170.555 -16.845 1.00 0.00 ? 31  LEU D CA  1 
ATOM 9032  C C   . LEU D 1 36  ? 37.859   170.239 -18.065 1.00 0.00 ? 31  LEU D C   1 
ATOM 9033  O O   . LEU D 1 36  ? 37.092   171.081 -18.565 1.00 0.00 ? 31  LEU D O   1 
ATOM 9034  C CB  . LEU D 1 36  ? 40.086   171.100 -17.130 1.00 0.00 ? 31  LEU D CB  1 
ATOM 9035  C CG  . LEU D 1 36  ? 40.243   172.166 -18.262 1.00 0.00 ? 31  LEU D CG  1 
ATOM 9036  C CD1 . LEU D 1 36  ? 39.540   173.446 -17.916 1.00 0.00 ? 31  LEU D CD1 1 
ATOM 9037  C CD2 . LEU D 1 36  ? 41.754   172.513 -18.549 1.00 0.00 ? 31  LEU D CD2 1 
ATOM 9038  N N   . GLU D 1 37  ? 38.065   169.055 -18.585 1.00 0.00 ? 32  GLU D N   1 
ATOM 9039  C CA  . GLU D 1 37  ? 37.435   168.587 -19.805 1.00 0.00 ? 32  GLU D CA  1 
ATOM 9040  C C   . GLU D 1 37  ? 36.017   168.374 -19.579 1.00 0.00 ? 32  GLU D C   1 
ATOM 9041  O O   . GLU D 1 37  ? 35.212   168.718 -20.447 1.00 0.00 ? 32  GLU D O   1 
ATOM 9042  C CB  . GLU D 1 37  ? 38.108   167.174 -20.039 1.00 0.00 ? 32  GLU D CB  1 
ATOM 9043  C CG  . GLU D 1 37  ? 37.367   166.339 -21.181 1.00 0.00 ? 32  GLU D CG  1 
ATOM 9044  C CD  . GLU D 1 37  ? 38.095   165.008 -21.407 1.00 0.00 ? 32  GLU D CD  1 
ATOM 9045  O OE1 . GLU D 1 37  ? 38.357   164.296 -20.392 1.00 0.00 ? 32  GLU D OE1 1 
ATOM 9046  O OE2 . GLU D 1 37  ? 38.363   164.719 -22.582 1.00 0.00 ? 32  GLU D OE2 1 
ATOM 9047  N N   . THR D 1 38  ? 35.665   167.818 -18.437 1.00 0.00 ? 33  THR D N   1 
ATOM 9048  C CA  . THR D 1 38  ? 34.246   167.621 -18.195 1.00 0.00 ? 33  THR D CA  1 
ATOM 9049  C C   . THR D 1 38  ? 33.549   168.982 -18.188 1.00 0.00 ? 33  THR D C   1 
ATOM 9050  O O   . THR D 1 38  ? 32.468   169.046 -18.809 1.00 0.00 ? 33  THR D O   1 
ATOM 9051  C CB  . THR D 1 38  ? 34.039   167.007 -16.794 1.00 0.00 ? 33  THR D CB  1 
ATOM 9052  O OG1 . THR D 1 38  ? 34.736   165.728 -16.833 1.00 0.00 ? 33  THR D OG1 1 
ATOM 9053  C CG2 . THR D 1 38  ? 32.618   166.903 -16.444 1.00 0.00 ? 33  THR D CG2 1 
ATOM 9054  N N   . ARG D 1 39  ? 34.074   170.033 -17.533 1.00 0.00 ? 34  ARG D N   1 
ATOM 9055  C CA  . ARG D 1 39  ? 33.443   171.351 -17.384 1.00 0.00 ? 34  ARG D CA  1 
ATOM 9056  C C   . ARG D 1 39  ? 33.425   172.096 -18.678 1.00 0.00 ? 34  ARG D C   1 
ATOM 9057  O O   . ARG D 1 39  ? 32.419   172.720 -19.018 1.00 0.00 ? 34  ARG D O   1 
ATOM 9058  C CB  . ARG D 1 39  ? 34.102   172.312 -16.352 1.00 0.00 ? 34  ARG D CB  1 
ATOM 9059  C CG  . ARG D 1 39  ? 34.023   171.849 -14.878 1.00 0.00 ? 34  ARG D CG  1 
ATOM 9060  C CD  . ARG D 1 39  ? 32.837   172.282 -14.125 1.00 0.00 ? 34  ARG D CD  1 
ATOM 9061  N NE  . ARG D 1 39  ? 32.907   171.515 -12.825 1.00 0.00 ? 34  ARG D NE  1 
ATOM 9062  C CZ  . ARG D 1 39  ? 32.063   171.636 -11.819 1.00 0.00 ? 34  ARG D CZ  1 
ATOM 9063  N NH1 . ARG D 1 39  ? 31.077   172.493 -11.836 1.00 0.00 ? 34  ARG D NH1 1 
ATOM 9064  N NH2 . ARG D 1 39  ? 32.235   170.841 -10.719 1.00 0.00 ? 34  ARG D NH2 1 
ATOM 9065  N N   . LEU D 1 40  ? 34.550   172.056 -19.497 1.00 0.00 ? 35  LEU D N   1 
ATOM 9066  C CA  . LEU D 1 40  ? 34.592   172.553 -20.848 1.00 0.00 ? 35  LEU D CA  1 
ATOM 9067  C C   . LEU D 1 40  ? 33.503   171.889 -21.706 1.00 0.00 ? 35  LEU D C   1 
ATOM 9068  O O   . LEU D 1 40  ? 32.701   172.488 -22.393 1.00 0.00 ? 35  LEU D O   1 
ATOM 9069  C CB  . LEU D 1 40  ? 35.959   172.263 -21.567 1.00 0.00 ? 35  LEU D CB  1 
ATOM 9070  C CG  . LEU D 1 40  ? 37.101   173.312 -21.319 1.00 0.00 ? 35  LEU D CG  1 
ATOM 9071  C CD1 . LEU D 1 40  ? 38.414   172.666 -21.572 1.00 0.00 ? 35  LEU D CD1 1 
ATOM 9072  C CD2 . LEU D 1 40  ? 36.838   174.509 -22.196 1.00 0.00 ? 35  LEU D CD2 1 
ATOM 9073  N N   . GLU D 1 41  ? 33.439   170.515 -21.641 1.00 0.00 ? 36  GLU D N   1 
ATOM 9074  C CA  . GLU D 1 41  ? 32.463   169.803 -22.485 1.00 0.00 ? 36  GLU D CA  1 
ATOM 9075  C C   . GLU D 1 41  ? 31.055   170.068 -22.004 1.00 0.00 ? 36  GLU D C   1 
ATOM 9076  O O   . GLU D 1 41  ? 30.087   170.203 -22.724 1.00 0.00 ? 36  GLU D O   1 
ATOM 9077  C CB  . GLU D 1 41  ? 32.804   168.268 -22.660 1.00 0.00 ? 36  GLU D CB  1 
ATOM 9078  C CG  . GLU D 1 41  ? 32.059   167.603 -23.812 1.00 0.00 ? 36  GLU D CG  1 
ATOM 9079  C CD  . GLU D 1 41  ? 32.396   166.148 -24.001 1.00 0.00 ? 36  GLU D CD  1 
ATOM 9080  O OE1 . GLU D 1 41  ? 32.125   165.364 -23.072 1.00 0.00 ? 36  GLU D OE1 1 
ATOM 9081  O OE2 . GLU D 1 41  ? 32.850   165.742 -25.116 1.00 0.00 ? 36  GLU D OE2 1 
ATOM 9082  N N   . LYS D 1 42  ? 30.814   170.254 -20.679 1.00 0.00 ? 37  LYS D N   1 
ATOM 9083  C CA  . LYS D 1 42  ? 29.513   170.748 -20.216 1.00 0.00 ? 37  LYS D CA  1 
ATOM 9084  C C   . LYS D 1 42  ? 29.206   172.158 -20.726 1.00 0.00 ? 37  LYS D C   1 
ATOM 9085  O O   . LYS D 1 42  ? 28.109   172.532 -21.153 1.00 0.00 ? 37  LYS D O   1 
ATOM 9086  C CB  . LYS D 1 42  ? 29.593   170.681 -18.676 1.00 0.00 ? 37  LYS D CB  1 
ATOM 9087  C CG  . LYS D 1 42  ? 28.324   171.049 -17.861 1.00 0.00 ? 37  LYS D CG  1 
ATOM 9088  C CD  . LYS D 1 42  ? 28.067   170.364 -16.443 1.00 0.00 ? 37  LYS D CD  1 
ATOM 9089  C CE  . LYS D 1 42  ? 27.585   168.904 -16.637 1.00 0.00 ? 37  LYS D CE  1 
ATOM 9090  N NZ  . LYS D 1 42  ? 26.161   168.814 -17.045 1.00 0.00 ? 37  LYS D NZ  1 
ATOM 9091  N N   . LEU D 1 43  ? 30.189   173.115 -20.643 1.00 0.00 ? 38  LEU D N   1 
ATOM 9092  C CA  . LEU D 1 43  ? 30.115   174.490 -21.117 1.00 0.00 ? 38  LEU D CA  1 
ATOM 9093  C C   . LEU D 1 43  ? 29.816   174.478 -22.659 1.00 0.00 ? 38  LEU D C   1 
ATOM 9094  O O   . LEU D 1 43  ? 28.974   175.224 -23.134 1.00 0.00 ? 38  LEU D O   1 
ATOM 9095  C CB  . LEU D 1 43  ? 31.341   175.286 -20.776 1.00 0.00 ? 38  LEU D CB  1 
ATOM 9096  C CG  . LEU D 1 43  ? 31.307   176.781 -21.290 1.00 0.00 ? 38  LEU D CG  1 
ATOM 9097  C CD1 . LEU D 1 43  ? 30.250   177.488 -20.357 1.00 0.00 ? 38  LEU D CD1 1 
ATOM 9098  C CD2 . LEU D 1 43  ? 32.650   177.419 -21.269 1.00 0.00 ? 38  LEU D CD2 1 
ATOM 9099  N N   . LEU D 1 44  ? 30.421   173.607 -23.459 1.00 0.00 ? 39  LEU D N   1 
ATOM 9100  C CA  . LEU D 1 44  ? 30.174   173.176 -24.856 1.00 0.00 ? 39  LEU D CA  1 
ATOM 9101  C C   . LEU D 1 44  ? 28.739   172.675 -25.200 1.00 0.00 ? 39  LEU D C   1 
ATOM 9102  O O   . LEU D 1 44  ? 28.020   173.292 -25.983 1.00 0.00 ? 39  LEU D O   1 
ATOM 9103  C CB  . LEU D 1 44  ? 31.203   172.053 -25.278 1.00 0.00 ? 39  LEU D CB  1 
ATOM 9104  C CG  . LEU D 1 44  ? 31.314   171.706 -26.801 1.00 0.00 ? 39  LEU D CG  1 
ATOM 9105  C CD1 . LEU D 1 44  ? 31.678   172.966 -27.725 1.00 0.00 ? 39  LEU D CD1 1 
ATOM 9106  C CD2 . LEU D 1 44  ? 32.346   170.545 -27.112 1.00 0.00 ? 39  LEU D CD2 1 
ATOM 9107  N N   . LYS D 1 45  ? 28.167   171.652 -24.497 1.00 0.00 ? 40  LYS D N   1 
ATOM 9108  C CA  . LYS D 1 45  ? 26.762   171.359 -24.627 1.00 0.00 ? 40  LYS D CA  1 
ATOM 9109  C C   . LYS D 1 45  ? 25.820   172.449 -24.148 1.00 0.00 ? 40  LYS D C   1 
ATOM 9110  O O   . LYS D 1 45  ? 24.807   172.763 -24.760 1.00 0.00 ? 40  LYS D O   1 
ATOM 9111  C CB  . LYS D 1 45  ? 26.477   170.064 -23.846 1.00 0.00 ? 40  LYS D CB  1 
ATOM 9112  C CG  . LYS D 1 45  ? 27.324   168.934 -24.199 1.00 0.00 ? 40  LYS D CG  1 
ATOM 9113  C CD  . LYS D 1 45  ? 26.841   167.624 -23.526 1.00 0.00 ? 40  LYS D CD  1 
ATOM 9114  C CE  . LYS D 1 45  ? 27.528   166.394 -24.035 1.00 0.00 ? 40  LYS D CE  1 
ATOM 9115  N NZ  . LYS D 1 45  ? 27.186   166.138 -25.405 1.00 0.00 ? 40  LYS D NZ  1 
ATOM 9116  N N   . LEU D 1 46  ? 26.159   173.168 -23.029 1.00 0.00 ? 41  LEU D N   1 
ATOM 9117  C CA  . LEU D 1 46  ? 25.344   174.324 -22.639 1.00 0.00 ? 41  LEU D CA  1 
ATOM 9118  C C   . LEU D 1 46  ? 25.394   175.551 -23.670 1.00 0.00 ? 41  LEU D C   1 
ATOM 9119  O O   . LEU D 1 46  ? 24.310   176.103 -24.040 1.00 0.00 ? 41  LEU D O   1 
ATOM 9120  C CB  . LEU D 1 46  ? 25.746   174.853 -21.247 1.00 0.00 ? 41  LEU D CB  1 
ATOM 9121  C CG  . LEU D 1 46  ? 24.749   175.905 -20.738 1.00 0.00 ? 41  LEU D CG  1 
ATOM 9122  C CD1 . LEU D 1 46  ? 23.350   175.300 -20.613 1.00 0.00 ? 41  LEU D CD1 1 
ATOM 9123  C CD2 . LEU D 1 46  ? 25.164   176.514 -19.431 1.00 0.00 ? 41  LEU D CD2 1 
ATOM 9124  N N   . GLY D 1 47  ? 26.526   175.969 -24.227 1.00 0.00 ? 42  GLY D N   1 
ATOM 9125  C CA  . GLY D 1 47  ? 26.633   176.916 -25.339 1.00 0.00 ? 42  GLY D CA  1 
ATOM 9126  C C   . GLY D 1 47  ? 26.039   176.506 -26.599 1.00 0.00 ? 42  GLY D C   1 
ATOM 9127  O O   . GLY D 1 47  ? 25.644   177.331 -27.388 1.00 0.00 ? 42  GLY D O   1 
ATOM 9128  N N   . THR D 1 48  ? 25.950   175.180 -26.891 1.00 0.00 ? 43  THR D N   1 
ATOM 9129  C CA  . THR D 1 48  ? 25.124   174.578 -27.949 1.00 0.00 ? 43  THR D CA  1 
ATOM 9130  C C   . THR D 1 48  ? 23.633   174.822 -27.742 1.00 0.00 ? 43  THR D C   1 
ATOM 9131  O O   . THR D 1 48  ? 22.918   175.285 -28.646 1.00 0.00 ? 43  THR D O   1 
ATOM 9132  C CB  . THR D 1 48  ? 25.434   173.165 -28.141 1.00 0.00 ? 43  THR D CB  1 
ATOM 9133  O OG1 . THR D 1 48  ? 26.841   173.004 -28.407 1.00 0.00 ? 43  THR D OG1 1 
ATOM 9134  C CG2 . THR D 1 48  ? 24.707   172.549 -29.344 1.00 0.00 ? 43  THR D CG2 1 
ATOM 9135  N N   . GLY D 1 49  ? 23.193   174.569 -26.460 1.00 0.00 ? 44  GLY D N   1 
ATOM 9136  C CA  . GLY D 1 49  ? 21.859   174.665 -26.038 1.00 0.00 ? 44  GLY D CA  1 
ATOM 9137  C C   . GLY D 1 49  ? 21.362   176.090 -26.029 1.00 0.00 ? 44  GLY D C   1 
ATOM 9138  O O   . GLY D 1 49  ? 20.204   176.381 -26.342 1.00 0.00 ? 44  GLY D O   1 
ATOM 9139  N N   . LEU D 1 50  ? 22.279   177.054 -25.718 1.00 0.00 ? 45  LEU D N   1 
ATOM 9140  C CA  . LEU D 1 50  ? 22.036   178.469 -25.726 1.00 0.00 ? 45  LEU D CA  1 
ATOM 9141  C C   . LEU D 1 50  ? 21.694   179.001 -27.127 1.00 0.00 ? 45  LEU D C   1 
ATOM 9142  O O   . LEU D 1 50  ? 20.677   179.655 -27.358 1.00 0.00 ? 45  LEU D O   1 
ATOM 9143  C CB  . LEU D 1 50  ? 23.291   179.207 -25.196 1.00 0.00 ? 45  LEU D CB  1 
ATOM 9144  C CG  . LEU D 1 50  ? 23.239   180.638 -25.071 1.00 0.00 ? 45  LEU D CG  1 
ATOM 9145  C CD1 . LEU D 1 50  ? 22.037   181.271 -24.291 1.00 0.00 ? 45  LEU D CD1 1 
ATOM 9146  C CD2 . LEU D 1 50  ? 24.451   181.224 -24.409 1.00 0.00 ? 45  LEU D CD2 1 
ATOM 9147  N N   . LEU D 1 51  ? 22.535   178.634 -28.135 1.00 0.00 ? 46  LEU D N   1 
ATOM 9148  C CA  . LEU D 1 51  ? 22.240   178.951 -29.538 1.00 0.00 ? 46  LEU D CA  1 
ATOM 9149  C C   . LEU D 1 51  ? 20.876   178.387 -29.953 1.00 0.00 ? 46  LEU D C   1 
ATOM 9150  O O   . LEU D 1 51  ? 20.198   179.098 -30.658 1.00 0.00 ? 46  LEU D O   1 
ATOM 9151  C CB  . LEU D 1 51  ? 23.379   178.407 -30.439 1.00 0.00 ? 46  LEU D CB  1 
ATOM 9152  C CG  . LEU D 1 51  ? 24.800   178.845 -30.091 1.00 0.00 ? 46  LEU D CG  1 
ATOM 9153  C CD1 . LEU D 1 51  ? 25.770   177.856 -30.721 1.00 0.00 ? 46  LEU D CD1 1 
ATOM 9154  C CD2 . LEU D 1 51  ? 25.054   180.265 -30.668 1.00 0.00 ? 46  LEU D CD2 1 
ATOM 9155  N N   . GLU D 1 52  ? 20.531   177.145 -29.571 1.00 0.00 ? 47  GLU D N   1 
ATOM 9156  C CA  . GLU D 1 52  ? 19.276   176.428 -29.909 1.00 0.00 ? 47  GLU D CA  1 
ATOM 9157  C C   . GLU D 1 52  ? 18.162   177.188 -29.241 1.00 0.00 ? 47  GLU D C   1 
ATOM 9158  O O   . GLU D 1 52  ? 17.150   177.505 -29.795 1.00 0.00 ? 47  GLU D O   1 
ATOM 9159  C CB  . GLU D 1 52  ? 19.239   175.002 -29.483 1.00 0.00 ? 47  GLU D CB  1 
ATOM 9160  C CG  . GLU D 1 52  ? 17.946   174.318 -29.888 1.00 0.00 ? 47  GLU D CG  1 
ATOM 9161  C CD  . GLU D 1 52  ? 18.010   172.863 -29.423 1.00 0.00 ? 47  GLU D CD  1 
ATOM 9162  O OE1 . GLU D 1 52  ? 18.803   172.037 -30.052 1.00 0.00 ? 47  GLU D OE1 1 
ATOM 9163  O OE2 . GLU D 1 52  ? 17.360   172.518 -28.390 1.00 0.00 ? 47  GLU D OE2 1 
ATOM 9164  N N   . SER D 1 53  ? 18.327   177.576 -27.979 1.00 0.00 ? 48  SER D N   1 
ATOM 9165  C CA  . SER D 1 53  ? 17.352   178.403 -27.259 1.00 0.00 ? 48  SER D CA  1 
ATOM 9166  C C   . SER D 1 53  ? 17.157   179.784 -27.824 1.00 0.00 ? 48  SER D C   1 
ATOM 9167  O O   . SER D 1 53  ? 16.063   180.227 -27.989 1.00 0.00 ? 48  SER D O   1 
ATOM 9168  C CB  . SER D 1 53  ? 17.740   178.495 -25.688 1.00 0.00 ? 48  SER D CB  1 
ATOM 9169  O OG  . SER D 1 53  ? 17.400   177.290 -24.993 1.00 0.00 ? 48  SER D OG  1 
ATOM 9170  N N   . GLY D 1 54  ? 18.231   180.517 -28.250 1.00 0.00 ? 49  GLY D N   1 
ATOM 9171  C CA  . GLY D 1 54  ? 18.281   181.806 -28.974 1.00 0.00 ? 49  GLY D CA  1 
ATOM 9172  C C   . GLY D 1 54  ? 17.568   181.584 -30.260 1.00 0.00 ? 49  GLY D C   1 
ATOM 9173  O O   . GLY D 1 54  ? 16.724   182.324 -30.673 1.00 0.00 ? 49  GLY D O   1 
ATOM 9174  N N   . ARG D 1 55  ? 17.864   180.436 -30.974 1.00 0.00 ? 50  ARG D N   1 
ATOM 9175  C CA  . ARG D 1 55  ? 17.273   180.367 -32.296 1.00 0.00 ? 50  ARG D CA  1 
ATOM 9176  C C   . ARG D 1 55  ? 15.750   180.100 -32.410 1.00 0.00 ? 50  ARG D C   1 
ATOM 9177  O O   . ARG D 1 55  ? 15.009   180.508 -33.330 1.00 0.00 ? 50  ARG D O   1 
ATOM 9178  C CB  . ARG D 1 55  ? 17.870   179.146 -33.073 1.00 0.00 ? 50  ARG D CB  1 
ATOM 9179  C CG  . ARG D 1 55  ? 19.255   179.369 -33.769 1.00 0.00 ? 50  ARG D CG  1 
ATOM 9180  C CD  . ARG D 1 55  ? 19.208   180.330 -35.006 1.00 0.00 ? 50  ARG D CD  1 
ATOM 9181  N NE  . ARG D 1 55  ? 20.644   180.466 -35.311 1.00 0.00 ? 50  ARG D NE  1 
ATOM 9182  C CZ  . ARG D 1 55  ? 21.228   181.302 -36.196 1.00 0.00 ? 50  ARG D CZ  1 
ATOM 9183  N NH1 . ARG D 1 55  ? 20.407   182.106 -36.909 1.00 0.00 ? 50  ARG D NH1 1 
ATOM 9184  N NH2 . ARG D 1 55  ? 22.514   181.483 -36.398 1.00 0.00 ? 50  ARG D NH2 1 
ATOM 9185  N N   . HIS D 1 56  ? 15.273   179.341 -31.422 1.00 0.00 ? 51  HIS D N   1 
ATOM 9186  C CA  . HIS D 1 56  ? 13.867   179.116 -30.966 1.00 0.00 ? 51  HIS D CA  1 
ATOM 9187  C C   . HIS D 1 56  ? 13.226   180.454 -30.542 1.00 0.00 ? 51  HIS D C   1 
ATOM 9188  O O   . HIS D 1 56  ? 12.056   180.751 -30.955 1.00 0.00 ? 51  HIS D O   1 
ATOM 9189  C CB  . HIS D 1 56  ? 13.551   178.032 -29.826 1.00 0.00 ? 51  HIS D CB  1 
ATOM 9190  C CG  . HIS D 1 56  ? 13.655   176.549 -30.207 1.00 0.00 ? 51  HIS D CG  1 
ATOM 9191  N ND1 . HIS D 1 56  ? 13.891   175.599 -29.284 1.00 0.00 ? 51  HIS D ND1 1 
ATOM 9192  C CD2 . HIS D 1 56  ? 14.077   176.017 -31.401 1.00 0.00 ? 51  HIS D CD2 1 
ATOM 9193  C CE1 . HIS D 1 56  ? 14.289   174.454 -29.916 1.00 0.00 ? 51  HIS D CE1 1 
ATOM 9194  N NE2 . HIS D 1 56  ? 14.443   174.700 -31.229 1.00 0.00 ? 51  HIS D NE2 1 
ATOM 9195  N N   . TYR D 1 57  ? 13.990   181.346 -29.823 1.00 0.00 ? 52  TYR D N   1 
ATOM 9196  C CA  . TYR D 1 57  ? 13.574   182.638 -29.472 1.00 0.00 ? 52  TYR D CA  1 
ATOM 9197  C C   . TYR D 1 57  ? 13.380   183.563 -30.675 1.00 0.00 ? 52  TYR D C   1 
ATOM 9198  O O   . TYR D 1 57  ? 12.419   184.277 -30.844 1.00 0.00 ? 52  TYR D O   1 
ATOM 9199  C CB  . TYR D 1 57  ? 14.295   183.154 -28.180 1.00 0.00 ? 52  TYR D CB  1 
ATOM 9200  C CG  . TYR D 1 57  ? 13.942   184.623 -27.734 1.00 0.00 ? 52  TYR D CG  1 
ATOM 9201  C CD1 . TYR D 1 57  ? 12.643   184.973 -27.194 1.00 0.00 ? 52  TYR D CD1 1 
ATOM 9202  C CD2 . TYR D 1 57  ? 14.852   185.635 -27.731 1.00 0.00 ? 52  TYR D CD2 1 
ATOM 9203  C CE1 . TYR D 1 57  ? 12.252   186.241 -26.718 1.00 0.00 ? 52  TYR D CE1 1 
ATOM 9204  C CE2 . TYR D 1 57  ? 14.571   186.860 -27.057 1.00 0.00 ? 52  TYR D CE2 1 
ATOM 9205  C CZ  . TYR D 1 57  ? 13.303   187.152 -26.546 1.00 0.00 ? 52  TYR D CZ  1 
ATOM 9206  O OH  . TYR D 1 57  ? 12.891   188.325 -25.934 1.00 0.00 ? 52  TYR D OH  1 
ATOM 9207  N N   . LEU D 1 58  ? 14.417   183.676 -31.577 1.00 0.00 ? 53  LEU D N   1 
ATOM 9208  C CA  . LEU D 1 58  ? 14.272   184.456 -32.798 1.00 0.00 ? 53  LEU D CA  1 
ATOM 9209  C C   . LEU D 1 58  ? 13.056   183.937 -33.685 1.00 0.00 ? 53  LEU D C   1 
ATOM 9210  O O   . LEU D 1 58  ? 12.215   184.699 -34.188 1.00 0.00 ? 53  LEU D O   1 
ATOM 9211  C CB  . LEU D 1 58  ? 15.625   184.422 -33.662 1.00 0.00 ? 53  LEU D CB  1 
ATOM 9212  C CG  . LEU D 1 58  ? 16.792   185.118 -32.991 1.00 0.00 ? 53  LEU D CG  1 
ATOM 9213  C CD1 . LEU D 1 58  ? 17.972   184.932 -33.857 1.00 0.00 ? 53  LEU D CD1 1 
ATOM 9214  C CD2 . LEU D 1 58  ? 16.454   186.600 -32.729 1.00 0.00 ? 53  LEU D CD2 1 
ATOM 9215  N N   . ALA D 1 59  ? 12.829   182.569 -33.876 1.00 0.00 ? 54  ALA D N   1 
ATOM 9216  C CA  . ALA D 1 59  ? 11.635   182.032 -34.546 1.00 0.00 ? 54  ALA D CA  1 
ATOM 9217  C C   . ALA D 1 59  ? 10.283   182.291 -33.897 1.00 0.00 ? 54  ALA D C   1 
ATOM 9218  O O   . ALA D 1 59  ? 9.311    182.786 -34.521 1.00 0.00 ? 54  ALA D O   1 
ATOM 9219  C CB  . ALA D 1 59  ? 11.858   180.605 -34.893 1.00 0.00 ? 54  ALA D CB  1 
ATOM 9220  N N   . ALA D 1 60  ? 10.196   182.205 -32.567 1.00 0.00 ? 55  ALA D N   1 
ATOM 9221  C CA  . ALA D 1 60  ? 9.099    182.663 -31.692 1.00 0.00 ? 55  ALA D CA  1 
ATOM 9222  C C   . ALA D 1 60  ? 8.792    184.149 -31.940 1.00 0.00 ? 55  ALA D C   1 
ATOM 9223  O O   . ALA D 1 60  ? 7.639    184.547 -32.179 1.00 0.00 ? 55  ALA D O   1 
ATOM 9224  C CB  . ALA D 1 60  ? 9.508    182.354 -30.230 1.00 0.00 ? 55  ALA D CB  1 
ATOM 9225  N N   . SER D 1 61  ? 9.766    185.027 -31.918 1.00 0.00 ? 56  SER D N   1 
ATOM 9226  C CA  . SER D 1 61  ? 9.618    186.441 -32.296 1.00 0.00 ? 56  SER D CA  1 
ATOM 9227  C C   . SER D 1 61  ? 9.212    186.683 -33.694 1.00 0.00 ? 56  SER D C   1 
ATOM 9228  O O   . SER D 1 61  ? 8.298    187.425 -33.907 1.00 0.00 ? 56  SER D O   1 
ATOM 9229  C CB  . SER D 1 61  ? 10.972   187.197 -32.050 1.00 0.00 ? 56  SER D CB  1 
ATOM 9230  O OG  . SER D 1 61  ? 11.410   187.014 -30.717 1.00 0.00 ? 56  SER D OG  1 
ATOM 9231  N N   . ARG D 1 62  ? 9.824    186.001 -34.675 1.00 0.00 ? 57  ARG D N   1 
ATOM 9232  C CA  . ARG D 1 62  ? 9.589    186.126 -36.062 1.00 0.00 ? 57  ARG D CA  1 
ATOM 9233  C C   . ARG D 1 62  ? 8.143    185.781 -36.398 1.00 0.00 ? 57  ARG D C   1 
ATOM 9234  O O   . ARG D 1 62  ? 7.446    186.424 -37.132 1.00 0.00 ? 57  ARG D O   1 
ATOM 9235  C CB  . ARG D 1 62  ? 10.643   185.208 -36.802 1.00 0.00 ? 57  ARG D CB  1 
ATOM 9236  C CG  . ARG D 1 62  ? 10.768   185.431 -38.315 1.00 0.00 ? 57  ARG D CG  1 
ATOM 9237  C CD  . ARG D 1 62  ? 11.644   186.609 -38.772 1.00 0.00 ? 57  ARG D CD  1 
ATOM 9238  N NE  . ARG D 1 62  ? 13.033   186.127 -38.784 1.00 0.00 ? 57  ARG D NE  1 
ATOM 9239  C CZ  . ARG D 1 62  ? 14.063   186.948 -39.232 1.00 0.00 ? 57  ARG D CZ  1 
ATOM 9240  N NH1 . ARG D 1 62  ? 13.855   188.155 -39.746 1.00 0.00 ? 57  ARG D NH1 1 
ATOM 9241  N NH2 . ARG D 1 62  ? 15.326   186.510 -39.183 1.00 0.00 ? 57  ARG D NH2 1 
ATOM 9242  N N   . ALA D 1 63  ? 7.597    184.732 -35.809 1.00 0.00 ? 58  ALA D N   1 
ATOM 9243  C CA  . ALA D 1 63  ? 6.131    184.380 -35.925 1.00 0.00 ? 58  ALA D CA  1 
ATOM 9244  C C   . ALA D 1 63  ? 5.152    185.398 -35.259 1.00 0.00 ? 58  ALA D C   1 
ATOM 9245  O O   . ALA D 1 63  ? 4.125    185.700 -35.758 1.00 0.00 ? 58  ALA D O   1 
ATOM 9246  C CB  . ALA D 1 63  ? 5.940    182.942 -35.296 1.00 0.00 ? 58  ALA D CB  1 
ATOM 9247  N N   . PHE D 1 64  ? 5.459    185.985 -34.042 1.00 0.00 ? 59  PHE D N   1 
ATOM 9248  C CA  . PHE D 1 64  ? 4.809    187.082 -33.354 1.00 0.00 ? 59  PHE D CA  1 
ATOM 9249  C C   . PHE D 1 64  ? 4.838    188.350 -34.242 1.00 0.00 ? 59  PHE D C   1 
ATOM 9250  O O   . PHE D 1 64  ? 3.808    189.009 -34.413 1.00 0.00 ? 59  PHE D O   1 
ATOM 9251  C CB  . PHE D 1 64  ? 5.557    187.329 -32.031 1.00 0.00 ? 59  PHE D CB  1 
ATOM 9252  C CG  . PHE D 1 64  ? 4.899    188.293 -31.110 1.00 0.00 ? 59  PHE D CG  1 
ATOM 9253  C CD1 . PHE D 1 64  ? 3.715    187.991 -30.333 1.00 0.00 ? 59  PHE D CD1 1 
ATOM 9254  C CD2 . PHE D 1 64  ? 5.584    189.479 -30.845 1.00 0.00 ? 59  PHE D CD2 1 
ATOM 9255  C CE1 . PHE D 1 64  ? 3.315    188.875 -29.354 1.00 0.00 ? 59  PHE D CE1 1 
ATOM 9256  C CE2 . PHE D 1 64  ? 5.178    190.407 -29.924 1.00 0.00 ? 59  PHE D CE2 1 
ATOM 9257  C CZ  . PHE D 1 64  ? 4.140    190.017 -29.046 1.00 0.00 ? 59  PHE D CZ  1 
ATOM 9258  N N   . VAL D 1 65  ? 6.027    188.743 -34.878 1.00 0.00 ? 60  VAL D N   1 
ATOM 9259  C CA  . VAL D 1 65  ? 5.988    189.881 -35.743 1.00 0.00 ? 60  VAL D CA  1 
ATOM 9260  C C   . VAL D 1 65  ? 5.138    189.652 -36.974 1.00 0.00 ? 60  VAL D C   1 
ATOM 9261  O O   . VAL D 1 65  ? 4.430    190.529 -37.452 1.00 0.00 ? 60  VAL D O   1 
ATOM 9262  C CB  . VAL D 1 65  ? 7.385    190.432 -36.106 1.00 0.00 ? 60  VAL D CB  1 
ATOM 9263  C CG1 . VAL D 1 65  ? 7.274    191.613 -37.057 1.00 0.00 ? 60  VAL D CG1 1 
ATOM 9264  C CG2 . VAL D 1 65  ? 8.202    190.847 -34.852 1.00 0.00 ? 60  VAL D CG2 1 
ATOM 9265  N N   . VAL D 1 66  ? 5.039    188.424 -37.568 1.00 0.00 ? 61  VAL D N   1 
ATOM 9266  C CA  . VAL D 1 66  ? 4.017    188.180 -38.625 1.00 0.00 ? 61  VAL D CA  1 
ATOM 9267  C C   . VAL D 1 66  ? 2.586    188.353 -38.120 1.00 0.00 ? 61  VAL D C   1 
ATOM 9268  O O   . VAL D 1 66  ? 1.762    189.012 -38.710 1.00 0.00 ? 61  VAL D O   1 
ATOM 9269  C CB  . VAL D 1 66  ? 4.088    186.702 -39.232 1.00 0.00 ? 61  VAL D CB  1 
ATOM 9270  C CG1 . VAL D 1 66  ? 3.031    186.625 -40.418 1.00 0.00 ? 61  VAL D CG1 1 
ATOM 9271  C CG2 . VAL D 1 66  ? 5.506    186.611 -39.889 1.00 0.00 ? 61  VAL D CG2 1 
ATOM 9272  N N   . GLY D 1 67  ? 2.227    187.871 -36.918 1.00 0.00 ? 62  GLY D N   1 
ATOM 9273  C CA  . GLY D 1 67  ? 0.882    188.193 -36.322 1.00 0.00 ? 62  GLY D CA  1 
ATOM 9274  C C   . GLY D 1 67  ? 0.512    189.667 -36.112 1.00 0.00 ? 62  GLY D C   1 
ATOM 9275  O O   . GLY D 1 67  ? -0.646   189.969 -36.200 1.00 0.00 ? 62  GLY D O   1 
ATOM 9276  N N   . ILE D 1 68  ? 1.527    190.618 -35.873 1.00 0.00 ? 63  ILE D N   1 
ATOM 9277  C CA  . ILE D 1 68  ? 1.189    192.054 -35.791 1.00 0.00 ? 63  ILE D CA  1 
ATOM 9278  C C   . ILE D 1 68  ? 0.981    192.576 -37.216 1.00 0.00 ? 63  ILE D C   1 
ATOM 9279  O O   . ILE D 1 68  ? 0.119    193.411 -37.487 1.00 0.00 ? 63  ILE D O   1 
ATOM 9280  C CB  . ILE D 1 68  ? 2.366    192.778 -35.133 1.00 0.00 ? 63  ILE D CB  1 
ATOM 9281  C CG1 . ILE D 1 68  ? 2.702    192.268 -33.664 1.00 0.00 ? 63  ILE D CG1 1 
ATOM 9282  C CG2 . ILE D 1 68  ? 2.061    194.314 -35.141 1.00 0.00 ? 63  ILE D CG2 1 
ATOM 9283  C CD1 . ILE D 1 68  ? 3.882    193.081 -33.076 1.00 0.00 ? 63  ILE D CD1 1 
ATOM 9284  N N   . CYS D 1 69  ? 1.799    192.072 -38.193 1.00 0.00 ? 64  CYS D N   1 
ATOM 9285  C CA  . CYS D 1 69  ? 1.605    192.401 -39.639 1.00 0.00 ? 64  CYS D CA  1 
ATOM 9286  C C   . CYS D 1 69  ? 0.246    192.095 -40.258 1.00 0.00 ? 64  CYS D C   1 
ATOM 9287  O O   . CYS D 1 69  ? -0.266   192.861 -41.141 1.00 0.00 ? 64  CYS D O   1 
ATOM 9288  C CB  . CYS D 1 69  ? 2.838    191.887 -40.453 1.00 0.00 ? 64  CYS D CB  1 
ATOM 9289  S SG  . CYS D 1 69  ? 4.466    192.581 -39.792 1.00 0.00 ? 64  CYS D SG  1 
ATOM 9290  N N   . ASP D 1 70  ? -0.490   191.139 -39.675 1.00 0.00 ? 65  ASP D N   1 
ATOM 9291  C CA  . ASP D 1 70  ? -1.658   190.602 -40.282 1.00 0.00 ? 65  ASP D CA  1 
ATOM 9292  C C   . ASP D 1 70  ? -2.878   191.453 -40.113 1.00 0.00 ? 65  ASP D C   1 
ATOM 9293  O O   . ASP D 1 70  ? -3.757   191.530 -40.980 1.00 0.00 ? 65  ASP D O   1 
ATOM 9294  C CB  . ASP D 1 70  ? -1.901   189.139 -39.584 1.00 0.00 ? 65  ASP D CB  1 
ATOM 9295  C CG  . ASP D 1 70  ? -2.699   188.322 -40.538 1.00 0.00 ? 65  ASP D CG  1 
ATOM 9296  O OD1 . ASP D 1 70  ? -3.197   188.876 -41.508 1.00 0.00 ? 65  ASP D OD1 1 
ATOM 9297  O OD2 . ASP D 1 70  ? -2.834   187.109 -40.318 1.00 0.00 ? 65  ASP D OD2 1 
ATOM 9298  N N   . LEU D 1 71  ? -2.866   192.195 -39.008 1.00 0.00 ? 66  LEU D N   1 
ATOM 9299  C CA  . LEU D 1 71  ? -3.743   193.266 -38.618 1.00 0.00 ? 66  LEU D CA  1 
ATOM 9300  C C   . LEU D 1 71  ? -3.709   194.360 -39.603 1.00 0.00 ? 66  LEU D C   1 
ATOM 9301  O O   . LEU D 1 71  ? -4.669   194.978 -40.027 1.00 0.00 ? 66  LEU D O   1 
ATOM 9302  C CB  . LEU D 1 71  ? -3.346   193.821 -37.233 1.00 0.00 ? 66  LEU D CB  1 
ATOM 9303  C CG  . LEU D 1 71  ? -3.280   192.805 -36.137 1.00 0.00 ? 66  LEU D CG  1 
ATOM 9304  C CD1 . LEU D 1 71  ? -2.470   193.378 -34.908 1.00 0.00 ? 66  LEU D CD1 1 
ATOM 9305  C CD2 . LEU D 1 71  ? -4.737   192.505 -35.730 1.00 0.00 ? 66  LEU D CD2 1 
ATOM 9306  N N   . ALA D 1 72  ? -2.474   194.668 -40.053 1.00 0.00 ? 67  ALA D N   1 
ATOM 9307  C CA  . ALA D 1 72  ? -2.118   195.834 -40.839 1.00 0.00 ? 67  ALA D CA  1 
ATOM 9308  C C   . ALA D 1 72  ? -2.657   195.825 -42.305 1.00 0.00 ? 67  ALA D C   1 
ATOM 9309  O O   . ALA D 1 72  ? -3.309   196.734 -42.722 1.00 0.00 ? 67  ALA D O   1 
ATOM 9310  C CB  . ALA D 1 72  ? -0.614   196.030 -40.858 1.00 0.00 ? 67  ALA D CB  1 
ATOM 9311  N N   . ARG D 1 73  ? -2.545   194.693 -42.999 1.00 0.00 ? 68  ARG D N   1 
ATOM 9312  C CA  . ARG D 1 73  ? -3.213   194.463 -44.290 1.00 0.00 ? 68  ARG D CA  1 
ATOM 9313  C C   . ARG D 1 73  ? -4.725   194.279 -44.187 1.00 0.00 ? 68  ARG D C   1 
ATOM 9314  O O   . ARG D 1 73  ? -5.449   194.343 -45.282 1.00 0.00 ? 68  ARG D O   1 
ATOM 9315  C CB  . ARG D 1 73  ? -2.605   193.240 -44.955 1.00 0.00 ? 68  ARG D CB  1 
ATOM 9316  C CG  . ARG D 1 73  ? -2.667   191.855 -44.254 1.00 0.00 ? 68  ARG D CG  1 
ATOM 9317  C CD  . ARG D 1 73  ? -1.901   190.775 -44.948 1.00 0.00 ? 68  ARG D CD  1 
ATOM 9318  N NE  . ARG D 1 73  ? -2.057   189.604 -44.070 1.00 0.00 ? 68  ARG D NE  1 
ATOM 9319  C CZ  . ARG D 1 73  ? -2.151   188.344 -44.426 1.00 0.00 ? 68  ARG D CZ  1 
ATOM 9320  N NH1 . ARG D 1 73  ? -1.779   187.917 -45.638 1.00 0.00 ? 68  ARG D NH1 1 
ATOM 9321  N NH2 . ARG D 1 73  ? -2.663   187.337 -43.670 1.00 0.00 ? 68  ARG D NH2 1 
ATOM 9322  N N   . LEU D 1 74  ? -5.306   193.999 -43.015 1.00 0.00 ? 69  LEU D N   1 
ATOM 9323  C CA  . LEU D 1 74  ? -6.773   193.826 -42.762 1.00 0.00 ? 69  LEU D CA  1 
ATOM 9324  C C   . LEU D 1 74  ? -7.441   195.183 -42.717 1.00 0.00 ? 69  LEU D C   1 
ATOM 9325  O O   . LEU D 1 74  ? -8.521   195.459 -43.262 1.00 0.00 ? 69  LEU D O   1 
ATOM 9326  C CB  . LEU D 1 74  ? -7.040   193.084 -41.494 1.00 0.00 ? 69  LEU D CB  1 
ATOM 9327  C CG  . LEU D 1 74  ? -8.513   192.430 -41.328 1.00 0.00 ? 69  LEU D CG  1 
ATOM 9328  C CD1 . LEU D 1 74  ? -8.869   191.388 -42.450 1.00 0.00 ? 69  LEU D CD1 1 
ATOM 9329  C CD2 . LEU D 1 74  ? -8.623   191.833 -39.920 1.00 0.00 ? 69  LEU D CD2 1 
ATOM 9330  N N   . GLY D 1 75  ? -6.712   196.098 -42.030 1.00 0.00 ? 70  GLY D N   1 
ATOM 9331  C CA  . GLY D 1 75  ? -7.090   197.468 -41.791 1.00 0.00 ? 70  GLY D CA  1 
ATOM 9332  C C   . GLY D 1 75  ? -7.167   198.340 -43.013 1.00 0.00 ? 70  GLY D C   1 
ATOM 9333  O O   . GLY D 1 75  ? -7.015   197.899 -44.163 1.00 0.00 ? 70  GLY D O   1 
ATOM 9334  N N   . PRO D 1 76  ? -7.415   199.630 -42.802 1.00 0.00 ? 71  PRO D N   1 
ATOM 9335  C CA  . PRO D 1 76  ? -7.394   200.516 -43.929 1.00 0.00 ? 71  PRO D CA  1 
ATOM 9336  C C   . PRO D 1 76  ? -5.961   200.823 -44.237 1.00 0.00 ? 71  PRO D C   1 
ATOM 9337  O O   . PRO D 1 76  ? -5.094   200.671 -43.403 1.00 0.00 ? 71  PRO D O   1 
ATOM 9338  C CB  . PRO D 1 76  ? -7.980   201.823 -43.385 1.00 0.00 ? 71  PRO D CB  1 
ATOM 9339  C CG  . PRO D 1 76  ? -7.586   201.824 -41.926 1.00 0.00 ? 71  PRO D CG  1 
ATOM 9340  C CD  . PRO D 1 76  ? -7.783   200.374 -41.588 1.00 0.00 ? 71  PRO D CD  1 
ATOM 9341  N N   . PRO D 1 77  ? -5.602   201.197 -45.429 1.00 0.00 ? 72  PRO D N   1 
ATOM 9342  C CA  . PRO D 1 77  ? -4.154   201.497 -45.797 1.00 0.00 ? 72  PRO D CA  1 
ATOM 9343  C C   . PRO D 1 77  ? -3.813   203.027 -45.748 1.00 0.00 ? 72  PRO D C   1 
ATOM 9344  O O   . PRO D 1 77  ? -3.408   203.709 -46.708 1.00 0.00 ? 72  PRO D O   1 
ATOM 9345  C CB  . PRO D 1 77  ? -4.298   201.181 -47.296 1.00 0.00 ? 72  PRO D CB  1 
ATOM 9346  C CG  . PRO D 1 77  ? -5.676   201.730 -47.700 1.00 0.00 ? 72  PRO D CG  1 
ATOM 9347  C CD  . PRO D 1 77  ? -6.431   201.041 -46.572 1.00 0.00 ? 72  PRO D CD  1 
ATOM 9348  N N   . GLU D 1 78  ? -4.016   203.567 -44.495 1.00 0.00 ? 73  GLU D N   1 
ATOM 9349  C CA  . GLU D 1 78  ? -3.826   205.019 -44.324 1.00 0.00 ? 73  GLU D CA  1 
ATOM 9350  C C   . GLU D 1 78  ? -2.383   205.403 -43.959 1.00 0.00 ? 73  GLU D C   1 
ATOM 9351  O O   . GLU D 1 78  ? -1.691   204.585 -43.336 1.00 0.00 ? 73  GLU D O   1 
ATOM 9352  C CB  . GLU D 1 78  ? -4.864   205.577 -43.351 1.00 0.00 ? 73  GLU D CB  1 
ATOM 9353  C CG  . GLU D 1 78  ? -4.552   205.023 -41.943 1.00 0.00 ? 73  GLU D CG  1 
ATOM 9354  C CD  . GLU D 1 78  ? -5.417   205.685 -40.876 1.00 0.00 ? 73  GLU D CD  1 
ATOM 9355  O OE1 . GLU D 1 78  ? -6.596   205.214 -40.694 1.00 0.00 ? 73  GLU D OE1 1 
ATOM 9356  O OE2 . GLU D 1 78  ? -4.931   206.562 -40.136 1.00 0.00 ? 73  GLU D OE2 1 
ATOM 9357  N N   . PRO D 1 79  ? -1.910   206.600 -44.311 1.00 0.00 ? 74  PRO D N   1 
ATOM 9358  C CA  . PRO D 1 79  ? -0.528   207.015 -43.919 1.00 0.00 ? 74  PRO D CA  1 
ATOM 9359  C C   . PRO D 1 79  ? 0.150    206.615 -42.622 1.00 0.00 ? 74  PRO D C   1 
