data_4COO
# 
_entry.id   4COO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4COO         
PDBE  EBI-59633    
WWPDB D_1290059633 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4COO 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2014-01-29 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'McCorvie, T.J.'      1  
'Kopec, J.'           2  
'Vollamar, M.'        3  
'Strain-Damerell, C.' 4  
'Bushell, S.'         5  
'Bradley, A.'         6  
'Tallant, C.'         7  
'Kiyani, W.'          8  
'Froese, D.S.'        9  
'Carpenter, E.S.'     10 
'Burgess-Brown, N.'   11 
'von Delft, F.'       12 
'Arrowsmith, C.'      13 
'Edwards, A.'         14 
'Bountra, C.'         15 
'Yue, W.W.'           16 
# 
_citation.id                        primary 
_citation.title                     
'Inter-Domain Communication of Human Cystathionine Beta Synthase: Structural Basis of S-Adenosyl-L-Methionine Activation.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            289 
_citation.page_first                36018 
_citation.page_last                 ? 
_citation.year                      2014 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25336647 
_citation.pdbx_database_id_DOI      10.1074/JBC.M114.610782 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mccorvie, T.J.'      1  
primary 'Kopec, J.'           2  
primary 'Hyung, S.'           3  
primary 'Fitzpatrick, F.'     4  
primary 'Feng, X.'            5  
primary 'Termine, D.'         6  
primary 'Strain-Damerell, C.' 7  
primary 'Vollmar, M.'         8  
primary 'Fleming, J.'         9  
primary 'Janz, J.M.'          10 
primary 'Bulawa, C.'          11 
primary 'Yue, W.W.'           12 
# 
_cell.entry_id           4COO 
_cell.length_a           70.264 
_cell.length_b           116.193 
_cell.length_c           167.990 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4COO 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CYSTATHIONINE BETA-SYNTHASE'                                                        62132.949 2   4.2.1.22 ? 
'CATALYTIC AND REGULATORY DOMAINS, RESIDUES 1-515,526-551' ? 
2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'                                                    616.487   2   ?        ? ? 
? 
3 non-polymer syn 'ACETATE ION'                                                                        59.044    5   ?        ? ? 
? 
4 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE"                                                             247.142   2   ?        ? ? 
? 
5 non-polymer syn 1,2-ETHANEDIOL                                                                       62.068    7   ?        ? ? 
? 
6 non-polymer syn '2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL' 354.436   1   ?        ? ? 
? 
7 non-polymer syn 'SODIUM ION'                                                                         22.990    2   ?        ? ? 
? 
8 water       nat water                                                                                18.015    294 ?        ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BETA-THIONASE, SERINE SULFHYDRASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGR
PASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKP
GDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSH
ILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQ
TTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSV
RNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGM
VTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQQRQMVFGVVTAIDLLNFVAAQER
DQK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGR
PASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKP
GDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSH
ILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQ
TTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSV
RNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGM
VTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQQRQMVFGVVTAIDLLNFVAAQER
DQK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  PRO n 
1 25  SER n 
1 26  GLU n 
1 27  THR n 
1 28  PRO n 
1 29  GLN n 
1 30  ALA n 
1 31  GLU n 
1 32  VAL n 
1 33  GLY n 
1 34  PRO n 
1 35  THR n 
1 36  GLY n 
1 37  CYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  SER n 
1 42  GLY n 
1 43  PRO n 
1 44  HIS n 
1 45  SER n 
1 46  ALA n 
1 47  LYS n 
1 48  GLY n 
1 49  SER n 
1 50  LEU n 
1 51  GLU n 
1 52  LYS n 
1 53  GLY n 
1 54  SER n 
1 55  PRO n 
1 56  GLU n 
1 57  ASP n 
1 58  LYS n 
1 59  GLU n 
1 60  ALA n 
1 61  LYS n 
1 62  GLU n 
1 63  PRO n 
1 64  LEU n 
1 65  TRP n 
1 66  ILE n 
1 67  ARG n 
1 68  PRO n 
1 69  ASP n 
1 70  ALA n 
1 71  PRO n 
1 72  SER n 
1 73  ARG n 
1 74  CYS n 
1 75  THR n 
1 76  TRP n 
1 77  GLN n 
1 78  LEU n 
1 79  GLY n 
1 80  ARG n 
1 81  PRO n 
1 82  ALA n 
1 83  SER n 
1 84  GLU n 
1 85  SER n 
1 86  PRO n 
1 87  HIS n 
1 88  HIS n 
1 89  HIS n 
1 90  THR n 
1 91  ALA n 
1 92  PRO n 
1 93  ALA n 
1 94  LYS n 
1 95  SER n 
1 96  PRO n 
1 97  LYS n 
1 98  ILE n 
1 99  LEU n 
1 100 PRO n 
1 101 ASP n 
1 102 ILE n 
1 103 LEU n 
1 104 LYS n 
1 105 LYS n 
1 106 ILE n 
1 107 GLY n 
1 108 ASP n 
1 109 THR n 
1 110 PRO n 
1 111 MET n 
1 112 VAL n 
1 113 ARG n 
1 114 ILE n 
1 115 ASN n 
1 116 LYS n 
1 117 ILE n 
1 118 GLY n 
1 119 LYS n 
1 120 LYS n 
1 121 PHE n 
1 122 GLY n 
1 123 LEU n 
1 124 LYS n 
1 125 CYS n 
1 126 GLU n 
1 127 LEU n 
1 128 LEU n 
1 129 ALA n 
1 130 LYS n 
1 131 CYS n 
1 132 GLU n 
1 133 PHE n 
1 134 PHE n 
1 135 ASN n 
1 136 ALA n 
1 137 GLY n 
1 138 GLY n 
1 139 SER n 
1 140 VAL n 
1 141 LYS n 
1 142 ASP n 
1 143 ARG n 
1 144 ILE n 
1 145 SER n 
1 146 LEU n 
1 147 ARG n 
1 148 MET n 
1 149 ILE n 
1 150 GLU n 
1 151 ASP n 
1 152 ALA n 
1 153 GLU n 
1 154 ARG n 
1 155 ASP n 
1 156 GLY n 
1 157 THR n 
1 158 LEU n 
1 159 LYS n 
1 160 PRO n 
1 161 GLY n 
1 162 ASP n 
1 163 THR n 
1 164 ILE n 
1 165 ILE n 
1 166 GLU n 
1 167 PRO n 
1 168 THR n 
1 169 SER n 
1 170 GLY n 
1 171 ASN n 
1 172 THR n 
1 173 GLY n 
1 174 ILE n 
1 175 GLY n 
1 176 LEU n 
1 177 ALA n 
1 178 LEU n 
1 179 ALA n 
1 180 ALA n 
1 181 ALA n 
1 182 VAL n 
1 183 ARG n 
1 184 GLY n 
1 185 TYR n 
1 186 ARG n 
1 187 CYS n 
1 188 ILE n 
1 189 ILE n 
1 190 VAL n 
1 191 MET n 
1 192 PRO n 
1 193 GLU n 
1 194 LYS n 
1 195 MET n 
1 196 SER n 
1 197 SER n 
1 198 GLU n 
1 199 LYS n 
1 200 VAL n 
1 201 ASP n 
1 202 VAL n 
1 203 LEU n 
1 204 ARG n 
1 205 ALA n 
1 206 LEU n 
1 207 GLY n 
1 208 ALA n 
1 209 GLU n 
1 210 ILE n 
1 211 VAL n 
1 212 ARG n 
1 213 THR n 
1 214 PRO n 
1 215 THR n 
1 216 ASN n 
1 217 ALA n 
1 218 ARG n 
1 219 PHE n 
1 220 ASP n 
1 221 SER n 
1 222 PRO n 
1 223 GLU n 
1 224 SER n 
1 225 HIS n 
1 226 VAL n 
1 227 GLY n 
1 228 VAL n 
1 229 ALA n 
1 230 TRP n 
1 231 ARG n 
1 232 LEU n 
1 233 LYS n 
1 234 ASN n 
1 235 GLU n 
1 236 ILE n 
1 237 PRO n 
1 238 ASN n 
1 239 SER n 
1 240 HIS n 
1 241 ILE n 
1 242 LEU n 
1 243 ASP n 
1 244 GLN n 
1 245 TYR n 
1 246 ARG n 
1 247 ASN n 
1 248 ALA n 
1 249 SER n 
1 250 ASN n 
1 251 PRO n 
1 252 LEU n 
1 253 ALA n 
1 254 HIS n 
1 255 TYR n 
1 256 ASP n 
1 257 THR n 
1 258 THR n 
1 259 ALA n 
1 260 ASP n 
1 261 GLU n 
1 262 ILE n 
1 263 LEU n 
1 264 GLN n 
1 265 GLN n 
1 266 CYS n 
1 267 ASP n 
1 268 GLY n 
1 269 LYS n 
1 270 LEU n 
1 271 ASP n 
1 272 MET n 
1 273 LEU n 
1 274 VAL n 
1 275 ALA n 
1 276 SER n 
1 277 VAL n 
1 278 GLY n 
1 279 THR n 
1 280 GLY n 
1 281 GLY n 
1 282 THR n 
1 283 ILE n 
1 284 THR n 
1 285 GLY n 
1 286 ILE n 
1 287 ALA n 
1 288 ARG n 
1 289 LYS n 
1 290 LEU n 
1 291 LYS n 
1 292 GLU n 
1 293 LYS n 
1 294 CYS n 
1 295 PRO n 
1 296 GLY n 
1 297 CYS n 
1 298 ARG n 
1 299 ILE n 
1 300 ILE n 
1 301 GLY n 
1 302 VAL n 
1 303 ASP n 
1 304 PRO n 
1 305 GLU n 
1 306 GLY n 
1 307 SER n 
1 308 ILE n 
1 309 LEU n 
1 310 ALA n 
1 311 GLU n 
1 312 PRO n 
1 313 GLU n 
1 314 GLU n 
1 315 LEU n 
1 316 ASN n 
1 317 GLN n 
1 318 THR n 
1 319 GLU n 
1 320 GLN n 
1 321 THR n 
1 322 THR n 
1 323 TYR n 
1 324 GLU n 
1 325 VAL n 
1 326 GLU n 
1 327 GLY n 
1 328 ILE n 
1 329 GLY n 
1 330 TYR n 
1 331 ASP n 
1 332 PHE n 
1 333 ILE n 
1 334 PRO n 
1 335 THR n 
1 336 VAL n 
1 337 LEU n 
1 338 ASP n 
1 339 ARG n 
1 340 THR n 
1 341 VAL n 
1 342 VAL n 
1 343 ASP n 
1 344 LYS n 
1 345 TRP n 
1 346 PHE n 
1 347 LYS n 
1 348 SER n 
1 349 ASN n 
1 350 ASP n 
1 351 GLU n 
1 352 GLU n 
1 353 ALA n 
1 354 PHE n 
1 355 THR n 
1 356 PHE n 
1 357 ALA n 
1 358 ARG n 
1 359 MET n 
1 360 LEU n 
1 361 ILE n 
1 362 ALA n 
1 363 GLN n 
1 364 GLU n 
1 365 GLY n 
1 366 LEU n 
1 367 LEU n 
1 368 CYS n 
1 369 GLY n 
1 370 GLY n 
1 371 SER n 
1 372 ALA n 
1 373 GLY n 
1 374 SER n 
1 375 THR n 
1 376 VAL n 
1 377 ALA n 
1 378 VAL n 
1 379 ALA n 
1 380 VAL n 
1 381 LYS n 
1 382 ALA n 
1 383 ALA n 
1 384 GLN n 
1 385 GLU n 
1 386 LEU n 
1 387 GLN n 
1 388 GLU n 
1 389 GLY n 
1 390 GLN n 
1 391 ARG n 
1 392 CYS n 
1 393 VAL n 
1 394 VAL n 
1 395 ILE n 
1 396 LEU n 
1 397 PRO n 
1 398 ASP n 
1 399 SER n 
1 400 VAL n 
1 401 ARG n 
1 402 ASN n 
1 403 TYR n 
1 404 MET n 
1 405 THR n 
1 406 LYS n 
1 407 PHE n 
1 408 LEU n 
1 409 SER n 
1 410 ASP n 
1 411 ARG n 
1 412 TRP n 
1 413 MET n 
1 414 LEU n 
1 415 GLN n 
1 416 LYS n 
1 417 GLY n 
1 418 PHE n 
1 419 LEU n 
1 420 LYS n 
1 421 GLU n 
1 422 GLU n 
1 423 ASP n 
1 424 LEU n 
1 425 THR n 
1 426 GLU n 
1 427 LYS n 
1 428 LYS n 
1 429 PRO n 
1 430 TRP n 
1 431 TRP n 
1 432 TRP n 
1 433 HIS n 
1 434 LEU n 
1 435 ARG n 
1 436 VAL n 
1 437 GLN n 
1 438 GLU n 
1 439 LEU n 
1 440 GLY n 
1 441 LEU n 
1 442 SER n 
1 443 ALA n 
1 444 PRO n 
1 445 LEU n 
1 446 THR n 
1 447 VAL n 
1 448 LEU n 
1 449 PRO n 
1 450 THR n 
1 451 ILE n 
1 452 THR n 
1 453 CYS n 
1 454 GLY n 
1 455 HIS n 
1 456 THR n 
1 457 ILE n 
1 458 GLU n 
1 459 ILE n 
1 460 LEU n 
1 461 ARG n 
1 462 GLU n 
1 463 LYS n 
1 464 GLY n 
1 465 PHE n 
1 466 ASP n 
1 467 GLN n 
1 468 ALA n 
1 469 PRO n 
1 470 VAL n 
1 471 VAL n 
1 472 ASP n 
1 473 GLU n 
1 474 ALA n 
1 475 GLY n 
1 476 VAL n 
1 477 ILE n 
1 478 LEU n 
1 479 GLY n 
1 480 MET n 
1 481 VAL n 
1 482 THR n 
1 483 LEU n 
1 484 GLY n 
1 485 ASN n 
1 486 MET n 
1 487 LEU n 
1 488 SER n 
1 489 SER n 
1 490 LEU n 
1 491 LEU n 
1 492 ALA n 
1 493 GLY n 
1 494 LYS n 
1 495 VAL n 
1 496 GLN n 
1 497 PRO n 
1 498 SER n 
1 499 ASP n 
1 500 GLN n 
1 501 VAL n 
1 502 GLY n 
1 503 LYS n 
1 504 VAL n 
1 505 ILE n 
1 506 TYR n 
1 507 LYS n 
1 508 GLN n 
1 509 PHE n 
1 510 LYS n 
1 511 GLN n 
1 512 ILE n 
1 513 ARG n 
1 514 LEU n 
1 515 THR n 
1 516 ASP n 
1 517 THR n 
1 518 LEU n 
1 519 GLY n 
1 520 ARG n 
1 521 LEU n 
1 522 SER n 
1 523 HIS n 
1 524 ILE n 
1 525 LEU n 
1 526 GLU n 
1 527 MET n 
1 528 ASP n 
1 529 HIS n 
1 530 PHE n 
1 531 ALA n 
1 532 LEU n 
1 533 VAL n 
1 534 VAL n 
1 535 HIS n 
1 536 GLU n 
1 537 GLN n 
1 538 GLN n 
1 539 ARG n 
1 540 GLN n 
1 541 MET n 
1 542 VAL n 
1 543 PHE n 
1 544 GLY n 
1 545 VAL n 
1 546 VAL n 
1 547 THR n 
1 548 ALA n 
1 549 ILE n 
1 550 ASP n 
1 551 LEU n 
1 552 LEU n 
1 553 ASN n 
1 554 PHE n 
1 555 VAL n 
1 556 ALA n 
1 557 ALA n 
1 558 GLN n 
1 559 GLU n 
1 560 ARG n 
1 561 ASP n 
1 562 GLN n 
1 563 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              R3-PRARE2 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PNIC28-BSA4 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CBS_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P35520 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4COO A 23 ? 563 ? P35520 1 ? 551 ? 1 551 
2 1 4COO B 23 ? 563 ? P35520 1 ? 551 ? 1 541 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4COO MET A 1  ? UNP P35520 ?   ?   'expression tag' -21 1  
1 4COO HIS A 2  ? UNP P35520 ?   ?   'expression tag' -20 2  
1 4COO HIS A 3  ? UNP P35520 ?   ?   'expression tag' -19 3  
1 4COO HIS A 4  ? UNP P35520 ?   ?   'expression tag' -18 4  
1 4COO HIS A 5  ? UNP P35520 ?   ?   'expression tag' -17 5  
1 4COO HIS A 6  ? UNP P35520 ?   ?   'expression tag' -16 6  
1 4COO HIS A 7  ? UNP P35520 ?   ?   'expression tag' -15 7  
1 4COO SER A 8  ? UNP P35520 ?   ?   'expression tag' -14 8  
1 4COO SER A 9  ? UNP P35520 ?   ?   'expression tag' -13 9  
1 4COO GLY A 10 ? UNP P35520 ?   ?   'expression tag' -12 10 
1 4COO VAL A 11 ? UNP P35520 ?   ?   'expression tag' -11 11 
1 4COO ASP A 12 ? UNP P35520 ?   ?   'expression tag' -10 12 
1 4COO LEU A 13 ? UNP P35520 ?   ?   'expression tag' -9  13 
1 4COO GLY A 14 ? UNP P35520 ?   ?   'expression tag' -8  14 
1 4COO THR A 15 ? UNP P35520 ?   ?   'expression tag' -7  15 
1 4COO GLU A 16 ? UNP P35520 ?   ?   'expression tag' -6  16 
1 4COO ASN A 17 ? UNP P35520 ?   ?   'expression tag' -5  17 
1 4COO LEU A 18 ? UNP P35520 ?   ?   'expression tag' -4  18 
1 4COO TYR A 19 ? UNP P35520 ?   ?   'expression tag' -3  19 
1 4COO PHE A 20 ? UNP P35520 ?   ?   'expression tag' -2  20 
1 4COO GLN A 21 ? UNP P35520 ?   ?   'expression tag' -1  21 
1 4COO SER A 22 ? UNP P35520 ?   ?   'expression tag' 0   22 
1 4COO ?   A ?  ? UNP P35520 ILE 516 deletion         ?   23 
1 4COO ?   A ?  ? UNP P35520 GLN 517 deletion         ?   24 
1 4COO ?   A ?  ? UNP P35520 TYR 518 deletion         ?   25 
1 4COO ?   A ?  ? UNP P35520 HIS 519 deletion         ?   26 
1 4COO ?   A ?  ? UNP P35520 SER 520 deletion         ?   27 
1 4COO ?   A ?  ? UNP P35520 THR 521 deletion         ?   28 
1 4COO ?   A ?  ? UNP P35520 GLY 522 deletion         ?   29 
1 4COO ?   A ?  ? UNP P35520 LYS 523 deletion         ?   30 
1 4COO ?   A ?  ? UNP P35520 SER 524 deletion         ?   31 
1 4COO ?   A ?  ? UNP P35520 SER 525 deletion         ?   32 
2 4COO MET B 1  ? UNP P35520 ?   ?   'expression tag' -21 33 
2 4COO HIS B 2  ? UNP P35520 ?   ?   'expression tag' -20 34 
2 4COO HIS B 3  ? UNP P35520 ?   ?   'expression tag' -19 35 
2 4COO HIS B 4  ? UNP P35520 ?   ?   'expression tag' -18 36 
2 4COO HIS B 5  ? UNP P35520 ?   ?   'expression tag' -17 37 
2 4COO HIS B 6  ? UNP P35520 ?   ?   'expression tag' -16 38 
2 4COO HIS B 7  ? UNP P35520 ?   ?   'expression tag' -15 39 
2 4COO SER B 8  ? UNP P35520 ?   ?   'expression tag' -14 40 
2 4COO SER B 9  ? UNP P35520 ?   ?   'expression tag' -13 41 
2 4COO GLY B 10 ? UNP P35520 ?   ?   'expression tag' -12 42 
2 4COO VAL B 11 ? UNP P35520 ?   ?   'expression tag' -11 43 
2 4COO ASP B 12 ? UNP P35520 ?   ?   'expression tag' -10 44 
2 4COO LEU B 13 ? UNP P35520 ?   ?   'expression tag' -9  45 
2 4COO GLY B 14 ? UNP P35520 ?   ?   'expression tag' -8  46 
2 4COO THR B 15 ? UNP P35520 ?   ?   'expression tag' -7  47 
2 4COO GLU B 16 ? UNP P35520 ?   ?   'expression tag' -6  48 
2 4COO ASN B 17 ? UNP P35520 ?   ?   'expression tag' -5  49 
2 4COO LEU B 18 ? UNP P35520 ?   ?   'expression tag' -4  50 
2 4COO TYR B 19 ? UNP P35520 ?   ?   'expression tag' -3  51 
2 4COO PHE B 20 ? UNP P35520 ?   ?   'expression tag' -2  52 
2 4COO GLN B 21 ? UNP P35520 ?   ?   'expression tag' -1  53 
2 4COO SER B 22 ? UNP P35520 ?   ?   'expression tag' 0   54 
2 4COO ?   B ?  ? UNP P35520 ILE 516 deletion         ?   55 
2 4COO ?   B ?  ? UNP P35520 GLN 517 deletion         ?   56 
2 4COO ?   B ?  ? UNP P35520 TYR 518 deletion         ?   57 
2 4COO ?   B ?  ? UNP P35520 HIS 519 deletion         ?   58 
2 4COO ?   B ?  ? UNP P35520 SER 520 deletion         ?   59 
2 4COO ?   B ?  ? UNP P35520 THR 521 deletion         ?   60 
2 4COO ?   B ?  ? UNP P35520 GLY 522 deletion         ?   61 
2 4COO ?   B ?  ? UNP P35520 LYS 523 deletion         ?   62 
2 4COO ?   B ?  ? UNP P35520 SER 524 deletion         ?   63 
2 4COO ?   B ?  ? UNP P35520 SER 525 deletion         ?   64 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'                                                                        ? 'C2 H3 O2 -1' 
59.044  
ALA 'L-peptide linking' y ALANINE                                                                              ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                             ? 'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                           ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                      ? 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                             ? 'C3 H7 N O2 S' 
121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                                                       'ETHYLENE GLYCOL' 
'C2 H6 O2'         62.068  
GLN 'L-peptide linking' y GLUTAMINE                                                                            ? 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                      ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                              ? 'C2 H5 N O2' 
75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE'                                                    HEME 
'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                                                                            ? 'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                                                                ? 'H2 O' 18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                           ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                              ? 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                               ? 'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                                                           ? 'C5 H11 N O2 S' 
149.211 
NA  non-polymer         . 'SODIUM ION'                                                                         ? 'Na 1' 22.990  
PE4 non-polymer         . '2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL' 
'POLYETHYLENE GLYCOL PEG4000' 'C16 H34 O8'       354.436 
PHE 'L-peptide linking' y PHENYLALANINE                                                                        ? 'C9 H11 N O2' 
165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE"                                                             
'VITAMIN B6 Phosphate'        'C8 H10 N O6 P'    247.142 
PRO 'L-peptide linking' y PROLINE                                                                              ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                               ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                            ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                           ? 'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                             ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                               ? 'C5 H11 N O2' 
117.146 
# 
_exptl.entry_id          4COO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.89 
_exptl_crystal.density_percent_sol   57.42 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '18% PEG8000, 0.1 M CACODYLATE, PH 6.6 0.2 M SODIUM ACETATE' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2013-06-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_wavelength             0.9795 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4COO 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48.89 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   93295 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.10 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.03 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.85 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.00 
_reflns_shell.pdbx_redundancy        4.6 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4COO 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     88563 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             95.56 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    99.64 
_refine.ls_R_factor_obs                          0.17517 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17381 
_refine.ls_R_factor_R_free                       0.20068 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4662 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.966 
_refine.correlation_coeff_Fo_to_Fc_free          0.950 
_refine.B_iso_mean                               43.704 
_refine.aniso_B[1][1]                            -1.20 
_refine.aniso_B[2][2]                            1.56 
_refine.aniso_B[3][3]                            -0.35 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1JBQ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.134 
_refine.pdbx_overall_ESU_R_Free                  0.123 
_refine.overall_SU_ML                            0.098 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             7.023 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7495 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         173 
_refine_hist.number_atoms_solvent             294 
_refine_hist.number_atoms_total               7962 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        95.56 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.019  ? 7926  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 7689  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.430  1.989  ? 10773 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.804  3.000  ? 17671 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.772  5.000  ? 995   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       31.873 23.912 ? 317   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.092 15.000 ? 1351  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.870 15.000 ? 54    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.082  0.200  ? 1215  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.021  ? 8899  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.004  0.020  ? 1733  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.388  2.399  ? 3959  'X-RAY DIFFRACTION' ? 
r_mcbond_other               1.386  2.396  ? 3953  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.261  3.582  ? 4944  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.873  2.698  ? 3967  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.052 
_refine_ls_shell.number_reflns_R_work             6445 
_refine_ls_shell.R_factor_R_work                  0.275 
_refine_ls_shell.percent_reflns_obs               99.72 
_refine_ls_shell.R_factor_R_free                  0.298 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             329 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4COO 
_struct.title                     
'Crystal structure of human cystathionine beta-synthase (delta516-525) at 2.0 angstrom resolution' 
_struct.pdbx_descriptor           'CYSTATHIONINE BETA-SYNTHASE (E.C.4.2.1.22)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4COO 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'LYASE, METHIONINE CYCLE, METABOLIC PATHWAY, ALLOSTERIC REGULATION, SERINE METABOLISM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 7 ? 
M N N 5 ? 
N N N 2 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 4 ? 
S N N 5 ? 
T N N 7 ? 
U N N 3 ? 
V N N 8 ? 
W N N 8 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 81  ? SER A 85  ? PRO A 59  SER A 63  5 ? 5  
HELX_P HELX_P2  2  ASP A 101 ? LYS A 105 ? ASP A 79  LYS A 83  5 ? 5  
HELX_P HELX_P3  3  LYS A 116 ? PHE A 121 ? LYS A 94  PHE A 99  1 ? 6  
HELX_P HELX_P4  4  PHE A 133 ? ASN A 135 ? PHE A 111 ASN A 113 5 ? 3  
HELX_P HELX_P5  5  VAL A 140 ? ASP A 155 ? VAL A 118 ASP A 133 1 ? 16 
HELX_P HELX_P6  6  GLY A 170 ? GLY A 184 ? GLY A 148 GLY A 162 1 ? 15 
HELX_P HELX_P7  7  SER A 196 ? LEU A 206 ? SER A 174 LEU A 184 1 ? 11 
HELX_P HELX_P8  8  SER A 224 ? ILE A 236 ? SER A 202 ILE A 214 1 ? 13 
HELX_P HELX_P9  9  ALA A 248 ? THR A 257 ? ALA A 226 THR A 235 1 ? 10 
HELX_P HELX_P10 10 THR A 257 ? CYS A 266 ? THR A 235 CYS A 244 1 ? 10 
HELX_P HELX_P11 11 GLY A 280 ? CYS A 294 ? GLY A 258 CYS A 272 1 ? 15 
HELX_P HELX_P12 12 PRO A 312 ? GLN A 317 ? PRO A 290 GLN A 295 5 ? 6  
HELX_P HELX_P13 13 ASP A 338 ? VAL A 342 ? ASP A 316 VAL A 320 5 ? 5  
HELX_P HELX_P14 14 ASN A 349 ? GLY A 365 ? ASN A 327 GLY A 343 1 ? 17 
HELX_P HELX_P15 15 GLY A 369 ? ALA A 383 ? GLY A 347 ALA A 361 1 ? 15 
HELX_P HELX_P16 16 GLN A 384 ? LEU A 386 ? GLN A 362 LEU A 364 5 ? 3  
HELX_P HELX_P17 17 VAL A 400 ? MET A 404 ? VAL A 378 MET A 382 5 ? 5  
HELX_P HELX_P18 18 SER A 409 ? LYS A 416 ? SER A 387 LYS A 394 1 ? 8  
HELX_P HELX_P19 19 LYS A 420 ? LYS A 427 ? LYS A 398 LYS A 405 1 ? 8  
HELX_P HELX_P20 20 VAL A 436 ? GLY A 440 ? VAL A 414 GLY A 418 5 ? 5  
HELX_P HELX_P21 21 THR A 452 ? GLY A 464 ? THR A 430 GLY A 442 1 ? 13 
HELX_P HELX_P22 22 LEU A 483 ? ALA A 492 ? LEU A 461 ALA A 470 1 ? 10 
HELX_P HELX_P23 23 VAL A 501 ? VAL A 504 ? VAL A 479 VAL A 482 5 ? 4  
HELX_P HELX_P24 24 THR A 517 ? LEU A 525 ? THR A 495 LEU A 503 1 ? 9  
HELX_P HELX_P25 25 THR A 547 ? ARG A 560 ? THR A 535 ARG A 548 1 ? 14 
HELX_P HELX_P26 26 PRO B 81  ? SER B 85  ? PRO B 59  SER B 63  5 ? 5  
HELX_P HELX_P27 27 ASP B 101 ? LYS B 105 ? ASP B 79  LYS B 83  5 ? 5  
HELX_P HELX_P28 28 LYS B 116 ? PHE B 121 ? LYS B 94  PHE B 99  1 ? 6  
HELX_P HELX_P29 29 PHE B 133 ? ASN B 135 ? PHE B 111 ASN B 113 5 ? 3  
HELX_P HELX_P30 30 VAL B 140 ? ASP B 155 ? VAL B 118 ASP B 133 1 ? 16 
HELX_P HELX_P31 31 GLY B 170 ? GLY B 184 ? GLY B 148 GLY B 162 1 ? 15 
HELX_P HELX_P32 32 SER B 196 ? LEU B 206 ? SER B 174 LEU B 184 1 ? 11 
HELX_P HELX_P33 33 SER B 224 ? ILE B 236 ? SER B 202 ILE B 214 1 ? 13 
HELX_P HELX_P34 34 ALA B 248 ? THR B 257 ? ALA B 226 THR B 235 1 ? 10 
HELX_P HELX_P35 35 THR B 257 ? CYS B 266 ? THR B 235 CYS B 244 1 ? 10 
HELX_P HELX_P36 36 GLY B 280 ? CYS B 294 ? GLY B 258 CYS B 272 1 ? 15 
HELX_P HELX_P37 37 PRO B 312 ? GLN B 317 ? PRO B 290 GLN B 295 5 ? 6  
HELX_P HELX_P38 38 ASP B 338 ? VAL B 342 ? ASP B 316 VAL B 320 5 ? 5  
HELX_P HELX_P39 39 ASN B 349 ? GLY B 365 ? ASN B 327 GLY B 343 1 ? 17 
HELX_P HELX_P40 40 GLY B 369 ? ALA B 383 ? GLY B 347 ALA B 361 1 ? 15 
HELX_P HELX_P41 41 VAL B 400 ? MET B 404 ? VAL B 378 MET B 382 5 ? 5  
HELX_P HELX_P42 42 SER B 409 ? LYS B 416 ? SER B 387 LYS B 394 1 ? 8  
HELX_P HELX_P43 43 VAL B 436 ? GLY B 440 ? VAL B 414 GLY B 418 5 ? 5  
HELX_P HELX_P44 44 THR B 452 ? GLY B 464 ? THR B 430 GLY B 442 1 ? 13 
HELX_P HELX_P45 45 LEU B 483 ? ALA B 492 ? LEU B 461 ALA B 470 1 ? 10 
HELX_P HELX_P46 46 VAL B 501 ? VAL B 504 ? VAL B 479 VAL B 482 5 ? 4  
HELX_P HELX_P47 47 THR B 517 ? LEU B 525 ? THR B 495 LEU B 503 1 ? 9  
HELX_P HELX_P48 48 THR B 547 ? ARG B 560 ? THR B 525 ARG B 538 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 74  SG  ? ? ? 1_555 C HEM . FE  ? ? A CYS 52   A HEM 1549 1_555 ? ? ? ? ? ? ? 2.500 ? 
metalc2 metalc ? ? A HIS 87  NE2 ? ? ? 1_555 C HEM . FE  ? ? A HIS 65   A HEM 1549 1_555 ? ? ? ? ? ? ? 2.165 ? 
covale1 covale ? ? A LYS 141 NZ  ? ? ? 1_555 E PLP . C4A ? ? A LYS 119  A PLP 1551 1_555 ? ? ? ? ? ? ? 1.631 ? 
metalc3 metalc ? ? L NA  .   NA  ? ? ? 1_555 V HOH . O   ? ? A NA  1558 A HOH 2125 1_555 ? ? ? ? ? ? ? 3.047 ? 
metalc4 metalc ? ? B CYS 74  SG  ? ? ? 1_555 N HEM . FE  ? ? B CYS 52   B HEM 1539 1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc5 metalc ? ? B HIS 87  NE2 ? ? ? 1_555 N HEM . FE  ? ? B HIS 65   B HEM 1539 1_555 ? ? ? ? ? ? ? 2.137 ? 
covale2 covale ? ? B LYS 141 NZ  ? ? ? 1_555 R PLP . C4A ? ? B LYS 119  B PLP 1543 1_555 ? ? ? ? ? ? ? 1.671 ? 
metalc6 metalc ? ? T NA  .   NA  ? ? ? 1_555 W HOH . O   ? ? B NA  1545 B HOH 2058 1_555 ? ? ? ? ? ? ? 2.846 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 311 A . ? GLU 289 A PRO 312 A ? PRO 290 A 1 -3.47 
2 GLU 311 B . ? GLU 289 B PRO 312 B ? PRO 290 B 1 -0.33 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
AB ? 4 ? 
AC ? 2 ? 
AD ? 3 ? 
BA ? 6 ? 
BB ? 4 ? 
BC ? 2 ? 
BD ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AB 1 2 ? parallel      
AB 2 3 ? parallel      
AB 3 4 ? parallel      
AC 1 2 ? anti-parallel 
AD 1 2 ? parallel      
AD 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? parallel      
BA 3 4 ? parallel      
BA 4 5 ? parallel      
BA 5 6 ? parallel      
BB 1 2 ? parallel      
BB 2 3 ? parallel      
BB 3 4 ? parallel      
BC 1 2 ? anti-parallel 
BD 1 2 ? parallel      
BD 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 MET A 111 ? ARG A 113 ? MET A 89  ARG A 91  
AA 2 GLU A 126 ? CYS A 131 ? GLU A 104 CYS A 109 
AA 3 ARG A 391 ? LEU A 396 ? ARG A 369 LEU A 374 
AA 4 MET A 272 ? SER A 276 ? MET A 250 SER A 254 
AA 5 ARG A 298 ? PRO A 304 ? ARG A 276 PRO A 282 
AA 6 LYS A 344 ? SER A 348 ? LYS A 322 SER A 326 
AB 1 GLU A 209 ? THR A 213 ? GLU A 187 THR A 191 
AB 2 ARG A 186 ? PRO A 192 ? ARG A 164 PRO A 170 
AB 3 THR A 163 ? PRO A 167 ? THR A 141 PRO A 145 
AB 4 SER A 239 ? HIS A 240 ? SER A 217 HIS A 218 
AC 1 GLN A 467 ? VAL A 471 ? GLN A 445 VAL A 449 
AC 2 ILE A 477 ? THR A 482 ? ILE A 455 THR A 460 
AD 1 LYS A 510 ? ARG A 513 ? LYS A 488 ARG A 491 
AD 2 ALA A 531 ? VAL A 534 ? ALA A 509 VAL A 512 
AD 3 VAL A 542 ? VAL A 546 ? VAL A 530 VAL A 534 
BA 1 MET B 111 ? ARG B 113 ? MET B 89  ARG B 91  
BA 2 GLU B 126 ? CYS B 131 ? GLU B 104 CYS B 109 
BA 3 ARG B 391 ? LEU B 396 ? ARG B 369 LEU B 374 
BA 4 MET B 272 ? SER B 276 ? MET B 250 SER B 254 
BA 5 ARG B 298 ? PRO B 304 ? ARG B 276 PRO B 282 
BA 6 LYS B 344 ? SER B 348 ? LYS B 322 SER B 326 
BB 1 GLU B 209 ? THR B 213 ? GLU B 187 THR B 191 
BB 2 ARG B 186 ? PRO B 192 ? ARG B 164 PRO B 170 
BB 3 THR B 163 ? PRO B 167 ? THR B 141 PRO B 145 
BB 4 SER B 239 ? HIS B 240 ? SER B 217 HIS B 218 
BC 1 GLN B 467 ? VAL B 471 ? GLN B 445 VAL B 449 
BC 2 ILE B 477 ? THR B 482 ? ILE B 455 THR B 460 
BD 1 LYS B 510 ? ARG B 513 ? LYS B 488 ARG B 491 
BD 2 ALA B 531 ? VAL B 534 ? ALA B 509 VAL B 512 
BD 3 GLY B 544 ? VAL B 546 ? GLY B 522 VAL B 524 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N VAL A 112 ? N VAL A 90  O ALA A 129 ? O ALA A 107 
AA 2 3 N LEU A 128 ? N LEU A 106 O CYS A 392 ? O CYS A 370 
AA 3 4 N VAL A 393 ? N VAL A 371 O MET A 272 ? O MET A 250 
AA 4 5 N LEU A 273 ? N LEU A 251 O ARG A 298 ? O ARG A 276 
AA 5 6 N GLY A 301 ? N GLY A 279 O LYS A 344 ? O LYS A 322 
AB 1 2 N GLU A 209 ? N GLU A 187 O CYS A 187 ? O CYS A 165 
AB 2 3 N ILE A 188 ? N ILE A 166 O ILE A 164 ? O ILE A 142 
AB 3 4 N ILE A 165 ? N ILE A 143 O HIS A 240 ? O HIS A 218 
AC 1 2 O VAL A 470 ? O VAL A 448 N LEU A 478 ? N LEU A 456 
AD 1 2 N ILE A 512 ? N ILE A 490 O LEU A 532 ? O LEU A 510 
AD 2 3 O VAL A 533 ? O VAL A 511 N PHE A 543 ? N PHE A 531 
BA 1 2 N VAL B 112 ? N VAL B 90  O ALA B 129 ? O ALA B 107 
BA 2 3 N LEU B 128 ? N LEU B 106 O CYS B 392 ? O CYS B 370 
BA 3 4 N VAL B 393 ? N VAL B 371 O MET B 272 ? O MET B 250 
BA 4 5 N LEU B 273 ? N LEU B 251 O ARG B 298 ? O ARG B 276 
BA 5 6 N GLY B 301 ? N GLY B 279 O LYS B 344 ? O LYS B 322 
BB 1 2 N GLU B 209 ? N GLU B 187 O CYS B 187 ? O CYS B 165 
BB 2 3 N ILE B 188 ? N ILE B 166 O ILE B 164 ? O ILE B 142 
BB 3 4 N ILE B 165 ? N ILE B 143 O HIS B 240 ? O HIS B 218 
BC 1 2 O VAL B 470 ? O VAL B 448 N LEU B 478 ? N LEU B 456 
BD 1 2 N ILE B 512 ? N ILE B 490 O LEU B 532 ? O LEU B 510 
BD 2 3 N VAL B 533 ? N VAL B 511 O GLY B 544 ? O GLY B 522 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM A 1549' 
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE HEM B 1539' 
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE ACT A 1550' 
AC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE ACT B 1540' 
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE ACT B 1541' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACT B 1542' 
AC7 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE PLP A 1551' 
AC8 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE PLP B 1543' 
AC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE EDO A 1552' 
BC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE EDO A 1553' 
BC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO B 1544' 
BC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO A 1554' 
BC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 1555' 
BC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO A 1556' 
BC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE PE4 A 1557' 
BC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 1558'  
BC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA B 1545'  
BC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ACT B 1546' 
CC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO A 1559' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 17 SER A 72  ? SER A 50   . ? 1_555 ? 
2   AC1 17 ARG A 73  ? ARG A 51   . ? 1_555 ? 
3   AC1 17 CYS A 74  ? CYS A 52   . ? 1_555 ? 
4   AC1 17 THR A 75  ? THR A 53   . ? 1_555 ? 
5   AC1 17 TRP A 76  ? TRP A 54   . ? 1_555 ? 
6   AC1 17 GLU A 84  ? GLU A 62   . ? 1_555 ? 
7   AC1 17 SER A 85  ? SER A 63   . ? 1_555 ? 
8   AC1 17 PRO A 86  ? PRO A 64   . ? 1_555 ? 
9   AC1 17 HIS A 87  ? HIS A 65   . ? 1_555 ? 
10  AC1 17 ARG A 246 ? ARG A 224  . ? 1_555 ? 
11  AC1 17 ALA A 248 ? ALA A 226  . ? 1_555 ? 
12  AC1 17 LEU A 252 ? LEU A 230  . ? 1_555 ? 
13  AC1 17 TYR A 255 ? TYR A 233  . ? 1_555 ? 
14  AC1 17 ARG A 288 ? ARG A 266  . ? 1_555 ? 
15  AC1 17 EDO F .   ? EDO A 1552 . ? 1_555 ? 
16  AC1 17 HOH V .   ? HOH A 2091 . ? 1_555 ? 
17  AC1 17 HOH V .   ? HOH A 2096 . ? 1_555 ? 
18  AC2 15 SER B 72  ? SER B 50   . ? 1_555 ? 
19  AC2 15 ARG B 73  ? ARG B 51   . ? 1_555 ? 
20  AC2 15 CYS B 74  ? CYS B 52   . ? 1_555 ? 
21  AC2 15 THR B 75  ? THR B 53   . ? 1_555 ? 
22  AC2 15 PRO B 81  ? PRO B 59   . ? 1_555 ? 
23  AC2 15 GLU B 84  ? GLU B 62   . ? 1_555 ? 
24  AC2 15 SER B 85  ? SER B 63   . ? 1_555 ? 
25  AC2 15 PRO B 86  ? PRO B 64   . ? 1_555 ? 
26  AC2 15 HIS B 87  ? HIS B 65   . ? 1_555 ? 
27  AC2 15 ALA B 248 ? ALA B 226  . ? 1_555 ? 
28  AC2 15 PRO B 251 ? PRO B 229  . ? 1_555 ? 
29  AC2 15 TYR B 255 ? TYR B 233  . ? 1_555 ? 
30  AC2 15 ARG B 288 ? ARG B 266  . ? 1_555 ? 
31  AC2 15 EDO S .   ? EDO B 1544 . ? 1_555 ? 
32  AC2 15 HOH W .   ? HOH B 2102 . ? 1_555 ? 
33  AC3 8  LYS A 141 ? LYS A 119  . ? 1_555 ? 
34  AC3 8  THR A 168 ? THR A 146  . ? 1_555 ? 
35  AC3 8  SER A 169 ? SER A 147  . ? 1_555 ? 
36  AC3 8  ASN A 171 ? ASN A 149  . ? 1_555 ? 
37  AC3 8  THR A 172 ? THR A 150  . ? 1_555 ? 
38  AC3 8  GLN A 244 ? GLN A 222  . ? 1_555 ? 
39  AC3 8  HOH V .   ? HOH A 2047 . ? 1_555 ? 
40  AC3 8  HOH V .   ? HOH A 2048 . ? 1_555 ? 
41  AC4 8  LYS B 141 ? LYS B 119  . ? 1_555 ? 
42  AC4 8  THR B 168 ? THR B 146  . ? 1_555 ? 
43  AC4 8  SER B 169 ? SER B 147  . ? 1_555 ? 
44  AC4 8  ASN B 171 ? ASN B 149  . ? 1_555 ? 
45  AC4 8  THR B 172 ? THR B 150  . ? 1_555 ? 
46  AC4 8  GLN B 244 ? GLN B 222  . ? 1_555 ? 
47  AC4 8  HOH W .   ? HOH B 2018 . ? 1_555 ? 
48  AC4 8  HOH W .   ? HOH B 2019 . ? 1_555 ? 
49  AC5 3  EDO M .   ? EDO A 1559 . ? 1_555 ? 
50  AC5 3  GLU B 209 ? GLU B 187  . ? 1_555 ? 
51  AC5 3  VAL B 211 ? VAL B 189  . ? 1_555 ? 
52  AC6 4  EDO H .   ? EDO A 1554 . ? 1_555 ? 
53  AC6 4  HOH V .   ? HOH A 2190 . ? 1_555 ? 
54  AC6 4  TRP B 431 ? TRP B 409  . ? 1_555 ? 
55  AC6 4  LEU B 552 ? LEU B 530  . ? 1_555 ? 
56  AC7 18 LYS A 141 ? LYS A 119  . ? 1_555 ? 
57  AC7 18 ASN A 171 ? ASN A 149  . ? 1_555 ? 
58  AC7 18 SER A 276 ? SER A 254  . ? 1_555 ? 
59  AC7 18 VAL A 277 ? VAL A 255  . ? 1_555 ? 
60  AC7 18 GLY A 278 ? GLY A 256  . ? 1_555 ? 
61  AC7 18 THR A 279 ? THR A 257  . ? 1_555 ? 
62  AC7 18 GLY A 280 ? GLY A 258  . ? 1_555 ? 
63  AC7 18 GLY A 281 ? GLY A 259  . ? 1_555 ? 
64  AC7 18 THR A 282 ? THR A 260  . ? 1_555 ? 
65  AC7 18 GLY A 327 ? GLY A 305  . ? 1_555 ? 
66  AC7 18 ILE A 328 ? ILE A 306  . ? 1_555 ? 
67  AC7 18 SER A 371 ? SER A 349  . ? 1_555 ? 
68  AC7 18 PRO A 397 ? PRO A 375  . ? 1_555 ? 
69  AC7 18 ASP A 398 ? ASP A 376  . ? 1_555 ? 
70  AC7 18 HOH V .   ? HOH A 2047 . ? 1_555 ? 
71  AC7 18 HOH V .   ? HOH A 2094 . ? 1_555 ? 
72  AC7 18 HOH V .   ? HOH A 2106 . ? 1_555 ? 
73  AC7 18 HOH V .   ? HOH A 2107 . ? 1_555 ? 
74  AC8 19 LYS B 141 ? LYS B 119  . ? 1_555 ? 
75  AC8 19 ASN B 171 ? ASN B 149  . ? 1_555 ? 
76  AC8 19 SER B 276 ? SER B 254  . ? 1_555 ? 
77  AC8 19 VAL B 277 ? VAL B 255  . ? 1_555 ? 
78  AC8 19 GLY B 278 ? GLY B 256  . ? 1_555 ? 
79  AC8 19 THR B 279 ? THR B 257  . ? 1_555 ? 
80  AC8 19 GLY B 280 ? GLY B 258  . ? 1_555 ? 
81  AC8 19 GLY B 281 ? GLY B 259  . ? 1_555 ? 
82  AC8 19 THR B 282 ? THR B 260  . ? 1_555 ? 
83  AC8 19 GLU B 326 ? GLU B 304  . ? 1_555 ? 
84  AC8 19 GLY B 327 ? GLY B 305  . ? 1_555 ? 
85  AC8 19 ILE B 328 ? ILE B 306  . ? 1_555 ? 
86  AC8 19 SER B 371 ? SER B 349  . ? 1_555 ? 
87  AC8 19 PRO B 397 ? PRO B 375  . ? 1_555 ? 
88  AC8 19 ASP B 398 ? ASP B 376  . ? 1_555 ? 
89  AC8 19 HOH W .   ? HOH B 2019 . ? 1_555 ? 
90  AC8 19 HOH W .   ? HOH B 2044 . ? 1_555 ? 
91  AC8 19 HOH W .   ? HOH B 2047 . ? 1_555 ? 
92  AC8 19 HOH W .   ? HOH B 2048 . ? 1_555 ? 
93  AC9 7  SER A 72  ? SER A 50   . ? 1_555 ? 
94  AC9 7  PRO A 251 ? PRO A 229  . ? 1_555 ? 
95  AC9 7  THR A 284 ? THR A 262  . ? 1_555 ? 
96  AC9 7  ARG A 288 ? ARG A 266  . ? 1_555 ? 
97  AC9 7  THR A 335 ? THR A 313  . ? 1_555 ? 
98  AC9 7  VAL A 336 ? VAL A 314  . ? 1_555 ? 
99  AC9 7  HEM C .   ? HEM A 1549 . ? 1_555 ? 
100 BC1 7  ALA A 217 ? ALA A 195  . ? 1_555 ? 
101 BC1 7  PHE A 219 ? PHE A 197  . ? 1_555 ? 
102 BC1 7  SER A 224 ? SER A 202  . ? 1_555 ? 
103 BC1 7  HIS A 225 ? HIS A 203  . ? 1_555 ? 
104 BC1 7  TYR A 330 ? TYR A 308  . ? 1_555 ? 
105 BC1 7  ASP A 331 ? ASP A 309  . ? 1_555 ? 
106 BC1 7  HOH V .   ? HOH A 2081 . ? 1_555 ? 
107 BC2 6  SER B 72  ? SER B 50   . ? 1_555 ? 
108 BC2 6  THR B 284 ? THR B 262  . ? 1_555 ? 
109 BC2 6  ARG B 288 ? ARG B 266  . ? 1_555 ? 
110 BC2 6  THR B 335 ? THR B 313  . ? 1_555 ? 
111 BC2 6  VAL B 336 ? VAL B 314  . ? 1_555 ? 
112 BC2 6  HEM N .   ? HEM B 1539 . ? 1_555 ? 
113 BC3 4  GLU A 209 ? GLU A 187  . ? 1_555 ? 
114 BC3 4  HOH V .   ? HOH A 2190 . ? 1_555 ? 
115 BC3 4  ACT Q .   ? ACT B 1542 . ? 1_555 ? 
116 BC3 4  ACT U .   ? ACT B 1546 . ? 1_555 ? 
117 BC4 5  LYS A 507 ? LYS A 485  . ? 1_555 ? 
118 BC4 5  GLN A 508 ? GLN A 486  . ? 1_555 ? 
119 BC4 5  PHE A 509 ? PHE A 487  . ? 1_555 ? 
120 BC4 5  HOH V .   ? HOH A 2174 . ? 1_555 ? 
121 BC4 5  HOH V .   ? HOH A 2191 . ? 1_555 ? 
122 BC5 3  LEU A 337 ? LEU A 315  . ? 1_555 ? 
123 BC5 3  ASP A 338 ? ASP A 316  . ? 1_555 ? 
124 BC5 3  ARG A 339 ? ARG A 317  . ? 1_555 ? 
125 BC6 5  ASP A 220 ? ASP A 198  . ? 2_554 ? 
126 BC6 5  PRO A 222 ? PRO A 200  . ? 2_554 ? 
127 BC6 5  GLU A 458 ? GLU A 436  . ? 1_555 ? 
128 BC6 5  ARG A 461 ? ARG A 439  . ? 1_555 ? 
129 BC6 5  GLY B 484 ? GLY B 462  . ? 2_554 ? 
130 BC7 5  LYS A 194 ? LYS A 172  . ? 1_555 ? 
131 BC7 5  MET A 195 ? MET A 173  . ? 1_555 ? 
132 BC7 5  GLY A 327 ? GLY A 305  . ? 1_555 ? 
133 BC7 5  ILE A 328 ? ILE A 306  . ? 1_555 ? 
134 BC7 5  HOH V .   ? HOH A 2125 . ? 1_555 ? 
135 BC8 5  LYS B 194 ? LYS B 172  . ? 1_555 ? 
136 BC8 5  MET B 195 ? MET B 173  . ? 1_555 ? 
137 BC8 5  GLY B 327 ? GLY B 305  . ? 1_555 ? 
138 BC8 5  ILE B 328 ? ILE B 306  . ? 1_555 ? 
139 BC8 5  HOH W .   ? HOH B 2058 . ? 1_555 ? 
140 BC9 6  ILE A 210 ? ILE A 188  . ? 1_555 ? 
141 BC9 6  VAL A 211 ? VAL A 189  . ? 1_555 ? 
142 BC9 6  EDO H .   ? EDO A 1554 . ? 1_555 ? 
143 BC9 6  SER B 522 ? SER B 500  . ? 1_555 ? 
144 BC9 6  GLU B 526 ? GLU B 504  . ? 1_555 ? 
145 BC9 6  LEU B 551 ? LEU B 529  . ? 1_555 ? 
146 CC1 4  LEU A 551 ? LEU A 539  . ? 1_555 ? 
147 CC1 4  LEU A 552 ? LEU A 540  . ? 1_555 ? 
148 CC1 4  HOH V .   ? HOH A 2189 . ? 1_555 ? 
149 CC1 4  ACT P .   ? ACT B 1541 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4COO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4COO 
_atom_sites.fract_transf_matrix[1][1]   0.014232 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008606 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005953 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . TRP A 1 65  ? 12.969  16.837  -9.339  1.00 66.82  ? 43   TRP A N   1 
ATOM   2    C  CA  . TRP A 1 65  ? 12.293  16.118  -10.454 1.00 62.63  ? 43   TRP A CA  1 
ATOM   3    C  C   . TRP A 1 65  ? 10.831  16.232  -10.190 1.00 60.55  ? 43   TRP A C   1 
ATOM   4    O  O   . TRP A 1 65  ? 10.409  16.133  -9.033  1.00 65.62  ? 43   TRP A O   1 
ATOM   5    C  CB  . TRP A 1 65  ? 12.653  14.622  -10.476 1.00 65.02  ? 43   TRP A CB  1 
ATOM   6    C  CG  . TRP A 1 65  ? 12.040  13.878  -11.646 1.00 63.80  ? 43   TRP A CG  1 
ATOM   7    C  CD1 . TRP A 1 65  ? 12.033  14.293  -12.939 1.00 61.66  ? 43   TRP A CD1 1 
ATOM   8    C  CD2 . TRP A 1 65  ? 11.364  12.598  -11.631 1.00 60.92  ? 43   TRP A CD2 1 
ATOM   9    N  NE1 . TRP A 1 65  ? 11.389  13.367  -13.740 1.00 66.08  ? 43   TRP A NE1 1 
ATOM   10   C  CE2 . TRP A 1 65  ? 10.980  12.312  -12.968 1.00 62.72  ? 43   TRP A CE2 1 
ATOM   11   C  CE3 . TRP A 1 65  ? 11.043  11.677  -10.625 1.00 62.21  ? 43   TRP A CE3 1 
ATOM   12   C  CZ2 . TRP A 1 65  ? 10.291  11.137  -13.332 1.00 61.20  ? 43   TRP A CZ2 1 
ATOM   13   C  CZ3 . TRP A 1 65  ? 10.362  10.497  -10.985 1.00 63.58  ? 43   TRP A CZ3 1 
ATOM   14   C  CH2 . TRP A 1 65  ? 9.983   10.247  -12.330 1.00 63.21  ? 43   TRP A CH2 1 
ATOM   15   N  N   . ILE A 1 66  ? 10.044  16.449  -11.239 1.00 56.57  ? 44   ILE A N   1 
ATOM   16   C  CA  . ILE A 1 66  ? 8.599   16.317  -11.087 1.00 50.28  ? 44   ILE A CA  1 
ATOM   17   C  C   . ILE A 1 66  ? 8.083   15.133  -11.942 1.00 41.01  ? 44   ILE A C   1 
ATOM   18   O  O   . ILE A 1 66  ? 8.202   15.125  -13.188 1.00 42.13  ? 44   ILE A O   1 
ATOM   19   C  CB  . ILE A 1 66  ? 7.846   17.638  -11.332 1.00 53.82  ? 44   ILE A CB  1 
ATOM   20   C  CG1 . ILE A 1 66  ? 6.331   17.396  -11.286 1.00 54.02  ? 44   ILE A CG1 1 
ATOM   21   C  CG2 . ILE A 1 66  ? 8.286   18.296  -12.641 1.00 57.84  ? 44   ILE A CG2 1 
ATOM   22   C  CD1 . ILE A 1 66  ? 5.837   16.708  -10.025 1.00 55.70  ? 44   ILE A CD1 1 
ATOM   23   N  N   . ARG A 1 67  ? 7.558   14.132  -11.245 1.00 56.75  ? 45   ARG A N   1 
ATOM   24   C  CA  A ARG A 1 67  ? 7.059   12.919  -11.865 0.50 52.33  ? 45   ARG A CA  1 
ATOM   25   C  CA  B ARG A 1 67  ? 7.083   12.931  -11.895 0.50 52.33  ? 45   ARG A CA  1 
ATOM   26   C  C   . ARG A 1 67  ? 5.970   13.257  -12.887 1.00 45.84  ? 45   ARG A C   1 
ATOM   27   O  O   . ARG A 1 67  ? 5.121   14.094  -12.629 1.00 45.02  ? 45   ARG A O   1 
ATOM   28   C  CB  A ARG A 1 67  ? 6.509   11.972  -10.795 0.50 53.70  ? 45   ARG A CB  1 
ATOM   29   C  CB  B ARG A 1 67  ? 6.615   11.904  -10.870 0.50 53.79  ? 45   ARG A CB  1 
ATOM   30   C  CG  A ARG A 1 67  ? 7.575   11.322  -9.920  0.50 57.06  ? 45   ARG A CG  1 
ATOM   31   C  CG  B ARG A 1 67  ? 5.429   12.319  -10.013 0.50 53.71  ? 45   ARG A CG  1 
ATOM   32   C  CD  A ARG A 1 67  ? 6.979   10.674  -8.679  0.50 58.58  ? 45   ARG A CD  1 
ATOM   33   C  CD  B ARG A 1 67  ? 5.336   11.357  -8.848  0.50 56.28  ? 45   ARG A CD  1 
ATOM   34   N  NE  A ARG A 1 67  ? 6.013   9.648   -9.050  0.50 56.35  ? 45   ARG A NE  1 
ATOM   35   N  NE  B ARG A 1 67  ? 4.198   11.596  -7.981  0.50 57.34  ? 45   ARG A NE  1 
ATOM   36   C  CZ  A ARG A 1 67  ? 6.331   8.388   -9.297  0.50 55.77  ? 45   ARG A CZ  1 
ATOM   37   C  CZ  B ARG A 1 67  ? 3.092   10.864  -7.986  0.50 56.33  ? 45   ARG A CZ  1 
ATOM   38   N  NH1 A ARG A 1 67  ? 7.587   7.998   -9.191  0.50 58.02  ? 45   ARG A NH1 1 
ATOM   39   N  NH1 B ARG A 1 67  ? 2.961   9.867   -8.838  0.50 54.56  ? 45   ARG A NH1 1 
ATOM   40   N  NH2 A ARG A 1 67  ? 5.393   7.519   -9.627  0.50 54.00  ? 45   ARG A NH2 1 
ATOM   41   N  NH2 B ARG A 1 67  ? 2.118   11.139  -7.138  0.50 57.48  ? 45   ARG A NH2 1 
ATOM   42   N  N   . PRO A 1 68  ? 5.987   12.601  -14.053 1.00 41.23  ? 46   PRO A N   1 
ATOM   43   C  CA  . PRO A 1 68  ? 4.993   12.947  -15.081 1.00 36.79  ? 46   PRO A CA  1 
ATOM   44   C  C   . PRO A 1 68  ? 3.599   12.349  -14.833 1.00 35.68  ? 46   PRO A C   1 
ATOM   45   O  O   . PRO A 1 68  ? 2.697   12.556  -15.648 1.00 32.89  ? 46   PRO A O   1 
ATOM   46   C  CB  . PRO A 1 68  ? 5.594   12.354  -16.342 1.00 35.98  ? 46   PRO A CB  1 
ATOM   47   C  CG  . PRO A 1 68  ? 6.342   11.163  -15.857 1.00 38.05  ? 46   PRO A CG  1 
ATOM   48   C  CD  . PRO A 1 68  ? 6.904   11.541  -14.519 1.00 40.65  ? 46   PRO A CD  1 
ATOM   49   N  N   . ASP A 1 69  ? 3.443   11.630  -13.723 1.00 37.05  ? 47   ASP A N   1 
ATOM   50   C  CA  . ASP A 1 69  ? 2.178   11.027  -13.336 1.00 37.72  ? 47   ASP A CA  1 
ATOM   51   C  C   . ASP A 1 69  ? 1.612   11.570  -12.022 1.00 39.96  ? 47   ASP A C   1 
ATOM   52   O  O   . ASP A 1 69  ? 0.727   10.955  -11.448 1.00 41.30  ? 47   ASP A O   1 
ATOM   53   C  CB  . ASP A 1 69  ? 2.340   9.485   -13.253 1.00 39.08  ? 47   ASP A CB  1 
ATOM   54   C  CG  . ASP A 1 69  ? 3.251   9.025   -12.099 1.00 42.34  ? 47   ASP A CG  1 
ATOM   55   O  OD1 . ASP A 1 69  ? 4.029   9.840   -11.571 1.00 44.04  ? 47   ASP A OD1 1 
ATOM   56   O  OD2 . ASP A 1 69  ? 3.237   7.830   -11.745 1.00 43.60  ? 47   ASP A OD2 1 
ATOM   57   N  N   . ALA A 1 70  ? 2.072   12.725  -11.546 1.00 40.88  ? 48   ALA A N   1 
ATOM   58   C  CA  . ALA A 1 70  ? 1.519   13.274  -10.304 1.00 42.72  ? 48   ALA A CA  1 
ATOM   59   C  C   . ALA A 1 70  ? 0.037   13.563  -10.514 1.00 42.05  ? 48   ALA A C   1 
ATOM   60   O  O   . ALA A 1 70  ? -0.360  13.934  -11.626 1.00 40.82  ? 48   ALA A O   1 
ATOM   61   C  CB  . ALA A 1 70  ? 2.247   14.539  -9.875  1.00 43.70  ? 48   ALA A CB  1 
ATOM   62   N  N   . PRO A 1 71  ? -0.783  13.371  -9.460  1.00 42.47  ? 49   PRO A N   1 
ATOM   63   C  CA  . PRO A 1 71  ? -2.197  13.614  -9.609  1.00 41.53  ? 49   PRO A CA  1 
ATOM   64   C  C   . PRO A 1 71  ? -2.469  15.048  -10.036 1.00 39.65  ? 49   PRO A C   1 
ATOM   65   O  O   . PRO A 1 71  ? -1.883  15.981  -9.495  1.00 39.77  ? 49   PRO A O   1 
ATOM   66   C  CB  . PRO A 1 71  ? -2.767  13.368  -8.193  1.00 44.61  ? 49   PRO A CB  1 
ATOM   67   C  CG  . PRO A 1 71  ? -1.774  12.473  -7.523  1.00 47.25  ? 49   PRO A CG  1 
ATOM   68   C  CD  . PRO A 1 71  ? -0.443  12.735  -8.174  1.00 45.81  ? 49   PRO A CD  1 
ATOM   69   N  N   . SER A 1 72  ? -3.384  15.219  -10.973 1.00 38.30  ? 50   SER A N   1 
ATOM   70   C  CA  . SER A 1 72  ? -3.746  16.546  -11.447 1.00 38.02  ? 50   SER A CA  1 
ATOM   71   C  C   . SER A 1 72  ? -4.315  17.373  -10.329 1.00 40.41  ? 50   SER A C   1 
ATOM   72   O  O   . SER A 1 72  ? -5.097  16.867  -9.542  1.00 42.90  ? 50   SER A O   1 
ATOM   73   C  CB  . SER A 1 72  ? -4.770  16.442  -12.579 1.00 36.87  ? 50   SER A CB  1 
ATOM   74   O  OG  . SER A 1 72  ? -5.127  17.747  -13.003 1.00 35.26  ? 50   SER A OG  1 
ATOM   75   N  N   . ARG A 1 73  ? -3.916  18.638  -10.238 1.00 41.82  ? 51   ARG A N   1 
ATOM   76   C  CA  . ARG A 1 73  ? -4.523  19.559  -9.286  1.00 44.13  ? 51   ARG A CA  1 
ATOM   77   C  C   . ARG A 1 73  ? -5.614  20.408  -9.944  1.00 42.20  ? 51   ARG A C   1 
ATOM   78   O  O   . ARG A 1 73  ? -6.152  21.322  -9.311  1.00 40.56  ? 51   ARG A O   1 
ATOM   79   C  CB  . ARG A 1 73  ? -3.469  20.461  -8.641  1.00 47.74  ? 51   ARG A CB  1 
ATOM   80   C  CG  . ARG A 1 73  ? -2.441  19.735  -7.781  1.00 50.66  ? 51   ARG A CG  1 
ATOM   81   C  CD  . ARG A 1 73  ? -1.161  20.550  -7.611  1.00 52.59  ? 51   ARG A CD  1 
ATOM   82   N  NE  . ARG A 1 73  ? -0.448  20.690  -8.885  1.00 51.76  ? 51   ARG A NE  1 
ATOM   83   C  CZ  . ARG A 1 73  ? 0.723   21.305  -9.041  1.00 53.91  ? 51   ARG A CZ  1 
ATOM   84   N  NH1 . ARG A 1 73  ? 1.354   21.841  -8.002  1.00 57.17  ? 51   ARG A NH1 1 
ATOM   85   N  NH2 . ARG A 1 73  ? 1.278   21.371  -10.244 1.00 52.34  ? 51   ARG A NH2 1 
ATOM   86   N  N   . CYS A 1 74  ? -5.949  20.104  -11.202 1.00 39.20  ? 52   CYS A N   1 
ATOM   87   C  CA  . CYS A 1 74  ? -7.046  20.794  -11.890 1.00 38.07  ? 52   CYS A CA  1 
ATOM   88   C  C   . CYS A 1 74  ? -8.388  20.556  -11.194 1.00 39.11  ? 52   CYS A C   1 
ATOM   89   O  O   . CYS A 1 74  ? -8.727  19.437  -10.860 1.00 39.62  ? 52   CYS A O   1 
ATOM   90   C  CB  . CYS A 1 74  ? -7.132  20.354  -13.350 1.00 36.32  ? 52   CYS A CB  1 
ATOM   91   S  SG  . CYS A 1 74  ? -8.437  21.178  -14.298 1.00 35.98  ? 52   CYS A SG  1 
ATOM   92   N  N   . THR A 1 75  ? -9.140  21.620  -10.969 1.00 39.69  ? 53   THR A N   1 
ATOM   93   C  CA  . THR A 1 75  ? -10.448 21.519  -10.309 1.00 41.04  ? 53   THR A CA  1 
ATOM   94   C  C   . THR A 1 75  ? -11.599 21.643  -11.303 1.00 39.74  ? 53   THR A C   1 
ATOM   95   O  O   . THR A 1 75  ? -12.737 21.814  -10.895 1.00 39.82  ? 53   THR A O   1 
ATOM   96   C  CB  . THR A 1 75  ? -10.614 22.598  -9.224  1.00 43.47  ? 53   THR A CB  1 
ATOM   97   O  OG1 . THR A 1 75  ? -10.428 23.893  -9.819  1.00 43.18  ? 53   THR A OG1 1 
ATOM   98   C  CG2 . THR A 1 75  ? -9.593  22.383  -8.097  1.00 44.75  ? 53   THR A CG2 1 
ATOM   99   N  N   . TRP A 1 76  ? -11.323 21.555  -12.606 1.00 37.25  ? 54   TRP A N   1 
ATOM   100  C  CA  . TRP A 1 76  ? -12.413 21.433  -13.556 1.00 36.93  ? 54   TRP A CA  1 
ATOM   101  C  C   . TRP A 1 76  ? -13.342 20.289  -13.141 1.00 38.78  ? 54   TRP A C   1 
ATOM   102  O  O   . TRP A 1 76  ? -12.896 19.223  -12.710 1.00 39.06  ? 54   TRP A O   1 
ATOM   103  C  CB  . TRP A 1 76  ? -11.895 21.127  -14.950 1.00 35.08  ? 54   TRP A CB  1 
ATOM   104  C  CG  . TRP A 1 76  ? -13.003 20.937  -15.986 1.00 35.11  ? 54   TRP A CG  1 
ATOM   105  C  CD1 . TRP A 1 76  ? -13.584 21.903  -16.727 1.00 35.55  ? 54   TRP A CD1 1 
ATOM   106  C  CD2 . TRP A 1 76  ? -13.622 19.702  -16.384 1.00 35.52  ? 54   TRP A CD2 1 
ATOM   107  N  NE1 . TRP A 1 76  ? -14.525 21.364  -17.575 1.00 36.60  ? 54   TRP A NE1 1 
ATOM   108  C  CE2 . TRP A 1 76  ? -14.569 20.011  -17.382 1.00 35.96  ? 54   TRP A CE2 1 
ATOM   109  C  CE3 . TRP A 1 76  ? -13.456 18.363  -16.002 1.00 35.26  ? 54   TRP A CE3 1 
ATOM   110  C  CZ2 . TRP A 1 76  ? -15.367 19.037  -17.994 1.00 36.63  ? 54   TRP A CZ2 1 
ATOM   111  C  CZ3 . TRP A 1 76  ? -14.240 17.402  -16.607 1.00 36.46  ? 54   TRP A CZ3 1 
ATOM   112  C  CH2 . TRP A 1 76  ? -15.194 17.746  -17.590 1.00 37.18  ? 54   TRP A CH2 1 
ATOM   113  N  N   . GLN A 1 77  ? -14.628 20.499  -13.332 1.00 39.67  ? 55   GLN A N   1 
ATOM   114  C  CA  . GLN A 1 77  ? -15.591 19.449  -13.161 1.00 43.60  ? 55   GLN A CA  1 
ATOM   115  C  C   . GLN A 1 77  ? -16.680 19.695  -14.196 1.00 43.07  ? 55   GLN A C   1 
ATOM   116  O  O   . GLN A 1 77  ? -16.984 20.837  -14.497 1.00 42.89  ? 55   GLN A O   1 
ATOM   117  C  CB  . GLN A 1 77  ? -16.143 19.569  -11.738 1.00 48.46  ? 55   GLN A CB  1 
ATOM   118  C  CG  . GLN A 1 77  ? -16.721 18.337  -11.122 1.00 54.31  ? 55   GLN A CG  1 
ATOM   119  C  CD  . GLN A 1 77  ? -17.370 18.665  -9.771  1.00 58.95  ? 55   GLN A CD  1 
ATOM   120  O  OE1 . GLN A 1 77  ? -18.599 18.813  -9.662  1.00 63.53  ? 55   GLN A OE1 1 
ATOM   121  N  NE2 . GLN A 1 77  ? -16.536 18.844  -8.751  1.00 59.39  ? 55   GLN A NE2 1 
ATOM   122  N  N   . LEU A 1 78  ? -17.290 18.645  -14.724 1.00 44.01  ? 56   LEU A N   1 
ATOM   123  C  CA  . LEU A 1 78  ? -18.328 18.835  -15.739 1.00 45.45  ? 56   LEU A CA  1 
ATOM   124  C  C   . LEU A 1 78  ? -19.486 19.562  -15.111 1.00 47.02  ? 56   LEU A C   1 
ATOM   125  O  O   . LEU A 1 78  ? -20.007 19.109  -14.108 1.00 48.21  ? 56   LEU A O   1 
ATOM   126  C  CB  . LEU A 1 78  ? -18.816 17.508  -16.328 1.00 46.37  ? 56   LEU A CB  1 
ATOM   127  C  CG  . LEU A 1 78  ? -19.904 17.676  -17.410 1.00 48.87  ? 56   LEU A CG  1 
ATOM   128  C  CD1 . LEU A 1 78  ? -19.392 18.462  -18.625 1.00 47.97  ? 56   LEU A CD1 1 
ATOM   129  C  CD2 . LEU A 1 78  ? -20.441 16.318  -17.852 1.00 51.04  ? 56   LEU A CD2 1 
ATOM   130  N  N   . GLY A 1 79  ? -19.878 20.684  -15.699 1.00 46.90  ? 57   GLY A N   1 
ATOM   131  C  CA  . GLY A 1 79  ? -20.932 21.517  -15.148 1.00 49.47  ? 57   GLY A CA  1 
ATOM   132  C  C   . GLY A 1 79  ? -20.423 22.861  -14.660 1.00 48.85  ? 57   GLY A C   1 
ATOM   133  O  O   . GLY A 1 79  ? -21.198 23.806  -14.554 1.00 48.75  ? 57   GLY A O   1 
ATOM   134  N  N   . ARG A 1 80  ? -19.129 22.956  -14.354 1.00 47.20  ? 58   ARG A N   1 
ATOM   135  C  CA  . ARG A 1 80  ? -18.546 24.252  -14.005 1.00 47.46  ? 58   ARG A CA  1 
ATOM   136  C  C   . ARG A 1 80  ? -18.532 25.176  -15.207 1.00 46.83  ? 58   ARG A C   1 
ATOM   137  O  O   . ARG A 1 80  ? -18.020 24.806  -16.259 1.00 44.22  ? 58   ARG A O   1 
ATOM   138  C  CB  . ARG A 1 80  ? -17.115 24.126  -13.493 1.00 47.25  ? 58   ARG A CB  1 
ATOM   139  C  CG  . ARG A 1 80  ? -17.020 23.464  -12.136 1.00 50.86  ? 58   ARG A CG  1 
ATOM   140  C  CD  . ARG A 1 80  ? -15.622 23.631  -11.566 1.00 52.15  ? 58   ARG A CD  1 
ATOM   141  N  NE  . ARG A 1 80  ? -15.424 24.979  -11.033 1.00 54.80  ? 58   ARG A NE  1 
ATOM   142  C  CZ  . ARG A 1 80  ? -14.498 25.307  -10.134 1.00 55.71  ? 58   ARG A CZ  1 
ATOM   143  N  NH1 . ARG A 1 80  ? -13.667 24.393  -9.644  1.00 54.28  ? 58   ARG A NH1 1 
ATOM   144  N  NH2 . ARG A 1 80  ? -14.412 26.560  -9.702  1.00 58.32  ? 58   ARG A NH2 1 
ATOM   145  N  N   . PRO A 1 81  ? -19.064 26.403  -15.042 1.00 47.84  ? 59   PRO A N   1 
ATOM   146  C  CA  . PRO A 1 81  ? -19.083 27.346  -16.160 1.00 47.03  ? 59   PRO A CA  1 
ATOM   147  C  C   . PRO A 1 81  ? -17.695 27.666  -16.666 1.00 44.04  ? 59   PRO A C   1 
ATOM   148  O  O   . PRO A 1 81  ? -16.736 27.694  -15.897 1.00 41.49  ? 59   PRO A O   1 
ATOM   149  C  CB  . PRO A 1 81  ? -19.765 28.610  -15.590 1.00 49.26  ? 59   PRO A CB  1 
ATOM   150  C  CG  . PRO A 1 81  ? -20.145 28.301  -14.190 1.00 49.97  ? 59   PRO A CG  1 
ATOM   151  C  CD  . PRO A 1 81  ? -19.802 26.879  -13.862 1.00 48.77  ? 59   PRO A CD  1 
ATOM   152  N  N   . ALA A 1 82  ? -17.603 27.923  -17.958 1.00 44.28  ? 60   ALA A N   1 
ATOM   153  C  CA  . ALA A 1 82  ? -16.339 28.314  -18.584 1.00 44.40  ? 60   ALA A CA  1 
ATOM   154  C  C   . ALA A 1 82  ? -15.753 29.589  -17.950 1.00 43.63  ? 60   ALA A C   1 
ATOM   155  O  O   . ALA A 1 82  ? -14.525 29.756  -17.920 1.00 42.01  ? 60   ALA A O   1 
ATOM   156  C  CB  . ALA A 1 82  ? -16.539 28.506  -20.073 1.00 45.69  ? 60   ALA A CB  1 
ATOM   157  N  N   . SER A 1 83  ? -16.625 30.456  -17.422 1.00 44.94  ? 61   SER A N   1 
ATOM   158  C  CA  . SER A 1 83  ? -16.192 31.655  -16.706 1.00 46.21  ? 61   SER A CA  1 
ATOM   159  C  C   . SER A 1 83  ? -15.328 31.373  -15.472 1.00 45.48  ? 61   SER A C   1 
ATOM   160  O  O   . SER A 1 83  ? -14.628 32.253  -15.011 1.00 46.58  ? 61   SER A O   1 
ATOM   161  C  CB  . SER A 1 83  ? -17.384 32.531  -16.314 1.00 48.73  ? 61   SER A CB  1 
ATOM   162  O  OG  . SER A 1 83  ? -18.316 31.821  -15.539 1.00 50.08  ? 61   SER A OG  1 
ATOM   163  N  N   . GLU A 1 84  ? -15.330 30.143  -14.967 1.00 43.83  ? 62   GLU A N   1 
ATOM   164  C  CA  . GLU A 1 84  ? -14.509 29.809  -13.817 1.00 42.41  ? 62   GLU A CA  1 
ATOM   165  C  C   . GLU A 1 84  ? -13.120 29.332  -14.170 1.00 40.88  ? 62   GLU A C   1 
ATOM   166  O  O   . GLU A 1 84  ? -12.301 29.145  -13.280 1.00 40.97  ? 62   GLU A O   1 
ATOM   167  C  CB  . GLU A 1 84  ? -15.251 28.802  -12.927 1.00 43.80  ? 62   GLU A CB  1 
ATOM   168  C  CG  . GLU A 1 84  ? -16.510 29.427  -12.327 1.00 45.98  ? 62   GLU A CG  1 
ATOM   169  C  CD  . GLU A 1 84  ? -17.272 28.523  -11.365 1.00 46.67  ? 62   GLU A CD  1 
ATOM   170  O  OE1 . GLU A 1 84  ? -16.923 27.369  -11.144 1.00 47.17  ? 62   GLU A OE1 1 
ATOM   171  O  OE2 . GLU A 1 84  ? -18.272 28.969  -10.821 1.00 49.07  ? 62   GLU A OE2 1 
ATOM   172  N  N   . SER A 1 85  ? -12.807 29.162  -15.458 1.00 39.04  ? 63   SER A N   1 
ATOM   173  C  CA  . SER A 1 85  ? -11.496 28.661  -15.807 1.00 37.41  ? 63   SER A CA  1 
ATOM   174  C  C   . SER A 1 85  ? -10.430 29.687  -15.453 1.00 37.65  ? 63   SER A C   1 
ATOM   175  O  O   . SER A 1 85  ? -10.598 30.862  -15.737 1.00 37.79  ? 63   SER A O   1 
ATOM   176  C  CB  . SER A 1 85  ? -11.399 28.327  -17.302 1.00 36.36  ? 63   SER A CB  1 
ATOM   177  O  OG  . SER A 1 85  ? -10.077 27.942  -17.609 1.00 34.91  ? 63   SER A OG  1 
ATOM   178  N  N   . PRO A 1 86  ? -9.308  29.233  -14.872 1.00 37.71  ? 64   PRO A N   1 
ATOM   179  C  CA  . PRO A 1 86  ? -8.221  30.158  -14.606 1.00 38.33  ? 64   PRO A CA  1 
ATOM   180  C  C   . PRO A 1 86  ? -7.218  30.131  -15.737 1.00 37.12  ? 64   PRO A C   1 
ATOM   181  O  O   . PRO A 1 86  ? -6.182  30.759  -15.634 1.00 37.54  ? 64   PRO A O   1 
ATOM   182  C  CB  . PRO A 1 86  ? -7.594  29.575  -13.328 1.00 39.27  ? 64   PRO A CB  1 
ATOM   183  C  CG  . PRO A 1 86  ? -7.742  28.088  -13.519 1.00 37.72  ? 64   PRO A CG  1 
ATOM   184  C  CD  . PRO A 1 86  ? -9.061  27.915  -14.244 1.00 37.31  ? 64   PRO A CD  1 
ATOM   185  N  N   . HIS A 1 87  ? -7.515  29.417  -16.816 1.00 35.85  ? 65   HIS A N   1 
ATOM   186  C  CA  . HIS A 1 87  ? -6.528  29.253  -17.890 1.00 35.27  ? 65   HIS A CA  1 
ATOM   187  C  C   . HIS A 1 87  ? -6.625  30.325  -18.979 1.00 35.59  ? 65   HIS A C   1 
ATOM   188  O  O   . HIS A 1 87  ? -7.601  31.044  -19.073 1.00 35.50  ? 65   HIS A O   1 
ATOM   189  C  CB  . HIS A 1 87  ? -6.655  27.860  -18.514 1.00 33.82  ? 65   HIS A CB  1 
ATOM   190  C  CG  . HIS A 1 87  ? -6.470  26.748  -17.534 1.00 33.48  ? 65   HIS A CG  1 
ATOM   191  N  ND1 . HIS A 1 87  ? -5.245  26.439  -16.986 1.00 33.21  ? 65   HIS A ND1 1 
ATOM   192  C  CD2 . HIS A 1 87  ? -7.350  25.867  -17.013 1.00 32.88  ? 65   HIS A CD2 1 
ATOM   193  C  CE1 . HIS A 1 87  ? -5.382  25.423  -16.158 1.00 33.59  ? 65   HIS A CE1 1 
ATOM   194  N  NE2 . HIS A 1 87  ? -6.647  25.053  -16.164 1.00 33.71  ? 65   HIS A NE2 1 
ATOM   195  N  N   . HIS A 1 88  ? -5.574  30.427  -19.777 1.00 35.02  ? 66   HIS A N   1 
ATOM   196  C  CA  . HIS A 1 88  ? -5.638  31.094  -21.054 1.00 36.91  ? 66   HIS A CA  1 
ATOM   197  C  C   . HIS A 1 88  ? -6.327  30.194  -22.073 1.00 36.20  ? 66   HIS A C   1 
ATOM   198  O  O   . HIS A 1 88  ? -6.046  29.010  -22.128 1.00 33.34  ? 66   HIS A O   1 
ATOM   199  C  CB  . HIS A 1 88  ? -4.248  31.372  -21.577 1.00 37.41  ? 66   HIS A CB  1 
ATOM   200  C  CG  . HIS A 1 88  ? -4.247  32.124  -22.863 1.00 39.41  ? 66   HIS A CG  1 
ATOM   201  N  ND1 . HIS A 1 88  ? -4.795  33.380  -22.985 1.00 40.94  ? 66   HIS A ND1 1 
ATOM   202  C  CD2 . HIS A 1 88  ? -3.786  31.794  -24.091 1.00 39.53  ? 66   HIS A CD2 1 
ATOM   203  C  CE1 . HIS A 1 88  ? -4.647  33.801  -24.229 1.00 42.40  ? 66   HIS A CE1 1 
ATOM   204  N  NE2 . HIS A 1 88  ? -4.045  32.857  -24.919 1.00 40.17  ? 66   HIS A NE2 1 
ATOM   205  N  N   . HIS A 1 89  ? -7.235  30.766  -22.854 1.00 37.40  ? 67   HIS A N   1 
ATOM   206  C  CA  . HIS A 1 89  ? -7.963  30.037  -23.869 1.00 38.15  ? 67   HIS A CA  1 
ATOM   207  C  C   . HIS A 1 89  ? -7.841  30.748  -25.197 1.00 40.22  ? 67   HIS A C   1 
ATOM   208  O  O   . HIS A 1 89  ? -8.042  31.955  -25.282 1.00 42.07  ? 67   HIS A O   1 
ATOM   209  C  CB  . HIS A 1 89  ? -9.429  29.903  -23.478 1.00 38.74  ? 67   HIS A CB  1 
ATOM   210  C  CG  . HIS A 1 89  ? -9.641  28.994  -22.310 1.00 38.14  ? 67   HIS A CG  1 
ATOM   211  N  ND1 . HIS A 1 89  ? -9.585  27.623  -22.422 1.00 36.35  ? 67   HIS A ND1 1 
ATOM   212  C  CD2 . HIS A 1 89  ? -9.862  29.259  -20.999 1.00 37.47  ? 67   HIS A CD2 1 
ATOM   213  C  CE1 . HIS A 1 89  ? -9.766  27.081  -21.230 1.00 36.12  ? 67   HIS A CE1 1 
ATOM   214  N  NE2 . HIS A 1 89  ? -9.925  28.053  -20.349 1.00 37.51  ? 67   HIS A NE2 1 
ATOM   215  N  N   . THR A 1 90  ? -7.466  29.997  -26.226 1.00 41.89  ? 68   THR A N   1 
ATOM   216  C  CA  . THR A 1 90  ? -7.456  30.495  -27.603 1.00 42.88  ? 68   THR A CA  1 
ATOM   217  C  C   . THR A 1 90  ? -8.731  30.022  -28.313 1.00 43.60  ? 68   THR A C   1 
ATOM   218  O  O   . THR A 1 90  ? -9.576  29.341  -27.738 1.00 40.74  ? 68   THR A O   1 
ATOM   219  C  CB  . THR A 1 90  ? -6.258  29.949  -28.388 1.00 43.74  ? 68   THR A CB  1 
ATOM   220  O  OG1 . THR A 1 90  ? -6.376  28.522  -28.521 1.00 41.62  ? 68   THR A OG1 1 
ATOM   221  C  CG2 . THR A 1 90  ? -4.931  30.284  -27.702 1.00 44.27  ? 68   THR A CG2 1 
ATOM   222  N  N   . ALA A 1 91  ? -8.848  30.368  -29.583 1.00 46.91  ? 69   ALA A N   1 
ATOM   223  C  CA  . ALA A 1 91  ? -9.899  29.813  -30.412 1.00 48.84  ? 69   ALA A CA  1 
ATOM   224  C  C   . ALA A 1 91  ? -9.376  29.700  -31.829 1.00 50.20  ? 69   ALA A C   1 
ATOM   225  O  O   . ALA A 1 91  ? -8.371  30.332  -32.163 1.00 50.67  ? 69   ALA A O   1 
ATOM   226  C  CB  . ALA A 1 91  ? -11.136 30.695  -30.352 1.00 50.42  ? 69   ALA A CB  1 
ATOM   227  N  N   . PRO A 1 92  ? -10.038 28.876  -32.665 1.00 51.86  ? 70   PRO A N   1 
ATOM   228  C  CA  . PRO A 1 92  ? -9.704  28.862  -34.082 1.00 54.06  ? 70   PRO A CA  1 
ATOM   229  C  C   . PRO A 1 92  ? -9.783  30.267  -34.676 1.00 57.37  ? 70   PRO A C   1 
ATOM   230  O  O   . PRO A 1 92  ? -10.735 30.990  -34.421 1.00 58.25  ? 70   PRO A O   1 
ATOM   231  C  CB  . PRO A 1 92  ? -10.786 27.955  -34.684 1.00 55.79  ? 70   PRO A CB  1 
ATOM   232  C  CG  . PRO A 1 92  ? -11.127 27.009  -33.582 1.00 53.34  ? 70   PRO A CG  1 
ATOM   233  C  CD  . PRO A 1 92  ? -11.030 27.834  -32.324 1.00 51.52  ? 70   PRO A CD  1 
ATOM   234  N  N   . ALA A 1 93  ? -8.771  30.645  -35.440 1.00 59.64  ? 71   ALA A N   1 
ATOM   235  C  CA  . ALA A 1 93  ? -8.748  31.943  -36.079 1.00 63.38  ? 71   ALA A CA  1 
ATOM   236  C  C   . ALA A 1 93  ? -8.596  31.781  -37.588 1.00 66.60  ? 71   ALA A C   1 
ATOM   237  O  O   . ALA A 1 93  ? -7.987  30.825  -38.072 1.00 65.65  ? 71   ALA A O   1 
ATOM   238  C  CB  . ALA A 1 93  ? -7.611  32.777  -35.515 1.00 62.80  ? 71   ALA A CB  1 
ATOM   239  N  N   . LYS A 1 94  ? -9.204  32.710  -38.309 1.00 69.71  ? 72   LYS A N   1 
ATOM   240  C  CA  . LYS A 1 94  ? -9.025  32.866  -39.735 1.00 74.31  ? 72   LYS A CA  1 
ATOM   241  C  C   . LYS A 1 94  ? -7.555  33.194  -39.991 1.00 72.17  ? 72   LYS A C   1 
ATOM   242  O  O   . LYS A 1 94  ? -6.937  33.943  -39.239 1.00 72.31  ? 72   LYS A O   1 
ATOM   243  C  CB  . LYS A 1 94  ? -9.939  34.008  -40.208 1.00 78.89  ? 72   LYS A CB  1 
ATOM   244  C  CG  . LYS A 1 94  ? -9.661  34.571  -41.586 1.00 84.75  ? 72   LYS A CG  1 
ATOM   245  C  CD  . LYS A 1 94  ? -10.452 33.870  -42.677 1.00 89.18  ? 72   LYS A CD  1 
ATOM   246  C  CE  . LYS A 1 94  ? -10.592 34.775  -43.886 1.00 93.99  ? 72   LYS A CE  1 
ATOM   247  N  NZ  . LYS A 1 94  ? -11.394 34.130  -44.955 1.00 98.81  ? 72   LYS A NZ  1 
ATOM   248  N  N   . SER A 1 95  ? -6.977  32.617  -41.027 1.00 71.55  ? 73   SER A N   1 
ATOM   249  C  CA  . SER A 1 95  ? -5.560  32.843  -41.270 1.00 69.63  ? 73   SER A CA  1 
ATOM   250  C  C   . SER A 1 95  ? -5.362  33.849  -42.393 1.00 71.54  ? 73   SER A C   1 
ATOM   251  O  O   . SER A 1 95  ? -6.232  34.024  -43.241 1.00 73.26  ? 73   SER A O   1 
ATOM   252  C  CB  . SER A 1 95  ? -4.825  31.515  -41.526 1.00 68.45  ? 73   SER A CB  1 
ATOM   253  O  OG  . SER A 1 95  ? -5.313  30.860  -42.678 1.00 72.11  ? 73   SER A OG  1 
ATOM   254  N  N   . PRO A 1 96  ? -4.212  34.532  -42.387 1.00 70.87  ? 74   PRO A N   1 
ATOM   255  C  CA  . PRO A 1 96  ? -3.975  35.523  -43.406 1.00 74.78  ? 74   PRO A CA  1 
ATOM   256  C  C   . PRO A 1 96  ? -3.674  34.872  -44.750 1.00 78.12  ? 74   PRO A C   1 
ATOM   257  O  O   . PRO A 1 96  ? -3.363  33.690  -44.815 1.00 76.18  ? 74   PRO A O   1 
ATOM   258  C  CB  . PRO A 1 96  ? -2.762  36.280  -42.878 1.00 73.41  ? 74   PRO A CB  1 
ATOM   259  C  CG  . PRO A 1 96  ? -2.015  35.269  -42.095 1.00 69.25  ? 74   PRO A CG  1 
ATOM   260  C  CD  . PRO A 1 96  ? -3.044  34.357  -41.503 1.00 67.27  ? 74   PRO A CD  1 
ATOM   261  N  N   . LYS A 1 97  ? -3.794  35.655  -45.808 1.00 47.70  ? 75   LYS A N   1 
ATOM   262  C  CA  . LYS A 1 97  ? -3.604  35.171  -47.162 1.00 50.08  ? 75   LYS A CA  1 
ATOM   263  C  C   . LYS A 1 97  ? -2.209  34.608  -47.370 1.00 48.71  ? 75   LYS A C   1 
ATOM   264  O  O   . LYS A 1 97  ? -2.051  33.545  -47.950 1.00 47.60  ? 75   LYS A O   1 
ATOM   265  C  CB  . LYS A 1 97  ? -3.851  36.282  -48.150 1.00 53.60  ? 75   LYS A CB  1 
ATOM   266  C  CG  . LYS A 1 97  ? -5.317  36.623  -48.288 1.00 56.61  ? 75   LYS A CG  1 
ATOM   267  C  CD  . LYS A 1 97  ? -5.583  37.282  -49.618 1.00 61.25  ? 75   LYS A CD  1 
ATOM   268  C  CE  . LYS A 1 97  ? -7.040  37.151  -50.015 1.00 64.87  ? 75   LYS A CE  1 
ATOM   269  N  NZ  . LYS A 1 97  ? -7.885  38.096  -49.232 1.00 67.23  ? 75   LYS A NZ  1 
ATOM   270  N  N   . ILE A 1 98  ? -1.221  35.358  -46.898 1.00 47.96  ? 76   ILE A N   1 
ATOM   271  C  CA  . ILE A 1 98  ? 0.159   34.947  -46.869 1.00 47.29  ? 76   ILE A CA  1 
ATOM   272  C  C   . ILE A 1 98  ? 0.514   34.609  -45.420 1.00 46.47  ? 76   ILE A C   1 
ATOM   273  O  O   . ILE A 1 98  ? 0.344   35.433  -44.528 1.00 48.43  ? 76   ILE A O   1 
ATOM   274  C  CB  . ILE A 1 98  ? 1.048   36.074  -47.400 1.00 48.84  ? 76   ILE A CB  1 
ATOM   275  C  CG1 . ILE A 1 98  ? 0.675   36.382  -48.861 1.00 50.58  ? 76   ILE A CG1 1 
ATOM   276  C  CG2 . ILE A 1 98  ? 2.517   35.719  -47.247 1.00 48.48  ? 76   ILE A CG2 1 
ATOM   277  C  CD1 . ILE A 1 98  ? 1.248   37.678  -49.399 1.00 52.16  ? 76   ILE A CD1 1 
ATOM   278  N  N   . LEU A 1 99  ? 0.976   33.390  -45.179 1.00 42.91  ? 77   LEU A N   1 
ATOM   279  C  CA  . LEU A 1 99  ? 1.408   33.005  -43.858 1.00 41.09  ? 77   LEU A CA  1 
ATOM   280  C  C   . LEU A 1 99  ? 2.752   33.639  -43.558 1.00 41.77  ? 77   LEU A C   1 
ATOM   281  O  O   . LEU A 1 99  ? 3.651   33.616  -44.395 1.00 42.60  ? 77   LEU A O   1 
ATOM   282  C  CB  . LEU A 1 99  ? 1.501   31.484  -43.717 1.00 38.94  ? 77   LEU A CB  1 
ATOM   283  C  CG  . LEU A 1 99  ? 0.273   30.657  -44.116 1.00 39.22  ? 77   LEU A CG  1 
ATOM   284  C  CD1 . LEU A 1 99  ? 0.409   29.219  -43.629 1.00 37.20  ? 77   LEU A CD1 1 
ATOM   285  C  CD2 . LEU A 1 99  ? -1.007  31.277  -43.572 1.00 41.38  ? 77   LEU A CD2 1 
ATOM   286  N  N   . PRO A 1 100 ? 2.901   34.227  -42.368 1.00 43.00  ? 78   PRO A N   1 
ATOM   287  C  CA  . PRO A 1 100 ? 4.192   34.856  -42.042 1.00 43.87  ? 78   PRO A CA  1 
ATOM   288  C  C   . PRO A 1 100 ? 5.329   33.837  -41.832 1.00 39.45  ? 78   PRO A C   1 
ATOM   289  O  O   . PRO A 1 100 ? 6.487   34.138  -42.078 1.00 38.47  ? 78   PRO A O   1 
ATOM   290  C  CB  . PRO A 1 100 ? 3.876   35.682  -40.767 1.00 45.43  ? 78   PRO A CB  1 
ATOM   291  C  CG  . PRO A 1 100 ? 2.609   35.086  -40.217 1.00 45.53  ? 78   PRO A CG  1 
ATOM   292  C  CD  . PRO A 1 100 ? 1.839   34.627  -41.424 1.00 44.87  ? 78   PRO A CD  1 
ATOM   293  N  N   . ASP A 1 101 ? 4.973   32.641  -41.404 1.00 37.02  ? 79   ASP A N   1 
ATOM   294  C  CA  . ASP A 1 101 ? 5.868   31.508  -41.397 1.00 36.16  ? 79   ASP A CA  1 
ATOM   295  C  C   . ASP A 1 101 ? 5.014   30.255  -41.352 1.00 35.36  ? 79   ASP A C   1 
ATOM   296  O  O   . ASP A 1 101 ? 3.776   30.339  -41.222 1.00 34.65  ? 79   ASP A O   1 
ATOM   297  C  CB  . ASP A 1 101 ? 6.842   31.561  -40.215 1.00 36.48  ? 79   ASP A CB  1 
ATOM   298  C  CG  . ASP A 1 101 ? 6.132   31.641  -38.872 1.00 36.32  ? 79   ASP A CG  1 
ATOM   299  O  OD1 . ASP A 1 101 ? 5.377   30.732  -38.538 1.00 36.56  ? 79   ASP A OD1 1 
ATOM   300  O  OD2 . ASP A 1 101 ? 6.317   32.629  -38.152 1.00 40.55  ? 79   ASP A OD2 1 
ATOM   301  N  N   . ILE A 1 102 ? 5.678   29.098  -41.406 1.00 34.27  ? 80   ILE A N   1 
ATOM   302  C  CA  . ILE A 1 102 ? 4.988   27.820  -41.535 1.00 33.41  ? 80   ILE A CA  1 
ATOM   303  C  C   . ILE A 1 102 ? 4.258   27.413  -40.266 1.00 33.21  ? 80   ILE A C   1 
ATOM   304  O  O   . ILE A 1 102 ? 3.356   26.567  -40.315 1.00 31.66  ? 80   ILE A O   1 
ATOM   305  C  CB  . ILE A 1 102 ? 5.967   26.701  -42.005 1.00 32.10  ? 80   ILE A CB  1 
ATOM   306  C  CG1 . ILE A 1 102 ? 5.243   25.461  -42.551 1.00 31.47  ? 80   ILE A CG1 1 
ATOM   307  C  CG2 . ILE A 1 102 ? 6.883   26.253  -40.872 1.00 31.58  ? 80   ILE A CG2 1 
ATOM   308  C  CD1 . ILE A 1 102 ? 4.327   25.719  -43.734 1.00 33.40  ? 80   ILE A CD1 1 
ATOM   309  N  N   . LEU A 1 103 ? 4.618   27.999  -39.124 1.00 35.72  ? 81   LEU A N   1 
ATOM   310  C  CA  . LEU A 1 103 ? 3.909   27.684  -37.882 1.00 36.30  ? 81   LEU A CA  1 
ATOM   311  C  C   . LEU A 1 103 ? 2.426   28.102  -37.902 1.00 37.29  ? 81   LEU A C   1 
ATOM   312  O  O   . LEU A 1 103 ? 1.646   27.608  -37.106 1.00 37.90  ? 81   LEU A O   1 
ATOM   313  C  CB  . LEU A 1 103 ? 4.617   28.272  -36.666 1.00 37.67  ? 81   LEU A CB  1 
ATOM   314  C  CG  . LEU A 1 103 ? 6.097   27.916  -36.504 1.00 38.36  ? 81   LEU A CG  1 
ATOM   315  C  CD1 . LEU A 1 103 ? 6.681   28.595  -35.273 1.00 38.02  ? 81   LEU A CD1 1 
ATOM   316  C  CD2 . LEU A 1 103 ? 6.254   26.408  -36.438 1.00 37.91  ? 81   LEU A CD2 1 
ATOM   317  N  N   . LYS A 1 104 ? 2.032   28.971  -38.825 1.00 39.83  ? 82   LYS A N   1 
ATOM   318  C  CA  . LYS A 1 104 ? 0.611   29.255  -39.051 1.00 42.35  ? 82   LYS A CA  1 
ATOM   319  C  C   . LYS A 1 104 ? -0.135  28.097  -39.759 1.00 40.70  ? 82   LYS A C   1 
ATOM   320  O  O   . LYS A 1 104 ? -1.363  28.063  -39.737 1.00 37.54  ? 82   LYS A O   1 
ATOM   321  C  CB  . LYS A 1 104 ? 0.439   30.553  -39.847 1.00 48.70  ? 82   LYS A CB  1 
ATOM   322  C  CG  . LYS A 1 104 ? 0.436   31.810  -38.991 1.00 56.83  ? 82   LYS A CG  1 
ATOM   323  C  CD  . LYS A 1 104 ? -0.785  31.860  -38.066 1.00 62.34  ? 82   LYS A CD  1 
ATOM   324  C  CE  . LYS A 1 104 ? -0.990  33.247  -37.457 1.00 70.96  ? 82   LYS A CE  1 
ATOM   325  N  NZ  . LYS A 1 104 ? 0.274   33.770  -36.859 1.00 73.71  ? 82   LYS A NZ  1 
ATOM   326  N  N   . LYS A 1 105 ? 0.601   27.148  -40.357 1.00 35.81  ? 83   LYS A N   1 
ATOM   327  C  CA  . LYS A 1 105 ? -0.003  25.996  -41.012 1.00 35.52  ? 83   LYS A CA  1 
ATOM   328  C  C   . LYS A 1 105 ? -0.205  24.839  -40.009 1.00 32.96  ? 83   LYS A C   1 
ATOM   329  O  O   . LYS A 1 105 ? 0.258   23.701  -40.191 1.00 31.38  ? 83   LYS A O   1 
ATOM   330  C  CB  . LYS A 1 105 ? 0.838   25.582  -42.228 1.00 37.97  ? 83   LYS A CB  1 
ATOM   331  C  CG  . LYS A 1 105 ? 0.004   25.221  -43.436 1.00 42.68  ? 83   LYS A CG  1 
ATOM   332  C  CD  . LYS A 1 105 ? -0.839  24.012  -43.101 1.00 45.04  ? 83   LYS A CD  1 
ATOM   333  C  CE  . LYS A 1 105 ? -1.672  23.516  -44.266 1.00 49.28  ? 83   LYS A CE  1 
ATOM   334  N  NZ  . LYS A 1 105 ? -2.183  22.171  -43.856 1.00 49.43  ? 83   LYS A NZ  1 
ATOM   335  N  N   . ILE A 1 106 ? -0.893  25.157  -38.926 1.00 30.99  ? 84   ILE A N   1 
ATOM   336  C  CA  . ILE A 1 106 ? -1.135  24.226  -37.869 1.00 31.68  ? 84   ILE A CA  1 
ATOM   337  C  C   . ILE A 1 106 ? -2.586  24.460  -37.492 1.00 33.34  ? 84   ILE A C   1 
ATOM   338  O  O   . ILE A 1 106 ? -3.000  25.594  -37.343 1.00 32.70  ? 84   ILE A O   1 
ATOM   339  C  CB  . ILE A 1 106 ? -0.167  24.428  -36.686 1.00 31.94  ? 84   ILE A CB  1 
ATOM   340  C  CG1 . ILE A 1 106 ? 1.285   24.196  -37.121 1.00 32.89  ? 84   ILE A CG1 1 
ATOM   341  C  CG2 . ILE A 1 106 ? -0.472  23.453  -35.566 1.00 31.04  ? 84   ILE A CG2 1 
ATOM   342  C  CD1 . ILE A 1 106 ? 2.305   24.447  -36.010 1.00 33.79  ? 84   ILE A CD1 1 
ATOM   343  N  N   . GLY A 1 107 ? -3.371  23.384  -37.416 1.00 34.04  ? 85   GLY A N   1 
ATOM   344  C  CA  . GLY A 1 107 ? -4.800  23.500  -37.163 1.00 33.73  ? 85   GLY A CA  1 