ATOM 9360  O O   . PRO D 1 79  ? 1.348    206.131 -42.716 1.00 0.00 ? 74  PRO D O   1 
ATOM 9361  C CB  . PRO D 1 79  ? -0.636   208.648 -44.006 1.00 0.00 ? 74  PRO D CB  1 
ATOM 9362  C CG  . PRO D 1 79  ? -1.724   208.807 -45.109 1.00 0.00 ? 74  PRO D CG  1 
ATOM 9363  C CD  . PRO D 1 79  ? -2.695   207.650 -44.822 1.00 0.00 ? 74  PRO D CD  1 
ATOM 9364  N N   . MET D 1 80  ? -0.540   206.764 -41.474 1.00 0.00 ? 75  MET D N   1 
ATOM 9365  C CA  . MET D 1 80  ? 0.046    206.310 -40.156 1.00 0.00 ? 75  MET D CA  1 
ATOM 9366  C C   . MET D 1 80  ? 0.208    204.747 -40.079 1.00 0.00 ? 75  MET D C   1 
ATOM 9367  O O   . MET D 1 80  ? 1.221    204.162 -39.687 1.00 0.00 ? 75  MET D O   1 
ATOM 9368  C CB  . MET D 1 80  ? -0.997   206.689 -39.071 1.00 0.00 ? 75  MET D CB  1 
ATOM 9369  C CG  . MET D 1 80  ? -0.414   206.350 -37.646 1.00 0.00 ? 75  MET D CG  1 
ATOM 9370  S SD  . MET D 1 80  ? -1.210   207.153 -36.172 1.00 0.00 ? 75  MET D SD  1 
ATOM 9371  C CE  . MET D 1 80  ? -2.734   206.203 -36.108 1.00 0.00 ? 75  MET D CE  1 
ATOM 9372  N N   . MET D 1 81  ? -0.744   203.935 -40.558 1.00 0.00 ? 76  MET D N   1 
ATOM 9373  C CA  . MET D 1 81  ? -0.793   202.492 -40.678 1.00 0.00 ? 76  MET D CA  1 
ATOM 9374  C C   . MET D 1 81  ? 0.170    202.080 -41.783 1.00 0.00 ? 76  MET D C   1 
ATOM 9375  O O   . MET D 1 81  ? 0.982    201.162 -41.643 1.00 0.00 ? 76  MET D O   1 
ATOM 9376  C CB  . MET D 1 81  ? -2.195   201.954 -41.088 1.00 0.00 ? 76  MET D CB  1 
ATOM 9377  C CG  . MET D 1 81  ? -3.346   202.317 -40.055 1.00 0.00 ? 76  MET D CG  1 
ATOM 9378  S SD  . MET D 1 81  ? -3.065   201.585 -38.402 1.00 0.00 ? 76  MET D SD  1 
ATOM 9379  C CE  . MET D 1 81  ? -2.456   202.982 -37.496 1.00 0.00 ? 76  MET D CE  1 
ATOM 9380  N N   . ALA D 1 82  ? 0.024    202.798 -42.958 1.00 0.00 ? 77  ALA D N   1 
ATOM 9381  C CA  . ALA D 1 82  ? 0.708    202.385 -44.168 1.00 0.00 ? 77  ALA D CA  1 
ATOM 9382  C C   . ALA D 1 82  ? 2.283    202.467 -44.001 1.00 0.00 ? 77  ALA D C   1 
ATOM 9383  O O   . ALA D 1 82  ? 3.054    201.586 -44.456 1.00 0.00 ? 77  ALA D O   1 
ATOM 9384  C CB  . ALA D 1 82  ? 0.324    203.208 -45.393 1.00 0.00 ? 77  ALA D CB  1 
ATOM 9385  N N   . GLU D 1 83  ? 2.828    203.538 -43.367 1.00 0.00 ? 78  GLU D N   1 
ATOM 9386  C CA  . GLU D 1 83  ? 4.228    203.884 -43.297 1.00 0.00 ? 78  GLU D CA  1 
ATOM 9387  C C   . GLU D 1 83  ? 4.643    203.628 -41.850 1.00 0.00 ? 78  GLU D C   1 
ATOM 9388  O O   . GLU D 1 83  ? 5.452    202.716 -41.613 1.00 0.00 ? 78  GLU D O   1 
ATOM 9389  C CB  . GLU D 1 83  ? 4.434    205.365 -43.512 1.00 0.00 ? 78  GLU D CB  1 
ATOM 9390  C CG  . GLU D 1 83  ? 5.946    205.756 -43.368 1.00 0.00 ? 78  GLU D CG  1 
ATOM 9391  C CD  . GLU D 1 83  ? 6.150    207.227 -43.831 1.00 0.00 ? 78  GLU D CD  1 
ATOM 9392  O OE1 . GLU D 1 83  ? 6.330    207.438 -45.049 1.00 0.00 ? 78  GLU D OE1 1 
ATOM 9393  O OE2 . GLU D 1 83  ? 6.272    208.195 -43.022 1.00 0.00 ? 78  GLU D OE2 1 
ATOM 9394  N N   . CYS D 1 84  ? 4.033    204.302 -40.794 1.00 0.00 ? 79  CYS D N   1 
ATOM 9395  C CA  . CYS D 1 84  ? 4.578    204.132 -39.418 1.00 0.00 ? 79  CYS D CA  1 
ATOM 9396  C C   . CYS D 1 84  ? 4.467    202.684 -38.935 1.00 0.00 ? 79  CYS D C   1 
ATOM 9397  O O   . CYS D 1 84  ? 5.486    202.123 -38.442 1.00 0.00 ? 79  CYS D O   1 
ATOM 9398  C CB  . CYS D 1 84  ? 3.950    205.138 -38.431 1.00 0.00 ? 79  CYS D CB  1 
ATOM 9399  S SG  . CYS D 1 84  ? 3.967    206.832 -38.979 1.00 0.00 ? 79  CYS D SG  1 
ATOM 9400  N N   . LEU D 1 85  ? 3.346    202.020 -39.082 1.00 0.00 ? 80  LEU D N   1 
ATOM 9401  C CA  . LEU D 1 85  ? 3.097    200.720 -38.501 1.00 0.00 ? 80  LEU D CA  1 
ATOM 9402  C C   . LEU D 1 85  ? 4.080    199.679 -39.208 1.00 0.00 ? 80  LEU D C   1 
ATOM 9403  O O   . LEU D 1 85  ? 4.586    198.735 -38.657 1.00 0.00 ? 80  LEU D O   1 
ATOM 9404  C CB  . LEU D 1 85  ? 1.647    200.264 -38.488 1.00 0.00 ? 80  LEU D CB  1 
ATOM 9405  C CG  . LEU D 1 85  ? 1.211    199.045 -37.561 1.00 0.00 ? 80  LEU D CG  1 
ATOM 9406  C CD1 . LEU D 1 85  ? 1.180    199.494 -36.034 1.00 0.00 ? 80  LEU D CD1 1 
ATOM 9407  C CD2 . LEU D 1 85  ? -0.088   198.448 -38.052 1.00 0.00 ? 80  LEU D CD2 1 
ATOM 9408  N N   . GLU D 1 86  ? 4.270    199.903 -40.519 1.00 0.00 ? 81  GLU D N   1 
ATOM 9409  C CA  . GLU D 1 86  ? 5.286    199.137 -41.276 1.00 0.00 ? 81  GLU D CA  1 
ATOM 9410  C C   . GLU D 1 86  ? 6.759    199.407 -40.884 1.00 0.00 ? 81  GLU D C   1 
ATOM 9411  O O   . GLU D 1 86  ? 7.583    198.488 -40.869 1.00 0.00 ? 81  GLU D O   1 
ATOM 9412  C CB  . GLU D 1 86  ? 5.246    199.464 -42.812 1.00 0.00 ? 81  GLU D CB  1 
ATOM 9413  C CG  . GLU D 1 86  ? 5.905    198.314 -43.671 1.00 0.00 ? 81  GLU D CG  1 
ATOM 9414  C CD  . GLU D 1 86  ? 5.866    198.485 -45.130 1.00 0.00 ? 81  GLU D CD  1 
ATOM 9415  O OE1 . GLU D 1 86  ? 6.607    199.294 -45.739 1.00 0.00 ? 81  GLU D OE1 1 
ATOM 9416  O OE2 . GLU D 1 86  ? 5.038    197.715 -45.712 1.00 0.00 ? 81  GLU D OE2 1 
ATOM 9417  N N   . LYS D 1 87  ? 7.126    200.651 -40.534 1.00 0.00 ? 82  LYS D N   1 
ATOM 9418  C CA  . LYS D 1 87  ? 8.478    200.982 -40.148 1.00 0.00 ? 82  LYS D CA  1 
ATOM 9419  C C   . LYS D 1 87  ? 8.736    200.415 -38.779 1.00 0.00 ? 82  LYS D C   1 
ATOM 9420  O O   . LYS D 1 87  ? 9.852    199.923 -38.578 1.00 0.00 ? 82  LYS D O   1 
ATOM 9421  C CB  . LYS D 1 87  ? 8.651    202.519 -40.198 1.00 0.00 ? 82  LYS D CB  1 
ATOM 9422  C CG  . LYS D 1 87  ? 8.784    203.046 -41.656 1.00 0.00 ? 82  LYS D CG  1 
ATOM 9423  C CD  . LYS D 1 87  ? 10.180   202.904 -42.348 1.00 0.00 ? 82  LYS D CD  1 
ATOM 9424  C CE  . LYS D 1 87  ? 10.257   203.693 -43.634 1.00 0.00 ? 82  LYS D CE  1 
ATOM 9425  N NZ  . LYS D 1 87  ? 11.396   203.340 -44.390 1.00 0.00 ? 82  LYS D NZ  1 
ATOM 9426  N N   . PHE D 1 88  ? 7.725    200.304 -37.931 1.00 0.00 ? 83  PHE D N   1 
ATOM 9427  C CA  . PHE D 1 88  ? 7.947    199.692 -36.617 1.00 0.00 ? 83  PHE D CA  1 
ATOM 9428  C C   . PHE D 1 88  ? 8.223    198.239 -36.669 1.00 0.00 ? 83  PHE D C   1 
ATOM 9429  O O   . PHE D 1 88  ? 9.135    197.682 -36.090 1.00 0.00 ? 83  PHE D O   1 
ATOM 9430  C CB  . PHE D 1 88  ? 6.801    199.908 -35.589 1.00 0.00 ? 83  PHE D CB  1 
ATOM 9431  C CG  . PHE D 1 88  ? 6.754    201.345 -35.114 1.00 0.00 ? 83  PHE D CG  1 
ATOM 9432  C CD1 . PHE D 1 88  ? 7.763    201.846 -34.227 1.00 0.00 ? 83  PHE D CD1 1 
ATOM 9433  C CD2 . PHE D 1 88  ? 5.608    202.139 -35.313 1.00 0.00 ? 83  PHE D CD2 1 
ATOM 9434  C CE1 . PHE D 1 88  ? 7.638    203.170 -33.739 1.00 0.00 ? 83  PHE D CE1 1 
ATOM 9435  C CE2 . PHE D 1 88  ? 5.413    203.370 -34.666 1.00 0.00 ? 83  PHE D CE2 1 
ATOM 9436  C CZ  . PHE D 1 88  ? 6.442    203.912 -33.948 1.00 0.00 ? 83  PHE D CZ  1 
ATOM 9437  N N   . THR D 1 89  ? 7.520    197.495 -37.519 1.00 0.00 ? 84  THR D N   1 
ATOM 9438  C CA  . THR D 1 89  ? 7.553    196.026 -37.596 1.00 0.00 ? 84  THR D CA  1 
ATOM 9439  C C   . THR D 1 89  ? 8.823    195.574 -38.478 1.00 0.00 ? 84  THR D C   1 
ATOM 9440  O O   . THR D 1 89  ? 9.365    194.534 -38.078 1.00 0.00 ? 84  THR D O   1 
ATOM 9441  C CB  . THR D 1 89  ? 6.305    195.410 -38.106 1.00 0.00 ? 84  THR D CB  1 
ATOM 9442  O OG1 . THR D 1 89  ? 5.981    195.958 -39.387 1.00 0.00 ? 84  THR D OG1 1 
ATOM 9443  C CG2 . THR D 1 89  ? 5.031    195.636 -37.185 1.00 0.00 ? 84  THR D CG2 1 
ATOM 9444  N N   . VAL D 1 90  ? 9.182    196.288 -39.491 1.00 0.00 ? 85  VAL D N   1 
ATOM 9445  C CA  . VAL D 1 90  ? 10.382   195.966 -40.326 1.00 0.00 ? 85  VAL D CA  1 
ATOM 9446  C C   . VAL D 1 90  ? 11.677   196.202 -39.469 1.00 0.00 ? 85  VAL D C   1 
ATOM 9447  O O   . VAL D 1 90  ? 12.626   195.474 -39.551 1.00 0.00 ? 85  VAL D O   1 
ATOM 9448  C CB  . VAL D 1 90  ? 10.323   196.929 -41.514 1.00 0.00 ? 85  VAL D CB  1 
ATOM 9449  C CG1 . VAL D 1 90  ? 11.770   197.092 -42.193 1.00 0.00 ? 85  VAL D CG1 1 
ATOM 9450  C CG2 . VAL D 1 90  ? 9.315    196.536 -42.563 1.00 0.00 ? 85  VAL D CG2 1 
ATOM 9451  N N   . SER D 1 91  ? 11.703   197.263 -38.639 1.00 0.00 ? 86  SER D N   1 
ATOM 9452  C CA  . SER D 1 91  ? 12.739   197.431 -37.660 1.00 0.00 ? 86  SER D CA  1 
ATOM 9453  C C   . SER D 1 91  ? 12.792   196.225 -36.708 1.00 0.00 ? 86  SER D C   1 
ATOM 9454  O O   . SER D 1 91  ? 13.930   195.782 -36.464 1.00 0.00 ? 86  SER D O   1 
ATOM 9455  C CB  . SER D 1 91  ? 12.485   198.683 -36.783 1.00 0.00 ? 86  SER D CB  1 
ATOM 9456  O OG  . SER D 1 91  ? 13.584   199.003 -35.890 1.00 0.00 ? 86  SER D OG  1 
ATOM 9457  N N   . LEU D 1 92  ? 11.652   195.668 -36.269 1.00 0.00 ? 87  LEU D N   1 
ATOM 9458  C CA  . LEU D 1 92  ? 11.616   194.371 -35.547 1.00 0.00 ? 87  LEU D CA  1 
ATOM 9459  C C   . LEU D 1 92  ? 12.218   193.209 -36.257 1.00 0.00 ? 87  LEU D C   1 
ATOM 9460  O O   . LEU D 1 92  ? 12.986   192.423 -35.611 1.00 0.00 ? 87  LEU D O   1 
ATOM 9461  C CB  . LEU D 1 92  ? 10.273   194.124 -34.872 1.00 0.00 ? 87  LEU D CB  1 
ATOM 9462  C CG  . LEU D 1 92  ? 9.804    195.315 -33.961 1.00 0.00 ? 87  LEU D CG  1 
ATOM 9463  C CD1 . LEU D 1 92  ? 8.345    195.159 -33.721 1.00 0.00 ? 87  LEU D CD1 1 
ATOM 9464  C CD2 . LEU D 1 92  ? 10.601   195.353 -32.683 1.00 0.00 ? 87  LEU D CD2 1 
ATOM 9465  N N   . ASN D 1 93  ? 12.044   193.096 -37.550 1.00 0.00 ? 88  ASN D N   1 
ATOM 9466  C CA  . ASN D 1 93  ? 12.603   191.899 -38.343 1.00 0.00 ? 88  ASN D CA  1 
ATOM 9467  C C   . ASN D 1 93  ? 14.086   192.067 -38.556 1.00 0.00 ? 88  ASN D C   1 
ATOM 9468  O O   . ASN D 1 93  ? 14.924   191.133 -38.583 1.00 0.00 ? 88  ASN D O   1 
ATOM 9469  C CB  . ASN D 1 93  ? 11.772   191.466 -39.643 1.00 0.00 ? 88  ASN D CB  1 
ATOM 9470  C CG  . ASN D 1 93  ? 10.395   191.081 -39.177 1.00 0.00 ? 88  ASN D CG  1 
ATOM 9471  O OD1 . ASN D 1 93  ? 10.196   190.259 -38.312 1.00 0.00 ? 88  ASN D OD1 1 
ATOM 9472  N ND2 . ASN D 1 93  ? 9.364    191.698 -39.781 1.00 0.00 ? 88  ASN D ND2 1 
ATOM 9473  N N   . HIS D 1 94  ? 14.583   193.341 -38.753 1.00 0.00 ? 89  HIS D N   1 
ATOM 9474  C CA  . HIS D 1 94  ? 15.968   193.810 -38.999 1.00 0.00 ? 89  HIS D CA  1 
ATOM 9475  C C   . HIS D 1 94  ? 16.821   193.451 -37.803 1.00 0.00 ? 89  HIS D C   1 
ATOM 9476  O O   . HIS D 1 94  ? 17.915   192.826 -37.781 1.00 0.00 ? 89  HIS D O   1 
ATOM 9477  C CB  . HIS D 1 94  ? 15.937   195.372 -39.128 1.00 0.00 ? 89  HIS D CB  1 
ATOM 9478  C CG  . HIS D 1 94  ? 15.817   195.667 -40.611 1.00 0.00 ? 89  HIS D CG  1 
ATOM 9479  N ND1 . HIS D 1 94  ? 14.890   195.050 -41.438 1.00 0.00 ? 89  HIS D ND1 1 
ATOM 9480  C CD2 . HIS D 1 94  ? 16.385   196.605 -41.401 1.00 0.00 ? 89  HIS D CD2 1 
ATOM 9481  C CE1 . HIS D 1 94  ? 15.003   195.551 -42.686 1.00 0.00 ? 89  HIS D CE1 1 
ATOM 9482  N NE2 . HIS D 1 94  ? 15.941   196.547 -42.712 1.00 0.00 ? 89  HIS D NE2 1 
ATOM 9483  N N   . LYS D 1 95  ? 16.249   193.798 -36.622 1.00 0.00 ? 90  LYS D N   1 
ATOM 9484  C CA  . LYS D 1 95  ? 16.812   193.402 -35.285 1.00 0.00 ? 90  LYS D CA  1 
ATOM 9485  C C   . LYS D 1 95  ? 16.949   191.842 -34.991 1.00 0.00 ? 90  LYS D C   1 
ATOM 9486  O O   . LYS D 1 95  ? 17.974   191.376 -34.662 1.00 0.00 ? 90  LYS D O   1 
ATOM 9487  C CB  . LYS D 1 95  ? 16.175   194.354 -34.230 1.00 0.00 ? 90  LYS D CB  1 
ATOM 9488  C CG  . LYS D 1 95  ? 16.432   195.880 -34.441 1.00 0.00 ? 90  LYS D CG  1 
ATOM 9489  C CD  . LYS D 1 95  ? 17.861   196.227 -33.989 1.00 0.00 ? 90  LYS D CD  1 
ATOM 9490  C CE  . LYS D 1 95  ? 18.280   197.641 -34.404 1.00 0.00 ? 90  LYS D CE  1 
ATOM 9491  N NZ  . LYS D 1 95  ? 18.558   197.769 -35.842 1.00 0.00 ? 90  LYS D NZ  1 
ATOM 9492  N N   . LEU D 1 96  ? 15.947   191.046 -35.447 1.00 0.00 ? 91  LEU D N   1 
ATOM 9493  C CA  . LEU D 1 96  ? 16.014   189.585 -35.465 1.00 0.00 ? 91  LEU D CA  1 
ATOM 9494  C C   . LEU D 1 96  ? 17.215   189.045 -36.339 1.00 0.00 ? 91  LEU D C   1 
ATOM 9495  O O   . LEU D 1 96  ? 17.926   188.095 -35.952 1.00 0.00 ? 91  LEU D O   1 
ATOM 9496  C CB  . LEU D 1 96  ? 14.710   188.829 -35.723 1.00 0.00 ? 91  LEU D CB  1 
ATOM 9497  C CG  . LEU D 1 96  ? 13.496   189.283 -34.824 1.00 0.00 ? 91  LEU D CG  1 
ATOM 9498  C CD1 . LEU D 1 96  ? 12.298   188.492 -35.341 1.00 0.00 ? 91  LEU D CD1 1 
ATOM 9499  C CD2 . LEU D 1 96  ? 13.717   188.965 -33.327 1.00 0.00 ? 91  LEU D CD2 1 
ATOM 9500  N N   . ASP D 1 97  ? 17.323   189.481 -37.587 1.00 0.00 ? 92  ASP D N   1 
ATOM 9501  C CA  . ASP D 1 97  ? 18.479   189.158 -38.412 1.00 0.00 ? 92  ASP D CA  1 
ATOM 9502  C C   . ASP D 1 97  ? 19.871   189.544 -37.872 1.00 0.00 ? 92  ASP D C   1 
ATOM 9503  O O   . ASP D 1 97  ? 20.866   188.943 -38.202 1.00 0.00 ? 92  ASP D O   1 
ATOM 9504  C CB  . ASP D 1 97  ? 18.276   189.913 -39.768 1.00 0.00 ? 92  ASP D CB  1 
ATOM 9505  C CG  . ASP D 1 97  ? 17.042   189.173 -40.430 1.00 0.00 ? 92  ASP D CG  1 
ATOM 9506  O OD1 . ASP D 1 97  ? 17.130   187.903 -40.586 1.00 0.00 ? 92  ASP D OD1 1 
ATOM 9507  O OD2 . ASP D 1 97  ? 16.020   189.763 -40.798 1.00 0.00 ? 92  ASP D OD2 1 
ATOM 9508  N N   . SER D 1 98  ? 20.009   190.722 -37.213 1.00 0.00 ? 93  SER D N   1 
ATOM 9509  C CA  . SER D 1 98  ? 21.264   191.163 -36.584 1.00 0.00 ? 93  SER D CA  1 
ATOM 9510  C C   . SER D 1 98  ? 21.626   190.324 -35.414 1.00 0.00 ? 93  SER D C   1 
ATOM 9511  O O   . SER D 1 98  ? 22.803   189.934 -35.213 1.00 0.00 ? 93  SER D O   1 
ATOM 9512  C CB  . SER D 1 98  ? 21.041   192.586 -36.293 1.00 0.00 ? 93  SER D CB  1 
ATOM 9513  O OG  . SER D 1 98  ? 22.192   193.122 -35.636 1.00 0.00 ? 93  SER D OG  1 
ATOM 9514  N N   . HIS D 1 99  ? 20.638   189.942 -34.631 1.00 0.00 ? 94  HIS D N   1 
ATOM 9515  C CA  . HIS D 1 99  ? 20.736   189.061 -33.573 1.00 0.00 ? 94  HIS D CA  1 
ATOM 9516  C C   . HIS D 1 99  ? 21.097   187.601 -33.953 1.00 0.00 ? 94  HIS D C   1 
ATOM 9517  O O   . HIS D 1 99  ? 21.865   186.854 -33.391 1.00 0.00 ? 94  HIS D O   1 
ATOM 9518  C CB  . HIS D 1 99  ? 19.569   189.119 -32.599 1.00 0.00 ? 94  HIS D CB  1 
ATOM 9519  C CG  . HIS D 1 99  ? 19.869   188.634 -31.267 1.00 0.00 ? 94  HIS D CG  1 
ATOM 9520  N ND1 . HIS D 1 99  ? 20.751   189.239 -30.387 1.00 0.00 ? 94  HIS D ND1 1 
ATOM 9521  C CD2 . HIS D 1 99  ? 19.468   187.524 -30.640 1.00 0.00 ? 94  HIS D CD2 1 
ATOM 9522  C CE1 . HIS D 1 99  ? 20.701   188.561 -29.243 1.00 0.00 ? 94  HIS D CE1 1 
ATOM 9523  N NE2 . HIS D 1 99  ? 19.928   187.495 -29.305 1.00 0.00 ? 94  HIS D NE2 1 
ATOM 9524  N N   . ALA D 1 100 ? 20.561   187.138 -35.114 1.00 0.00 ? 95  ALA D N   1 
ATOM 9525  C CA  . ALA D 1 100 ? 21.028   185.986 -35.854 1.00 0.00 ? 95  ALA D CA  1 
ATOM 9526  C C   . ALA D 1 100 ? 22.527   186.072 -36.178 1.00 0.00 ? 95  ALA D C   1 
ATOM 9527  O O   . ALA D 1 100 ? 23.168   185.096 -35.906 1.00 0.00 ? 95  ALA D O   1 
ATOM 9528  C CB  . ALA D 1 100 ? 20.113   185.812 -37.039 1.00 0.00 ? 95  ALA D CB  1 
ATOM 9529  N N   . GLU D 1 101 ? 23.055   187.246 -36.627 1.00 0.00 ? 96  GLU D N   1 
ATOM 9530  C CA  . GLU D 1 101 ? 24.453   187.335 -36.838 1.00 0.00 ? 96  GLU D CA  1 
ATOM 9531  C C   . GLU D 1 101 ? 25.255   187.176 -35.547 1.00 0.00 ? 96  GLU D C   1 
ATOM 9532  O O   . GLU D 1 101 ? 26.283   186.517 -35.504 1.00 0.00 ? 96  GLU D O   1 
ATOM 9533  C CB  . GLU D 1 101 ? 24.857   188.570 -37.667 1.00 0.00 ? 96  GLU D CB  1 
ATOM 9534  C CG  . GLU D 1 101 ? 24.313   188.661 -39.101 1.00 0.00 ? 96  GLU D CG  1 
ATOM 9535  C CD  . GLU D 1 101 ? 24.727   189.878 -39.902 1.00 0.00 ? 96  GLU D CD  1 
ATOM 9536  O OE1 . GLU D 1 101 ? 24.389   191.021 -39.457 1.00 0.00 ? 96  GLU D OE1 1 
ATOM 9537  O OE2 . GLU D 1 101 ? 25.344   189.788 -40.969 1.00 0.00 ? 96  GLU D OE2 1 
ATOM 9538  N N   . LEU D 1 102 ? 24.715   187.655 -34.373 1.00 0.00 ? 97  LEU D N   1 
ATOM 9539  C CA  . LEU D 1 102 ? 25.370   187.420 -33.083 1.00 0.00 ? 97  LEU D CA  1 
ATOM 9540  C C   . LEU D 1 102 ? 25.350   185.921 -32.654 1.00 0.00 ? 97  LEU D C   1 
ATOM 9541  O O   . LEU D 1 102 ? 26.313   185.397 -32.073 1.00 0.00 ? 97  LEU D O   1 
ATOM 9542  C CB  . LEU D 1 102 ? 24.602   188.184 -32.014 1.00 0.00 ? 97  LEU D CB  1 
ATOM 9543  C CG  . LEU D 1 102 ? 25.301   188.195 -30.614 1.00 0.00 ? 97  LEU D CG  1 
ATOM 9544  C CD1 . LEU D 1 102 ? 26.664   188.823 -30.638 1.00 0.00 ? 97  LEU D CD1 1 
ATOM 9545  C CD2 . LEU D 1 102 ? 24.431   189.051 -29.677 1.00 0.00 ? 97  LEU D CD2 1 
ATOM 9546  N N   . LEU D 1 103 ? 24.256   185.151 -32.879 1.00 0.00 ? 98  LEU D N   1 
ATOM 9547  C CA  . LEU D 1 103 ? 24.260   183.741 -32.614 1.00 0.00 ? 98  LEU D CA  1 
ATOM 9548  C C   . LEU D 1 103 ? 25.180   182.999 -33.626 1.00 0.00 ? 98  LEU D C   1 
ATOM 9549  O O   . LEU D 1 103 ? 25.890   182.117 -33.261 1.00 0.00 ? 98  LEU D O   1 
ATOM 9550  C CB  . LEU D 1 103 ? 22.774   183.126 -32.798 1.00 0.00 ? 98  LEU D CB  1 
ATOM 9551  C CG  . LEU D 1 103 ? 21.834   183.541 -31.670 1.00 0.00 ? 98  LEU D CG  1 
ATOM 9552  C CD1 . LEU D 1 103 ? 20.515   182.821 -31.962 1.00 0.00 ? 98  LEU D CD1 1 
ATOM 9553  C CD2 . LEU D 1 103 ? 22.392   183.236 -30.240 1.00 0.00 ? 98  LEU D CD2 1 
ATOM 9554  N N   . ASP D 1 104 ? 25.288   183.380 -34.894 1.00 0.00 ? 99  ASP D N   1 
ATOM 9555  C CA  . ASP D 1 104 ? 26.306   182.896 -35.761 1.00 0.00 ? 99  ASP D CA  1 
ATOM 9556  C C   . ASP D 1 104 ? 27.695   183.191 -35.262 1.00 0.00 ? 99  ASP D C   1 
ATOM 9557  O O   . ASP D 1 104 ? 28.482   182.257 -35.186 1.00 0.00 ? 99  ASP D O   1 
ATOM 9558  C CB  . ASP D 1 104 ? 26.139   183.368 -37.228 1.00 0.00 ? 99  ASP D CB  1 
ATOM 9559  C CG  . ASP D 1 104 ? 25.145   182.541 -37.816 1.00 0.00 ? 99  ASP D CG  1 
ATOM 9560  O OD1 . ASP D 1 104 ? 25.405   181.354 -38.154 1.00 0.00 ? 99  ASP D OD1 1 
ATOM 9561  O OD2 . ASP D 1 104 ? 23.976   183.086 -37.910 1.00 0.00 ? 99  ASP D OD2 1 
ATOM 9562  N N   . ALA D 1 105 ? 27.977   184.388 -34.772 1.00 0.00 ? 100 ALA D N   1 
ATOM 9563  C CA  . ALA D 1 105 ? 29.295   184.683 -34.269 1.00 0.00 ? 100 ALA D CA  1 
ATOM 9564  C C   . ALA D 1 105 ? 29.623   184.014 -32.938 1.00 0.00 ? 100 ALA D C   1 
ATOM 9565  O O   . ALA D 1 105 ? 30.679   183.468 -32.632 1.00 0.00 ? 100 ALA D O   1 
ATOM 9566  C CB  . ALA D 1 105 ? 29.412   186.256 -34.199 1.00 0.00 ? 100 ALA D CB  1 
ATOM 9567  N N   . THR D 1 106 ? 28.682   183.884 -31.969 1.00 0.00 ? 101 THR D N   1 
ATOM 9568  C CA  . THR D 1 106 ? 28.808   182.989 -30.751 1.00 0.00 ? 101 THR D CA  1 
ATOM 9569  C C   . THR D 1 106 ? 29.159   181.529 -31.031 1.00 0.00 ? 101 THR D C   1 
ATOM 9570  O O   . THR D 1 106 ? 30.069   180.886 -30.481 1.00 0.00 ? 101 THR D O   1 
ATOM 9571  C CB  . THR D 1 106 ? 27.616   183.044 -29.834 1.00 0.00 ? 101 THR D CB  1 
ATOM 9572  O OG1 . THR D 1 106 ? 27.654   184.297 -29.105 1.00 0.00 ? 101 THR D OG1 1 
ATOM 9573  C CG2 . THR D 1 106 ? 27.737   182.027 -28.765 1.00 0.00 ? 101 THR D CG2 1 
ATOM 9574  N N   . GLN D 1 107 ? 28.522   180.901 -32.006 1.00 0.00 ? 102 GLN D N   1 
ATOM 9575  C CA  . GLN D 1 107 ? 28.805   179.607 -32.530 1.00 0.00 ? 102 GLN D CA  1 
ATOM 9576  C C   . GLN D 1 107 ? 30.227   179.499 -33.033 1.00 0.00 ? 102 GLN D C   1 
ATOM 9577  O O   . GLN D 1 107 ? 30.998   178.562 -32.746 1.00 0.00 ? 102 GLN D O   1 
ATOM 9578  C CB  . GLN D 1 107 ? 27.930   179.310 -33.795 1.00 0.00 ? 102 GLN D CB  1 
ATOM 9579  C CG  . GLN D 1 107 ? 27.874   177.762 -34.249 1.00 0.00 ? 102 GLN D CG  1 
ATOM 9580  C CD  . GLN D 1 107 ? 27.033   177.731 -35.562 1.00 0.00 ? 102 GLN D CD  1 
ATOM 9581  O OE1 . GLN D 1 107 ? 25.897   178.200 -35.682 1.00 0.00 ? 102 GLN D OE1 1 
ATOM 9582  N NE2 . GLN D 1 107 ? 27.692   177.248 -36.628 1.00 0.00 ? 102 GLN D NE2 1 
ATOM 9583  N N   . HIS D 1 108 ? 30.698   180.478 -33.841 1.00 0.00 ? 103 HIS D N   1 
ATOM 9584  C CA  . HIS D 1 108 ? 32.072   180.587 -34.410 1.00 0.00 ? 103 HIS D CA  1 
ATOM 9585  C C   . HIS D 1 108 ? 33.027   180.545 -33.289 1.00 0.00 ? 103 HIS D C   1 
ATOM 9586  O O   . HIS D 1 108 ? 33.844   179.654 -33.149 1.00 0.00 ? 103 HIS D O   1 
ATOM 9587  C CB  . HIS D 1 108 ? 32.262   181.856 -35.200 1.00 0.00 ? 103 HIS D CB  1 
ATOM 9588  C CG  . HIS D 1 108 ? 33.572   181.865 -35.985 1.00 0.00 ? 103 HIS D CG  1 
ATOM 9589  N ND1 . HIS D 1 108 ? 34.524   182.765 -35.622 1.00 0.00 ? 103 HIS D ND1 1 
ATOM 9590  C CD2 . HIS D 1 108 ? 34.213   181.079 -36.911 1.00 0.00 ? 103 HIS D CD2 1 
ATOM 9591  C CE1 . HIS D 1 108 ? 35.636   182.628 -36.350 1.00 0.00 ? 103 HIS D CE1 1 
ATOM 9592  N NE2 . HIS D 1 108 ? 35.530   181.594 -37.135 1.00 0.00 ? 103 HIS D NE2 1 
ATOM 9593  N N   . THR D 1 109 ? 32.820   181.433 -32.333 1.00 0.00 ? 104 THR D N   1 
ATOM 9594  C CA  . THR D 1 109 ? 33.535   181.641 -31.050 1.00 0.00 ? 104 THR D CA  1 
ATOM 9595  C C   . THR D 1 109 ? 33.658   180.325 -30.295 1.00 0.00 ? 104 THR D C   1 
ATOM 9596  O O   . THR D 1 109 ? 34.755   180.010 -29.895 1.00 0.00 ? 104 THR D O   1 
ATOM 9597  C CB  . THR D 1 109 ? 33.057   182.689 -30.219 1.00 0.00 ? 104 THR D CB  1 
ATOM 9598  O OG1 . THR D 1 109 ? 33.303   183.855 -31.001 1.00 0.00 ? 104 THR D OG1 1 
ATOM 9599  C CG2 . THR D 1 109 ? 33.896   182.949 -28.974 1.00 0.00 ? 104 THR D CG2 1 
ATOM 9600  N N   . LEU D 1 110 ? 32.597   179.602 -30.086 1.00 0.00 ? 105 LEU D N   1 
ATOM 9601  C CA  . LEU D 1 110 ? 32.487   178.303 -29.385 1.00 0.00 ? 105 LEU D CA  1 
ATOM 9602  C C   . LEU D 1 110 ? 33.140   177.198 -30.178 1.00 0.00 ? 105 LEU D C   1 
ATOM 9603  O O   . LEU D 1 110 ? 33.970   176.476 -29.682 1.00 0.00 ? 105 LEU D O   1 
ATOM 9604  C CB  . LEU D 1 110 ? 30.929   178.111 -29.205 1.00 0.00 ? 105 LEU D CB  1 
ATOM 9605  C CG  . LEU D 1 110 ? 30.450   176.893 -28.377 1.00 0.00 ? 105 LEU D CG  1 
ATOM 9606  C CD1 . LEU D 1 110 ? 30.722   177.173 -26.843 1.00 0.00 ? 105 LEU D CD1 1 
ATOM 9607  C CD2 . LEU D 1 110 ? 28.948   176.588 -28.626 1.00 0.00 ? 105 LEU D CD2 1 
ATOM 9608  N N   . GLN D 1 111 ? 32.898   177.090 -31.507 1.00 0.00 ? 106 GLN D N   1 
ATOM 9609  C CA  . GLN D 1 111 ? 33.639   176.140 -32.407 1.00 0.00 ? 106 GLN D CA  1 
ATOM 9610  C C   . GLN D 1 111 ? 35.164   176.374 -32.573 1.00 0.00 ? 106 GLN D C   1 
ATOM 9611  O O   . GLN D 1 111 ? 35.967   175.437 -32.537 1.00 0.00 ? 106 GLN D O   1 
ATOM 9612  C CB  . GLN D 1 111 ? 32.881   176.119 -33.709 1.00 0.00 ? 106 GLN D CB  1 
ATOM 9613  C CG  . GLN D 1 111 ? 33.529   175.406 -34.897 1.00 0.00 ? 106 GLN D CG  1 
ATOM 9614  C CD  . GLN D 1 111 ? 32.464   174.958 -35.916 1.00 0.00 ? 106 GLN D CD  1 
ATOM 9615  O OE1 . GLN D 1 111 ? 31.295   175.379 -35.850 1.00 0.00 ? 106 GLN D OE1 1 
ATOM 9616  N NE2 . GLN D 1 111 ? 32.709   173.941 -36.763 1.00 0.00 ? 106 GLN D NE2 1 
ATOM 9617  N N   . GLN D 1 112 ? 35.589   177.647 -32.599 1.00 0.00 ? 107 GLN D N   1 
ATOM 9618  C CA  . GLN D 1 112 ? 36.995   178.033 -32.465 1.00 0.00 ? 107 GLN D CA  1 
ATOM 9619  C C   . GLN D 1 112 ? 37.673   177.559 -31.193 1.00 0.00 ? 107 GLN D C   1 
ATOM 9620  O O   . GLN D 1 112 ? 38.747   176.934 -31.237 1.00 0.00 ? 107 GLN D O   1 
ATOM 9621  C CB  . GLN D 1 112 ? 37.210   179.564 -32.593 1.00 0.00 ? 107 GLN D CB  1 
ATOM 9622  C CG  . GLN D 1 112 ? 38.645   180.153 -32.861 1.00 0.00 ? 107 GLN D CG  1 
ATOM 9623  C CD  . GLN D 1 112 ? 38.699   181.670 -32.881 1.00 0.00 ? 107 GLN D CD  1 
ATOM 9624  O OE1 . GLN D 1 112 ? 38.918   182.236 -31.801 1.00 0.00 ? 107 GLN D OE1 1 
ATOM 9625  N NE2 . GLN D 1 112 ? 38.535   182.367 -33.999 1.00 0.00 ? 107 GLN D NE2 1 
ATOM 9626  N N   . GLN D 1 113 ? 37.111   177.905 -30.028 1.00 0.00 ? 108 GLN D N   1 
ATOM 9627  C CA  . GLN D 1 113 ? 37.856   177.711 -28.802 1.00 0.00 ? 108 GLN D CA  1 
ATOM 9628  C C   . GLN D 1 113 ? 37.473   176.429 -28.068 1.00 0.00 ? 108 GLN D C   1 
ATOM 9629  O O   . GLN D 1 113 ? 38.206   175.475 -27.767 1.00 0.00 ? 108 GLN D O   1 
ATOM 9630  C CB  . GLN D 1 113 ? 37.690   178.877 -27.852 1.00 0.00 ? 108 GLN D CB  1 
ATOM 9631  C CG  . GLN D 1 113 ? 38.312   180.275 -28.325 1.00 0.00 ? 108 GLN D CG  1 
ATOM 9632  C CD  . GLN D 1 113 ? 39.790   180.300 -28.706 1.00 0.00 ? 108 GLN D CD  1 
ATOM 9633  O OE1 . GLN D 1 113 ? 40.182   179.812 -29.815 1.00 0.00 ? 108 GLN D OE1 1 
ATOM 9634  N NE2 . GLN D 1 113 ? 40.575   180.847 -27.748 1.00 0.00 ? 108 GLN D NE2 1 
ATOM 9635  N N   . ILE D 1 114 ? 36.188   176.307 -27.718 1.00 0.00 ? 109 ILE D N   1 
ATOM 9636  C CA  . ILE D 1 114 ? 35.777   175.282 -26.756 1.00 0.00 ? 109 ILE D CA  1 
ATOM 9637  C C   . ILE D 1 114 ? 35.603   173.963 -27.389 1.00 0.00 ? 109 ILE D C   1 
ATOM 9638  O O   . ILE D 1 114 ? 35.947   172.888 -26.825 1.00 0.00 ? 109 ILE D O   1 
ATOM 9639  C CB  . ILE D 1 114 ? 34.399   175.568 -26.024 1.00 0.00 ? 109 ILE D CB  1 
ATOM 9640  C CG1 . ILE D 1 114 ? 34.270   176.957 -25.344 1.00 0.00 ? 109 ILE D CG1 1 
ATOM 9641  C CG2 . ILE D 1 114 ? 34.175   174.524 -24.966 1.00 0.00 ? 109 ILE D CG2 1 
ATOM 9642  C CD1 . ILE D 1 114 ? 35.345   177.324 -24.348 1.00 0.00 ? 109 ILE D CD1 1 
ATOM 9643  N N   . GLN D 1 115 ? 35.152   173.853 -28.626 1.00 0.00 ? 110 GLN D N   1 
ATOM 9644  C CA  . GLN D 1 115 ? 35.182   172.671 -29.392 1.00 0.00 ? 110 GLN D CA  1 
ATOM 9645  C C   . GLN D 1 115 ? 36.463   172.055 -29.800 1.00 0.00 ? 110 GLN D C   1 
ATOM 9646  O O   . GLN D 1 115 ? 36.630   170.876 -29.568 1.00 0.00 ? 110 GLN D O   1 
ATOM 9647  C CB  . GLN D 1 115 ? 34.189   172.879 -30.544 1.00 0.00 ? 110 GLN D CB  1 
ATOM 9648  C CG  . GLN D 1 115 ? 33.627   171.677 -31.311 1.00 0.00 ? 110 GLN D CG  1 
ATOM 9649  C CD  . GLN D 1 115 ? 32.566   172.173 -32.339 1.00 0.00 ? 110 GLN D CD  1 
ATOM 9650  O OE1 . GLN D 1 115 ? 31.578   172.840 -32.018 1.00 0.00 ? 110 GLN D OE1 1 
ATOM 9651  N NE2 . GLN D 1 115 ? 32.711   171.940 -33.637 1.00 0.00 ? 110 GLN D NE2 1 
ATOM 9652  N N   . THR D 1 116 ? 37.336   172.925 -30.230 1.00 0.00 ? 111 THR D N   1 
ATOM 9653  C CA  . THR D 1 116 ? 38.733   172.608 -30.424 1.00 0.00 ? 111 THR D CA  1 
ATOM 9654  C C   . THR D 1 116 ? 39.421   172.136 -29.156 1.00 0.00 ? 111 THR D C   1 
ATOM 9655  O O   . THR D 1 116 ? 40.134   171.094 -29.165 1.00 0.00 ? 111 THR D O   1 
ATOM 9656  C CB  . THR D 1 116 ? 39.498   173.770 -31.056 1.00 0.00 ? 111 THR D CB  1 
ATOM 9657  O OG1 . THR D 1 116 ? 38.901   174.255 -32.220 1.00 0.00 ? 111 THR D OG1 1 
ATOM 9658  C CG2 . THR D 1 116 ? 41.010   173.441 -31.399 1.00 0.00 ? 111 THR D CG2 1 
ATOM 9659  N N   . LEU D 1 117 ? 39.188   172.826 -28.078 1.00 0.00 ? 112 LEU D N   1 
ATOM 9660  C CA  . LEU D 1 117 ? 39.850   172.378 -26.828 1.00 0.00 ? 112 LEU D CA  1 
ATOM 9661  C C   . LEU D 1 117 ? 39.385   170.932 -26.365 1.00 0.00 ? 112 LEU D C   1 
ATOM 9662  O O   . LEU D 1 117 ? 40.177   170.042 -26.043 1.00 0.00 ? 112 LEU D O   1 
ATOM 9663  C CB  . LEU D 1 117 ? 39.683   173.285 -25.660 1.00 0.00 ? 112 LEU D CB  1 
ATOM 9664  C CG  . LEU D 1 117 ? 40.939   174.028 -25.149 1.00 0.00 ? 112 LEU D CG  1 
ATOM 9665  C CD1 . LEU D 1 117 ? 40.490   175.295 -24.399 1.00 0.00 ? 112 LEU D CD1 1 
ATOM 9666  C CD2 . LEU D 1 117 ? 41.807   173.099 -24.194 1.00 0.00 ? 112 LEU D CD2 1 
ATOM 9667  N N   . VAL D 1 118 ? 38.050   170.740 -26.346 1.00 0.00 ? 113 VAL D N   1 
ATOM 9668  C CA  . VAL D 1 118 ? 37.476   169.384 -26.040 1.00 0.00 ? 113 VAL D CA  1 
ATOM 9669  C C   . VAL D 1 118 ? 37.988   168.285 -27.019 1.00 0.00 ? 113 VAL D C   1 
ATOM 9670  O O   . VAL D 1 118 ? 38.340   167.155 -26.624 1.00 0.00 ? 113 VAL D O   1 
ATOM 9671  C CB  . VAL D 1 118 ? 35.988   169.599 -25.966 1.00 0.00 ? 113 VAL D CB  1 
ATOM 9672  C CG1 . VAL D 1 118 ? 35.264   168.219 -25.871 1.00 0.00 ? 113 VAL D CG1 1 
ATOM 9673  C CG2 . VAL D 1 118 ? 35.709   170.505 -24.779 1.00 0.00 ? 113 VAL D CG2 1 
ATOM 9674  N N   . LYS D 1 119 ? 37.940   168.616 -28.354 1.00 0.00 ? 114 LYS D N   1 
ATOM 9675  C CA  . LYS D 1 119 ? 38.313   167.688 -29.494 1.00 0.00 ? 114 LYS D CA  1 
ATOM 9676  C C   . LYS D 1 119 ? 39.783   167.372 -29.601 1.00 0.00 ? 114 LYS D C   1 
ATOM 9677  O O   . LYS D 1 119 ? 40.082   166.237 -29.964 1.00 0.00 ? 114 LYS D O   1 
ATOM 9678  C CB  . LYS D 1 119 ? 37.678   168.174 -30.836 1.00 0.00 ? 114 LYS D CB  1 
ATOM 9679  C CG  . LYS D 1 119 ? 37.314   167.102 -31.862 1.00 0.00 ? 114 LYS D CG  1 
ATOM 9680  C CD  . LYS D 1 119 ? 38.483   166.557 -32.754 1.00 0.00 ? 114 LYS D CD  1 
ATOM 9681  C CE  . LYS D 1 119 ? 38.161   165.582 -33.813 1.00 0.00 ? 114 LYS D CE  1 
ATOM 9682  N NZ  . LYS D 1 119 ? 39.363   165.265 -34.672 1.00 0.00 ? 114 LYS D NZ  1 
ATOM 9683  N N   . GLU D 1 120 ? 40.727   168.295 -29.419 1.00 0.00 ? 115 GLU D N   1 
ATOM 9684  C CA  . GLU D 1 120 ? 42.050   168.020 -29.838 1.00 0.00 ? 115 GLU D CA  1 
ATOM 9685  C C   . GLU D 1 120 ? 43.012   168.969 -29.022 1.00 0.00 ? 115 GLU D C   1 
ATOM 9686  O O   . GLU D 1 120 ? 44.187   169.208 -29.299 1.00 0.00 ? 115 GLU D O   1 
ATOM 9687  C CB  . GLU D 1 120 ? 42.125   168.263 -31.301 1.00 0.00 ? 115 GLU D CB  1 
ATOM 9688  C CG  . GLU D 1 120 ? 41.609   169.667 -31.777 1.00 0.00 ? 115 GLU D CG  1 
ATOM 9689  C CD  . GLU D 1 120 ? 41.834   169.808 -33.233 1.00 0.00 ? 115 GLU D CD  1 
ATOM 9690  O OE1 . GLU D 1 120 ? 42.360   168.841 -33.842 1.00 0.00 ? 115 GLU D OE1 1 
ATOM 9691  O OE2 . GLU D 1 120 ? 41.386   170.830 -33.874 1.00 0.00 ? 115 GLU D OE2 1 
ATOM 9692  N N   . GLY D 1 121 ? 42.550   169.506 -27.836 1.00 0.00 ? 116 GLY D N   1 
ATOM 9693  C CA  . GLY D 1 121 ? 43.293   170.537 -27.066 1.00 0.00 ? 116 GLY D CA  1 
ATOM 9694  C C   . GLY D 1 121 ? 43.984   169.799 -25.845 1.00 0.00 ? 116 GLY D C   1 
ATOM 9695  O O   . GLY D 1 121 ? 44.863   170.421 -25.164 1.00 0.00 ? 116 GLY D O   1 
ATOM 9696  N N   . LEU D 1 122 ? 43.685   168.541 -25.521 1.00 0.00 ? 117 LEU D N   1 
ATOM 9697  C CA  . LEU D 1 122 ? 44.243   167.741 -24.421 1.00 0.00 ? 117 LEU D CA  1 
ATOM 9698  C C   . LEU D 1 122 ? 45.170   166.632 -24.928 1.00 0.00 ? 117 LEU D C   1 
ATOM 9699  O O   . LEU D 1 122 ? 45.860   165.945 -24.158 1.00 0.00 ? 117 LEU D O   1 
ATOM 9700  C CB  . LEU D 1 122 ? 43.111   167.063 -23.555 1.00 0.00 ? 117 LEU D CB  1 
ATOM 9701  C CG  . LEU D 1 122 ? 42.125   168.141 -23.039 1.00 0.00 ? 117 LEU D CG  1 
ATOM 9702  C CD1 . LEU D 1 122 ? 41.062   167.355 -22.303 1.00 0.00 ? 117 LEU D CD1 1 
ATOM 9703  C CD2 . LEU D 1 122 ? 42.603   169.281 -22.143 1.00 0.00 ? 117 LEU D CD2 1 
ATOM 9704  N N   . ARG D 1 123 ? 45.284   166.569 -26.241 1.00 0.00 ? 118 ARG D N   1 
ATOM 9705  C CA  . ARG D 1 123 ? 45.810   165.477 -27.033 1.00 0.00 ? 118 ARG D CA  1 
ATOM 9706  C C   . ARG D 1 123 ? 47.302   165.320 -26.887 1.00 0.00 ? 118 ARG D C   1 
ATOM 9707  O O   . ARG D 1 123 ? 47.834   164.235 -26.775 1.00 0.00 ? 118 ARG D O   1 
ATOM 9708  C CB  . ARG D 1 123 ? 45.422   165.779 -28.493 1.00 0.00 ? 118 ARG D CB  1 
ATOM 9709  C CG  . ARG D 1 123 ? 45.580   164.583 -29.435 1.00 0.00 ? 118 ARG D CG  1 
ATOM 9710  C CD  . ARG D 1 123 ? 44.961   164.767 -30.813 1.00 0.00 ? 118 ARG D CD  1 
ATOM 9711  N NE  . ARG D 1 123 ? 45.260   163.432 -31.489 1.00 0.00 ? 118 ARG D NE  1 
ATOM 9712  C CZ  . ARG D 1 123 ? 44.572   162.997 -32.538 1.00 0.00 ? 118 ARG D CZ  1 
ATOM 9713  N NH1 . ARG D 1 123 ? 43.792   163.838 -33.260 1.00 0.00 ? 118 ARG D NH1 1 
ATOM 9714  N NH2 . ARG D 1 123 ? 44.729   161.804 -33.020 1.00 0.00 ? 118 ARG D NH2 1 
ATOM 9715  N N   . GLY D 1 124 ? 48.063   166.386 -26.778 1.00 0.00 ? 119 GLY D N   1 
ATOM 9716  C CA  . GLY D 1 124 ? 49.513   166.280 -26.531 1.00 0.00 ? 119 GLY D CA  1 
ATOM 9717  C C   . GLY D 1 124 ? 49.956   166.118 -25.103 1.00 0.00 ? 119 GLY D C   1 
ATOM 9718  O O   . GLY D 1 124 ? 50.994   165.463 -24.706 1.00 0.00 ? 119 GLY D O   1 
ATOM 9719  N N   . PHE D 1 125 ? 49.145   166.609 -24.167 1.00 0.00 ? 120 PHE D N   1 
ATOM 9720  C CA  . PHE D 1 125 ? 49.195   166.231 -22.755 1.00 0.00 ? 120 PHE D CA  1 
ATOM 9721  C C   . PHE D 1 125 ? 48.940   164.719 -22.590 1.00 0.00 ? 120 PHE D C   1 
ATOM 9722  O O   . PHE D 1 125 ? 49.584   163.994 -21.861 1.00 0.00 ? 120 PHE D O   1 
ATOM 9723  C CB  . PHE D 1 125 ? 48.239   167.144 -21.918 1.00 0.00 ? 120 PHE D CB  1 
ATOM 9724  C CG  . PHE D 1 125 ? 48.132   166.692 -20.423 1.00 0.00 ? 120 PHE D CG  1 
ATOM 9725  C CD1 . PHE D 1 125 ? 47.133   165.723 -20.038 1.00 0.00 ? 120 PHE D CD1 1 
ATOM 9726  C CD2 . PHE D 1 125 ? 49.016   167.186 -19.456 1.00 0.00 ? 120 PHE D CD2 1 
ATOM 9727  C CE1 . PHE D 1 125 ? 47.125   165.286 -18.694 1.00 0.00 ? 120 PHE D CE1 1 
ATOM 9728  C CE2 . PHE D 1 125 ? 48.887   166.773 -18.110 1.00 0.00 ? 120 PHE D CE2 1 
ATOM 9729  C CZ  . PHE D 1 125 ? 47.972   165.754 -17.704 1.00 0.00 ? 120 PHE D CZ  1 
ATOM 9730  N N   . ARG D 1 126 ? 47.993   164.123 -23.365 1.00 0.00 ? 121 ARG D N   1 
ATOM 9731  C CA  . ARG D 1 126 ? 47.643   162.742 -23.141 1.00 0.00 ? 121 ARG D CA  1 
ATOM 9732  C C   . ARG D 1 126 ? 48.677   161.859 -23.798 1.00 0.00 ? 121 ARG D C   1 
ATOM 9733  O O   . ARG D 1 126 ? 49.076   160.849 -23.169 1.00 0.00 ? 121 ARG D O   1 
ATOM 9734  C CB  . ARG D 1 126 ? 46.159   162.354 -23.607 1.00 0.00 ? 121 ARG D CB  1 
ATOM 9735  C CG  . ARG D 1 126 ? 45.129   162.918 -22.527 1.00 0.00 ? 121 ARG D CG  1 
ATOM 9736  C CD  . ARG D 1 126 ? 43.604   162.814 -22.982 1.00 0.00 ? 121 ARG D CD  1 
ATOM 9737  N NE  . ARG D 1 126 ? 42.884   163.042 -21.732 1.00 0.00 ? 121 ARG D NE  1 
ATOM 9738  C CZ  . ARG D 1 126 ? 41.694   163.549 -21.666 1.00 0.00 ? 121 ARG D CZ  1 
ATOM 9739  N NH1 . ARG D 1 126 ? 40.912   163.671 -22.789 1.00 0.00 ? 121 ARG D NH1 1 
ATOM 9740  N NH2 . ARG D 1 126 ? 41.144   163.878 -20.486 1.00 0.00 ? 121 ARG D NH2 1 
ATOM 9741  N N   . GLU D 1 127 ? 49.208   162.263 -25.056 1.00 0.00 ? 122 GLU D N   1 
ATOM 9742  C CA  . GLU D 1 127 ? 50.432   161.709 -25.655 1.00 0.00 ? 122 GLU D CA  1 
ATOM 9743  C C   . GLU D 1 127 ? 51.567   161.591 -24.748 1.00 0.00 ? 122 GLU D C   1 
ATOM 9744  O O   . GLU D 1 127 ? 52.184   160.559 -24.539 1.00 0.00 ? 122 GLU D O   1 
ATOM 9745  C CB  . GLU D 1 127 ? 50.846   162.544 -26.842 1.00 0.00 ? 122 GLU D CB  1 
ATOM 9746  C CG  . GLU D 1 127 ? 51.647   161.790 -27.916 1.00 0.00 ? 122 GLU D CG  1 
ATOM 9747  C CD  . GLU D 1 127 ? 50.875   160.588 -28.411 1.00 0.00 ? 122 GLU D CD  1 
ATOM 9748  O OE1 . GLU D 1 127 ? 49.839   160.889 -29.124 1.00 0.00 ? 122 GLU D OE1 1 
ATOM 9749  O OE2 . GLU D 1 127 ? 51.271   159.414 -28.206 1.00 0.00 ? 122 GLU D OE2 1 
ATOM 9750  N N   . ALA D 1 128 ? 51.969   162.759 -24.063 1.00 0.00 ? 123 ALA D N   1 
ATOM 9751  C CA  . ALA D 1 128 ? 53.153   162.851 -23.135 1.00 0.00 ? 123 ALA D CA  1 
ATOM 9752  C C   . ALA D 1 128 ? 52.955   162.005 -21.906 1.00 0.00 ? 123 ALA D C   1 
ATOM 9753  O O   . ALA D 1 128 ? 53.837   161.240 -21.487 1.00 0.00 ? 123 ALA D O   1 
ATOM 9754  C CB  . ALA D 1 128 ? 53.496   164.334 -22.736 1.00 0.00 ? 123 ALA D CB  1 
ATOM 9755  N N   . ARG D 1 129 ? 51.769   162.077 -21.243 1.00 0.00 ? 124 ARG D N   1 
ATOM 9756  C CA  . ARG D 1 129 ? 51.415   161.289 -20.097 1.00 0.00 ? 124 ARG D CA  1 
ATOM 9757  C C   . ARG D 1 129 ? 51.433   159.756 -20.267 1.00 0.00 ? 124 ARG D C   1 
ATOM 9758  O O   . ARG D 1 129 ? 52.030   159.040 -19.495 1.00 0.00 ? 124 ARG D O   1 
ATOM 9759  C CB  . ARG D 1 129 ? 50.017   161.817 -19.717 1.00 0.00 ? 124 ARG D CB  1 
ATOM 9760  C CG  . ARG D 1 129 ? 49.287   161.052 -18.543 1.00 0.00 ? 124 ARG D CG  1 
ATOM 9761  C CD  . ARG D 1 129 ? 47.933   161.561 -18.094 1.00 0.00 ? 124 ARG D CD  1 
ATOM 9762  N NE  . ARG D 1 129 ? 47.531   160.582 -16.946 1.00 0.00 ? 124 ARG D NE  1 
ATOM 9763  C CZ  . ARG D 1 129 ? 46.964   159.418 -17.160 1.00 0.00 ? 124 ARG D CZ  1 
ATOM 9764  N NH1 . ARG D 1 129 ? 46.438   159.019 -18.318 1.00 0.00 ? 124 ARG D NH1 1 
ATOM 9765  N NH2 . ARG D 1 129 ? 46.610   158.798 -16.062 1.00 0.00 ? 124 ARG D NH2 1 
ATOM 9766  N N   . ARG D 1 130 ? 50.786   159.211 -21.326 1.00 0.00 ? 125 ARG D N   1 
ATOM 9767  C CA  . ARG D 1 130 ? 50.826   157.752 -21.610 1.00 0.00 ? 125 ARG D CA  1 
ATOM 9768  C C   . ARG D 1 130 ? 52.248   157.266 -21.977 1.00 0.00 ? 125 ARG D C   1 
ATOM 9769  O O   . ARG D 1 130 ? 52.740   156.220 -21.567 1.00 0.00 ? 125 ARG D O   1 
ATOM 9770  C CB  . ARG D 1 130 ? 49.970   157.471 -22.890 1.00 0.00 ? 125 ARG D CB  1 
ATOM 9771  C CG  . ARG D 1 130 ? 49.911   156.045 -23.429 1.00 0.00 ? 125 ARG D CG  1 
ATOM 9772  C CD  . ARG D 1 130 ? 49.133   155.792 -24.693 1.00 0.00 ? 125 ARG D CD  1 
ATOM 9773  N NE  . ARG D 1 130 ? 49.842   156.349 -25.912 1.00 0.00 ? 125 ARG D NE  1 
ATOM 9774  C CZ  . ARG D 1 130 ? 49.329   156.281 -27.175 1.00 0.00 ? 125 ARG D CZ  1 
ATOM 9775  N NH1 . ARG D 1 130 ? 48.452   155.358 -27.469 1.00 0.00 ? 125 ARG D NH1 1 
ATOM 9776  N NH2 . ARG D 1 130 ? 49.750   157.099 -28.139 1.00 0.00 ? 125 ARG D NH2 1 
ATOM 9777  N N   . ASP D 1 131 ? 53.050   158.110 -22.726 1.00 0.00 ? 126 ASP D N   1 
ATOM 9778  C CA  . ASP D 1 131 ? 54.482   157.801 -23.049 1.00 0.00 ? 126 ASP D CA  1 
ATOM 9779  C C   . ASP D 1 131 ? 55.302   157.834 -21.691 1.00 0.00 ? 126 ASP D C   1 
ATOM 9780  O O   . ASP D 1 131 ? 56.073   156.902 -21.369 1.00 0.00 ? 126 ASP D O   1 
ATOM 9781  C CB  . ASP D 1 131 ? 55.012   158.791 -24.073 1.00 0.00 ? 126 ASP D CB  1 
ATOM 9782  C CG  . ASP D 1 131 ? 56.135   158.178 -24.829 1.00 0.00 ? 126 ASP D CG  1 
ATOM 9783  O OD1 . ASP D 1 131 ? 56.009   157.116 -25.448 1.00 0.00 ? 126 ASP D OD1 1 
ATOM 9784  O OD2 . ASP D 1 131 ? 57.237   158.721 -24.672 1.00 0.00 ? 126 ASP D OD2 1 
ATOM 9785  N N   . PHE D 1 132 ? 55.101   158.843 -20.871 1.00 0.00 ? 127 PHE D N   1 
ATOM 9786  C CA  . PHE D 1 132 ? 55.731   158.998 -19.554 1.00 0.00 ? 127 PHE D CA  1 
ATOM 9787  C C   . PHE D 1 132 ? 55.488   157.863 -18.468 1.00 0.00 ? 127 PHE D C   1 
ATOM 9788  O O   . PHE D 1 132 ? 56.454   157.308 -17.883 1.00 0.00 ? 127 PHE D O   1 
ATOM 9789  C CB  . PHE D 1 132 ? 55.334   160.451 -18.992 1.00 0.00 ? 127 PHE D CB  1 
ATOM 9790  C CG  . PHE D 1 132 ? 55.646   160.590 -17.454 1.00 0.00 ? 127 PHE D CG  1 
ATOM 9791  C CD1 . PHE D 1 132 ? 57.015   160.751 -16.922 1.00 0.00 ? 127 PHE D CD1 1 
ATOM 9792  C CD2 . PHE D 1 132 ? 54.538   160.421 -16.657 1.00 0.00 ? 127 PHE D CD2 1 
ATOM 9793  C CE1 . PHE D 1 132 ? 57.061   160.684 -15.525 1.00 0.00 ? 127 PHE D CE1 1 
ATOM 9794  C CE2 . PHE D 1 132 ? 54.715   160.266 -15.275 1.00 0.00 ? 127 PHE D CE2 1 
ATOM 9795  C CZ  . PHE D 1 132 ? 55.964   160.373 -14.728 1.00 0.00 ? 127 PHE D CZ  1 
ATOM 9796  N N   . TRP D 1 133 ? 54.255   157.392 -18.265 1.00 0.00 ? 128 TRP D N   1 
ATOM 9797  C CA  . TRP D 1 133 ? 53.849   156.271 -17.440 1.00 0.00 ? 128 TRP D CA  1 
ATOM 9798  C C   . TRP D 1 133 ? 54.361   154.944 -18.093 1.00 0.00 ? 128 TRP D C   1 
ATOM 9799  O O   . TRP D 1 133 ? 54.706   153.985 -17.361 1.00 0.00 ? 128 TRP D O   1 
ATOM 9800  C CB  . TRP D 1 133 ? 52.340   156.177 -17.105 1.00 0.00 ? 128 TRP D CB  1 
ATOM 9801  C CG  . TRP D 1 133 ? 51.786   157.158 -16.142 1.00 0.00 ? 128 TRP D CG  1 
ATOM 9802  C CD1 . TRP D 1 133 ? 50.595   157.953 -16.243 1.00 0.00 ? 128 TRP D CD1 1 
ATOM 9803  C CD2 . TRP D 1 133 ? 52.216   157.344 -14.775 1.00 0.00 ? 128 TRP D CD2 1 
ATOM 9804  N NE1 . TRP D 1 133 ? 50.521   158.807 -15.165 1.00 0.00 ? 128 TRP D NE1 1 
ATOM 9805  C CE2 . TRP D 1 133 ? 51.475   158.414 -14.231 1.00 0.00 ? 128 TRP D CE2 1 
ATOM 9806  C CE3 . TRP D 1 133 ? 53.219   156.709 -14.007 1.00 0.00 ? 128 TRP D CE3 1 
ATOM 9807  C CZ2 . TRP D 1 133 ? 51.783   158.815 -12.908 1.00 0.00 ? 128 TRP D CZ2 1 
ATOM 9808  C CZ3 . TRP D 1 133 ? 53.584   157.194 -12.712 1.00 0.00 ? 128 TRP D CZ3 1 
ATOM 9809  C CH2 . TRP D 1 133 ? 52.860   158.216 -12.145 1.00 0.00 ? 128 TRP D CH2 1 
ATOM 9810  N N   . ARG D 1 134 ? 54.356   154.874 -19.445 1.00 0.00 ? 129 ARG D N   1 
ATOM 9811  C CA  . ARG D 1 134 ? 55.117   153.806 -20.164 1.00 0.00 ? 129 ARG D CA  1 
ATOM 9812  C C   . ARG D 1 134 ? 56.575   153.729 -19.782 1.00 0.00 ? 129 ARG D C   1 
ATOM 9813  O O   . ARG D 1 134 ? 57.114   152.680 -19.457 1.00 0.00 ? 129 ARG D O   1 
ATOM 9814  C CB  . ARG D 1 134 ? 55.095   153.825 -21.657 1.00 0.00 ? 129 ARG D CB  1 
ATOM 9815  C CG  . ARG D 1 134 ? 55.514   152.471 -22.335 1.00 0.00 ? 129 ARG D CG  1 
ATOM 9816  C CD  . ARG D 1 134 ? 54.693   151.206 -21.992 1.00 0.00 ? 129 ARG D CD  1 
ATOM 9817  N NE  . ARG D 1 134 ? 53.394   151.397 -22.743 1.00 0.00 ? 129 ARG D NE  1 
ATOM 9818  C CZ  . ARG D 1 134 ? 52.270   150.770 -22.497 1.00 0.00 ? 129 ARG D CZ  1 
ATOM 9819  N NH1 . ARG D 1 134 ? 52.190   149.785 -21.604 1.00 0.00 ? 129 ARG D NH1 1 
ATOM 9820  N NH2 . ARG D 1 134 ? 51.236   151.140 -23.188 1.00 0.00 ? 129 ARG D NH2 1 
ATOM 9821  N N   . GLY D 1 135 ? 57.334   154.886 -19.712 1.00 0.00 ? 130 GLY D N   1 
ATOM 9822  C CA  . GLY D 1 135 ? 58.685   154.961 -19.139 1.00 0.00 ? 130 GLY D CA  1 
ATOM 9823  C C   . GLY D 1 135 ? 58.871   154.484 -17.768 1.00 0.00 ? 130 GLY D C   1 
ATOM 9824  O O   . GLY D 1 135 ? 59.960   153.956 -17.478 1.00 0.00 ? 130 GLY D O   1 
ATOM 9825  N N   . ALA D 1 136 ? 57.890   154.708 -16.934 1.00 0.00 ? 131 ALA D N   1 
ATOM 9826  C CA  . ALA D 1 136 ? 57.960   154.268 -15.507 1.00 0.00 ? 131 ALA D CA  1 
ATOM 9827  C C   . ALA D 1 136 ? 57.552   152.788 -15.290 1.00 0.00 ? 131 ALA D C   1 
ATOM 9828  O O   . ALA D 1 136 ? 58.015   152.100 -14.359 1.00 0.00 ? 131 ALA D O   1 
ATOM 9829  C CB  . ALA D 1 136 ? 56.897   155.090 -14.874 1.00 0.00 ? 131 ALA D CB  1 
ATOM 9830  N N   . GLU D 1 137 ? 56.791   152.223 -16.302 1.00 0.00 ? 132 GLU D N   1 
ATOM 9831  C CA  . GLU D 1 137 ? 56.447   150.850 -16.387 1.00 0.00 ? 132 GLU D CA  1 
ATOM 9832  C C   . GLU D 1 137 ? 57.630   149.959 -16.694 1.00 0.00 ? 132 GLU D C   1 
ATOM 9833  O O   . GLU D 1 137 ? 57.897   149.064 -15.877 1.00 0.00 ? 132 GLU D O   1 
ATOM 9834  C CB  . GLU D 1 137 ? 55.393   150.580 -17.514 1.00 0.00 ? 132 GLU D CB  1 
ATOM 9835  C CG  . GLU D 1 137 ? 54.866   149.138 -17.495 1.00 0.00 ? 132 GLU D CG  1 
ATOM 9836  C CD  . GLU D 1 137 ? 53.747   149.146 -18.617 1.00 0.00 ? 132 GLU D CD  1 
ATOM 9837  O OE1 . GLU D 1 137 ? 52.605   149.590 -18.270 1.00 0.00 ? 132 GLU D OE1 1 
ATOM 9838  O OE2 . GLU D 1 137 ? 54.011   148.776 -19.785 1.00 0.00 ? 132 GLU D OE2 1 
ATOM 9839  N N   . SER D 1 138 ? 58.313   150.363 -17.713 1.00 0.00 ? 133 SER D N   1 
ATOM 9840  C CA  . SER D 1 138 ? 59.561   149.810 -17.972 1.00 0.00 ? 133 SER D CA  1 
ATOM 9841  C C   . SER D 1 138 ? 60.668   150.015 -16.916 1.00 0.00 ? 133 SER D C   1 
ATOM 9842  O O   . SER D 1 138 ? 61.366   149.047 -16.640 1.00 0.00 ? 133 SER D O   1 
ATOM 9843  C CB  . SER D 1 138 ? 60.201   150.409 -19.321 1.00 0.00 ? 133 SER D CB  1 
ATOM 9844  O OG  . SER D 1 138 ? 59.461   150.147 -20.494 1.00 0.00 ? 133 SER D OG  1 
ATOM 9845  N N   . LEU D 1 139 ? 60.778   151.208 -16.270 1.00 0.00 ? 134 LEU D N   1 
ATOM 9846  C CA  . LEU D 1 139 ? 61.702   151.411 -15.162 1.00 0.00 ? 134 LEU D CA  1 
ATOM 9847  C C   . LEU D 1 139 ? 61.333   150.606 -13.912 1.00 0.00 ? 134 LEU D C   1 
ATOM 9848  O O   . LEU D 1 139 ? 62.188   149.960 -13.283 1.00 0.00 ? 134 LEU D O   1 
ATOM 9849  C CB  . LEU D 1 139 ? 61.739   152.969 -14.761 1.00 0.00 ? 134 LEU D CB  1 
ATOM 9850  C CG  . LEU D 1 139 ? 62.686   153.374 -13.667 1.00 0.00 ? 134 LEU D CG  1 
ATOM 9851  C CD1 . LEU D 1 139 ? 64.094   152.922 -13.894 1.00 0.00 ? 134 LEU D CD1 1 
ATOM 9852  C CD2 . LEU D 1 139 ? 62.699   154.901 -13.470 1.00 0.00 ? 134 LEU D CD2 1 
ATOM 9853  N N   . GLU D 1 140 ? 60.018   150.422 -13.590 1.00 0.00 ? 135 GLU D N   1 
ATOM 9854  C CA  . GLU D 1 140 ? 59.535   149.536 -12.465 1.00 0.00 ? 135 GLU D CA  1 
ATOM 9855  C C   . GLU D 1 140 ? 60.000   148.124 -12.687 1.00 0.00 ? 135 GLU D C   1 
ATOM 9856  O O   . GLU D 1 140 ? 60.537   147.499 -11.764 1.00 0.00 ? 135 GLU D O   1 
ATOM 9857  C CB  . GLU D 1 140 ? 58.017   149.728 -12.294 1.00 0.00 ? 135 GLU D CB  1 
ATOM 9858  C CG  . GLU D 1 140 ? 57.388   149.135 -10.953 1.00 0.00 ? 135 GLU D CG  1 
ATOM 9859  C CD  . GLU D 1 140 ? 55.849   149.312 -10.834 1.00 0.00 ? 135 GLU D CD  1 
ATOM 9860  O OE1 . GLU D 1 140 ? 55.180   150.099 -11.628 1.00 0.00 ? 135 GLU D OE1 1 
ATOM 9861  O OE2 . GLU D 1 140 ? 55.306   148.735 -9.850  1.00 0.00 ? 135 GLU D OE2 1 
ATOM 9862  N N   . ALA D 1 141 ? 59.850   147.604 -13.943 1.00 0.00 ? 136 ALA D N   1 
ATOM 9863  C CA  . ALA D 1 141 ? 60.218   146.283 -14.410 1.00 0.00 ? 136 ALA D CA  1 
ATOM 9864  C C   . ALA D 1 141 ? 61.793   146.128 -14.330 1.00 0.00 ? 136 ALA D C   1 
ATOM 9865  O O   . ALA D 1 141 ? 62.388   145.165 -13.820 1.00 0.00 ? 136 ALA D O   1 
ATOM 9866  C CB  . ALA D 1 141 ? 59.777   146.167 -15.926 1.00 0.00 ? 136 ALA D CB  1 
ATOM 9867  N N   . ALA D 1 142 ? 62.597   147.081 -14.794 1.00 0.00 ? 137 ALA D N   1 
ATOM 9868  C CA  . ALA D 1 142 ? 64.058   147.110 -14.769 1.00 0.00 ? 137 ALA D CA  1 
ATOM 9869  C C   . ALA D 1 142 ? 64.722   147.362 -13.443 1.00 0.00 ? 137 ALA D C   1 
ATOM 9870  O O   . ALA D 1 142 ? 65.846   146.937 -13.254 1.00 0.00 ? 137 ALA D O   1 
ATOM 9871  C CB  . ALA D 1 142 ? 64.579   148.291 -15.709 1.00 0.00 ? 137 ALA D CB  1 
ATOM 9872  N N   . LEU D 1 143 ? 64.011   148.058 -12.490 1.00 0.00 ? 138 LEU D N   1 
ATOM 9873  C CA  . LEU D 1 143 ? 64.357   148.014 -11.058 1.00 0.00 ? 138 LEU D CA  1 
ATOM 9874  C C   . LEU D 1 143 ? 64.242   146.658 -10.430 1.00 0.00 ? 138 LEU D C   1 
ATOM 9875  O O   . LEU D 1 143 ? 65.114   146.255 -9.691  1.00 0.00 ? 138 LEU D O   1 
ATOM 9876  C CB  . LEU D 1 143 ? 63.429   148.931 -10.311 1.00 0.00 ? 138 LEU D CB  1 
ATOM 9877  C CG  . LEU D 1 143 ? 63.798   150.447 -10.600 1.00 0.00 ? 138 LEU D CG  1 
ATOM 9878  C CD1 . LEU D 1 143 ? 62.594   151.382 -10.134 1.00 0.00 ? 138 LEU D CD1 1 
ATOM 9879  C CD2 . LEU D 1 143 ? 65.081   150.864 -9.955  1.00 0.00 ? 138 LEU D CD2 1 
ATOM 9880  N N   . THR D 1 144 ? 63.181   145.910 -10.822 1.00 0.00 ? 139 THR D N   1 
ATOM 9881  C CA  . THR D 1 144 ? 63.064   144.421 -10.474 1.00 0.00 ? 139 THR D CA  1 
ATOM 9882  C C   . THR D 1 144 ? 64.162   143.586 -11.069 1.00 0.00 ? 139 THR D C   1 
ATOM 9883  O O   . THR D 1 144 ? 64.894   142.838 -10.466 1.00 0.00 ? 139 THR D O   1 
ATOM 9884  C CB  . THR D 1 144 ? 61.755   143.825 -11.022 1.00 0.00 ? 139 THR D CB  1 
ATOM 9885  O OG1 . THR D 1 144 ? 60.624   144.520 -10.464 1.00 0.00 ? 139 THR D OG1 1 
ATOM 9886  C CG2 . THR D 1 144 ? 61.587   142.380 -10.401 1.00 0.00 ? 139 THR D CG2 1 
ATOM 9887  N N   . HIS D 1 145 ? 64.422   143.879 -12.384 1.00 0.00 ? 140 HIS D N   1 
ATOM 9888  C CA  . HIS D 1 145 ? 65.406   143.196 -13.150 1.00 0.00 ? 140 HIS D CA  1 
ATOM 9889  C C   . HIS D 1 145 ? 66.833   143.370 -12.615 1.00 0.00 ? 140 HIS D C   1 
ATOM 9890  O O   . HIS D 1 145 ? 67.601   142.404 -12.556 1.00 0.00 ? 140 HIS D O   1 
ATOM 9891  C CB  . HIS D 1 145 ? 65.435   143.557 -14.721 1.00 0.00 ? 140 HIS D CB  1 
ATOM 9892  C CG  . HIS D 1 145 ? 66.393   142.837 -15.636 1.00 0.00 ? 140 HIS D CG  1 
ATOM 9893  N ND1 . HIS D 1 145 ? 66.501   141.482 -15.832 1.00 0.00 ? 140 HIS D ND1 1 
ATOM 9894  C CD2 . HIS D 1 145 ? 67.418   143.339 -16.333 1.00 0.00 ? 140 HIS D CD2 1 
ATOM 9895  C CE1 . HIS D 1 145 ? 67.553   141.216 -16.633 1.00 0.00 ? 140 HIS D CE1 1 
ATOM 9896  N NE2 . HIS D 1 145 ? 68.079   142.366 -17.033 1.00 0.00 ? 140 HIS D NE2 1 
ATOM 9897  N N   . ASN D 1 146 ? 67.202   144.636 -12.129 1.00 0.00 ? 141 ASN D N   1 
ATOM 9898  C CA  . ASN D 1 146 ? 68.374   145.119 -11.543 1.00 0.00 ? 141 ASN D CA  1 
ATOM 9899  C C   . ASN D 1 146 ? 68.653   144.476 -10.160 1.00 0.00 ? 141 ASN D C   1 
ATOM 9900  O O   . ASN D 1 146 ? 69.813   144.448 -9.757  1.00 0.00 ? 141 ASN D O   1 
ATOM 9901  C CB  . ASN D 1 146 ? 68.310   146.685 -11.469 1.00 0.00 ? 141 ASN D CB  1 
ATOM 9902  C CG  . ASN D 1 146 ? 69.589   147.241 -10.884 1.00 0.00 ? 141 ASN D CG  1 
ATOM 9903  O OD1 . ASN D 1 146 ? 70.654   147.285 -11.487 1.00 0.00 ? 141 ASN D OD1 1 
ATOM 9904  N ND2 . ASN D 1 146 ? 69.476   147.753 -9.707  1.00 0.00 ? 141 ASN D ND2 1 
ATOM 9905  N N   . ALA D 1 147 ? 67.560   143.957 -9.592  1.00 0.00 ? 142 ALA D N   1 
ATOM 9906  C CA  . ALA D 1 147 ? 67.559   143.481 -8.200  1.00 0.00 ? 142 ALA D CA  1 
ATOM 9907  C C   . ALA D 1 147 ? 67.746   141.995 -8.224  1.00 0.00 ? 142 ALA D C   1 
ATOM 9908  O O   . ALA D 1 147 ? 68.323   141.395 -7.303  1.00 0.00 ? 142 ALA D O   1 
ATOM 9909  C CB  . ALA D 1 147 ? 66.311   143.932 -7.432  1.00 0.00 ? 142 ALA D CB  1 
ATOM 9910  N N   . GLU D 1 148 ? 67.317   141.260 -9.295  1.00 0.00 ? 143 GLU D N   1 
ATOM 9911  C CA  . GLU D 1 148 ? 67.550   139.811 -9.488  1.00 0.00 ? 143 GLU D CA  1 
ATOM 9912  C C   . GLU D 1 148 ? 68.968   139.490 -9.930  1.00 0.00 ? 143 GLU D C   1 
ATOM 9913  O O   . GLU D 1 148 ? 69.164   138.931 -11.045 1.00 0.00 ? 143 GLU D O   1 
ATOM 9914  C CB  . GLU D 1 148 ? 66.556   139.282 -10.604 1.00 0.00 ? 143 GLU D CB  1 
ATOM 9915  C CG  . GLU D 1 148 ? 65.014   139.167 -10.256 1.00 0.00 ? 143 GLU D CG  1 
ATOM 9916  C CD  . GLU D 1 148 ? 64.224   138.776 -11.421 1.00 0.00 ? 143 GLU D CD  1 
ATOM 9917  O OE1 . GLU D 1 148 ? 64.484   139.240 -12.548 1.00 0.00 ? 143 GLU D OE1 1 
ATOM 9918  O OE2 . GLU D 1 148 ? 63.508   137.765 -11.227 1.00 0.00 ? 143 GLU D OE2 1 
ATOM 9919  N N   . VAL D 1 149 ? 69.995   139.891 -9.170  1.00 0.00 ? 144 VAL D N   1 
ATOM 9920  C CA  . VAL D 1 149 ? 71.404   139.629 -9.476  1.00 0.00 ? 144 VAL D CA  1 
ATOM 9921  C C   . VAL D 1 149 ? 71.976   138.817 -8.315  1.00 0.00 ? 144 VAL D C   1 
ATOM 9922  O O   . VAL D 1 149 ? 72.104   139.253 -7.159  1.00 0.00 ? 144 VAL D O   1 
ATOM 9923  C CB  . VAL D 1 149 ? 72.226   140.860 -9.784  1.00 0.00 ? 144 VAL D CB  1 
ATOM 9924  C CG1 . VAL D 1 149 ? 73.736   140.572 -9.963  1.00 0.00 ? 144 VAL D CG1 1 
ATOM 9925  C CG2 . VAL D 1 149 ? 71.726   141.392 -11.197 1.00 0.00 ? 144 VAL D CG2 1 
ATOM 9926  N N   . PRO D 1 150 ? 72.342   137.553 -8.567  1.00 0.00 ? 145 PRO D N   1 
ATOM 9927  C CA  . PRO D 1 150 ? 73.113   136.803 -7.624  1.00 0.00 ? 145 PRO D CA  1 
ATOM 9928  C C   . PRO D 1 150 ? 74.390   137.430 -7.188  1.00 0.00 ? 145 PRO D C   1 
ATOM 9929  O O   . PRO D 1 150 ? 75.076   137.883 -8.102  1.00 0.00 ? 145 PRO D O   1 
ATOM 9930  C CB  . PRO D 1 150 ? 73.217   135.422 -8.295  1.00 0.00 ? 145 PRO D CB  1 
ATOM 9931  C CG  . PRO D 1 150 ? 71.885   135.335 -9.066  1.00 0.00 ? 145 PRO D CG  1 
ATOM 9932  C CD  . PRO D 1 150 ? 71.594   136.733 -9.582  1.00 0.00 ? 145 PRO D CD  1 
ATOM 9933  N N   . ARG D 1 151 ? 74.791   137.489 -5.864  1.00 0.00 ? 146 ARG D N   1 
ATOM 9934  C CA  . ARG D 1 151 ? 76.051   138.084 -5.315  1.00 0.00 ? 146 ARG D CA  1 
ATOM 9935  C C   . ARG D 1 151 ? 77.406   137.619 -5.891  1.00 0.00 ? 146 ARG D C   1 
ATOM 9936  O O   . ARG D 1 151 ? 78.369   138.395 -6.090  1.00 0.00 ? 146 ARG D O   1 
ATOM 9937  C CB  . ARG D 1 151 ? 76.128   137.889 -3.793  1.00 0.00 ? 146 ARG D CB  1 
ATOM 9938  C CG  . ARG D 1 151 ? 77.179   138.866 -3.114  1.00 0.00 ? 146 ARG D CG  1 
ATOM 9939  C CD  . ARG D 1 151 ? 77.142   138.862 -1.629  1.00 0.00 ? 146 ARG D CD  1 
ATOM 9940  N NE  . ARG D 1 151 ? 78.037   140.064 -1.173  1.00 0.00 ? 146 ARG D NE  1 
ATOM 9941  C CZ  . ARG D 1 151 ? 77.585   141.141 -0.453  1.00 0.00 ? 146 ARG D CZ  1 
ATOM 9942  N NH1 . ARG D 1 151 ? 76.366   141.173 0.030   1.00 0.00 ? 146 ARG D NH1 1 
ATOM 9943  N NH2 . ARG D 1 151 ? 78.357   142.192 -0.237  1.00 0.00 ? 146 ARG D NH2 1 
ATOM 9944  N N   . ARG D 1 152 ? 77.532   136.359 -6.229  1.00 0.00 ? 147 ARG D N   1 
ATOM 9945  C CA  . ARG D 1 152 ? 78.651   135.790 -6.978  1.00 0.00 ? 147 ARG D CA  1 
ATOM 9946  C C   . ARG D 1 152 ? 78.960   136.433 -8.359  1.00 0.00 ? 147 ARG D C   1 
ATOM 9947  O O   . ARG D 1 152 ? 80.115   136.496 -8.832  1.00 0.00 ? 147 ARG D O   1 
ATOM 9948  C CB  . ARG D 1 152 ? 78.514   134.274 -7.094  1.00 0.00 ? 147 ARG D CB  1 
ATOM 9949  C CG  . ARG D 1 152 ? 77.321   133.680 -7.868  1.00 0.00 ? 147 ARG D CG  1 
ATOM 9950  C CD  . ARG D 1 152 ? 77.058   132.153 -7.665  1.00 0.00 ? 147 ARG D CD  1 
ATOM 9951  N NE  . ARG D 1 152 ? 76.065   131.766 -8.651  1.00 0.00 ? 147 ARG D NE  1 
ATOM 9952  C CZ  . ARG D 1 152 ? 74.720   131.565 -8.402  1.00 0.00 ? 147 ARG D CZ  1 
ATOM 9953  N NH1 . ARG D 1 152 ? 74.175   131.642 -7.158  1.00 0.00 ? 147 ARG D NH1 1 
ATOM 9954  N NH2 . ARG D 1 152 ? 73.923   131.281 -9.417  1.00 0.00 ? 147 ARG D NH2 1 
ATOM 9955  N N   . ARG D 1 153 ? 77.884   137.002 -8.946  1.00 0.00 ? 148 ARG D N   1 
ATOM 9956  C CA  . ARG D 1 153 ? 77.986   137.383 -10.347 1.00 0.00 ? 148 ARG D CA  1 
ATOM 9957  C C   . ARG D 1 153 ? 78.426   138.756 -10.648 1.00 0.00 ? 148 ARG D C   1 
ATOM 9958  O O   . ARG D 1 153 ? 78.267   139.716 -9.864  1.00 0.00 ? 148 ARG D O   1 
ATOM 9959  C CB  . ARG D 1 153 ? 76.613   137.175 -11.057 1.00 0.00 ? 148 ARG D CB  1 
ATOM 9960  C CG  . ARG D 1 153 ? 76.224   135.695 -11.082 1.00 0.00 ? 148 ARG D CG  1 
ATOM 9961  C CD  . ARG D 1 153 ? 75.286   135.318 -12.218 1.00 0.00 ? 148 ARG D CD  1 
ATOM 9962  N NE  . ARG D 1 153 ? 75.016   133.830 -12.143 1.00 0.00 ? 148 ARG D NE  1 
ATOM 9963  C CZ  . ARG D 1 153 ? 74.235   133.179 -13.052 1.00 0.00 ? 148 ARG D CZ  1 
ATOM 9964  N NH1 . ARG D 1 153 ? 73.380   133.850 -13.825 1.00 0.00 ? 148 ARG D NH1 1 
ATOM 9965  N NH2 . ARG D 1 153 ? 74.316   131.878 -13.224 1.00 0.00 ? 148 ARG D NH2 1 
ATOM 9966  N N   . ALA D 1 154 ? 79.038   138.897 -11.855 1.00 0.00 ? 149 ALA D N   1 
ATOM 9967  C CA  . ALA D 1 154 ? 79.686   140.137 -12.362 1.00 0.00 ? 149 ALA D CA  1 
ATOM 9968  C C   . ALA D 1 154 ? 79.292   140.500 -13.844 1.00 0.00 ? 149 ALA D C   1 
ATOM 9969  O O   . ALA D 1 154 ? 79.174   141.650 -14.239 1.00 0.00 ? 149 ALA D O   1 
ATOM 9970  C CB  . ALA D 1 154 ? 81.204   139.986 -12.256 1.00 0.00 ? 149 ALA D CB  1 
ATOM 9971  N N   . GLN D 1 155 ? 79.059   139.454 -14.657 1.00 0.00 ? 150 GLN D N   1 
ATOM 9972  C CA  . GLN D 1 155 ? 78.590   139.566 -15.989 1.00 0.00 ? 150 GLN D CA  1 
ATOM 9973  C C   . GLN D 1 155 ? 77.063   139.737 -15.950 1.00 0.00 ? 150 GLN D C   1 
ATOM 9974  O O   . GLN D 1 155 ? 76.466   140.402 -16.741 1.00 0.00 ? 150 GLN D O   1 
ATOM 9975  C CB  . GLN D 1 155 ? 79.078   138.282 -16.892 1.00 0.00 ? 150 GLN D CB  1 
ATOM 9976  C CG  . GLN D 1 155 ? 78.863   138.606 -18.447 1.00 0.00 ? 150 GLN D CG  1 
ATOM 9977  C CD  . GLN D 1 155 ? 78.973   137.357 -19.282 1.00 0.00 ? 150 GLN D CD  1 
ATOM 9978  O OE1 . GLN D 1 155 ? 80.081   137.223 -19.936 1.00 0.00 ? 150 GLN D OE1 1 
ATOM 9979  N NE2 . GLN D 1 155 ? 78.087   136.354 -19.155 1.00 0.00 ? 150 GLN D NE2 1 
ATOM 9980  N N   . GLU D 1 156 ? 76.396   139.082 -14.978 1.00 0.00 ? 151 GLU D N   1 
ATOM 9981  C CA  . GLU D 1 156 ? 75.005   139.417 -14.750 1.00 0.00 ? 151 GLU D CA  1 
ATOM 9982  C C   . GLU D 1 156 ? 74.797   140.761 -14.178 1.00 0.00 ? 151 GLU D C   1 
ATOM 9983  O O   . GLU D 1 156 ? 73.902   141.504 -14.480 1.00 0.00 ? 151 GLU D O   1 
ATOM 9984  C CB  . GLU D 1 156 ? 74.305   138.329 -13.872 1.00 0.00 ? 151 GLU D CB  1 
ATOM 9985  C CG  . GLU D 1 156 ? 72.778   138.385 -13.915 1.00 0.00 ? 151 GLU D CG  1 
ATOM 9986  C CD  . GLU D 1 156 ? 71.981   137.097 -14.099 1.00 0.00 ? 151 GLU D CD  1 
ATOM 9987  O OE1 . GLU D 1 156 ? 72.213   136.224 -13.251 1.00 0.00 ? 151 GLU D OE1 1 
ATOM 9988  O OE2 . GLU D 1 156 ? 71.000   137.077 -14.851 1.00 0.00 ? 151 GLU D OE2 1 
ATOM 9989  N N   . ALA D 1 157 ? 75.702   141.235 -13.270 1.00 0.00 ? 152 ALA D N   1 
ATOM 9990  C CA  . ALA D 1 157 ? 75.676   142.622 -12.718 1.00 0.00 ? 152 ALA D CA  1 
ATOM 9991  C C   . ALA D 1 157 ? 75.817   143.730 -13.678 1.00 0.00 ? 152 ALA D C   1 
ATOM 9992  O O   . ALA D 1 157 ? 75.071   144.731 -13.679 1.00 0.00 ? 152 ALA D O   1 
ATOM 9993  C CB  . ALA D 1 157 ? 76.835   142.757 -11.681 1.00 0.00 ? 152 ALA D CB  1 
ATOM 9994  N N   . GLU D 1 158 ? 76.747   143.585 -14.656 1.00 0.00 ? 153 GLU D N   1 
ATOM 9995  C CA  . GLU D 1 158 ? 76.902   144.674 -15.602 1.00 0.00 ? 153 GLU D CA  1 
ATOM 9996  C C   . GLU D 1 158 ? 75.750   144.689 -16.670 1.00 0.00 ? 153 GLU D C   1 
ATOM 9997  O O   . GLU D 1 158 ? 75.405   145.682 -17.307 1.00 0.00 ? 153 GLU D O   1 
ATOM 9998  C CB  . GLU D 1 158 ? 78.438   144.723 -16.158 1.00 0.00 ? 153 GLU D CB  1 
ATOM 9999  C CG  . GLU D 1 158 ? 79.511   145.137 -15.110 1.00 0.00 ? 153 GLU D CG  1 
ATOM 10000 C CD  . GLU D 1 158 ? 79.120   146.496 -14.555 1.00 0.00 ? 153 GLU D CD  1 
ATOM 10001 O OE1 . GLU D 1 158 ? 78.937   147.419 -15.330 1.00 0.00 ? 153 GLU D OE1 1 
ATOM 10002 O OE2 . GLU D 1 158 ? 79.033   146.692 -13.287 1.00 0.00 ? 153 GLU D OE2 1 
ATOM 10003 N N   . GLU D 1 159 ? 75.236   143.536 -17.002 1.00 0.00 ? 154 GLU D N   1 
ATOM 10004 C CA  . GLU D 1 159 ? 74.122   143.245 -17.920 1.00 0.00 ? 154 GLU D CA  1 
ATOM 10005 C C   . GLU D 1 159 ? 72.773   143.701 -17.353 1.00 0.00 ? 154 GLU D C   1 
ATOM 10006 O O   . GLU D 1 159 ? 71.992   144.296 -18.031 1.00 0.00 ? 154 GLU D O   1 
ATOM 10007 C CB  . GLU D 1 159 ? 74.149   141.735 -18.467 1.00 0.00 ? 154 GLU D CB  1 
ATOM 10008 C CG  . GLU D 1 159 ? 73.125   141.408 -19.599 1.00 0.00 ? 154 GLU D CG  1 
ATOM 10009 C CD  . GLU D 1 159 ? 72.884   140.004 -19.919 1.00 0.00 ? 154 GLU D CD  1 
ATOM 10010 O OE1 . GLU D 1 159 ? 72.385   139.213 -18.987 1.00 0.00 ? 154 GLU D OE1 1 
ATOM 10011 O OE2 . GLU D 1 159 ? 73.309   139.569 -21.018 1.00 0.00 ? 154 GLU D OE2 1 
ATOM 10012 N N   . ALA D 1 160 ? 72.562   143.407 -16.075 1.00 0.00 ? 155 ALA D N   1 
ATOM 10013 C CA  . ALA D 1 160 ? 71.379   143.882 -15.458 1.00 0.00 ? 155 ALA D CA  1 
ATOM 10014 C C   . ALA D 1 160 ? 71.416   145.393 -15.350 1.00 0.00 ? 155 ALA D C   1 
ATOM 10015 O O   . ALA D 1 160 ? 70.473   146.135 -15.651 1.00 0.00 ? 155 ALA D O   1 
ATOM 10016 C CB  . ALA D 1 160 ? 71.255   143.211 -14.031 1.00 0.00 ? 155 ALA D CB  1 