ATOM   345  C  C   . GLY A 1 107 ? -5.621  23.650  -38.427 1.00 35.71  ? 85   GLY A C   1 
ATOM   346  O  O   . GLY A 1 107 ? -5.092  23.674  -39.563 1.00 33.33  ? 85   GLY A O   1 
ATOM   347  N  N   . ASP A 1 108 ? -6.932  23.757  -38.216 1.00 35.61  ? 86   ASP A N   1 
ATOM   348  C  CA  . ASP A 1 108 ? -7.929  23.754  -39.294 1.00 38.79  ? 86   ASP A CA  1 
ATOM   349  C  C   . ASP A 1 108 ? -7.706  22.584  -40.262 1.00 36.70  ? 86   ASP A C   1 
ATOM   350  O  O   . ASP A 1 108 ? -7.622  22.743  -41.472 1.00 35.75  ? 86   ASP A O   1 
ATOM   351  C  CB  . ASP A 1 108 ? -7.950  25.095  -40.018 1.00 44.46  ? 86   ASP A CB  1 
ATOM   352  C  CG  . ASP A 1 108 ? -8.527  26.228  -39.156 1.00 53.17  ? 86   ASP A CG  1 
ATOM   353  O  OD1 . ASP A 1 108 ? -9.513  26.010  -38.385 1.00 55.98  ? 86   ASP A OD1 1 
ATOM   354  O  OD2 . ASP A 1 108 ? -8.003  27.366  -39.280 1.00 60.33  ? 86   ASP A OD2 1 
ATOM   355  N  N   . THR A 1 109 ? -7.599  21.400  -39.692 1.00 34.30  ? 87   THR A N   1 
ATOM   356  C  CA  . THR A 1 109 ? -7.337  20.210  -40.457 1.00 33.41  ? 87   THR A CA  1 
ATOM   357  C  C   . THR A 1 109 ? -8.631  19.655  -41.039 1.00 34.22  ? 87   THR A C   1 
ATOM   358  O  O   . THR A 1 109 ? -9.737  19.924  -40.532 1.00 33.72  ? 87   THR A O   1 
ATOM   359  C  CB  . THR A 1 109 ? -6.698  19.143  -39.584 1.00 32.14  ? 87   THR A CB  1 
ATOM   360  O  OG1 . THR A 1 109 ? -7.499  18.959  -38.408 1.00 30.19  ? 87   THR A OG1 1 
ATOM   361  C  CG2 . THR A 1 109 ? -5.295  19.563  -39.206 1.00 31.90  ? 87   THR A CG2 1 
ATOM   362  N  N   . PRO A 1 110 ? -8.499  18.864  -42.111 1.00 34.15  ? 88   PRO A N   1 
ATOM   363  C  CA  . PRO A 1 110 ? -9.704  18.348  -42.781 1.00 34.47  ? 88   PRO A CA  1 
ATOM   364  C  C   . PRO A 1 110 ? -10.457 17.277  -41.992 1.00 32.87  ? 88   PRO A C   1 
ATOM   365  O  O   . PRO A 1 110 ? -9.870  16.505  -41.194 1.00 30.45  ? 88   PRO A O   1 
ATOM   366  C  CB  . PRO A 1 110 ? -9.178  17.734  -44.085 1.00 36.01  ? 88   PRO A CB  1 
ATOM   367  C  CG  . PRO A 1 110 ? -7.707  17.889  -44.095 1.00 34.46  ? 88   PRO A CG  1 
ATOM   368  C  CD  . PRO A 1 110 ? -7.253  18.607  -42.860 1.00 33.58  ? 88   PRO A CD  1 
ATOM   369  N  N   . MET A 1 111 ? -11.755 17.258  -42.235 1.00 32.33  ? 89   MET A N   1 
ATOM   370  C  CA  . MET A 1 111 ? -12.631 16.231  -41.747 1.00 32.74  ? 89   MET A CA  1 
ATOM   371  C  C   . MET A 1 111 ? -13.112 15.538  -42.992 1.00 32.76  ? 89   MET A C   1 
ATOM   372  O  O   . MET A 1 111 ? -13.746 16.147  -43.827 1.00 34.69  ? 89   MET A O   1 
ATOM   373  C  CB  . MET A 1 111 ? -13.800 16.842  -40.981 1.00 34.54  ? 89   MET A CB  1 
ATOM   374  C  CG  . MET A 1 111 ? -14.734 15.799  -40.402 1.00 35.28  ? 89   MET A CG  1 
ATOM   375  S  SD  . MET A 1 111 ? -14.010 15.007  -38.970 1.00 35.11  ? 89   MET A SD  1 
ATOM   376  C  CE  . MET A 1 111 ? -14.364 16.275  -37.758 1.00 35.45  ? 89   MET A CE  1 
ATOM   377  N  N   . VAL A 1 112 ? -12.791 14.262  -43.121 1.00 32.52  ? 90   VAL A N   1 
ATOM   378  C  CA  . VAL A 1 112 ? -13.024 13.552  -44.355 1.00 33.46  ? 90   VAL A CA  1 
ATOM   379  C  C   . VAL A 1 112 ? -13.888 12.336  -44.105 1.00 33.53  ? 90   VAL A C   1 
ATOM   380  O  O   . VAL A 1 112 ? -13.616 11.566  -43.182 1.00 32.79  ? 90   VAL A O   1 
ATOM   381  C  CB  . VAL A 1 112 ? -11.667 13.105  -44.970 1.00 33.48  ? 90   VAL A CB  1 
ATOM   382  C  CG1 . VAL A 1 112 ? -11.878 12.560  -46.373 1.00 35.02  ? 90   VAL A CG1 1 
ATOM   383  C  CG2 . VAL A 1 112 ? -10.701 14.291  -45.000 1.00 33.61  ? 90   VAL A CG2 1 
ATOM   384  N  N   . ARG A 1 113 ? -14.913 12.157  -44.928 1.00 36.18  ? 91   ARG A N   1 
ATOM   385  C  CA  . ARG A 1 113 ? -15.784 10.985  -44.824 1.00 38.98  ? 91   ARG A CA  1 
ATOM   386  C  C   . ARG A 1 113 ? -15.049 9.712   -45.287 1.00 38.49  ? 91   ARG A C   1 
ATOM   387  O  O   . ARG A 1 113 ? -14.372 9.700   -46.332 1.00 36.43  ? 91   ARG A O   1 
ATOM   388  C  CB  . ARG A 1 113 ? -17.067 11.188  -45.620 1.00 42.73  ? 91   ARG A CB  1 
ATOM   389  C  CG  . ARG A 1 113 ? -17.957 9.952   -45.628 1.00 47.73  ? 91   ARG A CG  1 
ATOM   390  C  CD  . ARG A 1 113 ? -19.432 10.208  -45.893 1.00 51.77  ? 91   ARG A CD  1 
ATOM   391  N  NE  . ARG A 1 113 ? -19.625 11.330  -46.798 1.00 59.66  ? 91   ARG A NE  1 
ATOM   392  C  CZ  . ARG A 1 113 ? -20.087 12.545  -46.465 1.00 63.76  ? 91   ARG A CZ  1 
ATOM   393  N  NH1 . ARG A 1 113 ? -20.463 12.848  -45.226 1.00 65.03  ? 91   ARG A NH1 1 
ATOM   394  N  NH2 . ARG A 1 113 ? -20.195 13.480  -47.401 1.00 67.01  ? 91   ARG A NH2 1 
ATOM   395  N  N   . ILE A 1 114 ? -15.144 8.671   -44.466 1.00 38.13  ? 92   ILE A N   1 
ATOM   396  C  CA  . ILE A 1 114 ? -14.601 7.352   -44.770 1.00 37.73  ? 92   ILE A CA  1 
ATOM   397  C  C   . ILE A 1 114 ? -15.663 6.566   -45.543 1.00 40.68  ? 92   ILE A C   1 
ATOM   398  O  O   . ILE A 1 114 ? -16.753 6.284   -45.022 1.00 40.56  ? 92   ILE A O   1 
ATOM   399  C  CB  . ILE A 1 114 ? -14.285 6.564   -43.481 1.00 38.28  ? 92   ILE A CB  1 
ATOM   400  C  CG1 . ILE A 1 114 ? -13.236 7.269   -42.610 1.00 38.42  ? 92   ILE A CG1 1 
ATOM   401  C  CG2 . ILE A 1 114 ? -13.847 5.139   -43.815 1.00 38.55  ? 92   ILE A CG2 1 
ATOM   402  C  CD1 . ILE A 1 114 ? -11.887 7.407   -43.241 1.00 39.44  ? 92   ILE A CD1 1 
ATOM   403  N  N   . ASN A 1 115 ? -15.358 6.199   -46.781 1.00 39.70  ? 93   ASN A N   1 
ATOM   404  C  CA  . ASN A 1 115 ? -16.359 5.641   -47.650 1.00 41.57  ? 93   ASN A CA  1 
ATOM   405  C  C   . ASN A 1 115 ? -16.418 4.135   -47.780 1.00 42.51  ? 93   ASN A C   1 
ATOM   406  O  O   . ASN A 1 115 ? -17.476 3.599   -48.099 1.00 43.79  ? 93   ASN A O   1 
ATOM   407  C  CB  . ASN A 1 115 ? -16.224 6.290   -49.021 1.00 42.09  ? 93   ASN A CB  1 
ATOM   408  C  CG  . ASN A 1 115 ? -16.412 7.777   -48.938 1.00 42.41  ? 93   ASN A CG  1 
ATOM   409  O  OD1 . ASN A 1 115 ? -17.482 8.236   -48.534 1.00 42.54  ? 93   ASN A OD1 1 
ATOM   410  N  ND2 . ASN A 1 115 ? -15.380 8.542   -49.268 1.00 39.87  ? 93   ASN A ND2 1 
ATOM   411  N  N   . LYS A 1 116 ? -15.307 3.448   -47.585 1.00 41.77  ? 94   LYS A N   1 
ATOM   412  C  CA  . LYS A 1 116 ? -15.297 2.011   -47.841 1.00 44.33  ? 94   LYS A CA  1 
ATOM   413  C  C   . LYS A 1 116 ? -15.156 1.197   -46.579 1.00 41.99  ? 94   LYS A C   1 
ATOM   414  O  O   . LYS A 1 116 ? -15.843 0.198   -46.407 1.00 42.77  ? 94   LYS A O   1 
ATOM   415  C  CB  . LYS A 1 116 ? -14.180 1.643   -48.807 1.00 46.34  ? 94   LYS A CB  1 
ATOM   416  C  CG  . LYS A 1 116 ? -14.392 2.137   -50.220 1.00 51.28  ? 94   LYS A CG  1 
ATOM   417  C  CD  . LYS A 1 116 ? -13.217 1.692   -51.080 1.00 55.32  ? 94   LYS A CD  1 
ATOM   418  C  CE  . LYS A 1 116 ? -13.110 2.476   -52.384 1.00 59.28  ? 94   LYS A CE  1 
ATOM   419  N  NZ  . LYS A 1 116 ? -11.733 3.041   -52.503 1.00 56.57  ? 94   LYS A NZ  1 
ATOM   420  N  N   . ILE A 1 117 ? -14.273 1.626   -45.697 1.00 39.64  ? 95   ILE A N   1 
ATOM   421  C  CA  . ILE A 1 117 ? -13.929 0.823   -44.527 1.00 39.31  ? 95   ILE A CA  1 
ATOM   422  C  C   . ILE A 1 117 ? -15.142 0.578   -43.586 1.00 41.16  ? 95   ILE A C   1 
ATOM   423  O  O   . ILE A 1 117 ? -15.403 -0.557  -43.169 1.00 39.34  ? 95   ILE A O   1 
ATOM   424  C  CB  . ILE A 1 117 ? -12.730 1.427   -43.799 1.00 37.59  ? 95   ILE A CB  1 
ATOM   425  C  CG1 . ILE A 1 117 ? -11.485 1.328   -44.709 1.00 37.34  ? 95   ILE A CG1 1 
ATOM   426  C  CG2 . ILE A 1 117 ? -12.433 0.670   -42.504 1.00 37.15  ? 95   ILE A CG2 1 
ATOM   427  C  CD1 . ILE A 1 117 ? -10.265 2.001   -44.119 1.00 35.87  ? 95   ILE A CD1 1 
ATOM   428  N  N   . GLY A 1 118 ? -15.904 1.629   -43.300 1.00 41.45  ? 96   GLY A N   1 
ATOM   429  C  CA  . GLY A 1 118 ? -17.064 1.491   -42.426 1.00 43.87  ? 96   GLY A CA  1 
ATOM   430  C  C   . GLY A 1 118 ? -18.034 0.467   -42.955 1.00 47.19  ? 96   GLY A C   1 
ATOM   431  O  O   . GLY A 1 118 ? -18.411 -0.468  -42.238 1.00 48.14  ? 96   GLY A O   1 
ATOM   432  N  N   . LYS A 1 119 ? -18.420 0.642   -44.221 1.00 49.65  ? 97   LYS A N   1 
ATOM   433  C  CA  . LYS A 1 119 ? -19.347 -0.258  -44.893 1.00 53.54  ? 97   LYS A CA  1 
ATOM   434  C  C   . LYS A 1 119 ? -18.876 -1.699  -44.890 1.00 52.77  ? 97   LYS A C   1 
ATOM   435  O  O   . LYS A 1 119 ? -19.657 -2.603  -44.677 1.00 52.49  ? 97   LYS A O   1 
ATOM   436  C  CB  . LYS A 1 119 ? -19.536 0.141   -46.359 1.00 58.55  ? 97   LYS A CB  1 
ATOM   437  C  CG  . LYS A 1 119 ? -20.167 1.499   -46.589 1.00 62.32  ? 97   LYS A CG  1 
ATOM   438  C  CD  . LYS A 1 119 ? -20.726 1.580   -48.012 1.00 68.33  ? 97   LYS A CD  1 
ATOM   439  C  CE  . LYS A 1 119 ? -21.251 2.975   -48.351 1.00 71.32  ? 97   LYS A CE  1 
ATOM   440  N  NZ  . LYS A 1 119 ? -20.180 4.026   -48.254 1.00 68.83  ? 97   LYS A NZ  1 
ATOM   441  N  N   . LYS A 1 120 ? -17.596 -1.904  -45.169 1.00 50.02  ? 98   LYS A N   1 
ATOM   442  C  CA  . LYS A 1 120 ? -17.007 -3.233  -45.205 1.00 50.98  ? 98   LYS A CA  1 
ATOM   443  C  C   . LYS A 1 120 ? -17.144 -3.952  -43.857 1.00 49.17  ? 98   LYS A C   1 
ATOM   444  O  O   . LYS A 1 120 ? -17.279 -5.165  -43.816 1.00 49.40  ? 98   LYS A O   1 
ATOM   445  C  CB  . LYS A 1 120 ? -15.536 -3.094  -45.611 1.00 51.77  ? 98   LYS A CB  1 
ATOM   446  C  CG  . LYS A 1 120 ? -14.702 -4.353  -45.716 1.00 54.39  ? 98   LYS A CG  1 
ATOM   447  C  CD  . LYS A 1 120 ? -13.308 -3.952  -46.201 1.00 55.53  ? 98   LYS A CD  1 
ATOM   448  C  CE  . LYS A 1 120 ? -12.191 -4.820  -45.640 1.00 57.47  ? 98   LYS A CE  1 
ATOM   449  N  NZ  . LYS A 1 120 ? -11.914 -5.976  -46.532 1.00 61.96  ? 98   LYS A NZ  1 
ATOM   450  N  N   . PHE A 1 121 ? -17.113 -3.214  -42.753 1.00 46.68  ? 99   PHE A N   1 
ATOM   451  C  CA  . PHE A 1 121 ? -17.273 -3.838  -41.446 1.00 46.65  ? 99   PHE A CA  1 
ATOM   452  C  C   . PHE A 1 121 ? -18.691 -3.724  -40.857 1.00 47.91  ? 99   PHE A C   1 
ATOM   453  O  O   . PHE A 1 121 ? -18.876 -3.968  -39.683 1.00 49.66  ? 99   PHE A O   1 
ATOM   454  C  CB  . PHE A 1 121 ? -16.212 -3.307  -40.496 1.00 45.57  ? 99   PHE A CB  1 
ATOM   455  C  CG  . PHE A 1 121 ? -14.854 -3.832  -40.806 1.00 46.06  ? 99   PHE A CG  1 
ATOM   456  C  CD1 . PHE A 1 121 ? -14.435 -5.041  -40.279 1.00 46.91  ? 99   PHE A CD1 1 
ATOM   457  C  CD2 . PHE A 1 121 ? -14.030 -3.165  -41.696 1.00 44.75  ? 99   PHE A CD2 1 
ATOM   458  C  CE1 . PHE A 1 121 ? -13.187 -5.549  -40.587 1.00 47.82  ? 99   PHE A CE1 1 
ATOM   459  C  CE2 . PHE A 1 121 ? -12.777 -3.673  -42.013 1.00 45.56  ? 99   PHE A CE2 1 
ATOM   460  C  CZ  . PHE A 1 121 ? -12.354 -4.863  -41.459 1.00 45.80  ? 99   PHE A CZ  1 
ATOM   461  N  N   . GLY A 1 122 ? -19.669 -3.368  -41.680 1.00 46.90  ? 100  GLY A N   1 
ATOM   462  C  CA  . GLY A 1 122 ? -21.076 -3.395  -41.287 1.00 50.24  ? 100  GLY A CA  1 
ATOM   463  C  C   . GLY A 1 122 ? -21.632 -2.173  -40.560 1.00 50.13  ? 100  GLY A C   1 
ATOM   464  O  O   . GLY A 1 122 ? -22.766 -2.211  -40.108 1.00 51.66  ? 100  GLY A O   1 
ATOM   465  N  N   . LEU A 1 123 ? -20.858 -1.093  -40.443 1.00 47.94  ? 101  LEU A N   1 
ATOM   466  C  CA  . LEU A 1 123 ? -21.326 0.115   -39.751 1.00 47.23  ? 101  LEU A CA  1 
ATOM   467  C  C   . LEU A 1 123 ? -22.502 0.713   -40.473 1.00 49.28  ? 101  LEU A C   1 
ATOM   468  O  O   . LEU A 1 123 ? -22.568 0.640   -41.693 1.00 52.37  ? 101  LEU A O   1 
ATOM   469  C  CB  . LEU A 1 123 ? -20.232 1.176   -39.696 1.00 44.75  ? 101  LEU A CB  1 
ATOM   470  C  CG  . LEU A 1 123 ? -19.088 0.960   -38.736 1.00 43.96  ? 101  LEU A CG  1 
ATOM   471  C  CD1 . LEU A 1 123 ? -18.174 2.180   -38.814 1.00 42.51  ? 101  LEU A CD1 1 
ATOM   472  C  CD2 . LEU A 1 123 ? -19.575 0.754   -37.302 1.00 43.82  ? 101  LEU A CD2 1 
ATOM   473  N  N   . LYS A 1 124 ? -23.436 1.299   -39.735 1.00 49.91  ? 102  LYS A N   1 
ATOM   474  C  CA  . LYS A 1 124 ? -24.583 1.974   -40.355 1.00 52.45  ? 102  LYS A CA  1 
ATOM   475  C  C   . LYS A 1 124 ? -24.427 3.487   -40.279 1.00 49.54  ? 102  LYS A C   1 
ATOM   476  O  O   . LYS A 1 124 ? -25.002 4.215   -41.079 1.00 50.67  ? 102  LYS A O   1 
ATOM   477  C  CB  . LYS A 1 124 ? -25.902 1.588   -39.660 1.00 57.13  ? 102  LYS A CB  1 
ATOM   478  C  CG  . LYS A 1 124 ? -26.035 0.125   -39.257 1.00 60.17  ? 102  LYS A CG  1 
ATOM   479  C  CD  . LYS A 1 124 ? -27.010 -0.631  -40.134 1.00 65.80  ? 102  LYS A CD  1 
ATOM   480  C  CE  . LYS A 1 124 ? -26.410 -0.924  -41.504 1.00 67.72  ? 102  LYS A CE  1 
ATOM   481  N  NZ  . LYS A 1 124 ? -27.398 -1.636  -42.363 1.00 71.43  ? 102  LYS A NZ  1 
ATOM   482  N  N   . CYS A 1 125 ? -23.700 3.955   -39.274 1.00 46.71  ? 103  CYS A N   1 
ATOM   483  C  CA  . CYS A 1 125 ? -23.457 5.373   -39.072 1.00 46.27  ? 103  CYS A CA  1 
ATOM   484  C  C   . CYS A 1 125 ? -22.498 5.934   -40.120 1.00 45.58  ? 103  CYS A C   1 
ATOM   485  O  O   . CYS A 1 125 ? -21.872 5.194   -40.887 1.00 44.08  ? 103  CYS A O   1 
ATOM   486  C  CB  . CYS A 1 125 ? -22.851 5.615   -37.676 1.00 44.96  ? 103  CYS A CB  1 
ATOM   487  S  SG  . CYS A 1 125 ? -21.297 4.742   -37.370 1.00 43.98  ? 103  CYS A SG  1 
ATOM   488  N  N   . GLU A 1 126 ? -22.395 7.254   -40.122 1.00 44.80  ? 104  GLU A N   1 
ATOM   489  C  CA  . GLU A 1 126 ? -21.366 7.945   -40.854 1.00 43.90  ? 104  GLU A CA  1 
ATOM   490  C  C   . GLU A 1 126 ? -20.083 7.856   -40.045 1.00 41.73  ? 104  GLU A C   1 
ATOM   491  O  O   . GLU A 1 126 ? -20.108 7.953   -38.807 1.00 39.58  ? 104  GLU A O   1 
ATOM   492  C  CB  . GLU A 1 126 ? -21.783 9.396   -41.075 1.00 45.93  ? 104  GLU A CB  1 
ATOM   493  C  CG  . GLU A 1 126 ? -20.854 10.190  -41.979 1.00 46.51  ? 104  GLU A CG  1 
ATOM   494  C  CD  . GLU A 1 126 ? -21.381 11.586  -42.245 1.00 48.15  ? 104  GLU A CD  1 
ATOM   495  O  OE1 . GLU A 1 126 ? -21.691 12.315  -41.285 1.00 48.76  ? 104  GLU A OE1 1 
ATOM   496  O  OE2 . GLU A 1 126 ? -21.489 11.964  -43.421 1.00 51.01  ? 104  GLU A OE2 1 
ATOM   497  N  N   . LEU A 1 127 ? -18.965 7.652   -40.749 1.00 38.55  ? 105  LEU A N   1 
ATOM   498  C  CA  . LEU A 1 127 ? -17.652 7.575   -40.140 1.00 36.71  ? 105  LEU A CA  1 
ATOM   499  C  C   . LEU A 1 127 ? -16.800 8.675   -40.796 1.00 36.59  ? 105  LEU A C   1 
ATOM   500  O  O   . LEU A 1 127 ? -16.687 8.732   -42.028 1.00 37.37  ? 105  LEU A O   1 
ATOM   501  C  CB  . LEU A 1 127 ? -17.046 6.175   -40.365 1.00 36.90  ? 105  LEU A CB  1 
ATOM   502  C  CG  . LEU A 1 127 ? -15.674 5.867   -39.763 1.00 37.13  ? 105  LEU A CG  1 
ATOM   503  C  CD1 . LEU A 1 127 ? -15.680 6.025   -38.254 1.00 37.21  ? 105  LEU A CD1 1 
ATOM   504  C  CD2 . LEU A 1 127 ? -15.185 4.474   -40.124 1.00 37.77  ? 105  LEU A CD2 1 
ATOM   505  N  N   . LEU A 1 128 ? -16.252 9.564   -39.972 1.00 34.80  ? 106  LEU A N   1 
ATOM   506  C  CA  . LEU A 1 128 ? -15.496 10.709  -40.427 1.00 33.63  ? 106  LEU A CA  1 
ATOM   507  C  C   . LEU A 1 128 ? -14.129 10.658  -39.792 1.00 31.74  ? 106  LEU A C   1 
ATOM   508  O  O   . LEU A 1 128 ? -13.990 10.261  -38.622 1.00 30.61  ? 106  LEU A O   1 
ATOM   509  C  CB  . LEU A 1 128 ? -16.186 11.995  -40.010 1.00 34.71  ? 106  LEU A CB  1 
ATOM   510  C  CG  . LEU A 1 128 ? -17.626 12.153  -40.474 1.00 37.36  ? 106  LEU A CG  1 
ATOM   511  C  CD1 . LEU A 1 128 ? -18.108 13.516  -39.995 1.00 39.22  ? 106  LEU A CD1 1 
ATOM   512  C  CD2 . LEU A 1 128 ? -17.808 12.041  -41.989 1.00 39.06  ? 106  LEU A CD2 1 
ATOM   513  N  N   . ALA A 1 129 ? -13.122 11.052  -40.566 1.00 30.63  ? 107  ALA A N   1 
ATOM   514  C  CA  . ALA A 1 129 ? -11.759 11.130  -40.070 1.00 29.21  ? 107  ALA A CA  1 
ATOM   515  C  C   . ALA A 1 129 ? -11.238 12.573  -39.955 1.00 28.69  ? 107  ALA A C   1 
ATOM   516  O  O   . ALA A 1 129 ? -11.279 13.360  -40.910 1.00 30.48  ? 107  ALA A O   1 
ATOM   517  C  CB  . ALA A 1 129 ? -10.856 10.300  -40.951 1.00 29.06  ? 107  ALA A CB  1 
ATOM   518  N  N   . LYS A 1 130 ? -10.740 12.908  -38.774 1.00 27.90  ? 108  LYS A N   1 
ATOM   519  C  CA  . LYS A 1 130 ? -10.070 14.171  -38.535 1.00 28.27  ? 108  LYS A CA  1 
ATOM   520  C  C   . LYS A 1 130 ? -8.580  13.947  -38.803 1.00 28.14  ? 108  LYS A C   1 
ATOM   521  O  O   . LYS A 1 130 ? -7.904  13.242  -38.054 1.00 28.06  ? 108  LYS A O   1 
ATOM   522  C  CB  . LYS A 1 130 ? -10.334 14.613  -37.092 1.00 28.91  ? 108  LYS A CB  1 
ATOM   523  C  CG  . LYS A 1 130 ? -9.749  15.958  -36.698 1.00 28.73  ? 108  LYS A CG  1 
ATOM   524  C  CD  . LYS A 1 130 ? -10.407 17.112  -37.392 1.00 30.37  ? 108  LYS A CD  1 
ATOM   525  C  CE  . LYS A 1 130 ? -10.001 18.422  -36.734 1.00 29.94  ? 108  LYS A CE  1 
ATOM   526  N  NZ  . LYS A 1 130 ? -10.327 19.512  -37.668 1.00 31.11  ? 108  LYS A NZ  1 
ATOM   527  N  N   . CYS A 1 131 ? -8.086  14.518  -39.903 1.00 28.91  ? 109  CYS A N   1 
ATOM   528  C  CA  . CYS A 1 131 ? -6.786  14.153  -40.459 1.00 27.87  ? 109  CYS A CA  1 
ATOM   529  C  C   . CYS A 1 131 ? -5.714  15.142  -40.017 1.00 28.01  ? 109  CYS A C   1 
ATOM   530  O  O   . CYS A 1 131 ? -5.443  16.128  -40.704 1.00 28.79  ? 109  CYS A O   1 
ATOM   531  C  CB  . CYS A 1 131 ? -6.866  14.124  -41.978 1.00 30.16  ? 109  CYS A CB  1 
ATOM   532  S  SG  . CYS A 1 131 ? -8.061  12.944  -42.626 1.00 31.52  ? 109  CYS A SG  1 
ATOM   533  N  N   . GLU A 1 132 ? -5.102  14.853  -38.876 1.00 27.08  ? 110  GLU A N   1 
ATOM   534  C  CA  . GLU A 1 132 ? -4.099  15.734  -38.296 1.00 28.37  ? 110  GLU A CA  1 
ATOM   535  C  C   . GLU A 1 132 ? -2.725  15.655  -38.978 1.00 28.56  ? 110  GLU A C   1 
ATOM   536  O  O   . GLU A 1 132 ? -1.826  16.452  -38.672 1.00 28.67  ? 110  GLU A O   1 
ATOM   537  C  CB  . GLU A 1 132 ? -3.962  15.414  -36.805 1.00 28.20  ? 110  GLU A CB  1 
ATOM   538  C  CG  . GLU A 1 132 ? -5.208  15.799  -36.021 1.00 27.66  ? 110  GLU A CG  1 
ATOM   539  C  CD  . GLU A 1 132 ? -5.437  17.297  -36.011 1.00 30.18  ? 110  GLU A CD  1 
ATOM   540  O  OE1 . GLU A 1 132 ? -4.474  18.039  -35.710 1.00 30.02  ? 110  GLU A OE1 1 
ATOM   541  O  OE2 . GLU A 1 132 ? -6.584  17.757  -36.275 1.00 30.79  ? 110  GLU A OE2 1 
ATOM   542  N  N   . PHE A 1 133 ? -2.567  14.721  -39.909 1.00 28.42  ? 111  PHE A N   1 
ATOM   543  C  CA  . PHE A 1 133 ? -1.304  14.581  -40.630 1.00 28.21  ? 111  PHE A CA  1 
ATOM   544  C  C   . PHE A 1 133 ? -1.057  15.672  -41.668 1.00 29.17  ? 111  PHE A C   1 
ATOM   545  O  O   . PHE A 1 133 ? 0.016   15.735  -42.263 1.00 30.42  ? 111  PHE A O   1 
ATOM   546  C  CB  . PHE A 1 133 ? -1.133  13.179  -41.215 1.00 28.61  ? 111  PHE A CB  1 
ATOM   547  C  CG  . PHE A 1 133 ? -2.265  12.695  -42.081 1.00 29.21  ? 111  PHE A CG  1 
ATOM   548  C  CD1 . PHE A 1 133 ? -2.260  12.925  -43.443 1.00 30.09  ? 111  PHE A CD1 1 
ATOM   549  C  CD2 . PHE A 1 133 ? -3.311  11.955  -41.522 1.00 29.53  ? 111  PHE A CD2 1 
ATOM   550  C  CE1 . PHE A 1 133 ? -3.272  12.437  -44.253 1.00 32.16  ? 111  PHE A CE1 1 
ATOM   551  C  CE2 . PHE A 1 133 ? -4.342  11.485  -42.316 1.00 31.25  ? 111  PHE A CE2 1 
ATOM   552  C  CZ  . PHE A 1 133 ? -4.328  11.735  -43.686 1.00 32.27  ? 111  PHE A CZ  1 
ATOM   553  N  N   . PHE A 1 134 ? -2.043  16.530  -41.908 1.00 29.76  ? 112  PHE A N   1 
ATOM   554  C  CA  . PHE A 1 134 ? -1.833  17.699  -42.751 1.00 31.17  ? 112  PHE A CA  1 
ATOM   555  C  C   . PHE A 1 134 ? -1.200  18.910  -42.048 1.00 29.63  ? 112  PHE A C   1 
ATOM   556  O  O   . PHE A 1 134 ? -0.941  19.930  -42.676 1.00 33.85  ? 112  PHE A O   1 
ATOM   557  C  CB  . PHE A 1 134 ? -3.156  18.126  -43.394 1.00 34.59  ? 112  PHE A CB  1 
ATOM   558  C  CG  . PHE A 1 134 ? -3.635  17.173  -44.449 1.00 36.39  ? 112  PHE A CG  1 
ATOM   559  C  CD1 . PHE A 1 134 ? -3.174  17.283  -45.744 1.00 40.34  ? 112  PHE A CD1 1 
ATOM   560  C  CD2 . PHE A 1 134 ? -4.517  16.150  -44.138 1.00 36.41  ? 112  PHE A CD2 1 
ATOM   561  C  CE1 . PHE A 1 134 ? -3.616  16.401  -46.729 1.00 42.31  ? 112  PHE A CE1 1 
ATOM   562  C  CE2 . PHE A 1 134 ? -4.960  15.266  -45.100 1.00 39.51  ? 112  PHE A CE2 1 
ATOM   563  C  CZ  . PHE A 1 134 ? -4.508  15.390  -46.405 1.00 40.75  ? 112  PHE A CZ  1 
ATOM   564  N  N   . ASN A 1 135 ? -0.987  18.845  -40.757 1.00 27.88  ? 113  ASN A N   1 
ATOM   565  C  CA  . ASN A 1 135 ? -0.257  19.904  -40.091 1.00 27.43  ? 113  ASN A CA  1 
ATOM   566  C  C   . ASN A 1 135 ? 1.200   20.004  -40.604 1.00 29.03  ? 113  ASN A C   1 
ATOM   567  O  O   . ASN A 1 135 ? 1.768   19.018  -41.122 1.00 30.11  ? 113  ASN A O   1 
ATOM   568  C  CB  . ASN A 1 135 ? -0.281  19.694  -38.588 1.00 26.15  ? 113  ASN A CB  1 
ATOM   569  C  CG  . ASN A 1 135 ? -1.656  19.969  -37.971 1.00 27.31  ? 113  ASN A CG  1 
ATOM   570  O  OD1 . ASN A 1 135 ? -2.370  20.900  -38.352 1.00 30.30  ? 113  ASN A OD1 1 
ATOM   571  N  ND2 . ASN A 1 135 ? -2.015  19.168  -37.015 1.00 26.35  ? 113  ASN A ND2 1 
ATOM   572  N  N   . ALA A 1 136 ? 1.787   21.188  -40.436 1.00 28.57  ? 114  ALA A N   1 
ATOM   573  C  CA  . ALA A 1 136 ? 3.118   21.511  -40.944 1.00 29.52  ? 114  ALA A CA  1 
ATOM   574  C  C   . ALA A 1 136 ? 4.199   20.447  -40.724 1.00 28.31  ? 114  ALA A C   1 
ATOM   575  O  O   . ALA A 1 136 ? 4.994   20.218  -41.613 1.00 29.47  ? 114  ALA A O   1 
ATOM   576  C  CB  . ALA A 1 136 ? 3.599   22.827  -40.357 1.00 30.08  ? 114  ALA A CB  1 
ATOM   577  N  N   . GLY A 1 137 ? 4.243   19.859  -39.539 1.00 26.65  ? 115  GLY A N   1 
ATOM   578  C  CA  . GLY A 1 137 ? 5.221   18.841  -39.171 1.00 26.96  ? 115  GLY A CA  1 
ATOM   579  C  C   . GLY A 1 137 ? 4.756   17.408  -39.424 1.00 26.73  ? 115  GLY A C   1 
ATOM   580  O  O   . GLY A 1 137 ? 5.520   16.467  -39.267 1.00 27.31  ? 115  GLY A O   1 
ATOM   581  N  N   . GLY A 1 138 ? 3.513   17.258  -39.875 1.00 27.37  ? 116  GLY A N   1 
ATOM   582  C  CA  . GLY A 1 138 ? 2.929   15.963  -40.183 1.00 26.33  ? 116  GLY A CA  1 
ATOM   583  C  C   . GLY A 1 138 ? 2.149   15.299  -39.073 1.00 25.41  ? 116  GLY A C   1 
ATOM   584  O  O   . GLY A 1 138 ? 1.823   14.147  -39.202 1.00 25.08  ? 116  GLY A O   1 
ATOM   585  N  N   . SER A 1 139 ? 1.825   16.007  -37.988 1.00 25.66  ? 117  SER A N   1 
ATOM   586  C  CA  . SER A 1 139 ? 1.044   15.392  -36.939 1.00 25.42  ? 117  SER A CA  1 
ATOM   587  C  C   . SER A 1 139 ? 0.243   16.363  -36.072 1.00 25.84  ? 117  SER A C   1 
ATOM   588  O  O   . SER A 1 139 ? 0.463   17.585  -36.075 1.00 25.45  ? 117  SER A O   1 
ATOM   589  C  CB  . SER A 1 139 ? 1.924   14.543  -36.014 1.00 24.77  ? 117  SER A CB  1 
ATOM   590  O  OG  . SER A 1 139 ? 2.535   15.340  -35.018 1.00 23.42  ? 117  SER A OG  1 
ATOM   591  N  N   . VAL A 1 140 ? -0.650  15.742  -35.313 1.00 25.70  ? 118  VAL A N   1 
ATOM   592  C  CA  . VAL A 1 140 ? -1.468  16.384  -34.269 1.00 26.40  ? 118  VAL A CA  1 
ATOM   593  C  C   . VAL A 1 140 ? -0.636  17.142  -33.253 1.00 26.67  ? 118  VAL A C   1 
ATOM   594  O  O   . VAL A 1 140 ? -1.079  18.150  -32.733 1.00 25.67  ? 118  VAL A O   1 
ATOM   595  C  CB  . VAL A 1 140 ? -2.349  15.338  -33.539 1.00 26.12  ? 118  VAL A CB  1 
ATOM   596  C  CG1 . VAL A 1 140 ? -1.520  14.295  -32.820 1.00 25.82  ? 118  VAL A CG1 1 
ATOM   597  C  CG2 . VAL A 1 140 ? -3.314  15.984  -32.549 1.00 27.95  ? 118  VAL A CG2 1 
ATOM   598  N  N   . LYS A 1 141 ? 0.579   16.668  -32.983 1.00 25.95  ? 119  LYS A N   1 
ATOM   599  C  CA  . LYS A 1 141 ? 1.448   17.312  -31.990 1.00 25.19  ? 119  LYS A CA  1 
ATOM   600  C  C   . LYS A 1 141 ? 1.964   18.670  -32.343 1.00 25.32  ? 119  LYS A C   1 
ATOM   601  O  O   . LYS A 1 141 ? 2.395   19.425  -31.449 1.00 25.34  ? 119  LYS A O   1 
ATOM   602  C  CB  . LYS A 1 141 ? 2.662   16.438  -31.696 1.00 25.58  ? 119  LYS A CB  1 
ATOM   603  C  CG  . LYS A 1 141 ? 2.298   15.104  -31.131 1.00 26.34  ? 119  LYS A CG  1 
ATOM   604  C  CD  . LYS A 1 141 ? 1.443   15.317  -29.886 1.00 27.62  ? 119  LYS A CD  1 
ATOM   605  C  CE  . LYS A 1 141 ? 1.704   14.245  -28.892 1.00 28.88  ? 119  LYS A CE  1 
ATOM   606  N  NZ  . LYS A 1 141 ? 1.531   13.019  -29.672 1.00 29.33  ? 119  LYS A NZ  1 
ATOM   607  N  N   . ASP A 1 142 ? 1.954   19.011  -33.624 1.00 25.91  ? 120  ASP A N   1 
ATOM   608  C  CA  . ASP A 1 142 ? 2.272   20.373  -34.017 1.00 26.53  ? 120  ASP A CA  1 
ATOM   609  C  C   . ASP A 1 142 ? 1.391   21.398  -33.248 1.00 28.31  ? 120  ASP A C   1 
ATOM   610  O  O   . ASP A 1 142 ? 1.848   22.507  -32.976 1.00 26.65  ? 120  ASP A O   1 
ATOM   611  C  CB  . ASP A 1 142 ? 2.123   20.543  -35.522 1.00 29.13  ? 120  ASP A CB  1 
ATOM   612  C  CG  . ASP A 1 142 ? 3.079   19.610  -36.317 1.00 30.65  ? 120  ASP A CG  1 
ATOM   613  O  OD1 . ASP A 1 142 ? 4.137   19.258  -35.750 1.00 31.13  ? 120  ASP A OD1 1 
ATOM   614  O  OD2 . ASP A 1 142 ? 2.750   19.176  -37.460 1.00 31.38  ? 120  ASP A OD2 1 
ATOM   615  N  N   . ARG A 1 143 ? 0.136   21.036  -32.935 1.00 26.41  ? 121  ARG A N   1 
ATOM   616  C  CA  . ARG A 1 143 ? -0.756  21.934  -32.165 1.00 26.70  ? 121  ARG A CA  1 
ATOM   617  C  C   . ARG A 1 143 ? -0.172  22.204  -30.786 1.00 25.54  ? 121  ARG A C   1 
ATOM   618  O  O   . ARG A 1 143 ? -0.150  23.334  -30.358 1.00 26.51  ? 121  ARG A O   1 
ATOM   619  C  CB  . ARG A 1 143 ? -2.158  21.329  -32.004 1.00 25.72  ? 121  ARG A CB  1 
ATOM   620  C  CG  . ARG A 1 143 ? -2.953  21.173  -33.281 1.00 27.36  ? 121  ARG A CG  1 
ATOM   621  C  CD  . ARG A 1 143 ? -4.302  20.528  -32.983 1.00 27.27  ? 121  ARG A CD  1 
ATOM   622  N  NE  . ARG A 1 143 ? -5.083  20.213  -34.174 1.00 28.17  ? 121  ARG A NE  1 
ATOM   623  C  CZ  . ARG A 1 143 ? -6.054  20.973  -34.684 1.00 28.73  ? 121  ARG A CZ  1 
ATOM   624  N  NH1 . ARG A 1 143 ? -6.378  22.142  -34.146 1.00 31.43  ? 121  ARG A NH1 1 
ATOM   625  N  NH2 . ARG A 1 143 ? -6.708  20.578  -35.761 1.00 28.37  ? 121  ARG A NH2 1 
ATOM   626  N  N   . ILE A 1 144 ? 0.298   21.166  -30.086 1.00 25.03  ? 122  ILE A N   1 
ATOM   627  C  CA  . ILE A 1 144 ? 0.726   21.347  -28.694 1.00 26.08  ? 122  ILE A CA  1 
ATOM   628  C  C   . ILE A 1 144 ? 2.153   21.867  -28.600 1.00 27.62  ? 122  ILE A C   1 
ATOM   629  O  O   . ILE A 1 144 ? 2.478   22.591  -27.688 1.00 26.25  ? 122  ILE A O   1 
ATOM   630  C  CB  . ILE A 1 144 ? 0.534   20.091  -27.839 1.00 27.60  ? 122  ILE A CB  1 
ATOM   631  C  CG1 . ILE A 1 144 ? 1.632   19.048  -28.096 1.00 27.27  ? 122  ILE A CG1 1 
ATOM   632  C  CG2 . ILE A 1 144 ? -0.870  19.502  -28.053 1.00 27.19  ? 122  ILE A CG2 1 
ATOM   633  C  CD1 . ILE A 1 144 ? 1.680   17.997  -27.034 1.00 26.55  ? 122  ILE A CD1 1 
ATOM   634  N  N   . SER A 1 145 ? 2.984   21.562  -29.596 1.00 27.80  ? 123  SER A N   1 
ATOM   635  C  CA  . SER A 1 145 ? 4.320   22.153  -29.699 1.00 28.01  ? 123  SER A CA  1 
ATOM   636  C  C   . SER A 1 145 ? 4.234   23.651  -29.788 1.00 27.29  ? 123  SER A C   1 
ATOM   637  O  O   . SER A 1 145 ? 4.876   24.370  -29.038 1.00 29.61  ? 123  SER A O   1 
ATOM   638  C  CB  . SER A 1 145 ? 5.053   21.569  -30.932 1.00 29.29  ? 123  SER A CB  1 
ATOM   639  O  OG  . SER A 1 145 ? 5.254   20.185  -30.653 1.00 34.21  ? 123  SER A OG  1 
ATOM   640  N  N   . LEU A 1 146 ? 3.450   24.142  -30.725 1.00 27.18  ? 124  LEU A N   1 
ATOM   641  C  CA  . LEU A 1 146 ? 3.266   25.574  -30.872 1.00 27.54  ? 124  LEU A CA  1 
ATOM   642  C  C   . LEU A 1 146 ? 2.630   26.207  -29.609 1.00 28.78  ? 124  LEU A C   1 
ATOM   643  O  O   . LEU A 1 146 ? 3.076   27.232  -29.116 1.00 27.79  ? 124  LEU A O   1 
ATOM   644  C  CB  . LEU A 1 146 ? 2.376   25.843  -32.066 1.00 28.94  ? 124  LEU A CB  1 
ATOM   645  C  CG  . LEU A 1 146 ? 2.003   27.296  -32.361 1.00 32.03  ? 124  LEU A CG  1 
ATOM   646  C  CD1 . LEU A 1 146 ? 3.259   28.119  -32.555 1.00 34.41  ? 124  LEU A CD1 1 
ATOM   647  C  CD2 . LEU A 1 146 ? 1.117   27.411  -33.594 1.00 33.32  ? 124  LEU A CD2 1 
ATOM   648  N  N   . ARG A 1 147 ? 1.557   25.623  -29.127 1.00 29.59  ? 125  ARG A N   1 
ATOM   649  C  CA  . ARG A 1 147 ? 0.895   26.193  -27.945 1.00 32.72  ? 125  ARG A CA  1 
ATOM   650  C  C   . ARG A 1 147 ? 1.817   26.226  -26.711 1.00 31.35  ? 125  ARG A C   1 
ATOM   651  O  O   . ARG A 1 147 ? 1.835   27.219  -25.984 1.00 31.37  ? 125  ARG A O   1 
ATOM   652  C  CB  . ARG A 1 147 ? -0.407  25.454  -27.632 1.00 35.27  ? 125  ARG A CB  1 
ATOM   653  C  CG  . ARG A 1 147 ? -0.998  25.817  -26.263 1.00 37.89  ? 125  ARG A CG  1 
ATOM   654  C  CD  . ARG A 1 147 ? -1.547  27.232  -26.165 1.00 44.69  ? 125  ARG A CD  1 
ATOM   655  N  NE  . ARG A 1 147 ? -2.927  27.060  -26.517 1.00 49.83  ? 125  ARG A NE  1 
ATOM   656  C  CZ  . ARG A 1 147 ? -3.996  27.150  -25.743 1.00 41.25  ? 125  ARG A CZ  1 
ATOM   657  N  NH1 . ARG A 1 147 ? -3.997  27.609  -24.501 1.00 45.04  ? 125  ARG A NH1 1 
ATOM   658  N  NH2 . ARG A 1 147 ? -5.126  26.839  -26.319 1.00 41.02  ? 125  ARG A NH2 1 
ATOM   659  N  N   . MET A 1 148 ? 2.566   25.147  -26.471 1.00 30.27  ? 126  MET A N   1 
ATOM   660  C  CA  . MET A 1 148 ? 3.454   25.096  -25.297 1.00 30.20  ? 126  MET A CA  1 
ATOM   661  C  C   . MET A 1 148 ? 4.522   26.167  -25.425 1.00 29.76  ? 126  MET A C   1 
ATOM   662  O  O   . MET A 1 148 ? 4.860   26.834  -24.450 1.00 30.16  ? 126  MET A O   1 
ATOM   663  C  CB  . MET A 1 148 ? 4.102   23.721  -25.119 1.00 29.06  ? 126  MET A CB  1 
ATOM   664  C  CG  . MET A 1 148 ? 3.188   22.664  -24.530 1.00 30.30  ? 126  MET A CG  1 
ATOM   665  S  SD  . MET A 1 148 ? 4.022   21.135  -24.049 1.00 30.16  ? 126  MET A SD  1 
ATOM   666  C  CE  . MET A 1 148 ? 4.700   20.585  -25.597 1.00 30.20  ? 126  MET A CE  1 
ATOM   667  N  N   . ILE A 1 149 ? 5.062   26.340  -26.626 1.00 28.61  ? 127  ILE A N   1 
ATOM   668  C  CA  . ILE A 1 149 ? 6.062   27.387  -26.821 1.00 30.43  ? 127  ILE A CA  1 
ATOM   669  C  C   . ILE A 1 149 ? 5.464   28.785  -26.673 1.00 31.31  ? 127  ILE A C   1 
ATOM   670  O  O   . ILE A 1 149 ? 6.028   29.645  -25.977 1.00 32.09  ? 127  ILE A O   1 
ATOM   671  C  CB  . ILE A 1 149 ? 6.782   27.249  -28.183 1.00 30.33  ? 127  ILE A CB  1 
ATOM   672  C  CG1 . ILE A 1 149 ? 7.671   26.011  -28.135 1.00 29.97  ? 127  ILE A CG1 1 
ATOM   673  C  CG2 . ILE A 1 149 ? 7.581   28.519  -28.529 1.00 31.24  ? 127  ILE A CG2 1 
ATOM   674  C  CD1 . ILE A 1 149 ? 8.255   25.632  -29.466 1.00 30.68  ? 127  ILE A CD1 1 
ATOM   675  N  N   . GLU A 1 150 ? 4.332   29.024  -27.313 1.00 32.26  ? 128  GLU A N   1 
ATOM   676  C  CA  . GLU A 1 150 ? 3.699   30.368  -27.226 1.00 35.34  ? 128  GLU A CA  1 
ATOM   677  C  C   . GLU A 1 150 ? 3.359   30.764  -25.787 1.00 33.30  ? 128  GLU A C   1 
ATOM   678  O  O   . GLU A 1 150 ? 3.620   31.871  -25.371 1.00 33.10  ? 128  GLU A O   1 
ATOM   679  C  CB  . GLU A 1 150 ? 2.479   30.463  -28.159 1.00 38.65  ? 128  GLU A CB  1 
ATOM   680  C  CG  . GLU A 1 150 ? 2.972   30.373  -29.609 1.00 46.08  ? 128  GLU A CG  1 
ATOM   681  C  CD  . GLU A 1 150 ? 2.081   30.991  -30.674 1.00 50.92  ? 128  GLU A CD  1 
ATOM   682  O  OE1 . GLU A 1 150 ? 0.838   30.775  -30.617 1.00 52.59  ? 128  GLU A OE1 1 
ATOM   683  O  OE2 . GLU A 1 150 ? 2.665   31.626  -31.606 1.00 52.32  ? 128  GLU A OE2 1 
ATOM   684  N  N   . ASP A 1 151 ? 2.823   29.828  -25.026 1.00 32.57  ? 129  ASP A N   1 
ATOM   685  C  CA  . ASP A 1 151 ? 2.477   30.105  -23.633 1.00 33.82  ? 129  ASP A CA  1 
ATOM   686  C  C   . ASP A 1 151 ? 3.729   30.371  -22.800 1.00 34.07  ? 129  ASP A C   1 
ATOM   687  O  O   . ASP A 1 151 ? 3.751   31.302  -22.018 1.00 35.59  ? 129  ASP A O   1 
ATOM   688  C  CB  . ASP A 1 151 ? 1.647   28.949  -23.065 1.00 32.89  ? 129  ASP A CB  1 
ATOM   689  C  CG  . ASP A 1 151 ? 0.234   28.883  -23.672 1.00 32.90  ? 129  ASP A CG  1 
ATOM   690  O  OD1 . ASP A 1 151 ? -0.213  29.841  -24.341 1.00 33.94  ? 129  ASP A OD1 1 
ATOM   691  O  OD2 . ASP A 1 151 ? -0.439  27.862  -23.484 1.00 33.20  ? 129  ASP A OD2 1 
ATOM   692  N  N   . ALA A 1 152 ? 4.783   29.583  -23.011 1.00 33.36  ? 130  ALA A N   1 
ATOM   693  C  CA  . ALA A 1 152 ? 6.035   29.760  -22.268 1.00 33.92  ? 130  ALA A CA  1 
ATOM   694  C  C   . ALA A 1 152 ? 6.733   31.054  -22.653 1.00 35.81  ? 130  ALA A C   1 
ATOM   695  O  O   . ALA A 1 152 ? 7.401   31.675  -21.806 1.00 36.29  ? 130  ALA A O   1 
ATOM   696  C  CB  . ALA A 1 152 ? 6.973   28.571  -22.485 1.00 33.20  ? 130  ALA A CB  1 
ATOM   697  N  N   . GLU A 1 153 ? 6.596   31.481  -23.914 1.00 35.68  ? 131  GLU A N   1 
ATOM   698  C  CA  . GLU A 1 153 ? 7.119   32.788  -24.299 1.00 38.25  ? 131  GLU A CA  1 
ATOM   699  C  C   . GLU A 1 153 ? 6.333   33.917  -23.615 1.00 40.65  ? 131  GLU A C   1 
ATOM   700  O  O   . GLU A 1 153 ? 6.919   34.876  -23.141 1.00 39.83  ? 131  GLU A O   1 
ATOM   701  C  CB  . GLU A 1 153 ? 7.115   32.993  -25.820 1.00 39.47  ? 131  GLU A CB  1 
ATOM   702  C  CG  . GLU A 1 153 ? 8.158   32.155  -26.575 1.00 39.61  ? 131  GLU A CG  1 
ATOM   703  C  CD  . GLU A 1 153 ? 7.983   32.195  -28.096 1.00 40.98  ? 131  GLU A CD  1 
ATOM   704  O  OE1 . GLU A 1 153 ? 6.941   32.663  -28.584 1.00 41.72  ? 131  GLU A OE1 1 
ATOM   705  O  OE2 . GLU A 1 153 ? 8.883   31.726  -28.821 1.00 41.99  ? 131  GLU A OE2 1 
ATOM   706  N  N   . ARG A 1 154 ? 5.012   33.801  -23.568 1.00 41.62  ? 132  ARG A N   1 
ATOM   707  C  CA  . ARG A 1 154 ? 4.183   34.864  -23.003 1.00 43.68  ? 132  ARG A CA  1 
ATOM   708  C  C   . ARG A 1 154 ? 4.409   34.956  -21.486 1.00 45.36  ? 132  ARG A C   1 
ATOM   709  O  O   . ARG A 1 154 ? 4.460   36.044  -20.944 1.00 46.91  ? 132  ARG A O   1 
ATOM   710  C  CB  . ARG A 1 154 ? 2.710   34.622  -23.325 1.00 44.39  ? 132  ARG A CB  1 
ATOM   711  C  CG  . ARG A 1 154 ? 1.815   35.850  -23.158 1.00 47.92  ? 132  ARG A CG  1 
ATOM   712  C  CD  . ARG A 1 154 ? 0.485   35.676  -23.883 1.00 48.31  ? 132  ARG A CD  1 
ATOM   713  N  NE  . ARG A 1 154 ? -0.121  34.469  -23.392 1.00 49.29  ? 132  ARG A NE  1 
ATOM   714  C  CZ  . ARG A 1 154 ? -0.369  33.369  -24.096 1.00 48.22  ? 132  ARG A CZ  1 
ATOM   715  N  NH1 . ARG A 1 154 ? -0.161  33.302  -25.407 1.00 50.80  ? 132  ARG A NH1 1 
ATOM   716  N  NH2 . ARG A 1 154 ? -0.875  32.328  -23.467 1.00 47.73  ? 132  ARG A NH2 1 
ATOM   717  N  N   . ASP A 1 155 ? 4.534   33.798  -20.841 1.00 45.30  ? 133  ASP A N   1 
ATOM   718  C  CA  . ASP A 1 155 ? 4.966   33.644  -19.442 1.00 47.51  ? 133  ASP A CA  1 
ATOM   719  C  C   . ASP A 1 155 ? 6.254   34.290  -19.067 1.00 48.21  ? 133  ASP A C   1 
ATOM   720  O  O   . ASP A 1 155 ? 6.481   34.498  -17.917 1.00 48.96  ? 133  ASP A O   1 
ATOM   721  C  CB  . ASP A 1 155 ? 5.242   32.158  -19.139 1.00 49.07  ? 133  ASP A CB  1 
ATOM   722  C  CG  . ASP A 1 155 ? 4.010   31.412  -18.821 1.00 51.65  ? 133  ASP A CG  1 
ATOM   723  O  OD1 . ASP A 1 155 ? 2.966   32.103  -18.761 1.00 56.80  ? 133  ASP A OD1 1 
ATOM   724  O  OD2 . ASP A 1 155 ? 4.071   30.168  -18.649 1.00 49.36  ? 133  ASP A OD2 1 
ATOM   725  N  N   . GLY A 1 156 ? 7.167   34.464  -20.005 1.00 49.35  ? 134  GLY A N   1 
ATOM   726  C  CA  . GLY A 1 156 ? 8.525   34.859  -19.642 1.00 51.37  ? 134  GLY A CA  1 
ATOM   727  C  C   . GLY A 1 156 ? 9.431   33.700  -19.269 1.00 50.13  ? 134  GLY A C   1 
ATOM   728  O  O   . GLY A 1 156 ? 10.584  33.930  -18.943 1.00 54.95  ? 134  GLY A O   1 
ATOM   729  N  N   . THR A 1 157 ? 8.917   32.472  -19.320 1.00 47.72  ? 135  THR A N   1 
ATOM   730  C  CA  . THR A 1 157 ? 9.707   31.280  -19.078 1.00 49.11  ? 135  THR A CA  1 
ATOM   731  C  C   . THR A 1 157 ? 10.768  31.094  -20.164 1.00 49.03  ? 135  THR A C   1 
ATOM   732  O  O   . THR A 1 157 ? 11.942  30.880  -19.882 1.00 50.97  ? 135  THR A O   1 
ATOM   733  C  CB  . THR A 1 157 ? 8.817   30.037  -19.119 1.00 48.93  ? 135  THR A CB  1 
ATOM   734  O  OG1 . THR A 1 157 ? 7.743   30.193  -18.205 1.00 51.73  ? 135  THR A OG1 1 
ATOM   735  C  CG2 . THR A 1 157 ? 9.606   28.769  -18.775 1.00 51.57  ? 135  THR A CG2 1 
ATOM   736  N  N   . LEU A 1 158 ? 10.332  31.184  -21.412 1.00 46.01  ? 136  LEU A N   1 
ATOM   737  C  CA  . LEU A 1 158 ? 11.188  30.905  -22.555 1.00 45.31  ? 136  LEU A CA  1 
ATOM   738  C  C   . LEU A 1 158 ? 11.675  32.201  -23.173 1.00 45.51  ? 136  LEU A C   1 
ATOM   739  O  O   . LEU A 1 158 ? 10.861  32.993  -23.640 1.00 45.71  ? 136  LEU A O   1 
ATOM   740  C  CB  . LEU A 1 158 ? 10.380  30.108  -23.580 1.00 43.79  ? 136  LEU A CB  1 
ATOM   741  C  CG  . LEU A 1 158 ? 11.124  29.309  -24.636 1.00 43.94  ? 136  LEU A CG  1 
ATOM   742  C  CD1 . LEU A 1 158 ? 12.175  28.406  -23.994 1.00 43.36  ? 136  LEU A CD1 1 
ATOM   743  C  CD2 . LEU A 1 158 ? 10.123  28.499  -25.455 1.00 41.58  ? 136  LEU A CD2 1 
ATOM   744  N  N   . LYS A 1 159 ? 12.992  32.399  -23.177 1.00 46.71  ? 137  LYS A N   1 
ATOM   745  C  CA  . LYS A 1 159 ? 13.641  33.612  -23.695 1.00 50.42  ? 137  LYS A CA  1 
ATOM   746  C  C   . LYS A 1 159 ? 14.336  33.362  -25.018 1.00 49.22  ? 137  LYS A C   1 
ATOM   747  O  O   . LYS A 1 159 ? 14.673  32.216  -25.340 1.00 44.35  ? 137  LYS A O   1 
ATOM   748  C  CB  . LYS A 1 159 ? 14.741  34.117  -22.739 1.00 54.76  ? 137  LYS A CB  1 
ATOM   749  C  CG  . LYS A 1 159 ? 14.390  34.150  -21.271 1.00 58.46  ? 137  LYS A CG  1 
ATOM   750  C  CD  . LYS A 1 159 ? 13.311  35.167  -20.993 1.00 62.14  ? 137  LYS A CD  1 
ATOM   751  C  CE  . LYS A 1 159 ? 13.302  35.535  -19.521 1.00 66.62  ? 137  LYS A CE  1 
ATOM   752  N  NZ  . LYS A 1 159 ? 12.284  36.584  -19.252 1.00 69.34  ? 137  LYS A NZ  1 
ATOM   753  N  N   . PRO A 1 160 ? 14.632  34.449  -25.760 1.00 50.45  ? 138  PRO A N   1 
ATOM   754  C  CA  . PRO A 1 160 ? 15.317  34.272  -27.052 1.00 50.13  ? 138  PRO A CA  1 
ATOM   755  C  C   . PRO A 1 160 ? 16.584  33.434  -26.922 1.00 49.08  ? 138  PRO A C   1 
ATOM   756  O  O   . PRO A 1 160 ? 17.378  33.666  -26.009 1.00 48.95  ? 138  PRO A O   1 
ATOM   757  C  CB  . PRO A 1 160 ? 15.635  35.709  -27.473 1.00 51.71  ? 138  PRO A CB  1 
ATOM   758  C  CG  . PRO A 1 160 ? 14.548  36.523  -26.839 1.00 52.19  ? 138  PRO A CG  1 
ATOM   759  C  CD  . PRO A 1 160 ? 14.245  35.857  -25.529 1.00 51.42  ? 138  PRO A CD  1 
ATOM   760  N  N   . GLY A 1 161 ? 16.729  32.439  -27.795 1.00 49.02  ? 139  GLY A N   1 
ATOM   761  C  CA  . GLY A 1 161 ? 17.898  31.551  -27.791 1.00 49.55  ? 139  GLY A CA  1 
ATOM   762  C  C   . GLY A 1 161 ? 18.045  30.566  -26.625 1.00 49.55  ? 139  GLY A C   1 
ATOM   763  O  O   . GLY A 1 161 ? 19.119  29.995  -26.442 1.00 51.26  ? 139  GLY A O   1 
ATOM   764  N  N   . ASP A 1 162 ? 16.990  30.352  -25.835 1.00 45.67  ? 140  ASP A N   1 
ATOM   765  C  CA  . ASP A 1 162 ? 17.035  29.341  -24.765 1.00 44.13  ? 140  ASP A CA  1 
ATOM   766  C  C   . ASP A 1 162 ? 17.030  27.957  -25.367 1.00 38.54  ? 140  ASP A C   1 
ATOM   767  O  O   . ASP A 1 162 ? 16.827  27.793  -26.572 1.00 39.66  ? 140  ASP A O   1 
ATOM   768  C  CB  . ASP A 1 162 ? 15.826  29.450  -23.811 1.00 44.14  ? 140  ASP A CB  1 
ATOM   769  C  CG  . ASP A 1 162 ? 16.005  30.513  -22.737 1.00 46.33  ? 140  ASP A CG  1 
ATOM   770  O  OD1 . ASP A 1 162 ? 17.086  31.111  -22.658 1.00 49.50  ? 140  ASP A OD1 1 
ATOM   771  O  OD2 . ASP A 1 162 ? 15.050  30.738  -21.960 1.00 44.57  ? 140  ASP A OD2 1 
ATOM   772  N  N   . THR A 1 163 ? 17.227  26.957  -24.518 1.00 36.85  ? 141  THR A N   1 
ATOM   773  C  CA  . THR A 1 163 ? 17.164  25.564  -24.932 1.00 35.44  ? 141  THR A CA  1 
ATOM   774  C  C   . THR A 1 163 ? 15.889  24.848  -24.482 1.00 34.82  ? 141  THR A C   1 
ATOM   775  O  O   . THR A 1 163 ? 15.488  24.919  -23.325 1.00 36.86  ? 141  THR A O   1 
ATOM   776  C  CB  . THR A 1 163 ? 18.382  24.802  -24.405 1.00 35.10  ? 141  THR A CB  1 
ATOM   777  O  OG1 . THR A 1 163 ? 19.538  25.389  -24.971 1.00 36.16  ? 141  THR A OG1 1 
ATOM   778  C  CG2 . THR A 1 163 ? 18.341  23.362  -24.803 1.00 34.06  ? 141  THR A CG2 1 
ATOM   779  N  N   . ILE A 1 164 ? 15.286  24.153  -25.425 1.00 33.05  ? 142  ILE A N   1 
ATOM   780  C  CA  . ILE A 1 164 ? 14.109  23.309  -25.210 1.00 34.26  ? 142  ILE A CA  1 
ATOM   781  C  C   . ILE A 1 164 ? 14.570  21.839  -25.198 1.00 31.30  ? 142  ILE A C   1 
ATOM   782  O  O   . ILE A 1 164 ? 15.240  21.392  -26.119 1.00 30.95  ? 142  ILE A O   1 
ATOM   783  C  CB  . ILE A 1 164 ? 13.070  23.546  -26.332 1.00 35.21  ? 142  ILE A CB  1 
ATOM   784  C  CG1 . ILE A 1 164 ? 12.556  24.983  -26.281 1.00 38.71  ? 142  ILE A CG1 1 
ATOM   785  C  CG2 . ILE A 1 164 ? 11.897  22.577  -26.227 1.00 37.19  ? 142  ILE A CG2 1 
ATOM   786  C  CD1 . ILE A 1 164 ? 11.769  25.391  -27.521 1.00 41.43  ? 142  ILE A CD1 1 
ATOM   787  N  N   . ILE A 1 165 ? 14.223  21.110  -24.144 1.00 29.47  ? 143  ILE A N   1 
ATOM   788  C  CA  . ILE A 1 165 ? 14.514  19.689  -24.035 1.00 28.39  ? 143  ILE A CA  1 
ATOM   789  C  C   . ILE A 1 165 ? 13.194  18.992  -23.797 1.00 28.79  ? 143  ILE A C   1 
ATOM   790  O  O   . ILE A 1 165 ? 12.449  19.374  -22.862 1.00 32.56  ? 143  ILE A O   1 
ATOM   791  C  CB  . ILE A 1 165 ? 15.426  19.410  -22.835 1.00 29.19  ? 143  ILE A CB  1 
ATOM   792  C  CG1 . ILE A 1 165 ? 16.677  20.296  -22.915 1.00 30.86  ? 143  ILE A CG1 1 
ATOM   793  C  CG2 . ILE A 1 165 ? 15.704  17.910  -22.732 1.00 28.57  ? 143  ILE A CG2 1 
ATOM   794  C  CD1 . ILE A 1 165 ? 17.603  20.153  -21.745 1.00 32.80  ? 143  ILE A CD1 1 
ATOM   795  N  N   . GLU A 1 166 ? 12.866  17.998  -24.605 1.00 26.72  ? 144  GLU A N   1 
ATOM   796  C  CA  . GLU A 1 166 ? 11.591  17.312  -24.427 1.00 27.40  ? 144  GLU A CA  1 
ATOM   797  C  C   . GLU A 1 166 ? 11.696  15.802  -24.579 1.00 26.68  ? 144  GLU A C   1 
ATOM   798  O  O   . GLU A 1 166 ? 12.258  15.309  -25.563 1.00 25.59  ? 144  GLU A O   1 
ATOM   799  C  CB  . GLU A 1 166 ? 10.539  17.829  -25.401 1.00 28.03  ? 144  GLU A CB  1 
ATOM   800  C  CG  . GLU A 1 166 ? 9.136   17.277  -25.163 1.00 28.35  ? 144  GLU A CG  1 
ATOM   801  C  CD  . GLU A 1 166 ? 8.391   17.911  -23.975 1.00 32.26  ? 144  GLU A CD  1 
ATOM   802  O  OE1 . GLU A 1 166 ? 8.858   18.903  -23.356 1.00 31.64  ? 144  GLU A OE1 1 
ATOM   803  O  OE2 . GLU A 1 166 ? 7.291   17.394  -23.667 1.00 33.61  ? 144  GLU A OE2 1 
ATOM   804  N  N   . PRO A 1 167 ? 11.125  15.072  -23.618 1.00 26.50  ? 145  PRO A N   1 
ATOM   805  C  CA  . PRO A 1 167 ? 10.910  13.650  -23.767 1.00 25.79  ? 145  PRO A CA  1 
ATOM   806  C  C   . PRO A 1 167 ? 9.732   13.372  -24.680 1.00 26.32  ? 145  PRO A C   1 
ATOM   807  O  O   . PRO A 1 167 ? 8.647   13.908  -24.459 1.00 27.01  ? 145  PRO A O   1 
ATOM   808  C  CB  . PRO A 1 167 ? 10.650  13.183  -22.326 1.00 26.97  ? 145  PRO A CB  1 
ATOM   809  C  CG  . PRO A 1 167 ? 10.066  14.378  -21.642 1.00 26.84  ? 145  PRO A CG  1 
ATOM   810  C  CD  . PRO A 1 167 ? 10.554  15.595  -22.360 1.00 27.21  ? 145  PRO A CD  1 
ATOM   811  N  N   . THR A 1 168 ? 9.928   12.528  -25.692 1.00 23.77  ? 146  THR A N   1 
ATOM   812  C  CA  . THR A 1 168 ? 8.926   12.385  -26.726 1.00 24.55  ? 146  THR A CA  1 
ATOM   813  C  C   . THR A 1 168 ? 9.037   11.006  -27.399 1.00 24.52  ? 146  THR A C   1 
ATOM   814  O  O   . THR A 1 168 ? 10.103  10.393  -27.411 1.00 24.65  ? 146  THR A O   1 
ATOM   815  C  CB  . THR A 1 168 ? 9.084   13.526  -27.748 1.00 25.51  ? 146  THR A CB  1 
ATOM   816  O  OG1 . THR A 1 168 ? 8.212   13.346  -28.875 1.00 23.36  ? 146  THR A OG1 1 
ATOM   817  C  CG2 . THR A 1 168 ? 10.516  13.583  -28.267 1.00 27.27  ? 146  THR A CG2 1 
ATOM   818  N  N   . SER A 1 169 ? 7.917   10.536  -27.928 1.00 23.94  ? 147  SER A N   1 
ATOM   819  C  CA  . SER A 1 169 ? 7.846   9.369   -28.754 1.00 25.28  ? 147  SER A CA  1 
ATOM   820  C  C   . SER A 1 169 ? 8.115   9.777   -30.195 1.00 26.38  ? 147  SER A C   1 
ATOM   821  O  O   . SER A 1 169 ? 8.196   8.921   -31.060 1.00 27.21  ? 147  SER A O   1 
ATOM   822  C  CB  . SER A 1 169 ? 6.482   8.658   -28.629 1.00 25.76  ? 147  SER A CB  1 
ATOM   823  O  OG  . SER A 1 169 ? 5.406   9.554   -28.852 1.00 26.29  ? 147  SER A OG  1 
ATOM   824  N  N   . GLY A 1 170 ? 8.265   11.077  -30.439 1.00 23.74  ? 148  GLY A N   1 
ATOM   825  C  CA  . GLY A 1 170 ? 8.799   11.563  -31.705 1.00 24.60  ? 148  GLY A CA  1 
ATOM   826  C  C   . GLY A 1 170 ? 8.035   12.741  -32.303 1.00 23.84  ? 148  GLY A C   1 
ATOM   827  O  O   . GLY A 1 170 ? 8.652   13.688  -32.755 1.00 22.66  ? 148  GLY A O   1 
ATOM   828  N  N   . ASN A 1 171 ? 6.700   12.684  -32.317 1.00 23.07  ? 149  ASN A N   1 
ATOM   829  C  CA  . ASN A 1 171 ? 5.931   13.763  -32.962 1.00 24.41  ? 149  ASN A CA  1 
ATOM   830  C  C   . ASN A 1 171 ? 5.956   15.100  -32.254 1.00 22.85  ? 149  ASN A C   1 
ATOM   831  O  O   . ASN A 1 171 ? 6.021   16.108  -32.915 1.00 24.37  ? 149  ASN A O   1 
ATOM   832  C  CB  . ASN A 1 171 ? 4.508   13.340  -33.273 1.00 22.96  ? 149  ASN A CB  1 
ATOM   833  C  CG  . ASN A 1 171 ? 4.458   12.363  -34.421 1.00 25.47  ? 149  ASN A CG  1 
ATOM   834  O  OD1 . ASN A 1 171 ? 5.205   12.508  -35.405 1.00 26.36  ? 149  ASN A OD1 1 
ATOM   835  N  ND2 . ASN A 1 171 ? 3.578   11.376  -34.323 1.00 24.62  ? 149  ASN A ND2 1 
ATOM   836  N  N   . THR A 1 172 ? 5.936   15.118  -30.928 1.00 22.11  ? 150  THR A N   1 
ATOM   837  C  CA  . THR A 1 172 ? 6.071   16.349  -30.206 1.00 23.63  ? 150  THR A CA  1 
ATOM   838  C  C   . THR A 1 172 ? 7.491   16.890  -30.415 1.00 24.60  ? 150  THR A C   1 
ATOM   839  O  O   . THR A 1 172 ? 7.681   18.085  -30.570 1.00 25.75  ? 150  THR A O   1 
ATOM   840  C  CB  . THR A 1 172 ? 5.757   16.172  -28.724 1.00 24.34  ? 150  THR A CB  1 
ATOM   841  O  OG1 . THR A 1 172 ? 4.381   15.770  -28.587 1.00 23.58  ? 150  THR A OG1 1 
ATOM   842  C  CG2 . THR A 1 172 ? 5.961   17.445  -27.995 1.00 24.29  ? 150  THR A CG2 1 
ATOM   843  N  N   . GLY A 1 173 ? 8.479   16.000  -30.437 1.00 25.28  ? 151  GLY A N   1 
ATOM   844  C  CA  . GLY A 1 173 ? 9.851   16.399  -30.761 1.00 26.41  ? 151  GLY A CA  1 
ATOM   845  C  C   . GLY A 1 173 ? 9.939   17.062  -32.122 1.00 24.87  ? 151  GLY A C   1 
ATOM   846  O  O   . GLY A 1 173 ? 10.572  18.103  -32.267 1.00 23.31  ? 151  GLY A O   1 
ATOM   847  N  N   . ILE A 1 174 ? 9.286   16.466  -33.123 1.00 23.79  ? 152  ILE A N   1 
ATOM   848  C  CA  . ILE A 1 174 ? 9.321   17.036  -34.468 1.00 25.00  ? 152  ILE A CA  1 
ATOM   849  C  C   . ILE A 1 174 ? 8.658   18.410  -34.440 1.00 26.07  ? 152  ILE A C   1 
ATOM   850  O  O   . ILE A 1 174 ? 9.193   19.372  -35.013 1.00 25.10  ? 152  ILE A O   1 
ATOM   851  C  CB  . ILE A 1 174 ? 8.704   16.094  -35.524 1.00 24.25  ? 152  ILE A CB  1 
ATOM   852  C  CG1 . ILE A 1 174 ? 9.661   14.903  -35.777 1.00 26.60  ? 152  ILE A CG1 1 
ATOM   853  C  CG2 . ILE A 1 174 ? 8.365   16.814  -36.820 1.00 25.24  ? 152  ILE A CG2 1 
ATOM   854  C  CD1 . ILE A 1 174 ? 9.016   13.754  -36.533 1.00 25.49  ? 152  ILE A CD1 1 
ATOM   855  N  N   . GLY A 1 175 ? 7.510   18.509  -33.750 1.00 25.63  ? 153  GLY A N   1 
ATOM   856  C  CA  . GLY A 1 175 ? 6.782   19.790  -33.656 1.00 24.71  ? 153  GLY A CA  1 
ATOM   857  C  C   . GLY A 1 175 ? 7.605   20.881  -33.016 1.00 24.70  ? 153  GLY A C   1 
ATOM   858  O  O   . GLY A 1 175 ? 7.680   22.003  -33.498 1.00 25.07  ? 153  GLY A O   1 
ATOM   859  N  N   . LEU A 1 176 ? 8.229   20.535  -31.908 1.00 24.62  ? 154  LEU A N   1 
ATOM   860  C  CA  . LEU A 1 176 ? 9.064   21.472  -31.193 1.00 24.45  ? 154  LEU A CA  1 
ATOM   861  C  C   . LEU A 1 176 ? 10.313  21.814  -31.993 1.00 25.80  ? 154  LEU A C   1 
ATOM   862  O  O   . LEU A 1 176 ? 10.745  22.959  -31.992 1.00 25.43  ? 154  LEU A O   1 
ATOM   863  C  CB  . LEU A 1 176 ? 9.458   20.885  -29.849 1.00 25.05  ? 154  LEU A CB  1 
ATOM   864  C  CG  . LEU A 1 176 ? 8.347   20.832  -28.788 1.00 24.91  ? 154  LEU A CG  1 
ATOM   865  C  CD1 . LEU A 1 176 ? 8.808   19.978  -27.612 1.00 25.52  ? 154  LEU A CD1 1 
ATOM   866  C  CD2 . LEU A 1 176 ? 7.906   22.214  -28.306 1.00 26.35  ? 154  LEU A CD2 1 
ATOM   867  N  N   . ALA A 1 177 ? 10.914  20.821  -32.667 1.00 24.84  ? 155  ALA A N   1 
ATOM   868  C  CA  . ALA A 1 177 ? 12.110  21.098  -33.484 1.00 24.92  ? 155  ALA A CA  1 
ATOM   869  C  C   . ALA A 1 177 ? 11.762  22.016  -34.646 1.00 25.56  ? 155  ALA A C   1 
ATOM   870  O  O   . ALA A 1 177 ? 12.557  22.874  -35.032 1.00 25.97  ? 155  ALA A O   1 
ATOM   871  C  CB  . ALA A 1 177 ? 12.749  19.815  -33.990 1.00 24.54  ? 155  ALA A CB  1 
ATOM   872  N  N   . LEU A 1 178 ? 10.588  21.824  -35.222 1.00 26.53  ? 156  LEU A N   1 
ATOM   873  C  CA  . LEU A 1 178 ? 10.161  22.702  -36.321 1.00 28.65  ? 156  LEU A CA  1 
ATOM   874  C  C   . LEU A 1 178 ? 10.026  24.149  -35.855 1.00 28.74  ? 156  LEU A C   1 
ATOM   875  O  O   . LEU A 1 178 ? 10.598  25.103  -36.451 1.00 30.18  ? 156  LEU A O   1 
ATOM   876  C  CB  . LEU A 1 178 ? 8.851   22.201  -36.911 1.00 30.16  ? 156  LEU A CB  1 
ATOM   877  C  CG  . LEU A 1 178 ? 8.697   22.646  -38.356 1.00 33.80  ? 156  LEU A CG  1 
ATOM   878  C  CD1 . LEU A 1 178 ? 8.004   21.574  -39.174 1.00 35.64  ? 156  LEU A CD1 1 
ATOM   879  C  CD2 . LEU A 1 178 ? 7.953   23.964  -38.433 1.00 35.32  ? 156  LEU A CD2 1 
ATOM   880  N  N   . ALA A 1 179 ? 9.284   24.327  -34.764 1.00 29.30  ? 157  ALA A N   1 
ATOM   881  C  CA  . ALA A 1 179 ? 9.122   25.655  -34.179 1.00 30.28  ? 157  ALA A CA  1 
ATOM   882  C  C   . ALA A 1 179 ? 10.472  26.232  -33.726 1.00 29.92  ? 157  ALA A C   1 
ATOM   883  O  O   . ALA A 1 179 ? 10.710  27.432  -33.855 1.00 31.04  ? 157  ALA A O   1 
ATOM   884  C  CB  . ALA A 1 179 ? 8.131   25.597  -33.021 1.00 30.99  ? 157  ALA A CB  1 
ATOM   885  N  N   . ALA A 1 180 ? 11.353  25.378  -33.213 1.00 28.74  ? 158  ALA A N   1 
ATOM   886  C  CA  . ALA A 1 180 ? 12.686  25.820  -32.759 1.00 30.36  ? 158  ALA A CA  1 
ATOM   887  C  C   . ALA A 1 180 ? 13.565  26.285  -33.924 1.00 31.70  ? 158  ALA A C   1 
ATOM   888  O  O   . ALA A 1 180 ? 14.345  27.252  -33.803 1.00 30.18  ? 158  ALA A O   1 
ATOM   889  C  CB  . ALA A 1 180 ? 13.384  24.708  -32.007 1.00 30.38  ? 158  ALA A CB  1 
ATOM   890  N  N   . ALA A 1 181 ? 13.413  25.607  -35.063 1.00 30.87  ? 159  ALA A N   1 
ATOM   891  C  CA  . ALA A 1 181 ? 14.176  25.969  -36.256 1.00 31.84  ? 159  ALA A CA  1 
ATOM   892  C  C   . ALA A 1 181 ? 13.716  27.357  -36.734 1.00 33.33  ? 159  ALA A C   1 
ATOM   893  O  O   . ALA A 1 181 ? 14.516  28.228  -37.049 1.00 33.43  ? 159  ALA A O   1 
ATOM   894  C  CB  . ALA A 1 181 ? 13.963  24.933  -37.338 1.00 31.00  ? 159  ALA A CB  1 
ATOM   895  N  N   . VAL A 1 182 ? 12.406  27.554  -36.757 1.00 33.41  ? 160  VAL A N   1 
ATOM   896  C  CA  . VAL A 1 182 ? 11.834  28.806  -37.214 1.00 33.92  ? 160  VAL A CA  1 
ATOM   897  C  C   . VAL A 1 182 ? 12.174  29.972  -36.251 1.00 35.90  ? 160  VAL A C   1 
ATOM   898  O  O   . VAL A 1 182 ? 12.620  31.021  -36.680 1.00 36.14  ? 160  VAL A O   1 
ATOM   899  C  CB  . VAL A 1 182 ? 10.307  28.654  -37.380 1.00 33.07  ? 160  VAL A CB  1 
ATOM   900  C  CG1 . VAL A 1 182 ? 9.666   29.992  -37.727 1.00 34.40  ? 160  VAL A CG1 1 
ATOM   901  C  CG2 . VAL A 1 182 ? 9.985   27.636  -38.468 1.00 32.39  ? 160  VAL A CG2 1 
ATOM   902  N  N   . ARG A 1 183 ? 11.994  29.743  -34.954 1.00 35.86  ? 161  ARG A N   1 
ATOM   903  C  CA  A ARG A 1 183 ? 12.092  30.825  -33.980 0.50 37.09  ? 161  ARG A CA  1 
ATOM   904  C  CA  B ARG A 1 183 ? 12.078  30.782  -33.917 0.50 37.76  ? 161  ARG A CA  1 
ATOM   905  C  C   . ARG A 1 183 ? 13.489  30.971  -33.385 1.00 38.51  ? 161  ARG A C   1 
ATOM   906  O  O   . ARG A 1 183 ? 13.778  31.962  -32.739 1.00 41.72  ? 161  ARG A O   1 
ATOM   907  C  CB  A ARG A 1 183 ? 11.051  30.633  -32.877 0.50 36.22  ? 161  ARG A CB  1 
ATOM   908  C  CB  B ARG A 1 183 ? 11.175  30.412  -32.727 0.50 37.56  ? 161  ARG A CB  1 
ATOM   909  C  CG  A ARG A 1 183 ? 9.634   30.479  -33.407 0.50 35.16  ? 161  ARG A CG  1 
ATOM   910  C  CG  B ARG A 1 183 ? 9.909   31.230  -32.547 0.50 38.91  ? 161  ARG A CG  1 
ATOM   911  C  CD  A ARG A 1 183 ? 8.608   30.962  -32.402 0.50 36.09  ? 161  ARG A CD  1 
ATOM   912  C  CD  B ARG A 1 183 ? 9.391   31.866  -33.822 0.50 39.71  ? 161  ARG A CD  1 
ATOM   913  N  NE  A ARG A 1 183 ? 7.287   31.115  -33.005 0.50 36.14  ? 161  ARG A NE  1 
ATOM   914  N  NE  B ARG A 1 183 ? 7.935   31.962  -33.780 0.50 39.36  ? 161  ARG A NE  1 
ATOM   915  C  CZ  A ARG A 1 183 ? 6.193   31.407  -32.318 0.50 35.66  ? 161  ARG A CZ  1 
ATOM   916  C  CZ  B ARG A 1 183 ? 7.188   32.235  -34.839 0.50 39.36  ? 161  ARG A CZ  1 
ATOM   917  N  NH1 A ARG A 1 183 ? 6.270   31.591  -31.008 0.50 34.64  ? 161  ARG A NH1 1 
ATOM   918  N  NH1 B ARG A 1 183 ? 7.778   32.455  -35.989 0.50 39.24  ? 161  ARG A NH1 1 
ATOM   919  N  NH2 A ARG A 1 183 ? 5.032   31.521  -32.950 0.50 35.37  ? 161  ARG A NH2 1 
ATOM   920  N  NH2 B ARG A 1 183 ? 5.866   32.281  -34.747 0.50 39.45  ? 161  ARG A NH2 1 
ATOM   921  N  N   . GLY A 1 184 ? 14.369  30.013  -33.611 1.00 38.07  ? 162  GLY A N   1 
ATOM   922  C  CA  . GLY A 1 184 ? 15.760  30.165  -33.149 1.00 39.39  ? 162  GLY A CA  1 
ATOM   923  C  C   . GLY A 1 184 ? 16.053  29.626  -31.750 1.00 38.49  ? 162  GLY A C   1 
ATOM   924  O  O   . GLY A 1 184 ? 16.812  30.200  -31.016 1.00 41.13  ? 162  GLY A O   1 
ATOM   925  N  N   . TYR A 1 185 ? 15.479  28.504  -31.380 1.00 37.09  ? 163  TYR A N   1 
ATOM   926  C  CA  . TYR A 1 185 ? 15.817  27.867  -30.103 1.00 36.22  ? 163  TYR A CA  1 
ATOM   927  C  C   . TYR A 1 185 ? 16.668  26.622  -30.369 1.00 34.95  ? 163  TYR A C   1 
ATOM   928  O  O   . TYR A 1 185 ? 16.407  25.923  -31.312 1.00 33.73  ? 163  TYR A O   1 
ATOM   929  C  CB  . TYR A 1 185 ? 14.540  27.413  -29.380 1.00 34.88  ? 163  TYR A CB  1 
ATOM   930  C  CG  . TYR A 1 185 ? 13.607  28.523  -28.944 1.00 35.78  ? 163  TYR A CG  1 
ATOM   931  C  CD1 . TYR A 1 185 ? 13.978  29.408  -27.945 1.00 38.29  ? 163  TYR A CD1 1 
ATOM   932  C  CD2 . TYR A 1 185 ? 12.351  28.671  -29.516 1.00 35.35  ? 163  TYR A CD2 1 
ATOM   933  C  CE1 . TYR A 1 185 ? 13.139  30.435  -27.546 1.00 39.41  ? 163  TYR A CE1 1 
ATOM   934  C  CE2 . TYR A 1 185 ? 11.503  29.696  -29.127 1.00 36.51  ? 163  TYR A CE2 1 
ATOM   935  C  CZ  . TYR A 1 185 ? 11.915  30.572  -28.139 1.00 38.25  ? 163  TYR A CZ  1 
ATOM   936  O  OH  . TYR A 1 185 ? 11.101  31.565  -27.724 1.00 39.37  ? 163  TYR A OH  1 
ATOM   937  N  N   . ARG A 1 186 ? 17.634  26.333  -29.510 1.00 34.42  ? 164  ARG A N   1 
ATOM   938  C  CA  . ARG A 1 186 ? 18.272  25.022  -29.457 1.00 34.26  ? 164  ARG A CA  1 
ATOM   939  C  C   . ARG A 1 186 ? 17.252  23.984  -28.971 1.00 33.37  ? 164  ARG A C   1 
ATOM   940  O  O   . ARG A 1 186 ? 16.495  24.249  -28.038 1.00 33.37  ? 164  ARG A O   1 
ATOM   941  C  CB  . ARG A 1 186 ? 19.467  25.070  -28.498 1.00 35.33  ? 164  ARG A CB  1 
ATOM   942  C  CG  . ARG A 1 186 ? 20.291  23.798  -28.421 1.00 34.65  ? 164  ARG A CG  1 
ATOM   943  C  CD  . ARG A 1 186 ? 21.489  23.933  -27.459 1.00 36.71  ? 164  ARG A CD  1 
ATOM   944  N  NE  . ARG A 1 186 ? 22.151  22.629  -27.340 1.00 36.61  ? 164  ARG A NE  1 
ATOM   945  C  CZ  . ARG A 1 186 ? 22.973  22.264  -26.355 1.00 37.77  ? 164  ARG A CZ  1 
ATOM   946  N  NH1 . ARG A 1 186 ? 23.271  23.074  -25.371 1.00 38.77  ? 164  ARG A NH1 1 
ATOM   947  N  NH2 . ARG A 1 186 ? 23.481  21.053  -26.348 1.00 38.57  ? 164  ARG A NH2 1 
ATOM   948  N  N   . CYS A 1 187 ? 17.237  22.811  -29.598 1.00 30.81  ? 165  CYS A N   1 
ATOM   949  C  CA  . CYS A 1 187 ? 16.211  21.821  -29.352 1.00 30.65  ? 165  CYS A CA  1 
ATOM   950  C  C   . CYS A 1 187 ? 16.888  20.467  -29.195 1.00 31.51  ? 165  CYS A C   1 
ATOM   951  O  O   . CYS A 1 187 ? 17.681  20.043  -30.074 1.00 31.22  ? 165  CYS A O   1 
ATOM   952  C  CB  . CYS A 1 187 ? 15.183  21.809  -30.479 1.00 30.63  ? 165  CYS A CB  1 
ATOM   953  S  SG  . CYS A 1 187 ? 13.835  20.633  -30.234 1.00 31.89  ? 165  CYS A SG  1 
ATOM   954  N  N   . ILE A 1 188 ? 16.651  19.849  -28.029 1.00 29.11  ? 166  ILE A N   1 
ATOM   955  C  CA  . ILE A 1 188 ? 17.148  18.525  -27.688 1.00 28.61  ? 166  ILE A CA  1 
ATOM   956  C  C   . ILE A 1 188 ? 15.962  17.617  -27.424 1.00 29.69  ? 166  ILE A C   1 
ATOM   957  O  O   . ILE A 1 188 ? 15.126  17.924  -26.567 1.00 29.00  ? 166  ILE A O   1 
ATOM   958  C  CB  . ILE A 1 188 ? 18.022  18.537  -26.425 1.00 30.59  ? 166  ILE A CB  1 
ATOM   959  C  CG1 . ILE A 1 188 ? 19.193  19.515  -26.597 1.00 32.27  ? 166  ILE A CG1 1 
ATOM   960  C  CG2 . ILE A 1 188 ? 18.505  17.124  -26.122 1.00 30.35  ? 166  ILE A CG2 1 
ATOM   961  C  CD1 . ILE A 1 188 ? 19.944  19.853  -25.333 1.00 33.74  ? 166  ILE A CD1 1 
ATOM   962  N  N   . ILE A 1 189 ? 15.924  16.482  -28.122 1.00 26.41  ? 167  ILE A N   1 
ATOM   963  C  CA  . ILE A 1 189 ? 14.814  15.552  -28.081 1.00 28.40  ? 167  ILE A CA  1 
ATOM   964  C  C   . ILE A 1 189 ? 15.331  14.288  -27.424 1.00 27.66  ? 167  ILE A C   1 
ATOM   965  O  O   . ILE A 1 189 ? 16.442  13.857  -27.715 1.00 27.46  ? 167  ILE A O   1 
ATOM   966  C  CB  . ILE A 1 189 ? 14.378  15.275  -29.537 1.00 30.88  ? 167  ILE A CB  1 
ATOM   967  C  CG1 . ILE A 1 189 ? 13.562  16.467  -30.132 1.00 33.35  ? 167  ILE A CG1 1 
ATOM   968  C  CG2 . ILE A 1 189 ? 13.789  13.903  -29.739 1.00 35.88  ? 167  ILE A CG2 1 
ATOM   969  C  CD1 . ILE A 1 189 ? 12.787  17.356  -29.207 1.00 35.73  ? 167  ILE A CD1 1 
ATOM   970  N  N   . VAL A 1 190 ? 14.538  13.698  -26.544 1.00 25.72  ? 168  VAL A N   1 
ATOM   971  C  CA  . VAL A 1 190 ? 14.911  12.452  -25.883 1.00 26.49  ? 168  VAL A CA  1 
ATOM   972  C  C   . VAL A 1 190 ? 13.830  11.443  -26.205 1.00 26.52  ? 168  VAL A C   1 
ATOM   973  O  O   . VAL A 1 190 ? 12.650  11.629  -25.833 1.00 26.64  ? 168  VAL A O   1 
ATOM   974  C  CB  . VAL A 1 190 ? 15.049  12.623  -24.366 1.00 26.53  ? 168  VAL A CB  1 
ATOM   975  C  CG1 . VAL A 1 190 ? 15.517  11.318  -23.745 1.00 27.39  ? 168  VAL A CG1 1 
ATOM   976  C  CG2 . VAL A 1 190 ? 16.001  13.755  -24.041 1.00 28.04  ? 168  VAL A CG2 1 
ATOM   977  N  N   . MET A 1 191 ? 14.222  10.400  -26.935 1.00 25.24  ? 169  MET A N   1 
ATOM   978  C  CA  . MET A 1 191 ? 13.279  9.521   -27.622 1.00 24.33  ? 169  MET A CA  1 
ATOM   979  C  C   . MET A 1 191 ? 13.614  8.038   -27.420 1.00 23.86  ? 169  MET A C   1 
ATOM   980  O  O   . MET A 1 191 ? 14.779  7.637   -27.585 1.00 24.18  ? 169  MET A O   1 
ATOM   981  C  CB  . MET A 1 191 ? 13.314  9.875   -29.107 1.00 24.62  ? 169  MET A CB  1 
ATOM   982  C  CG  . MET A 1 191 ? 12.259  9.210   -29.940 1.00 24.72  ? 169  MET A CG  1 
ATOM   983  S  SD  . MET A 1 191 ? 11.958  9.906   -31.584 1.00 26.94  ? 169  MET A SD  1 
ATOM   984  C  CE  . MET A 1 191 ? 13.541  9.623   -32.407 1.00 28.07  ? 169  MET A CE  1 
ATOM   985  N  N   . PRO A 1 192 ? 12.615  7.211   -27.052 1.00 23.87  ? 170  PRO A N   1 
ATOM   986  C  CA  . PRO A 1 192 ? 12.884  5.785   -26.867 1.00 24.09  ? 170  PRO A CA  1 
ATOM   987  C  C   . PRO A 1 192 ? 13.469  5.119   -28.130 1.00 23.62  ? 170  PRO A C   1 
ATOM   988  O  O   . PRO A 1 192 ? 13.170  5.543   -29.252 1.00 21.63  ? 170  PRO A O   1 
ATOM   989  C  CB  . PRO A 1 192 ? 11.492  5.196   -26.523 1.00 24.27  ? 170  PRO A CB  1 
ATOM   990  C  CG  . PRO A 1 192 ? 10.803  6.312   -25.821 1.00 24.48  ? 170  PRO A CG  1 
ATOM   991  C  CD  . PRO A 1 192 ? 11.234  7.543   -26.637 1.00 25.19  ? 170  PRO A CD  1 
ATOM   992  N  N   . GLU A 1 193 ? 14.259  4.073   -27.920 1.00 23.93  ? 171  GLU A N   1 
ATOM   993  C  CA  . GLU A 1 193 ? 14.989  3.384   -29.009 1.00 24.59  ? 171  GLU A CA  1 
ATOM   994  C  C   . GLU A 1 193 ? 14.072  2.756   -30.061 1.00 24.35  ? 171  GLU A C   1 
ATOM   995  O  O   . GLU A 1 193 ? 14.470  2.633   -31.228 1.00 24.11  ? 171  GLU A O   1 
ATOM   996  C  CB  . GLU A 1 193 ? 15.929  2.314   -28.447 1.00 27.04  ? 171  GLU A CB  1 
ATOM   997  C  CG  . GLU A 1 193 ? 17.196  2.887   -27.852 1.00 27.68  ? 171  GLU A CG  1 
ATOM   998  C  CD  . GLU A 1 193 ? 18.033  1.877   -27.108 1.00 30.69  ? 171  GLU A CD  1 
ATOM   999  O  OE1 . GLU A 1 193 ? 17.528  0.783   -26.770 1.00 29.74  ? 171  GLU A OE1 1 
ATOM   1000 O  OE2 . GLU A 1 193 ? 19.221  2.189   -26.860 1.00 30.67  ? 171  GLU A OE2 1 
ATOM   1001 N  N   . LYS A 1 194 ? 12.844  2.394   -29.697 1.00 23.30  ? 172  LYS A N   1 
ATOM   1002 C  CA  . LYS A 1 194 ? 11.959  1.770   -30.680 1.00 25.91  ? 172  LYS A CA  1 
ATOM   1003 C  C   . LYS A 1 194 ? 11.456  2.725   -31.779 1.00 24.12  ? 172  LYS A C   1 
ATOM   1004 O  O   . LYS A 1 194 ? 11.003  2.264   -32.829 1.00 23.73  ? 172  LYS A O   1 
ATOM   1005 C  CB  . LYS A 1 194 ? 10.754  1.103   -30.008 1.00 28.41  ? 172  LYS A CB  1 
ATOM   1006 C  CG  . LYS A 1 194 ? 9.650   2.075   -29.616 1.00 30.73  ? 172  LYS A CG  1 
ATOM   1007 C  CD  . LYS A 1 194 ? 8.426   1.369   -29.016 1.00 32.75  ? 172  LYS A CD  1 
ATOM   1008 C  CE  . LYS A 1 194 ? 7.148   1.850   -29.650 1.00 32.58  ? 172  LYS A CE  1 
ATOM   1009 N  NZ  . LYS A 1 194 ? 5.923   1.270   -29.021 1.00 31.06  ? 172  LYS A NZ  1 
ATOM   1010 N  N   . MET A 1 195 ? 11.504  4.037   -31.546 1.00 23.25  ? 173  MET A N   1 
ATOM   1011 C  CA  . MET A 1 195 ? 10.886  4.974   -32.492 1.00 22.78  ? 173  MET A CA  1 
ATOM   1012 C  C   . MET A 1 195 ? 11.660  4.959   -33.843 1.00 22.73  ? 173  MET A C   1 
ATOM   1013 O  O   . MET A 1 195 ? 12.852  4.718   -33.862 1.00 22.85  ? 173  MET A O   1 
ATOM   1014 C  CB  . MET A 1 195 ? 10.752  6.365   -31.882 1.00 22.93  ? 173  MET A CB  1 
ATOM   1015 C  CG  . MET A 1 195 ? 10.064  6.378   -30.484 1.00 23.51  ? 173  MET A CG  1 
ATOM   1016 S  SD  . MET A 1 195 ? 8.450   5.560   -30.545 1.00 24.93  ? 173  MET A SD  1 
ATOM   1017 C  CE  . MET A 1 195 ? 8.107   5.631   -28.758 1.00 27.09  ? 173  MET A CE  1 
ATOM   1018 N  N   . SER A 1 196 ? 10.954  5.197   -34.946 1.00 22.57  ? 174  SER A N   1 
ATOM   1019 C  CA  . SER A 1 196 ? 11.481  4.977   -36.279 1.00 23.69  ? 174  SER A CA  1 
ATOM   1020 C  C   . SER A 1 196 ? 12.672  5.863   -36.613 1.00 23.42  ? 174  SER A C   1 
ATOM   1021 O  O   . SER A 1 196 ? 12.818  6.991   -36.109 1.00 23.55  ? 174  SER A O   1 
ATOM   1022 C  CB  . SER A 1 196 ? 10.399  5.209   -37.330 1.00 25.69  ? 174  SER A CB  1 
ATOM   1023 O  OG  . SER A 1 196 ? 10.106  6.591   -37.377 1.00 26.97  ? 174  SER A OG  1 
ATOM   1024 N  N   . SER A 1 197 ? 13.498  5.367   -37.519 1.00 23.47  ? 175  SER A N   1 
ATOM   1025 C  CA  . SER A 1 197 ? 14.624  6.123   -37.958 1.00 25.19  ? 175  SER A CA  1 
ATOM   1026 C  C   . SER A 1 197 ? 14.164  7.297   -38.861 1.00 23.83  ? 175  SER A C   1 
ATOM   1027 O  O   . SER A 1 197 ? 14.869  8.285   -39.005 1.00 25.25  ? 175  SER A O   1 
ATOM   1028 C  CB  . SER A 1 197 ? 15.650  5.171   -38.617 1.00 26.39  ? 175  SER A CB  1 
ATOM   1029 O  OG  . SER A 1 197 ? 15.091  4.722   -39.823 1.00 32.13  ? 175  SER A OG  1 
ATOM   1030 N  N   . GLU A 1 198 ? 12.962  7.211   -39.423 1.00 23.12  ? 176  GLU A N   1 
ATOM   1031 C  CA  . GLU A 1 198 ? 12.382  8.303   -40.198 1.00 24.03  ? 176  GLU A CA  1 
ATOM   1032 C  C   . GLU A 1 198 ? 12.179  9.559   -39.347 1.00 24.13  ? 176  GLU A C   1 
ATOM   1033 O  O   . GLU A 1 198 ? 12.403  10.700  -39.799 1.00 24.80  ? 176  GLU A O   1 
ATOM   1034 C  CB  . GLU A 1 198 ? 11.046  7.873   -40.822 1.00 24.49  ? 176  GLU A CB  1 
ATOM   1035 C  CG  . GLU A 1 198 ? 11.162  6.953   -42.049 1.00 25.38  ? 176  GLU A CG  1 
ATOM   1036 C  CD  . GLU A 1 198 ? 11.363  5.479   -41.715 1.00 26.83  ? 176  GLU A CD  1 
ATOM   1037 O  OE1 . GLU A 1 198 ? 11.384  5.103   -40.521 1.00 28.69  ? 176  GLU A OE1 1 
ATOM   1038 O  OE2 . GLU A 1 198 ? 11.489  4.665   -42.652 1.00 27.84  ? 176  GLU A OE2 1 
ATOM   1039 N  N   . LYS A 1 199 ? 11.779  9.343   -38.095 1.00 23.31  ? 177  LYS A N   1 
ATOM   1040 C  CA  . LYS A 1 199 ? 11.669  10.438  -37.130 1.00 23.15  ? 177  LYS A CA  1 
ATOM   1041 C  C   . LYS A 1 199 ? 13.028  11.054  -36.869 1.00 23.51  ? 177  LYS A C   1 
ATOM   1042 O  O   . LYS A 1 199 ? 13.163  12.273  -36.835 1.00 24.29  ? 177  LYS A O   1 
ATOM   1043 C  CB  . LYS A 1 199 ? 11.076  9.936   -35.807 1.00 21.96  ? 177  LYS A CB  1 
ATOM   1044 C  CG  . LYS A 1 199 ? 9.590   9.701   -35.902 1.00 22.46  ? 177  LYS A CG  1 
ATOM   1045 C  CD  . LYS A 1 199 ? 9.134   8.868   -34.735 1.00 25.28  ? 177  LYS A CD  1 
ATOM   1046 C  CE  . LYS A 1 199 ? 7.605   8.802   -34.657 1.00 23.92  ? 177  LYS A CE  1 
ATOM   1047 N  NZ  . LYS A 1 199 ? 7.230   7.902   -33.528 1.00 23.94  ? 177  LYS A NZ  1 
ATOM   1048 N  N   . VAL A 1 200 ? 14.029  10.206  -36.649 1.00 23.60  ? 178  VAL A N   1 
ATOM   1049 C  CA  . VAL A 1 200 ? 15.416  10.683  -36.463 1.00 25.07  ? 178  VAL A CA  1 
ATOM   1050 C  C   . VAL A 1 200 ? 15.858  11.521  -37.655 1.00 24.73  ? 178  VAL A C   1 
ATOM   1051 O  O   . VAL A 1 200 ? 16.466  12.572  -37.499 1.00 25.02  ? 178  VAL A O   1 
ATOM   1052 C  CB  . VAL A 1 200 ? 16.398  9.496   -36.245 1.00 25.91  ? 178  VAL A CB  1 
ATOM   1053 C  CG1 . VAL A 1 200 ? 17.842  9.969   -36.227 1.00 28.80  ? 178  VAL A CG1 1 
ATOM   1054 C  CG2 . VAL A 1 200 ? 16.062  8.767   -34.952 1.00 26.47  ? 178  VAL A CG2 1 
ATOM   1055 N  N   . ASP A 1 201 ? 15.556  11.067  -38.856 1.00 26.49  ? 179  ASP A N   1 
ATOM   1056 C  CA  . ASP A 1 201 ? 16.067  11.790  -40.052 1.00 29.20  ? 179  ASP A CA  1 
ATOM   1057 C  C   . ASP A 1 201 ? 15.445  13.194  -40.203 1.00 27.30  ? 179  ASP A C   1 
ATOM   1058 O  O   . ASP A 1 201 ? 16.146  14.154  -40.532 1.00 25.67  ? 179  ASP A O   1 
ATOM   1059 C  CB  . ASP A 1 201 ? 15.874  10.938  -41.292 1.00 33.65  ? 179  ASP A CB  1 
ATOM   1060 C  CG  . ASP A 1 201 ? 16.831  9.719   -41.304 1.00 37.31  ? 179  ASP A CG  1 
ATOM   1061 O  OD1 . ASP A 1 201 ? 17.934  9.810   -40.739 1.00 45.75  ? 179  ASP A OD1 1 
ATOM   1062 O  OD2 . ASP A 1 201 ? 16.458  8.664   -41.814 1.00 42.22  ? 179  ASP A OD2 1 
ATOM   1063 N  N   . VAL A 1 202 ? 14.164  13.315  -39.866 1.00 24.45  ? 180  VAL A N   1 
ATOM   1064 C  CA  . VAL A 1 202 ? 13.508  14.610  -39.882 1.00 25.39  ? 180  VAL A CA  1 
ATOM   1065 C  C   . VAL A 1 202 ? 14.035  15.485  -38.758 1.00 25.75  ? 180  VAL A C   1 
ATOM   1066 O  O   . VAL A 1 202 ? 14.344  16.659  -38.965 1.00 25.99  ? 180  VAL A O   1 
ATOM   1067 C  CB  . VAL A 1 202 ? 11.985  14.473  -39.806 1.00 25.49  ? 180  VAL A CB  1 
ATOM   1068 C  CG1 . VAL A 1 202 ? 11.337  15.840  -39.640 1.00 27.07  ? 180  VAL A CG1 1 
ATOM   1069 C  CG2 . VAL A 1 202 ? 11.463  13.804  -41.083 1.00 27.75  ? 180  VAL A CG2 1 
ATOM   1070 N  N   . LEU A 1 203 ? 14.154  14.914  -37.564 1.00 25.98  ? 181  LEU A N   1 
ATOM   1071 C  CA  . LEU A 1 203 ? 14.713  15.669  -36.460 1.00 25.76  ? 181  LEU A CA  1 
ATOM   1072 C  C   . LEU A 1 203 ? 16.092  16.227  -36.765 1.00 27.10  ? 181  LEU A C   1 
ATOM   1073 O  O   . LEU A 1 203 ? 16.379  17.396  -36.485 1.00 27.50  ? 181  LEU A O   1 
ATOM   1074 C  CB  . LEU A 1 203 ? 14.753  14.830  -35.181 1.00 25.78  ? 181  LEU A CB  1 
ATOM   1075 C  CG  . LEU A 1 203 ? 13.412  14.519  -34.539 1.00 25.41  ? 181  LEU A CG  1 
ATOM   1076 C  CD1 . LEU A 1 203 ? 13.573  13.332  -33.598 1.00 25.39  ? 181  LEU A CD1 1 
ATOM   1077 C  CD2 . LEU A 1 203 ? 12.825  15.717  -33.812 1.00 26.65  ? 181  LEU A CD2 1 
ATOM   1078 N  N   . ARG A 1 204 ? 16.957  15.383  -37.302 1.00 28.68  ? 182  ARG A N   1 
ATOM   1079 C  CA  . ARG A 1 204 ? 18.260  15.817  -37.696 1.00 30.89  ? 182  ARG A CA  1 
ATOM   1080 C  C   . ARG A 1 204 ? 18.205  16.957  -38.688 1.00 30.44  ? 182  ARG A C   1 
ATOM   1081 O  O   . ARG A 1 204 ? 18.928  17.926  -38.536 1.00 30.32  ? 182  ARG A O   1 
ATOM   1082 C  CB  . ARG A 1 204 ? 19.051  14.677  -38.335 1.00 34.89  ? 182  ARG A CB  1 
ATOM   1083 C  CG  . ARG A 1 204 ? 19.650  13.717  -37.342 1.00 39.68  ? 182  ARG A CG  1 
ATOM   1084 C  CD  . ARG A 1 204 ? 20.886  12.998  -37.906 1.00 45.25  ? 182  ARG A CD  1 
ATOM   1085 N  NE  . ARG A 1 204 ? 20.543  11.747  -38.548 1.00 48.23  ? 182  ARG A NE  1 
ATOM   1086 C  CZ  . ARG A 1 204 ? 20.855  10.517  -38.120 1.00 49.17  ? 182  ARG A CZ  1 
ATOM   1087 N  NH1 . ARG A 1 204 ? 21.533  10.297  -37.006 1.00 49.36  ? 182  ARG A NH1 1 
ATOM   1088 N  NH2 . ARG A 1 204 ? 20.470  9.474   -38.845 1.00 53.78  ? 182  ARG A NH2 1 
ATOM   1089 N  N   . ALA A 1 205 ? 17.398  16.815  -39.731 1.00 28.54  ? 183  ALA A N   1 
ATOM   1090 C  CA  . ALA A 1 205 ? 17.309  17.851  -40.750 1.00 28.96  ? 183  ALA A CA  1 
ATOM   1091 C  C   . ALA A 1 205 ? 16.766  19.182  -40.184 1.00 28.91  ? 183  ALA A C   1 
ATOM   1092 O  O   . ALA A 1 205 ? 17.110  20.232  -40.685 1.00 28.14  ? 183  ALA A O   1 
ATOM   1093 C  CB  . ALA A 1 205 ? 16.443  17.384  -41.905 1.00 28.26  ? 183  ALA A CB  1 
ATOM   1094 N  N   . LEU A 1 206 ? 15.915  19.120  -39.152 1.00 28.06  ? 184  LEU A N   1 
ATOM   1095 C  CA  . LEU A 1 206 ? 15.390  20.334  -38.492 1.00 28.62  ? 184  LEU A CA  1 
ATOM   1096 C  C   . LEU A 1 206 ? 16.382  20.960  -37.519 1.00 30.75  ? 184  LEU A C   1 
ATOM   1097 O  O   . LEU A 1 206 ? 16.117  22.042  -36.992 1.00 31.22  ? 184  LEU A O   1 
ATOM   1098 C  CB  . LEU A 1 206 ? 14.081  20.062  -37.756 1.00 26.45  ? 184  LEU A CB  1 
ATOM   1099 C  CG  . LEU A 1 206 ? 12.903  19.776  -38.681 1.00 26.06  ? 184  LEU A CG  1 
ATOM   1100 C  CD1 . LEU A 1 206 ? 11.716  19.231  -37.909 1.00 24.83  ? 184  LEU A CD1 1 
ATOM   1101 C  CD2 . LEU A 1 206 ? 12.488  21.038  -39.436 1.00 27.24  ? 184  LEU A CD2 1 
ATOM   1102 N  N   . GLY A 1 207 ? 17.521  20.303  -37.309 1.00 30.33  ? 185  GLY A N   1 
ATOM   1103 C  CA  . GLY A 1 207 ? 18.567  20.843  -36.447 1.00 31.17  ? 185  GLY A CA  1 
ATOM   1104 C  C   . GLY A 1 207 ? 18.430  20.417  -34.989 1.00 28.60  ? 185  GLY A C   1 
ATOM   1105 O  O   . GLY A 1 207 ? 19.130  20.926  -34.151 1.00 29.04  ? 185  GLY A O   1 
ATOM   1106 N  N   . ALA A 1 208 ? 17.556  19.471  -34.679 1.00 27.31  ? 186  ALA A N   1 
ATOM   1107 C  CA  . ALA A 1 208 ? 17.437  18.983  -33.301 1.00 28.86  ? 186  ALA A CA  1 
ATOM   1108 C  C   . ALA A 1 208 ? 18.579  18.063  -32.902 1.00 30.64  ? 186  ALA A C   1 
ATOM   1109 O  O   . ALA A 1 208 ? 19.072  17.320  -33.738 1.00 32.76  ? 186  ALA A O   1 
ATOM   1110 C  CB  . ALA A 1 208 ? 16.122  18.275  -33.104 1.00 27.50  ? 186  ALA A CB  1 
ATOM   1111 N  N   . GLU A 1 209 ? 19.003  18.122  -31.640 1.00 30.82  ? 187  GLU A N   1 
ATOM   1112 C  CA  . GLU A 1 209 ? 19.923  17.137  -31.085 1.00 31.48  ? 187  GLU A CA  1 
ATOM   1113 C  C   . GLU A 1 209 ? 19.074  15.991  -30.542 1.00 29.90  ? 187  GLU A C   1 
ATOM   1114 O  O   . GLU A 1 209 ? 17.938  16.200  -30.081 1.00 30.60  ? 187  GLU A O   1 
ATOM   1115 C  CB  . GLU A 1 209 ? 20.823  17.730  -30.001 1.00 34.04  ? 187  GLU A CB  1 
ATOM   1116 C  CG  . GLU A 1 209 ? 21.627  18.925  -30.476 1.00 36.45  ? 187  GLU A CG  1 
ATOM   1117 C  CD  . GLU A 1 209 ? 22.207  19.762  -29.361 1.00 39.77  ? 187  GLU A CD  1 
ATOM   1118 O  OE1 . GLU A 1 209 ? 22.677  19.209  -28.345 1.00 40.30  ? 187  GLU A OE1 1 
ATOM   1119 O  OE2 . GLU A 1 209 ? 22.220  21.005  -29.516 1.00 43.66  ? 187  GLU A OE2 1 
ATOM   1120 N  N   . ILE A 1 210 ? 19.594  14.772  -30.669 1.00 28.94  ? 188  ILE A N   1 
ATOM   1121 C  CA  . ILE A 1 210 ? 18.817  13.569  -30.405 1.00 28.76  ? 188  ILE A CA  1 
ATOM   1122 C  C   . ILE A 1 210 ? 19.546  12.647  -29.431 1.00 28.91  ? 188  ILE A C   1 
ATOM   1123 O  O   . ILE A 1 210 ? 20.724  12.274  -29.637 1.00 28.08  ? 188  ILE A O   1 
ATOM   1124 C  CB  . ILE A 1 210 ? 18.525  12.807  -31.702 1.00 30.02  ? 188  ILE A CB  1 
ATOM   1125 C  CG1 . ILE A 1 210 ? 17.790  13.699  -32.715 1.00 30.76  ? 188  ILE A CG1 1 
ATOM   1126 C  CG2 . ILE A 1 210 ? 17.657  11.595  -31.421 1.00 30.68  ? 188  ILE A CG2 1 
ATOM   1127 C  CD1 . ILE A 1 210 ? 18.087  13.340  -34.152 1.00 31.44  ? 188  ILE A CD1 1 
ATOM   1128 N  N   . VAL A 1 211 ? 18.832  12.276  -28.382 1.00 26.57  ? 189  VAL A N   1 
ATOM   1129 C  CA  . VAL A 1 211 ? 19.307  11.341  -27.391 1.00 27.10  ? 189  VAL A CA  1 
ATOM   1130 C  C   . VAL A 1 211 ? 18.268  10.227  -27.316 1.00 25.61  ? 189  VAL A C   1 
ATOM   1131 O  O   . VAL A 1 211 ? 17.073  10.488  -27.481 1.00 24.53  ? 189  VAL A O   1 
ATOM   1132 C  CB  . VAL A 1 211 ? 19.426  12.032  -26.022 1.00 29.08  ? 189  VAL A CB  1 
ATOM   1133 C  CG1 . VAL A 1 211 ? 19.749  11.033  -24.941 1.00 30.13  ? 189  VAL A CG1 1 
ATOM   1134 C  CG2 . VAL A 1 211 ? 20.482  13.116  -26.068 1.00 31.78  ? 189  VAL A CG2 1 
ATOM   1135 N  N   . ARG A 1 212 ? 18.708  9.005   -27.054 1.00 24.38  ? 190  ARG A N   1 
ATOM   1136 C  CA  . ARG A 1 212 ? 17.807  7.862   -27.018 1.00 24.59  ? 190  ARG A CA  1 
ATOM   1137 C  C   . ARG A 1 212 ? 17.868  7.125   -25.691 1.00 24.62  ? 190  ARG A C   1 
ATOM   1138 O  O   . ARG A 1 212 ? 18.872  7.161   -24.993 1.00 25.67  ? 190  ARG A O   1 
ATOM   1139 C  CB  . ARG A 1 212 ? 18.140  6.856   -28.123 1.00 24.83  ? 190  ARG A CB  1 
ATOM   1140 C  CG  . ARG A 1 212 ? 18.290  7.437   -29.506 1.00 24.85  ? 190  ARG A CG  1 
ATOM   1141 C  CD  . ARG A 1 212 ? 17.052  8.145   -30.029 1.00 23.49  ? 190  ARG A CD  1 
ATOM   1142 N  NE  . ARG A 1 212 ? 15.933  7.260   -30.350 1.00 23.04  ? 190  ARG A NE  1 
ATOM   1143 C  CZ  . ARG A 1 212 ? 15.730  6.628   -31.513 1.00 23.37  ? 190  ARG A CZ  1 
ATOM   1144 N  NH1 . ARG A 1 212 ? 16.597  6.690   -32.499 1.00 25.17  ? 190  ARG A NH1 1 
ATOM   1145 N  NH2 . ARG A 1 212 ? 14.662  5.876   -31.676 1.00 23.81  ? 190  ARG A NH2 1 
ATOM   1146 N  N   . THR A 1 213 ? 16.783  6.426   -25.389 1.00 24.27  ? 191  THR A N   1 
ATOM   1147 C  CA  . THR A 1 213 ? 16.611  5.692   -24.139 1.00 24.66  ? 191  THR A CA  1 
ATOM   1148 C  C   . THR A 1 213 ? 16.024  4.276   -24.407 1.00 24.41  ? 191  THR A C   1 
ATOM   1149 O  O   . THR A 1 213 ? 15.329  4.071   -25.406 1.00 23.73  ? 191  THR A O   1 
ATOM   1150 C  CB  . THR A 1 213 ? 15.675  6.471   -23.195 1.00 24.10  ? 191  THR A CB  1 
ATOM   1151 O  OG1 . THR A 1 213 ? 14.448  6.757   -23.859 1.00 24.52  ? 191  THR A OG1 1 
ATOM   1152 C  CG2 . THR A 1 213 ? 16.319  7.753   -22.783 1.00 25.55  ? 191  THR A CG2 1 
ATOM   1153 N  N   . PRO A 1 214 ? 16.347  3.301   -23.544 1.00 24.44  ? 192  PRO A N   1 
ATOM   1154 C  CA  . PRO A 1 214 ? 15.904  1.940   -23.777 1.00 25.17  ? 192  PRO A CA  1 
ATOM   1155 C  C   . PRO A 1 214 ? 14.398  1.889   -23.756 1.00 25.67  ? 192  PRO A C   1 
ATOM   1156 O  O   . PRO A 1 214 ? 13.752  2.523   -22.914 1.00 26.08  ? 192  PRO A O   1 
ATOM   1157 C  CB  . PRO A 1 214 ? 16.504  1.157   -22.616 1.00 25.91  ? 192  PRO A CB  1 
ATOM   1158 C  CG  . PRO A 1 214 ? 17.650  1.993   -22.139 1.00 26.72  ? 192  PRO A CG  1 
ATOM   1159 C  CD  . PRO A 1 214 ? 17.132  3.398   -22.310 1.00 26.11  ? 192  PRO A CD  1 
ATOM   1160 N  N   . THR A 1 215 ? 13.846  1.165   -24.708 1.00 25.51  ? 193  THR A N   1 
ATOM   1161 C  CA  . THR A 1 215 ? 12.414  1.097   -24.868 1.00 26.33  ? 193  THR A CA  1 
ATOM   1162 C  C   . THR A 1 215 ? 11.717  0.553   -23.641 1.00 25.84  ? 193  THR A C   1 
ATOM   1163 O  O   . THR A 1 215 ? 10.657  1.031   -23.301 1.00 26.35  ? 193  THR A O   1 
ATOM   1164 C  CB  . THR A 1 215 ? 12.069  0.233   -26.082 1.00 27.75  ? 193  THR A CB  1 
ATOM   1165 O  OG1 . THR A 1 215 ? 12.582  0.902   -27.246 1.00 27.43  ? 193  THR A OG1 1 
ATOM   1166 C  CG2 . THR A 1 215 ? 10.532  -0.016  -26.200 1.00 29.80  ? 193  THR A CG2 1 
ATOM   1167 N  N   A ASN A 1 216 ? 12.308  -0.420  -22.973 0.50 26.66  ? 194  ASN A N   1 
ATOM   1168 N  N   B ASN A 1 216 ? 12.290  -0.462  -23.001 0.50 26.70  ? 194  ASN A N   1 
ATOM   1169 C  CA  A ASN A 1 216 ? 11.660  -1.025  -21.813 0.50 28.25  ? 194  ASN A CA  1 
ATOM   1170 C  CA  B ASN A 1 216 ? 11.660  -1.072  -21.817 0.50 28.34  ? 194  ASN A CA  1 
ATOM   1171 C  C   A ASN A 1 216 ? 12.221  -0.513  -20.473 0.50 28.61  ? 194  ASN A C   1 
ATOM   1172 C  C   B ASN A 1 216 ? 12.005  -0.410  -20.471 0.50 28.34  ? 194  ASN A C   1 
ATOM   1173 O  O   A ASN A 1 216 ? 12.221  -1.214  -19.465 0.50 29.67  ? 194  ASN A O   1 
ATOM   1174 O  O   B ASN A 1 216 ? 11.605  -0.923  -19.437 0.50 28.64  ? 194  ASN A O   1 
ATOM   1175 C  CB  A ASN A 1 216 ? 11.718  -2.536  -21.987 0.50 29.34  ? 194  ASN A CB  1 
ATOM   1176 C  CB  B ASN A 1 216 ? 11.990  -2.566  -21.731 0.50 29.98  ? 194  ASN A CB  1 
ATOM   1177 C  CG  A ASN A 1 216 ? 11.130  -2.947  -23.332 0.50 29.64  ? 194  ASN A CG  1 
ATOM   1178 C  CG  B ASN A 1 216 ? 13.471  -2.844  -21.867 0.50 32.47  ? 194  ASN A CG  1 
ATOM   1179 O  OD1 A ASN A 1 216 ? 10.083  -2.434  -23.717 0.50 29.48  ? 194  ASN A OD1 1 
ATOM   1180 O  OD1 B ASN A 1 216 ? 14.176  -2.194  -22.673 0.50 34.05  ? 194  ASN A OD1 1 
ATOM   1181 N  ND2 A ASN A 1 216 ? 11.827  -3.786  -24.080 0.50 30.12  ? 194  ASN A ND2 1 
ATOM   1182 N  ND2 B ASN A 1 216 ? 13.966  -3.828  -21.089 0.50 34.26  ? 194  ASN A ND2 1 
ATOM   1183 N  N   . ALA A 1 217 ? 12.705  0.726   -20.477 1.00 27.11  ? 195  ALA A N   1 
ATOM   1184 C  CA  . ALA A 1 217 ? 13.094  1.384   -19.235 1.00 28.61  ? 195  ALA A CA  1 
ATOM   1185 C  C   . ALA A 1 217 ? 11.791  1.815   -18.536 1.00 29.21  ? 195  ALA A C   1 
ATOM   1186 O  O   . ALA A 1 217 ? 10.955  2.431   -19.157 1.00 28.35  ? 195  ALA A O   1 
ATOM   1187 C  CB  . ALA A 1 217 ? 13.976  2.589   -19.503 1.00 27.49  ? 195  ALA A CB  1 
ATOM   1188 N  N   . ARG A 1 218 ? 11.597  1.436   -17.285 1.00 30.14  ? 196  ARG A N   1 
ATOM   1189 C  CA  . ARG A 1 218 ? 10.438  1.928   -16.555 1.00 31.35  ? 196  ARG A CA  1 
ATOM   1190 C  C   . ARG A 1 218 ? 10.521  3.457   -16.431 1.00 29.99  ? 196  ARG A C   1 