ATOM 10017 N N   . GLY D 1 161 ? 72.601   145.889 -14.817 1.00 0.00 ? 156 GLY D N   1 
ATOM 10018 C CA  . GLY D 1 161 ? 72.783   147.343 -14.648 1.00 0.00 ? 156 GLY D CA  1 
ATOM 10019 C C   . GLY D 1 161 ? 72.741   148.130 -15.869 1.00 0.00 ? 156 GLY D C   1 
ATOM 10020 O O   . GLY D 1 161 ? 72.352   149.319 -15.749 1.00 0.00 ? 156 GLY D O   1 
ATOM 10021 N N   . ALA D 1 162 ? 73.055   147.670 -17.053 1.00 0.00 ? 157 ALA D N   1 
ATOM 10022 C CA  . ALA D 1 162 ? 72.962   148.401 -18.280 1.00 0.00 ? 157 ALA D CA  1 
ATOM 10023 C C   . ALA D 1 162 ? 71.473   148.656 -18.736 1.00 0.00 ? 157 ALA D C   1 
ATOM 10024 O O   . ALA D 1 162 ? 71.032   149.788 -19.033 1.00 0.00 ? 157 ALA D O   1 
ATOM 10025 C CB  . ALA D 1 162 ? 73.816   147.727 -19.351 1.00 0.00 ? 157 ALA D CB  1 
ATOM 10026 N N   . ALA D 1 163 ? 70.618   147.637 -18.526 1.00 0.00 ? 158 ALA D N   1 
ATOM 10027 C CA  . ALA D 1 163 ? 69.181   147.674 -18.679 1.00 0.00 ? 158 ALA D CA  1 
ATOM 10028 C C   . ALA D 1 163 ? 68.517   148.718 -17.732 1.00 0.00 ? 158 ALA D C   1 
ATOM 10029 O O   . ALA D 1 163 ? 67.655   149.475 -18.159 1.00 0.00 ? 158 ALA D O   1 
ATOM 10030 C CB  . ALA D 1 163 ? 68.657   146.225 -18.472 1.00 0.00 ? 158 ALA D CB  1 
ATOM 10031 N N   . LEU D 1 164 ? 68.982   148.839 -16.442 1.00 0.00 ? 159 LEU D N   1 
ATOM 10032 C CA  . LEU D 1 164 ? 68.556   149.842 -15.533 1.00 0.00 ? 159 LEU D CA  1 
ATOM 10033 C C   . LEU D 1 164 ? 68.935   151.295 -15.979 1.00 0.00 ? 159 LEU D C   1 
ATOM 10034 O O   . LEU D 1 164 ? 68.018   152.207 -16.040 1.00 0.00 ? 159 LEU D O   1 
ATOM 10035 C CB  . LEU D 1 164 ? 69.299   149.572 -14.182 1.00 0.00 ? 159 LEU D CB  1 
ATOM 10036 C CG  . LEU D 1 164 ? 69.100   150.630 -13.070 1.00 0.00 ? 159 LEU D CG  1 
ATOM 10037 C CD1 . LEU D 1 164 ? 67.694   150.545 -12.393 1.00 0.00 ? 159 LEU D CD1 1 
ATOM 10038 C CD2 . LEU D 1 164 ? 70.249   150.585 -11.965 1.00 0.00 ? 159 LEU D CD2 1 
ATOM 10039 N N   . ARG D 1 165 ? 70.150   151.482 -16.473 1.00 0.00 ? 160 ARG D N   1 
ATOM 10040 C CA  . ARG D 1 165 ? 70.705   152.690 -17.046 1.00 0.00 ? 160 ARG D CA  1 
ATOM 10041 C C   . ARG D 1 165 ? 69.887   153.350 -18.138 1.00 0.00 ? 160 ARG D C   1 
ATOM 10042 O O   . ARG D 1 165 ? 69.505   154.532 -18.170 1.00 0.00 ? 160 ARG D O   1 
ATOM 10043 C CB  . ARG D 1 165 ? 72.201   152.836 -17.414 1.00 0.00 ? 160 ARG D CB  1 
ATOM 10044 C CG  . ARG D 1 165 ? 73.256   152.348 -16.423 1.00 0.00 ? 160 ARG D CG  1 
ATOM 10045 C CD  . ARG D 1 165 ? 72.758   152.386 -14.909 1.00 0.00 ? 160 ARG D CD  1 
ATOM 10046 N NE  . ARG D 1 165 ? 73.939   151.960 -14.022 1.00 0.00 ? 160 ARG D NE  1 
ATOM 10047 C CZ  . ARG D 1 165 ? 74.202   152.507 -12.812 1.00 0.00 ? 160 ARG D CZ  1 
ATOM 10048 N NH1 . ARG D 1 165 ? 73.167   152.981 -12.079 1.00 0.00 ? 160 ARG D NH1 1 
ATOM 10049 N NH2 . ARG D 1 165 ? 75.402   152.575 -12.352 1.00 0.00 ? 160 ARG D NH2 1 
ATOM 10050 N N   . THR D 1 166 ? 69.497   152.562 -19.128 1.00 0.00 ? 161 THR D N   1 
ATOM 10051 C CA  . THR D 1 166 ? 68.701   153.073 -20.244 1.00 0.00 ? 161 THR D CA  1 
ATOM 10052 C C   . THR D 1 166 ? 67.260   153.339 -19.939 1.00 0.00 ? 161 THR D C   1 
ATOM 10053 O O   . THR D 1 166 ? 66.679   154.300 -20.402 1.00 0.00 ? 161 THR D O   1 
ATOM 10054 C CB  . THR D 1 166 ? 68.740   152.126 -21.401 1.00 0.00 ? 161 THR D CB  1 
ATOM 10055 O OG1 . THR D 1 166 ? 68.642   150.803 -20.890 1.00 0.00 ? 161 THR D OG1 1 
ATOM 10056 C CG2 . THR D 1 166 ? 70.048   152.261 -22.145 1.00 0.00 ? 161 THR D CG2 1 
ATOM 10057 N N   . ALA D 1 167 ? 66.630   152.459 -19.098 1.00 0.00 ? 162 ALA D N   1 
ATOM 10058 C CA  . ALA D 1 167 ? 65.391   152.687 -18.414 1.00 0.00 ? 162 ALA D CA  1 
ATOM 10059 C C   . ALA D 1 167 ? 65.348   153.961 -17.568 1.00 0.00 ? 162 ALA D C   1 
ATOM 10060 O O   . ALA D 1 167 ? 64.250   154.566 -17.583 1.00 0.00 ? 162 ALA D O   1 
ATOM 10061 C CB  . ALA D 1 167 ? 64.914   151.524 -17.536 1.00 0.00 ? 162 ALA D CB  1 
ATOM 10062 N N   . ARG D 1 168 ? 66.401   154.344 -16.809 1.00 0.00 ? 163 ARG D N   1 
ATOM 10063 C CA  . ARG D 1 168 ? 66.441   155.488 -15.971 1.00 0.00 ? 163 ARG D CA  1 
ATOM 10064 C C   . ARG D 1 168 ? 66.639   156.783 -16.811 1.00 0.00 ? 163 ARG D C   1 
ATOM 10065 O O   . ARG D 1 168 ? 65.825   157.711 -16.600 1.00 0.00 ? 163 ARG D O   1 
ATOM 10066 C CB  . ARG D 1 168 ? 67.491   155.373 -14.772 1.00 0.00 ? 163 ARG D CB  1 
ATOM 10067 C CG  . ARG D 1 168 ? 67.764   156.686 -13.986 1.00 0.00 ? 163 ARG D CG  1 
ATOM 10068 C CD  . ARG D 1 168 ? 66.523   157.162 -13.134 1.00 0.00 ? 163 ARG D CD  1 
ATOM 10069 N NE  . ARG D 1 168 ? 66.383   156.240 -11.954 1.00 0.00 ? 163 ARG D NE  1 
ATOM 10070 C CZ  . ARG D 1 168 ? 65.370   156.224 -11.071 1.00 0.00 ? 163 ARG D CZ  1 
ATOM 10071 N NH1 . ARG D 1 168 ? 64.406   157.118 -11.047 1.00 0.00 ? 163 ARG D NH1 1 
ATOM 10072 N NH2 . ARG D 1 168 ? 65.275   155.290 -10.130 1.00 0.00 ? 163 ARG D NH2 1 
ATOM 10073 N N   . ALA D 1 169 ? 67.480   156.762 -17.832 1.00 0.00 ? 164 ALA D N   1 
ATOM 10074 C CA  . ALA D 1 169 ? 67.756   157.869 -18.778 1.00 0.00 ? 164 ALA D CA  1 
ATOM 10075 C C   . ALA D 1 169 ? 66.560   158.251 -19.628 1.00 0.00 ? 164 ALA D C   1 
ATOM 10076 O O   . ALA D 1 169 ? 66.195   159.420 -19.874 1.00 0.00 ? 164 ALA D O   1 
ATOM 10077 C CB  . ALA D 1 169 ? 69.017   157.403 -19.680 1.00 0.00 ? 164 ALA D CB  1 
ATOM 10078 N N   . GLY D 1 170 ? 65.810   157.270 -20.033 1.00 0.00 ? 165 GLY D N   1 
ATOM 10079 C CA  . GLY D 1 170 ? 64.635   157.418 -20.814 1.00 0.00 ? 165 GLY D CA  1 
ATOM 10080 C C   . GLY D 1 170 ? 63.412   157.888 -20.112 1.00 0.00 ? 165 GLY D C   1 
ATOM 10081 O O   . GLY D 1 170 ? 62.724   158.848 -20.550 1.00 0.00 ? 165 GLY D O   1 
ATOM 10082 N N   . TYR D 1 171 ? 63.227   157.361 -18.818 1.00 0.00 ? 166 TYR D N   1 
ATOM 10083 C CA  . TYR D 1 171 ? 62.258   157.913 -17.842 1.00 0.00 ? 166 TYR D CA  1 
ATOM 10084 C C   . TYR D 1 171 ? 62.440   159.416 -17.575 1.00 0.00 ? 166 TYR D C   1 
ATOM 10085 O O   . TYR D 1 171 ? 61.499   160.236 -17.583 1.00 0.00 ? 166 TYR D O   1 
ATOM 10086 C CB  . TYR D 1 171 ? 62.395   157.114 -16.496 1.00 0.00 ? 166 TYR D CB  1 
ATOM 10087 C CG  . TYR D 1 171 ? 61.401   157.462 -15.451 1.00 0.00 ? 166 TYR D CG  1 
ATOM 10088 C CD1 . TYR D 1 171 ? 60.116   157.594 -15.751 1.00 0.00 ? 166 TYR D CD1 1 
ATOM 10089 C CD2 . TYR D 1 171 ? 61.888   157.992 -14.229 1.00 0.00 ? 166 TYR D CD2 1 
ATOM 10090 C CE1 . TYR D 1 171 ? 59.152   158.016 -14.755 1.00 0.00 ? 166 TYR D CE1 1 
ATOM 10091 C CE2 . TYR D 1 171 ? 60.943   158.370 -13.253 1.00 0.00 ? 166 TYR D CE2 1 
ATOM 10092 C CZ  . TYR D 1 171 ? 59.573   158.377 -13.495 1.00 0.00 ? 166 TYR D CZ  1 
ATOM 10093 O OH  . TYR D 1 171 ? 58.644   158.920 -12.538 1.00 0.00 ? 166 TYR D OH  1 
ATOM 10094 N N   . ARG D 1 172 ? 63.709   159.873 -17.493 1.00 0.00 ? 167 ARG D N   1 
ATOM 10095 C CA  . ARG D 1 172 ? 64.129   161.217 -17.331 1.00 0.00 ? 167 ARG D CA  1 
ATOM 10096 C C   . ARG D 1 172 ? 63.918   162.088 -18.575 1.00 0.00 ? 167 ARG D C   1 
ATOM 10097 O O   . ARG D 1 172 ? 63.402   163.207 -18.431 1.00 0.00 ? 167 ARG D O   1 
ATOM 10098 C CB  . ARG D 1 172 ? 65.593   161.185 -16.870 1.00 0.00 ? 167 ARG D CB  1 
ATOM 10099 C CG  . ARG D 1 172 ? 65.876   160.888 -15.404 1.00 0.00 ? 167 ARG D CG  1 
ATOM 10100 C CD  . ARG D 1 172 ? 67.346   160.952 -14.987 1.00 0.00 ? 167 ARG D CD  1 
ATOM 10101 N NE  . ARG D 1 172 ? 67.425   160.851 -13.509 1.00 0.00 ? 167 ARG D NE  1 
ATOM 10102 C CZ  . ARG D 1 172 ? 68.563   160.741 -12.830 1.00 0.00 ? 167 ARG D CZ  1 
ATOM 10103 N NH1 . ARG D 1 172 ? 69.721   160.434 -13.475 1.00 0.00 ? 167 ARG D NH1 1 
ATOM 10104 N NH2 . ARG D 1 172 ? 68.568   161.069 -11.538 1.00 0.00 ? 167 ARG D NH2 1 
ATOM 10105 N N   . GLY D 1 173 ? 64.154   161.603 -19.808 1.00 0.00 ? 168 GLY D N   1 
ATOM 10106 C CA  . GLY D 1 173 ? 63.807   162.316 -21.026 1.00 0.00 ? 168 GLY D CA  1 
ATOM 10107 C C   . GLY D 1 173 ? 62.259   162.433 -21.185 1.00 0.00 ? 168 GLY D C   1 
ATOM 10108 O O   . GLY D 1 173 ? 61.805   163.496 -21.573 1.00 0.00 ? 168 GLY D O   1 
ATOM 10109 N N   . ARG D 1 174 ? 61.496   161.407 -20.800 1.00 0.00 ? 169 ARG D N   1 
ATOM 10110 C CA  . ARG D 1 174 ? 60.069   161.328 -20.823 1.00 0.00 ? 169 ARG D CA  1 
ATOM 10111 C C   . ARG D 1 174 ? 59.418   162.256 -19.753 1.00 0.00 ? 169 ARG D C   1 
ATOM 10112 O O   . ARG D 1 174 ? 58.382   162.885 -19.917 1.00 0.00 ? 169 ARG D O   1 
ATOM 10113 C CB  . ARG D 1 174 ? 59.540   159.849 -20.734 1.00 0.00 ? 169 ARG D CB  1 
ATOM 10114 C CG  . ARG D 1 174 ? 59.845   159.256 -22.123 1.00 0.00 ? 169 ARG D CG  1 
ATOM 10115 C CD  . ARG D 1 174 ? 60.052   157.727 -22.184 1.00 0.00 ? 169 ARG D CD  1 
ATOM 10116 N NE  . ARG D 1 174 ? 58.787   157.173 -22.898 1.00 0.00 ? 169 ARG D NE  1 
ATOM 10117 C CZ  . ARG D 1 174 ? 58.726   155.928 -23.172 1.00 0.00 ? 169 ARG D CZ  1 
ATOM 10118 N NH1 . ARG D 1 174 ? 59.620   154.977 -22.785 1.00 0.00 ? 169 ARG D NH1 1 
ATOM 10119 N NH2 . ARG D 1 174 ? 57.695   155.406 -23.771 1.00 0.00 ? 169 ARG D NH2 1 
ATOM 10120 N N   . ALA D 1 175 ? 60.116   162.326 -18.622 1.00 0.00 ? 170 ALA D N   1 
ATOM 10121 C CA  . ALA D 1 175 ? 59.830   163.273 -17.622 1.00 0.00 ? 170 ALA D CA  1 
ATOM 10122 C C   . ALA D 1 175 ? 59.956   164.756 -18.056 1.00 0.00 ? 170 ALA D C   1 
ATOM 10123 O O   . ALA D 1 175 ? 59.098   165.647 -17.835 1.00 0.00 ? 170 ALA D O   1 
ATOM 10124 C CB  . ALA D 1 175 ? 60.683   163.171 -16.347 1.00 0.00 ? 170 ALA D CB  1 
ATOM 10125 N N   . LEU D 1 176 ? 61.079   165.082 -18.717 1.00 0.00 ? 171 LEU D N   1 
ATOM 10126 C CA  . LEU D 1 176 ? 61.209   166.416 -19.311 1.00 0.00 ? 171 LEU D CA  1 
ATOM 10127 C C   . LEU D 1 176 ? 60.013   166.840 -20.284 1.00 0.00 ? 171 LEU D C   1 
ATOM 10128 O O   . LEU D 1 176 ? 59.485   167.966 -20.140 1.00 0.00 ? 171 LEU D O   1 
ATOM 10129 C CB  . LEU D 1 176 ? 62.554   166.447 -20.068 1.00 0.00 ? 171 LEU D CB  1 
ATOM 10130 C CG  . LEU D 1 176 ? 63.808   166.433 -19.138 1.00 0.00 ? 171 LEU D CG  1 
ATOM 10131 C CD1 . LEU D 1 176 ? 65.116   166.459 -19.917 1.00 0.00 ? 171 LEU D CD1 1 
ATOM 10132 C CD2 . LEU D 1 176 ? 63.719   167.590 -18.115 1.00 0.00 ? 171 LEU D CD2 1 
ATOM 10133 N N   . ASP D 1 177 ? 59.563   165.971 -21.245 1.00 0.00 ? 172 ASP D N   1 
ATOM 10134 C CA  . ASP D 1 177 ? 58.358   166.123 -22.083 1.00 0.00 ? 172 ASP D CA  1 
ATOM 10135 C C   . ASP D 1 177 ? 57.049   166.195 -21.317 1.00 0.00 ? 172 ASP D C   1 
ATOM 10136 O O   . ASP D 1 177 ? 56.229   167.001 -21.725 1.00 0.00 ? 172 ASP D O   1 
ATOM 10137 C CB  . ASP D 1 177 ? 58.306   165.010 -23.270 1.00 0.00 ? 172 ASP D CB  1 
ATOM 10138 C CG  . ASP D 1 177 ? 59.213   165.367 -24.385 1.00 0.00 ? 172 ASP D CG  1 
ATOM 10139 O OD1 . ASP D 1 177 ? 58.784   166.277 -25.169 1.00 0.00 ? 172 ASP D OD1 1 
ATOM 10140 O OD2 . ASP D 1 177 ? 60.364   164.779 -24.503 1.00 0.00 ? 172 ASP D OD2 1 
ATOM 10141 N N   . TYR D 1 178 ? 56.816   165.456 -20.188 1.00 0.00 ? 173 TYR D N   1 
ATOM 10142 C CA  . TYR D 1 178 ? 55.556   165.578 -19.373 1.00 0.00 ? 173 TYR D CA  1 
ATOM 10143 C C   . TYR D 1 178 ? 55.610   166.935 -18.703 1.00 0.00 ? 173 TYR D C   1 
ATOM 10144 O O   . TYR D 1 178 ? 54.681   167.723 -18.937 1.00 0.00 ? 173 TYR D O   1 
ATOM 10145 C CB  . TYR D 1 178 ? 55.381   164.301 -18.526 1.00 0.00 ? 173 TYR D CB  1 
ATOM 10146 C CG  . TYR D 1 178 ? 54.000   164.224 -17.952 1.00 0.00 ? 173 TYR D CG  1 
ATOM 10147 C CD1 . TYR D 1 178 ? 52.823   164.576 -18.695 1.00 0.00 ? 173 TYR D CD1 1 
ATOM 10148 C CD2 . TYR D 1 178 ? 53.915   163.737 -16.619 1.00 0.00 ? 173 TYR D CD2 1 
ATOM 10149 C CE1 . TYR D 1 178 ? 51.606   164.488 -18.038 1.00 0.00 ? 173 TYR D CE1 1 
ATOM 10150 C CE2 . TYR D 1 178 ? 52.602   163.460 -16.103 1.00 0.00 ? 173 TYR D CE2 1 
ATOM 10151 C CZ  . TYR D 1 178 ? 51.495   163.811 -16.805 1.00 0.00 ? 173 TYR D CZ  1 
ATOM 10152 O OH  . TYR D 1 178 ? 50.228   163.527 -16.401 1.00 0.00 ? 173 TYR D OH  1 
ATOM 10153 N N   . ALA D 1 179 ? 56.714   167.287 -18.109 1.00 0.00 ? 174 ALA D N   1 
ATOM 10154 C CA  . ALA D 1 179 ? 56.861   168.570 -17.403 1.00 0.00 ? 174 ALA D CA  1 
ATOM 10155 C C   . ALA D 1 179 ? 56.584   169.824 -18.218 1.00 0.00 ? 174 ALA D C   1 
ATOM 10156 O O   . ALA D 1 179 ? 55.972   170.803 -17.831 1.00 0.00 ? 174 ALA D O   1 
ATOM 10157 C CB  . ALA D 1 179 ? 58.213   168.727 -16.766 1.00 0.00 ? 174 ALA D CB  1 
ATOM 10158 N N   . LEU D 1 180 ? 57.216   169.798 -19.414 1.00 0.00 ? 175 LEU D N   1 
ATOM 10159 C CA  . LEU D 1 180 ? 57.107   170.915 -20.310 1.00 0.00 ? 175 LEU D CA  1 
ATOM 10160 C C   . LEU D 1 180 ? 55.674   171.071 -20.720 1.00 0.00 ? 175 LEU D C   1 
ATOM 10161 O O   . LEU D 1 180 ? 55.190   172.146 -20.785 1.00 0.00 ? 175 LEU D O   1 
ATOM 10162 C CB  . LEU D 1 180 ? 58.006   170.510 -21.479 1.00 0.00 ? 175 LEU D CB  1 
ATOM 10163 C CG  . LEU D 1 180 ? 58.055   171.532 -22.702 1.00 0.00 ? 175 LEU D CG  1 
ATOM 10164 C CD1 . LEU D 1 180 ? 58.616   172.944 -22.507 1.00 0.00 ? 175 LEU D CD1 1 
ATOM 10165 C CD2 . LEU D 1 180 ? 58.839   170.803 -23.853 1.00 0.00 ? 175 LEU D CD2 1 
ATOM 10166 N N   . GLN D 1 181 ? 54.914   169.967 -20.935 1.00 0.00 ? 176 GLN D N   1 
ATOM 10167 C CA  . GLN D 1 181 ? 53.474   170.037 -21.377 1.00 0.00 ? 176 GLN D CA  1 
ATOM 10168 C C   . GLN D 1 181 ? 52.574   170.429 -20.241 1.00 0.00 ? 176 GLN D C   1 
ATOM 10169 O O   . GLN D 1 181 ? 51.502   171.074 -20.401 1.00 0.00 ? 176 GLN D O   1 
ATOM 10170 C CB  . GLN D 1 181 ? 52.891   168.694 -21.860 1.00 0.00 ? 176 GLN D CB  1 
ATOM 10171 C CG  . GLN D 1 181 ? 53.395   168.422 -23.277 1.00 0.00 ? 176 GLN D CG  1 
ATOM 10172 C CD  . GLN D 1 181 ? 52.503   169.203 -24.313 1.00 0.00 ? 176 GLN D CD  1 
ATOM 10173 O OE1 . GLN D 1 181 ? 51.275   169.367 -24.199 1.00 0.00 ? 176 GLN D OE1 1 
ATOM 10174 N NE2 . GLN D 1 181 ? 53.158   169.514 -25.482 1.00 0.00 ? 176 GLN D NE2 1 
ATOM 10175 N N   . ILE D 1 182 ? 53.104   170.191 -18.992 1.00 0.00 ? 177 ILE D N   1 
ATOM 10176 C CA  . ILE D 1 182 ? 52.303   170.574 -17.828 1.00 0.00 ? 177 ILE D CA  1 
ATOM 10177 C C   . ILE D 1 182 ? 52.315   172.102 -17.655 1.00 0.00 ? 177 ILE D C   1 
ATOM 10178 O O   . ILE D 1 182 ? 51.323   172.717 -17.314 1.00 0.00 ? 177 ILE D O   1 
ATOM 10179 C CB  . ILE D 1 182 ? 52.922   169.925 -16.563 1.00 0.00 ? 177 ILE D CB  1 
ATOM 10180 C CG1 . ILE D 1 182 ? 52.595   168.431 -16.633 1.00 0.00 ? 177 ILE D CG1 1 
ATOM 10181 C CG2 . ILE D 1 182 ? 52.236   170.542 -15.242 1.00 0.00 ? 177 ILE D CG2 1 
ATOM 10182 C CD1 . ILE D 1 182 ? 53.175   167.502 -15.581 1.00 0.00 ? 177 ILE D CD1 1 
ATOM 10183 N N   . ASN D 1 183 ? 53.428   172.727 -18.012 1.00 0.00 ? 178 ASN D N   1 
ATOM 10184 C CA  . ASN D 1 183 ? 53.485   174.179 -18.239 1.00 0.00 ? 178 ASN D CA  1 
ATOM 10185 C C   . ASN D 1 183 ? 52.656   174.682 -19.444 1.00 0.00 ? 178 ASN D C   1 
ATOM 10186 O O   . ASN D 1 183 ? 52.037   175.718 -19.363 1.00 0.00 ? 178 ASN D O   1 
ATOM 10187 C CB  . ASN D 1 183 ? 55.014   174.575 -18.425 1.00 0.00 ? 178 ASN D CB  1 
ATOM 10188 C CG  . ASN D 1 183 ? 55.715   174.622 -17.141 1.00 0.00 ? 178 ASN D CG  1 
ATOM 10189 O OD1 . ASN D 1 183 ? 55.884   175.735 -16.589 1.00 0.00 ? 178 ASN D OD1 1 
ATOM 10190 N ND2 . ASN D 1 183 ? 55.950   173.498 -16.546 1.00 0.00 ? 178 ASN D ND2 1 
ATOM 10191 N N   . VAL D 1 184 ? 52.638   173.966 -20.609 1.00 0.00 ? 179 VAL D N   1 
ATOM 10192 C CA  . VAL D 1 184 ? 51.748   174.376 -21.752 1.00 0.00 ? 179 VAL D CA  1 
ATOM 10193 C C   . VAL D 1 184 ? 50.239   174.387 -21.623 1.00 0.00 ? 179 VAL D C   1 
ATOM 10194 O O   . VAL D 1 184 ? 49.551   175.318 -22.074 1.00 0.00 ? 179 VAL D O   1 
ATOM 10195 C CB  . VAL D 1 184 ? 52.112   173.516 -22.989 1.00 0.00 ? 179 VAL D CB  1 
ATOM 10196 C CG1 . VAL D 1 184 ? 51.252   173.749 -24.259 1.00 0.00 ? 179 VAL D CG1 1 
ATOM 10197 C CG2 . VAL D 1 184 ? 53.619   173.860 -23.363 1.00 0.00 ? 179 VAL D CG2 1 
ATOM 10198 N N   . ILE D 1 185 ? 49.699   173.360 -20.904 1.00 0.00 ? 180 ILE D N   1 
ATOM 10199 C CA  . ILE D 1 185 ? 48.331   173.228 -20.455 1.00 0.00 ? 180 ILE D CA  1 
ATOM 10200 C C   . ILE D 1 185 ? 47.839   174.255 -19.535 1.00 0.00 ? 180 ILE D C   1 
ATOM 10201 O O   . ILE D 1 185 ? 46.626   174.533 -19.554 1.00 0.00 ? 180 ILE D O   1 
ATOM 10202 C CB  . ILE D 1 185 ? 47.981   171.837 -20.093 1.00 0.00 ? 180 ILE D CB  1 
ATOM 10203 C CG1 . ILE D 1 185 ? 46.472   171.486 -20.232 1.00 0.00 ? 180 ILE D CG1 1 
ATOM 10204 C CG2 . ILE D 1 185 ? 48.342   171.504 -18.656 1.00 0.00 ? 180 ILE D CG2 1 
ATOM 10205 C CD1 . ILE D 1 185 ? 46.251   169.968 -20.380 1.00 0.00 ? 180 ILE D CD1 1 
ATOM 10206 N N   . GLU D 1 186 ? 48.788   174.772 -18.667 1.00 0.00 ? 181 GLU D N   1 
ATOM 10207 C CA  . GLU D 1 186 ? 48.535   175.671 -17.592 1.00 0.00 ? 181 GLU D CA  1 
ATOM 10208 C C   . GLU D 1 186 ? 48.263   177.116 -18.053 1.00 0.00 ? 181 GLU D C   1 
ATOM 10209 O O   . GLU D 1 186 ? 47.335   177.707 -17.537 1.00 0.00 ? 181 GLU D O   1 
ATOM 10210 C CB  . GLU D 1 186 ? 49.847   175.669 -16.746 1.00 0.00 ? 181 GLU D CB  1 
ATOM 10211 C CG  . GLU D 1 186 ? 50.032   176.608 -15.525 1.00 0.00 ? 181 GLU D CG  1 
ATOM 10212 C CD  . GLU D 1 186 ? 51.342   176.461 -14.820 1.00 0.00 ? 181 GLU D CD  1 
ATOM 10213 O OE1 . GLU D 1 186 ? 51.448   175.570 -13.945 1.00 0.00 ? 181 GLU D OE1 1 
ATOM 10214 O OE2 . GLU D 1 186 ? 52.181   177.408 -14.943 1.00 0.00 ? 181 GLU D OE2 1 
ATOM 10215 N N   . ASP D 1 187 ? 49.027   177.542 -19.043 1.00 0.00 ? 182 ASP D N   1 
ATOM 10216 C CA  . ASP D 1 187 ? 48.853   178.759 -19.862 1.00 0.00 ? 182 ASP D CA  1 
ATOM 10217 C C   . ASP D 1 187 ? 47.772   178.561 -20.916 1.00 0.00 ? 182 ASP D C   1 
ATOM 10218 O O   . ASP D 1 187 ? 47.077   179.525 -21.005 1.00 0.00 ? 182 ASP D O   1 
ATOM 10219 C CB  . ASP D 1 187 ? 50.161   179.163 -20.472 1.00 0.00 ? 182 ASP D CB  1 
ATOM 10220 C CG  . ASP D 1 187 ? 51.214   179.455 -19.417 1.00 0.00 ? 182 ASP D CG  1 
ATOM 10221 O OD1 . ASP D 1 187 ? 50.967   179.703 -18.231 1.00 0.00 ? 182 ASP D OD1 1 
ATOM 10222 O OD2 . ASP D 1 187 ? 52.371   179.743 -19.921 1.00 0.00 ? 182 ASP D OD2 1 
ATOM 10223 N N   . LYS D 1 188 ? 47.656   177.445 -21.609 1.00 0.00 ? 183 LYS D N   1 
ATOM 10224 C CA  . LYS D 1 188 ? 46.521   177.191 -22.526 1.00 0.00 ? 183 LYS D CA  1 
ATOM 10225 C C   . LYS D 1 188 ? 45.160   177.256 -21.833 1.00 0.00 ? 183 LYS D C   1 
ATOM 10226 O O   . LYS D 1 188 ? 44.310   177.913 -22.376 1.00 0.00 ? 183 LYS D O   1 
ATOM 10227 C CB  . LYS D 1 188 ? 46.642   175.854 -23.242 1.00 0.00 ? 183 LYS D CB  1 
ATOM 10228 C CG  . LYS D 1 188 ? 45.601   175.581 -24.360 1.00 0.00 ? 183 LYS D CG  1 
ATOM 10229 C CD  . LYS D 1 188 ? 45.893   174.372 -25.352 1.00 0.00 ? 183 LYS D CD  1 
ATOM 10230 C CE  . LYS D 1 188 ? 44.777   173.933 -26.371 1.00 0.00 ? 183 LYS D CE  1 
ATOM 10231 N NZ  . LYS D 1 188 ? 44.480   175.068 -27.256 1.00 0.00 ? 183 LYS D NZ  1 
ATOM 10232 N N   . ARG D 1 189 ? 45.007   176.605 -20.643 1.00 0.00 ? 184 ARG D N   1 
ATOM 10233 C CA  . ARG D 1 189 ? 43.751   176.773 -19.836 1.00 0.00 ? 184 ARG D CA  1 
ATOM 10234 C C   . ARG D 1 189 ? 43.490   178.204 -19.431 1.00 0.00 ? 184 ARG D C   1 
ATOM 10235 O O   . ARG D 1 189 ? 42.361   178.663 -19.491 1.00 0.00 ? 184 ARG D O   1 
ATOM 10236 C CB  . ARG D 1 189 ? 43.590   175.780 -18.683 1.00 0.00 ? 184 ARG D CB  1 
ATOM 10237 C CG  . ARG D 1 189 ? 44.341   176.165 -17.361 1.00 0.00 ? 184 ARG D CG  1 
ATOM 10238 C CD  . ARG D 1 189 ? 44.284   174.958 -16.327 1.00 0.00 ? 184 ARG D CD  1 
ATOM 10239 N NE  . ARG D 1 189 ? 42.891   174.882 -15.737 1.00 0.00 ? 184 ARG D NE  1 
ATOM 10240 C CZ  . ARG D 1 189 ? 42.607   174.166 -14.591 1.00 0.00 ? 184 ARG D CZ  1 
ATOM 10241 N NH1 . ARG D 1 189 ? 43.422   173.303 -13.987 1.00 0.00 ? 184 ARG D NH1 1 
ATOM 10242 N NH2 . ARG D 1 189 ? 41.391   174.155 -14.161 1.00 0.00 ? 184 ARG D NH2 1 
ATOM 10243 N N   . LYS D 1 190 ? 44.445   179.069 -19.061 1.00 0.00 ? 185 LYS D N   1 
ATOM 10244 C CA  . LYS D 1 190 ? 44.251   180.494 -18.926 1.00 0.00 ? 185 LYS D CA  1 
ATOM 10245 C C   . LYS D 1 190 ? 43.898   181.305 -20.211 1.00 0.00 ? 185 LYS D C   1 
ATOM 10246 O O   . LYS D 1 190 ? 42.887   181.971 -20.291 1.00 0.00 ? 185 LYS D O   1 
ATOM 10247 C CB  . LYS D 1 190 ? 45.464   181.060 -18.283 1.00 0.00 ? 185 LYS D CB  1 
ATOM 10248 C CG  . LYS D 1 190 ? 45.367   182.558 -17.799 1.00 0.00 ? 185 LYS D CG  1 
ATOM 10249 C CD  . LYS D 1 190 ? 46.674   183.211 -17.318 1.00 0.00 ? 185 LYS D CD  1 
ATOM 10250 C CE  . LYS D 1 190 ? 47.146   182.610 -15.957 1.00 0.00 ? 185 LYS D CE  1 
ATOM 10251 N NZ  . LYS D 1 190 ? 48.409   183.235 -15.662 1.00 0.00 ? 185 LYS D NZ  1 
ATOM 10252 N N   . PHE D 1 191 ? 44.651   181.196 -21.271 1.00 0.00 ? 186 PHE D N   1 
ATOM 10253 C CA  . PHE D 1 191 ? 44.522   182.054 -22.440 1.00 0.00 ? 186 PHE D CA  1 
ATOM 10254 C C   . PHE D 1 191 ? 43.402   181.776 -23.451 1.00 0.00 ? 186 PHE D C   1 
ATOM 10255 O O   . PHE D 1 191 ? 42.838   182.605 -24.179 1.00 0.00 ? 186 PHE D O   1 
ATOM 10256 C CB  . PHE D 1 191 ? 45.786   182.062 -23.281 1.00 0.00 ? 186 PHE D CB  1 
ATOM 10257 C CG  . PHE D 1 191 ? 47.056   182.343 -22.490 1.00 0.00 ? 186 PHE D CG  1 
ATOM 10258 C CD1 . PHE D 1 191 ? 47.206   183.180 -21.412 1.00 0.00 ? 186 PHE D CD1 1 
ATOM 10259 C CD2 . PHE D 1 191 ? 48.202   181.812 -23.157 1.00 0.00 ? 186 PHE D CD2 1 
ATOM 10260 C CE1 . PHE D 1 191 ? 48.472   183.589 -20.968 1.00 0.00 ? 186 PHE D CE1 1 
ATOM 10261 C CE2 . PHE D 1 191 ? 49.450   182.204 -22.685 1.00 0.00 ? 186 PHE D CE2 1 
ATOM 10262 C CZ  . PHE D 1 191 ? 49.630   183.125 -21.617 1.00 0.00 ? 186 PHE D CZ  1 
ATOM 10263 N N   . ASP D 1 192 ? 43.064   180.498 -23.607 1.00 0.00 ? 187 ASP D N   1 
ATOM 10264 C CA  . ASP D 1 192 ? 41.958   180.088 -24.425 1.00 0.00 ? 187 ASP D CA  1 
ATOM 10265 C C   . ASP D 1 192 ? 40.603   180.462 -23.770 1.00 0.00 ? 187 ASP D C   1 
ATOM 10266 O O   . ASP D 1 192 ? 39.650   180.884 -24.413 1.00 0.00 ? 187 ASP D O   1 
ATOM 10267 C CB  . ASP D 1 192 ? 42.085   178.613 -24.805 1.00 0.00 ? 187 ASP D CB  1 
ATOM 10268 C CG  . ASP D 1 192 ? 43.138   178.316 -25.865 1.00 0.00 ? 187 ASP D CG  1 
ATOM 10269 O OD1 . ASP D 1 192 ? 44.006   179.118 -26.232 1.00 0.00 ? 187 ASP D OD1 1 
ATOM 10270 O OD2 . ASP D 1 192 ? 43.000   177.182 -26.424 1.00 0.00 ? 187 ASP D OD2 1 
ATOM 10271 N N   . ILE D 1 193 ? 40.572   180.348 -22.410 1.00 0.00 ? 188 ILE D N   1 
ATOM 10272 C CA  . ILE D 1 193 ? 39.340   180.718 -21.724 1.00 0.00 ? 188 ILE D CA  1 
ATOM 10273 C C   . ILE D 1 193 ? 39.219   182.274 -21.607 1.00 0.00 ? 188 ILE D C   1 
ATOM 10274 O O   . ILE D 1 193 ? 38.159   182.835 -21.747 1.00 0.00 ? 188 ILE D O   1 
ATOM 10275 C CB  . ILE D 1 193 ? 39.341   180.155 -20.313 1.00 0.00 ? 188 ILE D CB  1 
ATOM 10276 C CG1 . ILE D 1 193 ? 39.286   178.575 -20.337 1.00 0.00 ? 188 ILE D CG1 1 
ATOM 10277 C CG2 . ILE D 1 193 ? 38.180   180.753 -19.465 1.00 0.00 ? 188 ILE D CG2 1 
ATOM 10278 C CD1 . ILE D 1 193 ? 37.947   178.018 -20.918 1.00 0.00 ? 188 ILE D CD1 1 
ATOM 10279 N N   . MET D 1 194 ? 40.286   182.993 -21.331 1.00 0.00 ? 189 MET D N   1 
ATOM 10280 C CA  . MET D 1 194 ? 40.350   184.543 -21.234 1.00 0.00 ? 189 MET D CA  1 
ATOM 10281 C C   . MET D 1 194 ? 39.970   185.184 -22.530 1.00 0.00 ? 189 MET D C   1 
ATOM 10282 O O   . MET D 1 194 ? 39.160   186.093 -22.626 1.00 0.00 ? 189 MET D O   1 
ATOM 10283 C CB  . MET D 1 194 ? 41.761   185.002 -20.631 1.00 0.00 ? 189 MET D CB  1 
ATOM 10284 C CG  . MET D 1 194 ? 41.721   186.544 -20.292 1.00 0.00 ? 189 MET D CG  1 
ATOM 10285 S SD  . MET D 1 194 ? 43.365   187.231 -19.913 1.00 0.00 ? 189 MET D SD  1 
ATOM 10286 C CE  . MET D 1 194 ? 43.761   186.257 -18.414 1.00 0.00 ? 189 MET D CE  1 
ATOM 10287 N N   . GLU D 1 195 ? 40.588   184.669 -23.724 1.00 0.00 ? 190 GLU D N   1 
ATOM 10288 C CA  . GLU D 1 195 ? 40.209   185.095 -25.118 1.00 0.00 ? 190 GLU D CA  1 
ATOM 10289 C C   . GLU D 1 195 ? 38.797   184.770 -25.484 1.00 0.00 ? 190 GLU D C   1 
ATOM 10290 O O   . GLU D 1 195 ? 38.075   185.579 -26.083 1.00 0.00 ? 190 GLU D O   1 
ATOM 10291 C CB  . GLU D 1 195 ? 41.121   184.353 -26.069 1.00 0.00 ? 190 GLU D CB  1 
ATOM 10292 C CG  . GLU D 1 195 ? 41.141   184.861 -27.497 1.00 0.00 ? 190 GLU D CG  1 
ATOM 10293 C CD  . GLU D 1 195 ? 42.244   184.169 -28.234 1.00 0.00 ? 190 GLU D CD  1 
ATOM 10294 O OE1 . GLU D 1 195 ? 42.214   182.926 -28.430 1.00 0.00 ? 190 GLU D OE1 1 
ATOM 10295 O OE2 . GLU D 1 195 ? 43.206   184.857 -28.595 1.00 0.00 ? 190 GLU D OE2 1 
ATOM 10296 N N   . PHE D 1 196 ? 38.307   183.539 -25.139 1.00 0.00 ? 191 PHE D N   1 
ATOM 10297 C CA  . PHE D 1 196 ? 36.906   183.263 -25.282 1.00 0.00 ? 191 PHE D CA  1 
ATOM 10298 C C   . PHE D 1 196 ? 35.930   184.321 -24.659 1.00 0.00 ? 191 PHE D C   1 
ATOM 10299 O O   . PHE D 1 196 ? 35.195   184.967 -25.378 1.00 0.00 ? 191 PHE D O   1 
ATOM 10300 C CB  . PHE D 1 196 ? 36.567   181.886 -24.547 1.00 0.00 ? 191 PHE D CB  1 
ATOM 10301 C CG  . PHE D 1 196 ? 35.210   181.365 -24.761 1.00 0.00 ? 191 PHE D CG  1 
ATOM 10302 C CD1 . PHE D 1 196 ? 34.795   181.107 -26.023 1.00 0.00 ? 191 PHE D CD1 1 
ATOM 10303 C CD2 . PHE D 1 196 ? 34.413   180.994 -23.713 1.00 0.00 ? 191 PHE D CD2 1 
ATOM 10304 C CE1 . PHE D 1 196 ? 33.544   180.447 -26.278 1.00 0.00 ? 191 PHE D CE1 1 
ATOM 10305 C CE2 . PHE D 1 196 ? 33.192   180.404 -23.912 1.00 0.00 ? 191 PHE D CE2 1 
ATOM 10306 C CZ  . PHE D 1 196 ? 32.762   180.015 -25.153 1.00 0.00 ? 191 PHE D CZ  1 
ATOM 10307 N N   . VAL D 1 197 ? 36.072   184.636 -23.334 1.00 0.00 ? 192 VAL D N   1 
ATOM 10308 C CA  . VAL D 1 197 ? 35.248   185.610 -22.601 1.00 0.00 ? 192 VAL D CA  1 
ATOM 10309 C C   . VAL D 1 197 ? 35.329   186.974 -23.200 1.00 0.00 ? 192 VAL D C   1 
ATOM 10310 O O   . VAL D 1 197 ? 34.338   187.607 -23.492 1.00 0.00 ? 192 VAL D O   1 
ATOM 10311 C CB  . VAL D 1 197 ? 35.555   185.529 -21.083 1.00 0.00 ? 192 VAL D CB  1 
ATOM 10312 C CG1 . VAL D 1 197 ? 34.654   186.574 -20.369 1.00 0.00 ? 192 VAL D CG1 1 
ATOM 10313 C CG2 . VAL D 1 197 ? 35.204   184.105 -20.542 1.00 0.00 ? 192 VAL D CG2 1 
ATOM 10314 N N   . LEU D 1 198 ? 36.512   187.452 -23.449 1.00 0.00 ? 193 LEU D N   1 
ATOM 10315 C CA  . LEU D 1 198 ? 36.749   188.746 -24.038 1.00 0.00 ? 193 LEU D CA  1 
ATOM 10316 C C   . LEU D 1 198 ? 36.166   188.815 -25.472 1.00 0.00 ? 193 LEU D C   1 
ATOM 10317 O O   . LEU D 1 198 ? 35.595   189.795 -25.819 1.00 0.00 ? 193 LEU D O   1 
ATOM 10318 C CB  . LEU D 1 198 ? 38.259   188.833 -24.251 1.00 0.00 ? 193 LEU D CB  1 
ATOM 10319 C CG  . LEU D 1 198 ? 38.803   190.112 -24.917 1.00 0.00 ? 193 LEU D CG  1 
ATOM 10320 C CD1 . LEU D 1 198 ? 38.203   191.254 -24.125 1.00 0.00 ? 193 LEU D CD1 1 
ATOM 10321 C CD2 . LEU D 1 198 ? 40.336   190.067 -24.795 1.00 0.00 ? 193 LEU D CD2 1 
ATOM 10322 N N   . ARG D 1 199 ? 36.222   187.730 -26.297 1.00 0.00 ? 194 ARG D N   1 
ATOM 10323 C CA  . ARG D 1 199 ? 35.541   187.795 -27.570 1.00 0.00 ? 194 ARG D CA  1 
ATOM 10324 C C   . ARG D 1 199 ? 34.047   187.891 -27.496 1.00 0.00 ? 194 ARG D C   1 
ATOM 10325 O O   . ARG D 1 199 ? 33.438   188.616 -28.216 1.00 0.00 ? 194 ARG D O   1 
ATOM 10326 C CB  . ARG D 1 199 ? 35.842   186.520 -28.286 1.00 0.00 ? 194 ARG D CB  1 
ATOM 10327 C CG  . ARG D 1 199 ? 35.501   186.433 -29.849 1.00 0.00 ? 194 ARG D CG  1 
ATOM 10328 C CD  . ARG D 1 199 ? 36.265   187.459 -30.665 1.00 0.00 ? 194 ARG D CD  1 
ATOM 10329 N NE  . ARG D 1 199 ? 37.690   187.055 -30.573 1.00 0.00 ? 194 ARG D NE  1 
ATOM 10330 C CZ  . ARG D 1 199 ? 38.691   187.697 -29.896 1.00 0.00 ? 194 ARG D CZ  1 
ATOM 10331 N NH1 . ARG D 1 199 ? 38.474   188.839 -29.245 1.00 0.00 ? 194 ARG D NH1 1 
ATOM 10332 N NH2 . ARG D 1 199 ? 39.892   187.134 -29.770 1.00 0.00 ? 194 ARG D NH2 1 
ATOM 10333 N N   . LEU D 1 200 ? 33.449   187.151 -26.660 1.00 0.00 ? 195 LEU D N   1 
ATOM 10334 C CA  . LEU D 1 200 ? 32.042   187.197 -26.426 1.00 0.00 ? 195 LEU D CA  1 
ATOM 10335 C C   . LEU D 1 200 ? 31.508   188.533 -25.919 1.00 0.00 ? 195 LEU D C   1 
ATOM 10336 O O   . LEU D 1 200 ? 30.455   188.968 -26.444 1.00 0.00 ? 195 LEU D O   1 
ATOM 10337 C CB  . LEU D 1 200 ? 31.576   186.140 -25.433 1.00 0.00 ? 195 LEU D CB  1 
ATOM 10338 C CG  . LEU D 1 200 ? 31.586   184.674 -26.015 1.00 0.00 ? 195 LEU D CG  1 
ATOM 10339 C CD1 . LEU D 1 200 ? 31.134   183.777 -24.842 1.00 0.00 ? 195 LEU D CD1 1 
ATOM 10340 C CD2 . LEU D 1 200 ? 30.745   184.478 -27.265 1.00 0.00 ? 195 LEU D CD2 1 
ATOM 10341 N N   . VAL D 1 201 ? 32.110   189.173 -24.914 1.00 0.00 ? 196 VAL D N   1 
ATOM 10342 C CA  . VAL D 1 201 ? 31.798   190.517 -24.257 1.00 0.00 ? 196 VAL D CA  1 
ATOM 10343 C C   . VAL D 1 201 ? 31.921   191.641 -25.267 1.00 0.00 ? 196 VAL D C   1 
ATOM 10344 O O   . VAL D 1 201 ? 31.152   192.581 -25.315 1.00 0.00 ? 196 VAL D O   1 