ATOM   1191 O  O   . ARG A 1 218 ? 11.615  4.022   -16.242 1.00 29.02  ? 196  ARG A O   1 
ATOM   1192 C  CB  . ARG A 1 218 ? 10.359  1.281   -15.180 1.00 35.65  ? 196  ARG A CB  1 
ATOM   1193 C  CG  . ARG A 1 218 ? 10.081  -0.216  -15.193 1.00 39.26  ? 196  ARG A CG  1 
ATOM   1194 C  CD  . ARG A 1 218 ? 9.208   -0.659  -14.018 1.00 44.19  ? 196  ARG A CD  1 
ATOM   1195 N  NE  . ARG A 1 218 ? 7.851   -0.678  -14.483 1.00 50.20  ? 196  ARG A NE  1 
ATOM   1196 C  CZ  . ARG A 1 218 ? 6.799   -0.077  -13.950 1.00 50.07  ? 196  ARG A CZ  1 
ATOM   1197 N  NH1 . ARG A 1 218 ? 6.845   0.598   -12.809 1.00 52.85  ? 196  ARG A NH1 1 
ATOM   1198 N  NH2 . ARG A 1 218 ? 5.662   -0.191  -14.600 1.00 52.47  ? 196  ARG A NH2 1 
ATOM   1199 N  N   . PHE A 1 219 ? 9.364   4.122   -16.501 1.00 28.42  ? 197  PHE A N   1 
ATOM   1200 C  CA  . PHE A 1 219 ? 9.305   5.592   -16.561 1.00 28.29  ? 197  PHE A CA  1 
ATOM   1201 C  C   . PHE A 1 219 ? 10.046  6.264   -15.405 1.00 29.25  ? 197  PHE A C   1 
ATOM   1202 O  O   . PHE A 1 219 ? 10.579  7.359   -15.580 1.00 28.35  ? 197  PHE A O   1 
ATOM   1203 C  CB  . PHE A 1 219 ? 7.848   6.092   -16.616 1.00 29.44  ? 197  PHE A CB  1 
ATOM   1204 C  CG  . PHE A 1 219 ? 7.102   5.982   -15.287 1.00 30.02  ? 197  PHE A CG  1 
ATOM   1205 C  CD1 . PHE A 1 219 ? 6.626   4.767   -14.830 1.00 30.46  ? 197  PHE A CD1 1 
ATOM   1206 C  CD2 . PHE A 1 219 ? 6.879   7.109   -14.515 1.00 31.40  ? 197  PHE A CD2 1 
ATOM   1207 C  CE1 . PHE A 1 219 ? 5.959   4.681   -13.611 1.00 32.10  ? 197  PHE A CE1 1 
ATOM   1208 C  CE2 . PHE A 1 219 ? 6.226   7.027   -13.289 1.00 31.25  ? 197  PHE A CE2 1 
ATOM   1209 C  CZ  . PHE A 1 219 ? 5.774   5.814   -12.840 1.00 32.16  ? 197  PHE A CZ  1 
ATOM   1210 N  N   . ASP A 1 220 ? 10.081  5.611   -14.250 1.00 29.74  ? 198  ASP A N   1 
ATOM   1211 C  CA  . ASP A 1 220 ? 10.686  6.203   -13.063 1.00 32.22  ? 198  ASP A CA  1 
ATOM   1212 C  C   . ASP A 1 220 ? 12.136  5.774   -12.849 1.00 31.94  ? 198  ASP A C   1 
ATOM   1213 O  O   . ASP A 1 220 ? 12.706  6.088   -11.827 1.00 33.88  ? 198  ASP A O   1 
ATOM   1214 C  CB  . ASP A 1 220 ? 9.827   5.930   -11.812 1.00 34.27  ? 198  ASP A CB  1 
ATOM   1215 C  CG  . ASP A 1 220 ? 9.673   4.450   -11.502 1.00 37.10  ? 198  ASP A CG  1 
ATOM   1216 O  OD1 . ASP A 1 220 ? 9.888   3.592   -12.378 1.00 36.19  ? 198  ASP A OD1 1 
ATOM   1217 O  OD2 . ASP A 1 220 ? 9.346   4.137   -10.350 1.00 40.22  ? 198  ASP A OD2 1 
ATOM   1218 N  N   . SER A 1 221 ? 12.737  5.082   -13.817 1.00 31.05  ? 199  SER A N   1 
ATOM   1219 C  CA  . SER A 1 221 ? 14.170  4.713   -13.740 1.00 31.99  ? 199  SER A CA  1 
ATOM   1220 C  C   . SER A 1 221 ? 14.965  5.881   -14.321 1.00 30.43  ? 199  SER A C   1 
ATOM   1221 O  O   . SER A 1 221 ? 14.434  6.640   -15.108 1.00 29.99  ? 199  SER A O   1 
ATOM   1222 C  CB  . SER A 1 221 ? 14.486  3.426   -14.546 1.00 31.32  ? 199  SER A CB  1 
ATOM   1223 O  OG  . SER A 1 221 ? 14.314  3.652   -15.945 1.00 30.51  ? 199  SER A OG  1 
ATOM   1224 N  N   . PRO A 1 222 ? 16.251  6.008   -13.963 1.00 32.22  ? 200  PRO A N   1 
ATOM   1225 C  CA  . PRO A 1 222 ? 17.014  7.153   -14.480 1.00 32.64  ? 200  PRO A CA  1 
ATOM   1226 C  C   . PRO A 1 222 ? 17.184  7.159   -16.009 1.00 32.51  ? 200  PRO A C   1 
ATOM   1227 O  O   . PRO A 1 222 ? 17.429  8.221   -16.608 1.00 32.91  ? 200  PRO A O   1 
ATOM   1228 C  CB  . PRO A 1 222 ? 18.366  7.045   -13.745 1.00 34.23  ? 200  PRO A CB  1 
ATOM   1229 C  CG  . PRO A 1 222 ? 18.065  6.265   -12.508 1.00 34.92  ? 200  PRO A CG  1 
ATOM   1230 C  CD  . PRO A 1 222 ? 16.955  5.314   -12.873 1.00 33.71  ? 200  PRO A CD  1 
ATOM   1231 N  N   . GLU A 1 223 ? 16.990  6.018   -16.651 1.00 31.88  ? 201  GLU A N   1 
ATOM   1232 C  CA  . GLU A 1 223 ? 17.296  5.922   -18.070 1.00 32.87  ? 201  GLU A CA  1 
ATOM   1233 C  C   . GLU A 1 223 ? 16.063  5.992   -18.938 1.00 30.36  ? 201  GLU A C   1 
ATOM   1234 O  O   . GLU A 1 223 ? 16.162  5.824   -20.128 1.00 29.58  ? 201  GLU A O   1 
ATOM   1235 C  CB  . GLU A 1 223 ? 18.164  4.678   -18.371 1.00 35.60  ? 201  GLU A CB  1 
ATOM   1236 C  CG  . GLU A 1 223 ? 17.508  3.353   -18.070 1.00 36.18  ? 201  GLU A CG  1 
ATOM   1237 C  CD  . GLU A 1 223 ? 17.698  2.899   -16.648 1.00 38.54  ? 201  GLU A CD  1 
ATOM   1238 O  OE1 . GLU A 1 223 ? 18.284  3.633   -15.838 1.00 40.04  ? 201  GLU A OE1 1 
ATOM   1239 O  OE2 . GLU A 1 223 ? 17.257  1.785   -16.352 1.00 40.37  ? 201  GLU A OE2 1 
ATOM   1240 N  N   . SER A 1 224 ? 14.891  6.273   -18.369 1.00 29.52  ? 202  SER A N   1 
ATOM   1241 C  CA  . SER A 1 224 ? 13.721  6.533   -19.200 1.00 27.34  ? 202  SER A CA  1 
ATOM   1242 C  C   . SER A 1 224 ? 13.878  7.849   -19.968 1.00 26.81  ? 202  SER A C   1 
ATOM   1243 O  O   . SER A 1 224 ? 14.710  8.682   -19.620 1.00 29.20  ? 202  SER A O   1 
ATOM   1244 C  CB  . SER A 1 224 ? 12.440  6.612   -18.369 1.00 28.08  ? 202  SER A CB  1 
ATOM   1245 O  OG  . SER A 1 224 ? 12.427  7.769   -17.557 1.00 28.15  ? 202  SER A OG  1 
ATOM   1246 N  N   . HIS A 1 225 ? 13.077  8.031   -21.001 1.00 26.34  ? 203  HIS A N   1 
ATOM   1247 C  CA  . HIS A 1 225 ? 13.061  9.278   -21.754 1.00 27.52  ? 203  HIS A CA  1 
ATOM   1248 C  C   . HIS A 1 225 ? 12.761  10.494  -20.878 1.00 29.78  ? 203  HIS A C   1 
ATOM   1249 O  O   . HIS A 1 225 ? 13.449  11.514  -20.999 1.00 28.64  ? 203  HIS A O   1 
ATOM   1250 C  CB  . HIS A 1 225 ? 12.177  9.183   -22.999 1.00 27.99  ? 203  HIS A CB  1 
ATOM   1251 C  CG  . HIS A 1 225 ? 10.705  9.120   -22.745 1.00 28.78  ? 203  HIS A CG  1 
ATOM   1252 N  ND1 . HIS A 1 225 ? 10.122  8.230   -21.872 1.00 32.69  ? 203  HIS A ND1 1 
ATOM   1253 C  CD2 . HIS A 1 225 ? 9.686   9.791   -23.329 1.00 30.13  ? 203  HIS A CD2 1 
ATOM   1254 C  CE1 . HIS A 1 225 ? 8.810   8.388   -21.892 1.00 31.81  ? 203  HIS A CE1 1 
ATOM   1255 N  NE2 . HIS A 1 225 ? 8.521   9.335   -22.763 1.00 31.22  ? 203  HIS A NE2 1 
ATOM   1256 N  N   . VAL A 1 226 ? 11.809  10.349  -19.944 1.00 28.82  ? 204  VAL A N   1 
ATOM   1257 C  CA  . VAL A 1 226 ? 11.527  11.421  -18.986 1.00 31.39  ? 204  VAL A CA  1 
ATOM   1258 C  C   . VAL A 1 226 ? 12.681  11.629  -18.000 1.00 30.12  ? 204  VAL A C   1 
ATOM   1259 O  O   . VAL A 1 226 ? 13.085  12.764  -17.786 1.00 30.24  ? 204  VAL A O   1 
ATOM   1260 C  CB  . VAL A 1 226 ? 10.158  11.231  -18.271 1.00 34.00  ? 204  VAL A CB  1 
ATOM   1261 C  CG1 . VAL A 1 226 ? 9.040   11.093  -19.315 1.00 33.36  ? 204  VAL A CG1 1 
ATOM   1262 C  CG2 . VAL A 1 226 ? 10.176  10.022  -17.373 1.00 36.72  ? 204  VAL A CG2 1 
ATOM   1263 N  N   . GLY A 1 227 ? 13.261  10.550  -17.450 1.00 29.36  ? 205  GLY A N   1 
ATOM   1264 C  CA  . GLY A 1 227 ? 14.392  10.703  -16.522 1.00 29.41  ? 205  GLY A CA  1 
ATOM   1265 C  C   . GLY A 1 227 ? 15.617  11.360  -17.173 1.00 29.46  ? 205  GLY A C   1 
ATOM   1266 O  O   . GLY A 1 227 ? 16.312  12.173  -16.551 1.00 29.60  ? 205  GLY A O   1 
ATOM   1267 N  N   . VAL A 1 228 ? 15.902  10.982  -18.421 1.00 28.14  ? 206  VAL A N   1 
ATOM   1268 C  CA  . VAL A 1 228 ? 17.096  11.479  -19.120 1.00 29.12  ? 206  VAL A CA  1 
ATOM   1269 C  C   . VAL A 1 228 ? 16.883  12.940  -19.489 1.00 27.84  ? 206  VAL A C   1 
ATOM   1270 O  O   . VAL A 1 228 ? 17.779  13.749  -19.338 1.00 28.46  ? 206  VAL A O   1 
ATOM   1271 C  CB  . VAL A 1 228 ? 17.449  10.602  -20.352 1.00 28.73  ? 206  VAL A CB  1 
ATOM   1272 C  CG1 . VAL A 1 228 ? 18.466  11.286  -21.264 1.00 29.51  ? 206  VAL A CG1 1 
ATOM   1273 C  CG2 . VAL A 1 228 ? 18.009  9.255   -19.886 1.00 30.29  ? 206  VAL A CG2 1 
ATOM   1274 N  N   . ALA A 1 229 ? 15.674  13.296  -19.895 1.00 27.49  ? 207  ALA A N   1 
ATOM   1275 C  CA  . ALA A 1 229 ? 15.373  14.715  -20.171 1.00 28.76  ? 207  ALA A CA  1 
ATOM   1276 C  C   . ALA A 1 229 ? 15.659  15.608  -18.971 1.00 30.96  ? 207  ALA A C   1 
ATOM   1277 O  O   . ALA A 1 229 ? 16.355  16.625  -19.112 1.00 31.15  ? 207  ALA A O   1 
ATOM   1278 C  CB  . ALA A 1 229 ? 13.949  14.899  -20.673 1.00 28.04  ? 207  ALA A CB  1 
ATOM   1279 N  N   . TRP A 1 230 ? 15.206  15.196  -17.780 1.00 32.73  ? 208  TRP A N   1 
ATOM   1280 C  CA  A TRP A 1 230 ? 15.464  15.976  -16.572 0.40 34.60  ? 208  TRP A CA  1 
ATOM   1281 C  CA  B TRP A 1 230 ? 15.462  15.924  -16.519 0.60 35.08  ? 208  TRP A CA  1 
ATOM   1282 C  C   . TRP A 1 230 ? 16.960  16.039  -16.233 1.00 36.40  ? 208  TRP A C   1 
ATOM   1283 O  O   . TRP A 1 230 ? 17.468  17.106  -15.897 1.00 35.24  ? 208  TRP A O   1 
ATOM   1284 C  CB  A TRP A 1 230 ? 14.597  15.489  -15.396 0.40 35.79  ? 208  TRP A CB  1 
ATOM   1285 C  CB  B TRP A 1 230 ? 14.735  15.239  -15.333 0.60 37.01  ? 208  TRP A CB  1 
ATOM   1286 C  CG  A TRP A 1 230 ? 13.140  15.891  -15.592 0.40 35.81  ? 208  TRP A CG  1 
ATOM   1287 C  CG  B TRP A 1 230 ? 15.108  15.740  -13.946 0.60 40.92  ? 208  TRP A CG  1 
ATOM   1288 C  CD1 A TRP A 1 230 ? 12.154  15.148  -16.165 0.40 34.66  ? 208  TRP A CD1 1 
ATOM   1289 C  CD1 B TRP A 1 230 ? 15.956  15.132  -13.049 0.60 42.57  ? 208  TRP A CD1 1 
ATOM   1290 C  CD2 A TRP A 1 230 ? 12.537  17.148  -15.239 0.40 36.39  ? 208  TRP A CD2 1 
ATOM   1291 C  CD2 B TRP A 1 230 ? 14.634  16.930  -13.291 0.60 44.38  ? 208  TRP A CD2 1 
ATOM   1292 N  NE1 A TRP A 1 230 ? 10.975  15.849  -16.178 0.40 34.87  ? 208  TRP A NE1 1 
ATOM   1293 N  NE1 B TRP A 1 230 ? 16.036  15.868  -11.900 0.60 45.37  ? 208  TRP A NE1 1 
ATOM   1294 C  CE2 A TRP A 1 230 ? 11.184  17.083  -15.624 0.40 35.28  ? 208  TRP A CE2 1 
ATOM   1295 C  CE2 B TRP A 1 230 ? 15.244  16.976  -12.017 0.60 45.43  ? 208  TRP A CE2 1 
ATOM   1296 C  CE3 A TRP A 1 230 ? 13.013  18.319  -14.641 0.40 37.78  ? 208  TRP A CE3 1 
ATOM   1297 C  CE3 B TRP A 1 230 ? 13.755  17.956  -13.657 0.60 44.87  ? 208  TRP A CE3 1 
ATOM   1298 C  CZ2 A TRP A 1 230 ? 10.297  18.144  -15.434 0.40 35.50  ? 208  TRP A CZ2 1 
ATOM   1299 C  CZ2 B TRP A 1 230 ? 15.019  18.018  -11.108 0.60 50.10  ? 208  TRP A CZ2 1 
ATOM   1300 C  CZ3 A TRP A 1 230 ? 12.118  19.381  -14.445 0.40 38.04  ? 208  TRP A CZ3 1 
ATOM   1301 C  CZ3 B TRP A 1 230 ? 13.521  18.995  -12.742 0.60 47.88  ? 208  TRP A CZ3 1 
ATOM   1302 C  CH2 A TRP A 1 230 ? 10.779  19.278  -14.842 0.40 36.69  ? 208  TRP A CH2 1 
ATOM   1303 C  CH2 B TRP A 1 230 ? 14.156  19.015  -11.484 0.60 49.98  ? 208  TRP A CH2 1 
ATOM   1304 N  N   . ARG A 1 231 ? 17.678  14.928  -16.369 1.00 36.60  ? 209  ARG A N   1 
ATOM   1305 C  CA  . ARG A 1 231 ? 19.122  14.936  -16.103 1.00 39.09  ? 209  ARG A CA  1 
ATOM   1306 C  C   . ARG A 1 231 ? 19.874  15.825  -17.102 1.00 37.47  ? 209  ARG A C   1 
ATOM   1307 O  O   . ARG A 1 231 ? 20.828  16.465  -16.728 1.00 38.82  ? 209  ARG A O   1 
ATOM   1308 C  CB  . ARG A 1 231 ? 19.695  13.515  -16.089 1.00 42.03  ? 209  ARG A CB  1 
ATOM   1309 C  CG  . ARG A 1 231 ? 19.271  12.688  -14.869 1.00 47.25  ? 209  ARG A CG  1 
ATOM   1310 C  CD  . ARG A 1 231 ? 19.235  11.175  -15.131 1.00 50.24  ? 209  ARG A CD  1 
ATOM   1311 N  NE  . ARG A 1 231 ? 20.576  10.564  -15.093 1.00 57.28  ? 209  ARG A NE  1 
ATOM   1312 C  CZ  . ARG A 1 231 ? 20.993  9.503   -15.817 1.00 59.12  ? 209  ARG A CZ  1 
ATOM   1313 N  NH1 . ARG A 1 231 ? 20.198  8.878   -16.695 1.00 53.89  ? 209  ARG A NH1 1 
ATOM   1314 N  NH2 . ARG A 1 231 ? 22.244  9.066   -15.675 1.00 59.62  ? 209  ARG A NH2 1 
ATOM   1315 N  N   . LEU A 1 232 ? 19.442  15.893  -18.363 1.00 35.70  ? 210  LEU A N   1 
ATOM   1316 C  CA  . LEU A 1 232 ? 20.111  16.792  -19.301 1.00 35.88  ? 210  LEU A CA  1 
ATOM   1317 C  C   . LEU A 1 232 ? 19.890  18.249  -18.912 1.00 36.46  ? 210  LEU A C   1 
ATOM   1318 O  O   . LEU A 1 232 ? 20.813  19.044  -18.870 1.00 36.42  ? 210  LEU A O   1 
ATOM   1319 C  CB  . LEU A 1 232 ? 19.601  16.580  -20.715 1.00 34.46  ? 210  LEU A CB  1 
ATOM   1320 C  CG  . LEU A 1 232 ? 19.982  15.230  -21.311 1.00 35.67  ? 210  LEU A CG  1 
ATOM   1321 C  CD1 . LEU A 1 232 ? 19.285  15.040  -22.647 1.00 33.78  ? 210  LEU A CD1 1 
ATOM   1322 C  CD2 . LEU A 1 232 ? 21.485  15.107  -21.459 1.00 38.50  ? 210  LEU A CD2 1 
ATOM   1323 N  N   . LYS A 1 233 ? 18.637  18.575  -18.645 1.00 36.86  ? 211  LYS A N   1 
ATOM   1324 C  CA  . LYS A 1 233 ? 18.233  19.914  -18.284 1.00 39.31  ? 211  LYS A CA  1 
ATOM   1325 C  C   . LYS A 1 233 ? 19.020  20.423  -17.105 1.00 41.48  ? 211  LYS A C   1 
ATOM   1326 O  O   . LYS A 1 233 ? 19.468  21.560  -17.112 1.00 38.89  ? 211  LYS A O   1 
ATOM   1327 C  CB  . LYS A 1 233 ? 16.743  19.949  -17.950 1.00 41.45  ? 211  LYS A CB  1 
ATOM   1328 C  CG  . LYS A 1 233 ? 16.236  21.345  -17.631 1.00 47.54  ? 211  LYS A CG  1 
ATOM   1329 C  CD  . LYS A 1 233 ? 14.760  21.352  -17.304 1.00 50.57  ? 211  LYS A CD  1 
ATOM   1330 C  CE  . LYS A 1 233 ? 14.517  20.645  -16.005 1.00 55.71  ? 211  LYS A CE  1 
ATOM   1331 N  NZ  . LYS A 1 233 ? 15.157  21.397  -14.896 1.00 62.73  ? 211  LYS A NZ  1 
ATOM   1332 N  N   . ASN A 1 234 ? 19.231  19.569  -16.111 1.00 42.83  ? 212  ASN A N   1 
ATOM   1333 C  CA  . ASN A 1 234 ? 20.000  19.976  -14.945 1.00 47.31  ? 212  ASN A CA  1 
ATOM   1334 C  C   . ASN A 1 234 ? 21.435  20.363  -15.236 1.00 47.78  ? 212  ASN A C   1 
ATOM   1335 O  O   . ASN A 1 234 ? 22.021  21.087  -14.441 1.00 48.99  ? 212  ASN A O   1 
ATOM   1336 C  CB  . ASN A 1 234 ? 19.959  18.910  -13.850 1.00 50.40  ? 212  ASN A CB  1 
ATOM   1337 C  CG  . ASN A 1 234 ? 18.584  18.790  -13.218 1.00 53.73  ? 212  ASN A CG  1 
ATOM   1338 O  OD1 . ASN A 1 234 ? 17.827  19.762  -13.144 1.00 58.70  ? 212  ASN A OD1 1 
ATOM   1339 N  ND2 . ASN A 1 234 ? 18.251  17.596  -12.767 1.00 55.64  ? 212  ASN A ND2 1 
ATOM   1340 N  N   . GLU A 1 235 ? 21.993  19.924  -16.360 1.00 46.20  ? 213  GLU A N   1 
ATOM   1341 C  CA  . GLU A 1 235 ? 23.369  20.292  -16.720 1.00 49.27  ? 213  GLU A CA  1 
ATOM   1342 C  C   . GLU A 1 235 ? 23.479  21.413  -17.747 1.00 47.59  ? 213  GLU A C   1 
ATOM   1343 O  O   . GLU A 1 235 ? 24.583  21.831  -18.069 1.00 48.49  ? 213  GLU A O   1 
ATOM   1344 C  CB  . GLU A 1 235 ? 24.125  19.072  -17.253 1.00 51.33  ? 213  GLU A CB  1 
ATOM   1345 C  CG  . GLU A 1 235 ? 24.112  17.869  -16.321 1.00 53.53  ? 213  GLU A CG  1 
ATOM   1346 C  CD  . GLU A 1 235 ? 24.673  18.165  -14.942 1.00 57.68  ? 213  GLU A CD  1 
ATOM   1347 O  OE1 . GLU A 1 235 ? 25.552  19.036  -14.786 1.00 60.45  ? 213  GLU A OE1 1 
ATOM   1348 O  OE2 . GLU A 1 235 ? 24.227  17.513  -13.985 1.00 62.90  ? 213  GLU A OE2 1 
ATOM   1349 N  N   . ILE A 1 236 ? 22.354  21.888  -18.272 1.00 44.49  ? 214  ILE A N   1 
ATOM   1350 C  CA  . ILE A 1 236 ? 22.376  22.876  -19.347 1.00 43.37  ? 214  ILE A CA  1 
ATOM   1351 C  C   . ILE A 1 236 ? 21.698  24.167  -18.897 1.00 43.97  ? 214  ILE A C   1 
ATOM   1352 O  O   . ILE A 1 236 ? 20.477  24.188  -18.735 1.00 41.69  ? 214  ILE A O   1 
ATOM   1353 C  CB  . ILE A 1 236 ? 21.672  22.337  -20.610 1.00 39.98  ? 214  ILE A CB  1 
ATOM   1354 C  CG1 . ILE A 1 236 ? 22.416  21.106  -21.135 1.00 39.19  ? 214  ILE A CG1 1 
ATOM   1355 C  CG2 . ILE A 1 236 ? 21.620  23.403  -21.707 1.00 39.38  ? 214  ILE A CG2 1 
ATOM   1356 C  CD1 . ILE A 1 236 ? 21.712  20.420  -22.287 1.00 36.94  ? 214  ILE A CD1 1 
ATOM   1357 N  N   . PRO A 1 237 ? 22.474  25.255  -18.734 1.00 47.14  ? 215  PRO A N   1 
ATOM   1358 C  CA  . PRO A 1 237 ? 21.865  26.513  -18.309 1.00 48.02  ? 215  PRO A CA  1 
ATOM   1359 C  C   . PRO A 1 237 ? 20.902  27.047  -19.340 1.00 46.65  ? 215  PRO A C   1 
ATOM   1360 O  O   . PRO A 1 237 ? 21.060  26.787  -20.536 1.00 47.02  ? 215  PRO A O   1 
ATOM   1361 C  CB  . PRO A 1 237 ? 23.058  27.469  -18.157 1.00 50.72  ? 215  PRO A CB  1 
ATOM   1362 C  CG  . PRO A 1 237 ? 24.263  26.610  -18.131 1.00 51.60  ? 215  PRO A CG  1 
ATOM   1363 C  CD  . PRO A 1 237 ? 23.930  25.389  -18.918 1.00 48.67  ? 215  PRO A CD  1 
ATOM   1364 N  N   . ASN A 1 238 ? 19.892  27.758  -18.864 1.00 46.68  ? 216  ASN A N   1 
ATOM   1365 C  CA  . ASN A 1 238 ? 18.832  28.305  -19.710 1.00 46.18  ? 216  ASN A CA  1 
ATOM   1366 C  C   . ASN A 1 238 ? 18.084  27.296  -20.569 1.00 43.02  ? 216  ASN A C   1 
ATOM   1367 O  O   . ASN A 1 238 ? 17.674  27.631  -21.695 1.00 41.24  ? 216  ASN A O   1 
ATOM   1368 C  CB  . ASN A 1 238 ? 19.381  29.422  -20.598 1.00 48.03  ? 216  ASN A CB  1 
ATOM   1369 C  CG  . ASN A 1 238 ? 20.031  30.517  -19.802 1.00 52.48  ? 216  ASN A CG  1 
ATOM   1370 O  OD1 . ASN A 1 238 ? 21.221  30.765  -19.954 1.00 55.34  ? 216  ASN A OD1 1 
ATOM   1371 N  ND2 . ASN A 1 238 ? 19.267  31.161  -18.923 1.00 54.16  ? 216  ASN A ND2 1 
ATOM   1372 N  N   . SER A 1 239 ? 17.919  26.070  -20.054 1.00 40.68  ? 217  SER A N   1 
ATOM   1373 C  CA  . SER A 1 239 ? 17.129  25.057  -20.718 1.00 39.02  ? 217  SER A CA  1 
ATOM   1374 C  C   . SER A 1 239 ? 15.819  24.863  -19.980 1.00 37.83  ? 217  SER A C   1 
ATOM   1375 O  O   . SER A 1 239 ? 15.736  25.134  -18.785 1.00 36.72  ? 217  SER A O   1 
ATOM   1376 C  CB  . SER A 1 239 ? 17.879  23.716  -20.785 1.00 38.38  ? 217  SER A CB  1 
ATOM   1377 O  OG  . SER A 1 239 ? 18.157  23.220  -19.485 1.00 38.88  ? 217  SER A OG  1 
ATOM   1378 N  N   . HIS A 1 240 ? 14.816  24.371  -20.698 1.00 36.44  ? 218  HIS A N   1 
ATOM   1379 C  CA  . HIS A 1 240 ? 13.465  24.170  -20.129 1.00 37.02  ? 218  HIS A CA  1 
ATOM   1380 C  C   . HIS A 1 240 ? 12.878  22.909  -20.713 1.00 33.74  ? 218  HIS A C   1 
ATOM   1381 O  O   . HIS A 1 240 ? 13.075  22.619  -21.898 1.00 32.80  ? 218  HIS A O   1 
ATOM   1382 C  CB  . HIS A 1 240 ? 12.513  25.329  -20.481 1.00 37.90  ? 218  HIS A CB  1 
ATOM   1383 C  CG  . HIS A 1 240 ? 13.109  26.680  -20.295 1.00 40.75  ? 218  HIS A CG  1 
ATOM   1384 N  ND1 . HIS A 1 240 ? 13.023  27.375  -19.105 1.00 44.55  ? 218  HIS A ND1 1 
ATOM   1385 C  CD2 . HIS A 1 240 ? 13.839  27.458  -21.133 1.00 42.76  ? 218  HIS A CD2 1 
ATOM   1386 C  CE1 . HIS A 1 240 ? 13.659  28.529  -19.221 1.00 44.79  ? 218  HIS A CE1 1 
ATOM   1387 N  NE2 . HIS A 1 240 ? 14.162  28.606  -20.442 1.00 44.43  ? 218  HIS A NE2 1 
ATOM   1388 N  N   . ILE A 1 241 ? 12.159  22.161  -19.886 1.00 31.78  ? 219  ILE A N   1 
ATOM   1389 C  CA  . ILE A 1 241 ? 11.332  21.073  -20.367 1.00 30.37  ? 219  ILE A CA  1 
ATOM   1390 C  C   . ILE A 1 241 ? 9.906   21.627  -20.317 1.00 32.25  ? 219  ILE A C   1 
ATOM   1391 O  O   . ILE A 1 241 ? 9.358   21.887  -19.238 1.00 29.96  ? 219  ILE A O   1 
ATOM   1392 C  CB  . ILE A 1 241 ? 11.484  19.813  -19.489 1.00 30.84  ? 219  ILE A CB  1 
ATOM   1393 C  CG1 . ILE A 1 241 ? 12.921  19.298  -19.511 1.00 31.73  ? 219  ILE A CG1 1 
ATOM   1394 C  CG2 . ILE A 1 241 ? 10.569  18.698  -19.964 1.00 29.47  ? 219  ILE A CG2 1 
ATOM   1395 C  CD1 . ILE A 1 241 ? 13.245  18.345  -18.368 1.00 34.04  ? 219  ILE A CD1 1 
ATOM   1396 N  N   . LEU A 1 242 ? 9.319   21.841  -21.480 1.00 31.13  ? 220  LEU A N   1 
ATOM   1397 C  CA  . LEU A 1 242 ? 7.943   22.282  -21.550 1.00 33.25  ? 220  LEU A CA  1 
ATOM   1398 C  C   . LEU A 1 242 ? 6.990   21.210  -20.943 1.00 34.11  ? 220  LEU A C   1 
ATOM   1399 O  O   . LEU A 1 242 ? 6.002   21.567  -20.302 1.00 32.77  ? 220  LEU A O   1 
ATOM   1400 C  CB  . LEU A 1 242 ? 7.582   22.629  -23.004 1.00 32.54  ? 220  LEU A CB  1 
ATOM   1401 C  CG  . LEU A 1 242 ? 8.373   23.848  -23.484 1.00 33.60  ? 220  LEU A CG  1 
ATOM   1402 C  CD1 . LEU A 1 242 ? 8.159   24.043  -24.973 1.00 34.85  ? 220  LEU A CD1 1 
ATOM   1403 C  CD2 . LEU A 1 242 ? 7.977   25.110  -22.733 1.00 36.28  ? 220  LEU A CD2 1 
ATOM   1404 N  N   . ASP A 1 243 ? 7.324   19.923  -21.127 1.00 31.75  ? 221  ASP A N   1 
ATOM   1405 C  CA  . ASP A 1 243 ? 6.688   18.773  -20.426 1.00 31.58  ? 221  ASP A CA  1 
ATOM   1406 C  C   . ASP A 1 243 ? 5.227   18.549  -20.821 1.00 30.38  ? 221  ASP A C   1 
ATOM   1407 O  O   . ASP A 1 243 ? 4.280   18.910  -20.106 1.00 29.51  ? 221  ASP A O   1 
ATOM   1408 C  CB  . ASP A 1 243 ? 6.825   18.879  -18.901 1.00 34.69  ? 221  ASP A CB  1 
ATOM   1409 C  CG  . ASP A 1 243 ? 6.564   17.545  -18.191 1.00 37.79  ? 221  ASP A CG  1 
ATOM   1410 O  OD1 . ASP A 1 243 ? 6.057   16.588  -18.840 1.00 37.36  ? 221  ASP A OD1 1 
ATOM   1411 O  OD2 . ASP A 1 243 ? 6.871   17.449  -16.972 1.00 40.55  ? 221  ASP A OD2 1 
ATOM   1412 N  N   . GLN A 1 244 ? 5.067   17.936  -21.970 1.00 28.21  ? 222  GLN A N   1 
ATOM   1413 C  CA  . GLN A 1 244 ? 3.762   17.557  -22.476 1.00 28.58  ? 222  GLN A CA  1 
ATOM   1414 C  C   . GLN A 1 244 ? 2.919   16.641  -21.560 1.00 29.42  ? 222  GLN A C   1 
ATOM   1415 O  O   . GLN A 1 244 ? 1.703   16.554  -21.753 1.00 28.36  ? 222  GLN A O   1 
ATOM   1416 C  CB  . GLN A 1 244 ? 3.914   16.893  -23.821 1.00 28.84  ? 222  GLN A CB  1 
ATOM   1417 C  CG  . GLN A 1 244 ? 4.619   15.541  -23.779 1.00 29.30  ? 222  GLN A CG  1 
ATOM   1418 C  CD  . GLN A 1 244 ? 4.771   14.941  -25.163 1.00 30.60  ? 222  GLN A CD  1 
ATOM   1419 O  OE1 . GLN A 1 244 ? 3.942   15.166  -26.050 1.00 29.41  ? 222  GLN A OE1 1 
ATOM   1420 N  NE2 . GLN A 1 244 ? 5.826   14.147  -25.353 1.00 30.72  ? 222  GLN A NE2 1 
ATOM   1421 N  N   . TYR A 1 245 ? 3.563   15.937  -20.627 1.00 29.53  ? 223  TYR A N   1 
ATOM   1422 C  CA  . TYR A 1 245 ? 2.864   15.033  -19.703 1.00 30.10  ? 223  TYR A CA  1 
ATOM   1423 C  C   . TYR A 1 245 ? 2.122   15.775  -18.585 1.00 29.38  ? 223  TYR A C   1 
ATOM   1424 O  O   . TYR A 1 245 ? 1.212   15.205  -18.005 1.00 28.86  ? 223  TYR A O   1 
ATOM   1425 C  CB  . TYR A 1 245 ? 3.813   13.961  -19.101 1.00 29.84  ? 223  TYR A CB  1 
ATOM   1426 C  CG  . TYR A 1 245 ? 4.470   13.126  -20.189 1.00 30.05  ? 223  TYR A CG  1 
ATOM   1427 C  CD1 . TYR A 1 245 ? 3.738   12.201  -20.926 1.00 28.74  ? 223  TYR A CD1 1 
ATOM   1428 C  CD2 . TYR A 1 245 ? 5.811   13.333  -20.542 1.00 32.44  ? 223  TYR A CD2 1 
ATOM   1429 C  CE1 . TYR A 1 245 ? 4.312   11.504  -21.964 1.00 28.18  ? 223  TYR A CE1 1 
ATOM   1430 C  CE2 . TYR A 1 245 ? 6.408   12.622  -21.574 1.00 30.95  ? 223  TYR A CE2 1 
ATOM   1431 C  CZ  . TYR A 1 245 ? 5.665   11.702  -22.273 1.00 30.80  ? 223  TYR A CZ  1 
ATOM   1432 O  OH  . TYR A 1 245 ? 6.265   11.011  -23.302 1.00 31.03  ? 223  TYR A OH  1 
ATOM   1433 N  N   . ARG A 1 246 ? 2.551   16.998  -18.273 1.00 30.17  ? 224  ARG A N   1 
ATOM   1434 C  CA  . ARG A 1 246 ? 2.001   17.823  -17.183 1.00 34.01  ? 224  ARG A CA  1 
ATOM   1435 C  C   . ARG A 1 246 ? 1.504   19.201  -17.616 1.00 33.33  ? 224  ARG A C   1 
ATOM   1436 O  O   . ARG A 1 246 ? 0.750   19.820  -16.892 1.00 34.30  ? 224  ARG A O   1 
ATOM   1437 C  CB  . ARG A 1 246 ? 3.072   18.076  -16.120 1.00 35.95  ? 224  ARG A CB  1 
ATOM   1438 C  CG  . ARG A 1 246 ? 3.655   16.816  -15.528 1.00 39.16  ? 224  ARG A CG  1 
ATOM   1439 C  CD  . ARG A 1 246 ? 4.603   17.115  -14.366 1.00 42.13  ? 224  ARG A CD  1 
ATOM   1440 N  NE  . ARG A 1 246 ? 4.161   18.198  -13.471 1.00 49.81  ? 224  ARG A NE  1 
ATOM   1441 C  CZ  . ARG A 1 246 ? 3.178   18.133  -12.558 1.00 53.45  ? 224  ARG A CZ  1 
ATOM   1442 N  NH1 . ARG A 1 246 ? 2.452   17.034  -12.385 1.00 55.14  ? 224  ARG A NH1 1 
ATOM   1443 N  NH2 . ARG A 1 246 ? 2.905   19.201  -11.815 1.00 55.89  ? 224  ARG A NH2 1 
ATOM   1444 N  N   . ASN A 1 247 ? 1.961   19.700  -18.765 1.00 30.74  ? 225  ASN A N   1 
ATOM   1445 C  CA  . ASN A 1 247 ? 1.661   21.063  -19.182 1.00 30.81  ? 225  ASN A CA  1 
ATOM   1446 C  C   . ASN A 1 247 ? 0.229   21.204  -19.701 1.00 29.54  ? 225  ASN A C   1 
ATOM   1447 O  O   . ASN A 1 247 ? -0.137  20.579  -20.695 1.00 27.75  ? 225  ASN A O   1 
ATOM   1448 C  CB  . ASN A 1 247 ? 2.641   21.442  -20.285 1.00 30.96  ? 225  ASN A CB  1 
ATOM   1449 C  CG  . ASN A 1 247 ? 2.716   22.920  -20.537 1.00 32.82  ? 225  ASN A CG  1 
ATOM   1450 O  OD1 . ASN A 1 247 ? 1.720   23.638  -20.453 1.00 32.61  ? 225  ASN A OD1 1 
ATOM   1451 N  ND2 . ASN A 1 247 ? 3.924   23.392  -20.883 1.00 32.78  ? 225  ASN A ND2 1 
ATOM   1452 N  N   . ALA A 1 248 ? -0.563  22.058  -19.056 1.00 29.75  ? 226  ALA A N   1 
ATOM   1453 C  CA  . ALA A 1 248 ? -1.969  22.289  -19.462 1.00 29.68  ? 226  ALA A CA  1 
ATOM   1454 C  C   . ALA A 1 248 ? -2.115  22.737  -20.903 1.00 30.54  ? 226  ALA A C   1 
ATOM   1455 O  O   . ALA A 1 248 ? -3.137  22.473  -21.545 1.00 29.25  ? 226  ALA A O   1 
ATOM   1456 C  CB  . ALA A 1 248 ? -2.646  23.293  -18.516 1.00 31.53  ? 226  ALA A CB  1 
ATOM   1457 N  N   . SER A 1 249 ? -1.078  23.398  -21.417 1.00 30.78  ? 227  SER A N   1 
ATOM   1458 C  CA  . SER A 1 249 ? -1.001  23.798  -22.826 1.00 30.69  ? 227  SER A CA  1 
ATOM   1459 C  C   . SER A 1 249 ? -1.255  22.679  -23.819 1.00 29.33  ? 227  SER A C   1 
ATOM   1460 O  O   . SER A 1 249 ? -1.735  22.933  -24.911 1.00 29.79  ? 227  SER A O   1 
ATOM   1461 C  CB  . SER A 1 249 ? 0.352   24.465  -23.117 1.00 30.82  ? 227  SER A CB  1 
ATOM   1462 O  OG  . SER A 1 249 ? 0.393   25.747  -22.527 1.00 30.75  ? 227  SER A OG  1 
ATOM   1463 N  N   . ASN A 1 250 ? -0.952  21.444  -23.429 1.00 28.43  ? 228  ASN A N   1 
ATOM   1464 C  CA  . ASN A 1 250 ? -1.259  20.278  -24.241 1.00 26.84  ? 228  ASN A CA  1 
ATOM   1465 C  C   . ASN A 1 250 ? -2.788  20.034  -24.355 1.00 27.71  ? 228  ASN A C   1 
ATOM   1466 O  O   . ASN A 1 250 ? -3.363  20.236  -25.419 1.00 27.92  ? 228  ASN A O   1 
ATOM   1467 C  CB  . ASN A 1 250 ? -0.460  19.088  -23.669 1.00 25.87  ? 228  ASN A CB  1 
ATOM   1468 C  CG  . ASN A 1 250 ? -0.788  17.756  -24.272 1.00 24.75  ? 228  ASN A CG  1 
ATOM   1469 O  OD1 . ASN A 1 250 ? -1.581  17.613  -25.215 1.00 26.10  ? 228  ASN A OD1 1 
ATOM   1470 N  ND2 . ASN A 1 250 ? -0.116  16.746  -23.752 1.00 23.16  ? 228  ASN A ND2 1 
ATOM   1471 N  N   . PRO A 1 251 ? -3.458  19.601  -23.273 1.00 27.47  ? 229  PRO A N   1 
ATOM   1472 C  CA  . PRO A 1 251 ? -4.883  19.363  -23.477 1.00 27.41  ? 229  PRO A CA  1 
ATOM   1473 C  C   . PRO A 1 251 ? -5.666  20.615  -23.841 1.00 28.05  ? 229  PRO A C   1 
ATOM   1474 O  O   . PRO A 1 251 ? -6.670  20.494  -24.533 1.00 28.81  ? 229  PRO A O   1 
ATOM   1475 C  CB  . PRO A 1 251 ? -5.353  18.768  -22.140 1.00 28.52  ? 229  PRO A CB  1 
ATOM   1476 C  CG  . PRO A 1 251 ? -4.344  19.238  -21.157 1.00 29.78  ? 229  PRO A CG  1 
ATOM   1477 C  CD  . PRO A 1 251 ? -3.037  19.251  -21.919 1.00 28.43  ? 229  PRO A CD  1 
ATOM   1478 N  N   . LEU A 1 252 ? -5.206  21.798  -23.425 1.00 29.18  ? 230  LEU A N   1 
ATOM   1479 C  CA  . LEU A 1 252 ? -5.908  23.042  -23.761 1.00 30.56  ? 230  LEU A CA  1 
ATOM   1480 C  C   . LEU A 1 252 ? -5.879  23.334  -25.248 1.00 29.30  ? 230  LEU A C   1 
ATOM   1481 O  O   . LEU A 1 252 ? -6.837  23.893  -25.784 1.00 29.09  ? 230  LEU A O   1 
ATOM   1482 C  CB  . LEU A 1 252 ? -5.389  24.261  -22.961 1.00 32.07  ? 230  LEU A CB  1 
ATOM   1483 C  CG  . LEU A 1 252 ? -5.722  24.324  -21.454 1.00 33.03  ? 230  LEU A CG  1 
ATOM   1484 C  CD1 . LEU A 1 252 ? -4.885  25.421  -20.806 1.00 34.76  ? 230  LEU A CD1 1 
ATOM   1485 C  CD2 . LEU A 1 252 ? -7.195  24.572  -21.146 1.00 33.76  ? 230  LEU A CD2 1 
ATOM   1486 N  N   . ALA A 1 253 ? -4.790  22.973  -25.937 1.00 28.60  ? 231  ALA A N   1 
ATOM   1487 C  CA  . ALA A 1 253 ? -4.741  23.232  -27.361 1.00 28.05  ? 231  ALA A CA  1 
ATOM   1488 C  C   . ALA A 1 253 ? -5.905  22.481  -28.021 1.00 27.82  ? 231  ALA A C   1 
ATOM   1489 O  O   . ALA A 1 253 ? -6.559  22.998  -28.938 1.00 28.58  ? 231  ALA A O   1 
ATOM   1490 C  CB  . ALA A 1 253 ? -3.406  22.789  -27.934 1.00 28.21  ? 231  ALA A CB  1 
ATOM   1491 N  N   . HIS A 1 254 ? -6.176  21.273  -27.534 1.00 25.88  ? 232  HIS A N   1 
ATOM   1492 C  CA  . HIS A 1 254 ? -7.238  20.443  -28.099 1.00 26.69  ? 232  HIS A CA  1 
ATOM   1493 C  C   . HIS A 1 254 ? -8.625  20.880  -27.651 1.00 27.31  ? 232  HIS A C   1 
ATOM   1494 O  O   . HIS A 1 254 ? -9.550  20.854  -28.429 1.00 27.94  ? 232  HIS A O   1 
ATOM   1495 C  CB  . HIS A 1 254 ? -6.988  18.984  -27.759 1.00 26.43  ? 232  HIS A CB  1 
ATOM   1496 C  CG  . HIS A 1 254 ? -5.698  18.476  -28.300 1.00 26.19  ? 232  HIS A CG  1 
ATOM   1497 N  ND1 . HIS A 1 254 ? -5.437  18.428  -29.651 1.00 27.44  ? 232  HIS A ND1 1 
ATOM   1498 C  CD2 . HIS A 1 254 ? -4.597  17.993  -27.682 1.00 26.03  ? 232  HIS A CD2 1 
ATOM   1499 C  CE1 . HIS A 1 254 ? -4.226  17.950  -29.841 1.00 26.86  ? 232  HIS A CE1 1 
ATOM   1500 N  NE2 . HIS A 1 254 ? -3.695  17.671  -28.663 1.00 27.47  ? 232  HIS A NE2 1 
ATOM   1501 N  N   . TYR A 1 255 ? -8.765  21.283  -26.393 1.00 27.20  ? 233  TYR A N   1 
ATOM   1502 C  CA  . TYR A 1 255 ? -10.032 21.849  -25.916 1.00 28.53  ? 233  TYR A CA  1 
ATOM   1503 C  C   . TYR A 1 255 ? -10.406 23.124  -26.683 1.00 29.33  ? 233  TYR A C   1 
ATOM   1504 O  O   . TYR A 1 255 ? -11.575 23.289  -27.070 1.00 31.06  ? 233  TYR A O   1 
ATOM   1505 C  CB  . TYR A 1 255 ? -9.897  22.147  -24.422 1.00 29.01  ? 233  TYR A CB  1 
ATOM   1506 C  CG  . TYR A 1 255 ? -11.074 22.732  -23.689 1.00 29.39  ? 233  TYR A CG  1 
ATOM   1507 C  CD1 . TYR A 1 255 ? -12.066 21.922  -23.176 1.00 30.16  ? 233  TYR A CD1 1 
ATOM   1508 C  CD2 . TYR A 1 255 ? -11.129 24.079  -23.391 1.00 30.73  ? 233  TYR A CD2 1 
ATOM   1509 C  CE1 . TYR A 1 255 ? -13.134 22.447  -22.459 1.00 30.98  ? 233  TYR A CE1 1 
ATOM   1510 C  CE2 . TYR A 1 255 ? -12.195 24.620  -22.645 1.00 32.47  ? 233  TYR A CE2 1 
ATOM   1511 C  CZ  . TYR A 1 255 ? -13.193 23.788  -22.176 1.00 32.54  ? 233  TYR A CZ  1 
ATOM   1512 O  OH  . TYR A 1 255 ? -14.268 24.305  -21.420 1.00 34.93  ? 233  TYR A OH  1 
ATOM   1513 N  N   . ASP A 1 256 ? -9.422  24.000  -26.906 1.00 29.63  ? 234  ASP A N   1 
ATOM   1514 C  CA  . ASP A 1 256 ? -9.659  25.321  -27.522 1.00 32.95  ? 234  ASP A CA  1 
ATOM   1515 C  C   . ASP A 1 256 ? -9.795  25.249  -29.044 1.00 32.15  ? 234  ASP A C   1 
ATOM   1516 O  O   . ASP A 1 256 ? -10.575 26.004  -29.631 1.00 31.78  ? 234  ASP A O   1 
ATOM   1517 C  CB  . ASP A 1 256 ? -8.486  26.288  -27.222 1.00 32.80  ? 234  ASP A CB  1 
ATOM   1518 C  CG  . ASP A 1 256 ? -8.432  26.722  -25.768 1.00 34.48  ? 234  ASP A CG  1 
ATOM   1519 O  OD1 . ASP A 1 256 ? -9.446  26.512  -25.051 1.00 33.71  ? 234  ASP A OD1 1 
ATOM   1520 O  OD2 . ASP A 1 256 ? -7.370  27.272  -25.354 1.00 32.28  ? 234  ASP A OD2 1 
ATOM   1521 N  N   . THR A 1 257 ? -9.003  24.397  -29.680 1.00 30.78  ? 235  THR A N   1 
ATOM   1522 C  CA  . THR A 1 257 ? -8.932  24.432  -31.144 1.00 31.79  ? 235  THR A CA  1 
ATOM   1523 C  C   . THR A 1 257 ? -9.483  23.168  -31.783 1.00 30.32  ? 235  THR A C   1 
ATOM   1524 O  O   . THR A 1 257 ? -10.508 23.227  -32.451 1.00 32.19  ? 235  THR A O   1 
ATOM   1525 C  CB  . THR A 1 257 ? -7.504  24.769  -31.674 1.00 32.08  ? 235  THR A CB  1 
ATOM   1526 O  OG1 . THR A 1 257 ? -6.583  23.738  -31.301 1.00 32.95  ? 235  THR A OG1 1 
ATOM   1527 C  CG2 . THR A 1 257 ? -7.040  26.073  -31.108 1.00 32.82  ? 235  THR A CG2 1 
ATOM   1528 N  N   . THR A 1 258 ? -8.826  22.038  -31.564 1.00 28.40  ? 236  THR A N   1 
ATOM   1529 C  CA  . THR A 1 258 ? -9.213  20.783  -32.183 1.00 29.32  ? 236  THR A CA  1 
ATOM   1530 C  C   . THR A 1 258 ? -10.713 20.491  -31.971 1.00 31.15  ? 236  THR A C   1 
ATOM   1531 O  O   . THR A 1 258 ? -11.462 20.237  -32.921 1.00 31.65  ? 236  THR A O   1 
ATOM   1532 C  CB  . THR A 1 258 ? -8.371  19.597  -31.637 1.00 28.11  ? 236  THR A CB  1 
ATOM   1533 O  OG1 . THR A 1 258 ? -6.990  19.961  -31.556 1.00 27.94  ? 236  THR A OG1 1 
ATOM   1534 C  CG2 . THR A 1 258 ? -8.520  18.369  -32.524 1.00 27.66  ? 236  THR A CG2 1 
ATOM   1535 N  N   . ALA A 1 259 ? -11.142 20.518  -30.718 1.00 31.53  ? 237  ALA A N   1 
ATOM   1536 C  CA  . ALA A 1 259 ? -12.548 20.265  -30.374 1.00 32.00  ? 237  ALA A CA  1 
ATOM   1537 C  C   . ALA A 1 259 ? -13.527 21.229  -31.041 1.00 33.60  ? 237  ALA A C   1 
ATOM   1538 O  O   . ALA A 1 259 ? -14.593 20.816  -31.528 1.00 33.85  ? 237  ALA A O   1 
ATOM   1539 C  CB  . ALA A 1 259 ? -12.728 20.318  -28.853 1.00 32.63  ? 237  ALA A CB  1 
ATOM   1540 N  N   . ASP A 1 260 ? -13.192 22.512  -31.049 1.00 34.46  ? 238  ASP A N   1 
ATOM   1541 C  CA  . ASP A 1 260 ? -14.061 23.501  -31.670 1.00 37.21  ? 238  ASP A CA  1 
ATOM   1542 C  C   . ASP A 1 260 ? -14.122 23.276  -33.179 1.00 35.37  ? 238  ASP A C   1 
ATOM   1543 O  O   . ASP A 1 260 ? -15.163 23.492  -33.775 1.00 33.39  ? 238  ASP A O   1 
ATOM   1544 C  CB  . ASP A 1 260 ? -13.630 24.955  -31.355 1.00 41.41  ? 238  ASP A CB  1 
ATOM   1545 C  CG  . ASP A 1 260 ? -14.071 25.433  -29.945 1.00 46.49  ? 238  ASP A CG  1 
ATOM   1546 O  OD1 . ASP A 1 260 ? -14.830 24.722  -29.263 1.00 47.93  ? 238  ASP A OD1 1 
ATOM   1547 O  OD2 . ASP A 1 260 ? -13.652 26.553  -29.524 1.00 51.67  ? 238  ASP A OD2 1 
ATOM   1548 N  N   . GLU A 1 261 ? -13.009 22.867  -33.799 1.00 32.80  ? 239  GLU A N   1 
ATOM   1549 C  CA  . GLU A 1 261 ? -13.020 22.592  -35.247 1.00 32.52  ? 239  GLU A CA  1 
ATOM   1550 C  C   . GLU A 1 261 ? -13.969 21.432  -35.534 1.00 32.26  ? 239  GLU A C   1 
ATOM   1551 O  O   . GLU A 1 261 ? -14.790 21.502  -36.441 1.00 32.30  ? 239  GLU A O   1 
ATOM   1552 C  CB  . GLU A 1 261 ? -11.625 22.237  -35.763 1.00 32.07  ? 239  GLU A CB  1 
ATOM   1553 C  CG  . GLU A 1 261 ? -10.631 23.380  -35.842 1.00 32.80  ? 239  GLU A CG  1 
ATOM   1554 C  CD  . GLU A 1 261 ? -9.210  22.891  -36.132 1.00 33.19  ? 239  GLU A CD  1 
ATOM   1555 O  OE1 . GLU A 1 261 ? -9.022  21.767  -36.707 1.00 31.89  ? 239  GLU A OE1 1 
ATOM   1556 O  OE2 . GLU A 1 261 ? -8.259  23.620  -35.768 1.00 31.91  ? 239  GLU A OE2 1 
ATOM   1557 N  N   . ILE A 1 262 ? -13.866 20.376  -34.736 1.00 32.07  ? 240  ILE A N   1 
ATOM   1558 C  CA  . ILE A 1 262 ? -14.700 19.181  -34.898 1.00 32.88  ? 240  ILE A CA  1 
ATOM   1559 C  C   . ILE A 1 262 ? -16.176 19.544  -34.812 1.00 35.81  ? 240  ILE A C   1 
ATOM   1560 O  O   . ILE A 1 262 ? -16.984 19.136  -35.656 1.00 35.95  ? 240  ILE A O   1 
ATOM   1561 C  CB  . ILE A 1 262 ? -14.335 18.124  -33.848 1.00 32.80  ? 240  ILE A CB  1 
ATOM   1562 C  CG1 . ILE A 1 262 ? -12.967 17.543  -34.172 1.00 31.40  ? 240  ILE A CG1 1 
ATOM   1563 C  CG2 . ILE A 1 262 ? -15.383 17.015  -33.766 1.00 33.94  ? 240  ILE A CG2 1 
ATOM   1564 C  CD1 . ILE A 1 262 ? -12.410 16.626  -33.098 1.00 31.36  ? 240  ILE A CD1 1 
ATOM   1565 N  N   . LEU A 1 263 ? -16.532 20.336  -33.809 1.00 36.94  ? 241  LEU A N   1 
ATOM   1566 C  CA  . LEU A 1 263 ? -17.921 20.821  -33.692 1.00 38.92  ? 241  LEU A CA  1 
ATOM   1567 C  C   . LEU A 1 263 ? -18.364 21.719  -34.850 1.00 40.41  ? 241  LEU A C   1 
ATOM   1568 O  O   . LEU A 1 263 ? -19.459 21.550  -35.371 1.00 41.33  ? 241  LEU A O   1 
ATOM   1569 C  CB  . LEU A 1 263 ? -18.115 21.574  -32.375 1.00 39.52  ? 241  LEU A CB  1 
ATOM   1570 C  CG  . LEU A 1 263 ? -18.119 20.685  -31.130 1.00 40.23  ? 241  LEU A CG  1 
ATOM   1571 C  CD1 . LEU A 1 263 ? -17.943 21.517  -29.869 1.00 41.23  ? 241  LEU A CD1 1 
ATOM   1572 C  CD2 . LEU A 1 263 ? -19.396 19.864  -31.027 1.00 41.73  ? 241  LEU A CD2 1 
ATOM   1573 N  N   . GLN A 1 264 ? -17.547 22.698  -35.229 1.00 41.35  ? 242  GLN A N   1 
ATOM   1574 C  CA  . GLN A 1 264 ? -17.865 23.533  -36.404 1.00 44.01  ? 242  GLN A CA  1 
ATOM   1575 C  C   . GLN A 1 264 ? -18.046 22.638  -37.615 1.00 41.02  ? 242  GLN A C   1 
ATOM   1576 O  O   . GLN A 1 264 ? -18.997 22.781  -38.365 1.00 40.86  ? 242  GLN A O   1 
ATOM   1577 C  CB  . GLN A 1 264 ? -16.733 24.501  -36.760 1.00 48.24  ? 242  GLN A CB  1 
ATOM   1578 C  CG  . GLN A 1 264 ? -16.447 25.647  -35.805 1.00 55.46  ? 242  GLN A CG  1 
ATOM   1579 C  CD  . GLN A 1 264 ? -15.243 26.473  -36.291 1.00 62.37  ? 242  GLN A CD  1 
ATOM   1580 O  OE1 . GLN A 1 264 ? -15.293 27.064  -37.373 1.00 67.60  ? 242  GLN A OE1 1 
ATOM   1581 N  NE2 . GLN A 1 264 ? -14.153 26.494  -35.513 1.00 62.69  ? 242  GLN A NE2 1 
ATOM   1582 N  N   . GLN A 1 265 ? -17.098 21.727  -37.823 1.00 38.17  ? 243  GLN A N   1 
ATOM   1583 C  CA  . GLN A 1 265 ? -17.148 20.859  -38.996 1.00 38.48  ? 243  GLN A CA  1 
ATOM   1584 C  C   . GLN A 1 265 ? -18.366 19.932  -39.018 1.00 40.42  ? 243  GLN A C   1 
ATOM   1585 O  O   . GLN A 1 265 ? -18.912 19.688  -40.099 1.00 42.12  ? 243  GLN A O   1 
ATOM   1586 C  CB  . GLN A 1 265 ? -15.847 20.083  -39.186 1.00 37.11  ? 243  GLN A CB  1 
ATOM   1587 C  CG  . GLN A 1 265 ? -14.704 20.983  -39.626 1.00 36.34  ? 243  GLN A CG  1 
ATOM   1588 C  CD  . GLN A 1 265 ? -13.359 20.300  -39.561 1.00 34.88  ? 243  GLN A CD  1 
ATOM   1589 O  OE1 . GLN A 1 265 ? -13.018 19.627  -38.575 1.00 33.85  ? 243  GLN A OE1 1 
ATOM   1590 N  NE2 . GLN A 1 265 ? -12.569 20.481  -40.609 1.00 35.94  ? 243  GLN A NE2 1 
ATOM   1591 N  N   . CYS A 1 266 ? -18.829 19.478  -37.849 1.00 39.16  ? 244  CYS A N   1 
ATOM   1592 C  CA  . CYS A 1 266 ? -20.005 18.592  -37.762 1.00 41.11  ? 244  CYS A CA  1 
ATOM   1593 C  C   . CYS A 1 266 ? -21.326 19.312  -37.566 1.00 43.42  ? 244  CYS A C   1 
ATOM   1594 O  O   . CYS A 1 266 ? -22.341 18.676  -37.281 1.00 42.12  ? 244  CYS A O   1 
ATOM   1595 C  CB  . CYS A 1 266 ? -19.819 17.599  -36.616 1.00 40.76  ? 244  CYS A CB  1 
ATOM   1596 S  SG  . CYS A 1 266 ? -18.439 16.468  -36.894 1.00 41.07  ? 244  CYS A SG  1 
ATOM   1597 N  N   . ASP A 1 267 ? -21.313 20.637  -37.657 1.00 44.91  ? 245  ASP A N   1 
ATOM   1598 C  CA  . ASP A 1 267 ? -22.512 21.423  -37.384 1.00 48.10  ? 245  ASP A CA  1 
ATOM   1599 C  C   . ASP A 1 267 ? -23.065 21.121  -35.988 1.00 48.25  ? 245  ASP A C   1 
ATOM   1600 O  O   . ASP A 1 267 ? -24.278 21.089  -35.784 1.00 49.27  ? 245  ASP A O   1 
ATOM   1601 C  CB  . ASP A 1 267 ? -23.583 21.155  -38.443 1.00 51.80  ? 245  ASP A CB  1 
ATOM   1602 C  CG  . ASP A 1 267 ? -23.259 21.803  -39.775 1.00 53.69  ? 245  ASP A CG  1 
ATOM   1603 O  OD1 . ASP A 1 267 ? -22.370 22.679  -39.811 1.00 53.19  ? 245  ASP A OD1 1 
ATOM   1604 O  OD2 . ASP A 1 267 ? -23.893 21.435  -40.786 1.00 59.00  ? 245  ASP A OD2 1 
ATOM   1605 N  N   . GLY A 1 268 ? -22.163 20.902  -35.035 1.00 46.73  ? 246  GLY A N   1 
ATOM   1606 C  CA  . GLY A 1 268 ? -22.530 20.598  -33.659 1.00 47.71  ? 246  GLY A CA  1 
ATOM   1607 C  C   . GLY A 1 268 ? -23.142 19.226  -33.425 1.00 49.32  ? 246  GLY A C   1 
ATOM   1608 O  O   . GLY A 1 268 ? -23.638 18.957  -32.334 1.00 51.26  ? 246  GLY A O   1 
ATOM   1609 N  N   . LYS A 1 269 ? -23.114 18.353  -34.423 1.00 48.66  ? 247  LYS A N   1 
ATOM   1610 C  CA  . LYS A 1 269 ? -23.791 17.074  -34.322 1.00 50.63  ? 247  LYS A CA  1 
ATOM   1611 C  C   . LYS A 1 269 ? -22.839 15.914  -34.511 1.00 47.94  ? 247  LYS A C   1 
ATOM   1612 O  O   . LYS A 1 269 ? -22.373 15.676  -35.624 1.00 46.56  ? 247  LYS A O   1 
ATOM   1613 C  CB  . LYS A 1 269 ? -24.890 16.984  -35.369 1.00 55.69  ? 247  LYS A CB  1 
ATOM   1614 C  CG  . LYS A 1 269 ? -25.971 18.042  -35.219 1.00 61.21  ? 247  LYS A CG  1 
ATOM   1615 C  CD  . LYS A 1 269 ? -27.154 17.785  -36.144 1.00 68.17  ? 247  LYS A CD  1 
ATOM   1616 C  CE  . LYS A 1 269 ? -26.798 17.872  -37.632 1.00 71.49  ? 247  LYS A CE  1 
ATOM   1617 N  NZ  . LYS A 1 269 ? -26.725 19.267  -38.160 1.00 74.24  ? 247  LYS A NZ  1 
ATOM   1618 N  N   . LEU A 1 270 ? -22.530 15.210  -33.424 1.00 46.48  ? 248  LEU A N   1 
ATOM   1619 C  CA  . LEU A 1 270 ? -21.830 13.915  -33.507 1.00 44.86  ? 248  LEU A CA  1 
ATOM   1620 C  C   . LEU A 1 270 ? -22.199 13.010  -32.341 1.00 43.35  ? 248  LEU A C   1 
ATOM   1621 O  O   . LEU A 1 270 ? -22.620 13.500  -31.294 1.00 44.13  ? 248  LEU A O   1 
ATOM   1622 C  CB  . LEU A 1 270 ? -20.303 14.066  -33.619 1.00 44.86  ? 248  LEU A CB  1 
ATOM   1623 C  CG  . LEU A 1 270 ? -19.488 14.619  -32.462 1.00 44.44  ? 248  LEU A CG  1 
ATOM   1624 C  CD1 . LEU A 1 270 ? -18.123 13.999  -32.457 1.00 42.65  ? 248  LEU A CD1 1 
ATOM   1625 C  CD2 . LEU A 1 270 ? -19.358 16.126  -32.575 1.00 46.74  ? 248  LEU A CD2 1 
ATOM   1626 N  N   . ASP A 1 271 ? -22.060 11.696  -32.537 1.00 39.71  ? 249  ASP A N   1 
ATOM   1627 C  CA  . ASP A 1 271 ? -22.498 10.710  -31.544 1.00 38.70  ? 249  ASP A CA  1 
ATOM   1628 C  C   . ASP A 1 271 ? -21.356 9.960   -30.875 1.00 36.53  ? 249  ASP A C   1 
ATOM   1629 O  O   . ASP A 1 271 ? -21.536 9.424   -29.791 1.00 35.27  ? 249  ASP A O   1 
ATOM   1630 C  CB  . ASP A 1 271 ? -23.507 9.732   -32.149 1.00 40.16  ? 249  ASP A CB  1 
ATOM   1631 C  CG  . ASP A 1 271 ? -24.694 10.447  -32.772 1.00 42.26  ? 249  ASP A CG  1 
ATOM   1632 O  OD1 . ASP A 1 271 ? -24.585 10.834  -33.960 1.00 41.88  ? 249  ASP A OD1 1 
ATOM   1633 O  OD2 . ASP A 1 271 ? -25.720 10.652  -32.073 1.00 41.81  ? 249  ASP A OD2 1 
ATOM   1634 N  N   . MET A 1 272 ? -20.169 9.922   -31.489 1.00 34.70  ? 250  MET A N   1 
ATOM   1635 C  CA  . MET A 1 272 ? -19.079 9.187   -30.912 1.00 33.31  ? 250  MET A CA  1 
ATOM   1636 C  C   . MET A 1 272 ? -17.790 9.791   -31.395 1.00 33.32  ? 250  MET A C   1 
ATOM   1637 O  O   . MET A 1 272 ? -17.691 10.251  -32.537 1.00 31.96  ? 250  MET A O   1 
ATOM   1638 C  CB  . MET A 1 272 ? -19.165 7.728   -31.344 1.00 35.09  ? 250  MET A CB  1 
ATOM   1639 C  CG  . MET A 1 272 ? -18.069 6.826   -30.801 1.00 33.59  ? 250  MET A CG  1 
ATOM   1640 S  SD  . MET A 1 272 ? -18.410 5.110   -31.202 1.00 36.53  ? 250  MET A SD  1 
ATOM   1641 C  CE  . MET A 1 272 ? -19.776 4.792   -30.093 1.00 37.36  ? 250  MET A CE  1 
ATOM   1642 N  N   . LEU A 1 273 ? -16.811 9.805   -30.508 1.00 32.63  ? 251  LEU A N   1 
ATOM   1643 C  CA  . LEU A 1 273 ? -15.491 10.274  -30.839 1.00 32.22  ? 251  LEU A CA  1 
ATOM   1644 C  C   . LEU A 1 273 ? -14.527 9.201   -30.393 1.00 31.20  ? 251  LEU A C   1 
ATOM   1645 O  O   . LEU A 1 273 ? -14.567 8.784   -29.236 1.00 32.11  ? 251  LEU A O   1 
ATOM   1646 C  CB  . LEU A 1 273 ? -15.155 11.571  -30.132 1.00 32.74  ? 251  LEU A CB  1 
ATOM   1647 C  CG  . LEU A 1 273 ? -13.736 11.912  -30.620 1.00 34.38  ? 251  LEU A CG  1 
ATOM   1648 C  CD1 . LEU A 1 273 ? -13.701 13.074  -31.604 1.00 34.29  ? 251  LEU A CD1 1 
ATOM   1649 C  CD2 . LEU A 1 273 ? -12.790 12.073  -29.449 1.00 35.05  ? 251  LEU A CD2 1 
ATOM   1650 N  N   . VAL A 1 274 ? -13.673 8.746   -31.299 1.00 28.74  ? 252  VAL A N   1 
ATOM   1651 C  CA  . VAL A 1 274 ? -12.719 7.691   -30.978 1.00 28.47  ? 252  VAL A CA  1 
ATOM   1652 C  C   . VAL A 1 274 ? -11.316 8.270   -31.148 1.00 27.99  ? 252  VAL A C   1 
ATOM   1653 O  O   . VAL A 1 274 ? -10.991 8.850   -32.183 1.00 27.04  ? 252  VAL A O   1 
ATOM   1654 C  CB  . VAL A 1 274 ? -12.881 6.462   -31.899 1.00 28.64  ? 252  VAL A CB  1 
ATOM   1655 C  CG1 . VAL A 1 274 ? -12.029 5.302   -31.402 1.00 27.89  ? 252  VAL A CG1 1 
ATOM   1656 C  CG2 . VAL A 1 274 ? -14.326 6.028   -32.004 1.00 31.14  ? 252  VAL A CG2 1 
ATOM   1657 N  N   . ALA A 1 275 ? -10.499 8.142   -30.111 1.00 28.30  ? 253  ALA A N   1 
ATOM   1658 C  CA  . ALA A 1 275 ? -9.166  8.688   -30.133 1.00 27.29  ? 253  ALA A CA  1 
ATOM   1659 C  C   . ALA A 1 275 ? -8.224  7.749   -29.411 1.00 27.22  ? 253  ALA A C   1 
ATOM   1660 O  O   . ALA A 1 275 ? -8.550  7.243   -28.317 1.00 26.41  ? 253  ALA A O   1 
ATOM   1661 C  CB  . ALA A 1 275 ? -9.149  10.074  -29.482 1.00 27.49  ? 253  ALA A CB  1 
ATOM   1662 N  N   . SER A 1 276 ? -7.072  7.492   -30.024 1.00 25.51  ? 254  SER A N   1 
ATOM   1663 C  CA  . SER A 1 276 ? -5.992  6.785   -29.345 1.00 25.27  ? 254  SER A CA  1 
ATOM   1664 C  C   . SER A 1 276 ? -5.281  7.698   -28.351 1.00 24.74  ? 254  SER A C   1 
ATOM   1665 O  O   . SER A 1 276 ? -5.336  8.919   -28.447 1.00 24.33  ? 254  SER A O   1 
ATOM   1666 C  CB  . SER A 1 276 ? -4.997  6.184   -30.350 1.00 26.71  ? 254  SER A CB  1 
ATOM   1667 O  OG  . SER A 1 276 ? -4.411  7.198   -31.144 1.00 27.40  ? 254  SER A OG  1 
ATOM   1668 N  N   . VAL A 1 277 ? -4.630  7.077   -27.378 1.00 24.65  ? 255  VAL A N   1 
ATOM   1669 C  CA  . VAL A 1 277 ? -4.161  7.791   -26.202 1.00 25.08  ? 255  VAL A CA  1 
ATOM   1670 C  C   . VAL A 1 277 ? -2.694  7.534   -25.893 1.00 23.77  ? 255  VAL A C   1 
ATOM   1671 O  O   . VAL A 1 277 ? -2.263  6.389   -25.759 1.00 24.94  ? 255  VAL A O   1 
ATOM   1672 C  CB  . VAL A 1 277 ? -4.996  7.415   -24.976 1.00 25.12  ? 255  VAL A CB  1 
ATOM   1673 C  CG1 . VAL A 1 277 ? -4.713  8.365   -23.817 1.00 25.84  ? 255  VAL A CG1 1 
ATOM   1674 C  CG2 . VAL A 1 277 ? -6.475  7.450   -25.325 1.00 26.84  ? 255  VAL A CG2 1 
ATOM   1675 N  N   . GLY A 1 278 ? -1.974  8.629   -25.742 1.00 23.51  ? 256  GLY A N   1 
ATOM   1676 C  CA  . GLY A 1 278 ? -0.581  8.644   -25.344 1.00 24.52  ? 256  GLY A CA  1 
ATOM   1677 C  C   . GLY A 1 278 ? -0.458  9.537   -24.146 1.00 24.64  ? 256  GLY A C   1 
ATOM   1678 O  O   . GLY A 1 278 ? -0.648  9.073   -23.027 1.00 26.06  ? 256  GLY A O   1 
ATOM   1679 N  N   . THR A 1 279 ? -0.156  10.816  -24.350 1.00 25.11  ? 257  THR A N   1 
ATOM   1680 C  CA  . THR A 1 279 ? -0.195  11.754  -23.218 1.00 25.43  ? 257  THR A CA  1 
ATOM   1681 C  C   . THR A 1 279 ? -1.613  11.874  -22.633 1.00 25.54  ? 257  THR A C   1 
ATOM   1682 O  O   . THR A 1 279 ? -1.774  12.191  -21.468 1.00 25.62  ? 257  THR A O   1 
ATOM   1683 C  CB  . THR A 1 279 ? 0.273   13.171  -23.582 1.00 26.33  ? 257  THR A CB  1 
ATOM   1684 O  OG1 . THR A 1 279 ? -0.668  13.807  -24.460 1.00 25.51  ? 257  THR A OG1 1 
ATOM   1685 C  CG2 . THR A 1 279 ? 1.698   13.171  -24.248 1.00 27.20  ? 257  THR A CG2 1 
ATOM   1686 N  N   . GLY A 1 280 ? -2.631  11.679  -23.461 1.00 24.50  ? 258  GLY A N   1 
ATOM   1687 C  CA  . GLY A 1 280 ? -4.004  11.908  -23.052 1.00 25.14  ? 258  GLY A CA  1 
ATOM   1688 C  C   . GLY A 1 280 ? -4.501  13.315  -23.347 1.00 25.85  ? 258  GLY A C   1 
ATOM   1689 O  O   . GLY A 1 280 ? -5.684  13.605  -23.111 1.00 25.28  ? 258  GLY A O   1 
ATOM   1690 N  N   . GLY A 1 281 ? -3.632  14.174  -23.891 1.00 25.51  ? 259  GLY A N   1 
ATOM   1691 C  CA  . GLY A 1 281 ? -3.998  15.568  -24.175 1.00 25.66  ? 259  GLY A CA  1 
ATOM   1692 C  C   . GLY A 1 281 ? -5.136  15.702  -25.188 1.00 26.58  ? 259  GLY A C   1 
ATOM   1693 O  O   . GLY A 1 281 ? -6.048  16.495  -24.991 1.00 26.38  ? 259  GLY A O   1 
ATOM   1694 N  N   . THR A 1 282 ? -5.079  14.905  -26.260 1.00 25.78  ? 260  THR A N   1 
ATOM   1695 C  CA  . THR A 1 282 ? -6.070  14.941  -27.320 1.00 25.90  ? 260  THR A CA  1 
ATOM   1696 C  C   . THR A 1 282 ? -7.445  14.512  -26.793 1.00 26.65  ? 260  THR A C   1 
ATOM   1697 O  O   . THR A 1 282 ? -8.409  15.287  -26.861 1.00 27.03  ? 260  THR A O   1 
ATOM   1698 C  CB  . THR A 1 282 ? -5.642  14.082  -28.530 1.00 27.17  ? 260  THR A CB  1 
ATOM   1699 O  OG1 . THR A 1 282 ? -4.379  14.549  -29.028 1.00 24.96  ? 260  THR A OG1 1 
ATOM   1700 C  CG2 . THR A 1 282 ? -6.651  14.168  -29.644 1.00 27.90  ? 260  THR A CG2 1 
ATOM   1701 N  N   . ILE A 1 283 ? -7.528  13.323  -26.218 1.00 25.26  ? 261  ILE A N   1 
ATOM   1702 C  CA  . ILE A 1 283 ? -8.807  12.820  -25.765 1.00 27.31  ? 261  ILE A CA  1 
ATOM   1703 C  C   . ILE A 1 283 ? -9.357  13.682  -24.630 1.00 27.85  ? 261  ILE A C   1 
ATOM   1704 O  O   . ILE A 1 283 ? -10.553 13.927  -24.587 1.00 28.43  ? 261  ILE A O   1 
ATOM   1705 C  CB  . ILE A 1 283 ? -8.757  11.320  -25.360 1.00 27.63  ? 261  ILE A CB  1 
ATOM   1706 C  CG1 . ILE A 1 283 ? -10.173 10.747  -25.290 1.00 29.66  ? 261  ILE A CG1 1 
ATOM   1707 C  CG2 . ILE A 1 283 ? -8.063  11.116  -24.033 1.00 27.97  ? 261  ILE A CG2 1 
ATOM   1708 C  CD1 . ILE A 1 283 ? -10.218 9.251   -25.458 1.00 31.16  ? 261  ILE A CD1 1 
ATOM   1709 N  N   . THR A 1 284 ? -8.490  14.170  -23.737 1.00 27.26  ? 262  THR A N   1 
ATOM   1710 C  CA  . THR A 1 284 ? -8.949  14.915  -22.568 1.00 28.67  ? 262  THR A CA  1 
ATOM   1711 C  C   . THR A 1 284 ? -9.490  16.287  -23.006 1.00 29.45  ? 262  THR A C   1 
ATOM   1712 O  O   . THR A 1 284 ? -10.590 16.683  -22.613 1.00 27.73  ? 262  THR A O   1 
ATOM   1713 C  CB  . THR A 1 284 ? -7.824  15.103  -21.541 1.00 28.43  ? 262  THR A CB  1 
ATOM   1714 O  OG1 . THR A 1 284 ? -7.415  13.823  -21.076 1.00 28.96  ? 262  THR A OG1 1 
ATOM   1715 C  CG2 . THR A 1 284 ? -8.267  15.952  -20.381 1.00 31.29  ? 262  THR A CG2 1 
ATOM   1716 N  N   . GLY A 1 285 ? -8.712  16.990  -23.836 1.00 27.28  ? 263  GLY A N   1 
ATOM   1717 C  CA  . GLY A 1 285 ? -9.127  18.297  -24.318 1.00 28.24  ? 263  GLY A CA  1 
ATOM   1718 C  C   . GLY A 1 285 ? -10.406 18.224  -25.132 1.00 29.44  ? 263  GLY A C   1 
ATOM   1719 O  O   . GLY A 1 285 ? -11.344 19.014  -24.927 1.00 29.23  ? 263  GLY A O   1 
ATOM   1720 N  N   . ILE A 1 286 ? -10.467 17.253  -26.038 1.00 28.13  ? 264  ILE A N   1 
ATOM   1721 C  CA  . ILE A 1 286 ? -11.661 17.108  -26.879 1.00 29.11  ? 264  ILE A CA  1 
ATOM   1722 C  C   . ILE A 1 286 ? -12.874 16.733  -26.039 1.00 30.10  ? 264  ILE A C   1 
ATOM   1723 O  O   . ILE A 1 286 ? -13.934 17.336  -26.201 1.00 29.74  ? 264  ILE A O   1 
ATOM   1724 C  CB  . ILE A 1 286 ? -11.466 16.086  -28.003 1.00 28.73  ? 264  ILE A CB  1 
ATOM   1725 C  CG1 . ILE A 1 286 ? -10.387 16.593  -28.976 1.00 29.37  ? 264  ILE A CG1 1 
ATOM   1726 C  CG2 . ILE A 1 286 ? -12.770 15.879  -28.741 1.00 30.28  ? 264  ILE A CG2 1 
ATOM   1727 C  CD1 . ILE A 1 286 ? -9.979  15.616  -30.044 1.00 28.91  ? 264  ILE A CD1 1 
ATOM   1728 N  N   . ALA A 1 287 ? -12.705 15.733  -25.170 1.00 30.04  ? 265  ALA A N   1 
ATOM   1729 C  CA  . ALA A 1 287 ? -13.803 15.195  -24.346 1.00 31.15  ? 265  ALA A CA  1 
ATOM   1730 C  C   . ALA A 1 287 ? -14.344 16.207  -23.358 1.00 33.80  ? 265  ALA A C   1 
ATOM   1731 O  O   . ALA A 1 287 ? -15.570 16.272  -23.165 1.00 33.93  ? 265  ALA A O   1 
ATOM   1732 C  CB  . ALA A 1 287 ? -13.395 13.922  -23.626 1.00 30.23  ? 265  ALA A CB  1 
ATOM   1733 N  N   . ARG A 1 288 ? -13.468 17.006  -22.734 1.00 32.76  ? 266  ARG A N   1 
ATOM   1734 C  CA  . ARG A 1 288 ? -13.968 18.059  -21.831 1.00 33.64  ? 266  ARG A CA  1 
ATOM   1735 C  C   . ARG A 1 288 ? -14.848 19.067  -22.574 1.00 34.57  ? 266  ARG A C   1 
ATOM   1736 O  O   . ARG A 1 288 ? -15.908 19.467  -22.071 1.00 36.04  ? 266  ARG A O   1 
ATOM   1737 C  CB  . ARG A 1 288 ? -12.834 18.762  -21.073 1.00 33.35  ? 266  ARG A CB  1 
ATOM   1738 C  CG  . ARG A 1 288 ? -12.237 17.932  -19.942 1.00 32.79  ? 266  ARG A CG  1 
ATOM   1739 C  CD  . ARG A 1 288 ? -11.185 18.690  -19.139 1.00 32.61  ? 266  ARG A CD  1 
ATOM   1740 N  NE  . ARG A 1 288 ? -10.797 17.961  -17.931 1.00 32.70  ? 266  ARG A NE  1 
ATOM   1741 C  CZ  . ARG A 1 288 ? -10.078 18.464  -16.921 1.00 34.93  ? 266  ARG A CZ  1 
ATOM   1742 N  NH1 . ARG A 1 288 ? -9.620  19.711  -16.966 1.00 35.62  ? 266  ARG A NH1 1 
ATOM   1743 N  NH2 . ARG A 1 288 ? -9.825  17.721  -15.837 1.00 34.67  ? 266  ARG A NH2 1 
ATOM   1744 N  N   . LYS A 1 289 ? -14.436 19.464  -23.775 1.00 33.70  ? 267  LYS A N   1 
ATOM   1745 C  CA  . LYS A 1 289 ? -15.248 20.375  -24.586 1.00 35.22  ? 267  LYS A CA  1 
ATOM   1746 C  C   . LYS A 1 289 ? -16.531 19.710  -25.076 1.00 36.28  ? 267  LYS A C   1 
ATOM   1747 O  O   . LYS A 1 289 ? -17.619 20.274  -24.942 1.00 37.54  ? 267  LYS A O   1 
ATOM   1748 C  CB  . LYS A 1 289 ? -14.448 20.949  -25.756 1.00 34.09  ? 267  LYS A CB  1 
ATOM   1749 C  CG  . LYS A 1 289 ? -15.191 21.960  -26.632 1.00 35.90  ? 267  LYS A CG  1 
ATOM   1750 C  CD  . LYS A 1 289 ? -15.717 23.178  -25.897 1.00 37.91  ? 267  LYS A CD  1 
ATOM   1751 C  CE  . LYS A 1 289 ? -14.622 24.087  -25.361 1.00 37.20  ? 267  LYS A CE  1 
ATOM   1752 N  NZ  . LYS A 1 289 ? -13.840 24.794  -26.402 1.00 35.96  ? 267  LYS A NZ  1 
ATOM   1753 N  N   . LEU A 1 290 ? -16.427 18.503  -25.604 1.00 35.70  ? 268  LEU A N   1 
ATOM   1754 C  CA  . LEU A 1 290 ? -17.618 17.803  -26.104 1.00 38.79  ? 268  LEU A CA  1 
ATOM   1755 C  C   . LEU A 1 290 ? -18.653 17.502  -25.008 1.00 40.88  ? 268  LEU A C   1 
ATOM   1756 O  O   . LEU A 1 290 ? -19.842 17.731  -25.196 1.00 41.96  ? 268  LEU A O   1 
ATOM   1757 C  CB  . LEU A 1 290 ? -17.237 16.511  -26.846 1.00 38.87  ? 268  LEU A CB  1 
ATOM   1758 C  CG  . LEU A 1 290 ? -16.483 16.691  -28.165 1.00 38.60  ? 268  LEU A CG  1 
ATOM   1759 C  CD1 . LEU A 1 290 ? -16.322 15.358  -28.884 1.00 39.57  ? 268  LEU A CD1 1 
ATOM   1760 C  CD2 . LEU A 1 290 ? -17.148 17.671  -29.093 1.00 41.01  ? 268  LEU A CD2 1 
ATOM   1761 N  N   . LYS A 1 291 ? -18.200 17.017  -23.858 1.00 41.51  ? 269  LYS A N   1 
ATOM   1762 C  CA  . LYS A 1 291 ? -19.095 16.767  -22.734 1.00 42.97  ? 269  LYS A CA  1 
ATOM   1763 C  C   . LYS A 1 291 ? -19.873 18.023  -22.352 1.00 43.54  ? 269  LYS A C   1 
ATOM   1764 O  O   . LYS A 1 291 ? -21.029 17.934  -21.945 1.00 42.50  ? 269  LYS A O   1 
ATOM   1765 C  CB  . LYS A 1 291 ? -18.318 16.239  -21.531 1.00 44.35  ? 269  LYS A CB  1 
ATOM   1766 C  CG  . LYS A 1 291 ? -17.830 14.805  -21.704 1.00 45.26  ? 269  LYS A CG  1 
ATOM   1767 C  CD  . LYS A 1 291 ? -18.914 13.791  -21.406 1.00 48.99  ? 269  LYS A CD  1 
ATOM   1768 C  CE  . LYS A 1 291 ? -18.467 12.405  -21.848 1.00 51.07  ? 269  LYS A CE  1 
ATOM   1769 N  NZ  . LYS A 1 291 ? -19.090 11.386  -20.975 1.00 53.66  ? 269  LYS A NZ  1 
ATOM   1770 N  N   . GLU A 1 292 ? -19.238 19.182  -22.504 1.00 42.44  ? 270  GLU A N   1 
ATOM   1771 C  CA  . GLU A 1 292 ? -19.903 20.462  -22.269 1.00 45.30  ? 270  GLU A CA  1 
ATOM   1772 C  C   . GLU A 1 292 ? -20.858 20.842  -23.413 1.00 45.51  ? 270  GLU A C   1 
ATOM   1773 O  O   . GLU A 1 292 ? -21.945 21.294  -23.161 1.00 46.00  ? 270  GLU A O   1 
ATOM   1774 C  CB  . GLU A 1 292 ? -18.862 21.573  -22.023 1.00 43.82  ? 270  GLU A CB  1 
ATOM   1775 C  CG  . GLU A 1 292 ? -18.161 21.430  -20.685 1.00 43.73  ? 270  GLU A CG  1 
ATOM   1776 C  CD  . GLU A 1 292 ? -16.928 22.311  -20.506 1.00 42.98  ? 270  GLU A CD  1 
ATOM   1777 O  OE1 . GLU A 1 292 ? -16.396 22.872  -21.499 1.00 41.71  ? 270  GLU A OE1 1 
ATOM   1778 O  OE2 . GLU A 1 292 ? -16.481 22.426  -19.344 1.00 41.59  ? 270  GLU A OE2 1 
ATOM   1779 N  N   . LYS A 1 293 ? -20.459 20.655  -24.664 1.00 46.49  ? 271  LYS A N   1 
ATOM   1780 C  CA  . LYS A 1 293 ? -21.257 21.177  -25.767 1.00 50.78  ? 271  LYS A CA  1 
ATOM   1781 C  C   . LYS A 1 293 ? -22.126 20.153  -26.492 1.00 50.94  ? 271  LYS A C   1 
ATOM   1782 O  O   . LYS A 1 293 ? -23.102 20.517  -27.127 1.00 49.25  ? 271  LYS A O   1 
ATOM   1783 C  CB  . LYS A 1 293 ? -20.361 21.946  -26.737 1.00 53.64  ? 271  LYS A CB  1 
ATOM   1784 C  CG  . LYS A 1 293 ? -19.646 23.108  -26.051 1.00 59.20  ? 271  LYS A CG  1 
ATOM   1785 C  CD  . LYS A 1 293 ? -19.595 24.389  -26.877 1.00 65.34  ? 271  LYS A CD  1 
ATOM   1786 C  CE  . LYS A 1 293 ? -18.830 24.168  -28.173 1.00 69.58  ? 271  LYS A CE  1 
ATOM   1787 N  NZ  . LYS A 1 293 ? -18.251 25.404  -28.790 1.00 75.36  ? 271  LYS A NZ  1 
ATOM   1788 N  N   . CYS A 1 294 ? -21.782 18.878  -26.364 1.00 50.53  ? 272  CYS A N   1 
ATOM   1789 C  CA  . CYS A 1 294 ? -22.445 17.812  -27.091 1.00 51.51  ? 272  CYS A CA  1 
ATOM   1790 C  C   . CYS A 1 294 ? -22.488 16.591  -26.162 1.00 49.32  ? 272  CYS A C   1 
ATOM   1791 O  O   . CYS A 1 294 ? -21.841 15.577  -26.423 1.00 48.27  ? 272  CYS A O   1 
ATOM   1792 C  CB  . CYS A 1 294 ? -21.664 17.526  -28.381 1.00 51.90  ? 272  CYS A CB  1 
ATOM   1793 S  SG  . CYS A 1 294 ? -22.522 16.451  -29.542 1.00 58.50  ? 272  CYS A SG  1 
ATOM   1794 N  N   . PRO A 1 295 ? -23.233 16.699  -25.056 1.00 53.82  ? 273  PRO A N   1 
ATOM   1795 C  CA  . PRO A 1 295 ? -23.184 15.729  -23.958 1.00 53.99  ? 273  PRO A CA  1 
ATOM   1796 C  C   . PRO A 1 295 ? -23.642 14.320  -24.335 1.00 54.09  ? 273  PRO A C   1 
ATOM   1797 O  O   . PRO A 1 295 ? -23.290 13.358  -23.645 1.00 53.29  ? 273  PRO A O   1 
ATOM   1798 C  CB  . PRO A 1 295 ? -24.127 16.329  -22.917 1.00 56.10  ? 273  PRO A CB  1 
ATOM   1799 C  CG  . PRO A 1 295 ? -25.071 17.161  -23.704 1.00 58.07  ? 273  PRO A CG  1 
ATOM   1800 C  CD  . PRO A 1 295 ? -24.238 17.745  -24.805 1.00 56.60  ? 273  PRO A CD  1 
ATOM   1801 N  N   . GLY A 1 296 ? -24.409 14.201  -25.417 1.00 53.24  ? 274  GLY A N   1 
ATOM   1802 C  CA  . GLY A 1 296 ? -24.717 12.899  -25.976 1.00 52.39  ? 274  GLY A CA  1 
ATOM   1803 C  C   . GLY A 1 296 ? -23.529 12.130  -26.536 1.00 49.94  ? 274  GLY A C   1 
ATOM   1804 O  O   . GLY A 1 296 ? -23.581 10.902  -26.617 1.00 49.88  ? 274  GLY A O   1 
ATOM   1805 N  N   . CYS A 1 297 ? -22.460 12.833  -26.915 1.00 45.36  ? 275  CYS A N   1 
ATOM   1806 C  CA  . CYS A 1 297 ? -21.342 12.213  -27.605 1.00 44.37  ? 275  CYS A CA  1 
ATOM   1807 C  C   . CYS A 1 297 ? -20.553 11.216  -26.740 1.00 41.55  ? 275  CYS A C   1 
ATOM   1808 O  O   . CYS A 1 297 ? -20.035 11.565  -25.699 1.00 40.52  ? 275  CYS A O   1 
ATOM   1809 C  CB  . CYS A 1 297 ? -20.402 13.292  -28.136 1.00 43.77  ? 275  CYS A CB  1 
ATOM   1810 S  SG  . CYS A 1 297 ? -19.108 12.625  -29.199 1.00 45.69  ? 275  CYS A SG  1 
ATOM   1811 N  N   . ARG A 1 298 ? -20.479 9.974   -27.192 1.00 41.39  ? 276  ARG A N   1 
ATOM   1812 C  CA  . ARG A 1 298 ? -19.721 8.922   -26.516 1.00 41.33  ? 276  ARG A CA  1 
ATOM   1813 C  C   . ARG A 1 298 ? -18.210 9.079   -26.755 1.00 37.44  ? 276  ARG A C   1 
ATOM   1814 O  O   . ARG A 1 298 ? -17.762 9.166   -27.895 1.00 36.72  ? 276  ARG A O   1 
ATOM   1815 C  CB  . ARG A 1 298 ? -20.194 7.558   -27.026 1.00 44.75  ? 276  ARG A CB  1 
ATOM   1816 C  CG  . ARG A 1 298 ? -21.600 7.174   -26.562 1.00 51.61  ? 276  ARG A CG  1 
ATOM   1817 C  CD  . ARG A 1 298 ? -21.527 6.187   -25.413 1.00 55.75  ? 276  ARG A CD  1 
ATOM   1818 N  NE  . ARG A 1 298 ? -20.867 4.954   -25.870 1.00 61.75  ? 276  ARG A NE  1 
ATOM   1819 C  CZ  . ARG A 1 298 ? -20.454 3.956   -25.085 1.00 64.17  ? 276  ARG A CZ  1 
ATOM   1820 N  NH1 . ARG A 1 298 ? -20.616 4.016   -23.758 1.00 65.01  ? 276  ARG A NH1 1 
ATOM   1821 N  NH2 . ARG A 1 298 ? -19.884 2.886   -25.644 1.00 62.64  ? 276  ARG A NH2 1 
ATOM   1822 N  N   . ILE A 1 299 ? -17.427 9.111   -25.691 1.00 34.78  ? 277  ILE A N   1 
ATOM   1823 C  CA  . ILE A 1 299 ? -15.981 9.248   -25.814 1.00 32.97  ? 277  ILE A CA  1 
ATOM   1824 C  C   . ILE A 1 299 ? -15.323 7.864   -25.680 1.00 32.44  ? 277  ILE A C   1 
ATOM   1825 O  O   . ILE A 1 299 ? -15.403 7.231   -24.616 1.00 33.01  ? 277  ILE A O   1 
ATOM   1826 C  CB  . ILE A 1 299 ? -15.398 10.198  -24.723 1.00 32.97  ? 277  ILE A CB  1 
ATOM   1827 C  CG1 . ILE A 1 299 ? -16.077 11.564  -24.727 1.00 33.68  ? 277  ILE A CG1 1 
ATOM   1828 C  CG2 . ILE A 1 299 ? -13.899 10.365  -24.880 1.00 31.25  ? 277  ILE A CG2 1 
ATOM   1829 C  CD1 . ILE A 1 299 ? -15.967 12.330  -26.029 1.00 32.88  ? 277  ILE A CD1 1 
ATOM   1830 N  N   . ILE A 1 300 ? -14.651 7.416   -26.738 1.00 30.21  ? 278  ILE A N   1 
ATOM   1831 C  CA  . ILE A 1 300 ? -14.037 6.094   -26.795 1.00 30.14  ? 278  ILE A CA  1 
ATOM   1832 C  C   . ILE A 1 300 ? -12.516 6.267   -26.847 1.00 29.12  ? 278  ILE A C   1 
ATOM   1833 O  O   . ILE A 1 300 ? -11.988 6.950   -27.750 1.00 29.01  ? 278  ILE A O   1 
ATOM   1834 C  CB  . ILE A 1 300 ? -14.484 5.335   -28.056 1.00 30.38  ? 278  ILE A CB  1 
ATOM   1835 C  CG1 . ILE A 1 300 ? -16.005 5.280   -28.148 1.00 32.06  ? 278  ILE A CG1 1 
ATOM   1836 C  CG2 . ILE A 1 300 ? -13.880 3.938   -28.101 1.00 31.19  ? 278  ILE A CG2 1 
ATOM   1837 C  CD1 . ILE A 1 300 ? -16.712 4.668   -26.939 1.00 33.71  ? 278  ILE A CD1 1 
ATOM   1838 N  N   . GLY A 1 301 ? -11.829 5.669   -25.881 1.00 28.26  ? 279  GLY A N   1 
ATOM   1839 C  CA  . GLY A 1 301 ? -10.380 5.743   -25.772 1.00 27.38  ? 279  GLY A CA  1 
ATOM   1840 C  C   . GLY A 1 301 ? -9.728  4.455   -26.271 1.00 26.74  ? 279  GLY A C   1 
ATOM   1841 O  O   . GLY A 1 301 ? -10.234 3.349   -26.021 1.00 28.29  ? 279  GLY A O   1 
ATOM   1842 N  N   . VAL A 1 302 ? -8.620  4.592   -26.995 1.00 24.94  ? 280  VAL A N   1 
ATOM   1843 C  CA  . VAL A 1 302 ? -7.926  3.442   -27.558 1.00 25.89  ? 280  VAL A CA  1 
ATOM   1844 C  C   . VAL A 1 302 ? -6.527  3.348   -26.957 1.00 25.02  ? 280  VAL A C   1 
ATOM   1845 O  O   . VAL A 1 302 ? -5.769  4.298   -27.003 1.00 24.07  ? 280  VAL A O   1 
ATOM   1846 C  CB  . VAL A 1 302 ? -7.838  3.532   -29.100 1.00 26.03  ? 280  VAL A CB  1 
ATOM   1847 C  CG1 . VAL A 1 302 ? -7.050  2.351   -29.669 1.00 25.82  ? 280  VAL A CG1 1 
ATOM   1848 C  CG2 . VAL A 1 302 ? -9.243  3.596   -29.705 1.00 27.13  ? 280  VAL A CG2 1 
ATOM   1849 N  N   . ASP A 1 303 ? -6.205  2.183   -26.407 1.00 27.28  ? 281  ASP A N   1 
ATOM   1850 C  CA  . ASP A 1 303 ? -4.975  1.984   -25.637 1.00 27.69  ? 281  ASP A CA  1 
ATOM   1851 C  C   . ASP A 1 303 ? -4.345  0.681   -26.106 1.00 28.76  ? 281  ASP A C   1 
ATOM   1852 O  O   . ASP A 1 303 ? -5.027  -0.347  -26.138 1.00 30.01  ? 281  ASP A O   1 
ATOM   1853 C  CB  . ASP A 1 303 ? -5.333  1.881   -24.144 1.00 28.75  ? 281  ASP A CB  1 
ATOM   1854 C  CG  . ASP A 1 303 ? -4.114  1.841   -23.220 1.00 28.73  ? 281  ASP A CG  1 
ATOM   1855 O  OD1 . ASP A 1 303 ? -3.180  2.614   -23.465 1.00 27.87  ? 281  ASP A OD1 1 
ATOM   1856 O  OD2 . ASP A 1 303 ? -4.130  1.068   -22.218 1.00 30.59  ? 281  ASP A OD2 1 
ATOM   1857 N  N   . PRO A 1 304 ? -3.040  0.695   -26.430 1.00 28.06  ? 282  PRO A N   1 
ATOM   1858 C  CA  . PRO A 1 304 ? -2.418  -0.557  -26.866 1.00 28.41  ? 282  PRO A CA  1 
ATOM   1859 C  C   . PRO A 1 304 ? -2.266  -1.611  -25.759 1.00 29.55  ? 282  PRO A C   1 
ATOM   1860 O  O   . PRO A 1 304 ? -2.103  -1.267  -24.582 1.00 28.55  ? 282  PRO A O   1 
ATOM   1861 C  CB  . PRO A 1 304 ? -1.037  -0.099  -27.347 1.00 27.71  ? 282  PRO A CB  1 
ATOM   1862 C  CG  . PRO A 1 304 ? -0.759  1.115   -26.535 1.00 27.33  ? 282  PRO A CG  1 
ATOM   1863 C  CD  . PRO A 1 304 ? -2.082  1.816   -26.455 1.00 26.34  ? 282  PRO A CD  1 
ATOM   1864 N  N   . GLU A 1 305 ? -2.324  -2.885  -26.134 1.00 31.29  ? 283  GLU A N   1 
ATOM   1865 C  CA  . GLU A 1 305 ? -2.005  -3.947  -25.221 1.00 35.45  ? 283  GLU A CA  1 
ATOM   1866 C  C   . GLU A 1 305 ? -0.559  -3.762  -24.777 1.00 34.46  ? 283  GLU A C   1 
ATOM   1867 O  O   . GLU A 1 305 ? 0.304   -3.506  -25.600 1.00 31.75  ? 283  GLU A O   1 
ATOM   1868 C  CB  . GLU A 1 305 ? -2.207  -5.332  -25.869 1.00 40.92  ? 283  GLU A CB  1 
ATOM   1869 C  CG  . GLU A 1 305 ? -3.684  -5.661  -26.083 1.00 45.77  ? 283  GLU A CG  1 
ATOM   1870 C  CD  . GLU A 1 305 ? -3.940  -7.005  -26.747 1.00 51.89  ? 283  GLU A CD  1 
ATOM   1871 O  OE1 . GLU A 1 305 ? -3.012  -7.825  -26.846 1.00 56.72  ? 283  GLU A OE1 1 
ATOM   1872 O  OE2 . GLU A 1 305 ? -5.098  -7.248  -27.156 1.00 60.04  ? 283  GLU A OE2 1 
ATOM   1873 N  N   . GLY A 1 306 ? -0.336  -3.876  -23.474 1.00 34.79  ? 284  GLY A N   1 
ATOM   1874 C  CA  . GLY A 1 306 ? 0.944   -3.552  -22.852 1.00 35.87  ? 284  GLY A CA  1 
ATOM   1875 C  C   . GLY A 1 306 ? 0.948   -2.226  -22.092 1.00 33.99  ? 284  GLY A C   1 
ATOM   1876 O  O   . GLY A 1 306 ? 1.779   -2.029  -21.222 1.00 35.84  ? 284  GLY A O   1 
ATOM   1877 N  N   . SER A 1 307 ? 0.023   -1.334  -22.420 1.00 31.96  ? 285  SER A N   1 
ATOM   1878 C  CA  . SER A 1 307 ? -0.165  -0.062  -21.702 1.00 31.26  ? 285  SER A CA  1 
ATOM   1879 C  C   . SER A 1 307 ? -1.129  -0.210  -20.531 1.00 31.55  ? 285  SER A C   1 
ATOM   1880 O  O   . SER A 1 307 ? -1.914  -1.159  -20.482 1.00 31.41  ? 285  SER A O   1 
ATOM   1881 C  CB  . SER A 1 307 ? -0.702  1.011   -22.643 1.00 29.14  ? 285  SER A CB  1 
ATOM   1882 O  OG  . SER A 1 307 ? -1.048  2.198   -21.956 1.00 28.48  ? 285  SER A OG  1 
ATOM   1883 N  N   . ILE A 1 308 ? -1.064  0.733   -19.588 1.00 31.93  ? 286  ILE A N   1 
ATOM   1884 C  CA  . ILE A 1 308 ? -1.926  0.678   -18.395 1.00 33.47  ? 286  ILE A CA  1 
ATOM   1885 C  C   . ILE A 1 308 ? -2.965  1.801   -18.391 1.00 32.36  ? 286  ILE A C   1 
ATOM   1886 O  O   . ILE A 1 308 ? -3.619  2.017   -17.381 1.00 33.58  ? 286  ILE A O   1 
ATOM   1887 C  CB  . ILE A 1 308 ? -1.116  0.734   -17.085 1.00 35.25  ? 286  ILE A CB  1 
ATOM   1888 C  CG1 . ILE A 1 308 ? -0.426  2.092   -16.919 1.00 35.02  ? 286  ILE A CG1 1 
ATOM   1889 C  CG2 . ILE A 1 308 ? -0.126  -0.416  -17.025 1.00 37.70  ? 286  ILE A CG2 1 
ATOM   1890 C  CD1 . ILE A 1 308 ? -0.012  2.377   -15.497 1.00 38.30  ? 286  ILE A CD1 1 
ATOM   1891 N  N   . LEU A 1 309 ? -3.131  2.514   -19.497 1.00 31.19  ? 287  LEU A N   1 
ATOM   1892 C  CA  . LEU A 1 309 ? -4.009  3.705   -19.489 1.00 30.92  ? 287  LEU A CA  1 
ATOM   1893 C  C   . LEU A 1 309 ? -5.492  3.316   -19.325 1.00 32.35  ? 287  LEU A C   1 
ATOM   1894 O  O   . LEU A 1 309 ? -6.253  4.002   -18.611 1.00 33.73  ? 287  LEU A O   1 
ATOM   1895 C  CB  . LEU A 1 309 ? -3.812  4.542   -20.731 1.00 29.48  ? 287  LEU A CB  1 
ATOM   1896 C  CG  . LEU A 1 309 ? -2.382  5.074   -20.940 1.00 30.09  ? 287  LEU A CG  1 
ATOM   1897 C  CD1 . LEU A 1 309 ? -2.300  5.913   -22.220 1.00 29.19  ? 287  LEU A CD1 1 
ATOM   1898 C  CD2 . LEU A 1 309 ? -1.906  5.883   -19.735 1.00 31.18  ? 287  LEU A CD2 1 
ATOM   1899 N  N   . ALA A 1 310 ? -5.884  2.192   -19.917 1.00 31.27  ? 288  ALA A N   1 
ATOM   1900 C  CA  . ALA A 1 310 ? -7.307  1.855   -20.012 1.00 32.53  ? 288  ALA A CA  1 
ATOM   1901 C  C   . ALA A 1 310 ? -7.907  1.508   -18.655 1.00 33.48  ? 288  ALA A C   1 
ATOM   1902 O  O   . ALA A 1 310 ? -7.212  1.034   -17.768 1.00 33.83  ? 288  ALA A O   1 
ATOM   1903 C  CB  . ALA A 1 310 ? -7.533  0.696   -20.982 1.00 32.83  ? 288  ALA A CB  1 
ATOM   1904 N  N   . GLU A 1 311 ? -9.208  1.746   -18.531 1.00 35.25  ? 289  GLU A N   1 
ATOM   1905 C  CA  . GLU A 1 311 ? -10.018 1.249   -17.434 1.00 37.77  ? 289  GLU A CA  1 
ATOM   1906 C  C   . GLU A 1 311 ? -11.181 0.449   -17.998 1.00 37.80  ? 289  GLU A C   1 
ATOM   1907 O  O   . GLU A 1 311 ? -11.624 0.720   -19.105 1.00 36.38  ? 289  GLU A O   1 
ATOM   1908 C  CB  . GLU A 1 311 ? -10.581 2.401   -16.618 1.00 40.38  ? 289  GLU A CB  1 
ATOM   1909 C  CG  . GLU A 1 311 ? -9.540  3.434   -16.193 1.00 41.04  ? 289  GLU A CG  1 
ATOM   1910 C  CD  . GLU A 1 311 ? -10.108 4.389   -15.143 1.00 43.13  ? 289  GLU A CD  1 
ATOM   1911 O  OE1 . GLU A 1 311 ? -10.861 5.307   -15.517 1.00 44.47  ? 289  GLU A OE1 1 
ATOM   1912 O  OE2 . GLU A 1 311 ? -9.802  4.214   -13.961 1.00 42.29  ? 289  GLU A OE2 1 
ATOM   1913 N  N   . PRO A 1 312 ? -11.694 -0.523  -17.230 1.00 40.16  ? 290  PRO A N   1 
ATOM   1914 C  CA  . PRO A 1 312 ? -11.192 -0.946  -15.906 1.00 41.99  ? 290  PRO A CA  1 
ATOM   1915 C  C   . PRO A 1 312 ? -9.811  -1.629  -15.983 1.00 42.69  ? 290  PRO A C   1 
ATOM   1916 O  O   . PRO A 1 312 ? -9.377  -2.025  -17.071 1.00 41.50  ? 290  PRO A O   1 
ATOM   1917 C  CB  . PRO A 1 312 ? -12.272 -1.926  -15.406 1.00 44.06  ? 290  PRO A CB  1 
ATOM   1918 C  CG  . PRO A 1 312 ? -13.012 -2.371  -16.620 1.00 43.80  ? 290  PRO A CG  1 
ATOM   1919 C  CD  . PRO A 1 312 ? -12.849 -1.315  -17.680 1.00 41.40  ? 290  PRO A CD  1 
ATOM   1920 N  N   . GLU A 1 313 ? -9.122  -1.739  -14.856 1.00 45.27  ? 291  GLU A N   1 
ATOM   1921 C  CA  . GLU A 1 313 ? -7.774  -2.332  -14.821 1.00 48.01  ? 291  GLU A CA  1 
ATOM   1922 C  C   . GLU A 1 313 ? -7.721  -3.757  -15.397 1.00 48.26  ? 291  GLU A C   1 
ATOM   1923 O  O   . GLU A 1 313 ? -6.723  -4.140  -15.971 1.00 47.56  ? 291  GLU A O   1 
ATOM   1924 C  CB  . GLU A 1 313 ? -7.170  -2.320  -13.406 1.00 51.25  ? 291  GLU A CB  1 
ATOM   1925 C  CG  . GLU A 1 313 ? -5.654  -2.584  -13.369 1.00 56.02  ? 291  GLU A CG  1 
ATOM   1926 C  CD  . GLU A 1 313 ? -4.829  -1.624  -14.241 1.00 58.35  ? 291  GLU A CD  1 
ATOM   1927 O  OE1 . GLU A 1 313 ? -5.266  -0.471  -14.465 1.00 60.89  ? 291  GLU A OE1 1 
ATOM   1928 O  OE2 . GLU A 1 313 ? -3.733  -1.999  -14.724 1.00 62.24  ? 291  GLU A OE2 1 
ATOM   1929 N  N   . GLU A 1 314 ? -8.806  -4.508  -15.275 1.00 48.85  ? 292  GLU A N   1 
ATOM   1930 C  CA  . GLU A 1 314 ? -8.915  -5.854  -15.857 1.00 50.85  ? 292  GLU A CA  1 
ATOM   1931 C  C   . GLU A 1 314 ? -8.562  -5.901  -17.348 1.00 48.22  ? 292  GLU A C   1 
ATOM   1932 O  O   . GLU A 1 314 ? -8.043  -6.917  -17.813 1.00 48.10  ? 292  GLU A O   1 
ATOM   1933 C  CB  . GLU A 1 314 ? -10.320 -6.426  -15.653 1.00 53.93  ? 292  GLU A CB  1 
ATOM   1934 C  CG  . GLU A 1 314 ? -10.592 -6.908  -14.226 1.00 58.95  ? 292  GLU A CG  1 
ATOM   1935 C  CD  . GLU A 1 314 ? -10.799 -5.780  -13.201 1.00 59.42  ? 292  GLU A CD  1 
ATOM   1936 O  OE1 . GLU A 1 314 ? -10.900 -4.594  -13.598 1.00 55.28  ? 292  GLU A OE1 1 
ATOM   1937 O  OE2 . GLU A 1 314 ? -10.882 -6.091  -11.982 1.00 63.01  ? 292  GLU A OE2 1 
ATOM   1938 N  N   . LEU A 1 315 ? -8.817  -4.819  -18.089 1.00 44.04  ? 293  LEU A N   1 
ATOM   1939 C  CA  . LEU A 1 315 ? -8.460  -4.789  -19.507 1.00 44.40  ? 293  LEU A CA  1 
ATOM   1940 C  C   . LEU A 1 315 ? -6.950  -4.845  -19.749 1.00 44.59  ? 293  LEU A C   1 
ATOM   1941 O  O   . LEU A 1 315 ? -6.528  -5.154  -20.870 1.00 44.61  ? 293  LEU A O   1 
ATOM   1942 C  CB  . LEU A 1 315 ? -8.982  -3.525  -20.209 1.00 41.19  ? 293  LEU A CB  1 
ATOM   1943 C  CG  . LEU A 1 315 ? -10.489 -3.374  -20.392 1.00 42.02  ? 293  LEU A CG  1 
ATOM   1944 C  CD1 . LEU A 1 315 ? -10.773 -2.049  -21.069 1.00 39.65  ? 293  LEU A CD1 1 
ATOM   1945 C  CD2 . LEU A 1 315 ? -11.091 -4.529  -21.190 1.00 43.16  ? 293  LEU A CD2 1 
ATOM   1946 N  N   . ASN A 1 316 ? -6.149  -4.486  -18.741 1.00 44.33  ? 294  ASN A N   1 
ATOM   1947 C  CA  . ASN A 1 316 ? -4.710  -4.301  -18.952 1.00 44.73  ? 294  ASN A CA  1 
ATOM   1948 C  C   . ASN A 1 316 ? -3.897  -5.581  -18.660 1.00 49.90  ? 294  ASN A C   1 
ATOM   1949 O  O   . ASN A 1 316 ? -2.682  -5.600  -18.863 1.00 52.69  ? 294  ASN A O   1 
ATOM   1950 C  CB  . ASN A 1 316 ? -4.195  -3.129  -18.134 1.00 41.18  ? 294  ASN A CB  1 
ATOM   1951 C  CG  . ASN A 1 316 ? -4.892  -1.823  -18.475 1.00 39.05  ? 294  ASN A CG  1 
ATOM   1952 O  OD1 . ASN A 1 316 ? -5.230  -1.559  -19.638 1.00 36.96  ? 294  ASN A OD1 1 
ATOM   1953 N  ND2 . ASN A 1 316 ? -5.081  -0.978  -17.474 1.00 37.81  ? 294  ASN A ND2 1 
ATOM   1954 N  N   . GLN A 1 317 ? -4.559  -6.645  -18.224 1.00 53.14  ? 295  GLN A N   1 
ATOM   1955 C  CA  . GLN A 1 317 ? -3.898  -7.939  -17.994 1.00 59.09  ? 295  GLN A CA  1 
ATOM   1956 C  C   . GLN A 1 317 ? -3.209  -8.450  -19.263 1.00 61.19  ? 295  GLN A C   1 
ATOM   1957 O  O   . GLN A 1 317 ? -3.863  -8.641  -20.278 1.00 63.90  ? 295  GLN A O   1 
ATOM   1958 C  CB  . GLN A 1 317 ? -4.916  -8.979  -17.513 1.00 61.14  ? 295  GLN A CB  1 
ATOM   1959 N  N   . THR A 1 318 ? -1.892  -8.631  -19.223 1.00 64.07  ? 296  THR A N   1 
ATOM   1960 C  CA  . THR A 1 318 ? -1.155  -9.147  -20.388 1.00 67.18  ? 296  THR A CA  1 
ATOM   1961 C  C   . THR A 1 318 ? 0.253   -9.616  -20.027 1.00 72.19  ? 296  THR A C   1 
ATOM   1962 O  O   . THR A 1 318 ? 0.840   -9.163  -19.041 1.00 72.31  ? 296  THR A O   1 
ATOM   1963 C  CB  . THR A 1 318 ? -1.065  -8.115  -21.542 1.00 64.09  ? 296  THR A CB  1 
ATOM   1964 O  OG1 . THR A 1 318 ? -0.374  -8.702  -22.647 1.00 65.66  ? 296  THR A OG1 1 
ATOM   1965 C  CG2 . THR A 1 318 ? -0.322  -6.852  -21.121 1.00 61.73  ? 296  THR A CG2 1 
ATOM   1966 N  N   . GLU A 1 319 ? 0.805   -10.481 -20.873 1.00 80.10  ? 297  GLU A N   1 
ATOM   1967 C  CA  . GLU A 1 319 ? 2.174   -10.956 -20.718 1.00 86.00  ? 297  GLU A CA  1 
ATOM   1968 C  C   . GLU A 1 319 ? 3.196   -9.864  -21.035 1.00 88.53  ? 297  GLU A C   1 
ATOM   1969 O  O   . GLU A 1 319 ? 3.954   -9.448  -20.159 1.00 91.92  ? 297  GLU A O   1 
ATOM   1970 C  CB  . GLU A 1 319 ? 2.419   -12.178 -21.606 1.00 87.44  ? 297  GLU A CB  1 
ATOM   1971 N  N   . GLN A 1 320 ? 3.220   -9.403  -22.284 1.00 85.38  ? 298  GLN A N   1 
ATOM   1972 C  CA  . GLN A 1 320 ? 4.199   -8.375  -22.693 1.00 83.08  ? 298  GLN A CA  1 
ATOM   1973 C  C   . GLN A 1 320 ? 3.775   -6.954  -22.353 1.00 74.04  ? 298  GLN A C   1 
ATOM   1974 O  O   . GLN A 1 320 ? 2.592   -6.681  -22.132 1.00 73.67  ? 298  GLN A O   1 
ATOM   1975 C  CB  . GLN A 1 320 ? 4.559   -8.471  -24.191 1.00 84.94  ? 298  GLN A CB  1 
ATOM   1976 C  CG  . GLN A 1 320 ? 3.409   -8.706  -25.180 1.00 87.98  ? 298  GLN A CG  1 
ATOM   1977 C  CD  . GLN A 1 320 ? 2.476   -7.512  -25.402 1.00 86.78  ? 298  GLN A CD  1 
ATOM   1978 O  OE1 . GLN A 1 320 ? 2.794   -6.366  -25.075 1.00 91.63  ? 298  GLN A OE1 1 
ATOM   1979 N  NE2 . GLN A 1 320 ? 1.321   -7.781  -25.999 1.00 83.08  ? 298  GLN A NE2 1 
ATOM   1980 N  N   . THR A 1 321 ? 4.762   -6.060  -22.292 1.00 68.34  ? 299  THR A N   1 
ATOM   1981 C  CA  . THR A 1 321 ? 4.506   -4.616  -22.216 1.00 65.37  ? 299  THR A CA  1 
ATOM   1982 C  C   . THR A 1 321 ? 5.182   -3.827  -23.363 1.00 60.54  ? 299  THR A C   1 
ATOM   1983 O  O   . THR A 1 321 ? 5.215   -2.589  -23.307 1.00 56.53  ? 299  THR A O   1 
ATOM   1984 C  CB  . THR A 1 321 ? 4.883   -4.001  -20.834 1.00 67.34  ? 299  THR A CB  1 
ATOM   1985 O  OG1 . THR A 1 321 ? 6.306   -3.895  -20.704 1.00 69.85  ? 299  THR A OG1 1 
ATOM   1986 C  CG2 . THR A 1 321 ? 4.310   -4.845  -19.665 1.00 69.33  ? 299  THR A CG2 1 
ATOM   1987 N  N   . THR A 1 322 ? 5.697   -4.532  -24.390 1.00 55.57  ? 300  THR A N   1 
ATOM   1988 C  CA  . THR A 1 322 ? 6.193   -3.888  -25.619 1.00 49.47  ? 300  THR A CA  1 
ATOM   1989 C  C   . THR A 1 322 ? 5.330   -4.167  -26.823 1.00 42.62  ? 300  THR A C   1 
ATOM   1990 O  O   . THR A 1 322 ? 4.735   -5.236  -26.958 1.00 42.70  ? 300  THR A O   1 
ATOM   1991 C  CB  . THR A 1 322 ? 7.568   -4.410  -26.045 1.00 54.51  ? 300  THR A CB  1 
ATOM   1992 O  OG1 . THR A 1 322 ? 7.563   -5.842  -26.016 1.00 59.51  ? 300  THR A OG1 1 
ATOM   1993 C  CG2 . THR A 1 322 ? 8.610   -3.900  -25.144 1.00 56.79  ? 300  THR A CG2 1 
ATOM   1994 N  N   . TYR A 1 323 ? 5.334   -3.205  -27.723 1.00 34.82  ? 301  TYR A N   1 
ATOM   1995 C  CA  . TYR A 1 323 ? 4.560   -3.254  -28.928 1.00 33.71  ? 301  TYR A CA  1 
ATOM   1996 C  C   . TYR A 1 323 ? 5.223   -2.302  -29.942 1.00 31.96  ? 301  TYR A C   1 
ATOM   1997 O  O   . TYR A 1 323 ? 6.030   -1.447  -29.586 1.00 30.52  ? 301  TYR A O   1 
ATOM   1998 C  CB  . TYR A 1 323 ? 3.092   -2.868  -28.635 1.00 31.40  ? 301  TYR A CB  1 
ATOM   1999 C  CG  . TYR A 1 323 ? 2.957   -1.621  -27.796 1.00 30.31  ? 301  TYR A CG  1 
ATOM   2000 C  CD1 . TYR A 1 323 ? 2.912   -0.370  -28.386 1.00 28.65  ? 301  TYR A CD1 1 
ATOM   2001 C  CD2 . TYR A 1 323 ? 2.910   -1.691  -26.405 1.00 31.14  ? 301  TYR A CD2 1 
ATOM   2002 C  CE1 . TYR A 1 323 ? 2.793   0.781   -27.628 1.00 28.08  ? 301  TYR A CE1 1 
ATOM   2003 C  CE2 . TYR A 1 323 ? 2.797   -0.546  -25.637 1.00 30.46  ? 301  TYR A CE2 1 
ATOM   2004 C  CZ  . TYR A 1 323 ? 2.740   0.684   -26.258 1.00 28.83  ? 301  TYR A CZ  1 
ATOM   2005 O  OH  . TYR A 1 323 ? 2.620   1.819   -25.524 1.00 28.30  ? 301  TYR A OH  1 
ATOM   2006 N  N   . GLU A 1 324 ? 4.850   -2.460  -31.198 1.00 31.47  ? 302  GLU A N   1 
ATOM   2007 C  CA  . GLU A 1 324 ? 5.500   -1.807  -32.319 1.00 30.94  ? 302  GLU A CA  1 
ATOM   2008 C  C   . GLU A 1 324 ? 4.850   -0.514  -32.714 1.00 29.87  ? 302  GLU A C   1 
ATOM   2009 O  O   . GLU A 1 324 ? 5.511   0.338   -33.299 1.00 30.27  ? 302  GLU A O   1 
ATOM   2010 C  CB  . GLU A 1 324 ? 5.498   -2.736  -33.522 1.00 32.21  ? 302  GLU A CB  1 
ATOM   2011 C  CG  . GLU A 1 324 ? 6.229   -4.032  -33.280 1.00 35.34  ? 302  GLU A CG  1 
ATOM   2012 C  CD  . GLU A 1 324 ? 7.731   -3.875  -33.407 1.00 37.25  ? 302  GLU A CD  1 
ATOM   2013 O  OE1 . GLU A 1 324 ? 8.234   -2.763  -33.719 1.00 35.57  ? 302  GLU A OE1 1 
ATOM   2014 O  OE2 . GLU A 1 324 ? 8.383   -4.882  -33.194 1.00 40.53  ? 302  GLU A OE2 1 
ATOM   2015 N  N   . VAL A 1 325 ? 3.550   -0.359  -32.435 1.00 29.38  ? 303  VAL A N   1 
ATOM   2016 C  CA  . VAL A 1 325 ? 2.877   0.879   -32.728 1.00 28.32  ? 303  VAL A CA  1 
ATOM   2017 C  C   . VAL A 1 325 ? 3.530   2.025   -31.932 1.00 27.59  ? 303  VAL A C   1 
ATOM   2018 O  O   . VAL A 1 325 ? 3.850   1.873   -30.742 1.00 26.97  ? 303  VAL A O   1 
ATOM   2019 C  CB  . VAL A 1 325 ? 1.354   0.815   -32.425 1.00 29.54  ? 303  VAL A CB  1 
ATOM   2020 C  CG1 . VAL A 1 325 ? 0.713   2.168   -32.579 1.00 29.76  ? 303  VAL A CG1 1 
ATOM   2021 C  CG2 . VAL A 1 325 ? 0.661   -0.116  -33.387 1.00 32.32  ? 303  VAL A CG2 1 
ATOM   2022 N  N   . GLU A 1 326 ? 3.675   3.169   -32.584 1.00 24.14  ? 304  GLU A N   1 
ATOM   2023 C  CA  . GLU A 1 326 ? 4.363   4.295   -31.994 1.00 25.45  ? 304  GLU A CA  1 
ATOM   2024 C  C   . GLU A 1 326 ? 3.406   5.441   -31.667 1.00 25.44  ? 304  GLU A C   1 
ATOM   2025 O  O   . GLU A 1 326 ? 2.586   5.850   -32.487 1.00 27.09  ? 304  GLU A O   1 
ATOM   2026 C  CB  . GLU A 1 326 ? 5.492   4.793   -32.904 1.00 25.03  ? 304  GLU A CB  1 
ATOM   2027 C  CG  . GLU A 1 326 ? 6.540   3.751   -33.148 1.00 26.77  ? 304  GLU A CG  1 
ATOM   2028 C  CD  . GLU A 1 326 ? 7.539   4.170   -34.209 1.00 27.95  ? 304  GLU A CD  1 
ATOM   2029 O  OE1 . GLU A 1 326 ? 8.083   5.288   -34.124 1.00 27.01  ? 304  GLU A OE1 1 
ATOM   2030 O  OE2 . GLU A 1 326 ? 7.766   3.349   -35.124 1.00 27.69  ? 304  GLU A OE2 1 
ATOM   2031 N  N   . GLY A 1 327 ? 3.540   5.948   -30.451 1.00 25.02  ? 305  GLY A N   1 
ATOM   2032 C  CA  . GLY A 1 327 ? 2.905   7.193   -30.040 1.00 25.74  ? 305  GLY A CA  1 
ATOM   2033 C  C   . GLY A 1 327 ? 1.729   7.053   -29.094 1.00 24.30  ? 305  GLY A C   1 
ATOM   2034 O  O   . GLY A 1 327 ? 1.179   8.068   -28.671 1.00 27.03  ? 305  GLY A O   1 
ATOM   2035 N  N   . ILE A 1 328 ? 1.357   5.816   -28.747 1.00 25.05  ? 306  ILE A N   1 
ATOM   2036 C  CA  . ILE A 1 328 ? 0.240   5.564   -27.828 1.00 25.25  ? 306  ILE A CA  1 
ATOM   2037 C  C   . ILE A 1 328 ? 0.652   4.585   -26.732 1.00 26.15  ? 306  ILE A C   1 