ATOM 10345 C CB  . VAL D 1 201 ? 32.450   190.766 -22.893 1.00 0.00 ? 196 VAL D CB  1 
ATOM 10346 C CG1 . VAL D 1 201 ? 32.104   192.120 -22.228 1.00 0.00 ? 196 VAL D CG1 1 
ATOM 10347 C CG2 . VAL D 1 201 ? 32.196   189.560 -21.937 1.00 0.00 ? 196 VAL D CG2 1 
ATOM 10348 N N   . GLU D 1 202 ? 32.963   191.465 -26.143 1.00 0.00 ? 197 GLU D N   1 
ATOM 10349 C CA  . GLU D 1 202 ? 33.300   192.402 -27.275 1.00 0.00 ? 197 GLU D CA  1 
ATOM 10350 C C   . GLU D 1 202 ? 32.264   192.453 -28.380 1.00 0.00 ? 197 GLU D C   1 
ATOM 10351 O O   . GLU D 1 202 ? 31.823   193.564 -28.744 1.00 0.00 ? 197 GLU D O   1 
ATOM 10352 C CB  . GLU D 1 202 ? 34.811   192.137 -27.733 1.00 0.00 ? 197 GLU D CB  1 
ATOM 10353 C CG  . GLU D 1 202 ? 35.139   192.442 -29.202 1.00 0.00 ? 197 GLU D CG  1 
ATOM 10354 C CD  . GLU D 1 202 ? 36.567   192.193 -29.492 1.00 0.00 ? 197 GLU D CD  1 
ATOM 10355 O OE1 . GLU D 1 202 ? 37.422   193.043 -29.079 1.00 0.00 ? 197 GLU D OE1 1 
ATOM 10356 O OE2 . GLU D 1 202 ? 36.934   191.079 -29.952 1.00 0.00 ? 197 GLU D OE2 1 
ATOM 10357 N N   . ALA D 1 203 ? 31.873   191.312 -28.842 1.00 0.00 ? 198 ALA D N   1 
ATOM 10358 C CA  . ALA D 1 203 ? 30.798   191.114 -29.851 1.00 0.00 ? 198 ALA D CA  1 
ATOM 10359 C C   . ALA D 1 203 ? 29.361   191.354 -29.358 1.00 0.00 ? 198 ALA D C   1 
ATOM 10360 O O   . ALA D 1 203 ? 28.520   191.865 -30.045 1.00 0.00 ? 198 ALA D O   1 
ATOM 10361 C CB  . ALA D 1 203 ? 30.911   189.701 -30.290 1.00 0.00 ? 198 ALA D CB  1 
ATOM 10362 N N   . GLN D 1 204 ? 29.057   191.033 -28.062 1.00 0.00 ? 199 GLN D N   1 
ATOM 10363 C CA  . GLN D 1 204 ? 27.783   191.503 -27.476 1.00 0.00 ? 199 GLN D CA  1 
ATOM 10364 C C   . GLN D 1 204 ? 27.620   192.977 -27.429 1.00 0.00 ? 199 GLN D C   1 
ATOM 10365 O O   . GLN D 1 204 ? 26.649   193.611 -27.728 1.00 0.00 ? 199 GLN D O   1 
ATOM 10366 C CB  . GLN D 1 204 ? 27.607   190.872 -26.068 1.00 0.00 ? 199 GLN D CB  1 
ATOM 10367 C CG  . GLN D 1 204 ? 26.413   191.428 -25.236 1.00 0.00 ? 199 GLN D CG  1 
ATOM 10368 C CD  . GLN D 1 204 ? 26.588   190.738 -23.825 1.00 0.00 ? 199 GLN D CD  1 
ATOM 10369 O OE1 . GLN D 1 204 ? 27.188   191.192 -22.847 1.00 0.00 ? 199 GLN D OE1 1 
ATOM 10370 N NE2 . GLN D 1 204 ? 26.224   189.453 -23.773 1.00 0.00 ? 199 GLN D NE2 1 
ATOM 10371 N N   . ALA D 1 205 ? 28.690   193.709 -27.033 1.00 0.00 ? 200 ALA D N   1 
ATOM 10372 C CA  . ALA D 1 205 ? 28.717   195.077 -26.805 1.00 0.00 ? 200 ALA D CA  1 
ATOM 10373 C C   . ALA D 1 205 ? 28.471   195.942 -28.011 1.00 0.00 ? 200 ALA D C   1 
ATOM 10374 O O   . ALA D 1 205 ? 27.717   196.854 -27.971 1.00 0.00 ? 200 ALA D O   1 
ATOM 10375 C CB  . ALA D 1 205 ? 30.019   195.563 -26.159 1.00 0.00 ? 200 ALA D CB  1 
ATOM 10376 N N   . THR D 1 206 ? 29.082   195.518 -29.217 1.00 0.00 ? 201 THR D N   1 
ATOM 10377 C CA  . THR D 1 206 ? 28.883   196.223 -30.548 1.00 0.00 ? 201 THR D CA  1 
ATOM 10378 C C   . THR D 1 206 ? 27.378   196.232 -30.981 1.00 0.00 ? 201 THR D C   1 
ATOM 10379 O O   . THR D 1 206 ? 26.894   197.284 -31.416 1.00 0.00 ? 201 THR D O   1 
ATOM 10380 C CB  . THR D 1 206 ? 29.671   195.458 -31.679 1.00 0.00 ? 201 THR D CB  1 
ATOM 10381 O OG1 . THR D 1 206 ? 31.025   195.315 -31.359 1.00 0.00 ? 201 THR D OG1 1 
ATOM 10382 C CG2 . THR D 1 206 ? 29.441   196.361 -32.991 1.00 0.00 ? 201 THR D CG2 1 
ATOM 10383 N N   . HIS D 1 207 ? 26.678   195.093 -30.764 1.00 0.00 ? 202 HIS D N   1 
ATOM 10384 C CA  . HIS D 1 207 ? 25.241   194.956 -31.119 1.00 0.00 ? 202 HIS D CA  1 
ATOM 10385 C C   . HIS D 1 207 ? 24.320   195.880 -30.402 1.00 0.00 ? 202 HIS D C   1 
ATOM 10386 O O   . HIS D 1 207 ? 23.391   196.455 -30.950 1.00 0.00 ? 202 HIS D O   1 
ATOM 10387 C CB  . HIS D 1 207 ? 24.929   193.486 -30.754 1.00 0.00 ? 202 HIS D CB  1 
ATOM 10388 C CG  . HIS D 1 207 ? 23.575   192.951 -31.081 1.00 0.00 ? 202 HIS D CG  1 
ATOM 10389 N ND1 . HIS D 1 207 ? 23.018   192.644 -32.331 1.00 0.00 ? 202 HIS D ND1 1 
ATOM 10390 C CD2 . HIS D 1 207 ? 22.621   192.593 -30.194 1.00 0.00 ? 202 HIS D CD2 1 
ATOM 10391 C CE1 . HIS D 1 207 ? 21.802   192.096 -32.116 1.00 0.00 ? 202 HIS D CE1 1 
ATOM 10392 N NE2 . HIS D 1 207 ? 21.559   192.059 -30.850 1.00 0.00 ? 202 HIS D NE2 1 
ATOM 10393 N N   . PHE D 1 208 ? 24.555   196.098 -29.095 1.00 0.00 ? 203 PHE D N   1 
ATOM 10394 C CA  . PHE D 1 208 ? 23.974   197.260 -28.396 1.00 0.00 ? 203 PHE D CA  1 
ATOM 10395 C C   . PHE D 1 208 ? 24.390   198.654 -28.890 1.00 0.00 ? 203 PHE D C   1 
ATOM 10396 O O   . PHE D 1 208 ? 23.541   199.524 -28.949 1.00 0.00 ? 203 PHE D O   1 
ATOM 10397 C CB  . PHE D 1 208 ? 24.364   197.307 -26.914 1.00 0.00 ? 203 PHE D CB  1 
ATOM 10398 C CG  . PHE D 1 208 ? 23.591   196.269 -26.162 1.00 0.00 ? 203 PHE D CG  1 
ATOM 10399 C CD1 . PHE D 1 208 ? 22.233   196.528 -25.899 1.00 0.00 ? 203 PHE D CD1 1 
ATOM 10400 C CD2 . PHE D 1 208 ? 24.171   195.030 -25.931 1.00 0.00 ? 203 PHE D CD2 1 
ATOM 10401 C CE1 . PHE D 1 208 ? 21.429   195.560 -25.408 1.00 0.00 ? 203 PHE D CE1 1 
ATOM 10402 C CE2 . PHE D 1 208 ? 23.350   194.040 -25.325 1.00 0.00 ? 203 PHE D CE2 1 
ATOM 10403 C CZ  . PHE D 1 208 ? 21.990   194.277 -25.173 1.00 0.00 ? 203 PHE D CZ  1 
ATOM 10404 N N   . GLN D 1 209 ? 25.689   198.911 -29.223 1.00 0.00 ? 204 GLN D N   1 
ATOM 10405 C CA  . GLN D 1 209 ? 26.205   200.196 -29.689 1.00 0.00 ? 204 GLN D CA  1 
ATOM 10406 C C   . GLN D 1 209 ? 25.506   200.713 -30.899 1.00 0.00 ? 204 GLN D C   1 
ATOM 10407 O O   . GLN D 1 209 ? 24.882   201.763 -30.982 1.00 0.00 ? 204 GLN D O   1 
ATOM 10408 C CB  . GLN D 1 209 ? 27.738   200.045 -29.823 1.00 0.00 ? 204 GLN D CB  1 
ATOM 10409 C CG  . GLN D 1 209 ? 28.687   201.316 -30.044 1.00 0.00 ? 204 GLN D CG  1 
ATOM 10410 C CD  . GLN D 1 209 ? 30.143   200.794 -30.183 1.00 0.00 ? 204 GLN D CD  1 
ATOM 10411 O OE1 . GLN D 1 209 ? 30.517   199.642 -30.063 1.00 0.00 ? 204 GLN D OE1 1 
ATOM 10412 N NE2 . GLN D 1 209 ? 30.959   201.835 -30.500 1.00 0.00 ? 204 GLN D NE2 1 
ATOM 10413 N N   . GLN D 1 210 ? 25.506   199.832 -31.897 1.00 0.00 ? 205 GLN D N   1 
ATOM 10414 C CA  . GLN D 1 210 ? 24.801   200.003 -33.189 1.00 0.00 ? 205 GLN D CA  1 
ATOM 10415 C C   . GLN D 1 210 ? 23.262   200.025 -33.000 1.00 0.00 ? 205 GLN D C   1 
ATOM 10416 O O   . GLN D 1 210 ? 22.559   200.730 -33.641 1.00 0.00 ? 205 GLN D O   1 
ATOM 10417 C CB  . GLN D 1 210 ? 25.202   199.024 -34.227 1.00 0.00 ? 205 GLN D CB  1 
ATOM 10418 C CG  . GLN D 1 210 ? 26.689   199.121 -34.644 1.00 0.00 ? 205 GLN D CG  1 
ATOM 10419 C CD  . GLN D 1 210 ? 27.057   198.046 -35.601 1.00 0.00 ? 205 GLN D CD  1 
ATOM 10420 O OE1 . GLN D 1 210 ? 26.691   196.915 -35.484 1.00 0.00 ? 205 GLN D OE1 1 
ATOM 10421 N NE2 . GLN D 1 210 ? 27.752   198.440 -36.677 1.00 0.00 ? 205 GLN D NE2 1 
ATOM 10422 N N   . GLY D 1 211 ? 22.830   199.223 -31.957 1.00 0.00 ? 206 GLY D N   1 
ATOM 10423 C CA  . GLY D 1 211 ? 21.403   199.034 -31.717 1.00 0.00 ? 206 GLY D CA  1 
ATOM 10424 C C   . GLY D 1 211 ? 20.763   200.320 -31.260 1.00 0.00 ? 206 GLY D C   1 
ATOM 10425 O O   . GLY D 1 211 ? 19.731   200.731 -31.824 1.00 0.00 ? 206 GLY D O   1 
ATOM 10426 N N   . HIS D 1 212 ? 21.289   200.902 -30.226 1.00 0.00 ? 207 HIS D N   1 
ATOM 10427 C CA  . HIS D 1 212 ? 20.910   202.086 -29.553 1.00 0.00 ? 207 HIS D CA  1 
ATOM 10428 C C   . HIS D 1 212 ? 20.903   203.290 -30.490 1.00 0.00 ? 207 HIS D C   1 
ATOM 10429 O O   . HIS D 1 212 ? 19.954   204.041 -30.422 1.00 0.00 ? 207 HIS D O   1 
ATOM 10430 C CB  . HIS D 1 212 ? 21.746   202.450 -28.331 1.00 0.00 ? 207 HIS D CB  1 
ATOM 10431 C CG  . HIS D 1 212 ? 21.503   203.792 -27.740 1.00 0.00 ? 207 HIS D CG  1 
ATOM 10432 N ND1 . HIS D 1 212 ? 20.268   204.124 -27.194 1.00 0.00 ? 207 HIS D ND1 1 
ATOM 10433 C CD2 . HIS D 1 212 ? 22.222   204.908 -27.567 1.00 0.00 ? 207 HIS D CD2 1 
ATOM 10434 C CE1 . HIS D 1 212 ? 20.293   205.421 -26.759 1.00 0.00 ? 207 HIS D CE1 1 
ATOM 10435 N NE2 . HIS D 1 212 ? 21.529   205.968 -27.009 1.00 0.00 ? 207 HIS D NE2 1 
ATOM 10436 N N   . GLU D 1 213 ? 21.814   203.454 -31.397 1.00 0.00 ? 208 GLU D N   1 
ATOM 10437 C CA  . GLU D 1 213 ? 21.822   204.468 -32.471 1.00 0.00 ? 208 GLU D CA  1 
ATOM 10438 C C   . GLU D 1 213 ? 20.458   204.592 -33.213 1.00 0.00 ? 208 GLU D C   1 
ATOM 10439 O O   . GLU D 1 213 ? 19.819   205.684 -33.286 1.00 0.00 ? 208 GLU D O   1 
ATOM 10440 C CB  . GLU D 1 213 ? 22.997   204.120 -33.450 1.00 0.00 ? 208 GLU D CB  1 
ATOM 10441 C CG  . GLU D 1 213 ? 23.410   205.334 -34.380 1.00 0.00 ? 208 GLU D CG  1 
ATOM 10442 C CD  . GLU D 1 213 ? 24.027   206.507 -33.823 1.00 0.00 ? 208 GLU D CD  1 
ATOM 10443 O OE1 . GLU D 1 213 ? 23.280   207.416 -33.401 1.00 0.00 ? 208 GLU D OE1 1 
ATOM 10444 O OE2 . GLU D 1 213 ? 25.309   206.533 -33.808 1.00 0.00 ? 208 GLU D OE2 1 
ATOM 10445 N N   . GLU D 1 214 ? 20.061   203.494 -33.739 1.00 0.00 ? 209 GLU D N   1 
ATOM 10446 C CA  . GLU D 1 214 ? 18.802   203.270 -34.335 1.00 0.00 ? 209 GLU D CA  1 
ATOM 10447 C C   . GLU D 1 214 ? 17.571   203.268 -33.437 1.00 0.00 ? 209 GLU D C   1 
ATOM 10448 O O   . GLU D 1 214 ? 16.620   203.967 -33.666 1.00 0.00 ? 209 GLU D O   1 
ATOM 10449 C CB  . GLU D 1 214 ? 18.885   202.044 -35.253 1.00 0.00 ? 209 GLU D CB  1 
ATOM 10450 C CG  . GLU D 1 214 ? 19.933   202.229 -36.377 1.00 0.00 ? 209 GLU D CG  1 
ATOM 10451 C CD  . GLU D 1 214 ? 19.840   201.216 -37.459 1.00 0.00 ? 209 GLU D CD  1 
ATOM 10452 O OE1 . GLU D 1 214 ? 19.539   200.112 -37.018 1.00 0.00 ? 209 GLU D OE1 1 
ATOM 10453 O OE2 . GLU D 1 214 ? 20.172   201.449 -38.682 1.00 0.00 ? 209 GLU D OE2 1 
ATOM 10454 N N   . LEU D 1 215 ? 17.599   202.450 -32.348 1.00 0.00 ? 210 LEU D N   1 
ATOM 10455 C CA  . LEU D 1 215 ? 16.435   202.307 -31.443 1.00 0.00 ? 210 LEU D CA  1 
ATOM 10456 C C   . LEU D 1 215 ? 16.201   203.559 -30.601 1.00 0.00 ? 210 LEU D C   1 
ATOM 10457 O O   . LEU D 1 215 ? 15.087   203.736 -30.136 1.00 0.00 ? 210 LEU D O   1 
ATOM 10458 C CB  . LEU D 1 215 ? 16.561   201.012 -30.566 1.00 0.00 ? 210 LEU D CB  1 
ATOM 10459 C CG  . LEU D 1 215 ? 16.351   199.717 -31.363 1.00 0.00 ? 210 LEU D CG  1 
ATOM 10460 C CD1 . LEU D 1 215 ? 17.006   198.494 -30.742 1.00 0.00 ? 210 LEU D CD1 1 
ATOM 10461 C CD2 . LEU D 1 215 ? 14.869   199.382 -31.615 1.00 0.00 ? 210 LEU D CD2 1 
ATOM 10462 N N   . SER D 1 216 ? 17.229   204.394 -30.337 1.00 0.00 ? 211 SER D N   1 
ATOM 10463 C CA  . SER D 1 216 ? 17.014   205.698 -29.698 1.00 0.00 ? 211 SER D CA  1 
ATOM 10464 C C   . SER D 1 216 ? 16.334   206.608 -30.669 1.00 0.00 ? 211 SER D C   1 
ATOM 10465 O O   . SER D 1 216 ? 15.406   207.273 -30.309 1.00 0.00 ? 211 SER D O   1 
ATOM 10466 C CB  . SER D 1 216 ? 18.467   206.375 -29.409 1.00 0.00 ? 211 SER D CB  1 
ATOM 10467 O OG  . SER D 1 216 ? 18.378   207.635 -28.625 1.00 0.00 ? 211 SER D OG  1 
ATOM 10468 N N   . ARG D 1 217 ? 16.687   206.631 -32.004 1.00 0.00 ? 212 ARG D N   1 
ATOM 10469 C CA  . ARG D 1 217 ? 15.868   207.328 -33.056 1.00 0.00 ? 212 ARG D CA  1 
ATOM 10470 C C   . ARG D 1 217 ? 14.473   206.809 -33.139 1.00 0.00 ? 212 ARG D C   1 
ATOM 10471 O O   . ARG D 1 217 ? 13.522   207.613 -33.106 1.00 0.00 ? 212 ARG D O   1 
ATOM 10472 C CB  . ARG D 1 217 ? 16.523   207.295 -34.471 1.00 0.00 ? 212 ARG D CB  1 
ATOM 10473 C CG  . ARG D 1 217 ? 17.724   208.186 -34.730 1.00 0.00 ? 212 ARG D CG  1 
ATOM 10474 C CD  . ARG D 1 217 ? 17.238   209.636 -34.628 1.00 0.00 ? 212 ARG D CD  1 
ATOM 10475 N NE  . ARG D 1 217 ? 16.479   210.029 -35.857 1.00 0.00 ? 212 ARG D NE  1 
ATOM 10476 C CZ  . ARG D 1 217 ? 15.398   210.849 -35.722 1.00 0.00 ? 212 ARG D CZ  1 
ATOM 10477 N NH1 . ARG D 1 217 ? 15.215   211.610 -34.732 1.00 0.00 ? 212 ARG D NH1 1 
ATOM 10478 N NH2 . ARG D 1 217 ? 14.515   210.778 -36.675 1.00 0.00 ? 212 ARG D NH2 1 
ATOM 10479 N N   . LEU D 1 218 ? 14.267   205.458 -33.148 1.00 0.00 ? 213 LEU D N   1 
ATOM 10480 C CA  . LEU D 1 218 ? 12.924   204.779 -32.988 1.00 0.00 ? 213 LEU D CA  1 
ATOM 10481 C C   . LEU D 1 218 ? 12.096   205.164 -31.697 1.00 0.00 ? 213 LEU D C   1 
ATOM 10482 O O   . LEU D 1 218 ? 10.846   205.275 -31.695 1.00 0.00 ? 213 LEU D O   1 
ATOM 10483 C CB  . LEU D 1 218 ? 13.029   203.193 -32.961 1.00 0.00 ? 213 LEU D CB  1 
ATOM 10484 C CG  . LEU D 1 218 ? 11.737   202.428 -33.451 1.00 0.00 ? 213 LEU D CG  1 
ATOM 10485 C CD1 . LEU D 1 218 ? 11.580   202.616 -34.917 1.00 0.00 ? 213 LEU D CD1 1 
ATOM 10486 C CD2 . LEU D 1 218 ? 11.828   200.919 -33.226 1.00 0.00 ? 213 LEU D CD2 1 
ATOM 10487 N N   . SER D 1 219 ? 12.784   205.429 -30.470 1.00 0.00 ? 214 SER D N   1 
ATOM 10488 C CA  . SER D 1 219 ? 12.218   206.019 -29.217 1.00 0.00 ? 214 SER D CA  1 
ATOM 10489 C C   . SER D 1 219 ? 11.662   207.372 -29.495 1.00 0.00 ? 214 SER D C   1 
ATOM 10490 O O   . SER D 1 219 ? 10.629   207.674 -28.949 1.00 0.00 ? 214 SER D O   1 
ATOM 10491 C CB  . SER D 1 219 ? 13.178   206.078 -28.014 1.00 0.00 ? 214 SER D CB  1 
ATOM 10492 O OG  . SER D 1 219 ? 12.515   206.391 -26.812 1.00 0.00 ? 214 SER D OG  1 
ATOM 10493 N N   . GLN D 1 220 ? 12.389   208.174 -30.258 1.00 0.00 ? 215 GLN D N   1 
ATOM 10494 C CA  . GLN D 1 220 ? 11.955   209.475 -30.707 1.00 0.00 ? 215 GLN D CA  1 
ATOM 10495 C C   . GLN D 1 220 ? 10.668   209.475 -31.595 1.00 0.00 ? 215 GLN D C   1 
ATOM 10496 O O   . GLN D 1 220 ? 9.767    210.324 -31.451 1.00 0.00 ? 215 GLN D O   1 
ATOM 10497 C CB  . GLN D 1 220 ? 13.202   210.243 -31.365 1.00 0.00 ? 215 GLN D CB  1 
ATOM 10498 C CG  . GLN D 1 220 ? 13.013   211.783 -31.546 1.00 0.00 ? 215 GLN D CG  1 
ATOM 10499 C CD  . GLN D 1 220 ? 12.806   212.469 -30.230 1.00 0.00 ? 215 GLN D CD  1 
ATOM 10500 O OE1 . GLN D 1 220 ? 13.274   212.090 -29.154 1.00 0.00 ? 215 GLN D OE1 1 
ATOM 10501 N NE2 . GLN D 1 220 ? 11.980   213.541 -30.361 1.00 0.00 ? 215 GLN D NE2 1 
ATOM 10502 N N   . TYR D 1 221 ? 10.611   208.465 -32.496 1.00 0.00 ? 216 TYR D N   1 
ATOM 10503 C CA  . TYR D 1 221 ? 9.507    208.208 -33.403 1.00 0.00 ? 216 TYR D CA  1 
ATOM 10504 C C   . TYR D 1 221 ? 8.212    207.814 -32.617 1.00 0.00 ? 216 TYR D C   1 
ATOM 10505 O O   . TYR D 1 221 ? 7.116    208.352 -32.803 1.00 0.00 ? 216 TYR D O   1 
ATOM 10506 C CB  . TYR D 1 221 ? 9.970    207.049 -34.297 1.00 0.00 ? 216 TYR D CB  1 
ATOM 10507 C CG  . TYR D 1 221 ? 9.235    206.961 -35.606 1.00 0.00 ? 216 TYR D CG  1 
ATOM 10508 C CD1 . TYR D 1 221 ? 9.156    208.114 -36.416 1.00 0.00 ? 216 TYR D CD1 1 
ATOM 10509 C CD2 . TYR D 1 221 ? 8.662    205.756 -36.032 1.00 0.00 ? 216 TYR D CD2 1 
ATOM 10510 C CE1 . TYR D 1 221 ? 8.418    208.129 -37.600 1.00 0.00 ? 216 TYR D CE1 1 
ATOM 10511 C CE2 . TYR D 1 221 ? 8.066    205.696 -37.290 1.00 0.00 ? 216 TYR D CE2 1 
ATOM 10512 C CZ  . TYR D 1 221 ? 7.949    206.865 -38.014 1.00 0.00 ? 216 TYR D CZ  1 
ATOM 10513 O OH  . TYR D 1 221 ? 7.411    206.645 -39.353 1.00 0.00 ? 216 TYR D OH  1 
ATOM 10514 N N   . ARG D 1 222 ? 8.399    206.903 -31.569 1.00 0.00 ? 217 ARG D N   1 
ATOM 10515 C CA  . ARG D 1 222 ? 7.493    206.303 -30.615 1.00 0.00 ? 217 ARG D CA  1 
ATOM 10516 C C   . ARG D 1 222 ? 6.804    207.356 -29.803 1.00 0.00 ? 217 ARG D C   1 
ATOM 10517 O O   . ARG D 1 222 ? 5.618    207.405 -29.675 1.00 0.00 ? 217 ARG D O   1 
ATOM 10518 C CB  . ARG D 1 222 ? 8.234    205.264 -29.731 1.00 0.00 ? 217 ARG D CB  1 
ATOM 10519 C CG  . ARG D 1 222 ? 7.242    204.281 -29.074 1.00 0.00 ? 217 ARG D CG  1 
ATOM 10520 C CD  . ARG D 1 222 ? 6.402    204.790 -27.895 1.00 0.00 ? 217 ARG D CD  1 
ATOM 10521 N NE  . ARG D 1 222 ? 7.428    205.208 -26.863 1.00 0.00 ? 217 ARG D NE  1 
ATOM 10522 C CZ  . ARG D 1 222 ? 7.159    206.310 -26.074 1.00 0.00 ? 217 ARG D CZ  1 
ATOM 10523 N NH1 . ARG D 1 222 ? 5.920    206.780 -25.943 1.00 0.00 ? 217 ARG D NH1 1 
ATOM 10524 N NH2 . ARG D 1 222 ? 8.107    206.905 -25.321 1.00 0.00 ? 217 ARG D NH2 1 
ATOM 10525 N N   . LYS D 1 223 ? 7.562    208.222 -29.088 1.00 0.00 ? 218 LYS D N   1 
ATOM 10526 C CA  . LYS D 1 223 ? 7.063    209.311 -28.313 1.00 0.00 ? 218 LYS D CA  1 
ATOM 10527 C C   . LYS D 1 223 ? 6.383    210.365 -29.121 1.00 0.00 ? 218 LYS D C   1 
ATOM 10528 O O   . LYS D 1 223 ? 5.341    210.890 -28.712 1.00 0.00 ? 218 LYS D O   1 
ATOM 10529 C CB  . LYS D 1 223 ? 8.170    209.888 -27.446 1.00 0.00 ? 218 LYS D CB  1 
ATOM 10530 C CG  . LYS D 1 223 ? 9.379    210.601 -28.076 1.00 0.00 ? 218 LYS D CG  1 
ATOM 10531 C CD  . LYS D 1 223 ? 10.579   210.892 -27.099 1.00 0.00 ? 218 LYS D CD  1 
ATOM 10532 C CE  . LYS D 1 223 ? 11.069   209.749 -26.230 1.00 0.00 ? 218 LYS D CE  1 
ATOM 10533 N NZ  . LYS D 1 223 ? 12.054   210.184 -25.268 1.00 0.00 ? 218 LYS D NZ  1 
ATOM 10534 N N   . GLU D 1 224 ? 6.827    210.712 -30.342 1.00 0.00 ? 219 GLU D N   1 
ATOM 10535 C CA  . GLU D 1 224 ? 6.191    211.674 -31.275 1.00 0.00 ? 219 GLU D CA  1 
ATOM 10536 C C   . GLU D 1 224 ? 4.818    211.064 -31.777 1.00 0.00 ? 219 GLU D C   1 
ATOM 10537 O O   . GLU D 1 224 ? 3.813    211.778 -31.624 1.00 0.00 ? 219 GLU D O   1 
ATOM 10538 C CB  . GLU D 1 224 ? 7.168    212.092 -32.438 1.00 0.00 ? 219 GLU D CB  1 
ATOM 10539 C CG  . GLU D 1 224 ? 6.778    213.306 -33.267 1.00 0.00 ? 219 GLU D CG  1 
ATOM 10540 C CD  . GLU D 1 224 ? 7.648    213.481 -34.535 1.00 0.00 ? 219 GLU D CD  1 
ATOM 10541 O OE1 . GLU D 1 224 ? 8.786    213.945 -34.465 1.00 0.00 ? 219 GLU D OE1 1 
ATOM 10542 O OE2 . GLU D 1 224 ? 7.050    213.180 -35.652 1.00 0.00 ? 219 GLU D OE2 1 
ATOM 10543 N N   . LEU D 1 225 ? 4.813    209.842 -32.343 1.00 0.00 ? 220 LEU D N   1 
ATOM 10544 C CA  . LEU D 1 225 ? 3.573    209.208 -32.772 1.00 0.00 ? 220 LEU D CA  1 
ATOM 10545 C C   . LEU D 1 225 ? 2.649    208.959 -31.630 1.00 0.00 ? 220 LEU D C   1 
ATOM 10546 O O   . LEU D 1 225 ? 1.439    209.308 -31.704 1.00 0.00 ? 220 LEU D O   1 
ATOM 10547 C CB  . LEU D 1 225 ? 3.706    207.948 -33.671 1.00 0.00 ? 220 LEU D CB  1 
ATOM 10548 C CG  . LEU D 1 225 ? 2.403    207.787 -34.550 1.00 0.00 ? 220 LEU D CG  1 
ATOM 10549 C CD1 . LEU D 1 225 ? 2.327    208.840 -35.656 1.00 0.00 ? 220 LEU D CD1 1 
ATOM 10550 C CD2 . LEU D 1 225 ? 2.278    206.351 -35.084 1.00 0.00 ? 220 LEU D CD2 1 
ATOM 10551 N N   . GLY D 1 226 ? 3.198    208.481 -30.511 1.00 0.00 ? 221 GLY D N   1 
ATOM 10552 C CA  . GLY D 1 226 ? 2.427    208.101 -29.389 1.00 0.00 ? 221 GLY D CA  1 
ATOM 10553 C C   . GLY D 1 226 ? 1.621    209.336 -28.839 1.00 0.00 ? 221 GLY D C   1 
ATOM 10554 O O   . GLY D 1 226 ? 0.480    209.205 -28.395 1.00 0.00 ? 221 GLY D O   1 
ATOM 10555 N N   . ALA D 1 227 ? 2.149    210.544 -29.000 1.00 0.00 ? 222 ALA D N   1 
ATOM 10556 C CA  . ALA D 1 227 ? 1.587    211.803 -28.630 1.00 0.00 ? 222 ALA D CA  1 
ATOM 10557 C C   . ALA D 1 227 ? 0.425    212.205 -29.584 1.00 0.00 ? 222 ALA D C   1 
ATOM 10558 O O   . ALA D 1 227 ? -0.588   212.752 -29.164 1.00 0.00 ? 222 ALA D O   1 
ATOM 10559 C CB  . ALA D 1 227 ? 2.737    212.825 -28.523 1.00 0.00 ? 222 ALA D CB  1 
ATOM 10560 N N   . GLN D 1 228 ? 0.595    212.011 -30.865 1.00 0.00 ? 223 GLN D N   1 
ATOM 10561 C CA  . GLN D 1 228 ? -0.493   212.146 -31.805 1.00 0.00 ? 223 GLN D CA  1 
ATOM 10562 C C   . GLN D 1 228 ? -1.601   211.132 -31.479 1.00 0.00 ? 223 GLN D C   1 
ATOM 10563 O O   . GLN D 1 228 ? -2.779   211.457 -31.373 1.00 0.00 ? 223 GLN D O   1 
ATOM 10564 C CB  . GLN D 1 228 ? 0.093    211.789 -33.250 1.00 0.00 ? 223 GLN D CB  1 
ATOM 10565 C CG  . GLN D 1 228 ? -0.847   212.262 -34.415 1.00 0.00 ? 223 GLN D CG  1 
ATOM 10566 C CD  . GLN D 1 228 ? -0.310   211.868 -35.821 1.00 0.00 ? 223 GLN D CD  1 
ATOM 10567 O OE1 . GLN D 1 228 ? -1.014   211.298 -36.596 1.00 0.00 ? 223 GLN D OE1 1 
ATOM 10568 N NE2 . GLN D 1 228 ? 1.001    212.130 -36.056 1.00 0.00 ? 223 GLN D NE2 1 
ATOM 10569 N N   . LEU D 1 229 ? -1.272   209.873 -31.073 1.00 0.00 ? 224 LEU D N   1 
ATOM 10570 C CA  . LEU D 1 229 ? -2.217   208.810 -30.700 1.00 0.00 ? 224 LEU D CA  1 
ATOM 10571 C C   . LEU D 1 229 ? -3.089   209.179 -29.551 1.00 0.00 ? 224 LEU D C   1 
ATOM 10572 O O   . LEU D 1 229 ? -4.330   208.920 -29.591 1.00 0.00 ? 224 LEU D O   1 
ATOM 10573 C CB  . LEU D 1 229 ? -1.475   207.437 -30.643 1.00 0.00 ? 224 LEU D CB  1 
ATOM 10574 C CG  . LEU D 1 229 ? -2.277   206.154 -30.875 1.00 0.00 ? 224 LEU D CG  1 
ATOM 10575 C CD1 . LEU D 1 229 ? -2.782   206.073 -32.317 1.00 0.00 ? 224 LEU D CD1 1 
ATOM 10576 C CD2 . LEU D 1 229 ? -1.542   204.983 -30.480 1.00 0.00 ? 224 LEU D CD2 1 
ATOM 10577 N N   . HIS D 1 230 ? -2.684   209.794 -28.447 1.00 0.00 ? 225 HIS D N   1 
ATOM 10578 C CA  . HIS D 1 230 ? -3.589   210.074 -27.294 1.00 0.00 ? 225 HIS D CA  1 
ATOM 10579 C C   . HIS D 1 230 ? -4.620   211.153 -27.701 1.00 0.00 ? 225 HIS D C   1 
ATOM 10580 O O   . HIS D 1 230 ? -5.857   211.066 -27.506 1.00 0.00 ? 225 HIS D O   1 
ATOM 10581 C CB  . HIS D 1 230 ? -2.889   210.541 -26.020 1.00 0.00 ? 225 HIS D CB  1 
ATOM 10582 C CG  . HIS D 1 230 ? -1.848   209.549 -25.524 1.00 0.00 ? 225 HIS D CG  1 
ATOM 10583 N ND1 . HIS D 1 230 ? -2.155   208.476 -24.689 1.00 0.00 ? 225 HIS D ND1 1 
ATOM 10584 C CD2 . HIS D 1 230 ? -0.494   209.531 -25.670 1.00 0.00 ? 225 HIS D CD2 1 
ATOM 10585 C CE1 . HIS D 1 230 ? -0.995   207.916 -24.302 1.00 0.00 ? 225 HIS D CE1 1 
ATOM 10586 N NE2 . HIS D 1 230 ? 0.049    208.523 -24.860 1.00 0.00 ? 225 HIS D NE2 1 
ATOM 10587 N N   . GLN D 1 231 ? -4.224   212.239 -28.447 1.00 0.00 ? 226 GLN D N   1 
ATOM 10588 C CA  . GLN D 1 231 ? -5.129   213.262 -28.835 1.00 0.00 ? 226 GLN D CA  1 
ATOM 10589 C C   . GLN D 1 231 ? -6.158   212.757 -29.854 1.00 0.00 ? 226 GLN D C   1 
ATOM 10590 O O   . GLN D 1 231 ? -7.348   212.992 -29.783 1.00 0.00 ? 226 GLN D O   1 
ATOM 10591 C CB  . GLN D 1 231 ? -4.370   214.544 -29.306 1.00 0.00 ? 226 GLN D CB  1 
ATOM 10592 C CG  . GLN D 1 231 ? -5.290   215.741 -29.719 1.00 0.00 ? 226 GLN D CG  1 
ATOM 10593 C CD  . GLN D 1 231 ? -6.122   216.342 -28.553 1.00 0.00 ? 226 GLN D CD  1 
ATOM 10594 O OE1 . GLN D 1 231 ? -5.547   216.770 -27.576 1.00 0.00 ? 226 GLN D OE1 1 
ATOM 10595 N NE2 . GLN D 1 231 ? -7.446   216.312 -28.644 1.00 0.00 ? 226 GLN D NE2 1 
ATOM 10596 N N   . LEU D 1 232 ? -5.652   211.886 -30.868 1.00 0.00 ? 227 LEU D N   1 
ATOM 10597 C CA  . LEU D 1 232 ? -6.458   211.273 -31.907 1.00 0.00 ? 227 LEU D CA  1 
ATOM 10598 C C   . LEU D 1 232 ? -7.601   210.461 -31.312 1.00 0.00 ? 227 LEU D C   1 
ATOM 10599 O O   . LEU D 1 232 ? -8.737   210.586 -31.780 1.00 0.00 ? 227 LEU D O   1 
ATOM 10600 C CB  . LEU D 1 232 ? -5.453   210.501 -32.809 1.00 0.00 ? 227 LEU D CB  1 
ATOM 10601 C CG  . LEU D 1 232 ? -6.071   209.885 -34.025 1.00 0.00 ? 227 LEU D CG  1 
ATOM 10602 C CD1 . LEU D 1 232 ? -6.542   210.996 -34.964 1.00 0.00 ? 227 LEU D CD1 1 
ATOM 10603 C CD2 . LEU D 1 232 ? -4.942   209.107 -34.725 1.00 0.00 ? 227 LEU D CD2 1 
ATOM 10604 N N   . VAL D 1 233 ? -7.306   209.654 -30.311 1.00 0.00 ? 228 VAL D N   1 
ATOM 10605 C CA  . VAL D 1 233 ? -8.356   208.944 -29.708 1.00 0.00 ? 228 VAL D CA  1 
ATOM 10606 C C   . VAL D 1 233 ? -9.221   209.799 -28.771 1.00 0.00 ? 228 VAL D C   1 
ATOM 10607 O O   . VAL D 1 233 ? -10.422  209.410 -28.661 1.00 0.00 ? 228 VAL D O   1 
ATOM 10608 C CB  . VAL D 1 233 ? -7.775   207.628 -29.093 1.00 0.00 ? 228 VAL D CB  1 
ATOM 10609 C CG1 . VAL D 1 233 ? -7.013   207.916 -27.792 1.00 0.00 ? 228 VAL D CG1 1 
ATOM 10610 C CG2 . VAL D 1 233 ? -8.784   206.525 -28.827 1.00 0.00 ? 228 VAL D CG2 1 
ATOM 10611 N N   . LEU D 1 234 ? -8.731   210.912 -28.152 1.00 0.00 ? 229 LEU D N   1 
ATOM 10612 C CA  . LEU D 1 234 ? -9.642   211.868 -27.485 1.00 0.00 ? 229 LEU D CA  1 
ATOM 10613 C C   . LEU D 1 234 ? -10.644  212.459 -28.491 1.00 0.00 ? 229 LEU D C   1 
ATOM 10614 O O   . LEU D 1 234 ? -11.845  212.714 -28.172 1.00 0.00 ? 229 LEU D O   1 
ATOM 10615 C CB  . LEU D 1 234 ? -8.879   212.933 -26.752 1.00 0.00 ? 229 LEU D CB  1 
ATOM 10616 C CG  . LEU D 1 234 ? -8.187   212.333 -25.482 1.00 0.00 ? 229 LEU D CG  1 
ATOM 10617 C CD1 . LEU D 1 234 ? -7.138   213.246 -24.899 1.00 0.00 ? 229 LEU D CD1 1 
ATOM 10618 C CD2 . LEU D 1 234 ? -9.235   211.931 -24.424 1.00 0.00 ? 229 LEU D CD2 1 
ATOM 10619 N N   . ASN D 1 235 ? -10.157  212.900 -29.638 1.00 0.00 ? 230 ASN D N   1 
ATOM 10620 C CA  . ASN D 1 235 ? -10.856  213.360 -30.831 1.00 0.00 ? 230 ASN D CA  1 
ATOM 10621 C C   . ASN D 1 235 ? -11.958  212.414 -31.217 1.00 0.00 ? 230 ASN D C   1 
ATOM 10622 O O   . ASN D 1 235 ? -13.124  212.711 -31.464 1.00 0.00 ? 230 ASN D O   1 
ATOM 10623 C CB  . ASN D 1 235 ? -9.974   213.522 -32.103 1.00 0.00 ? 230 ASN D CB  1 
ATOM 10624 C CG  . ASN D 1 235 ? -8.924   214.662 -31.950 1.00 0.00 ? 230 ASN D CG  1 
ATOM 10625 O OD1 . ASN D 1 235 ? -8.947   215.531 -31.048 1.00 0.00 ? 230 ASN D OD1 1 
ATOM 10626 N ND2 . ASN D 1 235 ? -7.956   214.717 -32.916 1.00 0.00 ? 230 ASN D ND2 1 
ATOM 10627 N N   . SER D 1 236 ? -11.581  211.110 -31.291 1.00 0.00 ? 231 SER D N   1 
ATOM 10628 C CA  . SER D 1 236 ? -12.545  210.011 -31.552 1.00 0.00 ? 231 SER D CA  1 
ATOM 10629 C C   . SER D 1 236 ? -13.623  209.908 -30.460 1.00 0.00 ? 231 SER D C   1 
ATOM 10630 O O   . SER D 1 236 ? -14.806  209.734 -30.822 1.00 0.00 ? 231 SER D O   1 
ATOM 10631 C CB  . SER D 1 236 ? -11.837  208.614 -31.630 1.00 0.00 ? 231 SER D CB  1 
ATOM 10632 O OG  . SER D 1 236 ? -12.616  207.776 -32.474 1.00 0.00 ? 231 SER D OG  1 
ATOM 10633 N N   . ALA D 1 237 ? -13.231  210.008 -29.185 1.00 0.00 ? 232 ALA D N   1 
ATOM 10634 C CA  . ALA D 1 237 ? -14.109  209.904 -28.021 1.00 0.00 ? 232 ALA D CA  1 
ATOM 10635 C C   . ALA D 1 237 ? -15.261  210.870 -27.962 1.00 0.00 ? 232 ALA D C   1 
ATOM 10636 O O   . ALA D 1 237 ? -16.403  210.485 -27.688 1.00 0.00 ? 232 ALA D O   1 
ATOM 10637 C CB  . ALA D 1 237 ? -13.223  210.072 -26.739 1.00 0.00 ? 232 ALA D CB  1 
ATOM 10638 N N   . ARG D 1 238 ? -14.898  212.201 -28.323 1.00 0.00 ? 233 ARG D N   1 
ATOM 10639 C CA  . ARG D 1 238 ? -15.836  213.193 -28.753 1.00 0.00 ? 233 ARG D CA  1 
ATOM 10640 C C   . ARG D 1 238 ? -16.643  212.803 -29.992 1.00 0.00 ? 233 ARG D C   1 
ATOM 10641 O O   . ARG D 1 238 ? -17.859  212.912 -29.988 1.00 0.00 ? 233 ARG D O   1 
ATOM 10642 C CB  . ARG D 1 238 ? -15.100  214.574 -29.087 1.00 0.00 ? 233 ARG D CB  1 
ATOM 10643 C CG  . ARG D 1 238 ? -14.700  215.315 -27.808 1.00 0.00 ? 233 ARG D CG  1 
ATOM 10644 C CD  . ARG D 1 238 ? -14.377  216.774 -27.997 1.00 0.00 ? 233 ARG D CD  1 
ATOM 10645 N NE  . ARG D 1 238 ? -12.941  216.860 -28.463 1.00 0.00 ? 233 ARG D NE  1 
ATOM 10646 C CZ  . ARG D 1 238 ? -12.421  217.582 -29.524 1.00 0.00 ? 233 ARG D CZ  1 
ATOM 10647 N NH1 . ARG D 1 238 ? -13.259  218.136 -30.377 1.00 0.00 ? 233 ARG D NH1 1 
ATOM 10648 N NH2 . ARG D 1 238 ? -11.129  217.680 -29.742 1.00 0.00 ? 233 ARG D NH2 1 
ATOM 10649 N N   . GLU D 1 239 ? -16.031  212.388 -31.132 1.00 0.00 ? 234 GLU D N   1 
ATOM 10650 C CA  . GLU D 1 239 ? -16.676  211.989 -32.340 1.00 0.00 ? 234 GLU D CA  1 
ATOM 10651 C C   . GLU D 1 239 ? -17.764  210.984 -32.220 1.00 0.00 ? 234 GLU D C   1 
ATOM 10652 O O   . GLU D 1 239 ? -18.850  211.234 -32.783 1.00 0.00 ? 234 GLU D O   1 
ATOM 10653 C CB  . GLU D 1 239 ? -15.685  211.527 -33.456 1.00 0.00 ? 234 GLU D CB  1 
ATOM 10654 C CG  . GLU D 1 239 ? -16.345  211.266 -34.894 1.00 0.00 ? 234 GLU D CG  1 
ATOM 10655 C CD  . GLU D 1 239 ? -15.406  210.539 -35.828 1.00 0.00 ? 234 GLU D CD  1 
ATOM 10656 O OE1 . GLU D 1 239 ? -14.265  210.985 -36.008 1.00 0.00 ? 234 GLU D OE1 1 
ATOM 10657 O OE2 . GLU D 1 239 ? -15.850  209.534 -36.465 1.00 0.00 ? 234 GLU D OE2 1 
ATOM 10658 N N   . LYS D 1 240 ? -17.523  209.866 -31.617 1.00 0.00 ? 235 LYS D N   1 
ATOM 10659 C CA  . LYS D 1 240 ? -18.568  208.808 -31.564 1.00 0.00 ? 235 LYS D CA  1 
ATOM 10660 C C   . LYS D 1 240 ? -19.619  209.110 -30.530 1.00 0.00 ? 235 LYS D C   1 
ATOM 10661 O O   . LYS D 1 240 ? -20.733  208.652 -30.672 1.00 0.00 ? 235 LYS D O   1 
ATOM 10662 C CB  . LYS D 1 240 ? -17.847  207.433 -31.231 1.00 0.00 ? 235 LYS D CB  1 
ATOM 10663 C CG  . LYS D 1 240 ? -16.629  207.134 -32.122 1.00 0.00 ? 235 LYS D CG  1 
ATOM 10664 C CD  . LYS D 1 240 ? -16.864  207.107 -33.676 1.00 0.00 ? 235 LYS D CD  1 
ATOM 10665 C CE  . LYS D 1 240 ? -15.626  206.814 -34.463 1.00 0.00 ? 235 LYS D CE  1 
ATOM 10666 N NZ  . LYS D 1 240 ? -15.772  206.898 -35.924 1.00 0.00 ? 235 LYS D NZ  1 
ATOM 10667 N N   . ARG D 1 241 ? -19.375  209.958 -29.537 1.00 0.00 ? 236 ARG D N   1 
ATOM 10668 C CA  . ARG D 1 241 ? -20.408  210.465 -28.603 1.00 0.00 ? 236 ARG D CA  1 
ATOM 10669 C C   . ARG D 1 241 ? -21.393  211.453 -29.300 1.00 0.00 ? 236 ARG D C   1 
ATOM 10670 O O   . ARG D 1 241 ? -22.568  211.526 -28.952 1.00 0.00 ? 236 ARG D O   1 
ATOM 10671 C CB  . ARG D 1 241 ? -19.685  211.209 -27.465 1.00 0.00 ? 236 ARG D CB  1 
ATOM 10672 C CG  . ARG D 1 241 ? -20.595  211.428 -26.207 1.00 0.00 ? 236 ARG D CG  1 
ATOM 10673 C CD  . ARG D 1 241 ? -21.135  210.147 -25.590 1.00 0.00 ? 236 ARG D CD  1 