ATOM   2038 O  O   . ILE A 1 328 ? 1.565   3.763   -26.916 1.00 24.39  ? 306  ILE A O   1 
ATOM   2039 C  CB  . ILE A 1 328 ? -1.021  5.088   -28.590 1.00 26.67  ? 306  ILE A CB  1 
ATOM   2040 C  CG1 . ILE A 1 328 ? -0.742  3.799   -29.363 1.00 28.03  ? 306  ILE A CG1 1 
ATOM   2041 C  CG2 . ILE A 1 328 ? -1.502  6.193   -29.504 1.00 25.35  ? 306  ILE A CG2 1 
ATOM   2042 C  CD1 . ILE A 1 328 ? -1.936  3.204   -30.074 1.00 28.37  ? 306  ILE A CD1 1 
ATOM   2043 N  N   . GLY A 1 329 ? 0.003   4.722   -25.571 1.00 24.75  ? 307  GLY A N   1 
ATOM   2044 C  CA  . GLY A 1 329 ? 0.244   3.857   -24.449 1.00 26.11  ? 307  GLY A CA  1 
ATOM   2045 C  C   . GLY A 1 329 ? 1.412   4.263   -23.576 1.00 26.80  ? 307  GLY A C   1 
ATOM   2046 O  O   . GLY A 1 329 ? 2.390   4.829   -24.055 1.00 26.80  ? 307  GLY A O   1 
ATOM   2047 N  N   . TYR A 1 330 ? 1.287   4.000   -22.282 1.00 27.27  ? 308  TYR A N   1 
ATOM   2048 C  CA  . TYR A 1 330 ? 2.354   4.278   -21.327 1.00 27.81  ? 308  TYR A CA  1 
ATOM   2049 C  C   . TYR A 1 330 ? 2.259   3.359   -20.145 1.00 28.65  ? 308  TYR A C   1 
ATOM   2050 O  O   . TYR A 1 330 ? 1.218   2.701   -19.915 1.00 28.69  ? 308  TYR A O   1 
ATOM   2051 C  CB  . TYR A 1 330 ? 2.326   5.753   -20.833 1.00 29.26  ? 308  TYR A CB  1 
ATOM   2052 C  CG  . TYR A 1 330 ? 2.980   6.696   -21.778 1.00 28.28  ? 308  TYR A CG  1 
ATOM   2053 C  CD1 . TYR A 1 330 ? 4.366   6.662   -21.978 1.00 30.38  ? 308  TYR A CD1 1 
ATOM   2054 C  CD2 . TYR A 1 330 ? 2.221   7.579   -22.532 1.00 29.12  ? 308  TYR A CD2 1 
ATOM   2055 C  CE1 . TYR A 1 330 ? 4.970   7.506   -22.897 1.00 29.58  ? 308  TYR A CE1 1 
ATOM   2056 C  CE2 . TYR A 1 330 ? 2.815   8.425   -23.445 1.00 29.83  ? 308  TYR A CE2 1 
ATOM   2057 C  CZ  . TYR A 1 330 ? 4.185   8.392   -23.610 1.00 30.16  ? 308  TYR A CZ  1 
ATOM   2058 O  OH  . TYR A 1 330 ? 4.733   9.238   -24.535 1.00 31.09  ? 308  TYR A OH  1 
ATOM   2059 N  N   . ASP A 1 331 ? 3.351   3.340   -19.381 1.00 29.51  ? 309  ASP A N   1 
ATOM   2060 C  CA  . ASP A 1 331 ? 3.444   2.608   -18.122 1.00 31.13  ? 309  ASP A CA  1 
ATOM   2061 C  C   . ASP A 1 331 ? 3.117   3.493   -16.892 1.00 31.52  ? 309  ASP A C   1 
ATOM   2062 O  O   . ASP A 1 331 ? 3.342   3.084   -15.748 1.00 31.42  ? 309  ASP A O   1 
ATOM   2063 C  CB  . ASP A 1 331 ? 4.825   1.940   -17.971 1.00 33.18  ? 309  ASP A CB  1 
ATOM   2064 C  CG  . ASP A 1 331 ? 5.999   2.937   -18.035 1.00 33.13  ? 309  ASP A CG  1 
ATOM   2065 O  OD1 . ASP A 1 331 ? 5.853   4.074   -18.572 1.00 33.85  ? 309  ASP A OD1 1 
ATOM   2066 O  OD2 . ASP A 1 331 ? 7.072   2.566   -17.554 1.00 33.70  ? 309  ASP A OD2 1 
ATOM   2067 N  N   . PHE A 1 332 ? 2.568   4.689   -17.136 1.00 29.76  ? 310  PHE A N   1 
ATOM   2068 C  CA  . PHE A 1 332 ? 2.160   5.593   -16.063 1.00 30.56  ? 310  PHE A CA  1 
ATOM   2069 C  C   . PHE A 1 332 ? 0.949   6.359   -16.574 1.00 29.34  ? 310  PHE A C   1 
ATOM   2070 O  O   . PHE A 1 332 ? 0.729   6.417   -17.788 1.00 27.03  ? 310  PHE A O   1 
ATOM   2071 C  CB  . PHE A 1 332 ? 3.317   6.547   -15.650 1.00 31.21  ? 310  PHE A CB  1 
ATOM   2072 C  CG  . PHE A 1 332 ? 3.758   7.498   -16.745 1.00 30.00  ? 310  PHE A CG  1 
ATOM   2073 C  CD1 . PHE A 1 332 ? 4.753   7.123   -17.651 1.00 29.78  ? 310  PHE A CD1 1 
ATOM   2074 C  CD2 . PHE A 1 332 ? 3.177   8.760   -16.892 1.00 29.09  ? 310  PHE A CD2 1 
ATOM   2075 C  CE1 . PHE A 1 332 ? 5.146   7.955   -18.664 1.00 29.24  ? 310  PHE A CE1 1 
ATOM   2076 C  CE2 . PHE A 1 332 ? 3.571   9.604   -17.910 1.00 28.83  ? 310  PHE A CE2 1 
ATOM   2077 C  CZ  . PHE A 1 332 ? 4.557   9.204   -18.815 1.00 28.89  ? 310  PHE A CZ  1 
ATOM   2078 N  N   . ILE A 1 333 ? 0.164   6.937   -15.660 1.00 29.95  ? 311  ILE A N   1 
ATOM   2079 C  CA  . ILE A 1 333 ? -0.973  7.793   -16.043 1.00 29.61  ? 311  ILE A CA  1 
ATOM   2080 C  C   . ILE A 1 333 ? -0.514  9.259   -16.126 1.00 29.38  ? 311  ILE A C   1 
ATOM   2081 O  O   . ILE A 1 333 ? -0.226  9.872   -15.104 1.00 30.23  ? 311  ILE A O   1 
ATOM   2082 C  CB  . ILE A 1 333 ? -2.119  7.727   -15.010 1.00 31.31  ? 311  ILE A CB  1 
ATOM   2083 C  CG1 . ILE A 1 333 ? -2.459  6.282   -14.673 1.00 32.94  ? 311  ILE A CG1 1 
ATOM   2084 C  CG2 . ILE A 1 333 ? -3.335  8.505   -15.526 1.00 30.46  ? 311  ILE A CG2 1 
ATOM   2085 C  CD1 . ILE A 1 333 ? -2.770  5.381   -15.851 1.00 31.86  ? 311  ILE A CD1 1 
ATOM   2086 N  N   . PRO A 1 334 ? -0.410  9.827   -17.334 1.00 27.57  ? 312  PRO A N   1 
ATOM   2087 C  CA  . PRO A 1 334 ? 0.064   11.224  -17.391 1.00 28.18  ? 312  PRO A CA  1 
ATOM   2088 C  C   . PRO A 1 334 ? -0.862  12.207  -16.651 1.00 29.78  ? 312  PRO A C   1 
ATOM   2089 O  O   . PRO A 1 334 ? -2.109  12.021  -16.617 1.00 28.56  ? 312  PRO A O   1 
ATOM   2090 C  CB  . PRO A 1 334 ? 0.107   11.525  -18.883 1.00 26.82  ? 312  PRO A CB  1 
ATOM   2091 C  CG  . PRO A 1 334 ? 0.161   10.184  -19.544 1.00 25.72  ? 312  PRO A CG  1 
ATOM   2092 C  CD  . PRO A 1 334 ? -0.659  9.291   -18.667 1.00 26.48  ? 312  PRO A CD  1 
ATOM   2093 N  N   . THR A 1 335 ? -0.245  13.192  -16.003 1.00 30.60  ? 313  THR A N   1 
ATOM   2094 C  CA  . THR A 1 335 ? -0.993  14.203  -15.245 1.00 32.20  ? 313  THR A CA  1 
ATOM   2095 C  C   . THR A 1 335 ? -2.084  14.846  -16.129 1.00 30.99  ? 313  THR A C   1 
ATOM   2096 O  O   . THR A 1 335 ? -3.162  15.123  -15.659 1.00 29.56  ? 313  THR A O   1 
ATOM   2097 C  CB  . THR A 1 335 ? -0.054  15.299  -14.708 1.00 33.31  ? 313  THR A CB  1 
ATOM   2098 O  OG1 . THR A 1 335 ? 0.919   14.715  -13.820 1.00 34.49  ? 313  THR A OG1 1 
ATOM   2099 C  CG2 . THR A 1 335 ? -0.852  16.391  -13.960 1.00 35.47  ? 313  THR A CG2 1 
ATOM   2100 N  N   . VAL A 1 336 ? -1.778  15.097  -17.403 1.00 30.02  ? 314  VAL A N   1 
ATOM   2101 C  CA  . VAL A 1 336 ? -2.762  15.726  -18.307 1.00 30.24  ? 314  VAL A CA  1 
ATOM   2102 C  C   . VAL A 1 336 ? -3.942  14.833  -18.753 1.00 30.34  ? 314  VAL A C   1 
ATOM   2103 O  O   . VAL A 1 336 ? -4.922  15.333  -19.315 1.00 30.37  ? 314  VAL A O   1 
ATOM   2104 C  CB  . VAL A 1 336 ? -2.090  16.316  -19.552 1.00 30.07  ? 314  VAL A CB  1 
ATOM   2105 C  CG1 . VAL A 1 336 ? -1.125  17.436  -19.170 1.00 30.29  ? 314  VAL A CG1 1 
ATOM   2106 C  CG2 . VAL A 1 336 ? -1.390  15.232  -20.368 1.00 30.18  ? 314  VAL A CG2 1 
ATOM   2107 N  N   . LEU A 1 337 ? -3.877  13.528  -18.511 1.00 29.79  ? 315  LEU A N   1 
ATOM   2108 C  CA  . LEU A 1 337 ? -4.962  12.647  -18.909 1.00 29.52  ? 315  LEU A CA  1 
ATOM   2109 C  C   . LEU A 1 337 ? -6.073  12.634  -17.842 1.00 31.06  ? 315  LEU A C   1 
ATOM   2110 O  O   . LEU A 1 337 ? -5.832  12.241  -16.722 1.00 30.77  ? 315  LEU A O   1 
ATOM   2111 C  CB  . LEU A 1 337 ? -4.451  11.219  -19.103 1.00 29.83  ? 315  LEU A CB  1 
ATOM   2112 C  CG  . LEU A 1 337 ? -5.500  10.137  -19.345 1.00 29.83  ? 315  LEU A CG  1 
ATOM   2113 C  CD1 . LEU A 1 337 ? -6.341  10.434  -20.571 1.00 30.17  ? 315  LEU A CD1 1 
ATOM   2114 C  CD2 . LEU A 1 337 ? -4.838  8.781   -19.492 1.00 29.85  ? 315  LEU A CD2 1 
ATOM   2115 N  N   . ASP A 1 338 ? -7.293  13.015  -18.232 1.00 30.40  ? 316  ASP A N   1 
ATOM   2116 C  CA  . ASP A 1 338 ? -8.467  12.889  -17.381 1.00 31.09  ? 316  ASP A CA  1 
ATOM   2117 C  C   . ASP A 1 338 ? -9.282  11.689  -17.837 1.00 31.81  ? 316  ASP A C   1 
ATOM   2118 O  O   . ASP A 1 338 ? -10.035 11.749  -18.804 1.00 31.49  ? 316  ASP A O   1 
ATOM   2119 C  CB  . ASP A 1 338 ? -9.305  14.163  -17.459 1.00 31.76  ? 316  ASP A CB  1 
ATOM   2120 C  CG  . ASP A 1 338 ? -10.492 14.157  -16.498 1.00 33.50  ? 316  ASP A CG  1 
ATOM   2121 O  OD1 . ASP A 1 338 ? -10.813 13.093  -15.931 1.00 33.79  ? 316  ASP A OD1 1 
ATOM   2122 O  OD2 . ASP A 1 338 ? -11.108 15.234  -16.324 1.00 34.57  ? 316  ASP A OD2 1 
ATOM   2123 N  N   . ARG A 1 339 ? -9.159  10.585  -17.127 1.00 33.12  ? 317  ARG A N   1 
ATOM   2124 C  CA  . ARG A 1 339 ? -9.833  9.391   -17.555 1.00 34.58  ? 317  ARG A CA  1 
ATOM   2125 C  C   . ARG A 1 339 ? -11.288 9.416   -17.195 1.00 34.58  ? 317  ARG A C   1 
ATOM   2126 O  O   . ARG A 1 339 ? -12.043 8.621   -17.743 1.00 35.28  ? 317  ARG A O   1 
ATOM   2127 C  CB  . ARG A 1 339 ? -9.212  8.168   -16.954 1.00 35.97  ? 317  ARG A CB  1 
ATOM   2128 C  CG  . ARG A 1 339 ? -7.767  7.952   -17.351 1.00 36.26  ? 317  ARG A CG  1 
ATOM   2129 C  CD  . ARG A 1 339 ? -7.135  7.283   -16.153 1.00 41.43  ? 317  ARG A CD  1 
ATOM   2130 N  NE  . ARG A 1 339 ? -6.802  5.939   -16.396 1.00 41.36  ? 317  ARG A NE  1 
ATOM   2131 C  CZ  . ARG A 1 339 ? -6.389  5.079   -15.482 1.00 40.41  ? 317  ARG A CZ  1 
ATOM   2132 N  NH1 . ARG A 1 339 ? -6.330  5.383   -14.192 1.00 41.62  ? 317  ARG A NH1 1 
ATOM   2133 N  NH2 . ARG A 1 339 ? -6.036  3.877   -15.902 1.00 39.49  ? 317  ARG A NH2 1 
ATOM   2134 N  N   . THR A 1 340 ? -11.697 10.323  -16.307 1.00 35.69  ? 318  THR A N   1 
ATOM   2135 C  CA  . THR A 1 340 ? -13.118 10.402  -15.935 1.00 36.73  ? 318  THR A CA  1 
ATOM   2136 C  C   . THR A 1 340 ? -13.975 10.834  -17.118 1.00 36.43  ? 318  THR A C   1 
ATOM   2137 O  O   . THR A 1 340 ? -15.159 10.607  -17.107 1.00 37.81  ? 318  THR A O   1 
ATOM   2138 C  CB  . THR A 1 340 ? -13.393 11.349  -14.750 1.00 38.45  ? 318  THR A CB  1 
ATOM   2139 O  OG1 . THR A 1 340 ? -13.134 12.705  -15.131 1.00 37.87  ? 318  THR A OG1 1 
ATOM   2140 C  CG2 . THR A 1 340 ? -12.539 10.991  -13.519 1.00 39.33  ? 318  THR A CG2 1 
ATOM   2141 N  N   . VAL A 1 341 ? -13.402 11.471  -18.132 1.00 35.69  ? 319  VAL A N   1 
ATOM   2142 C  CA  . VAL A 1 341 ? -14.212 11.910  -19.285 1.00 37.05  ? 319  VAL A CA  1 
ATOM   2143 C  C   . VAL A 1 341 ? -14.194 10.914  -20.448 1.00 35.90  ? 319  VAL A C   1 
ATOM   2144 O  O   . VAL A 1 341 ? -14.760 11.195  -21.492 1.00 34.41  ? 319  VAL A O   1 
ATOM   2145 C  CB  . VAL A 1 341 ? -13.816 13.332  -19.798 1.00 37.28  ? 319  VAL A CB  1 
ATOM   2146 C  CG1 . VAL A 1 341 ? -14.086 14.366  -18.735 1.00 40.02  ? 319  VAL A CG1 1 
ATOM   2147 C  CG2 . VAL A 1 341 ? -12.373 13.386  -20.226 1.00 36.73  ? 319  VAL A CG2 1 
ATOM   2148 N  N   . VAL A 1 342 ? -13.553 9.754   -20.268 1.00 36.08  ? 320  VAL A N   1 
ATOM   2149 C  CA  . VAL A 1 342 ? -13.598 8.675   -21.257 1.00 34.38  ? 320  VAL A CA  1 
ATOM   2150 C  C   . VAL A 1 342 ? -14.701 7.731   -20.850 1.00 34.42  ? 320  VAL A C   1 
ATOM   2151 O  O   . VAL A 1 342 ? -14.731 7.273   -19.734 1.00 33.98  ? 320  VAL A O   1 
ATOM   2152 C  CB  . VAL A 1 342 ? -12.236 7.941   -21.350 1.00 34.02  ? 320  VAL A CB  1 
ATOM   2153 C  CG1 . VAL A 1 342 ? -12.264 6.827   -22.396 1.00 34.39  ? 320  VAL A CG1 1 
ATOM   2154 C  CG2 . VAL A 1 342 ? -11.144 8.932   -21.688 1.00 32.46  ? 320  VAL A CG2 1 
ATOM   2155 N  N   . ASP A 1 343 ? -15.617 7.445   -21.765 1.00 35.30  ? 321  ASP A N   1 
ATOM   2156 C  CA  . ASP A 1 343 ? -16.784 6.621   -21.463 1.00 36.89  ? 321  ASP A CA  1 
ATOM   2157 C  C   . ASP A 1 343 ? -16.457 5.142   -21.512 1.00 36.96  ? 321  ASP A C   1 
ATOM   2158 O  O   . ASP A 1 343 ? -16.991 4.382   -20.737 1.00 35.88  ? 321  ASP A O   1 
ATOM   2159 C  CB  . ASP A 1 343 ? -17.924 6.913   -22.446 1.00 38.82  ? 321  ASP A CB  1 
ATOM   2160 C  CG  . ASP A 1 343 ? -18.475 8.310   -22.281 1.00 39.92  ? 321  ASP A CG  1 
ATOM   2161 O  OD1 . ASP A 1 343 ? -18.759 8.653   -21.130 1.00 39.74  ? 321  ASP A OD1 1 
ATOM   2162 O  OD2 . ASP A 1 343 ? -18.587 9.082   -23.268 1.00 39.83  ? 321  ASP A OD2 1 
ATOM   2163 N  N   . LYS A 1 344 ? -15.584 4.746   -22.435 1.00 33.88  ? 322  LYS A N   1 
ATOM   2164 C  CA  . LYS A 1 344 ? -15.256 3.358   -22.619 1.00 34.12  ? 322  LYS A CA  1 
ATOM   2165 C  C   . LYS A 1 344 ? -13.917 3.251   -23.323 1.00 31.87  ? 322  LYS A C   1 
ATOM   2166 O  O   . LYS A 1 344 ? -13.603 4.066   -24.204 1.00 29.64  ? 322  LYS A O   1 
ATOM   2167 C  CB  . LYS A 1 344 ? -16.327 2.643   -23.447 1.00 36.49  ? 322  LYS A CB  1 
ATOM   2168 C  CG  . LYS A 1 344 ? -16.100 1.150   -23.532 1.00 38.52  ? 322  LYS A CG  1 
ATOM   2169 C  CD  . LYS A 1 344 ? -17.117 0.431   -24.390 1.00 41.72  ? 322  LYS A CD  1 
ATOM   2170 C  CE  . LYS A 1 344 ? -16.925 -1.060  -24.267 1.00 43.96  ? 322  LYS A CE  1 
ATOM   2171 N  NZ  . LYS A 1 344 ? -17.917 -1.805  -25.104 1.00 47.82  ? 322  LYS A NZ  1 
ATOM   2172 N  N   . TRP A 1 345 ? -13.116 2.288   -22.882 1.00 31.36  ? 323  TRP A N   1 
ATOM   2173 C  CA  . TRP A 1 345 ? -11.817 2.026   -23.481 1.00 31.80  ? 323  TRP A CA  1 
ATOM   2174 C  C   . TRP A 1 345 ? -11.880 0.754   -24.306 1.00 31.87  ? 323  TRP A C   1 
ATOM   2175 O  O   . TRP A 1 345 ? -12.659 -0.143  -24.000 1.00 33.39  ? 323  TRP A O   1 
ATOM   2176 C  CB  . TRP A 1 345 ? -10.751 1.864   -22.401 1.00 32.13  ? 323  TRP A CB  1 
ATOM   2177 C  CG  . TRP A 1 345 ? -10.459 3.113   -21.646 1.00 31.19  ? 323  TRP A CG  1 
ATOM   2178 C  CD1 . TRP A 1 345 ? -11.146 3.595   -20.575 1.00 32.66  ? 323  TRP A CD1 1 
ATOM   2179 C  CD2 . TRP A 1 345 ? -9.385  4.025   -21.885 1.00 28.65  ? 323  TRP A CD2 1 
ATOM   2180 N  NE1 . TRP A 1 345 ? -10.558 4.760   -20.127 1.00 32.40  ? 323  TRP A NE1 1 
ATOM   2181 C  CE2 . TRP A 1 345 ? -9.481  5.046   -20.926 1.00 30.58  ? 323  TRP A CE2 1 
ATOM   2182 C  CE3 . TRP A 1 345 ? -8.357  4.074   -22.806 1.00 27.46  ? 323  TRP A CE3 1 
ATOM   2183 C  CZ2 . TRP A 1 345 ? -8.575  6.100   -20.866 1.00 29.66  ? 323  TRP A CZ2 1 
ATOM   2184 C  CZ3 . TRP A 1 345 ? -7.461  5.130   -22.753 1.00 27.54  ? 323  TRP A CZ3 1 
ATOM   2185 C  CH2 . TRP A 1 345 ? -7.567  6.121   -21.782 1.00 28.42  ? 323  TRP A CH2 1 
ATOM   2186 N  N   . PHE A 1 346 ? -11.073 0.695   -25.368 1.00 31.04  ? 324  PHE A N   1 
ATOM   2187 C  CA  . PHE A 1 346 ? -10.832 -0.554  -26.091 1.00 31.57  ? 324  PHE A CA  1 
ATOM   2188 C  C   . PHE A 1 346 ? -9.329  -0.758  -26.164 1.00 31.40  ? 324  PHE A C   1 
ATOM   2189 O  O   . PHE A 1 346 ? -8.611  0.178   -26.432 1.00 29.16  ? 324  PHE A O   1 
ATOM   2190 C  CB  . PHE A 1 346 ? -11.366 -0.466  -27.521 1.00 31.63  ? 324  PHE A CB  1 
ATOM   2191 C  CG  . PHE A 1 346 ? -12.843 -0.685  -27.643 1.00 32.86  ? 324  PHE A CG  1 
ATOM   2192 C  CD1 . PHE A 1 346 ? -13.734 0.359   -27.394 1.00 32.75  ? 324  PHE A CD1 1 
ATOM   2193 C  CD2 . PHE A 1 346 ? -13.347 -1.919  -28.036 1.00 34.16  ? 324  PHE A CD2 1 
ATOM   2194 C  CE1 . PHE A 1 346 ? -15.110 0.167   -27.508 1.00 33.97  ? 324  PHE A CE1 1 
ATOM   2195 C  CE2 . PHE A 1 346 ? -14.717 -2.110  -28.167 1.00 36.83  ? 324  PHE A CE2 1 
ATOM   2196 C  CZ  . PHE A 1 346 ? -15.597 -1.064  -27.902 1.00 35.86  ? 324  PHE A CZ  1 
ATOM   2197 N  N   . LYS A 1 347 ? -8.890  -1.993  -25.936 1.00 32.64  ? 325  LYS A N   1 
ATOM   2198 C  CA  . LYS A 1 347 ? -7.507  -2.404  -26.097 1.00 33.72  ? 325  LYS A CA  1 
ATOM   2199 C  C   . LYS A 1 347 ? -7.225  -2.697  -27.575 1.00 33.42  ? 325  LYS A C   1 
ATOM   2200 O  O   . LYS A 1 347 ? -7.966  -3.445  -28.185 1.00 33.19  ? 325  LYS A O   1 
ATOM   2201 C  CB  . LYS A 1 347 ? -7.266  -3.686  -25.291 1.00 35.87  ? 325  LYS A CB  1 
ATOM   2202 C  CG  . LYS A 1 347 ? -7.142  -3.375  -23.818 1.00 37.59  ? 325  LYS A CG  1 
ATOM   2203 C  CD  . LYS A 1 347 ? -5.736  -2.821  -23.663 1.00 38.79  ? 325  LYS A CD  1 
ATOM   2204 C  CE  . LYS A 1 347 ? -5.610  -1.879  -22.537 1.00 38.76  ? 325  LYS A CE  1 
ATOM   2205 N  NZ  . LYS A 1 347 ? -4.154  -1.735  -22.302 1.00 36.29  ? 325  LYS A NZ  1 
ATOM   2206 N  N   . SER A 1 348 ? -6.156  -2.135  -28.127 1.00 30.94  ? 326  SER A N   1 
ATOM   2207 C  CA  . SER A 1 348 ? -5.761  -2.451  -29.503 1.00 31.46  ? 326  SER A CA  1 
ATOM   2208 C  C   . SER A 1 348 ? -4.430  -3.227  -29.567 1.00 33.54  ? 326  SER A C   1 
ATOM   2209 O  O   . SER A 1 348 ? -3.653  -3.233  -28.608 1.00 34.16  ? 326  SER A O   1 
ATOM   2210 C  CB  . SER A 1 348 ? -5.670  -1.180  -30.336 1.00 29.68  ? 326  SER A CB  1 
ATOM   2211 O  OG  . SER A 1 348 ? -4.644  -0.311  -29.847 1.00 30.13  ? 326  SER A OG  1 
ATOM   2212 N  N   . ASN A 1 349 ? -4.183  -3.904  -30.685 1.00 33.23  ? 327  ASN A N   1 
ATOM   2213 C  CA  . ASN A 1 349 ? -2.921  -4.584  -30.873 1.00 34.77  ? 327  ASN A CA  1 
ATOM   2214 C  C   . ASN A 1 349 ? -2.200  -4.134  -32.159 1.00 32.77  ? 327  ASN A C   1 
ATOM   2215 O  O   . ASN A 1 349 ? -2.737  -3.378  -32.972 1.00 30.98  ? 327  ASN A O   1 
ATOM   2216 C  CB  . ASN A 1 349 ? -3.081  -6.101  -30.768 1.00 37.49  ? 327  ASN A CB  1 
ATOM   2217 C  CG  . ASN A 1 349 ? -3.909  -6.696  -31.897 1.00 40.33  ? 327  ASN A CG  1 
ATOM   2218 O  OD1 . ASN A 1 349 ? -3.668  -6.457  -33.075 1.00 40.52  ? 327  ASN A OD1 1 
ATOM   2219 N  ND2 . ASN A 1 349 ? -4.876  -7.500  -31.532 1.00 41.87  ? 327  ASN A ND2 1 
ATOM   2220 N  N   . ASP A 1 350 ? -0.973  -4.594  -32.316 1.00 32.48  ? 328  ASP A N   1 
ATOM   2221 C  CA  . ASP A 1 350 ? -0.148  -4.165  -33.437 1.00 31.17  ? 328  ASP A CA  1 
ATOM   2222 C  C   . ASP A 1 350 ? -0.719  -4.672  -34.763 1.00 31.48  ? 328  ASP A C   1 
ATOM   2223 O  O   . ASP A 1 350 ? -0.776  -3.937  -35.740 1.00 30.38  ? 328  ASP A O   1 
ATOM   2224 C  CB  . ASP A 1 350 ? 1.287   -4.692  -33.280 1.00 32.05  ? 328  ASP A CB  1 
ATOM   2225 C  CG  . ASP A 1 350 ? 2.121   -3.889  -32.289 1.00 30.94  ? 328  ASP A CG  1 
ATOM   2226 O  OD1 . ASP A 1 350 ? 1.807   -2.710  -31.990 1.00 29.90  ? 328  ASP A OD1 1 
ATOM   2227 O  OD2 . ASP A 1 350 ? 3.150   -4.436  -31.857 1.00 31.58  ? 328  ASP A OD2 1 
ATOM   2228 N  N   . GLU A 1 351 ? -1.099  -5.931  -34.816 1.00 32.88  ? 329  GLU A N   1 
ATOM   2229 C  CA  . GLU A 1 351 ? -1.515  -6.508  -36.080 1.00 36.81  ? 329  GLU A CA  1 
ATOM   2230 C  C   . GLU A 1 351 ? -2.708  -5.766  -36.672 1.00 35.85  ? 329  GLU A C   1 
ATOM   2231 O  O   . GLU A 1 351 ? -2.740  -5.458  -37.865 1.00 33.96  ? 329  GLU A O   1 
ATOM   2232 C  CB  . GLU A 1 351 ? -1.849  -7.972  -35.923 1.00 41.90  ? 329  GLU A CB  1 
ATOM   2233 C  CG  . GLU A 1 351 ? -2.336  -8.579  -37.209 1.00 46.80  ? 329  GLU A CG  1 
ATOM   2234 C  CD  . GLU A 1 351 ? -2.617  -10.056 -37.080 1.00 53.91  ? 329  GLU A CD  1 
ATOM   2235 O  OE1 . GLU A 1 351 ? -2.002  -10.721 -36.221 1.00 59.15  ? 329  GLU A OE1 1 
ATOM   2236 O  OE2 . GLU A 1 351 ? -3.463  -10.554 -37.851 1.00 59.14  ? 329  GLU A OE2 1 
ATOM   2237 N  N   . GLU A 1 352 ? -3.697  -5.481  -35.843 1.00 35.14  ? 330  GLU A N   1 
ATOM   2238 C  CA  . GLU A 1 352 ? -4.865  -4.776  -36.353 1.00 35.52  ? 330  GLU A CA  1 
ATOM   2239 C  C   . GLU A 1 352 ? -4.537  -3.339  -36.658 1.00 31.90  ? 330  GLU A C   1 
ATOM   2240 O  O   . GLU A 1 352 ? -5.068  -2.803  -37.622 1.00 32.58  ? 330  GLU A O   1 
ATOM   2241 C  CB  . GLU A 1 352 ? -6.094  -4.911  -35.428 1.00 37.60  ? 330  GLU A CB  1 
ATOM   2242 C  CG  . GLU A 1 352 ? -6.025  -4.086  -34.181 1.00 37.00  ? 330  GLU A CG  1 
ATOM   2243 C  CD  . GLU A 1 352 ? -7.080  -4.495  -33.143 1.00 40.17  ? 330  GLU A CD  1 
ATOM   2244 O  OE1 . GLU A 1 352 ? -8.102  -5.109  -33.494 1.00 43.67  ? 330  GLU A OE1 1 
ATOM   2245 O  OE2 . GLU A 1 352 ? -6.875  -4.202  -31.961 1.00 40.51  ? 330  GLU A OE2 1 
ATOM   2246 N  N   . ALA A 1 353 ? -3.652  -2.711  -35.877 1.00 29.94  ? 331  ALA A N   1 
ATOM   2247 C  CA  . ALA A 1 353 ? -3.243  -1.350  -36.160 1.00 28.62  ? 331  ALA A CA  1 
ATOM   2248 C  C   . ALA A 1 353 ? -2.674  -1.249  -37.572 1.00 28.93  ? 331  ALA A C   1 
ATOM   2249 O  O   . ALA A 1 353 ? -3.097  -0.392  -38.339 1.00 28.61  ? 331  ALA A O   1 
ATOM   2250 C  CB  . ALA A 1 353 ? -2.237  -0.836  -35.146 1.00 28.37  ? 331  ALA A CB  1 
ATOM   2251 N  N   . PHE A 1 354 ? -1.730  -2.123  -37.910 1.00 28.62  ? 332  PHE A N   1 
ATOM   2252 C  CA  . PHE A 1 354 ? -1.061  -2.043  -39.206 1.00 28.37  ? 332  PHE A CA  1 
ATOM   2253 C  C   . PHE A 1 354 ? -1.936  -2.516  -40.363 1.00 28.96  ? 332  PHE A C   1 
ATOM   2254 O  O   . PHE A 1 354 ? -1.893  -1.933  -41.435 1.00 29.87  ? 332  PHE A O   1 
ATOM   2255 C  CB  . PHE A 1 354 ? 0.288   -2.761  -39.171 1.00 28.22  ? 332  PHE A CB  1 
ATOM   2256 C  CG  . PHE A 1 354 ? 1.216   -2.206  -38.142 1.00 27.30  ? 332  PHE A CG  1 
ATOM   2257 C  CD1 . PHE A 1 354 ? 1.346   -0.838  -37.968 1.00 26.13  ? 332  PHE A CD1 1 
ATOM   2258 C  CD2 . PHE A 1 354 ? 1.960   -3.040  -37.345 1.00 28.68  ? 332  PHE A CD2 1 
ATOM   2259 C  CE1 . PHE A 1 354 ? 2.193   -0.314  -36.994 1.00 25.68  ? 332  PHE A CE1 1 
ATOM   2260 C  CE2 . PHE A 1 354 ? 2.823   -2.524  -36.384 1.00 28.08  ? 332  PHE A CE2 1 
ATOM   2261 C  CZ  . PHE A 1 354 ? 2.940   -1.168  -36.210 1.00 26.10  ? 332  PHE A CZ  1 
ATOM   2262 N  N   . THR A 1 355 ? -2.753  -3.529  -40.123 1.00 28.95  ? 333  THR A N   1 
ATOM   2263 C  CA  . THR A 1 355 ? -3.746  -3.948  -41.073 1.00 30.62  ? 333  THR A CA  1 
ATOM   2264 C  C   . THR A 1 355 ? -4.646  -2.771  -41.450 1.00 29.69  ? 333  THR A C   1 
ATOM   2265 O  O   . THR A 1 355 ? -4.881  -2.526  -42.623 1.00 28.18  ? 333  THR A O   1 
ATOM   2266 C  CB  . THR A 1 355 ? -4.573  -5.110  -40.499 1.00 32.62  ? 333  THR A CB  1 
ATOM   2267 O  OG1 . THR A 1 355 ? -3.692  -6.200  -40.225 1.00 34.13  ? 333  THR A OG1 1 
ATOM   2268 C  CG2 . THR A 1 355 ? -5.641  -5.574  -41.463 1.00 34.45  ? 333  THR A CG2 1 
ATOM   2269 N  N   . PHE A 1 356 ? -5.152  -2.054  -40.447 1.00 29.50  ? 334  PHE A N   1 
ATOM   2270 C  CA  . PHE A 1 356 ? -6.039  -0.934  -40.698 1.00 29.47  ? 334  PHE A CA  1 
ATOM   2271 C  C   . PHE A 1 356 ? -5.344  0.310   -41.253 1.00 28.51  ? 334  PHE A C   1 
ATOM   2272 O  O   . PHE A 1 356 ? -5.928  1.034   -42.064 1.00 28.12  ? 334  PHE A O   1 
ATOM   2273 C  CB  . PHE A 1 356 ? -6.889  -0.598  -39.456 1.00 29.88  ? 334  PHE A CB  1 
ATOM   2274 C  CG  . PHE A 1 356 ? -8.142  -1.409  -39.368 1.00 31.50  ? 334  PHE A CG  1 
ATOM   2275 C  CD1 . PHE A 1 356 ? -8.113  -2.694  -38.860 1.00 32.71  ? 334  PHE A CD1 1 
ATOM   2276 C  CD2 . PHE A 1 356 ? -9.349  -0.906  -39.856 1.00 32.77  ? 334  PHE A CD2 1 
ATOM   2277 C  CE1 . PHE A 1 356 ? -9.265  -3.452  -38.778 1.00 34.73  ? 334  PHE A CE1 1 
ATOM   2278 C  CE2 . PHE A 1 356 ? -10.506 -1.674  -39.798 1.00 34.54  ? 334  PHE A CE2 1 
ATOM   2279 C  CZ  . PHE A 1 356 ? -10.466 -2.950  -39.267 1.00 35.42  ? 334  PHE A CZ  1 
ATOM   2280 N  N   . ALA A 1 357 ? -4.110  0.555   -40.860 1.00 27.20  ? 335  ALA A N   1 
ATOM   2281 C  CA  . ALA A 1 357 ? -3.386  1.668   -41.472 1.00 28.08  ? 335  ALA A CA  1 
ATOM   2282 C  C   . ALA A 1 357 ? -3.170  1.386   -42.977 1.00 29.55  ? 335  ALA A C   1 
ATOM   2283 O  O   . ALA A 1 357 ? -3.339  2.282   -43.808 1.00 30.18  ? 335  ALA A O   1 
ATOM   2284 C  CB  . ALA A 1 357 ? -2.073  1.932   -40.769 1.00 26.88  ? 335  ALA A CB  1 
ATOM   2285 N  N   . ARG A 1 358 ? -2.837  0.147   -43.332 1.00 30.06  ? 336  ARG A N   1 
ATOM   2286 C  CA  . ARG A 1 358 ? -2.662  -0.175  -44.734 1.00 31.62  ? 336  ARG A CA  1 
ATOM   2287 C  C   . ARG A 1 358 ? -3.980  -0.057  -45.500 1.00 31.87  ? 336  ARG A C   1 
ATOM   2288 O  O   . ARG A 1 358 ? -3.989  0.361   -46.661 1.00 31.21  ? 336  ARG A O   1 
ATOM   2289 C  CB  . ARG A 1 358 ? -2.090  -1.554  -44.902 1.00 33.81  ? 336  ARG A CB  1 
ATOM   2290 C  CG  . ARG A 1 358 ? -0.655  -1.654  -44.435 1.00 35.15  ? 336  ARG A CG  1 
ATOM   2291 C  CD  . ARG A 1 358 ? -0.214  -3.109  -44.597 1.00 40.24  ? 336  ARG A CD  1 
ATOM   2292 N  NE  . ARG A 1 358 ? 1.193   -3.059  -44.877 1.00 44.98  ? 336  ARG A NE  1 
ATOM   2293 C  CZ  . ARG A 1 358 ? 1.813   -3.649  -45.868 1.00 42.35  ? 336  ARG A CZ  1 
ATOM   2294 N  NH1 . ARG A 1 358 ? 1.207   -4.504  -46.685 1.00 44.47  ? 336  ARG A NH1 1 
ATOM   2295 N  NH2 . ARG A 1 358 ? 3.102   -3.426  -45.964 1.00 44.80  ? 336  ARG A NH2 1 
ATOM   2296 N  N   . MET A 1 359 ? -5.067  -0.443  -44.845 1.00 30.66  ? 337  MET A N   1 
ATOM   2297 C  CA  . MET A 1 359 ? -6.397  -0.352  -45.425 1.00 34.31  ? 337  MET A CA  1 
ATOM   2298 C  C   . MET A 1 359 ? -6.826  1.122   -45.646 1.00 31.96  ? 337  MET A C   1 
ATOM   2299 O  O   . MET A 1 359 ? -7.422  1.469   -46.663 1.00 33.13  ? 337  MET A O   1 
ATOM   2300 C  CB  . MET A 1 359 ? -7.386  -1.101  -44.510 1.00 36.15  ? 337  MET A CB  1 
ATOM   2301 C  CG  . MET A 1 359 ? -8.741  -1.371  -45.086 1.00 42.01  ? 337  MET A CG  1 
ATOM   2302 S  SD  . MET A 1 359 ? -9.840  -2.187  -43.874 1.00 47.50  ? 337  MET A SD  1 
ATOM   2303 C  CE  . MET A 1 359 ? -8.881  -3.637  -43.451 1.00 44.54  ? 337  MET A CE  1 
ATOM   2304 N  N   . LEU A 1 360 ? -6.522  1.982   -44.692 1.00 30.52  ? 338  LEU A N   1 
ATOM   2305 C  CA  . LEU A 1 360 ? -6.789  3.418   -44.836 1.00 31.09  ? 338  LEU A CA  1 
ATOM   2306 C  C   . LEU A 1 360 ? -6.070  3.993   -46.066 1.00 30.17  ? 338  LEU A C   1 
ATOM   2307 O  O   . LEU A 1 360 ? -6.663  4.730   -46.841 1.00 30.64  ? 338  LEU A O   1 
ATOM   2308 C  CB  . LEU A 1 360 ? -6.380  4.172   -43.573 1.00 30.05  ? 338  LEU A CB  1 
ATOM   2309 C  CG  . LEU A 1 360 ? -7.360  3.973   -42.409 1.00 30.56  ? 338  LEU A CG  1 
ATOM   2310 C  CD1 . LEU A 1 360 ? -6.701  4.343   -41.096 1.00 29.32  ? 338  LEU A CD1 1 
ATOM   2311 C  CD2 . LEU A 1 360 ? -8.620  4.804   -42.643 1.00 31.08  ? 338  LEU A CD2 1 
ATOM   2312 N  N   . ILE A 1 361 ? -4.827  3.582   -46.280 1.00 29.21  ? 339  ILE A N   1 
ATOM   2313 C  CA  . ILE A 1 361 ? -4.098  3.982   -47.484 1.00 29.16  ? 339  ILE A CA  1 
ATOM   2314 C  C   . ILE A 1 361 ? -4.725  3.421   -48.739 1.00 31.76  ? 339  ILE A C   1 
ATOM   2315 O  O   . ILE A 1 361 ? -5.019  4.165   -49.665 1.00 32.65  ? 339  ILE A O   1 
ATOM   2316 C  CB  . ILE A 1 361 ? -2.619  3.562   -47.397 1.00 30.23  ? 339  ILE A CB  1 
ATOM   2317 C  CG1 . ILE A 1 361 ? -1.950  4.259   -46.213 1.00 28.66  ? 339  ILE A CG1 1 
ATOM   2318 C  CG2 . ILE A 1 361 ? -1.866  3.925   -48.669 1.00 31.71  ? 339  ILE A CG2 1 
ATOM   2319 C  CD1 . ILE A 1 361 ? -0.571  3.745   -45.908 1.00 29.69  ? 339  ILE A CD1 1 
ATOM   2320 N  N   . ALA A 1 362 ? -4.948  2.102   -48.768 1.00 32.70  ? 340  ALA A N   1 
ATOM   2321 C  CA  . ALA A 1 362 ? -5.364  1.418   -49.968 1.00 34.07  ? 340  ALA A CA  1 
ATOM   2322 C  C   . ALA A 1 362 ? -6.821  1.702   -50.367 1.00 35.72  ? 340  ALA A C   1 
ATOM   2323 O  O   . ALA A 1 362 ? -7.152  1.688   -51.545 1.00 34.54  ? 340  ALA A O   1 
ATOM   2324 C  CB  . ALA A 1 362 ? -5.149  -0.098  -49.824 1.00 35.65  ? 340  ALA A CB  1 
ATOM   2325 N  N   . GLN A 1 363 ? -7.687  1.909   -49.387 1.00 35.40  ? 341  GLN A N   1 
ATOM   2326 C  CA  . GLN A 1 363 ? -9.096  2.064   -49.662 1.00 39.05  ? 341  GLN A CA  1 
ATOM   2327 C  C   . GLN A 1 363 ? -9.589  3.503   -49.604 1.00 37.47  ? 341  GLN A C   1 
ATOM   2328 O  O   . GLN A 1 363 ? -10.558 3.827   -50.269 1.00 38.42  ? 341  GLN A O   1 
ATOM   2329 C  CB  . GLN A 1 363 ? -9.906  1.193   -48.708 1.00 42.53  ? 341  GLN A CB  1 
ATOM   2330 C  CG  . GLN A 1 363 ? -9.668  -0.285  -48.930 1.00 47.26  ? 341  GLN A CG  1 
ATOM   2331 C  CD  . GLN A 1 363 ? -10.780 -1.125  -48.355 1.00 53.64  ? 341  GLN A CD  1 
ATOM   2332 O  OE1 . GLN A 1 363 ? -10.612 -1.792  -47.339 1.00 58.67  ? 341  GLN A OE1 1 
ATOM   2333 N  NE2 . GLN A 1 363 ? -11.937 -1.075  -48.990 1.00 59.39  ? 341  GLN A NE2 1 
ATOM   2334 N  N   . GLU A 1 364 ? -8.946  4.345   -48.808 1.00 33.59  ? 342  GLU A N   1 
ATOM   2335 C  CA  . GLU A 1 364 ? -9.377  5.728   -48.636 1.00 34.81  ? 342  GLU A CA  1 
ATOM   2336 C  C   . GLU A 1 364 ? -8.356  6.738   -49.151 1.00 33.26  ? 342  GLU A C   1 
ATOM   2337 O  O   . GLU A 1 364 ? -8.665  7.910   -49.282 1.00 32.13  ? 342  GLU A O   1 
ATOM   2338 C  CB  . GLU A 1 364 ? -9.676  6.026   -47.146 1.00 33.58  ? 342  GLU A CB  1 
ATOM   2339 C  CG  . GLU A 1 364 ? -10.623 5.035   -46.479 1.00 34.48  ? 342  GLU A CG  1 
ATOM   2340 C  CD  . GLU A 1 364 ? -12.061 5.107   -46.965 1.00 37.67  ? 342  GLU A CD  1 
ATOM   2341 O  OE1 . GLU A 1 364 ? -12.520 6.183   -47.416 1.00 40.82  ? 342  GLU A OE1 1 
ATOM   2342 O  OE2 . GLU A 1 364 ? -12.761 4.083   -46.878 1.00 36.16  ? 342  GLU A OE2 1 
ATOM   2343 N  N   . GLY A 1 365 ? -7.135  6.299   -49.455 1.00 34.15  ? 343  GLY A N   1 
ATOM   2344 C  CA  . GLY A 1 365 ? -6.097  7.228   -49.910 1.00 32.43  ? 343  GLY A CA  1 
ATOM   2345 C  C   . GLY A 1 365 ? -5.644  8.163   -48.805 1.00 31.81  ? 343  GLY A C   1 
ATOM   2346 O  O   . GLY A 1 365 ? -5.130  9.253   -49.070 1.00 31.91  ? 343  GLY A O   1 
ATOM   2347 N  N   . LEU A 1 366 ? -5.776  7.723   -47.558 1.00 31.56  ? 344  LEU A N   1 
ATOM   2348 C  CA  . LEU A 1 366 ? -5.345  8.512   -46.404 1.00 29.66  ? 344  LEU A CA  1 
ATOM   2349 C  C   . LEU A 1 366 ? -3.952  8.067   -45.954 1.00 30.68  ? 344  LEU A C   1 
ATOM   2350 O  O   . LEU A 1 366 ? -3.764  6.927   -45.487 1.00 29.14  ? 344  LEU A O   1 
ATOM   2351 C  CB  . LEU A 1 366 ? -6.361  8.347   -45.290 1.00 30.29  ? 344  LEU A CB  1 
ATOM   2352 C  CG  . LEU A 1 366 ? -7.772  8.844   -45.607 1.00 30.92  ? 344  LEU A CG  1 
ATOM   2353 C  CD1 . LEU A 1 366 ? -8.717  8.459   -44.498 1.00 31.94  ? 344  LEU A CD1 1 
ATOM   2354 C  CD2 . LEU A 1 366 ? -7.804  10.352  -45.805 1.00 32.01  ? 344  LEU A CD2 1 
ATOM   2355 N  N   . LEU A 1 367 ? -2.960  8.952   -46.134 1.00 30.03  ? 345  LEU A N   1 
ATOM   2356 C  CA  . LEU A 1 367 ? -1.570  8.565   -45.998 1.00 29.51  ? 345  LEU A CA  1 
ATOM   2357 C  C   . LEU A 1 367 ? -1.131  8.779   -44.554 1.00 28.49  ? 345  LEU A C   1 
ATOM   2358 O  O   . LEU A 1 367 ? -0.290  9.645   -44.244 1.00 26.50  ? 345  LEU A O   1 
ATOM   2359 C  CB  . LEU A 1 367 ? -0.693  9.323   -46.989 1.00 30.87  ? 345  LEU A CB  1 
ATOM   2360 C  CG  . LEU A 1 367 ? -0.874  8.869   -48.428 1.00 33.42  ? 345  LEU A CG  1 
ATOM   2361 C  CD1 . LEU A 1 367 ? -0.195  9.865   -49.351 1.00 35.91  ? 345  LEU A CD1 1 
ATOM   2362 C  CD2 . LEU A 1 367 ? -0.304  7.475   -48.613 1.00 35.67  ? 345  LEU A CD2 1 
ATOM   2363 N  N   . CYS A 1 368 ? -1.712  7.939   -43.694 1.00 27.74  ? 346  CYS A N   1 
ATOM   2364 C  CA  . CYS A 1 368 ? -1.606  8.076   -42.259 1.00 28.29  ? 346  CYS A CA  1 
ATOM   2365 C  C   . CYS A 1 368 ? -0.678  7.033   -41.624 1.00 27.12  ? 346  CYS A C   1 
ATOM   2366 O  O   . CYS A 1 368 ? -0.185  6.119   -42.289 1.00 26.56  ? 346  CYS A O   1 
ATOM   2367 C  CB  . CYS A 1 368 ? -3.022  8.005   -41.630 1.00 28.55  ? 346  CYS A CB  1 
ATOM   2368 S  SG  . CYS A 1 368 ? -3.844  6.428   -41.867 1.00 32.54  ? 346  CYS A SG  1 
ATOM   2369 N  N   . GLY A 1 369 ? -0.495  7.153   -40.311 1.00 26.21  ? 347  GLY A N   1 
ATOM   2370 C  CA  . GLY A 1 369 ? 0.420   6.305   -39.539 1.00 26.24  ? 347  GLY A CA  1 
ATOM   2371 C  C   . GLY A 1 369 ? -0.229  5.166   -38.769 1.00 26.59  ? 347  GLY A C   1 
ATOM   2372 O  O   . GLY A 1 369 ? -1.400  4.857   -38.961 1.00 26.21  ? 347  GLY A O   1 
ATOM   2373 N  N   . GLY A 1 370 ? 0.558   4.532   -37.898 1.00 25.59  ? 348  GLY A N   1 
ATOM   2374 C  CA  . GLY A 1 370 ? 0.145   3.327   -37.224 1.00 25.39  ? 348  GLY A CA  1 
ATOM   2375 C  C   . GLY A 1 370 ? -1.011  3.538   -36.251 1.00 24.86  ? 348  GLY A C   1 
ATOM   2376 O  O   . GLY A 1 370 ? -1.943  2.724   -36.208 1.00 26.35  ? 348  GLY A O   1 
ATOM   2377 N  N   . SER A 1 371 ? -0.930  4.575   -35.436 1.00 24.08  ? 349  SER A N   1 
ATOM   2378 C  CA  . SER A 1 371 ? -1.965  4.809   -34.412 1.00 24.70  ? 349  SER A CA  1 
ATOM   2379 C  C   . SER A 1 371 ? -3.288  5.198   -35.047 1.00 25.46  ? 349  SER A C   1 
ATOM   2380 O  O   . SER A 1 371 ? -4.338  5.011   -34.430 1.00 24.48  ? 349  SER A O   1 
ATOM   2381 C  CB  . SER A 1 371 ? -1.556  5.864   -33.406 1.00 25.08  ? 349  SER A CB  1 
ATOM   2382 O  OG  . SER A 1 371 ? -1.463  7.159   -33.976 1.00 23.11  ? 349  SER A OG  1 
ATOM   2383 N  N   . ALA A 1 372 ? -3.247  5.729   -36.276 1.00 24.34  ? 350  ALA A N   1 
ATOM   2384 C  CA  . ALA A 1 372 ? -4.466  5.989   -37.052 1.00 25.29  ? 350  ALA A CA  1 
ATOM   2385 C  C   . ALA A 1 372 ? -5.183  4.687   -37.313 1.00 26.35  ? 350  ALA A C   1 
ATOM   2386 O  O   . ALA A 1 372 ? -6.427  4.592   -37.209 1.00 27.98  ? 350  ALA A O   1 
ATOM   2387 C  CB  . ALA A 1 372 ? -4.136  6.704   -38.370 1.00 25.14  ? 350  ALA A CB  1 
ATOM   2388 N  N   . GLY A 1 373 ? -4.397  3.659   -37.620 1.00 26.71  ? 351  GLY A N   1 
ATOM   2389 C  CA  . GLY A 1 373 ? -4.914  2.318   -37.799 1.00 26.49  ? 351  GLY A CA  1 
ATOM   2390 C  C   . GLY A 1 373 ? -5.507  1.720   -36.521 1.00 27.21  ? 351  GLY A C   1 
ATOM   2391 O  O   . GLY A 1 373 ? -6.564  1.051   -36.546 1.00 25.99  ? 351  GLY A O   1 
ATOM   2392 N  N   . SER A 1 374 ? -4.813  1.920   -35.408 1.00 26.48  ? 352  SER A N   1 
ATOM   2393 C  CA  . SER A 1 374 ? -5.327  1.446   -34.122 1.00 27.68  ? 352  SER A CA  1 
ATOM   2394 C  C   . SER A 1 374 ? -6.729  2.030   -33.886 1.00 26.79  ? 352  SER A C   1 
ATOM   2395 O  O   . SER A 1 374 ? -7.639  1.327   -33.429 1.00 28.95  ? 352  SER A O   1 
ATOM   2396 C  CB  . SER A 1 374 ? -4.413  1.880   -32.973 1.00 27.43  ? 352  SER A CB  1 
ATOM   2397 O  OG  . SER A 1 374 ? -3.066  1.452   -33.141 1.00 28.78  ? 352  SER A OG  1 
ATOM   2398 N  N   . THR A 1 375 ? -6.861  3.320   -34.170 1.00 25.73  ? 353  THR A N   1 
ATOM   2399 C  CA  . THR A 1 375 ? -8.073  4.080   -33.901 1.00 26.70  ? 353  THR A CA  1 
ATOM   2400 C  C   . THR A 1 375 ? -9.234  3.598   -34.745 1.00 27.00  ? 353  THR A C   1 
ATOM   2401 O  O   . THR A 1 375 ? -10.333 3.365   -34.239 1.00 26.76  ? 353  THR A O   1 
ATOM   2402 C  CB  . THR A 1 375 ? -7.819  5.593   -34.081 1.00 26.41  ? 353  THR A CB  1 
ATOM   2403 O  OG1 . THR A 1 375 ? -6.713  5.974   -33.263 1.00 27.09  ? 353  THR A OG1 1 
ATOM   2404 C  CG2 . THR A 1 375 ? -9.044  6.405   -33.630 1.00 28.46  ? 353  THR A CG2 1 
ATOM   2405 N  N   . VAL A 1 376 ? -8.978  3.367   -36.026 1.00 26.49  ? 354  VAL A N   1 
ATOM   2406 C  CA  . VAL A 1 376 ? -10.026 2.908   -36.900 1.00 27.81  ? 354  VAL A CA  1 
ATOM   2407 C  C   . VAL A 1 376 ? -10.370 1.433   -36.652 1.00 29.70  ? 354  VAL A C   1 
ATOM   2408 O  O   . VAL A 1 376 ? -11.534 1.030   -36.789 1.00 29.98  ? 354  VAL A O   1 
ATOM   2409 C  CB  . VAL A 1 376 ? -9.713  3.218   -38.369 1.00 27.31  ? 354  VAL A CB  1 
ATOM   2410 C  CG1 . VAL A 1 376 ? -10.773 2.641   -39.272 1.00 30.15  ? 354  VAL A CG1 1 
ATOM   2411 C  CG2 . VAL A 1 376 ? -9.639  4.715   -38.567 1.00 27.81  ? 354  VAL A CG2 1 
ATOM   2412 N  N   . ALA A 1 377 ? -9.378  0.634   -36.271 1.00 29.68  ? 355  ALA A N   1 
ATOM   2413 C  CA  . ALA A 1 377 ? -9.628  -0.750  -35.912 1.00 31.51  ? 355  ALA A CA  1 
ATOM   2414 C  C   . ALA A 1 377 ? -10.651 -0.839  -34.761 1.00 31.68  ? 355  ALA A C   1 
ATOM   2415 O  O   . ALA A 1 377 ? -11.519 -1.706  -34.741 1.00 33.44  ? 355  ALA A O   1 
ATOM   2416 C  CB  . ALA A 1 377 ? -8.327  -1.424  -35.511 1.00 31.71  ? 355  ALA A CB  1 
ATOM   2417 N  N   . VAL A 1 378 ? -10.501 0.042   -33.792 1.00 30.06  ? 356  VAL A N   1 
ATOM   2418 C  CA  . VAL A 1 378 ? -11.445 0.124   -32.706 1.00 31.90  ? 356  VAL A CA  1 
ATOM   2419 C  C   . VAL A 1 378 ? -12.768 0.755   -33.143 1.00 32.14  ? 356  VAL A C   1 
ATOM   2420 O  O   . VAL A 1 378 ? -13.833 0.248   -32.789 1.00 34.68  ? 356  VAL A O   1 
ATOM   2421 C  CB  . VAL A 1 378 ? -10.869 0.853   -31.493 1.00 30.49  ? 356  VAL A CB  1 
ATOM   2422 C  CG1 . VAL A 1 378 ? -11.981 1.205   -30.502 1.00 31.29  ? 356  VAL A CG1 1 
ATOM   2423 C  CG2 . VAL A 1 378 ? -9.831  -0.030  -30.811 1.00 30.51  ? 356  VAL A CG2 1 
ATOM   2424 N  N   . ALA A 1 379 ? -12.719 1.829   -33.918 1.00 31.17  ? 357  ALA A N   1 
ATOM   2425 C  CA  . ALA A 1 379 ? -13.964 2.511   -34.323 1.00 31.94  ? 357  ALA A CA  1 
ATOM   2426 C  C   . ALA A 1 379 ? -14.963 1.567   -35.004 1.00 34.55  ? 357  ALA A C   1 
ATOM   2427 O  O   . ALA A 1 379 ? -16.182 1.634   -34.732 1.00 35.29  ? 357  ALA A O   1 
ATOM   2428 C  CB  . ALA A 1 379 ? -13.657 3.728   -35.183 1.00 30.72  ? 357  ALA A CB  1 
ATOM   2429 N  N   . VAL A 1 380 ? -14.481 0.654   -35.856 1.00 33.80  ? 358  VAL A N   1 
ATOM   2430 C  CA  . VAL A 1 380 ? -15.414 -0.253  -36.540 1.00 35.12  ? 358  VAL A CA  1 
ATOM   2431 C  C   . VAL A 1 380 ? -16.056 -1.275  -35.609 1.00 36.48  ? 358  VAL A C   1 
ATOM   2432 O  O   . VAL A 1 380 ? -17.007 -1.928  -36.012 1.00 38.71  ? 358  VAL A O   1 
ATOM   2433 C  CB  . VAL A 1 380 ? -14.803 -0.981  -37.765 1.00 36.14  ? 358  VAL A CB  1 
ATOM   2434 C  CG1 . VAL A 1 380 ? -14.303 0.022   -38.784 1.00 34.85  ? 358  VAL A CG1 1 
ATOM   2435 C  CG2 . VAL A 1 380 ? -13.712 -1.975  -37.361 1.00 35.93  ? 358  VAL A CG2 1 
ATOM   2436 N  N   . LYS A 1 381 ? -15.537 -1.426  -34.387 1.00 36.30  ? 359  LYS A N   1 
ATOM   2437 C  CA  . LYS A 1 381 ? -16.219 -2.186  -33.346 1.00 38.36  ? 359  LYS A CA  1 
ATOM   2438 C  C   . LYS A 1 381 ? -17.067 -1.237  -32.502 1.00 36.84  ? 359  LYS A C   1 
ATOM   2439 O  O   . LYS A 1 381 ? -18.224 -1.511  -32.282 1.00 36.62  ? 359  LYS A O   1 
ATOM   2440 C  CB  . LYS A 1 381 ? -15.249 -2.922  -32.412 1.00 41.01  ? 359  LYS A CB  1 
ATOM   2441 C  CG  . LYS A 1 381 ? -14.172 -3.769  -33.091 1.00 43.73  ? 359  LYS A CG  1 
ATOM   2442 C  CD  . LYS A 1 381 ? -13.185 -4.362  -32.072 1.00 46.41  ? 359  LYS A CD  1 
ATOM   2443 C  CE  . LYS A 1 381 ? -11.741 -3.978  -32.379 1.00 47.98  ? 359  LYS A CE  1 
ATOM   2444 N  NZ  . LYS A 1 381 ? -10.758 -5.026  -31.994 1.00 50.33  ? 359  LYS A NZ  1 
ATOM   2445 N  N   . ALA A 1 382 ? -16.479 -0.138  -32.032 1.00 34.31  ? 360  ALA A N   1 
ATOM   2446 C  CA  . ALA A 1 382 ? -17.155 0.743   -31.048 1.00 35.00  ? 360  ALA A CA  1 
ATOM   2447 C  C   . ALA A 1 382 ? -18.449 1.316   -31.608 1.00 36.39  ? 360  ALA A C   1 
ATOM   2448 O  O   . ALA A 1 382 ? -19.466 1.380   -30.920 1.00 37.27  ? 360  ALA A O   1 
ATOM   2449 C  CB  . ALA A 1 382 ? -16.235 1.874   -30.610 1.00 32.71  ? 360  ALA A CB  1 
ATOM   2450 N  N   . ALA A 1 383 ? -18.389 1.692   -32.882 1.00 37.22  ? 361  ALA A N   1 
ATOM   2451 C  CA  . ALA A 1 383 ? -19.490 2.331   -33.577 1.00 38.72  ? 361  ALA A CA  1 
ATOM   2452 C  C   . ALA A 1 383 ? -20.532 1.360   -34.103 1.00 41.07  ? 361  ALA A C   1 
ATOM   2453 O  O   . ALA A 1 383 ? -21.490 1.790   -34.727 1.00 42.05  ? 361  ALA A O   1 
ATOM   2454 C  CB  . ALA A 1 383 ? -18.935 3.216   -34.694 1.00 37.58  ? 361  ALA A CB  1 
ATOM   2455 N  N   . GLN A 1 384 ? -20.390 0.059   -33.825 1.00 42.14  ? 362  GLN A N   1 
ATOM   2456 C  CA  . GLN A 1 384 ? -21.437 -0.879  -34.151 1.00 45.53  ? 362  GLN A CA  1 
ATOM   2457 C  C   . GLN A 1 384 ? -22.696 -0.523  -33.342 1.00 48.62  ? 362  GLN A C   1 
ATOM   2458 O  O   . GLN A 1 384 ? -23.786 -0.855  -33.761 1.00 48.25  ? 362  GLN A O   1 
ATOM   2459 C  CB  . GLN A 1 384 ? -21.042 -2.338  -33.842 1.00 47.45  ? 362  GLN A CB  1 
ATOM   2460 C  CG  . GLN A 1 384 ? -19.931 -2.909  -34.720 1.00 47.49  ? 362  GLN A CG  1 
ATOM   2461 C  CD  . GLN A 1 384 ? -20.401 -3.232  -36.125 1.00 49.05  ? 362  GLN A CD  1 