ATOM 10674 N NE  . ARG D 1 241 ? -21.818  210.523 -24.254 1.00 0.00 ? 236 ARG D NE  1 
ATOM 10675 C CZ  . ARG D 1 241 ? -23.178  210.578 -24.112 1.00 0.00 ? 236 ARG D CZ  1 
ATOM 10676 N NH1 . ARG D 1 241 ? -23.934  210.162 -25.104 1.00 0.00 ? 236 ARG D NH1 1 
ATOM 10677 N NH2 . ARG D 1 241 ? -23.702  211.015 -22.942 1.00 0.00 ? 236 ARG D NH2 1 
ATOM 10678 N N   . ASP D 1 242 ? -20.819  212.328 -30.167 1.00 0.00 ? 237 ASP D N   1 
ATOM 10679 C CA  . ASP D 1 242 ? -21.597  213.231 -31.012 1.00 0.00 ? 237 ASP D CA  1 
ATOM 10680 C C   . ASP D 1 242 ? -22.621  212.546 -31.915 1.00 0.00 ? 237 ASP D C   1 
ATOM 10681 O O   . ASP D 1 242 ? -23.790  212.953 -32.075 1.00 0.00 ? 237 ASP D O   1 
ATOM 10682 C CB  . ASP D 1 242 ? -20.472  214.081 -31.720 1.00 0.00 ? 237 ASP D CB  1 
ATOM 10683 C CG  . ASP D 1 242 ? -21.127  215.363 -32.133 1.00 0.00 ? 237 ASP D CG  1 
ATOM 10684 O OD1 . ASP D 1 242 ? -22.002  215.322 -33.021 1.00 0.00 ? 237 ASP D OD1 1 
ATOM 10685 O OD2 . ASP D 1 242 ? -20.873  216.426 -31.558 1.00 0.00 ? 237 ASP D OD2 1 
ATOM 10686 N N   . MET D 1 243 ? -22.118  211.433 -32.487 1.00 0.00 ? 238 MET D N   1 
ATOM 10687 C CA  . MET D 1 243 ? -22.876  210.504 -33.191 1.00 0.00 ? 238 MET D CA  1 
ATOM 10688 C C   . MET D 1 243 ? -23.937  209.850 -32.408 1.00 0.00 ? 238 MET D C   1 
ATOM 10689 O O   . MET D 1 243 ? -25.078  209.774 -32.876 1.00 0.00 ? 238 MET D O   1 
ATOM 10690 C CB  . MET D 1 243 ? -21.916  209.361 -33.757 1.00 0.00 ? 238 MET D CB  1 
ATOM 10691 C CG  . MET D 1 243 ? -22.481  208.535 -34.933 1.00 0.00 ? 238 MET D CG  1 
ATOM 10692 S SD  . MET D 1 243 ? -21.389  207.198 -35.637 1.00 0.00 ? 238 MET D SD  1 
ATOM 10693 C CE  . MET D 1 243 ? -22.252  206.943 -37.165 1.00 0.00 ? 238 MET D CE  1 
ATOM 10694 N N   . GLU D 1 244 ? -23.719  209.403 -31.115 1.00 0.00 ? 239 GLU D N   1 
ATOM 10695 C CA  . GLU D 1 244 ? -24.683  208.841 -30.236 1.00 0.00 ? 239 GLU D CA  1 
ATOM 10696 C C   . GLU D 1 244 ? -25.827  209.844 -29.817 1.00 0.00 ? 239 GLU D C   1 
ATOM 10697 O O   . GLU D 1 244 ? -27.025  209.588 -29.910 1.00 0.00 ? 239 GLU D O   1 
ATOM 10698 C CB  . GLU D 1 244 ? -23.904  208.375 -28.989 1.00 0.00 ? 239 GLU D CB  1 
ATOM 10699 C CG  . GLU D 1 244 ? -24.763  207.585 -28.009 1.00 0.00 ? 239 GLU D CG  1 
ATOM 10700 C CD  . GLU D 1 244 ? -23.967  206.953 -26.830 1.00 0.00 ? 239 GLU D CD  1 
ATOM 10701 O OE1 . GLU D 1 244 ? -23.153  207.714 -26.235 1.00 0.00 ? 239 GLU D OE1 1 
ATOM 10702 O OE2 . GLU D 1 244 ? -24.248  205.783 -26.505 1.00 0.00 ? 239 GLU D OE2 1 
ATOM 10703 N N   . GLN D 1 245 ? -25.466  211.140 -29.568 1.00 0.00 ? 240 GLN D N   1 
ATOM 10704 C CA  . GLN D 1 245 ? -26.235  212.276 -29.209 1.00 0.00 ? 240 GLN D CA  1 
ATOM 10705 C C   . GLN D 1 245 ? -27.214  212.704 -30.385 1.00 0.00 ? 240 GLN D C   1 
ATOM 10706 O O   . GLN D 1 245 ? -28.413  212.980 -30.171 1.00 0.00 ? 240 GLN D O   1 
ATOM 10707 C CB  . GLN D 1 245 ? -25.313  213.517 -28.856 1.00 0.00 ? 240 GLN D CB  1 
ATOM 10708 C CG  . GLN D 1 245 ? -24.727  213.491 -27.411 1.00 0.00 ? 240 GLN D CG  1 
ATOM 10709 C CD  . GLN D 1 245 ? -25.691  213.631 -26.276 1.00 0.00 ? 240 GLN D CD  1 
ATOM 10710 O OE1 . GLN D 1 245 ? -26.880  213.754 -26.426 1.00 0.00 ? 240 GLN D OE1 1 
ATOM 10711 N NE2 . GLN D 1 245 ? -25.162  213.592 -24.970 1.00 0.00 ? 240 GLN D NE2 1 
ATOM 10712 N N   . ARG D 1 246 ? -26.745  212.678 -31.614 1.00 0.00 ? 241 ARG D N   1 
ATOM 10713 C CA  . ARG D 1 246 ? -27.616  212.792 -32.803 1.00 0.00 ? 241 ARG D CA  1 
ATOM 10714 C C   . ARG D 1 246 ? -28.571  211.608 -32.883 1.00 0.00 ? 241 ARG D C   1 
ATOM 10715 O O   . ARG D 1 246 ? -29.738  211.712 -33.155 1.00 0.00 ? 241 ARG D O   1 
ATOM 10716 C CB  . ARG D 1 246 ? -26.635  212.786 -34.007 1.00 0.00 ? 241 ARG D CB  1 
ATOM 10717 C CG  . ARG D 1 246 ? -27.358  212.691 -35.426 1.00 0.00 ? 241 ARG D CG  1 
ATOM 10718 C CD  . ARG D 1 246 ? -28.224  213.980 -35.718 1.00 0.00 ? 241 ARG D CD  1 
ATOM 10719 N NE  . ARG D 1 246 ? -29.210  213.593 -36.765 1.00 0.00 ? 241 ARG D NE  1 
ATOM 10720 C CZ  . ARG D 1 246 ? -30.500  213.987 -36.755 1.00 0.00 ? 241 ARG D CZ  1 
ATOM 10721 N NH1 . ARG D 1 246 ? -30.927  214.974 -36.031 1.00 0.00 ? 241 ARG D NH1 1 
ATOM 10722 N NH2 . ARG D 1 246 ? -31.300  213.383 -37.633 1.00 0.00 ? 241 ARG D NH2 1 
ATOM 10723 N N   . HIS D 1 247 ? -28.123  210.442 -32.551 1.00 0.00 ? 242 HIS D N   1 
ATOM 10724 C CA  . HIS D 1 247 ? -28.926  209.222 -32.604 1.00 0.00 ? 242 HIS D CA  1 
ATOM 10725 C C   . HIS D 1 247 ? -30.055  209.138 -31.636 1.00 0.00 ? 242 HIS D C   1 
ATOM 10726 O O   . HIS D 1 247 ? -31.170  208.833 -32.062 1.00 0.00 ? 242 HIS D O   1 
ATOM 10727 C CB  . HIS D 1 247 ? -28.151  207.925 -32.619 1.00 0.00 ? 242 HIS D CB  1 
ATOM 10728 C CG  . HIS D 1 247 ? -27.434  207.638 -33.846 1.00 0.00 ? 242 HIS D CG  1 
ATOM 10729 N ND1 . HIS D 1 247 ? -26.744  206.510 -34.024 1.00 0.00 ? 242 HIS D ND1 1 
ATOM 10730 C CD2 . HIS D 1 247 ? -27.342  208.335 -35.050 1.00 0.00 ? 242 HIS D CD2 1 
ATOM 10731 C CE1 . HIS D 1 247 ? -26.211  206.482 -35.279 1.00 0.00 ? 242 HIS D CE1 1 
ATOM 10732 N NE2 . HIS D 1 247 ? -26.564  207.594 -35.933 1.00 0.00 ? 242 HIS D NE2 1 
ATOM 10733 N N   . VAL D 1 248 ? -29.923  209.473 -30.436 1.00 0.00 ? 243 VAL D N   1 
ATOM 10734 C CA  . VAL D 1 248 ? -31.079  209.568 -29.524 1.00 0.00 ? 243 VAL D CA  1 
ATOM 10735 C C   . VAL D 1 248 ? -32.070  210.710 -29.865 1.00 0.00 ? 243 VAL D C   1 
ATOM 10736 O O   . VAL D 1 248 ? -33.282  210.521 -29.740 1.00 0.00 ? 243 VAL D O   1 
ATOM 10737 C CB  . VAL D 1 248 ? -30.601  209.649 -28.116 1.00 0.00 ? 243 VAL D CB  1 
ATOM 10738 C CG1 . VAL D 1 248 ? -29.934  208.279 -27.697 1.00 0.00 ? 243 VAL D CG1 1 
ATOM 10739 C CG2 . VAL D 1 248 ? -29.608  210.762 -27.774 1.00 0.00 ? 243 VAL D CG2 1 
ATOM 10740 N N   . LEU D 1 249 ? -31.450  211.791 -30.466 1.00 0.00 ? 244 LEU D N   1 
ATOM 10741 C CA  . LEU D 1 249 ? -32.247  212.850 -31.095 1.00 0.00 ? 244 LEU D CA  1 
ATOM 10742 C C   . LEU D 1 249 ? -33.033  212.414 -32.347 1.00 0.00 ? 244 LEU D C   1 
ATOM 10743 O O   . LEU D 1 249 ? -34.208  212.685 -32.518 1.00 0.00 ? 244 LEU D O   1 
ATOM 10744 C CB  . LEU D 1 249 ? -31.327  214.109 -31.294 1.00 0.00 ? 244 LEU D CB  1 
ATOM 10745 C CG  . LEU D 1 249 ? -32.060  215.486 -31.519 1.00 0.00 ? 244 LEU D CG  1 
ATOM 10746 C CD1 . LEU D 1 249 ? -31.434  216.646 -30.696 1.00 0.00 ? 244 LEU D CD1 1 
ATOM 10747 C CD2 . LEU D 1 249 ? -31.837  215.862 -32.984 1.00 0.00 ? 244 LEU D CD2 1 
ATOM 10748 N N   . LEU D 1 250 ? -32.425  211.584 -33.196 1.00 0.00 ? 245 LEU D N   1 
ATOM 10749 C CA  . LEU D 1 250 ? -33.019  210.914 -34.359 1.00 0.00 ? 245 LEU D CA  1 
ATOM 10750 C C   . LEU D 1 250 ? -34.128  209.993 -33.882 1.00 0.00 ? 245 LEU D C   1 
ATOM 10751 O O   . LEU D 1 250 ? -35.262  210.035 -34.332 1.00 0.00 ? 245 LEU D O   1 
ATOM 10752 C CB  . LEU D 1 250 ? -32.015  210.101 -35.220 1.00 0.00 ? 245 LEU D CB  1 
ATOM 10753 C CG  . LEU D 1 250 ? -32.315  210.085 -36.785 1.00 0.00 ? 245 LEU D CG  1 
ATOM 10754 C CD1 . LEU D 1 250 ? -31.099  209.446 -37.471 1.00 0.00 ? 245 LEU D CD1 1 
ATOM 10755 C CD2 . LEU D 1 250 ? -33.571  209.274 -37.209 1.00 0.00 ? 245 LEU D CD2 1 
ATOM 10756 N N   . LYS D 1 251 ? -33.823  209.094 -32.913 1.00 0.00 ? 246 LYS D N   1 
ATOM 10757 C CA  . LYS D 1 251 ? -34.831  208.124 -32.435 1.00 0.00 ? 246 LYS D CA  1 
ATOM 10758 C C   . LYS D 1 251 ? -36.112  208.803 -31.826 1.00 0.00 ? 246 LYS D C   1 
ATOM 10759 O O   . LYS D 1 251 ? -37.194  208.267 -32.093 1.00 0.00 ? 246 LYS D O   1 
ATOM 10760 C CB  . LYS D 1 251 ? -34.225  207.160 -31.321 1.00 0.00 ? 246 LYS D CB  1 
ATOM 10761 C CG  . LYS D 1 251 ? -33.039  206.299 -31.873 1.00 0.00 ? 246 LYS D CG  1 
ATOM 10762 C CD  . LYS D 1 251 ? -32.711  205.328 -30.769 1.00 0.00 ? 246 LYS D CD  1 
ATOM 10763 C CE  . LYS D 1 251 ? -31.653  204.288 -31.208 1.00 0.00 ? 246 LYS D CE  1 
ATOM 10764 N NZ  . LYS D 1 251 ? -31.642  203.137 -30.254 1.00 0.00 ? 246 LYS D NZ  1 
ATOM 10765 N N   . GLN D 1 252 ? -35.999  209.877 -30.989 1.00 0.00 ? 247 GLN D N   1 
ATOM 10766 C CA  . GLN D 1 252 ? -36.966  210.574 -30.184 1.00 0.00 ? 247 GLN D CA  1 
ATOM 10767 C C   . GLN D 1 252 ? -37.841  211.429 -31.043 1.00 0.00 ? 247 GLN D C   1 
ATOM 10768 O O   . GLN D 1 252 ? -39.063  211.461 -30.909 1.00 0.00 ? 247 GLN D O   1 
ATOM 10769 C CB  . GLN D 1 252 ? -36.392  211.400 -29.063 1.00 0.00 ? 247 GLN D CB  1 
ATOM 10770 C CG  . GLN D 1 252 ? -37.462  211.998 -28.127 1.00 0.00 ? 247 GLN D CG  1 
ATOM 10771 C CD  . GLN D 1 252 ? -36.767  212.916 -27.129 1.00 0.00 ? 247 GLN D CD  1 
ATOM 10772 O OE1 . GLN D 1 252 ? -36.469  212.453 -26.038 1.00 0.00 ? 247 GLN D OE1 1 
ATOM 10773 N NE2 . GLN D 1 252 ? -36.806  214.218 -27.324 1.00 0.00 ? 247 GLN D NE2 1 
ATOM 10774 N N   . LYS D 1 253 ? -37.280  212.101 -32.027 1.00 0.00 ? 248 LYS D N   1 
ATOM 10775 C CA  . LYS D 1 253 ? -37.757  213.227 -32.830 1.00 0.00 ? 248 LYS D CA  1 
ATOM 10776 C C   . LYS D 1 253 ? -38.017  213.142 -34.337 1.00 0.00 ? 248 LYS D C   1 
ATOM 10777 O O   . LYS D 1 253 ? -38.897  213.743 -34.979 1.00 0.00 ? 248 LYS D O   1 
ATOM 10778 C CB  . LYS D 1 253 ? -36.849  214.475 -32.396 1.00 0.00 ? 248 LYS D CB  1 
ATOM 10779 C CG  . LYS D 1 253 ? -37.458  215.843 -32.847 1.00 0.00 ? 248 LYS D CG  1 
ATOM 10780 C CD  . LYS D 1 253 ? -36.763  217.032 -32.285 1.00 0.00 ? 248 LYS D CD  1 
ATOM 10781 C CE  . LYS D 1 253 ? -37.239  218.352 -33.045 1.00 0.00 ? 248 LYS D CE  1 
ATOM 10782 N NZ  . LYS D 1 253 ? -36.874  219.536 -32.257 1.00 0.00 ? 248 LYS D NZ  1 
ATOM 10783 N N   . GLU D 1 254 ? -37.103  212.358 -34.989 1.00 0.00 ? 249 GLU D N   1 
ATOM 10784 C CA  . GLU D 1 254 ? -37.164  212.134 -36.381 1.00 0.00 ? 249 GLU D CA  1 
ATOM 10785 C C   . GLU D 1 254 ? -37.363  210.583 -36.885 1.00 0.00 ? 249 GLU D C   1 
ATOM 10786 O O   . GLU D 1 254 ? -37.378  210.245 -38.088 1.00 0.00 ? 249 GLU D O   1 
ATOM 10787 C CB  . GLU D 1 254 ? -35.842  212.616 -37.032 1.00 0.00 ? 249 GLU D CB  1 
ATOM 10788 C CG  . GLU D 1 254 ? -35.458  214.073 -36.575 1.00 0.00 ? 249 GLU D CG  1 
ATOM 10789 C CD  . GLU D 1 254 ? -34.237  214.488 -37.291 1.00 0.00 ? 249 GLU D CD  1 
ATOM 10790 O OE1 . GLU D 1 254 ? -34.021  213.980 -38.454 1.00 0.00 ? 249 GLU D OE1 1 
ATOM 10791 O OE2 . GLU D 1 254 ? -33.423  215.310 -36.767 1.00 0.00 ? 249 GLU D OE2 1 
ATOM 10792 N N   . LEU D 1 255 ? -37.561  209.606 -36.010 1.00 0.00 ? 250 LEU D N   1 
ATOM 10793 C CA  . LEU D 1 255 ? -37.600  208.170 -36.394 1.00 0.00 ? 250 LEU D CA  1 
ATOM 10794 C C   . LEU D 1 255 ? -38.957  207.751 -37.059 1.00 0.00 ? 250 LEU D C   1 
ATOM 10795 O O   . LEU D 1 255 ? -40.026  208.089 -36.545 1.00 0.00 ? 250 LEU D O   1 
ATOM 10796 C CB  . LEU D 1 255 ? -37.355  207.330 -35.110 1.00 0.00 ? 250 LEU D CB  1 
ATOM 10797 C CG  . LEU D 1 255 ? -37.011  205.854 -35.347 1.00 0.00 ? 250 LEU D CG  1 
ATOM 10798 C CD1 . LEU D 1 255 ? -35.558  205.771 -35.887 1.00 0.00 ? 250 LEU D CD1 1 
ATOM 10799 C CD2 . LEU D 1 255 ? -37.218  205.187 -34.021 1.00 0.00 ? 250 LEU D CD2 1 
ATOM 10800 N N   . GLY D 1 256 ? -38.986  207.003 -38.212 1.00 0.00 ? 251 GLY D N   1 
ATOM 10801 C CA  . GLY D 1 256 ? -40.111  206.870 -38.998 1.00 0.00 ? 251 GLY D CA  1 
ATOM 10802 C C   . GLY D 1 256 ? -40.720  205.484 -38.913 1.00 0.00 ? 251 GLY D C   1 
ATOM 10803 O O   . GLY D 1 256 ? -39.974  204.533 -39.220 1.00 0.00 ? 251 GLY D O   1 
ATOM 10804 N N   . GLY D 1 257 ? -42.026  205.350 -38.663 1.00 0.00 ? 252 GLY D N   1 
ATOM 10805 C CA  . GLY D 1 257 ? -42.674  204.070 -38.676 1.00 0.00 ? 252 GLY D CA  1 
ATOM 10806 C C   . GLY D 1 257 ? -43.217  203.578 -39.990 1.00 0.00 ? 252 GLY D C   1 
ATOM 10807 O O   . GLY D 1 257 ? -43.803  202.467 -40.099 1.00 0.00 ? 252 GLY D O   1 
ATOM 10808 N N   . GLU D 1 258 ? -43.163  204.378 -41.071 1.00 0.00 ? 253 GLU D N   1 
ATOM 10809 C CA  . GLU D 1 258 ? -43.843  204.220 -42.380 1.00 0.00 ? 253 GLU D CA  1 
ATOM 10810 C C   . GLU D 1 258 ? -42.999  203.281 -43.202 1.00 0.00 ? 253 GLU D C   1 
ATOM 10811 O O   . GLU D 1 258 ? -41.783  203.094 -42.943 1.00 0.00 ? 253 GLU D O   1 
ATOM 10812 C CB  . GLU D 1 258 ? -43.988  205.620 -43.011 1.00 0.00 ? 253 GLU D CB  1 
ATOM 10813 C CG  . GLU D 1 258 ? -44.885  205.651 -44.276 1.00 0.00 ? 253 GLU D CG  1 
ATOM 10814 C CD  . GLU D 1 258 ? -46.192  204.831 -44.332 1.00 0.00 ? 253 GLU D CD  1 
ATOM 10815 O OE1 . GLU D 1 258 ? -46.124  203.581 -44.576 1.00 0.00 ? 253 GLU D OE1 1 
ATOM 10816 O OE2 . GLU D 1 258 ? -47.331  205.328 -44.115 1.00 0.00 ? 253 GLU D OE2 1 
ATOM 10817 N N   . GLU D 1 259 ? -43.540  202.603 -44.178 1.00 0.00 ? 254 GLU D N   1 
ATOM 10818 C CA  . GLU D 1 259 ? -42.867  201.733 -45.041 1.00 0.00 ? 254 GLU D CA  1 
ATOM 10819 C C   . GLU D 1 259 ? -41.959  202.545 -45.975 1.00 0.00 ? 254 GLU D C   1 
ATOM 10820 O O   . GLU D 1 259 ? -42.417  203.577 -46.495 1.00 0.00 ? 254 GLU D O   1 
ATOM 10821 C CB  . GLU D 1 259 ? -43.901  201.001 -45.828 1.00 0.00 ? 254 GLU D CB  1 
ATOM 10822 C CG  . GLU D 1 259 ? -44.543  199.739 -45.020 1.00 0.00 ? 254 GLU D CG  1 
ATOM 10823 C CD  . GLU D 1 259 ? -43.476  198.869 -44.329 1.00 0.00 ? 254 GLU D CD  1 
ATOM 10824 O OE1 . GLU D 1 259 ? -42.691  198.124 -44.979 1.00 0.00 ? 254 GLU D OE1 1 
ATOM 10825 O OE2 . GLU D 1 259 ? -43.311  199.029 -43.069 1.00 0.00 ? 254 GLU D OE2 1 
ATOM 10826 N N   . PRO D 1 260 ? -40.715  202.140 -46.192 1.00 0.00 ? 255 PRO D N   1 
ATOM 10827 C CA  . PRO D 1 260 ? -39.964  202.523 -47.408 1.00 0.00 ? 255 PRO D CA  1 
ATOM 10828 C C   . PRO D 1 260 ? -40.762  202.651 -48.743 1.00 0.00 ? 255 PRO D C   1 
ATOM 10829 O O   . PRO D 1 260 ? -41.423  201.716 -49.163 1.00 0.00 ? 255 PRO D O   1 
ATOM 10830 C CB  . PRO D 1 260 ? -38.804  201.472 -47.564 1.00 0.00 ? 255 PRO D CB  1 
ATOM 10831 C CG  . PRO D 1 260 ? -38.852  200.558 -46.330 1.00 0.00 ? 255 PRO D CG  1 
ATOM 10832 C CD  . PRO D 1 260 ? -40.306  200.748 -45.826 1.00 0.00 ? 255 PRO D CD  1 
ATOM 10833 N N   . GLU D 1 261 ? -40.719  203.827 -49.377 1.00 0.00 ? 256 GLU D N   1 
ATOM 10834 C CA  . GLU D 1 261 ? -41.508  204.067 -50.598 1.00 0.00 ? 256 GLU D CA  1 
ATOM 10835 C C   . GLU D 1 261 ? -40.623  204.059 -51.821 1.00 0.00 ? 256 GLU D C   1 
ATOM 10836 O O   . GLU D 1 261 ? -39.758  204.877 -51.943 1.00 0.00 ? 256 GLU D O   1 
ATOM 10837 C CB  . GLU D 1 261 ? -42.093  205.491 -50.513 1.00 0.00 ? 256 GLU D CB  1 
ATOM 10838 C CG  . GLU D 1 261 ? -43.082  205.819 -51.741 1.00 0.00 ? 256 GLU D CG  1 
ATOM 10839 C CD  . GLU D 1 261 ? -43.959  207.068 -51.602 1.00 0.00 ? 256 GLU D CD  1 
ATOM 10840 O OE1 . GLU D 1 261 ? -44.716  207.320 -50.648 1.00 0.00 ? 256 GLU D OE1 1 
ATOM 10841 O OE2 . GLU D 1 261 ? -43.823  207.970 -52.512 1.00 0.00 ? 256 GLU D OE2 1 
ATOM 10842 N N   . PRO D 1 262 ? -40.761  203.095 -52.701 1.00 0.00 ? 257 PRO D N   1 
ATOM 10843 C CA  . PRO D 1 262 ? -40.259  203.119 -54.108 1.00 0.00 ? 257 PRO D CA  1 
ATOM 10844 C C   . PRO D 1 262 ? -40.455  204.399 -54.891 1.00 0.00 ? 257 PRO D C   1 
ATOM 10845 O O   . PRO D 1 262 ? -41.267  205.312 -54.652 1.00 0.00 ? 257 PRO D O   1 
ATOM 10846 C CB  . PRO D 1 262 ? -41.024  201.979 -54.765 1.00 0.00 ? 257 PRO D CB  1 
ATOM 10847 C CG  . PRO D 1 262 ? -40.984  200.973 -53.600 1.00 0.00 ? 257 PRO D CG  1 
ATOM 10848 C CD  . PRO D 1 262 ? -41.398  201.856 -52.432 1.00 0.00 ? 257 PRO D CD  1 
ATOM 10849 N N   . SER D 1 263 ? -39.618  204.561 -56.017 1.00 0.00 ? 258 SER D N   1 
ATOM 10850 C CA  . SER D 1 263 ? -39.562  205.865 -56.700 1.00 0.00 ? 258 SER D CA  1 
ATOM 10851 C C   . SER D 1 263 ? -39.588  205.556 -58.202 1.00 0.00 ? 258 SER D C   1 
ATOM 10852 O O   . SER D 1 263 ? -38.857  204.650 -58.579 1.00 0.00 ? 258 SER D O   1 
ATOM 10853 C CB  . SER D 1 263 ? -38.286  206.632 -56.258 1.00 0.00 ? 258 SER D CB  1 
ATOM 10854 O OG  . SER D 1 263 ? -38.104  207.855 -56.982 1.00 0.00 ? 258 SER D OG  1 
ATOM 10855 N N   . LEU D 1 264 ? -40.463  206.257 -58.914 1.00 0.00 ? 259 LEU D N   1 
ATOM 10856 C CA  . LEU D 1 264 ? -40.797  206.213 -60.260 1.00 0.00 ? 259 LEU D CA  1 
ATOM 10857 C C   . LEU D 1 264 ? -40.120  207.331 -61.092 1.00 0.00 ? 259 LEU D C   1 
ATOM 10858 O O   . LEU D 1 264 ? -40.724  208.397 -61.302 1.00 0.00 ? 259 LEU D O   1 
ATOM 10859 C CB  . LEU D 1 264 ? -42.292  206.119 -60.352 1.00 0.00 ? 259 LEU D CB  1 
ATOM 10860 C CG  . LEU D 1 264 ? -42.916  205.721 -61.703 1.00 0.00 ? 259 LEU D CG  1 
ATOM 10861 C CD1 . LEU D 1 264 ? -42.442  204.330 -62.120 1.00 0.00 ? 259 LEU D CD1 1 
ATOM 10862 C CD2 . LEU D 1 264 ? -44.410  205.727 -61.580 1.00 0.00 ? 259 LEU D CD2 1 
ATOM 10863 N N   . ARG D 1 265 ? -38.821  207.103 -61.348 1.00 0.00 ? 260 ARG D N   1 
ATOM 10864 C CA  . ARG D 1 265 ? -37.974  208.197 -61.903 1.00 0.00 ? 260 ARG D CA  1 
ATOM 10865 C C   . ARG D 1 265 ? -37.104  207.732 -63.158 1.00 0.00 ? 260 ARG D C   1 
ATOM 10866 O O   . ARG D 1 265 ? -36.739  206.605 -63.330 1.00 0.00 ? 260 ARG D O   1 
ATOM 10867 C CB  . ARG D 1 265 ? -36.895  208.570 -60.774 1.00 0.00 ? 260 ARG D CB  1 
ATOM 10868 C CG  . ARG D 1 265 ? -35.780  207.588 -60.442 1.00 0.00 ? 260 ARG D CG  1 
ATOM 10869 C CD  . ARG D 1 265 ? -36.151  206.284 -59.694 1.00 0.00 ? 260 ARG D CD  1 
ATOM 10870 N NE  . ARG D 1 265 ? -34.868  205.522 -59.667 1.00 0.00 ? 260 ARG D NE  1 
ATOM 10871 C CZ  . ARG D 1 265 ? -34.859  204.195 -59.363 1.00 0.00 ? 260 ARG D CZ  1 
ATOM 10872 N NH1 . ARG D 1 265 ? -35.971  203.548 -59.054 1.00 0.00 ? 260 ARG D NH1 1 
ATOM 10873 N NH2 . ARG D 1 265 ? -33.698  203.599 -59.179 1.00 0.00 ? 260 ARG D NH2 1 
ATOM 10874 N N   . GLU D 1 266 ? -36.978  208.670 -64.107 1.00 0.00 ? 261 GLU D N   1 
ATOM 10875 C CA  . GLU D 1 266 ? -36.325  208.315 -65.396 1.00 0.00 ? 261 GLU D CA  1 
ATOM 10876 C C   . GLU D 1 266 ? -34.852  207.935 -65.262 1.00 0.00 ? 261 GLU D C   1 
ATOM 10877 O O   . GLU D 1 266 ? -34.159  208.552 -64.398 1.00 0.00 ? 261 GLU D O   1 
ATOM 10878 C CB  . GLU D 1 266 ? -36.503  209.365 -66.498 1.00 0.00 ? 261 GLU D CB  1 
ATOM 10879 C CG  . GLU D 1 266 ? -37.909  209.226 -67.192 1.00 0.00 ? 261 GLU D CG  1 
ATOM 10880 C CD  . GLU D 1 266 ? -38.052  210.264 -68.296 1.00 0.00 ? 261 GLU D CD  1 
ATOM 10881 O OE1 . GLU D 1 266 ? -37.952  211.491 -68.032 1.00 0.00 ? 261 GLU D OE1 1 
ATOM 10882 O OE2 . GLU D 1 266 ? -38.231  209.869 -69.489 1.00 0.00 ? 261 GLU D OE2 1 
ATOM 10883 N N   . GLY D 1 267 ? -34.391  206.957 -66.069 1.00 0.00 ? 262 GLY D N   1 
ATOM 10884 C CA  . GLY D 1 267 ? -33.077  206.421 -66.084 1.00 0.00 ? 262 GLY D CA  1 
ATOM 10885 C C   . GLY D 1 267 ? -32.331  206.477 -67.476 1.00 0.00 ? 262 GLY D C   1 
ATOM 10886 O O   . GLY D 1 267 ? -32.429  207.439 -68.203 1.00 0.00 ? 262 GLY D O   1 
ATOM 10887 N N   . PRO D 1 268 ? -31.634  205.359 -67.882 1.00 0.00 ? 263 PRO D N   1 
ATOM 10888 C CA  . PRO D 1 268 ? -31.138  205.249 -69.250 1.00 0.00 ? 263 PRO D CA  1 
ATOM 10889 C C   . PRO D 1 268 ? -32.265  205.119 -70.312 1.00 0.00 ? 263 PRO D C   1 
ATOM 10890 O O   . PRO D 1 268 ? -31.994  205.460 -71.506 1.00 0.00 ? 263 PRO D O   1 
ATOM 10891 C CB  . PRO D 1 268 ? -30.314  203.950 -69.205 1.00 0.00 ? 263 PRO D CB  1 
ATOM 10892 C CG  . PRO D 1 268 ? -29.761  204.039 -67.795 1.00 0.00 ? 263 PRO D CG  1 
ATOM 10893 C CD  . PRO D 1 268 ? -31.031  204.407 -66.952 1.00 0.00 ? 263 PRO D CD  1 
ATOM 10894 N N   . GLY D 1 269 ? -33.386  204.437 -70.046 1.00 0.00 ? 264 GLY D N   1 
ATOM 10895 C CA  . GLY D 1 269 ? -34.401  204.142 -71.063 1.00 0.00 ? 264 GLY D CA  1 
ATOM 10896 C C   . GLY D 1 269 ? -35.795  204.486 -70.703 1.00 0.00 ? 264 GLY D C   1 
ATOM 10897 O O   . GLY D 1 269 ? -36.698  204.262 -71.520 1.00 0.00 ? 264 GLY D O   1 
ATOM 10898 N N   . GLY D 1 270 ? -36.093  205.147 -69.577 1.00 0.00 ? 265 GLY D N   1 
ATOM 10899 C CA  . GLY D 1 270 ? -37.439  205.614 -69.165 1.00 0.00 ? 265 GLY D CA  1 
ATOM 10900 C C   . GLY D 1 270 ? -37.477  205.411 -67.699 1.00 0.00 ? 265 GLY D C   1 
ATOM 10901 O O   . GLY D 1 270 ? -36.542  205.181 -66.994 1.00 0.00 ? 265 GLY D O   1 
ATOM 10902 N N   . LEU D 1 271 ? -38.713  205.296 -67.208 1.00 0.00 ? 266 LEU D N   1 
ATOM 10903 C CA  . LEU D 1 271 ? -38.992  205.208 -65.802 1.00 0.00 ? 266 LEU D CA  1 
ATOM 10904 C C   . LEU D 1 271 ? -38.580  203.882 -65.178 1.00 0.00 ? 266 LEU D C   1 
ATOM 10905 O O   . LEU D 1 271 ? -38.847  202.803 -65.714 1.00 0.00 ? 266 LEU D O   1 
ATOM 10906 C CB  . LEU D 1 271 ? -40.560  205.433 -65.653 1.00 0.00 ? 266 LEU D CB  1 
ATOM 10907 C CG  . LEU D 1 271 ? -40.982  206.918 -65.936 1.00 0.00 ? 266 LEU D CG  1 
ATOM 10908 C CD1 . LEU D 1 271 ? -42.534  207.024 -65.929 1.00 0.00 ? 266 LEU D CD1 1 
ATOM 10909 C CD2 . LEU D 1 271 ? -40.393  207.929 -64.892 1.00 0.00 ? 266 LEU D CD2 1 
ATOM 10910 N N   . VAL D 1 272 ? -37.949  203.916 -63.981 1.00 0.00 ? 267 VAL D N   1 
ATOM 10911 C CA  . VAL D 1 272 ? -37.398  202.816 -63.221 1.00 0.00 ? 267 VAL D CA  1 
ATOM 10912 C C   . VAL D 1 272 ? -38.110  202.790 -61.898 1.00 0.00 ? 267 VAL D C   1 
ATOM 10913 O O   . VAL D 1 272 ? -38.409  203.871 -61.456 1.00 0.00 ? 267 VAL D O   1 
ATOM 10914 C CB  . VAL D 1 272 ? -35.889  202.730 -63.066 1.00 0.00 ? 267 VAL D CB  1 
ATOM 10915 C CG1 . VAL D 1 272 ? -35.328  201.592 -62.179 1.00 0.00 ? 267 VAL D CG1 1 
ATOM 10916 C CG2 . VAL D 1 272 ? -35.235  202.665 -64.425 1.00 0.00 ? 267 VAL D CG2 1 
ATOM 10917 N N   . MET D 1 273 ? -38.410  201.570 -61.399 1.00 0.00 ? 268 MET D N   1 
ATOM 10918 C CA  . MET D 1 273 ? -38.823  201.378 -59.965 1.00 0.00 ? 268 MET D CA  1 
ATOM 10919 C C   . MET D 1 273 ? -38.427  199.986 -59.484 1.00 0.00 ? 268 MET D C   1 
ATOM 10920 O O   . MET D 1 273 ? -38.538  199.076 -60.264 1.00 0.00 ? 268 MET D O   1 
ATOM 10921 C CB  . MET D 1 273 ? -40.335  201.670 -59.737 1.00 0.00 ? 268 MET D CB  1 
ATOM 10922 C CG  . MET D 1 273 ? -40.690  201.867 -58.210 1.00 0.00 ? 268 MET D CG  1 
ATOM 10923 S SD  . MET D 1 273 ? -42.335  202.713 -58.207 1.00 0.00 ? 268 MET D SD  1 
ATOM 10924 C CE  . MET D 1 273 ? -43.307  201.245 -58.156 1.00 0.00 ? 268 MET D CE  1 
ATOM 10925 N N   . GLU D 1 274 ? -38.005  199.915 -58.258 1.00 0.00 ? 269 GLU D N   1 
ATOM 10926 C CA  . GLU D 1 274 ? -37.484  198.686 -57.740 1.00 0.00 ? 269 GLU D CA  1 
ATOM 10927 C C   . GLU D 1 274 ? -37.913  198.588 -56.248 1.00 0.00 ? 269 GLU D C   1 
ATOM 10928 O O   . GLU D 1 274 ? -38.013  199.550 -55.522 1.00 0.00 ? 269 GLU D O   1 
ATOM 10929 C CB  . GLU D 1 274 ? -35.994  198.249 -57.988 1.00 0.00 ? 269 GLU D CB  1 
ATOM 10930 C CG  . GLU D 1 274 ? -34.908  199.098 -57.193 1.00 0.00 ? 269 GLU D CG  1 
ATOM 10931 C CD  . GLU D 1 274 ? -34.854  200.553 -57.662 1.00 0.00 ? 269 GLU D CD  1 
ATOM 10932 O OE1 . GLU D 1 274 ? -35.686  201.390 -57.175 1.00 0.00 ? 269 GLU D OE1 1 
ATOM 10933 O OE2 . GLU D 1 274 ? -33.909  200.954 -58.395 1.00 0.00 ? 269 GLU D OE2 1 
ATOM 10934 N N   . GLY D 1 275 ? -38.214  197.431 -55.817 1.00 0.00 ? 270 GLY D N   1 
ATOM 10935 C CA  . GLY D 1 275 ? -38.768  197.295 -54.463 1.00 0.00 ? 270 GLY D CA  1 
ATOM 10936 C C   . GLY D 1 275 ? -39.408  195.965 -54.149 1.00 0.00 ? 270 GLY D C   1 
ATOM 10937 O O   . GLY D 1 275 ? -39.706  195.185 -55.028 1.00 0.00 ? 270 GLY D O   1 
ATOM 10938 N N   . HIS D 1 276 ? -39.570  195.809 -52.799 1.00 0.00 ? 271 HIS D N   1 
ATOM 10939 C CA  . HIS D 1 276 ? -40.185  194.643 -52.264 1.00 0.00 ? 271 HIS D CA  1 
ATOM 10940 C C   . HIS D 1 276 ? -41.655  194.435 -52.646 1.00 0.00 ? 271 HIS D C   1 
ATOM 10941 O O   . HIS D 1 276 ? -42.531  195.309 -52.614 1.00 0.00 ? 271 HIS D O   1 
ATOM 10942 C CB  . HIS D 1 276 ? -40.084  194.618 -50.767 1.00 0.00 ? 271 HIS D CB  1 
ATOM 10943 C CG  . HIS D 1 276 ? -38.731  194.660 -50.149 1.00 0.00 ? 271 HIS D CG  1 
ATOM 10944 N ND1 . HIS D 1 276 ? -37.760  193.682 -50.192 1.00 0.00 ? 271 HIS D ND1 1 
ATOM 10945 C CD2 . HIS D 1 276 ? -38.182  195.609 -49.307 1.00 0.00 ? 271 HIS D CD2 1 
ATOM 10946 C CE1 . HIS D 1 276 ? -36.701  194.089 -49.402 1.00 0.00 ? 271 HIS D CE1 1 
ATOM 10947 N NE2 . HIS D 1 276 ? -36.962  195.244 -48.867 1.00 0.00 ? 271 HIS D NE2 1 
ATOM 10948 N N   . LEU D 1 277 ? -41.953  193.128 -52.956 1.00 0.00 ? 272 LEU D N   1 
ATOM 10949 C CA  . LEU D 1 277 ? -43.332  192.732 -53.118 1.00 0.00 ? 272 LEU D CA  1 
ATOM 10950 C C   . LEU D 1 277 ? -43.545  191.294 -52.624 1.00 0.00 ? 272 LEU D C   1 
ATOM 10951 O O   . LEU D 1 277 ? -42.638  190.429 -52.688 1.00 0.00 ? 272 LEU D O   1 
ATOM 10952 C CB  . LEU D 1 277 ? -43.783  192.693 -54.606 1.00 0.00 ? 272 LEU D CB  1 
ATOM 10953 C CG  . LEU D 1 277 ? -43.779  194.007 -55.352 1.00 0.00 ? 272 LEU D CG  1 
ATOM 10954 C CD1 . LEU D 1 277 ? -43.876  193.803 -56.847 1.00 0.00 ? 272 LEU D CD1 1 
ATOM 10955 C CD2 . LEU D 1 277 ? -45.039  194.908 -55.011 1.00 0.00 ? 272 LEU D CD2 1 
ATOM 10956 N N   . PHE D 1 278 ? -44.797  190.989 -52.264 1.00 0.00 ? 273 PHE D N   1 
ATOM 10957 C CA  . PHE D 1 278 ? -45.186  189.606 -51.978 1.00 0.00 ? 273 PHE D CA  1 
ATOM 10958 C C   . PHE D 1 278 ? -45.849  188.986 -53.197 1.00 0.00 ? 273 PHE D C   1 
ATOM 10959 O O   . PHE D 1 278 ? -46.541  189.628 -53.945 1.00 0.00 ? 273 PHE D O   1 
ATOM 10960 C CB  . PHE D 1 278 ? -46.266  189.536 -50.923 1.00 0.00 ? 273 PHE D CB  1 
ATOM 10961 C CG  . PHE D 1 278 ? -45.743  189.595 -49.511 1.00 0.00 ? 273 PHE D CG  1 
ATOM 10962 C CD1 . PHE D 1 278 ? -44.991  188.551 -49.017 1.00 0.00 ? 273 PHE D CD1 1 
ATOM 10963 C CD2 . PHE D 1 278 ? -46.147  190.554 -48.536 1.00 0.00 ? 273 PHE D CD2 1 
ATOM 10964 C CE1 . PHE D 1 278 ? -44.489  188.527 -47.702 1.00 0.00 ? 273 PHE D CE1 1 
ATOM 10965 C CE2 . PHE D 1 278 ? -45.561  190.627 -47.296 1.00 0.00 ? 273 PHE D CE2 1 
ATOM 10966 C CZ  . PHE D 1 278 ? -44.814  189.495 -46.785 1.00 0.00 ? 273 PHE D CZ  1 
ATOM 10967 N N   . LYS D 1 279 ? -45.627  187.654 -53.373 1.00 0.00 ? 274 LYS D N   1 
ATOM 10968 C CA  . LYS D 1 279 ? -46.043  186.884 -54.530 1.00 0.00 ? 274 LYS D CA  1 
ATOM 10969 C C   . LYS D 1 279 ? -46.380  185.523 -53.961 1.00 0.00 ? 274 LYS D C   1 
ATOM 10970 O O   . LYS D 1 279 ? -46.183  185.285 -52.805 1.00 0.00 ? 274 LYS D O   1 
ATOM 10971 C CB  . LYS D 1 279 ? -44.899  186.685 -55.612 1.00 0.00 ? 274 LYS D CB  1 
ATOM 10972 C CG  . LYS D 1 279 ? -43.549  186.319 -55.028 1.00 0.00 ? 274 LYS D CG  1 
ATOM 10973 C CD  . LYS D 1 279 ? -42.562  185.539 -55.986 1.00 0.00 ? 274 LYS D CD  1 
ATOM 10974 C CE  . LYS D 1 279 ? -42.928  184.103 -56.320 1.00 0.00 ? 274 LYS D CE  1 
ATOM 10975 N NZ  . LYS D 1 279 ? -42.102  183.584 -57.356 1.00 0.00 ? 274 LYS D NZ  1 
ATOM 10976 N N   . ARG D 1 280 ? -46.919  184.600 -54.760 1.00 0.00 ? 275 ARG D N   1 
ATOM 10977 C CA  . ARG D 1 280 ? -47.247  183.227 -54.391 1.00 0.00 ? 275 ARG D CA  1 
ATOM 10978 C C   . ARG D 1 280 ? -46.276  182.254 -55.013 1.00 0.00 ? 275 ARG D C   1 
ATOM 10979 O O   . ARG D 1 280 ? -45.848  182.438 -56.207 1.00 0.00 ? 275 ARG D O   1 
ATOM 10980 C CB  . ARG D 1 280 ? -48.683  182.799 -54.848 1.00 0.00 ? 275 ARG D CB  1 
ATOM 10981 C CG  . ARG D 1 280 ? -49.748  183.733 -54.222 1.00 0.00 ? 275 ARG D CG  1 
ATOM 10982 C CD  . ARG D 1 280 ? -51.275  183.250 -54.239 1.00 0.00 ? 275 ARG D CD  1 
ATOM 10983 N NE  . ARG D 1 280 ? -51.302  182.161 -53.264 1.00 0.00 ? 275 ARG D NE  1 
ATOM 10984 C CZ  . ARG D 1 280 ? -52.384  181.671 -52.643 1.00 0.00 ? 275 ARG D CZ  1 
ATOM 10985 N NH1 . ARG D 1 280 ? -53.598  182.218 -52.800 1.00 0.00 ? 275 ARG D NH1 1 
ATOM 10986 N NH2 . ARG D 1 280 ? -52.186  180.837 -51.683 1.00 0.00 ? 275 ARG D NH2 1 
ATOM 10987 N N   . ALA D 1 281 ? -45.792  181.227 -54.278 1.00 0.00 ? 276 ALA D N   1 
ATOM 10988 C CA  . ALA D 1 281 ? -44.805  180.229 -54.715 1.00 0.00 ? 276 ALA D CA  1 
ATOM 10989 C C   . ALA D 1 281 ? -45.411  179.233 -55.705 1.00 0.00 ? 276 ALA D C   1 
ATOM 10990 O O   . ALA D 1 281 ? -46.607  179.043 -55.802 1.00 0.00 ? 276 ALA D O   1 
ATOM 10991 C CB  . ALA D 1 281 ? -44.152  179.549 -53.528 1.00 0.00 ? 276 ALA D CB  1 
ATOM 10992 N N   . SER D 1 282 ? -44.536  178.412 -56.323 1.00 0.00 ? 277 SER D N   1 
ATOM 10993 C CA  . SER D 1 282 ? -44.907  177.354 -57.279 1.00 0.00 ? 277 SER D CA  1 
ATOM 10994 C C   . SER D 1 282 ? -45.005  175.939 -56.808 1.00 0.00 ? 277 SER D C   1 
ATOM 10995 O O   . SER D 1 282 ? -45.314  175.020 -57.567 1.00 0.00 ? 277 SER D O   1 
ATOM 10996 C CB  . SER D 1 282 ? -44.175  177.353 -58.591 1.00 0.00 ? 277 SER D CB  1 
ATOM 10997 O OG  . SER D 1 282 ? -43.959  178.599 -59.202 1.00 0.00 ? 277 SER D OG  1 
ATOM 10998 N N   . ASN D 1 283 ? -44.702  175.749 -55.545 1.00 0.00 ? 278 ASN D N   1 
ATOM 10999 C CA  . ASN D 1 283 ? -45.178  174.599 -54.694 1.00 0.00 ? 278 ASN D CA  1 
ATOM 11000 C C   . ASN D 1 283 ? -46.672  174.262 -54.748 1.00 0.00 ? 278 ASN D C   1 
ATOM 11001 O O   . ASN D 1 283 ? -47.586  174.959 -55.295 1.00 0.00 ? 278 ASN D O   1 
ATOM 11002 C CB  . ASN D 1 283 ? -44.623  174.686 -53.248 1.00 0.00 ? 278 ASN D CB  1 
ATOM 11003 C CG  . ASN D 1 283 ? -45.194  175.847 -52.509 1.00 0.00 ? 278 ASN D CG  1 
ATOM 11004 O OD1 . ASN D 1 283 ? -46.385  176.103 -52.608 1.00 0.00 ? 278 ASN D OD1 1 
ATOM 11005 N ND2 . ASN D 1 283 ? -44.368  176.474 -51.709 1.00 0.00 ? 278 ASN D ND2 1 
ATOM 11006 N N   . ALA D 1 284 ? -47.046  173.065 -54.256 1.00 0.00 ? 279 ALA D N   1 
ATOM 11007 C CA  . ALA D 1 284 ? -48.407  172.628 -54.442 1.00 0.00 ? 279 ALA D CA  1 
ATOM 11008 C C   . ALA D 1 284 ? -49.422  173.364 -53.528 1.00 0.00 ? 279 ALA D C   1 
ATOM 11009 O O   . ALA D 1 284 ? -50.557  173.497 -53.989 1.00 0.00 ? 279 ALA D O   1 
ATOM 11010 C CB  . ALA D 1 284 ? -48.517  171.133 -54.363 1.00 0.00 ? 279 ALA D CB  1 
ATOM 11011 N N   . PHE D 1 285 ? -48.939  173.832 -52.341 1.00 0.00 ? 280 PHE D N   1 
ATOM 11012 C CA  . PHE D 1 285 ? -49.783  174.686 -51.518 1.00 0.00 ? 280 PHE D CA  1 
ATOM 11013 C C   . PHE D 1 285 ? -49.921  176.107 -51.999 1.00 0.00 ? 280 PHE D C   1 
ATOM 11014 O O   . PHE D 1 285 ? -50.726  176.907 -51.491 1.00 0.00 ? 280 PHE D O   1 
ATOM 11015 C CB  . PHE D 1 285 ? -49.365  174.638 -50.016 1.00 0.00 ? 280 PHE D CB  1 
ATOM 11016 C CG  . PHE D 1 285 ? -49.492  173.195 -49.479 1.00 0.00 ? 280 PHE D CG  1 
ATOM 11017 C CD1 . PHE D 1 285 ? -50.744  172.572 -49.183 1.00 0.00 ? 280 PHE D CD1 1 
ATOM 11018 C CD2 . PHE D 1 285 ? -48.363  172.492 -49.009 1.00 0.00 ? 280 PHE D CD2 1 
ATOM 11019 C CE1 . PHE D 1 285 ? -50.831  171.442 -48.429 1.00 0.00 ? 280 PHE D CE1 1 
ATOM 11020 C CE2 . PHE D 1 285 ? -48.455  171.247 -48.362 1.00 0.00 ? 280 PHE D CE2 1 
ATOM 11021 C CZ  . PHE D 1 285 ? -49.713  170.746 -48.098 1.00 0.00 ? 280 PHE D CZ  1 
ATOM 11022 N N   . LYS D 1 286 ? -49.111  176.590 -53.002 1.00 0.00 ? 281 LYS D N   1 
ATOM 11023 C CA  . LYS D 1 286 ? -49.050  177.958 -53.443 1.00 0.00 ? 281 LYS D CA  1 
ATOM 11024 C C   . LYS D 1 286 ? -48.769  179.007 -52.364 1.00 0.00 ? 281 LYS D C   1 
ATOM 11025 O O   . LYS D 1 286 ? -49.500  179.962 -52.263 1.00 0.00 ? 281 LYS D O   1 
ATOM 11026 C CB  . LYS D 1 286 ? -50.307  178.342 -54.334 1.00 0.00 ? 281 LYS D CB  1 
ATOM 11027 C CG  . LYS D 1 286 ? -50.440  177.532 -55.652 1.00 0.00 ? 281 LYS D CG  1 
ATOM 11028 C CD  . LYS D 1 286 ? -51.515  176.466 -55.469 1.00 0.00 ? 281 LYS D CD  1 
ATOM 11029 C CE  . LYS D 1 286 ? -51.289  175.351 -56.528 1.00 0.00 ? 281 LYS D CE  1 
ATOM 11030 N NZ  . LYS D 1 286 ? -52.455  174.448 -56.726 1.00 0.00 ? 281 LYS D NZ  1 
ATOM 11031 N N   . THR D 1 287 ? -47.651  178.846 -51.557 1.00 0.00 ? 282 THR D N   1 
ATOM 11032 C CA  . THR D 1 287 ? -47.466  179.632 -50.376 1.00 0.00 ? 282 THR D CA  1 
ATOM 11033 C C   . THR D 1 287 ? -46.719  180.936 -50.724 1.00 0.00 ? 282 THR D C   1 
ATOM 11034 O O   . THR D 1 287 ? -45.813  181.033 -51.552 1.00 0.00 ? 282 THR D O   1 
ATOM 11035 C CB  . THR D 1 287 ? -46.714  178.964 -49.226 1.00 0.00 ? 282 THR D CB  1 
ATOM 11036 O OG1 . THR D 1 287 ? -45.451  178.441 -49.589 1.00 0.00 ? 282 THR D OG1 1 
ATOM 11037 C CG2 . THR D 1 287 ? -47.597  177.803 -48.651 1.00 0.00 ? 282 THR D CG2 1 
ATOM 11038 N N   . TRP D 1 288 ? -47.224  181.991 -50.020 1.00 0.00 ? 283 TRP D N   1 
ATOM 11039 C CA  . TRP D 1 288 ? -46.836  183.360 -50.302 1.00 0.00 ? 283 TRP D CA  1 
ATOM 11040 C C   . TRP D 1 288 ? -45.338  183.583 -49.882 1.00 0.00 ? 283 TRP D C   1 
ATOM 11041 O O   . TRP D 1 288 ? -44.800  183.052 -48.963 1.00 0.00 ? 283 TRP D O   1 
ATOM 11042 C CB  . TRP D 1 288 ? -47.743  184.372 -49.599 1.00 0.00 ? 283 TRP D CB  1 
ATOM 11043 C CG  . TRP D 1 288 ? -49.163  184.389 -50.080 1.00 0.00 ? 283 TRP D CG  1 
ATOM 11044 C CD1 . TRP D 1 288 ? -50.176  183.526 -49.918 1.00 0.00 ? 283 TRP D CD1 1 
ATOM 11045 C CD2 . TRP D 1 288 ? -49.674  185.413 -50.983 1.00 0.00 ? 283 TRP D CD2 1 
ATOM 11046 N NE1 . TRP D 1 288 ? -51.359  184.078 -50.404 1.00 0.00 ? 283 TRP D NE1 1 
ATOM 11047 C CE2 . TRP D 1 288 ? -51.074  185.160 -51.139 1.00 0.00 ? 283 TRP D CE2 1 
ATOM 11048 C CE3 . TRP D 1 288 ? -49.009  186.552 -51.529 1.00 0.00 ? 283 TRP D CE3 1 
ATOM 11049 C CZ2 . TRP D 1 288 ? -51.849  186.009 -51.919 1.00 0.00 ? 283 TRP D CZ2 1 
ATOM 11050 C CZ3 . TRP D 1 288 ? -49.811  187.432 -52.294 1.00 0.00 ? 283 TRP D CZ3 1 
ATOM 11051 C CH2 . TRP D 1 288 ? -51.163  187.133 -52.540 1.00 0.00 ? 283 TRP D CH2 1 
ATOM 11052 N N   . SER D 1 289 ? -44.642  184.538 -50.602 1.00 0.00 ? 284 SER D N   1 
ATOM 11053 C CA  . SER D 1 289 ? -43.231  184.766 -50.380 1.00 0.00 ? 284 SER D CA  1 
ATOM 11054 C C   . SER D 1 289 ? -42.899  186.123 -50.982 1.00 0.00 ? 284 SER D C   1 
ATOM 11055 O O   . SER D 1 289 ? -43.346  186.675 -51.942 1.00 0.00 ? 284 SER D O   1 
ATOM 11056 C CB  . SER D 1 289 ? -42.364  183.663 -51.038 1.00 0.00 ? 284 SER D CB  1 
ATOM 11057 O OG  . SER D 1 289 ? -40.939  183.877 -51.002 1.00 0.00 ? 284 SER D OG  1 
ATOM 11058 N N   . ARG D 1 290 ? -41.923  186.769 -50.269 1.00 0.00 ? 285 ARG D N   1 
ATOM 11059 C CA  . ARG D 1 290 ? -41.443  188.130 -50.498 1.00 0.00 ? 285 ARG D CA  1 
ATOM 11060 C C   . ARG D 1 290 ? -40.139  188.141 -51.374 1.00 0.00 ? 285 ARG D C   1 
ATOM 11061 O O   . ARG D 1 290 ? -39.142  187.501 -51.080 1.00 0.00 ? 285 ARG D O   1 
ATOM 11062 C CB  . ARG D 1 290 ? -41.295  188.762 -49.132 1.00 0.00 ? 285 ARG D CB  1 
ATOM 11063 C CG  . ARG D 1 290 ? -41.130  190.325 -49.072 1.00 0.00 ? 285 ARG D CG  1 
ATOM 11064 C CD  . ARG D 1 290 ? -41.365  190.969 -47.717 1.00 0.00 ? 285 ARG D CD  1 
ATOM 11065 N NE  . ARG D 1 290 ? -41.351  192.447 -47.802 1.00 0.00 ? 285 ARG D NE  1 
ATOM 11066 C CZ  . ARG D 1 290 ? -42.403  193.229 -48.091 1.00 0.00 ? 285 ARG D CZ  1 
ATOM 11067 N NH1 . ARG D 1 290 ? -43.666  192.788 -48.191 1.00 0.00 ? 285 ARG D NH1 1 
ATOM 11068 N NH2 . ARG D 1 290 ? -42.251  194.543 -48.053 1.00 0.00 ? 285 ARG D NH2 1 
ATOM 11069 N N   . ARG D 1 291 ? -40.188  188.871 -52.495 1.00 0.00 ? 286 ARG D N   1 
ATOM 11070 C CA  . ARG D 1 291 ? -39.047  189.051 -53.365 1.00 0.00 ? 286 ARG D CA  1 
ATOM 11071 C C   . ARG D 1 291 ? -38.925  190.459 -53.808 1.00 0.00 ? 286 ARG D C   1 
ATOM 11072 O O   . ARG D 1 291 ? -39.838  191.275 -53.635 1.00 0.00 ? 286 ARG D O   1 
ATOM 11073 C CB  . ARG D 1 291 ? -39.052  188.053 -54.605 1.00 0.00 ? 286 ARG D CB  1 
ATOM 11074 C CG  . ARG D 1 291 ? -38.716  186.648 -54.183 1.00 0.00 ? 286 ARG D CG  1 
ATOM 11075 C CD  . ARG D 1 291 ? -37.367  186.546 -53.552 1.00 0.00 ? 286 ARG D CD  1 
ATOM 11076 N NE  . ARG D 1 291 ? -37.047  185.114 -53.189 1.00 0.00 ? 286 ARG D NE  1 
ATOM 11077 C CZ  . ARG D 1 291 ? -37.249  184.555 -51.965 1.00 0.00 ? 286 ARG D CZ  1 
ATOM 11078 N NH1 . ARG D 1 291 ? -37.719  185.264 -50.921 1.00 0.00 ? 286 ARG D NH1 1 
ATOM 11079 N NH2 . ARG D 1 291 ? -36.841  183.288 -51.799 1.00 0.00 ? 286 ARG D NH2 1 
ATOM 11080 N N   . TRP D 1 292 ? -37.692  190.790 -54.319 1.00 0.00 ? 287 TRP D N   1 
ATOM 11081 C CA  . TRP D 1 292 ? -37.391  192.217 -54.706 1.00 0.00 ? 287 TRP D CA  1 
ATOM 11082 C C   . TRP D 1 292 ? -37.526  192.259 -56.232 1.00 0.00 ? 287 TRP D C   1 
ATOM 11083 O O   . TRP D 1 292 ? -36.809  191.572 -57.006 1.00 0.00 ? 287 TRP D O   1 
ATOM 11084 C CB  . TRP D 1 292 ? -36.013  192.680 -54.146 1.00 0.00 ? 287 TRP D CB  1 
ATOM 11085 C CG  . TRP D 1 292 ? -35.537  193.997 -54.656 1.00 0.00 ? 287 TRP D CG  1 
ATOM 11086 C CD1 . TRP D 1 292 ? -35.098  194.353 -55.932 1.00 0.00 ? 287 TRP D CD1 1 
ATOM 11087 C CD2 . TRP D 1 292 ? -35.534  195.200 -53.884 1.00 0.00 ? 287 TRP D CD2 1 
ATOM 11088 N NE1 . TRP D 1 292 ? -34.600  195.704 -55.970 1.00 0.00 ? 287 TRP D NE1 1 
ATOM 11089 C CE2 . TRP D 1 292 ? -34.800  196.208 -54.653 1.00 0.00 ? 287 TRP D CE2 1 
ATOM 11090 C CE3 . TRP D 1 292 ? -35.912  195.425 -52.607 1.00 0.00 ? 287 TRP D CE3 1 
ATOM 11091 C CZ2 . TRP D 1 292 ? -34.602  197.485 -54.106 1.00 0.00 ? 287 TRP D CZ2 1 
ATOM 11092 C CZ3 . TRP D 1 292 ? -35.816  196.760 -52.077 1.00 0.00 ? 287 TRP D CZ3 1 
ATOM 11093 C CH2 . TRP D 1 292 ? -35.175  197.760 -52.805 1.00 0.00 ? 287 TRP D CH2 1 
ATOM 11094 N N   . PHE D 1 293 ? -38.437  193.117 -56.674 1.00 0.00 ? 288 PHE D N   1 
ATOM 11095 C CA  . PHE D 1 293 ? -38.881  193.339 -58.093 1.00 0.00 ? 288 PHE D CA  1 
ATOM 11096 C C   . PHE D 1 293 ? -38.469  194.664 -58.665 1.00 0.00 ? 288 PHE D C   1 
ATOM 11097 O O   . PHE D 1 293 ? -38.591  195.694 -58.006 1.00 0.00 ? 288 PHE D O   1 
ATOM 11098 C CB  . PHE D 1 293 ? -40.427  193.289 -58.158 1.00 0.00 ? 288 PHE D CB  1 
ATOM 11099 C CG  . PHE D 1 293 ? -40.985  191.920 -58.041 1.00 0.00 ? 288 PHE D CG  1 
ATOM 11100 C CD1 . PHE D 1 293 ? -41.196  191.524 -56.641 1.00 0.00 ? 288 PHE D CD1 1 
ATOM 11101 C CD2 . PHE D 1 293 ? -41.360  191.220 -59.173 1.00 0.00 ? 288 PHE D CD2 1 
ATOM 11102 C CE1 . PHE D 1 293 ? -41.872  190.332 -56.431 1.00 0.00 ? 288 PHE D CE1 1 
ATOM 11103 C CE2 . PHE D 1 293 ? -41.956  189.922 -58.866 1.00 0.00 ? 288 PHE D CE2 1 
ATOM 11104 C CZ  . PHE D 1 293 ? -42.203  189.522 -57.590 1.00 0.00 ? 288 PHE D CZ  1 
ATOM 11105 N N   . THR D 1 294 ? -38.020  194.588 -59.954 1.00 0.00 ? 289 THR D N   1 
ATOM 11106 C CA  . THR D 1 294 ? -37.624  195.757 -60.743 1.00 0.00 ? 289 THR D CA  1 
ATOM 11107 C C   . THR D 1 294 ? -38.463  195.970 -62.012 1.00 0.00 ? 289 THR D C   1 
ATOM 11108 O O   . THR D 1 294 ? -38.568  195.070 -62.735 1.00 0.00 ? 289 THR D O   1 
ATOM 11109 C CB  . THR D 1 294 ? -36.150  195.570 -61.077 1.00 0.00 ? 289 THR D CB  1 
ATOM 11110 O OG1 . THR D 1 294 ? -35.267  195.597 -59.918 1.00 0.00 ? 289 THR D OG1 1 
ATOM 11111 C CG2 . THR D 1 294 ? -35.552  196.687 -61.966 1.00 0.00 ? 289 THR D CG2 1 
ATOM 11112 N N   . ILE D 1 295 ? -38.968  197.223 -62.256 1.00 0.00 ? 290 ILE D N   1 
ATOM 11113 C CA  . ILE D 1 295 ? -39.569  197.608 -63.532 1.00 0.00 ? 290 ILE D CA  1 
ATOM 11114 C C   . ILE D 1 295 ? -38.462  198.384 -64.273 1.00 0.00 ? 290 ILE D C   1 
ATOM 11115 O O   . ILE D 1 295 ? -37.958  199.430 -63.698 1.00 0.00 ? 290 ILE D O   1 
ATOM 11116 C CB  . ILE D 1 295 ? -40.717  198.561 -63.302 1.00 0.00 ? 290 ILE D CB  1 
ATOM 11117 C CG1 . ILE D 1 295 ? -41.608  198.117 -62.075 1.00 0.00 ? 290 ILE D CG1 1 
ATOM 11118 C CG2 . ILE D 1 295 ? -41.388  198.900 -64.660 1.00 0.00 ? 290 ILE D CG2 1 
ATOM 11119 C CD1 . ILE D 1 295 ? -42.697  199.137 -61.874 1.00 0.00 ? 290 ILE D CD1 1 
ATOM 11120 N N   . GLN D 1 296 ? -38.034  197.935 -65.429 1.00 0.00 ? 291 GLN D N   1 
ATOM 11121 C CA  . GLN D 1 296 ? -37.072  198.589 -66.294 1.00 0.00 ? 291 GLN D CA  1 
ATOM 11122 C C   . GLN D 1 296 ? -37.227  198.179 -67.766 1.00 0.00 ? 291 GLN D C   1 
ATOM 11123 O O   . GLN D 1 296 ? -37.518  196.978 -68.038 1.00 0.00 ? 291 GLN D O   1 
ATOM 11124 C CB  . GLN D 1 296 ? -35.639  198.296 -65.892 1.00 0.00 ? 291 GLN D CB  1 
ATOM 11125 C CG  . GLN D 1 296 ? -35.304  196.770 -65.783 1.00 0.00 ? 291 GLN D CG  1 
ATOM 11126 C CD  . GLN D 1 296 ? -33.834  196.513 -65.514 1.00 0.00 ? 291 GLN D CD  1 
ATOM 11127 O OE1 . GLN D 1 296 ? -33.437  196.212 -64.398 1.00 0.00 ? 291 GLN D OE1 1 
ATOM 11128 N NE2 . GLN D 1 296 ? -32.998  196.577 -66.571 1.00 0.00 ? 291 GLN D NE2 1 
ATOM 11129 N N   . SER D 1 297 ? -36.993  199.081 -68.730 1.00 0.00 ? 292 SER D N   1 
ATOM 11130 C CA  . SER D 1 297 ? -37.149  198.820 -70.177 1.00 0.00 ? 292 SER D CA  1 
ATOM 11131 C C   . SER D 1 297 ? -38.280  197.998 -70.671 1.00 0.00 ? 292 SER D C   1 
ATOM 11132 O O   . SER D 1 297 ? -38.203  197.085 -71.493 1.00 0.00 ? 292 SER D O   1 
ATOM 11133 C CB  . SER D 1 297 ? -35.856  198.720 -71.053 1.00 0.00 ? 292 SER D CB  1 
ATOM 11134 O OG  . SER D 1 297 ? -34.905  199.661 -70.572 1.00 0.00 ? 292 SER D OG  1 
ATOM 11135 N N   . ASN D 1 298 ? -39.504  198.407 -70.157 1.00 0.00 ? 293 ASN D N   1 
ATOM 11136 C CA  . ASN D 1 298 ? -40.770  197.748 -70.511 1.00 0.00 ? 293 ASN D CA  1 
ATOM 11137 C C   . ASN D 1 298 ? -40.826  196.295 -70.192 1.00 0.00 ? 293 ASN D C   1 
ATOM 11138 O O   . ASN D 1 298 ? -41.388  195.532 -70.978 1.00 0.00 ? 293 ASN D O   1 
ATOM 11139 C CB  . ASN D 1 298 ? -41.203  197.974 -71.986 1.00 0.00 ? 293 ASN D CB  1 
ATOM 11140 C CG  . ASN D 1 298 ? -41.019  199.464 -72.283 1.00 0.00 ? 293 ASN D CG  1 
ATOM 11141 O OD1 . ASN D 1 298 ? -41.480  200.278 -71.470 1.00 0.00 ? 293 ASN D OD1 1 
ATOM 11142 N ND2 . ASN D 1 298 ? -40.419  199.728 -73.476 1.00 0.00 ? 293 ASN D ND2 1 
ATOM 11143 N N   . GLN D 1 299 ? -40.275  195.967 -69.013 1.00 0.00 ? 294 GLN D N   1 
ATOM 11144 C CA  . GLN D 1 299 ? -40.112  194.597 -68.507 1.00 0.00 ? 294 GLN D CA  1 
ATOM 11145 C C   . GLN D 1 299 ? -40.314  194.674 -66.971 1.00 0.00 ? 294 GLN D C   1 
ATOM 11146 O O   . GLN D 1 299 ? -40.021  195.689 -66.334 1.00 0.00 ? 294 GLN D O   1 
ATOM 11147 C CB  . GLN D 1 299 ? -38.838  193.963 -69.088 1.00 0.00 ? 294 GLN D CB  1 
ATOM 11148 C CG  . GLN D 1 299 ? -38.614  192.488 -68.754 1.00 0.00 ? 294 GLN D CG  1 
ATOM 11149 C CD  . GLN D 1 299 ? -37.538  191.893 -69.574 1.00 0.00 ? 294 GLN D CD  1 
ATOM 11150 O OE1 . GLN D 1 299 ? -36.414  191.698 -69.027 1.00 0.00 ? 294 GLN D OE1 1 
ATOM 11151 N NE2 . GLN D 1 299 ? -37.903  191.451 -70.774 1.00 0.00 ? 294 GLN D NE2 1 
ATOM 11152 N N   . LEU D 1 300 ? -40.722  193.550 -66.396 1.00 0.00 ? 295 LEU D N   1 
ATOM 11153 C CA  . LEU D 1 300 ? -40.760  193.308 -64.920 1.00 0.00 ? 295 LEU D CA  1 
ATOM 11154 C C   . LEU D 1 300 ? -39.922  192.085 -64.617 1.00 0.00 ? 295 LEU D C   1 
ATOM 11155 O O   . LEU D 1 300 ? -40.332  190.948 -65.056 1.00 0.00 ? 295 LEU D O   1 
ATOM 11156 C CB  . LEU D 1 300 ? -42.115  193.079 -64.282 1.00 0.00 ? 295 LEU D CB  1 
ATOM 11157 C CG  . LEU D 1 300 ? -42.156  193.028 -62.745 1.00 0.00 ? 295 LEU D CG  1 
ATOM 11158 C CD1 . LEU D 1 300 ? -42.342  194.348 -62.082 1.00 0.00 ? 295 LEU D CD1 1 
ATOM 11159 C CD2 . LEU D 1 300 ? -43.409  192.256 -62.292 1.00 0.00 ? 295 LEU D CD2 1 
ATOM 11160 N N   . VAL D 1 301 ? -38.798  192.217 -63.833 1.00 0.00 ? 296 VAL D N   1 
ATOM 11161 C CA  . VAL D 1 301 ? -37.955  191.064 -63.401 1.00 0.00 ? 296 VAL D CA  1 
ATOM 11162 C C   . VAL D 1 301 ? -37.965  190.931 -61.897 1.00 0.00 ? 296 VAL D C   1 
ATOM 11163 O O   . VAL D 1 301 ? -38.303  191.845 -61.192 1.00 0.00 ? 296 VAL D O   1 
ATOM 11164 C CB  . VAL D 1 301 ? -36.587  191.389 -63.941 1.00 0.00 ? 296 VAL D CB  1 
ATOM 11165 C CG1 . VAL D 1 301 ? -36.523  191.608 -65.455 1.00 0.00 ? 296 VAL D CG1 1 
ATOM 11166 C CG2 . VAL D 1 301 ? -35.738  192.408 -63.233 1.00 0.00 ? 296 VAL D CG2 1 
ATOM 11167 N N   . TYR D 1 302 ? -37.567  189.785 -61.367 1.00 0.00 ? 297 TYR D N   1 
ATOM 11168 C CA  . TYR D 1 302 ? -37.453  189.540 -59.956 1.00 0.00 ? 297 TYR D CA  1 
ATOM 11169 C C   . TYR D 1 302 ? -36.063  188.969 -59.706 1.00 0.00 ? 297 TYR D C   1 
ATOM 11170 O O   . TYR D 1 302 ? -35.409  188.134 -60.346 1.00 0.00 ? 297 TYR D O   1 
ATOM 11171 C CB  . TYR D 1 302 ? -38.718  188.756 -59.413 1.00 0.00 ? 297 TYR D CB  1 
ATOM 11172 C CG  . TYR D 1 302 ? -38.453  187.257 -59.278 1.00 0.00 ? 297 TYR D CG  1 
ATOM 11173 C CD1 . TYR D 1 302 ? -38.637  186.328 -60.308 1.00 0.00 ? 297 TYR D CD1 1 
ATOM 11174 C CD2 . TYR D 1 302 ? -37.943  186.825 -57.992 1.00 0.00 ? 297 TYR D CD2 1 
ATOM 11175 C CE1 . TYR D 1 302 ? -38.416  184.934 -59.987 1.00 0.00 ? 297 TYR D CE1 1 
ATOM 11176 C CE2 . TYR D 1 302 ? -37.605  185.537 -57.793 1.00 0.00 ? 297 TYR D CE2 1 
ATOM 11177 C CZ  . TYR D 1 302 ? -37.805  184.571 -58.826 1.00 0.00 ? 297 TYR D CZ  1 
ATOM 11178 O OH  . TYR D 1 302 ? -37.548  183.212 -58.505 1.00 0.00 ? 297 TYR D OH  1 
ATOM 11179 N N   . GLN D 1 303 ? -35.535  189.376 -58.424 1.00 0.00 ? 298 GLN D N   1 
ATOM 11180 C CA  . GLN D 1 303 ? -34.202  189.091 -58.138 1.00 0.00 ? 298 GLN D CA  1 
ATOM 11181 C C   . GLN D 1 303 ? -34.260  187.859 -57.280 1.00 0.00 ? 298 GLN D C   1 
ATOM 11182 O O   . GLN D 1 303 ? -35.127  187.681 -56.417 1.00 0.00 ? 298 GLN D O   1 
ATOM 11183 C CB  . GLN D 1 303 ? -33.593  190.301 -57.344 1.00 0.00 ? 298 GLN D CB  1 
ATOM 11184 C CG  . GLN D 1 303 ? -32.194  190.153 -56.816 1.00 0.00 ? 298 GLN D CG  1 
ATOM 11185 C CD  . GLN D 1 303 ? -31.648  191.575 -56.422 1.00 0.00 ? 298 GLN D CD  1 
ATOM 11186 O OE1 . GLN D 1 303 ? -30.872  192.263 -57.102 1.00 0.00 ? 298 GLN D OE1 1 
ATOM 11187 N NE2 . GLN D 1 303 ? -31.941  191.922 -55.127 1.00 0.00 ? 298 GLN D NE2 1 
ATOM 11188 N N   . LYS D 1 304 ? -33.357  186.927 -57.531 1.00 0.00 ? 299 LYS D N   1 
ATOM 11189 C CA  . LYS D 1 304 ? -33.392  185.613 -56.921 1.00 0.00 ? 299 LYS D CA  1 
ATOM 11190 C C   . LYS D 1 304 ? -32.301  185.422 -55.848 1.00 0.00 ? 299 LYS D C   1 
ATOM 11191 O O   . LYS D 1 304 ? -32.563  184.658 -54.893 1.00 0.00 ? 299 LYS D O   1 
ATOM 11192 C CB  . LYS D 1 304 ? -33.418  184.492 -58.068 1.00 0.00 ? 299 LYS D CB  1 
ATOM 11193 C CG  . LYS D 1 304 ? -32.154  184.095 -58.781 1.00 0.00 ? 299 LYS D CG  1 
ATOM 11194 C CD  . LYS D 1 304 ? -32.422  183.433 -60.075 1.00 0.00 ? 299 LYS D CD  1 
ATOM 11195 C CE  . LYS D 1 304 ? -31.180  182.836 -60.798 1.00 0.00 ? 299 LYS D CE  1 
ATOM 11196 N NZ  . LYS D 1 304 ? -30.059  183.762 -61.128 1.00 0.00 ? 299 LYS D NZ  1 
ATOM 11197 N N   . LYS D 1 305 ? -31.197  186.104 -55.906 1.00 0.00 ? 300 LYS D N   1 
ATOM 11198 C CA  . LYS D 1 305 ? -30.265  186.379 -54.885 1.00 0.00 ? 300 LYS D CA  1 
ATOM 11199 C C   . LYS D 1 305 ? -29.545  187.753 -55.172 1.00 0.00 ? 300 LYS D C   1 
ATOM 11200 O O   . LYS D 1 305 ? -29.508  188.168 -56.300 1.00 0.00 ? 300 LYS D O   1 
ATOM 11201 C CB  . LYS D 1 305 ? -29.331  185.115 -54.754 1.00 0.00 ? 300 LYS D CB  1 
ATOM 11202 C CG  . LYS D 1 305 ? -28.170  185.226 -53.821 1.00 0.00 ? 300 LYS D CG  1 
ATOM 11203 C CD  . LYS D 1 305 ? -27.202  183.971 -53.840 1.00 0.00 ? 300 LYS D CD  1 
ATOM 11204 C CE  . LYS D 1 305 ? -25.906  184.121 -53.007 1.00 0.00 ? 300 LYS D CE  1 
ATOM 11205 N NZ  . LYS D 1 305 ? -25.122  182.867 -53.126 1.00 0.00 ? 300 LYS D NZ  1 
ATOM 11206 N N   . TYR D 1 306 ? -28.943  188.353 -54.135 1.00 0.00 ? 301 TYR D N   1 
ATOM 11207 C CA  . TYR D 1 306 ? -28.150  189.565 -54.313 1.00 0.00 ? 301 TYR D CA  1 
ATOM 11208 C C   . TYR D 1 306 ? -26.877  189.244 -55.086 1.00 0.00 ? 301 TYR D C   1 
ATOM 11209 O O   . TYR D 1 306 ? -26.148  188.293 -54.812 1.00 0.00 ? 301 TYR D O   1 
ATOM 11210 C CB  . TYR D 1 306 ? -27.873  190.166 -52.964 1.00 0.00 ? 301 TYR D CB  1 
ATOM 11211 C CG  . TYR D 1 306 ? -27.211  191.502 -52.979 1.00 0.00 ? 301 TYR D CG  1 
ATOM 11212 C CD1 . TYR D 1 306 ? -27.815  192.599 -53.579 1.00 0.00 ? 301 TYR D CD1 1 
ATOM 11213 C CD2 . TYR D 1 306 ? -25.930  191.732 -52.432 1.00 0.00 ? 301 TYR D CD2 1 
ATOM 11214 C CE1 . TYR D 1 306 ? -27.260  193.917 -53.622 1.00 0.00 ? 301 TYR D CE1 1 
ATOM 11215 C CE2 . TYR D 1 306 ? -25.335  193.002 -52.511 1.00 0.00 ? 301 TYR D CE2 1 
ATOM 11216 C CZ  . TYR D 1 306 ? -25.981  194.063 -53.095 1.00 0.00 ? 301 TYR D CZ  1 
ATOM 11217 O OH  . TYR D 1 306 ? -25.382  195.295 -53.310 1.00 0.00 ? 301 TYR D OH  1 
ATOM 11218 N N   . LYS D 1 307 ? -26.548  190.092 -56.116 1.00 0.00 ? 302 LYS D N   1 
ATOM 11219 C CA  . LYS D 1 307 ? -25.399  189.801 -56.983 1.00 0.00 ? 302 LYS D CA  1 
ATOM 11220 C C   . LYS D 1 307 ? -25.477  188.482 -57.729 1.00 0.00 ? 302 LYS D C   1 
ATOM 11221 O O   . LYS D 1 307 ? -24.531  187.679 -57.652 1.00 0.00 ? 302 LYS D O   1 
ATOM 11222 C CB  . LYS D 1 307 ? -24.021  189.894 -56.306 1.00 0.00 ? 302 LYS D CB  1 
ATOM 11223 C CG  . LYS D 1 307 ? -23.861  191.290 -55.687 1.00 0.00 ? 302 LYS D CG  1 
ATOM 11224 C CD  . LYS D 1 307 ? -23.899  192.428 -56.700 1.00 0.00 ? 302 LYS D CD  1 
ATOM 11225 C CE  . LYS D 1 307 ? -23.661  193.782 -56.032 1.00 0.00 ? 302 LYS D CE  1 
ATOM 11226 N NZ  . LYS D 1 307 ? -23.507  194.830 -57.077 1.00 0.00 ? 302 LYS D NZ  1 
ATOM 11227 N N   . ASP D 1 308 ? -26.607  188.153 -58.388 1.00 0.00 ? 303 ASP D N   1 
ATOM 11228 C CA  . ASP D 1 308 ? -26.689  186.940 -59.172 1.00 0.00 ? 303 ASP D CA  1 
ATOM 11229 C C   . ASP D 1 308 ? -27.674  187.208 -60.328 1.00 0.00 ? 303 ASP D C   1 
ATOM 11230 O O   . ASP D 1 308 ? -28.519  188.037 -59.991 1.00 0.00 ? 303 ASP D O   1 
ATOM 11231 C CB  . ASP D 1 308 ? -27.409  185.967 -58.092 1.00 0.00 ? 303 ASP D CB  1 
ATOM 11232 C CG  . ASP D 1 308 ? -27.662  184.497 -58.511 1.00 0.00 ? 303 ASP D CG  1 
ATOM 11233 O OD1 . ASP D 1 308 ? -26.677  183.745 -58.587 1.00 0.00 ? 303 ASP D OD1 1 
ATOM 11234 O OD2 . ASP D 1 308 ? -28.808  184.126 -58.935 1.00 0.00 ? 303 ASP D OD2 1 
ATOM 11235 N N   . PRO D 1 309 ? -27.676  186.716 -61.563 1.00 0.00 ? 304 PRO D N   1 
ATOM 11236 C CA  . PRO D 1 309 ? -28.647  187.005 -62.621 1.00 0.00 ? 304 PRO D CA  1 
ATOM 11237 C C   . PRO D 1 309 ? -30.158  187.017 -62.166 1.00 0.00 ? 304 PRO D C   1 
ATOM 11238 O O   . PRO D 1 309 ? -30.560  186.346 -61.205 1.00 0.00 ? 304 PRO D O   1 
ATOM 11239 C CB  . PRO D 1 309 ? -28.404  185.747 -63.501 1.00 0.00 ? 304 PRO D CB  1 
ATOM 11240 C CG  . PRO D 1 309 ? -26.898  185.547 -63.388 1.00 0.00 ? 304 PRO D CG  1 
ATOM 11241 C CD  . PRO D 1 309 ? -26.505  185.895 -61.955 1.00 0.00 ? 304 PRO D CD  1 
ATOM 11242 N N   . VAL D 1 310 ? -31.039  187.870 -62.800 1.00 0.00 ? 305 VAL D N   1 
ATOM 11243 C CA  . VAL D 1 310 ? -32.419  188.069 -62.448 1.00 0.00 ? 305 VAL D CA  1 
ATOM 11244 C C   . VAL D 1 310 ? -33.238  187.041 -63.256 1.00 0.00 ? 305 VAL D C   1 
ATOM 11245 O O   . VAL D 1 310 ? -32.716  186.499 -64.229 1.00 0.00 ? 305 VAL D O   1 
ATOM 11246 C CB  . VAL D 1 310 ? -32.930  189.419 -62.738 1.00 0.00 ? 305 VAL D CB  1 
ATOM 11247 C CG1 . VAL D 1 310 ? -32.296  190.440 -61.803 1.00 0.00 ? 305 VAL D CG1 1 
ATOM 11248 C CG2 . VAL D 1 310 ? -32.815  189.863 -64.229 1.00 0.00 ? 305 VAL D CG2 1 
ATOM 11249 N N   . THR D 1 311 ? -34.567  186.838 -62.902 1.00 0.00 ? 306 THR D N   1 
ATOM 11250 C CA  . THR D 1 311 ? -35.521  186.035 -63.705 1.00 0.00 ? 306 THR D CA  1 
ATOM 11251 C C   . THR D 1 311 ? -36.680  186.999 -64.106 1.00 0.00 ? 306 THR D C   1 
ATOM 11252 O O   . THR D 1 311 ? -37.049  187.873 -63.290 1.00 0.00 ? 306 THR D O   1 
ATOM 11253 C CB  . THR D 1 311 ? -35.970  184.802 -62.902 1.00 0.00 ? 306 THR D CB  1 
ATOM 11254 O OG1 . THR D 1 311 ? -34.849  183.967 -62.645 1.00 0.00 ? 306 THR D OG1 1 
ATOM 11255 C CG2 . THR D 1 311 ? -37.041  183.990 -63.641 1.00 0.00 ? 306 THR D CG2 1 
ATOM 11256 N N   . VAL D 1 312 ? -37.138  186.941 -65.387 1.00 0.00 ? 307 VAL D N   1 
ATOM 11257 C CA  . VAL D 1 312 ? -38.274  187.664 -65.972 1.00 0.00 ? 307 VAL D CA  1 
ATOM 11258 C C   . VAL D 1 312 ? -39.666  187.192 -65.347 1.00 0.00 ? 307 VAL D C   1 
ATOM 11259 O O   . VAL D 1 312 ? -39.794  186.002 -65.030 1.00 0.00 ? 307 VAL D O   1 
ATOM 11260 C CB  . VAL D 1 312 ? -38.351  187.751 -67.537 1.00 0.00 ? 307 VAL D CB  1 
ATOM 11261 C CG1 . VAL D 1 312 ? -39.595  188.467 -68.055 1.00 0.00 ? 307 VAL D CG1 1 
ATOM 11262 C CG2 . VAL D 1 312 ? -37.033  188.315 -67.988 1.00 0.00 ? 307 VAL D CG2 1 
ATOM 11263 N N   . VAL D 1 313 ? -40.622  188.142 -65.003 1.00 0.00 ? 308 VAL D N   1 
ATOM 11264 C CA  . VAL D 1 313 ? -41.882  187.813 -64.456 1.00 0.00 ? 308 VAL D CA  1 
ATOM 11265 C C   . VAL D 1 313 ? -42.949  188.029 -65.555 1.00 0.00 ? 308 VAL D C   1 
ATOM 11266 O O   . VAL D 1 313 ? -43.813  187.120 -65.715 1.00 0.00 ? 308 VAL D O   1 
ATOM 11267 C CB  . VAL D 1 313 ? -42.222  188.754 -63.286 1.00 0.00 ? 308 VAL D CB  1 
ATOM 11268 C CG1 . VAL D 1 313 ? -43.559  188.427 -62.757 1.00 0.00 ? 308 VAL D CG1 1 
ATOM 11269 C CG2 . VAL D 1 313 ? -41.176  188.485 -62.238 1.00 0.00 ? 308 VAL D CG2 1 
ATOM 11270 N N   . VAL D 1 314 ? -42.810  189.112 -66.294 1.00 0.00 ? 309 VAL D N   1 
ATOM 11271 C CA  . VAL D 1 314 ? -43.704  189.261 -67.475 1.00 0.00 ? 309 VAL D CA  1 
ATOM 11272 C C   . VAL D 1 314 ? -42.804  189.664 -68.596 1.00 0.00 ? 309 VAL D C   1 
ATOM 11273 O O   . VAL D 1 314 ? -41.946  190.517 -68.349 1.00 0.00 ? 309 VAL D O   1 
ATOM 11274 C CB  . VAL D 1 314 ? -44.901  190.271 -67.321 1.00 0.00 ? 309 VAL D CB  1 
ATOM 11275 C CG1 . VAL D 1 314 ? -45.875  189.715 -66.326 1.00 0.00 ? 309 VAL D CG1 1 
ATOM 11276 C CG2 . VAL D 1 314 ? -44.495  191.655 -66.828 1.00 0.00 ? 309 VAL D CG2 1 
ATOM 11277 N N   . ASP D 1 315 ? -42.861  189.062 -69.780 1.00 0.00 ? 310 ASP D N   1 
ATOM 11278 C CA  . ASP D 1 315 ? -41.997  189.310 -70.927 1.00 0.00 ? 310 ASP D CA  1 
ATOM 11279 C C   . ASP D 1 315 ? -41.993  190.767 -71.440 1.00 0.00 ? 310 ASP D C   1 
ATOM 11280 O O   . ASP D 1 315 ? -40.998  191.350 -71.792 1.00 0.00 ? 310 ASP D O   1 
ATOM 11281 C CB  . ASP D 1 315 ? -42.572  188.514 -72.128 1.00 0.00 ? 310 ASP D CB  1 
ATOM 11282 C CG  . ASP D 1 315 ? -42.160  186.988 -72.132 1.00 0.00 ? 310 ASP D CG  1 
ATOM 11283 O OD1 . ASP D 1 315 ? -41.427  186.574 -71.203 1.00 0.00 ? 310 ASP D OD1 1 
ATOM 11284 O OD2 . ASP D 1 315 ? -42.636  186.231 -73.025 1.00 0.00 ? 310 ASP D OD2 1 
ATOM 11285 N N   . ASP D 1 316 ? -43.184  191.326 -71.569 1.00 0.00 ? 311 ASP D N   1 
ATOM 11286 C CA  . ASP D 1 316 ? -43.437  192.746 -71.902 1.00 0.00 ? 311 ASP D CA  1 
ATOM 11287 C C   . ASP D 1 316 ? -44.567  193.429 -71.084 1.00 0.00 ? 311 ASP D C   1 
ATOM 11288 O O   . ASP D 1 316 ? -45.503  192.691 -70.672 1.00 0.00 ? 311 ASP D O   1 
ATOM 11289 C CB  . ASP D 1 316 ? -43.815  192.838 -73.378 1.00 0.00 ? 311 ASP D CB  1 
ATOM 11290 C CG  . ASP D 1 316 ? -43.347  194.162 -74.081 1.00 0.00 ? 311 ASP D CG  1 
ATOM 11291 O OD1 . ASP D 1 316 ? -43.867  195.218 -73.761 1.00 0.00 ? 311 ASP D OD1 1 
ATOM 11292 O OD2 . ASP D 1 316 ? -42.479  194.063 -74.976 1.00 0.00 ? 311 ASP D OD2 1 
ATOM 11293 N N   . LEU D 1 317 ? -44.460  194.819 -70.828 1.00 0.00 ? 312 LEU D N   1 
ATOM 11294 C CA  . LEU D 1 317 ? -45.452  195.549 -70.065 1.00 0.00 ? 312 LEU D CA  1 
ATOM 11295 C C   . LEU D 1 317 ? -46.427  196.281 -70.915 1.00 0.00 ? 312 LEU D C   1 
ATOM 11296 O O   . LEU D 1 317 ? -47.561  196.513 -70.491 1.00 0.00 ? 312 LEU D O   1 
ATOM 11297 C CB  . LEU D 1 317 ? -44.922  196.423 -68.924 1.00 0.00 ? 312 LEU D CB  1 
ATOM 11298 C CG  . LEU D 1 317 ? -43.998  195.745 -67.917 1.00 0.00 ? 312 LEU D CG  1 
ATOM 11299 C CD1 . LEU D 1 317 ? -43.327  196.937 -67.148 1.00 0.00 ? 312 LEU D CD1 1 
ATOM 11300 C CD2 . LEU D 1 317 ? -44.868  194.954 -66.918 1.00 0.00 ? 312 LEU D CD2 1 
ATOM 11301 N N   . ARG D 1 318 ? -46.118  196.356 -72.255 1.00 0.00 ? 313 ARG D N   1 
ATOM 11302 C CA  . ARG D 1 318 ? -46.942  197.187 -73.196 1.00 0.00 ? 313 ARG D CA  1 
ATOM 11303 C C   . ARG D 1 318 ? -48.147  196.280 -73.621 1.00 0.00 ? 313 ARG D C   1 
ATOM 11304 O O   . ARG D 1 318 ? -49.247  196.660 -74.060 1.00 0.00 ? 313 ARG D O   1 
ATOM 11305 C CB  . ARG D 1 318 ? -45.941  197.371 -74.385 1.00 0.00 ? 313 ARG D CB  1 
ATOM 11306 C CG  . ARG D 1 318 ? -44.815  198.297 -73.859 1.00 0.00 ? 313 ARG D CG  1 
ATOM 11307 C CD  . ARG D 1 318 ? -43.721  198.527 -74.957 1.00 0.00 ? 313 ARG D CD  1 
ATOM 11308 N NE  . ARG D 1 318 ? -42.840  197.392 -75.007 1.00 0.00 ? 313 ARG D NE  1 
ATOM 11309 C CZ  . ARG D 1 318 ? -41.796  197.246 -75.816 1.00 0.00 ? 313 ARG D CZ  1 
ATOM 11310 N NH1 . ARG D 1 318 ? -41.263  198.321 -76.369 1.00 0.00 ? 313 ARG D NH1 1 
ATOM 11311 N NH2 . ARG D 1 318 ? -41.109  196.115 -75.958 1.00 0.00 ? 313 ARG D NH2 1 
ATOM 11312 N N   . LEU D 1 319 ? -47.962  194.992 -73.349 1.00 0.00 ? 314 LEU D N   1 
ATOM 11313 C CA  . LEU D 1 319 ? -48.949  193.927 -73.566 1.00 0.00 ? 314 LEU D CA  1 
ATOM 11314 C C   . LEU D 1 319 ? -49.617  193.411 -72.255 1.00 0.00 ? 314 LEU D C   1 
ATOM 11315 O O   . LEU D 1 319 ? -50.345  192.387 -72.267 1.00 0.00 ? 314 LEU D O   1 
ATOM 11316 C CB  . LEU D 1 319 ? -48.273  192.688 -74.277 1.00 0.00 ? 314 LEU D CB  1 
ATOM 11317 C CG  . LEU D 1 319 ? -47.487  193.030 -75.606 1.00 0.00 ? 314 LEU D CG  1 
ATOM 11318 C CD1 . LEU D 1 319 ? -46.817  191.748 -76.081 1.00 0.00 ? 314 LEU D CD1 1 
ATOM 11319 C CD2 . LEU D 1 319 ? -48.297  193.572 -76.784 1.00 0.00 ? 314 LEU D CD2 1 
ATOM 11320 N N   . CYS D 1 320 ? -49.427  194.067 -71.158 1.00 0.00 ? 315 CYS D N   1 
ATOM 11321 C CA  . CYS D 1 320 ? -50.006  193.764 -69.875 1.00 0.00 ? 315 CYS D CA  1 
ATOM 11322 C C   . CYS D 1 320 ? -51.396  194.615 -69.745 1.00 0.00 ? 315 CYS D C   1 
ATOM 11323 O O   . CYS D 1 320 ? -51.598  195.523 -70.547 1.00 0.00 ? 315 CYS D O   1 
ATOM 11324 C CB  . CYS D 1 320 ? -48.985  194.098 -68.723 1.00 0.00 ? 315 CYS D CB  1 
ATOM 11325 S SG  . CYS D 1 320 ? -49.186  193.159 -67.197 1.00 0.00 ? 315 CYS D SG  1 
ATOM 11326 N N   . THR D 1 321 ? -52.229  194.146 -68.751 1.00 0.00 ? 316 THR D N   1 
ATOM 11327 C CA  . THR D 1 321 ? -53.376  194.834 -68.086 1.00 0.00 ? 316 THR D CA  1 
ATOM 11328 C C   . THR D 1 321 ? -53.165  194.689 -66.605 1.00 0.00 ? 316 THR D C   1 
ATOM 11329 O O   . THR D 1 321 ? -52.415  193.851 -66.126 1.00 0.00 ? 316 THR D O   1 
ATOM 11330 C CB  . THR D 1 321 ? -54.654  194.322 -68.565 1.00 0.00 ? 316 THR D CB  1 
ATOM 11331 O OG1 . THR D 1 321 ? -55.706  195.181 -68.189 1.00 0.00 ? 316 THR D OG1 1 
ATOM 11332 C CG2 . THR D 1 321 ? -54.999  192.892 -68.155 1.00 0.00 ? 316 THR D CG2 1 
ATOM 11333 N N   . VAL D 1 322 ? -53.832  195.615 -65.821 1.00 0.00 ? 317 VAL D N   1 
ATOM 11334 C CA  . VAL D 1 322 ? -53.524  195.774 -64.406 1.00 0.00 ? 317 VAL D CA  1 
ATOM 11335 C C   . VAL D 1 322 ? -54.804  195.838 -63.585 1.00 0.00 ? 317 VAL D C   1 
ATOM 11336 O O   . VAL D 1 322 ? -55.635  196.786 -63.726 1.00 0.00 ? 317 VAL D O   1 
ATOM 11337 C CB  . VAL D 1 322 ? -52.504  196.920 -64.070 1.00 0.00 ? 317 VAL D CB  1 
ATOM 11338 C CG1 . VAL D 1 322 ? -53.038  198.369 -64.385 1.00 0.00 ? 317 VAL D CG1 1 
ATOM 11339 C CG2 . VAL D 1 322 ? -52.111  196.921 -62.677 1.00 0.00 ? 317 VAL D CG2 1 
ATOM 11340 N N   . LYS D 1 323 ? -54.939  194.806 -62.719 1.00 0.00 ? 318 LYS D N   1 
ATOM 11341 C CA  . LYS D 1 323 ? -56.157  194.486 -61.959 1.00 0.00 ? 318 LYS D CA  1 
ATOM 11342 C C   . LYS D 1 323 ? -56.150  195.039 -60.604 1.00 0.00 ? 318 LYS D C   1 
ATOM 11343 O O   . LYS D 1 323 ? -55.217  194.828 -59.783 1.00 0.00 ? 318 LYS D O   1 
ATOM 11344 C CB  . LYS D 1 323 ? -56.287  192.946 -61.881 1.00 0.00 ? 318 LYS D CB  1 
ATOM 11345 C CG  . LYS D 1 323 ? -56.620  192.334 -63.172 1.00 0.00 ? 318 LYS D CG  1 
ATOM 11346 C CD  . LYS D 1 323 ? -56.799  190.876 -62.989 1.00 0.00 ? 318 LYS D CD  1 
ATOM 11347 C CE  . LYS D 1 323 ? -57.412  190.164 -64.224 1.00 0.00 ? 318 LYS D CE  1 
ATOM 11348 N NZ  . LYS D 1 323 ? -57.548  188.693 -63.833 1.00 0.00 ? 318 LYS D NZ  1 
ATOM 11349 N N   . LEU D 1 324 ? -57.143  195.895 -60.256 1.00 0.00 ? 319 LEU D N   1 
ATOM 11350 C CA  . LEU D 1 324 ? -57.148  196.579 -58.985 1.00 0.00 ? 319 LEU D CA  1 
ATOM 11351 C C   . LEU D 1 324 ? -58.051  195.799 -57.969 1.00 0.00 ? 319 LEU D C   1 
ATOM 11352 O O   . LEU D 1 324 ? -58.182  196.193 -56.794 1.00 0.00 ? 319 LEU D O   1 
ATOM 11353 C CB  . LEU D 1 324 ? -57.900  197.969 -59.044 1.00 0.00 ? 319 LEU D CB  1 
ATOM 11354 C CG  . LEU D 1 324 ? -57.008  199.075 -59.749 1.00 0.00 ? 319 LEU D CG  1 
ATOM 11355 C CD1 . LEU D 1 324 ? -57.919  199.988 -60.585 1.00 0.00 ? 319 LEU D CD1 1 
ATOM 11356 C CD2 . LEU D 1 324 ? -56.300  199.869 -58.645 1.00 0.00 ? 319 LEU D CD2 1 
ATOM 11357 N N   . CYS D 1 325 ? -58.566  194.719 -58.421 1.00 0.00 ? 320 CYS D N   1 
ATOM 11358 C CA  . CYS D 1 325 ? -59.077  193.703 -57.572 1.00 0.00 ? 320 CYS D CA  1 
ATOM 11359 C C   . CYS D 1 325 ? -60.026  194.121 -56.462 1.00 0.00 ? 320 CYS D C   1 
ATOM 11360 O O   . CYS D 1 325 ? -59.658  193.819 -55.295 1.00 0.00 ? 320 CYS D O   1 
ATOM 11361 C CB  . CYS D 1 325 ? -57.812  192.960 -56.949 1.00 0.00 ? 320 CYS D CB  1 
ATOM 11362 S SG  . CYS D 1 325 ? -56.886  192.044 -58.238 1.00 0.00 ? 320 CYS D SG  1 
ATOM 11363 N N   . PRO D 1 326 ? -61.154  194.709 -56.659 1.00 0.00 ? 321 PRO D N   1 
ATOM 11364 C CA  . PRO D 1 326 ? -61.904  195.318 -55.554 1.00 0.00 ? 321 PRO D CA  1 
ATOM 11365 C C   . PRO D 1 326 ? -62.714  194.189 -54.807 1.00 0.00 ? 321 PRO D C   1 
ATOM 11366 O O   . PRO D 1 326 ? -63.172  194.431 -53.664 1.00 0.00 ? 321 PRO D O   1 
ATOM 11367 C CB  . PRO D 1 326 ? -62.871  196.251 -56.389 1.00 0.00 ? 321 PRO D CB  1 
ATOM 11368 C CG  . PRO D 1 326 ? -63.084  195.520 -57.713 1.00 0.00 ? 321 PRO D CG  1 
ATOM 11369 C CD  . PRO D 1 326 ? -61.733  194.920 -58.032 1.00 0.00 ? 321 PRO D CD  1 
ATOM 11370 N N   . ASP D 1 327 ? -63.036  193.045 -55.468 1.00 0.00 ? 322 ASP D N   1 
ATOM 11371 C CA  . ASP D 1 327 ? -63.831  192.006 -54.905 1.00 0.00 ? 322 ASP D CA  1 
ATOM 11372 C C   . ASP D 1 327 ? -62.951  190.867 -54.274 1.00 0.00 ? 322 ASP D C   1 
ATOM 11373 O O   . ASP D 1 327 ? -63.583  189.909 -53.701 1.00 0.00 ? 322 ASP D O   1 
ATOM 11374 C CB  . ASP D 1 327 ? -64.679  191.501 -56.090 1.00 0.00 ? 322 ASP D CB  1 
ATOM 11375 C CG  . ASP D 1 327 ? -65.843  192.342 -56.489 1.00 0.00 ? 322 ASP D CG  1 
ATOM 11376 O OD1 . ASP D 1 327 ? -66.702  192.508 -55.570 1.00 0.00 ? 322 ASP D OD1 1 
ATOM 11377 O OD2 . ASP D 1 327 ? -65.909  192.847 -57.666 1.00 0.00 ? 322 ASP D OD2 1 
ATOM 11378 N N   . SER D 1 328 ? -61.612  190.918 -54.456 1.00 0.00 ? 323 SER D N   1 
ATOM 11379 C CA  . SER D 1 328 ? -60.772  190.006 -53.727 1.00 0.00 ? 323 SER D CA  1 
ATOM 11380 C C   . SER D 1 328 ? -60.813  190.057 -52.156 1.00 0.00 ? 323 SER D C   1 
ATOM 11381 O O   . SER D 1 328 ? -60.962  191.089 -51.513 1.00 0.00 ? 323 SER D O   1 
ATOM 11382 C CB  . SER D 1 328 ? -59.299  190.172 -54.271 1.00 0.00 ? 323 SER D CB  1 
ATOM 11383 O OG  . SER D 1 328 ? -58.334  189.269 -53.672 1.00 0.00 ? 323 SER D OG  1 
ATOM 11384 N N   . GLU D 1 329 ? -60.581  188.924 -51.559 1.00 0.00 ? 324 GLU D N   1 
ATOM 11385 C CA  . GLU D 1 329 ? -60.445  188.746 -50.087 1.00 0.00 ? 324 GLU D CA  1 
ATOM 11386 C C   . GLU D 1 329 ? -59.112  189.310 -49.609 1.00 0.00 ? 324 GLU D C   1 
ATOM 11387 O O   . GLU D 1 329 ? -59.037  190.051 -48.625 1.00 0.00 ? 324 GLU D O   1 
ATOM 11388 C CB  . GLU D 1 329 ? -60.336  187.226 -49.709 1.00 0.00 ? 324 GLU D CB  1 
ATOM 11389 C CG  . GLU D 1 329 ? -60.235  186.877 -48.205 1.00 0.00 ? 324 GLU D CG  1 
ATOM 11390 C CD  . GLU D 1 329 ? -61.596  186.747 -47.577 1.00 0.00 ? 324 GLU D CD  1 
ATOM 11391 O OE1 . GLU D 1 329 ? -62.499  187.613 -47.736 1.00 0.00 ? 324 GLU D OE1 1 
ATOM 11392 O OE2 . GLU D 1 329 ? -61.750  185.703 -46.915 1.00 0.00 ? 324 GLU D OE2 1 
ATOM 11393 N N   . ARG D 1 330 ? -57.996  189.053 -50.375 1.00 0.00 ? 325 ARG D N   1 
ATOM 11394 C CA  . ARG D 1 330 ? -56.701  189.470 -50.104 1.00 0.00 ? 325 ARG D CA  1 
ATOM 11395 C C   . ARG D 1 330 ? -56.574  190.982 -50.141 1.00 0.00 ? 325 ARG D C   1 
ATOM 11396 O O   . ARG D 1 330 ? -57.118  191.586 -51.052 1.00 0.00 ? 325 ARG D O   1 
ATOM 11397 C CB  . ARG D 1 330 ? -55.792  188.672 -51.179 1.00 0.00 ? 325 ARG D CB  1 
ATOM 11398 C CG  . ARG D 1 330 ? -54.278  188.435 -51.030 1.00 0.00 ? 325 ARG D CG  1 
ATOM 11399 C CD  . ARG D 1 330 ? -54.042  187.530 -49.791 1.00 0.00 ? 325 ARG D CD  1 
ATOM 11400 N NE  . ARG D 1 330 ? -52.591  187.619 -49.272 1.00 0.00 ? 325 ARG D NE  1 
ATOM 11401 C CZ  . ARG D 1 330 ? -52.077  186.863 -48.262 1.00 0.00 ? 325 ARG D CZ  1 
ATOM 11402 N NH1 . ARG D 1 330 ? -52.706  185.917 -47.628 1.00 0.00 ? 325 ARG D NH1 1 
ATOM 11403 N NH2 . ARG D 1 330 ? -50.816  187.141 -47.938 1.00 0.00 ? 325 ARG D NH2 1 
ATOM 11404 N N   . ARG D 1 331 ? -55.731  191.597 -49.209 1.00 0.00 ? 326 ARG D N   1 
ATOM 11405 C CA  . ARG D 1 331 ? -55.666  192.984 -48.977 1.00 0.00 ? 326 ARG D CA  1 
ATOM 11406 C C   . ARG D 1 331 ? -54.447  193.637 -49.683 1.00 0.00 ? 326 ARG D C   1 
ATOM 11407 O O   . ARG D 1 331 ? -53.368  193.081 -49.539 1.00 0.00 ? 326 ARG D O   1 
ATOM 11408 C CB  . ARG D 1 331 ? -55.444  193.222 -47.427 1.00 0.00 ? 326 ARG D CB  1 
ATOM 11409 C CG  . ARG D 1 331 ? -55.537  194.685 -47.102 1.00 0.00 ? 326 ARG D CG  1 
ATOM 11410 C CD  . ARG D 1 331 ? -55.705  194.992 -45.604 1.00 0.00 ? 326 ARG D CD  1 
ATOM 11411 N NE  . ARG D 1 331 ? -54.385  194.627 -44.962 1.00 0.00 ? 326 ARG D NE  1 
ATOM 11412 C CZ  . ARG D 1 331 ? -53.662  195.268 -43.982 1.00 0.00 ? 326 ARG D CZ  1 
ATOM 11413 N NH1 . ARG D 1 331 ? -54.204  196.221 -43.303 1.00 0.00 ? 326 ARG D NH1 1 
ATOM 11414 N NH2 . ARG D 1 331 ? -52.435  194.960 -43.758 1.00 0.00 ? 326 ARG D NH2 1 
ATOM 11415 N N   . PHE D 1 332 ? -54.551  194.770 -50.387 1.00 0.00 ? 327 PHE D N   1 
ATOM 11416 C CA  . PHE D 1 332 ? -53.491  195.591 -50.941 1.00 0.00 ? 327 PHE D CA  1 
ATOM 11417 C C   . PHE D 1 332 ? -52.959  194.837 -52.133 1.00 0.00 ? 327 PHE D C   1 
ATOM 11418 O O   . PHE D 1 332 ? -51.803  195.031 -52.547 1.00 0.00 ? 327 PHE D O   1 
ATOM 11419 C CB  . PHE D 1 332 ? -52.266  195.917 -50.015 1.00 0.00 ? 327 PHE D CB  1 
ATOM 11420 C CG  . PHE D 1 332 ? -52.626  196.730 -48.732 1.00 0.00 ? 327 PHE D CG  1 
ATOM 11421 C CD1 . PHE D 1 332 ? -53.751  197.539 -48.618 1.00 0.00 ? 327 PHE D CD1 1 
ATOM 11422 C CD2 . PHE D 1 332 ? -51.731  196.610 -47.655 1.00 0.00 ? 327 PHE D CD2 1 
ATOM 11423 C CE1 . PHE D 1 332 ? -54.020  198.051 -47.348 1.00 0.00 ? 327 PHE D CE1 1 
ATOM 11424 C CE2 . PHE D 1 332 ? -52.035  197.165 -46.419 1.00 0.00 ? 327 PHE D CE2 1 
ATOM 11425 C CZ  . PHE D 1 332 ? -53.186  197.872 -46.201 1.00 0.00 ? 327 PHE D CZ  1 
ATOM 11426 N N   . CYS D 1 333 ? -53.733  193.955 -52.758 1.00 0.00 ? 328 CYS D N   1 
ATOM 11427 C CA  . CYS D 1 333 ? -53.242  193.162 -53.889 1.00 0.00 ? 328 CYS D CA  1 
ATOM 11428 C C   . CYS D 1 333 ? -53.589  193.687 -55.241 1.00 0.00 ? 328 CYS D C   1 
ATOM 11429 O O   . CYS D 1 333 ? -54.592  194.372 -55.474 1.00 0.00 ? 328 CYS D O   1 
ATOM 11430 C CB  . CYS D 1 333 ? -53.861  191.741 -53.776 1.00 0.00 ? 328 CYS D CB  1 
ATOM 11431 S SG  . CYS D 1 333 ? -55.633  191.586 -53.774 1.00 0.00 ? 328 CYS D SG  1 
ATOM 11432 N N   . PHE D 1 334 ? -52.771  193.349 -56.230 1.00 0.00 ? 329 PHE D N   1 
ATOM 11433 C CA  . PHE D 1 334 ? -53.059  193.651 -57.637 1.00 0.00 ? 329 PHE D CA  1 
ATOM 11434 C C   . PHE D 1 334 ? -52.699  192.426 -58.406 1.00 0.00 ? 329 PHE D C   1 
ATOM 11435 O O   . PHE D 1 334 ? -51.897  191.536 -57.931 1.00 0.00 ? 329 PHE D O   1 
ATOM 11436 C CB  . PHE D 1 334 ? -52.318  194.949 -58.235 1.00 0.00 ? 329 PHE D CB  1 
ATOM 11437 C CG  . PHE D 1 334 ? -50.796  195.055 -58.128 1.00 0.00 ? 329 PHE D CG  1 
ATOM 11438 C CD1 . PHE D 1 334 ? -50.209  195.239 -56.850 1.00 0.00 ? 329 PHE D CD1 1 
ATOM 11439 C CD2 . PHE D 1 334 ? -49.931  194.941 -59.237 1.00 0.00 ? 329 PHE D CD2 1 
ATOM 11440 C CE1 . PHE D 1 334 ? -48.791  195.365 -56.703 1.00 0.00 ? 329 PHE D CE1 1 
ATOM 11441 C CE2 . PHE D 1 334 ? -48.560  195.206 -59.112 1.00 0.00 ? 329 PHE D CE2 1 
ATOM 11442 C CZ  . PHE D 1 334 ? -48.009  195.343 -57.854 1.00 0.00 ? 329 PHE D CZ  1 
ATOM 11443 N N   . GLU D 1 335 ? -53.149  192.319 -59.623 1.00 0.00 ? 330 GLU D N   1 
ATOM 11444 C CA  . GLU D 1 335 ? -52.767  191.287 -60.562 1.00 0.00 ? 330 GLU D CA  1 
ATOM 11445 C C   . GLU D 1 335 ? -52.299  191.886 -61.926 1.00 0.00 ? 330 GLU D C   1 
ATOM 11446 O O   . GLU D 1 335 ? -52.975  192.659 -62.592 1.00 0.00 ? 330 GLU D O   1 
ATOM 11447 C CB  . GLU D 1 335 ? -53.883  190.196 -60.678 1.00 0.00 ? 330 GLU D CB  1 
ATOM 11448 C CG  . GLU D 1 335 ? -53.508  189.024 -61.530 1.00 0.00 ? 330 GLU D CG  1 
ATOM 11449 C CD  . GLU D 1 335 ? -54.677  188.030 -61.689 1.00 0.00 ? 330 GLU D CD  1 
ATOM 11450 O OE1 . GLU D 1 335 ? -55.022  187.433 -60.634 1.00 0.00 ? 330 GLU D OE1 1 
ATOM 11451 O OE2 . GLU D 1 335 ? -55.228  187.746 -62.788 1.00 0.00 ? 330 GLU D OE2 1 
ATOM 11452 N N   . VAL D 1 336 ? -51.118  191.445 -62.399 1.00 0.00 ? 331 VAL D N   1 
ATOM 11453 C CA  . VAL D 1 336 ? -50.600  191.856 -63.709 1.00 0.00 ? 331 VAL D CA  1 
ATOM 11454 C C   . VAL D 1 336 ? -50.716  190.606 -64.609 1.00 0.00 ? 331 VAL D C   1 
ATOM 11455 O O   . VAL D 1 336 ? -50.238  189.514 -64.357 1.00 0.00 ? 331 VAL D O   1 
ATOM 11456 C CB  . VAL D 1 336 ? -49.138  192.370 -63.678 1.00 0.00 ? 331 VAL D CB  1 
ATOM 11457 C CG1 . VAL D 1 336 ? -49.195  193.916 -63.258 1.00 0.00 ? 331 VAL D CG1 1 
ATOM 11458 C CG2 . VAL D 1 336 ? -48.233  191.606 -62.705 1.00 0.00 ? 331 VAL D CG2 1 
ATOM 11459 N N   . VAL D 1 337 ? -51.506  190.793 -65.622 1.00 0.00 ? 332 VAL D N   1 
ATOM 11460 C CA  . VAL D 1 337 ? -51.812  189.753 -66.622 1.00 0.00 ? 332 VAL D CA  1 
ATOM 11461 C C   . VAL D 1 337 ? -51.321  190.075 -67.995 1.00 0.00 ? 332 VAL D C   1 
ATOM 11462 O O   . VAL D 1 337 ? -51.710  191.078 -68.631 1.00 0.00 ? 332 VAL D O   1 
ATOM 11463 C CB  . VAL D 1 337 ? -53.320  189.662 -66.718 1.00 0.00 ? 332 VAL D CB  1 
ATOM 11464 C CG1 . VAL D 1 337 ? -53.627  188.343 -67.591 1.00 0.00 ? 332 VAL D CG1 1 
ATOM 11465 C CG2 . VAL D 1 337 ? -53.978  189.498 -65.316 1.00 0.00 ? 332 VAL D CG2 1 
ATOM 11466 N N   . SER D 1 338 ? -50.321  189.371 -68.497 1.00 0.00 ? 333 SER D N   1 
ATOM 11467 C CA  . SER D 1 338 ? -49.678  189.667 -69.854 1.00 0.00 ? 333 SER D CA  1 
ATOM 11468 C C   . SER D 1 338 ? -49.908  188.433 -70.771 1.00 0.00 ? 333 SER D C   1 
ATOM 11469 O O   . SER D 1 338 ? -50.353  187.330 -70.310 1.00 0.00 ? 333 SER D O   1 
ATOM 11470 C CB  . SER D 1 338 ? -48.151  189.920 -69.654 1.00 0.00 ? 333 SER D CB  1 
ATOM 11471 O OG  . SER D 1 338 ? -47.697  190.771 -70.699 1.00 0.00 ? 333 SER D OG  1 
ATOM 11472 N N   . THR D 1 339 ? -49.680  188.562 -72.135 1.00 0.00 ? 334 THR D N   1 
ATOM 11473 C CA  . THR D 1 339 ? -49.921  187.454 -73.017 1.00 0.00 ? 334 THR D CA  1 
ATOM 11474 C C   . THR D 1 339 ? -49.255  186.129 -72.695 1.00 0.00 ? 334 THR D C   1 
ATOM 11475 O O   . THR D 1 339 ? -49.910  185.110 -72.810 1.00 0.00 ? 334 THR D O   1 
ATOM 11476 C CB  . THR D 1 339 ? -49.581  187.808 -74.515 1.00 0.00 ? 334 THR D CB  1 
ATOM 11477 O OG1 . THR D 1 339 ? -48.303  188.362 -74.688 1.00 0.00 ? 334 THR D OG1 1 
ATOM 11478 C CG2 . THR D 1 339 ? -50.640  188.701 -74.986 1.00 0.00 ? 334 THR D CG2 1 
ATOM 11479 N N   . SER D 1 340 ? -47.924  186.062 -72.396 1.00 0.00 ? 335 SER D N   1 
ATOM 11480 C CA  . SER D 1 340 ? -47.326  184.812 -72.121 1.00 0.00 ? 335 SER D CA  1 
ATOM 11481 C C   . SER D 1 340 ? -47.409  184.390 -70.654 1.00 0.00 ? 335 SER D C   1 
ATOM 11482 O O   . SER D 1 340 ? -47.594  183.244 -70.287 1.00 0.00 ? 335 SER D O   1 
ATOM 11483 C CB  . SER D 1 340 ? -45.867  184.825 -72.563 1.00 0.00 ? 335 SER D CB  1 
ATOM 11484 O OG  . SER D 1 340 ? -45.148  185.860 -71.986 1.00 0.00 ? 335 SER D OG  1 
ATOM 11485 N N   . LYS D 1 341 ? -47.460  185.420 -69.763 1.00 0.00 ? 336 LYS D N   1 
ATOM 11486 C CA  . LYS D 1 341 ? -47.344  185.223 -68.348 1.00 0.00 ? 336 LYS D CA  1 
ATOM 11487 C C   . LYS D 1 341 ? -48.182  186.211 -67.500 1.00 0.00 ? 336 LYS D C   1 
ATOM 11488 O O   . LYS D 1 341 ? -48.376  187.345 -67.761 1.00 0.00 ? 336 LYS D O   1 
ATOM 11489 C CB  . LYS D 1 341 ? -45.867  185.468 -67.912 1.00 0.00 ? 336 LYS D CB  1 
ATOM 11490 C CG  . LYS D 1 341 ? -44.906  184.437 -68.545 1.00 0.00 ? 336 LYS D CG  1 
ATOM 11491 C CD  . LYS D 1 341 ? -43.483  184.911 -68.548 1.00 0.00 ? 336 LYS D CD  1 
ATOM 11492 C CE  . LYS D 1 341 ? -42.570  183.915 -69.284 1.00 0.00 ? 336 LYS D CE  1 
ATOM 11493 N NZ  . LYS D 1 341 ? -41.190  184.286 -69.491 1.00 0.00 ? 336 LYS D NZ  1 
ATOM 11494 N N   . SER D 1 342 ? -48.787  185.738 -66.391 1.00 0.00 ? 337 SER D N   1 
ATOM 11495 C CA  . SER D 1 342 ? -49.435  186.453 -65.320 1.00 0.00 ? 337 SER D CA  1 
ATOM 11496 C C   . SER D 1 342 ? -48.755  186.372 -63.959 1.00 0.00 ? 337 SER D C   1 
ATOM 11497 O O   . SER D 1 342 ? -47.926  185.496 -63.721 1.00 0.00 ? 337 SER D O   1 
ATOM 11498 C CB  . SER D 1 342 ? -51.006  185.945 -65.221 1.00 0.00 ? 337 SER D CB  1 
ATOM 11499 O OG  . SER D 1 342 ? -51.770  186.926 -64.523 1.00 0.00 ? 337 SER D OG  1 
ATOM 11500 N N   . CYS D 1 343 ? -49.021  187.316 -63.004 1.00 0.00 ? 338 CYS D N   1 
ATOM 11501 C CA  . CYS D 1 343 ? -48.402  187.196 -61.708 1.00 0.00 ? 338 CYS D CA  1 
ATOM 11502 C C   . CYS D 1 343 ? -49.436  187.962 -60.774 1.00 0.00 ? 338 CYS D C   1 
ATOM 11503 O O   . CYS D 1 343 ? -49.804  189.125 -61.015 1.00 0.00 ? 338 CYS D O   1 
ATOM 11504 C CB  . CYS D 1 343 ? -46.987  187.707 -61.677 1.00 0.00 ? 338 CYS D CB  1 
ATOM 11505 S SG  . CYS D 1 343 ? -46.200  187.420 -60.133 1.00 0.00 ? 338 CYS D SG  1 
ATOM 11506 N N   . LEU D 1 344 ? -49.875  187.320 -59.665 1.00 0.00 ? 339 LEU D N   1 
ATOM 11507 C CA  . LEU D 1 344 ? -50.583  187.983 -58.571 1.00 0.00 ? 339 LEU D CA  1 
ATOM 11508 C C   . LEU D 1 344 ? -49.505  188.648 -57.724 1.00 0.00 ? 339 LEU D C   1 
ATOM 11509 O O   . LEU D 1 344 ? -48.412  188.120 -57.573 1.00 0.00 ? 339 LEU D O   1 
ATOM 11510 C CB  . LEU D 1 344 ? -51.308  186.958 -57.661 1.00 0.00 ? 339 LEU D CB  1 
ATOM 11511 C CG  . LEU D 1 344 ? -52.301  187.626 -56.695 1.00 0.00 ? 339 LEU D CG  1 
ATOM 11512 C CD1 . LEU D 1 344 ? -53.461  188.334 -57.378 1.00 0.00 ? 339 LEU D CD1 1 
ATOM 11513 C CD2 . LEU D 1 344 ? -52.871  186.606 -55.769 1.00 0.00 ? 339 LEU D CD2 1 
ATOM 11514 N N   . LEU D 1 345 ? -49.757  189.776 -57.097 1.00 0.00 ? 340 LEU D N   1 
ATOM 11515 C CA  . LEU D 1 345 ? -48.712  190.338 -56.246 1.00 0.00 ? 340 LEU D CA  1 
ATOM 11516 C C   . LEU D 1 345 ? -49.510  191.067 -55.197 1.00 0.00 ? 340 LEU D C   1 
ATOM 11517 O O   . LEU D 1 345 ? -50.737  191.312 -55.308 1.00 0.00 ? 340 LEU D O   1 
ATOM 11518 C CB  . LEU D 1 345 ? -47.720  191.289 -56.950 1.00 0.00 ? 340 LEU D CB  1 
ATOM 11519 C CG  . LEU D 1 345 ? -46.832  190.876 -58.112 1.00 0.00 ? 340 LEU D CG  1 
ATOM 11520 C CD1 . LEU D 1 345 ? -46.774  191.908 -59.196 1.00 0.00 ? 340 LEU D CD1 1 
ATOM 11521 C CD2 . LEU D 1 345 ? -45.464  190.416 -57.654 1.00 0.00 ? 340 LEU D CD2 1 
ATOM 11522 N N   . GLN D 1 346 ? -48.791  191.396 -54.054 1.00 0.00 ? 341 GLN D N   1 
ATOM 11523 C CA  . GLN D 1 346 ? -49.428  191.947 -52.849 1.00 0.00 ? 341 GLN D CA  1 
ATOM 11524 C C   . GLN D 1 346 ? -48.347  192.930 -52.215 1.00 0.00 ? 341 GLN D C   1 
ATOM 11525 O O   . GLN D 1 346 ? -47.162  192.648 -52.145 1.00 0.00 ? 341 GLN D O   1 
ATOM 11526 C CB  . GLN D 1 346 ? -49.839  190.838 -51.787 1.00 0.00 ? 341 GLN D CB  1 
ATOM 11527 C CG  . GLN D 1 346 ? -50.659  191.458 -50.579 1.00 0.00 ? 341 GLN D CG  1 
ATOM 11528 C CD  . GLN D 1 346 ? -50.864  190.472 -49.435 1.00 0.00 ? 341 GLN D CD  1 
ATOM 11529 O OE1 . GLN D 1 346 ? -50.271  189.390 -49.563 1.00 0.00 ? 341 GLN D OE1 1 
ATOM 11530 N NE2 . GLN D 1 346 ? -51.789  190.779 -48.483 1.00 0.00 ? 341 GLN D NE2 1 
ATOM 11531 N N   . ALA D 1 347 ? -48.749  194.138 -51.831 1.00 0.00 ? 342 ALA D N   1 
ATOM 11532 C CA  . ALA D 1 347 ? -47.844  195.209 -51.310 1.00 0.00 ? 342 ALA D CA  1 
ATOM 11533 C C   . ALA D 1 347 ? -48.286  195.557 -49.854 1.00 0.00 ? 342 ALA D C   1 
ATOM 11534 O O   . ALA D 1 347 ? -49.238  194.990 -49.337 1.00 0.00 ? 342 ALA D O   1 
ATOM 11535 C CB  . ALA D 1 347 ? -47.971  196.493 -52.234 1.00 0.00 ? 342 ALA D CB  1 
ATOM 11536 N N   . ASP D 1 348 ? -47.567  196.528 -49.136 1.00 0.00 ? 343 ASP D N   1 
ATOM 11537 C CA  . ASP D 1 348 ? -47.598  196.667 -47.679 1.00 0.00 ? 343 ASP D CA  1 
ATOM 11538 C C   . ASP D 1 348 ? -48.496  197.782 -47.271 1.00 0.00 ? 343 ASP D C   1 
ATOM 11539 O O   . ASP D 1 348 ? -48.820  197.908 -46.099 1.00 0.00 ? 343 ASP D O   1 
ATOM 11540 C CB  . ASP D 1 348 ? -46.111  196.893 -47.161 1.00 0.00 ? 343 ASP D CB  1 
ATOM 11541 C CG  . ASP D 1 348 ? -45.088  195.878 -47.605 1.00 0.00 ? 343 ASP D CG  1 
ATOM 11542 O OD1 . ASP D 1 348 ? -45.205  194.767 -47.052 1.00 0.00 ? 343 ASP D OD1 1 
ATOM 11543 O OD2 . ASP D 1 348 ? -44.195  196.146 -48.388 1.00 0.00 ? 343 ASP D OD2 1 
ATOM 11544 N N   . SER D 1 349 ? -49.044  198.536 -48.210 1.00 0.00 ? 344 SER D N   1 
ATOM 11545 C CA  . SER D 1 349 ? -49.790  199.715 -47.918 1.00 0.00 ? 344 SER D CA  1 
ATOM 11546 C C   . SER D 1 349 ? -50.694  199.985 -49.093 1.00 0.00 ? 344 SER D C   1 
ATOM 11547 O O   . SER D 1 349 ? -50.442  199.496 -50.177 1.00 0.00 ? 344 SER D O   1 
ATOM 11548 C CB  . SER D 1 349 ? -48.958  200.947 -47.468 1.00 0.00 ? 344 SER D CB  1 
ATOM 11549 O OG  . SER D 1 349 ? -48.316  201.721 -48.496 1.00 0.00 ? 344 SER D OG  1 
ATOM 11550 N N   . GLU D 1 350 ? -51.763  200.815 -48.957 1.00 0.00 ? 345 GLU D N   1 
ATOM 11551 C CA  . GLU D 1 350 ? -52.684  201.283 -50.006 1.00 0.00 ? 345 GLU D CA  1 
ATOM 11552 C C   . GLU D 1 350 ? -51.877  202.294 -50.880 1.00 0.00 ? 345 GLU D C   1 
ATOM 11553 O O   . GLU D 1 350 ? -51.944  202.256 -52.154 1.00 0.00 ? 345 GLU D O   1 
ATOM 11554 C CB  . GLU D 1 350 ? -53.946  202.024 -49.490 1.00 0.00 ? 345 GLU D CB  1 
ATOM 11555 C CG  . GLU D 1 350 ? -54.897  201.161 -48.569 1.00 0.00 ? 345 GLU D CG  1 
ATOM 11556 C CD  . GLU D 1 350 ? -56.340  201.695 -48.549 1.00 0.00 ? 345 GLU D CD  1 
ATOM 11557 O OE1 . GLU D 1 350 ? -57.054  201.453 -49.534 1.00 0.00 ? 345 GLU D OE1 1 
ATOM 11558 O OE2 . GLU D 1 350 ? -56.725  202.299 -47.510 1.00 0.00 ? 345 GLU D OE2 1 
ATOM 11559 N N   . ARG D 1 351 ? -50.992  203.136 -50.332 1.00 0.00 ? 346 ARG D N   1 
ATOM 11560 C CA  . ARG D 1 351 ? -50.034  203.878 -51.092 1.00 0.00 ? 346 ARG D CA  1 
ATOM 11561 C C   . ARG D 1 351 ? -49.196  203.045 -52.053 1.00 0.00 ? 346 ARG D C   1 
ATOM 11562 O O   . ARG D 1 351 ? -49.119  203.383 -53.237 1.00 0.00 ? 346 ARG D O   1 
ATOM 11563 C CB  . ARG D 1 351 ? -49.156  204.767 -50.180 1.00 0.00 ? 346 ARG D CB  1 
ATOM 11564 C CG  . ARG D 1 351 ? -47.935  205.431 -50.856 1.00 0.00 ? 346 ARG D CG  1 
ATOM 11565 C CD  . ARG D 1 351 ? -48.286  206.432 -52.062 1.00 0.00 ? 346 ARG D CD  1 
ATOM 11566 N NE  . ARG D 1 351 ? -47.078  207.173 -52.557 1.00 0.00 ? 346 ARG D NE  1 
ATOM 11567 C CZ  . ARG D 1 351 ? -47.036  207.944 -53.649 1.00 0.00 ? 346 ARG D CZ  1 
ATOM 11568 N NH1 . ARG D 1 351 ? -47.941  207.912 -54.603 1.00 0.00 ? 346 ARG D NH1 1 
ATOM 11569 N NH2 . ARG D 1 351 ? -46.157  208.890 -53.723 1.00 0.00 ? 346 ARG D NH2 1 
ATOM 11570 N N   . LEU D 1 352 ? -48.617  201.986 -51.539 1.00 0.00 ? 347 LEU D N   1 
ATOM 11571 C CA  . LEU D 1 352 ? -47.784  201.155 -52.409 1.00 0.00 ? 347 LEU D CA  1 
ATOM 11572 C C   . LEU D 1 352 ? -48.482  200.363 -53.541 1.00 0.00 ? 347 LEU D C   1 
ATOM 11573 O O   . LEU D 1 352 ? -47.918  200.037 -54.569 1.00 0.00 ? 347 LEU D O   1 
ATOM 11574 C CB  . LEU D 1 352 ? -46.954  200.187 -51.509 1.00 0.00 ? 347 LEU D CB  1 
ATOM 11575 C CG  . LEU D 1 352 ? -45.915  200.909 -50.613 1.00 0.00 ? 347 LEU D CG  1 
ATOM 11576 C CD1 . LEU D 1 352 ? -45.359  199.903 -49.641 1.00 0.00 ? 347 LEU D CD1 1 
ATOM 11577 C CD2 . LEU D 1 352 ? -44.741  201.562 -51.406 1.00 0.00 ? 347 LEU D CD2 1 
ATOM 11578 N N   . LEU D 1 353 ? -49.812  200.042 -53.296 1.00 0.00 ? 348 LEU D N   1 
ATOM 11579 C CA  . LEU D 1 353 ? -50.622  199.402 -54.296 1.00 0.00 ? 348 LEU D CA  1 
ATOM 11580 C C   . LEU D 1 353 ? -50.764  200.299 -55.489 1.00 0.00 ? 348 LEU D C   1 
ATOM 11581 O O   . LEU D 1 353 ? -50.471  199.996 -56.617 1.00 0.00 ? 348 LEU D O   1 
ATOM 11582 C CB  . LEU D 1 353 ? -52.002  199.086 -53.716 1.00 0.00 ? 348 LEU D CB  1 
ATOM 11583 C CG  . LEU D 1 353 ? -53.152  198.709 -54.715 1.00 0.00 ? 348 LEU D CG  1 
ATOM 11584 C CD1 . LEU D 1 353 ? -52.742  197.464 -55.530 1.00 0.00 ? 348 LEU D CD1 1 
ATOM 11585 C CD2 . LEU D 1 353 ? -54.481  198.510 -53.998 1.00 0.00 ? 348 LEU D CD2 1 
ATOM 11586 N N   . GLN D 1 354 ? -51.162  201.561 -55.235 1.00 0.00 ? 349 GLN D N   1 
ATOM 11587 C CA  . GLN D 1 354 ? -51.530  202.566 -56.193 1.00 0.00 ? 349 GLN D CA  1 
ATOM 11588 C C   . GLN D 1 354 ? -50.328  203.088 -57.013 1.00 0.00 ? 349 GLN D C   1 
ATOM 11589 O O   . GLN D 1 354 ? -50.489  203.409 -58.213 1.00 0.00 ? 349 GLN D O   1 
ATOM 11590 C CB  . GLN D 1 354 ? -52.080  203.846 -55.466 1.00 0.00 ? 349 GLN D CB  1 
ATOM 11591 C CG  . GLN D 1 354 ? -53.432  203.526 -54.816 1.00 0.00 ? 349 GLN D CG  1 
ATOM 11592 C CD  . GLN D 1 354 ? -53.989  204.744 -54.144 1.00 0.00 ? 349 GLN D CD  1 
ATOM 11593 O OE1 . GLN D 1 354 ? -53.309  205.750 -53.964 1.00 0.00 ? 349 GLN D OE1 1 
ATOM 11594 N NE2 . GLN D 1 354 ? -55.270  204.749 -53.649 1.00 0.00 ? 349 GLN D NE2 1 
ATOM 11595 N N   . LEU D 1 355 ? -49.203  203.187 -56.333 1.00 0.00 ? 350 LEU D N   1 
ATOM 11596 C CA  . LEU D 1 355 ? -47.900  203.503 -56.882 1.00 0.00 ? 350 LEU D CA  1 
ATOM 11597 C C   . LEU D 1 355 ? -47.338  202.332 -57.766 1.00 0.00 ? 350 LEU D C   1 
ATOM 11598 O O   . LEU D 1 355 ? -46.952  202.553 -58.899 1.00 0.00 ? 350 LEU D O   1 
ATOM 11599 C CB  . LEU D 1 355 ? -46.926  203.788 -55.716 1.00 0.00 ? 350 LEU D CB  1 
ATOM 11600 C CG  . LEU D 1 355 ? -45.635  204.386 -56.236 1.00 0.00 ? 350 LEU D CG  1 
ATOM 11601 C CD1 . LEU D 1 355 ? -45.718  205.933 -56.537 1.00 0.00 ? 350 LEU D CD1 1 
ATOM 11602 C CD2 . LEU D 1 355 ? -44.392  203.991 -55.456 1.00 0.00 ? 350 LEU D CD2 1 
ATOM 11603 N N   . TRP D 1 356 ? -47.416  201.032 -57.328 1.00 0.00 ? 351 TRP D N   1 
ATOM 11604 C CA  . TRP D 1 356 ? -47.080  199.857 -58.198 1.00 0.00 ? 351 TRP D CA  1 
ATOM 11605 C C   . TRP D 1 356 ? -48.107  199.654 -59.327 1.00 0.00 ? 351 TRP D C   1 
ATOM 11606 O O   . TRP D 1 356 ? -47.770  199.264 -60.463 1.00 0.00 ? 351 TRP D O   1 
ATOM 11607 C CB  . TRP D 1 356 ? -46.977  198.591 -57.324 1.00 0.00 ? 351 TRP D CB  1 
ATOM 11608 C CG  . TRP D 1 356 ? -45.630  198.476 -56.615 1.00 0.00 ? 351 TRP D CG  1 
ATOM 11609 C CD1 . TRP D 1 356 ? -45.213  198.764 -55.358 1.00 0.00 ? 351 TRP D CD1 1 
ATOM 11610 C CD2 . TRP D 1 356 ? -44.452  198.135 -57.319 1.00 0.00 ? 351 TRP D CD2 1 
ATOM 11611 N NE1 . TRP D 1 356 ? -43.782  198.681 -55.234 1.00 0.00 ? 351 TRP D NE1 1 
ATOM 11612 C CE2 . TRP D 1 356 ? -43.306  198.159 -56.424 1.00 0.00 ? 351 TRP D CE2 1 
ATOM 11613 C CE3 . TRP D 1 356 ? -44.257  197.694 -58.640 1.00 0.00 ? 351 TRP D CE3 1 
ATOM 11614 C CZ2 . TRP D 1 356 ? -42.044  197.788 -56.803 1.00 0.00 ? 351 TRP D CZ2 1 
ATOM 11615 C CZ3 . TRP D 1 356 ? -43.025  197.003 -58.870 1.00 0.00 ? 351 TRP D CZ3 1 
ATOM 11616 C CH2 . TRP D 1 356 ? -41.931  197.058 -57.991 1.00 0.00 ? 351 TRP D CH2 1 
ATOM 11617 N N   . VAL D 1 357 ? -49.381  199.976 -59.050 1.00 0.00 ? 352 VAL D N   1 
ATOM 11618 C CA  . VAL D 1 357 ? -50.403  199.871 -60.142 1.00 0.00 ? 352 VAL D CA  1 
ATOM 11619 C C   . VAL D 1 357 ? -50.197  200.988 -61.138 1.00 0.00 ? 352 VAL D C   1 
ATOM 11620 O O   . VAL D 1 357 ? -50.216  200.821 -62.368 1.00 0.00 ? 352 VAL D O   1 
ATOM 11621 C CB  . VAL D 1 357 ? -51.793  199.813 -59.583 1.00 0.00 ? 352 VAL D CB  1 
ATOM 11622 C CG1 . VAL D 1 357 ? -52.747  200.081 -60.752 1.00 0.00 ? 352 VAL D CG1 1 
ATOM 11623 C CG2 . VAL D 1 357 ? -51.942  198.372 -59.134 1.00 0.00 ? 352 VAL D CG2 1 
ATOM 11624 N N   . SER D 1 358 ? -49.911  202.250 -60.672 1.00 0.00 ? 353 SER D N   1 
ATOM 11625 C CA  . SER D 1 358 ? -49.633  203.336 -61.620 1.00 0.00 ? 353 SER D CA  1 
ATOM 11626 C C   . SER D 1 358 ? -48.342  203.137 -62.390 1.00 0.00 ? 353 SER D C   1 
ATOM 11627 O O   . SER D 1 358 ? -48.240  203.407 -63.594 1.00 0.00 ? 353 SER D O   1 
ATOM 11628 C CB  . SER D 1 358 ? -49.632  204.704 -60.828 1.00 0.00 ? 353 SER D CB  1 
ATOM 11629 O OG  . SER D 1 358 ? -50.857  205.010 -60.177 1.00 0.00 ? 353 SER D OG  1 
ATOM 11630 N N   . ALA D 1 359 ? -47.266  202.574 -61.849 1.00 0.00 ? 354 ALA D N   1 
ATOM 11631 C CA  . ALA D 1 359 ? -46.053  202.320 -62.562 1.00 0.00 ? 354 ALA D CA  1 
ATOM 11632 C C   . ALA D 1 359 ? -46.213  201.315 -63.633 1.00 0.00 ? 354 ALA D C   1 
ATOM 11633 O O   . ALA D 1 359 ? -45.640  201.312 -64.706 1.00 0.00 ? 354 ALA D O   1 
ATOM 11634 C CB  . ALA D 1 359 ? -44.944  201.979 -61.562 1.00 0.00 ? 354 ALA D CB  1 
ATOM 11635 N N   . VAL D 1 360 ? -47.007  200.237 -63.397 1.00 0.00 ? 355 VAL D N   1 
ATOM 11636 C CA  . VAL D 1 360 ? -47.284  199.317 -64.448 1.00 0.00 ? 355 VAL D CA  1 
ATOM 11637 C C   . VAL D 1 360 ? -48.174  199.974 -65.486 1.00 0.00 ? 355 VAL D C   1 
ATOM 11638 O O   . VAL D 1 360 ? -47.906  199.871 -66.730 1.00 0.00 ? 355 VAL D O   1 
ATOM 11639 C CB  . VAL D 1 360 ? -47.965  197.973 -63.827 1.00 0.00 ? 355 VAL D CB  1 
ATOM 11640 C CG1 . VAL D 1 360 ? -48.291  197.092 -65.017 1.00 0.00 ? 355 VAL D CG1 1 
ATOM 11641 C CG2 . VAL D 1 360 ? -47.019  197.330 -62.825 1.00 0.00 ? 355 VAL D CG2 1 
ATOM 11642 N N   . GLN D 1 361 ? -49.166  200.786 -65.024 1.00 0.00 ? 356 GLN D N   1 
ATOM 11643 C CA  . GLN D 1 361 ? -50.030  201.490 -65.970 1.00 0.00 ? 356 GLN D CA  1 
ATOM 11644 C C   . GLN D 1 361 ? -49.423  202.541 -66.893 1.00 0.00 ? 356 GLN D C   1 
ATOM 11645 O O   . GLN D 1 361 ? -49.686  202.552 -68.091 1.00 0.00 ? 356 GLN D O   1 
ATOM 11646 C CB  . GLN D 1 361 ? -51.164  201.940 -65.116 1.00 0.00 ? 356 GLN D CB  1 
ATOM 11647 C CG  . GLN D 1 361 ? -52.186  202.813 -65.843 1.00 0.00 ? 356 GLN D CG  1 
ATOM 11648 C CD  . GLN D 1 361 ? -51.822  204.272 -65.681 1.00 0.00 ? 356 GLN D CD  1 
ATOM 11649 O OE1 . GLN D 1 361 ? -51.119  204.660 -64.733 1.00 0.00 ? 356 GLN D OE1 1 
ATOM 11650 N NE2 . GLN D 1 361 ? -52.193  205.197 -66.642 1.00 0.00 ? 356 GLN D NE2 1 
ATOM 11651 N N   . SER D 1 362 ? -48.428  203.272 -66.410 1.00 0.00 ? 357 SER D N   1 
ATOM 11652 C CA  . SER D 1 362 ? -47.599  204.074 -67.348 1.00 0.00 ? 357 SER D CA  1 
ATOM 11653 C C   . SER D 1 362 ? -46.795  203.225 -68.261 1.00 0.00 ? 357 SER D C   1 
ATOM 11654 O O   . SER D 1 362 ? -46.717  203.560 -69.480 1.00 0.00 ? 357 SER D O   1 
ATOM 11655 C CB  . SER D 1 362 ? -46.619  204.961 -66.588 1.00 0.00 ? 357 SER D CB  1 
ATOM 11656 O OG  . SER D 1 362 ? -47.325  206.021 -65.946 1.00 0.00 ? 357 SER D OG  1 
ATOM 11657 N N   . SER D 1 363 ? -46.255  202.106 -67.783 1.00 0.00 ? 358 SER D N   1 
ATOM 11658 C CA  . SER D 1 363 ? -45.443  201.127 -68.526 1.00 0.0