ATOM   2462 O  OE1 . GLN A 1 384 ? -21.510 -3.668  -36.318 1.00 51.03  ? 362  GLN A OE1 1 
ATOM   2463 N  NE2 . GLN A 1 384 ? -19.548 -3.000  -37.110 1.00 49.15  ? 362  GLN A NE2 1 
ATOM   2464 N  N   . GLU A 1 385 ? -22.548 0.148   -32.194 1.00 49.89  ? 363  GLU A N   1 
ATOM   2465 C  CA  . GLU A 1 385 ? -23.728 0.488   -31.372 1.00 57.30  ? 363  GLU A CA  1 
ATOM   2466 C  C   . GLU A 1 385 ? -24.577 1.643   -31.935 1.00 55.61  ? 363  GLU A C   1 
ATOM   2467 O  O   . GLU A 1 385 ? -25.685 1.864   -31.463 1.00 59.21  ? 363  GLU A O   1 
ATOM   2468 C  CB  . GLU A 1 385 ? -23.323 0.779   -29.914 1.00 59.12  ? 363  GLU A CB  1 
ATOM   2469 C  CG  . GLU A 1 385 ? -22.586 2.084   -29.680 1.00 59.28  ? 363  GLU A CG  1 
ATOM   2470 C  CD  . GLU A 1 385 ? -22.334 2.345   -28.207 1.00 63.14  ? 363  GLU A CD  1 
ATOM   2471 O  OE1 . GLU A 1 385 ? -22.691 1.475   -27.386 1.00 71.59  ? 363  GLU A OE1 1 
ATOM   2472 O  OE2 . GLU A 1 385 ? -21.788 3.419   -27.864 1.00 64.84  ? 363  GLU A OE2 1 
ATOM   2473 N  N   . LEU A 1 386 ? -24.043 2.357   -32.930 1.00 51.52  ? 364  LEU A N   1 
ATOM   2474 C  CA  . LEU A 1 386 ? -24.726 3.461   -33.601 1.00 50.38  ? 364  LEU A CA  1 
ATOM   2475 C  C   . LEU A 1 386 ? -25.610 2.984   -34.749 1.00 51.48  ? 364  LEU A C   1 
ATOM   2476 O  O   . LEU A 1 386 ? -25.366 1.950   -35.351 1.00 50.08  ? 364  LEU A O   1 
ATOM   2477 C  CB  . LEU A 1 386 ? -23.707 4.473   -34.121 1.00 48.06  ? 364  LEU A CB  1 
ATOM   2478 C  CG  . LEU A 1 386 ? -22.788 5.037   -33.034 1.00 46.36  ? 364  LEU A CG  1 
ATOM   2479 C  CD1 . LEU A 1 386 ? -21.823 6.039   -33.636 1.00 43.80  ? 364  LEU A CD1 1 
ATOM   2480 C  CD2 . LEU A 1 386 ? -23.623 5.673   -31.925 1.00 48.16  ? 364  LEU A CD2 1 
ATOM   2481 N  N   . GLN A 1 387 ? -26.674 3.745   -35.016 1.00 52.66  ? 365  GLN A N   1 
ATOM   2482 C  CA  . GLN A 1 387 ? -27.586 3.459   -36.110 1.00 53.51  ? 365  GLN A CA  1 
ATOM   2483 C  C   . GLN A 1 387 ? -27.362 4.408   -37.286 1.00 53.62  ? 365  GLN A C   1 
ATOM   2484 O  O   . GLN A 1 387 ? -26.544 5.337   -37.225 1.00 50.42  ? 365  GLN A O   1 
ATOM   2485 C  CB  . GLN A 1 387 ? -29.031 3.537   -35.617 1.00 56.79  ? 365  GLN A CB  1 
ATOM   2486 C  CG  . GLN A 1 387 ? -29.538 4.908   -35.219 1.00 56.86  ? 365  GLN A CG  1 
ATOM   2487 C  CD  . GLN A 1 387 ? -31.009 4.849   -34.836 1.00 60.65  ? 365  GLN A CD  1 
ATOM   2488 O  OE1 . GLN A 1 387 ? -31.391 4.165   -33.882 1.00 61.90  ? 365  GLN A OE1 1 
ATOM   2489 N  NE2 . GLN A 1 387 ? -31.847 5.547   -35.594 1.00 62.43  ? 365  GLN A NE2 1 
ATOM   2490 N  N   . GLU A 1 388 ? -28.079 4.144   -38.371 1.00 56.57  ? 366  GLU A N   1 
ATOM   2491 C  CA  . GLU A 1 388 ? -28.035 4.980   -39.563 1.00 59.21  ? 366  GLU A CA  1 
ATOM   2492 C  C   . GLU A 1 388 ? -28.434 6.394   -39.165 1.00 58.55  ? 366  GLU A C   1 
ATOM   2493 O  O   . GLU A 1 388 ? -29.375 6.578   -38.378 1.00 58.79  ? 366  GLU A O   1 
ATOM   2494 C  CB  . GLU A 1 388 ? -29.027 4.455   -40.622 1.00 65.98  ? 366  GLU A CB  1 
ATOM   2495 C  CG  . GLU A 1 388 ? -28.637 4.819   -42.050 1.00 68.98  ? 366  GLU A CG  1 
ATOM   2496 C  CD  . GLU A 1 388 ? -29.781 4.682   -43.037 1.00 75.15  ? 366  GLU A CD  1 
ATOM   2497 O  OE1 . GLU A 1 388 ? -30.773 3.974   -42.753 1.00 78.30  ? 366  GLU A OE1 1 
ATOM   2498 O  OE2 . GLU A 1 388 ? -29.686 5.293   -44.116 1.00 80.27  ? 366  GLU A OE2 1 
ATOM   2499 N  N   . GLY A 1 389 ? -27.744 7.386   -39.713 1.00 55.44  ? 367  GLY A N   1 
ATOM   2500 C  CA  . GLY A 1 389 ? -28.008 8.771   -39.355 1.00 55.33  ? 367  GLY A CA  1 
ATOM   2501 C  C   . GLY A 1 389 ? -27.192 9.291   -38.179 1.00 52.91  ? 367  GLY A C   1 
ATOM   2502 O  O   . GLY A 1 389 ? -27.243 10.474  -37.888 1.00 54.37  ? 367  GLY A O   1 
ATOM   2503 N  N   . GLN A 1 390 ? -26.443 8.437   -37.482 1.00 49.89  ? 368  GLN A N   1 
ATOM   2504 C  CA  . GLN A 1 390 ? -25.554 8.931   -36.441 1.00 47.33  ? 368  GLN A CA  1 
ATOM   2505 C  C   . GLN A 1 390 ? -24.164 9.098   -37.019 1.00 44.51  ? 368  GLN A C   1 
ATOM   2506 O  O   . GLN A 1 390 ? -23.916 8.699   -38.144 1.00 44.04  ? 368  GLN A O   1 
ATOM   2507 C  CB  . GLN A 1 390 ? -25.547 7.991   -35.239 1.00 47.96  ? 368  GLN A CB  1 
ATOM   2508 C  CG  . GLN A 1 390 ? -26.839 8.067   -34.417 1.00 51.26  ? 368  GLN A CG  1 
ATOM   2509 C  CD  . GLN A 1 390 ? -26.698 7.207   -33.153 1.00 52.27  ? 368  GLN A CD  1 
ATOM   2510 O  OE1 . GLN A 1 390 ? -26.792 5.996   -33.210 1.00 53.80  ? 368  GLN A OE1 1 
ATOM   2511 N  NE2 . GLN A 1 390 ? -26.467 7.847   -32.011 1.00 53.12  ? 368  GLN A NE2 1 
ATOM   2512 N  N   . ARG A 1 391 ? -23.255 9.676   -36.242 1.00 42.58  ? 369  ARG A N   1 
ATOM   2513 C  CA  . ARG A 1 391 ? -21.955 10.057  -36.736 1.00 40.39  ? 369  ARG A CA  1 
ATOM   2514 C  C   . ARG A 1 391 ? -20.857 9.741   -35.729 1.00 37.85  ? 369  ARG A C   1 
ATOM   2515 O  O   . ARG A 1 391 ? -20.991 10.051  -34.543 1.00 36.24  ? 369  ARG A O   1 
ATOM   2516 C  CB  . ARG A 1 391 ? -21.986 11.545  -37.037 1.00 42.04  ? 369  ARG A CB  1 
ATOM   2517 C  CG  . ARG A 1 391 ? -20.652 12.176  -37.385 1.00 40.22  ? 369  ARG A CG  1 
ATOM   2518 C  CD  . ARG A 1 391 ? -20.887 13.640  -37.720 1.00 43.16  ? 369  ARG A CD  1 
ATOM   2519 N  NE  . ARG A 1 391 ? -21.615 13.810  -38.979 1.00 45.89  ? 369  ARG A NE  1 
ATOM   2520 C  CZ  . ARG A 1 391 ? -22.227 14.920  -39.373 1.00 47.76  ? 369  ARG A CZ  1 
ATOM   2521 N  NH1 . ARG A 1 391 ? -22.280 15.993  -38.593 1.00 48.34  ? 369  ARG A NH1 1 
ATOM   2522 N  NH2 . ARG A 1 391 ? -22.818 14.945  -40.559 1.00 50.48  ? 369  ARG A NH2 1 
ATOM   2523 N  N   . CYS A 1 392 ? -19.796 9.102   -36.222 1.00 35.49  ? 370  CYS A N   1 
ATOM   2524 C  CA  . CYS A 1 392 ? -18.612 8.785   -35.442 1.00 34.91  ? 370  CYS A CA  1 
ATOM   2525 C  C   . CYS A 1 392 ? -17.423 9.500   -36.065 1.00 33.23  ? 370  CYS A C   1 
ATOM   2526 O  O   . CYS A 1 392 ? -17.221 9.397   -37.264 1.00 33.84  ? 370  CYS A O   1 
ATOM   2527 C  CB  . CYS A 1 392 ? -18.348 7.260   -35.427 1.00 35.23  ? 370  CYS A CB  1 
ATOM   2528 S  SG  . CYS A 1 392 ? -16.890 6.750   -34.464 1.00 36.45  ? 370  CYS A SG  1 
ATOM   2529 N  N   . VAL A 1 393 ? -16.636 10.204  -35.250 1.00 32.12  ? 371  VAL A N   1 
ATOM   2530 C  CA  . VAL A 1 393 ? -15.423 10.856  -35.700 1.00 31.05  ? 371  VAL A CA  1 
ATOM   2531 C  C   . VAL A 1 393 ? -14.213 10.124  -35.130 1.00 29.85  ? 371  VAL A C   1 
ATOM   2532 O  O   . VAL A 1 393 ? -14.204 9.759   -33.957 1.00 29.33  ? 371  VAL A O   1 
ATOM   2533 C  CB  . VAL A 1 393 ? -15.407 12.341  -35.252 1.00 31.63  ? 371  VAL A CB  1 
ATOM   2534 C  CG1 . VAL A 1 393 ? -14.063 12.994  -35.524 1.00 30.22  ? 371  VAL A CG1 1 
ATOM   2535 C  CG2 . VAL A 1 393 ? -16.508 13.095  -35.963 1.00 34.25  ? 371  VAL A CG2 1 
ATOM   2536 N  N   . VAL A 1 394 ? -13.207 9.899   -35.965 1.00 28.73  ? 372  VAL A N   1 
ATOM   2537 C  CA  . VAL A 1 394 ? -11.949 9.309   -35.513 1.00 28.08  ? 372  VAL A CA  1 
ATOM   2538 C  C   . VAL A 1 394 ? -10.818 10.315  -35.677 1.00 27.06  ? 372  VAL A C   1 
ATOM   2539 O  O   . VAL A 1 394 ? -10.785 11.097  -36.630 1.00 27.77  ? 372  VAL A O   1 
ATOM   2540 C  CB  . VAL A 1 394 ? -11.587 8.023   -36.267 1.00 28.22  ? 372  VAL A CB  1 
ATOM   2541 C  CG1 . VAL A 1 394 ? -12.594 6.937   -35.984 1.00 30.92  ? 372  VAL A CG1 1 
ATOM   2542 C  CG2 . VAL A 1 394 ? -11.506 8.264   -37.764 1.00 28.96  ? 372  VAL A CG2 1 
ATOM   2543 N  N   . ILE A 1 395 ? -9.881  10.300  -34.741 1.00 26.79  ? 373  ILE A N   1 
ATOM   2544 C  CA  . ILE A 1 395 ? -8.690  11.143  -34.875 1.00 25.42  ? 373  ILE A CA  1 
ATOM   2545 C  C   . ILE A 1 395 ? -7.584  10.315  -35.522 1.00 25.10  ? 373  ILE A C   1 
ATOM   2546 O  O   . ILE A 1 395 ? -7.251  9.229   -35.011 1.00 25.35  ? 373  ILE A O   1 
ATOM   2547 C  CB  . ILE A 1 395 ? -8.212  11.648  -33.500 1.00 25.91  ? 373  ILE A CB  1 
ATOM   2548 C  CG1 . ILE A 1 395 ? -9.358  12.363  -32.762 1.00 26.80  ? 373  ILE A CG1 1 
ATOM   2549 C  CG2 . ILE A 1 395 ? -6.976  12.541  -33.650 1.00 25.06  ? 373  ILE A CG2 1 
ATOM   2550 C  CD1 . ILE A 1 395 ? -9.879  13.594  -33.464 1.00 26.91  ? 373  ILE A CD1 1 
ATOM   2551 N  N   . LEU A 1 396 ? -7.028  10.827  -36.631 1.00 25.05  ? 374  LEU A N   1 
ATOM   2552 C  CA  . LEU A 1 396 ? -5.868  10.221  -37.336 1.00 25.27  ? 374  LEU A CA  1 
ATOM   2553 C  C   . LEU A 1 396 ? -4.625  11.067  -37.053 1.00 23.69  ? 374  LEU A C   1 
ATOM   2554 O  O   . LEU A 1 396 ? -4.462  12.128  -37.607 1.00 24.84  ? 374  LEU A O   1 
ATOM   2555 C  CB  . LEU A 1 396 ? -6.126  10.106  -38.847 1.00 25.28  ? 374  LEU A CB  1 
ATOM   2556 C  CG  . LEU A 1 396 ? -7.451  9.434   -39.279 1.00 26.83  ? 374  LEU A CG  1 
ATOM   2557 C  CD1 . LEU A 1 396 ? -7.418  9.152   -40.790 1.00 27.30  ? 374  LEU A CD1 1 
ATOM   2558 C  CD2 . LEU A 1 396 ? -7.738  8.156   -38.495 1.00 26.15  ? 374  LEU A CD2 1 
ATOM   2559 N  N   . PRO A 1 397 ? -3.748  10.599  -36.144 1.00 24.12  ? 375  PRO A N   1 
ATOM   2560 C  CA  . PRO A 1 397 ? -2.751  11.516  -35.571 1.00 23.61  ? 375  PRO A CA  1 
ATOM   2561 C  C   . PRO A 1 397 ? -1.538  11.886  -36.429 1.00 23.55  ? 375  PRO A C   1 
ATOM   2562 O  O   . PRO A 1 397 ? -1.098  13.028  -36.390 1.00 24.23  ? 375  PRO A O   1 
ATOM   2563 C  CB  . PRO A 1 397 ? -2.298  10.761  -34.300 1.00 24.19  ? 375  PRO A CB  1 
ATOM   2564 C  CG  . PRO A 1 397 ? -3.450  9.887   -33.961 1.00 23.78  ? 375  PRO A CG  1 
ATOM   2565 C  CD  . PRO A 1 397 ? -3.892  9.392   -35.316 1.00 23.18  ? 375  PRO A CD  1 
ATOM   2566 N  N   . ASP A 1 398 ? -0.951  10.939  -37.151 1.00 23.16  ? 376  ASP A N   1 
ATOM   2567 C  CA  . ASP A 1 398 ? 0.249   11.268  -37.917 1.00 23.64  ? 376  ASP A CA  1 
ATOM   2568 C  C   . ASP A 1 398 ? 0.289   10.623  -39.306 1.00 25.53  ? 376  ASP A C   1 
ATOM   2569 O  O   . ASP A 1 398 ? -0.686  10.022  -39.799 1.00 23.80  ? 376  ASP A O   1 
ATOM   2570 C  CB  . ASP A 1 398 ? 1.559   11.053  -37.098 1.00 23.26  ? 376  ASP A CB  1 
ATOM   2571 C  CG  . ASP A 1 398 ? 1.988   9.600   -36.969 1.00 23.26  ? 376  ASP A CG  1 
ATOM   2572 O  OD1 . ASP A 1 398 ? 1.232   8.686   -37.353 1.00 24.70  ? 376  ASP A OD1 1 
ATOM   2573 O  OD2 . ASP A 1 398 ? 3.104   9.351   -36.415 1.00 24.29  ? 376  ASP A OD2 1 
ATOM   2574 N  N   . SER A 1 399 ? 1.423   10.815  -39.958 1.00 26.40  ? 377  SER A N   1 
ATOM   2575 C  CA  . SER A 1 399 ? 1.521   10.517  -41.349 1.00 28.39  ? 377  SER A CA  1 
ATOM   2576 C  C   . SER A 1 399 ? 2.391   9.282   -41.604 1.00 27.18  ? 377  SER A C   1 
ATOM   2577 O  O   . SER A 1 399 ? 3.206   8.887   -40.764 1.00 26.44  ? 377  SER A O   1 
ATOM   2578 C  CB  . SER A 1 399 ? 2.065   11.756  -42.062 1.00 29.45  ? 377  SER A CB  1 
ATOM   2579 O  OG  . SER A 1 399 ? 3.325   12.015  -41.627 1.00 32.57  ? 377  SER A OG  1 
ATOM   2580 N  N   . VAL A 1 400 ? 2.212   8.710   -42.790 1.00 26.35  ? 378  VAL A N   1 
ATOM   2581 C  CA  . VAL A 1 400 ? 2.944   7.529   -43.230 1.00 27.42  ? 378  VAL A CA  1 
ATOM   2582 C  C   . VAL A 1 400 ? 4.443   7.786   -43.360 1.00 26.71  ? 378  VAL A C   1 
ATOM   2583 O  O   . VAL A 1 400 ? 5.240   6.837   -43.311 1.00 26.54  ? 378  VAL A O   1 
ATOM   2584 C  CB  . VAL A 1 400 ? 2.381   6.999   -44.559 1.00 29.17  ? 378  VAL A CB  1 
ATOM   2585 C  CG1 . VAL A 1 400 ? 2.794   7.876   -45.732 1.00 29.13  ? 378  VAL A CG1 1 
ATOM   2586 C  CG2 . VAL A 1 400 ? 2.800   5.552   -44.775 1.00 31.11  ? 378  VAL A CG2 1 
ATOM   2587 N  N   . ARG A 1 401 ? 4.837   9.059   -43.460 1.00 25.56  ? 379  ARG A N   1 
ATOM   2588 C  CA  . ARG A 1 401 ? 6.262   9.438   -43.551 1.00 25.62  ? 379  ARG A CA  1 
ATOM   2589 C  C   . ARG A 1 401 ? 7.095   8.826   -42.412 1.00 24.92  ? 379  ARG A C   1 
ATOM   2590 O  O   . ARG A 1 401 ? 8.258   8.412   -42.608 1.00 23.09  ? 379  ARG A O   1 
ATOM   2591 C  CB  . ARG A 1 401 ? 6.401   10.986  -43.534 1.00 27.32  ? 379  ARG A CB  1 
ATOM   2592 C  CG  . ARG A 1 401 ? 7.821   11.564  -43.722 1.00 29.16  ? 379  ARG A CG  1 
ATOM   2593 C  CD  . ARG A 1 401 ? 7.930   13.010  -43.202 1.00 29.97  ? 379  ARG A CD  1 
ATOM   2594 N  NE  . ARG A 1 401 ? 7.870   12.984  -41.756 1.00 31.92  ? 379  ARG A NE  1 
ATOM   2595 C  CZ  . ARG A 1 401 ? 7.279   13.863  -40.939 1.00 34.56  ? 379  ARG A CZ  1 
ATOM   2596 N  NH1 . ARG A 1 401 ? 6.675   14.928  -41.403 1.00 34.53  ? 379  ARG A NH1 1 
ATOM   2597 N  NH2 . ARG A 1 401 ? 7.281   13.632  -39.601 1.00 35.71  ? 379  ARG A NH2 1 
ATOM   2598 N  N   . ASN A 1 402 ? 6.515   8.763   -41.210 1.00 22.74  ? 380  ASN A N   1 
ATOM   2599 C  CA  . ASN A 1 402 ? 7.246   8.229   -40.069 1.00 23.93  ? 380  ASN A CA  1 
ATOM   2600 C  C   . ASN A 1 402 ? 7.542   6.676   -40.120 1.00 24.49  ? 380  ASN A C   1 
ATOM   2601 O  O   . ASN A 1 402 ? 8.336   6.202   -39.328 1.00 24.46  ? 380  ASN A O   1 
ATOM   2602 C  CB  . ASN A 1 402 ? 6.515   8.552   -38.748 1.00 24.26  ? 380  ASN A CB  1 
ATOM   2603 C  CG  . ASN A 1 402 ? 6.669   9.994   -38.296 1.00 25.10  ? 380  ASN A CG  1 
ATOM   2604 O  OD1 . ASN A 1 402 ? 7.645   10.668  -38.600 1.00 25.93  ? 380  ASN A OD1 1 
ATOM   2605 N  ND2 . ASN A 1 402 ? 5.721   10.443  -37.486 1.00 25.15  ? 380  ASN A ND2 1 
ATOM   2606 N  N   . TYR A 1 403 ? 6.919   5.942   -41.039 1.00 23.29  ? 381  TYR A N   1 
ATOM   2607 C  CA  . TYR A 1 403 ? 6.853   4.472   -41.002 1.00 25.41  ? 381  TYR A CA  1 
ATOM   2608 C  C   . TYR A 1 403 ? 7.186   3.861   -42.355 1.00 25.88  ? 381  TYR A C   1 
ATOM   2609 O  O   . TYR A 1 403 ? 6.825   2.710   -42.633 1.00 26.65  ? 381  TYR A O   1 
ATOM   2610 C  CB  . TYR A 1 403 ? 5.443   4.040   -40.530 1.00 24.91  ? 381  TYR A CB  1 
ATOM   2611 C  CG  . TYR A 1 403 ? 5.049   4.797   -39.295 1.00 23.57  ? 381  TYR A CG  1 
ATOM   2612 C  CD1 . TYR A 1 403 ? 5.702   4.571   -38.091 1.00 24.28  ? 381  TYR A CD1 1 
ATOM   2613 C  CD2 . TYR A 1 403 ? 4.106   5.829   -39.353 1.00 24.16  ? 381  TYR A CD2 1 
ATOM   2614 C  CE1 . TYR A 1 403 ? 5.392   5.305   -36.955 1.00 25.12  ? 381  TYR A CE1 1 
ATOM   2615 C  CE2 . TYR A 1 403 ? 3.797   6.573   -38.227 1.00 22.94  ? 381  TYR A CE2 1 
ATOM   2616 C  CZ  . TYR A 1 403 ? 4.441   6.317   -37.038 1.00 23.92  ? 381  TYR A CZ  1 
ATOM   2617 O  OH  . TYR A 1 403 ? 4.143   7.060   -35.938 1.00 26.25  ? 381  TYR A OH  1 
ATOM   2618 N  N   . MET A 1 404 ? 7.916   4.620   -43.181 1.00 25.91  ? 382  MET A N   1 
ATOM   2619 C  CA  . MET A 1 404 ? 8.196   4.231   -44.572 1.00 27.21  ? 382  MET A CA  1 
ATOM   2620 C  C   . MET A 1 404 ? 8.857   2.863   -44.662 1.00 28.00  ? 382  MET A C   1 
ATOM   2621 O  O   . MET A 1 404 ? 8.562   2.112   -45.585 1.00 28.33  ? 382  MET A O   1 
ATOM   2622 C  CB  . MET A 1 404 ? 9.100   5.266   -45.286 1.00 27.90  ? 382  MET A CB  1 
ATOM   2623 C  CG  . MET A 1 404 ? 8.496   6.661   -45.422 1.00 28.09  ? 382  MET A CG  1 
ATOM   2624 S  SD  . MET A 1 404 ? 7.024   6.723   -46.447 1.00 30.31  ? 382  MET A SD  1 
ATOM   2625 C  CE  . MET A 1 404 ? 7.746   6.521   -48.071 1.00 31.68  ? 382  MET A CE  1 
ATOM   2626 N  N   . THR A 1 405 ? 9.758   2.562   -43.725 1.00 27.84  ? 383  THR A N   1 
ATOM   2627 C  CA  . THR A 1 405 ? 10.472  1.283   -43.737 1.00 29.72  ? 383  THR A CA  1 
ATOM   2628 C  C   . THR A 1 405 ? 9.949   0.366   -42.625 1.00 30.07  ? 383  THR A C   1 
ATOM   2629 O  O   . THR A 1 405 ? 10.534  -0.666  -42.378 1.00 29.37  ? 383  THR A O   1 
ATOM   2630 C  CB  . THR A 1 405 ? 11.992  1.447   -43.558 1.00 31.17  ? 383  THR A CB  1 
ATOM   2631 O  OG1 . THR A 1 405 ? 12.251  2.185   -42.368 1.00 28.63  ? 383  THR A OG1 1 
ATOM   2632 C  CG2 . THR A 1 405 ? 12.623  2.129   -44.767 1.00 32.09  ? 383  THR A CG2 1 
ATOM   2633 N  N   . LYS A 1 406 ? 8.842   0.739   -41.967 1.00 27.94  ? 384  LYS A N   1 
ATOM   2634 C  CA  . LYS A 1 406 ? 8.219   -0.141  -40.993 1.00 28.57  ? 384  LYS A CA  1 
ATOM   2635 C  C   . LYS A 1 406 ? 6.926   -0.743  -41.596 1.00 28.60  ? 384  LYS A C   1 
ATOM   2636 O  O   . LYS A 1 406 ? 7.022   -1.565  -42.532 1.00 28.68  ? 384  LYS A O   1 
ATOM   2637 C  CB  . LYS A 1 406 ? 8.088   0.584   -39.655 1.00 27.79  ? 384  LYS A CB  1 
ATOM   2638 C  CG  . LYS A 1 406 ? 9.460   0.963   -39.118 1.00 29.60  ? 384  LYS A CG  1 
ATOM   2639 C  CD  . LYS A 1 406 ? 9.435   1.665   -37.773 1.00 30.36  ? 384  LYS A CD  1 
ATOM   2640 C  CE  . LYS A 1 406 ? 9.503   0.729   -36.586 1.00 30.67  ? 384  LYS A CE  1 
ATOM   2641 N  NZ  . LYS A 1 406 ? 9.675   1.462   -35.288 1.00 29.15  ? 384  LYS A NZ  1 
ATOM   2642 N  N   . PHE A 1 407 ? 5.737   -0.366  -41.134 1.00 27.79  ? 385  PHE A N   1 
ATOM   2643 C  CA  . PHE A 1 407 ? 4.535   -1.070  -41.584 1.00 29.35  ? 385  PHE A CA  1 
ATOM   2644 C  C   . PHE A 1 407 ? 4.250   -0.908  -43.075 1.00 30.88  ? 385  PHE A C   1 
ATOM   2645 O  O   . PHE A 1 407 ? 3.507   -1.694  -43.655 1.00 30.64  ? 385  PHE A O   1 
ATOM   2646 C  CB  . PHE A 1 407 ? 3.306   -0.718  -40.743 1.00 28.82  ? 385  PHE A CB  1 
ATOM   2647 C  CG  . PHE A 1 407 ? 2.635   0.582   -41.107 1.00 27.49  ? 385  PHE A CG  1 
ATOM   2648 C  CD1 . PHE A 1 407 ? 1.798   0.663   -42.199 1.00 28.49  ? 385  PHE A CD1 1 
ATOM   2649 C  CD2 . PHE A 1 407 ? 2.803   1.709   -40.311 1.00 28.10  ? 385  PHE A CD2 1 
ATOM   2650 C  CE1 . PHE A 1 407 ? 1.164   1.847   -42.519 1.00 28.56  ? 385  PHE A CE1 1 
ATOM   2651 C  CE2 . PHE A 1 407 ? 2.171   2.895   -40.618 1.00 27.54  ? 385  PHE A CE2 1 
ATOM   2652 C  CZ  . PHE A 1 407 ? 1.350   2.967   -41.730 1.00 27.25  ? 385  PHE A CZ  1 
ATOM   2653 N  N   . LEU A 1 408 ? 4.826   0.115   -43.689 1.00 30.85  ? 386  LEU A N   1 
ATOM   2654 C  CA  . LEU A 1 408 ? 4.611   0.317   -45.132 1.00 34.17  ? 386  LEU A CA  1 
ATOM   2655 C  C   . LEU A 1 408 ? 5.335   -0.738  -45.932 1.00 37.26  ? 386  LEU A C   1 
ATOM   2656 O  O   . LEU A 1 408 ? 4.945   -1.028  -47.060 1.00 38.64  ? 386  LEU A O   1 
ATOM   2657 C  CB  . LEU A 1 408 ? 5.033   1.733   -45.552 1.00 34.02  ? 386  LEU A CB  1 
ATOM   2658 C  CG  . LEU A 1 408 ? 4.508   2.265   -46.882 1.00 36.54  ? 386  LEU A CG  1 
ATOM   2659 C  CD1 . LEU A 1 408 ? 3.007   2.380   -46.805 1.00 36.47  ? 386  LEU A CD1 1 
ATOM   2660 C  CD2 . LEU A 1 408 ? 5.125   3.606   -47.239 1.00 36.37  ? 386  LEU A CD2 1 
ATOM   2661 N  N   . SER A 1 409 ? 6.361   -1.348  -45.325 1.00 36.86  ? 387  SER A N   1 
ATOM   2662 C  CA  . SER A 1 409 ? 7.138   -2.405  -45.940 1.00 38.80  ? 387  SER A CA  1 
ATOM   2663 C  C   . SER A 1 409 ? 6.633   -3.828  -45.659 1.00 42.47  ? 387  SER A C   1 
ATOM   2664 O  O   . SER A 1 409 ? 6.557   -4.273  -44.497 1.00 41.18  ? 387  SER A O   1 
ATOM   2665 C  CB  . SER A 1 409 ? 8.597   -2.290  -45.462 1.00 39.90  ? 387  SER A CB  1 
ATOM   2666 O  OG  . SER A 1 409 ? 9.243   -3.534  -45.524 1.00 41.54  ? 387  SER A OG  1 
ATOM   2667 N  N   . ASP A 1 410 ? 6.338   -4.562  -46.732 1.00 44.12  ? 388  ASP A N   1 
ATOM   2668 C  CA  . ASP A 1 410 ? 5.849   -5.928  -46.620 1.00 46.84  ? 388  ASP A CA  1 
ATOM   2669 C  C   . ASP A 1 410 ? 6.897   -6.818  -45.969 1.00 47.67  ? 388  ASP A C   1 
ATOM   2670 O  O   . ASP A 1 410 ? 6.547   -7.735  -45.227 1.00 49.16  ? 388  ASP A O   1 
ATOM   2671 C  CB  . ASP A 1 410 ? 5.461   -6.509  -48.001 1.00 50.89  ? 388  ASP A CB  1 
ATOM   2672 C  CG  . ASP A 1 410 ? 4.260   -5.795  -48.646 1.00 51.46  ? 388  ASP A CG  1 
ATOM   2673 O  OD1 . ASP A 1 410 ? 3.619   -4.898  -48.043 1.00 49.11  ? 388  ASP A OD1 1 
ATOM   2674 O  OD2 . ASP A 1 410 ? 3.959   -6.129  -49.792 1.00 54.55  ? 388  ASP A OD2 1 
ATOM   2675 N  N   . ARG A 1 411 ? 8.175   -6.561  -46.253 1.00 47.42  ? 389  ARG A N   1 
ATOM   2676 C  CA  . ARG A 1 411 ? 9.267   -7.325  -45.649 1.00 48.34  ? 389  ARG A CA  1 
ATOM   2677 C  C   . ARG A 1 411 ? 9.292   -7.126  -44.138 1.00 46.45  ? 389  ARG A C   1 
ATOM   2678 O  O   . ARG A 1 411 ? 9.474   -8.076  -43.393 1.00 48.43  ? 389  ARG A O   1 
ATOM   2679 C  CB  . ARG A 1 411 ? 10.626  -6.939  -46.249 1.00 48.89  ? 389  ARG A CB  1 
ATOM   2680 N  N   . TRP A 1 412 ? 9.115   -5.890  -43.677 1.00 43.74  ? 390  TRP A N   1 
ATOM   2681 C  CA  . TRP A 1 412 ? 9.087   -5.613  -42.243 1.00 40.91  ? 390  TRP A CA  1 
ATOM   2682 C  C   . TRP A 1 412 ? 7.880   -6.304  -41.607 1.00 42.04  ? 390  TRP A C   1 
ATOM   2683 O  O   . TRP A 1 412 ? 8.007   -6.915  -40.559 1.00 42.86  ? 390  TRP A O   1 
ATOM   2684 C  CB  . TRP A 1 412 ? 8.993   -4.118  -42.008 1.00 38.09  ? 390  TRP A CB  1 
ATOM   2685 C  CG  . TRP A 1 412 ? 9.066   -3.707  -40.586 1.00 35.93  ? 390  TRP A CG  1 
ATOM   2686 C  CD1 . TRP A 1 412 ? 10.205  -3.474  -39.860 1.00 35.91  ? 390  TRP A CD1 1 
ATOM   2687 C  CD2 . TRP A 1 412 ? 7.972   -3.492  -39.699 1.00 33.30  ? 390  TRP A CD2 1 
ATOM   2688 N  NE1 . TRP A 1 412 ? 9.874   -3.101  -38.589 1.00 34.76  ? 390  TRP A NE1 1 
ATOM   2689 C  CE2 . TRP A 1 412 ? 8.512   -3.109  -38.459 1.00 32.89  ? 390  TRP A CE2 1 
ATOM   2690 C  CE3 . TRP A 1 412 ? 6.583   -3.577  -39.834 1.00 32.21  ? 390  TRP A CE3 1 
ATOM   2691 C  CZ2 . TRP A 1 412 ? 7.712   -2.786  -37.356 1.00 32.68  ? 390  TRP A CZ2 1 
ATOM   2692 C  CZ3 . TRP A 1 412 ? 5.784   -3.274  -38.740 1.00 31.83  ? 390  TRP A CZ3 1 
ATOM   2693 C  CH2 . TRP A 1 412 ? 6.350   -2.881  -37.509 1.00 32.32  ? 390  TRP A CH2 1 
ATOM   2694 N  N   . MET A 1 413 ? 6.718   -6.168  -42.239 1.00 40.11  ? 391  MET A N   1 
ATOM   2695 C  CA  . MET A 1 413 ? 5.500   -6.791  -41.763 1.00 41.55  ? 391  MET A CA  1 
ATOM   2696 C  C   . MET A 1 413 ? 5.649   -8.325  -41.666 1.00 46.41  ? 391  MET A C   1 
ATOM   2697 O  O   . MET A 1 413 ? 5.242   -8.924  -40.670 1.00 46.40  ? 391  MET A O   1 
ATOM   2698 C  CB  . MET A 1 413 ? 4.340   -6.449  -42.704 1.00 40.47  ? 391  MET A CB  1 
ATOM   2699 C  CG  . MET A 1 413 ? 3.874   -4.998  -42.646 1.00 37.75  ? 391  MET A CG  1 
ATOM   2700 S  SD  . MET A 1 413 ? 2.866   -4.577  -41.209 1.00 36.22  ? 391  MET A SD  1 
ATOM   2701 C  CE  . MET A 1 413 ? 1.387   -5.476  -41.660 1.00 37.32  ? 391  MET A CE  1 
ATOM   2702 N  N   . LEU A 1 414 ? 6.234   -8.943  -42.696 1.00 50.20  ? 392  LEU A N   1 
ATOM   2703 C  CA  . LEU A 1 414 ? 6.488   -10.395 -42.715 1.00 56.24  ? 392  LEU A CA  1 
ATOM   2704 C  C   . LEU A 1 414 ? 7.418   -10.800 -41.600 1.00 57.59  ? 392  LEU A C   1 
ATOM   2705 O  O   . LEU A 1 414 ? 7.076   -11.632 -40.776 1.00 60.34  ? 392  LEU A O   1 
ATOM   2706 C  CB  . LEU A 1 414 ? 7.104   -10.824 -44.038 1.00 59.85  ? 392  LEU A CB  1 
ATOM   2707 C  CG  . LEU A 1 414 ? 6.078   -11.094 -45.126 1.00 62.64  ? 392  LEU A CG  1 
ATOM   2708 C  CD1 . LEU A 1 414 ? 6.686   -10.887 -46.506 1.00 65.11  ? 392  LEU A CD1 1 
ATOM   2709 C  CD2 . LEU A 1 414 ? 5.553   -12.514 -44.974 1.00 66.42  ? 392  LEU A CD2 1 
ATOM   2710 N  N   . GLN A 1 415 ? 8.591   -10.188 -41.575 1.00 58.19  ? 393  GLN A N   1 
ATOM   2711 C  CA  . GLN A 1 415 ? 9.549   -10.343 -40.478 1.00 59.71  ? 393  GLN A CA  1 
ATOM   2712 C  C   . GLN A 1 415 ? 8.910   -10.238 -39.087 1.00 57.78  ? 393  GLN A C   1 
ATOM   2713 O  O   . GLN A 1 415 ? 9.265   -10.985 -38.178 1.00 57.25  ? 393  GLN A O   1 
ATOM   2714 C  CB  . GLN A 1 415 ? 10.634  -9.275  -40.604 1.00 61.83  ? 393  GLN A CB  1 
ATOM   2715 C  CG  . GLN A 1 415 ? 11.847  -9.501  -39.718 1.00 67.92  ? 393  GLN A CG  1 
ATOM   2716 C  CD  . GLN A 1 415 ? 12.393  -8.216  -39.104 1.00 69.67  ? 393  GLN A CD  1 
ATOM   2717 O  OE1 . GLN A 1 415 ? 11.666  -7.247  -38.882 1.00 70.19  ? 393  GLN A OE1 1 
ATOM   2718 N  NE2 . GLN A 1 415 ? 13.688  -8.212  -38.820 1.00 73.96  ? 393  GLN A NE2 1 
ATOM   2719 N  N   . LYS A 1 416 ? 7.977   -9.307  -38.913 1.00 53.01  ? 394  LYS A N   1 
ATOM   2720 C  CA  . LYS A 1 416 ? 7.325   -9.134  -37.614 1.00 52.33  ? 394  LYS A CA  1 
ATOM   2721 C  C   . LYS A 1 416 ? 6.162   -10.104 -37.369 1.00 54.25  ? 394  LYS A C   1 
ATOM   2722 O  O   . LYS A 1 416 ? 5.635   -10.155 -36.262 1.00 54.57  ? 394  LYS A O   1 
ATOM   2723 C  CB  . LYS A 1 416 ? 6.830   -7.697  -37.462 1.00 49.35  ? 394  LYS A CB  1 
ATOM   2724 C  CG  . LYS A 1 416 ? 7.938   -6.660  -37.510 1.00 48.09  ? 394  LYS A CG  1 
ATOM   2725 C  CD  . LYS A 1 416 ? 8.688   -6.614  -36.200 1.00 48.66  ? 394  LYS A CD  1 
ATOM   2726 C  CE  . LYS A 1 416 ? 10.079  -6.039  -36.363 1.00 49.11  ? 394  LYS A CE  1 
ATOM   2727 N  NZ  . LYS A 1 416 ? 10.575  -5.598  -35.032 1.00 49.38  ? 394  LYS A NZ  1 
ATOM   2728 N  N   . GLY A 1 417 ? 5.744   -10.836 -38.401 1.00 55.50  ? 395  GLY A N   1 
ATOM   2729 C  CA  . GLY A 1 417 ? 4.629   -11.772 -38.296 1.00 57.41  ? 395  GLY A CA  1 
ATOM   2730 C  C   . GLY A 1 417 ? 3.246   -11.155 -38.360 1.00 57.81  ? 395  GLY A C   1 
ATOM   2731 O  O   . GLY A 1 417 ? 2.262   -11.811 -38.032 1.00 61.14  ? 395  GLY A O   1 
ATOM   2732 N  N   . PHE A 1 418 ? 3.154   -9.898  -38.779 1.00 55.10  ? 396  PHE A N   1 
ATOM   2733 C  CA  . PHE A 1 418 ? 1.861   -9.212  -38.879 1.00 53.23  ? 396  PHE A CA  1 
ATOM   2734 C  C   . PHE A 1 418 ? 1.217   -9.500  -40.219 1.00 56.70  ? 396  PHE A C   1 
ATOM   2735 O  O   . PHE A 1 418 ? 0.093   -9.060  -40.490 1.00 56.80  ? 396  PHE A O   1 
ATOM   2736 C  CB  . PHE A 1 418 ? 2.029   -7.708  -38.747 1.00 47.36  ? 396  PHE A CB  1 
ATOM   2737 C  CG  . PHE A 1 418 ? 2.613   -7.286  -37.443 1.00 46.01  ? 396  PHE A CG  1 
ATOM   2738 C  CD1 . PHE A 1 418 ? 2.193   -7.870  -36.258 1.00 45.56  ? 396  PHE A CD1 1 
ATOM   2739 C  CD2 . PHE A 1 418 ? 3.588   -6.307  -37.401 1.00 43.01  ? 396  PHE A CD2 1 
ATOM   2740 C  CE1 . PHE A 1 418 ? 2.749   -7.486  -35.059 1.00 45.29  ? 396  PHE A CE1 1 
ATOM   2741 C  CE2 . PHE A 1 418 ? 4.134   -5.913  -36.212 1.00 42.05  ? 396  PHE A CE2 1 
ATOM   2742 C  CZ  . PHE A 1 418 ? 3.720   -6.499  -35.036 1.00 44.27  ? 396  PHE A CZ  1 
ATOM   2743 N  N   . LEU A 1 419 ? 1.977   -10.177 -41.063 1.00 59.24  ? 397  LEU A N   1 
ATOM   2744 C  CA  . LEU A 1 419 ? 1.525   -10.600 -42.350 1.00 66.37  ? 397  LEU A CA  1 
ATOM   2745 C  C   . LEU A 1 419 ? 1.963   -12.049 -42.445 1.00 72.44  ? 397  LEU A C   1 
ATOM   2746 O  O   . LEU A 1 419 ? 3.111   -12.373 -42.119 1.00 73.42  ? 397  LEU A O   1 
ATOM   2747 C  CB  . LEU A 1 419 ? 2.213   -9.765  -43.418 1.00 68.58  ? 397  LEU A CB  1 
ATOM   2748 C  CG  . LEU A 1 419 ? 1.568   -9.686  -44.791 1.00 72.81  ? 397  LEU A CG  1 
ATOM   2749 C  CD1 . LEU A 1 419 ? 0.101   -9.289  -44.679 1.00 71.90  ? 397  LEU A CD1 1 
ATOM   2750 C  CD2 . LEU A 1 419 ? 2.357   -8.689  -45.636 1.00 72.74  ? 397  LEU A CD2 1 
ATOM   2751 N  N   . LYS A 1 420 ? 1.047   -12.914 -42.867 1.00 77.26  ? 398  LYS A N   1 
ATOM   2752 C  CA  . LYS A 1 420 ? 1.333   -14.335 -43.006 1.00 83.25  ? 398  LYS A CA  1 
ATOM   2753 C  C   . LYS A 1 420 ? 1.192   -14.757 -44.462 1.00 86.22  ? 398  LYS A C   1 
ATOM   2754 O  O   . LYS A 1 420 ? 0.241   -14.369 -45.140 1.00 84.08  ? 398  LYS A O   1 
ATOM   2755 C  CB  . LYS A 1 420 ? 0.394   -15.161 -42.124 1.00 85.00  ? 398  LYS A CB  1 
ATOM   2756 C  CG  . LYS A 1 420 ? 0.927   -15.423 -40.725 1.00 85.80  ? 398  LYS A CG  1 
ATOM   2757 C  CD  . LYS A 1 420 ? 0.009   -16.353 -39.950 1.00 88.13  ? 398  LYS A CD  1 
ATOM   2758 C  CE  . LYS A 1 420 ? 0.133   -16.128 -38.452 1.00 87.60  ? 398  LYS A CE  1 
ATOM   2759 N  NZ  . LYS A 1 420 ? 1.542   -16.246 -37.987 1.00 87.77  ? 398  LYS A NZ  1 
ATOM   2760 N  N   . GLU A 1 421 ? 2.146   -15.548 -44.938 1.00 89.88  ? 399  GLU A N   1 
ATOM   2761 C  CA  . GLU A 1 421 ? 2.149   -15.981 -46.332 1.00 94.84  ? 399  GLU A CA  1 
ATOM   2762 C  C   . GLU A 1 421 ? 0.792   -16.504 -46.811 1.00 99.34  ? 399  GLU A C   1 
ATOM   2763 O  O   . GLU A 1 421 ? 0.526   -16.533 -48.012 1.00 102.31 ? 399  GLU A O   1 
ATOM   2764 C  CB  . GLU A 1 421 ? 3.226   -17.046 -46.556 1.00 95.32  ? 399  GLU A CB  1 
ATOM   2765 N  N   . GLU A 1 422 ? -0.060  -16.918 -45.877 1.00 104.19 ? 400  GLU A N   1 
ATOM   2766 C  CA  . GLU A 1 422 ? -1.363  -17.483 -46.238 1.00 108.95 ? 400  GLU A CA  1 
ATOM   2767 C  C   . GLU A 1 422 ? -2.269  -16.485 -46.964 1.00 113.66 ? 400  GLU A C   1 
ATOM   2768 O  O   . GLU A 1 422 ? -2.685  -16.735 -48.093 1.00 118.03 ? 400  GLU A O   1 
ATOM   2769 C  CB  . GLU A 1 422 ? -2.076  -18.007 -44.984 1.00 106.69 ? 400  GLU A CB  1 
ATOM   2770 C  CG  . GLU A 1 422 ? -3.319  -18.840 -45.273 1.00 106.23 ? 400  GLU A CG  1 
ATOM   2771 C  CD  . GLU A 1 422 ? -4.237  -18.994 -44.074 1.00 103.10 ? 400  GLU A CD  1 
ATOM   2772 O  OE1 . GLU A 1 422 ? -3.888  -18.522 -42.969 1.00 95.65  ? 400  GLU A OE1 1 
ATOM   2773 O  OE2 . GLU A 1 422 ? -5.315  -19.599 -44.246 1.00 103.33 ? 400  GLU A OE2 1 
ATOM   2774 N  N   . ASP A 1 423 ? -2.575  -15.367 -46.311 1.00 83.95  ? 401  ASP A N   1 
ATOM   2775 C  CA  . ASP A 1 423 ? -3.487  -14.344 -46.875 1.00 90.57  ? 401  ASP A CA  1 
ATOM   2776 C  C   . ASP A 1 423 ? -2.682  -13.383 -47.742 1.00 92.54  ? 401  ASP A C   1 
ATOM   2777 O  O   . ASP A 1 423 ? -3.250  -12.596 -48.508 1.00 92.92  ? 401  ASP A O   1 
ATOM   2778 C  CB  . ASP A 1 423 ? -4.222  -13.569 -45.771 1.00 90.20  ? 401  ASP A CB  1 
ATOM   2779 C  CG  . ASP A 1 423 ? -4.454  -14.411 -44.528 1.00 91.85  ? 401  ASP A CG  1 
ATOM   2780 O  OD1 . ASP A 1 423 ? -4.977  -15.543 -44.662 1.00 84.65  ? 401  ASP A OD1 1 
ATOM   2781 O  OD2 . ASP A 1 423 ? -4.082  -13.947 -43.427 1.00 87.40  ? 401  ASP A OD2 1 
ATOM   2782 N  N   . LEU A 1 424 ? -1.357  -13.448 -47.585 1.00 92.55  ? 402  LEU A N   1 
ATOM   2783 C  CA  . LEU A 1 424 ? -0.422  -12.881 -48.544 1.00 93.93  ? 402  LEU A CA  1 
ATOM   2784 C  C   . LEU A 1 424 ? -0.456  -13.652 -49.880 1.00 98.91  ? 402  LEU A C   1 
ATOM   2785 O  O   . LEU A 1 424 ? -0.112  -13.086 -50.914 1.00 99.48  ? 402  LEU A O   1 
ATOM   2786 C  CB  . LEU A 1 424 ? 0.998   -12.889 -47.963 1.00 90.59  ? 402  LEU A CB  1 
ATOM   2787 C  CG  . LEU A 1 424 ? 2.107   -12.173 -48.746 1.00 85.46  ? 402  LEU A CG  1 
ATOM   2788 C  CD1 . LEU A 1 424 ? 1.794   -10.696 -48.953 1.00 81.97  ? 402  LEU A CD1 1 
ATOM   2789 C  CD2 . LEU A 1 424 ? 3.437   -12.342 -48.029 1.00 83.08  ? 402  LEU A CD2 1 
ATOM   2790 N  N   . THR A 1 425 ? -0.852  -14.932 -49.849 1.00 99.96  ? 403  THR A N   1 
ATOM   2791 C  CA  . THR A 1 425 ? -1.083  -15.736 -51.075 1.00 94.59  ? 403  THR A CA  1 
ATOM   2792 C  C   . THR A 1 425 ? -2.576  -15.996 -51.423 1.00 92.30  ? 403  THR A C   1 
ATOM   2793 O  O   . THR A 1 425 ? -2.858  -16.513 -52.507 1.00 91.70  ? 403  THR A O   1 
ATOM   2794 C  CB  . THR A 1 425 ? -0.313  -17.078 -51.047 1.00 90.96  ? 403  THR A CB  1 
ATOM   2795 O  OG1 . THR A 1 425 ? -0.702  -17.841 -49.896 1.00 95.40  ? 403  THR A OG1 1 
ATOM   2796 C  CG2 . THR A 1 425 ? 1.212   -16.831 -51.039 1.00 85.23  ? 403  THR A CG2 1 
ATOM   2797 N  N   . GLU A 1 426 ? -3.515  -15.655 -50.526 1.00 84.25  ? 404  GLU A N   1 
ATOM   2798 C  CA  . GLU A 1 426 ? -4.963  -15.715 -50.836 1.00 79.65  ? 404  GLU A CA  1 
ATOM   2799 C  C   . GLU A 1 426 ? -5.318  -14.682 -51.899 1.00 77.30  ? 404  GLU A C   1 
ATOM   2800 O  O   . GLU A 1 426 ? -5.986  -14.986 -52.887 1.00 73.37  ? 404  GLU A O   1 
ATOM   2801 C  CB  . GLU A 1 426 ? -5.816  -15.456 -49.589 1.00 74.40  ? 404  GLU A CB  1 
ATOM   2802 N  N   . LYS A 1 427 ? -4.836  -13.460 -51.700 1.00 75.09  ? 405  LYS A N   1 
ATOM   2803 C  CA  . LYS A 1 427 ? -5.018  -12.397 -52.677 1.00 76.09  ? 405  LYS A CA  1 
ATOM   2804 C  C   . LYS A 1 427 ? -4.187  -12.615 -53.961 1.00 73.06  ? 405  LYS A C   1 
ATOM   2805 O  O   . LYS A 1 427 ? -4.145  -11.730 -54.809 1.00 72.35  ? 405  LYS A O   1 
ATOM   2806 C  CB  . LYS A 1 427 ? -4.643  -11.044 -52.049 1.00 74.43  ? 405  LYS A CB  1 
ATOM   2807 N  N   . LYS A 1 428 ? -3.538  -13.771 -54.124 1.00 64.95  ? 406  LYS A N   1 
ATOM   2808 C  CA  . LYS A 1 428 ? -2.544  -13.901 -55.190 1.00 61.50  ? 406  LYS A CA  1 
ATOM   2809 C  C   . LYS A 1 428 ? -3.078  -14.507 -56.456 1.00 53.74  ? 406  LYS A C   1 
ATOM   2810 O  O   . LYS A 1 428 ? -3.856  -15.459 -56.406 1.00 52.08  ? 406  LYS A O   1 
ATOM   2811 C  CB  . LYS A 1 428 ? -1.300  -14.649 -54.719 1.00 64.06  ? 406  LYS A CB  1 
ATOM   2812 C  CG  . LYS A 1 428 ? -0.463  -13.802 -53.774 1.00 68.22  ? 406  LYS A CG  1 
ATOM   2813 C  CD  . LYS A 1 428 ? -0.138  -12.425 -54.341 1.00 67.64  ? 406  LYS A CD  1 
ATOM   2814 C  CE  . LYS A 1 428 ? 0.444   -11.500 -53.290 1.00 71.03  ? 406  LYS A CE  1 
ATOM   2815 N  NZ  . LYS A 1 428 ? 0.741   -10.166 -53.880 1.00 72.46  ? 406  LYS A NZ  1 
ATOM   2816 N  N   . PRO A 1 429 ? -2.645  -13.959 -57.607 1.00 48.57  ? 407  PRO A N   1 
ATOM   2817 C  CA  . PRO A 1 429 ? -3.134  -14.460 -58.882 1.00 42.35  ? 407  PRO A CA  1 
ATOM   2818 C  C   . PRO A 1 429 ? -2.631  -15.869 -59.154 1.00 34.46  ? 407  PRO A C   1 
ATOM   2819 O  O   . PRO A 1 429 ? -1.634  -16.300 -58.546 1.00 35.70  ? 407  PRO A O   1 
ATOM   2820 C  CB  . PRO A 1 429 ? -2.558  -13.469 -59.904 1.00 47.74  ? 407  PRO A CB  1 
ATOM   2821 C  CG  . PRO A 1 429 ? -1.970  -12.351 -59.106 1.00 49.71  ? 407  PRO A CG  1 
ATOM   2822 C  CD  . PRO A 1 429 ? -1.597  -12.944 -57.796 1.00 49.19  ? 407  PRO A CD  1 
ATOM   2823 N  N   . TRP A 1 430 ? -3.305  -16.553 -60.073 1.00 49.82  ? 408  TRP A N   1 
ATOM   2824 C  CA  . TRP A 1 430 ? -3.014  -17.945 -60.400 1.00 48.04  ? 408  TRP A CA  1 
ATOM   2825 C  C   . TRP A 1 430 ? -1.545  -18.199 -60.791 1.00 46.00  ? 408  TRP A C   1 
ATOM   2826 O  O   . TRP A 1 430 ? -0.998  -19.263 -60.499 1.00 44.92  ? 408  TRP A O   1 
ATOM   2827 C  CB  . TRP A 1 430 ? -3.959  -18.434 -61.513 1.00 49.45  ? 408  TRP A CB  1 
ATOM   2828 C  CG  . TRP A 1 430 ? -3.765  -17.739 -62.837 1.00 48.88  ? 408  TRP A CG  1 
ATOM   2829 C  CD1 . TRP A 1 430 ? -4.450  -16.656 -63.303 1.00 48.92  ? 408  TRP A CD1 1 
ATOM   2830 C  CD2 . TRP A 1 430 ? -2.808  -18.068 -63.842 1.00 48.28  ? 408  TRP A CD2 1 
ATOM   2831 N  NE1 . TRP A 1 430 ? -3.980  -16.294 -64.533 1.00 47.98  ? 408  TRP A NE1 1 
ATOM   2832 C  CE2 . TRP A 1 430 ? -2.971  -17.145 -64.890 1.00 47.50  ? 408  TRP A CE2 1 
ATOM   2833 C  CE3 . TRP A 1 430 ? -1.832  -19.064 -63.964 1.00 47.92  ? 408  TRP A CE3 1 
ATOM   2834 C  CZ2 . TRP A 1 430 ? -2.202  -17.188 -66.047 1.00 48.46  ? 408  TRP A CZ2 1 
ATOM   2835 C  CZ3 . TRP A 1 430 ? -1.067  -19.101 -65.103 1.00 47.43  ? 408  TRP A CZ3 1 
ATOM   2836 C  CH2 . TRP A 1 430 ? -1.253  -18.173 -66.135 1.00 48.53  ? 408  TRP A CH2 1 
ATOM   2837 N  N   . TRP A 1 431 ? -0.901  -17.219 -61.430 1.00 42.25  ? 409  TRP A N   1 
ATOM   2838 C  CA  . TRP A 1 431 ? 0.473   -17.413 -61.906 1.00 40.35  ? 409  TRP A CA  1 
ATOM   2839 C  C   . TRP A 1 431 ? 1.554   -17.177 -60.851 1.00 38.87  ? 409  TRP A C   1 
ATOM   2840 O  O   . TRP A 1 431 ? 2.737   -17.412 -61.103 1.00 36.76  ? 409  TRP A O   1 
ATOM   2841 C  CB  . TRP A 1 431 ? 0.751   -16.518 -63.105 1.00 39.24  ? 409  TRP A CB  1 
ATOM   2842 C  CG  . TRP A 1 431 ? 0.364   -15.095 -62.907 1.00 38.08  ? 409  TRP A CG  1 
ATOM   2843 C  CD1 . TRP A 1 431 ? -0.839  -14.531 -63.211 1.00 38.40  ? 409  TRP A CD1 1 
ATOM   2844 C  CD2 . TRP A 1 431 ? 1.170   -14.061 -62.363 1.00 36.21  ? 409  TRP A CD2 1 
ATOM   2845 N  NE1 . TRP A 1 431 ? -0.834  -13.211 -62.879 1.00 38.15  ? 409  TRP A NE1 1 
ATOM   2846 C  CE2 . TRP A 1 431 ? 0.391   -12.885 -62.370 1.00 36.40  ? 409  TRP A CE2 1 
ATOM   2847 C  CE3 . TRP A 1 431 ? 2.483   -14.005 -61.885 1.00 35.50  ? 409  TRP A CE3 1 
ATOM   2848 C  CZ2 . TRP A 1 431 ? 0.872   -11.671 -61.917 1.00 35.50  ? 409  TRP A CZ2 1 
ATOM   2849 C  CZ3 . TRP A 1 431 ? 2.965   -12.798 -61.427 1.00 35.24  ? 409  TRP A CZ3 1 
ATOM   2850 C  CH2 . TRP A 1 431 ? 2.163   -11.637 -61.460 1.00 35.19  ? 409  TRP A CH2 1 
ATOM   2851 N  N   . TRP A 1 432 ? 1.152   -16.731 -59.669 1.00 39.43  ? 410  TRP A N   1 
ATOM   2852 C  CA  . TRP A 1 432 ? 2.102   -16.221 -58.681 1.00 39.42  ? 410  TRP A CA  1 
ATOM   2853 C  C   . TRP A 1 432 ? 3.193   -17.208 -58.289 1.00 39.56  ? 410  TRP A C   1 
ATOM   2854 O  O   . TRP A 1 432 ? 4.326   -16.788 -58.042 1.00 37.25  ? 410  TRP A O   1 
ATOM   2855 C  CB  . TRP A 1 432 ? 1.353   -15.797 -57.412 1.00 40.88  ? 410  TRP A CB  1 
ATOM   2856 C  CG  . TRP A 1 432 ? 2.131   -14.903 -56.504 1.00 41.30  ? 410  TRP A CG  1 
ATOM   2857 C  CD1 . TRP A 1 432 ? 2.647   -15.215 -55.265 1.00 42.10  ? 410  TRP A CD1 1 
ATOM   2858 C  CD2 . TRP A 1 432 ? 2.457   -13.527 -56.739 1.00 41.28  ? 410  TRP A CD2 1 
ATOM   2859 N  NE1 . TRP A 1 432 ? 3.276   -14.112 -54.725 1.00 41.30  ? 410  TRP A NE1 1 
ATOM   2860 C  CE2 . TRP A 1 432 ? 3.162   -13.061 -55.596 1.00 41.33  ? 410  TRP A CE2 1 
ATOM   2861 C  CE3 . TRP A 1 432 ? 2.222   -12.643 -57.801 1.00 40.38  ? 410  TRP A CE3 1 
ATOM   2862 C  CZ2 . TRP A 1 432 ? 3.641   -11.755 -55.494 1.00 41.88  ? 410  TRP A CZ2 1 
ATOM   2863 C  CZ3 . TRP A 1 432 ? 2.689   -11.334 -57.701 1.00 41.43  ? 410  TRP A CZ3 1 
ATOM   2864 C  CH2 . TRP A 1 432 ? 3.399   -10.902 -56.557 1.00 42.52  ? 410  TRP A CH2 1 
ATOM   2865 N  N   . HIS A 1 433 ? 2.847   -18.497 -58.199 1.00 41.12  ? 411  HIS A N   1 
ATOM   2866 C  CA  . HIS A 1 433 ? 3.799   -19.533 -57.762 1.00 44.25  ? 411  HIS A CA  1 
ATOM   2867 C  C   . HIS A 1 433 ? 4.386   -20.375 -58.885 1.00 43.45  ? 411  HIS A C   1 
ATOM   2868 O  O   . HIS A 1 433 ? 5.125   -21.336 -58.618 1.00 44.31  ? 411  HIS A O   1 
ATOM   2869 C  CB  . HIS A 1 433 ? 3.167   -20.451 -56.702 1.00 49.64  ? 411  HIS A CB  1 
ATOM   2870 C  CG  . HIS A 1 433 ? 2.772   -19.723 -55.457 1.00 51.31  ? 411  HIS A CG  1 
ATOM   2871 N  ND1 . HIS A 1 433 ? 3.691   -19.307 -54.519 1.00 51.96  ? 411  HIS A ND1 1 
ATOM   2872 C  CD2 . HIS A 1 433 ? 1.566   -19.296 -55.020 1.00 54.36  ? 411  HIS A CD2 1 
ATOM   2873 C  CE1 . HIS A 1 433 ? 3.066   -18.666 -53.546 1.00 52.93  ? 411  HIS A CE1 1 
ATOM   2874 N  NE2 . HIS A 1 433 ? 1.776   -18.645 -53.827 1.00 54.09  ? 411  HIS A NE2 1 
ATOM   2875 N  N   . LEU A 1 434 ? 4.076   -20.027 -60.132 1.00 41.23  ? 412  LEU A N   1 
ATOM   2876 C  CA  . LEU A 1 434 ? 4.814   -20.581 -61.263 1.00 40.87  ? 412  LEU A CA  1 
ATOM   2877 C  C   . LEU A 1 434 ? 6.265   -20.136 -61.181 1.00 39.28  ? 412  LEU A C   1 
ATOM   2878 O  O   . LEU A 1 434 ? 6.589   -19.121 -60.564 1.00 37.71  ? 412  LEU A O   1 
ATOM   2879 C  CB  . LEU A 1 434 ? 4.228   -20.124 -62.592 1.00 40.81  ? 412  LEU A CB  1 
ATOM   2880 C  CG  . LEU A 1 434 ? 2.771   -20.508 -62.831 1.00 42.93  ? 412  LEU A CG  1 
ATOM   2881 C  CD1 . LEU A 1 434 ? 2.406   -20.202 -64.270 1.00 43.26  ? 412  LEU A CD1 1 
ATOM   2882 C  CD2 . LEU A 1 434 ? 2.539   -21.980 -62.522 1.00 45.32  ? 412  LEU A CD2 1 
ATOM   2883 N  N   . ARG A 1 435 ? 7.142   -20.903 -61.801 1.00 40.08  ? 413  ARG A N   1 
ATOM   2884 C  CA  . ARG A 1 435 ? 8.549   -20.548 -61.839 1.00 39.75  ? 413  ARG A CA  1 
ATOM   2885 C  C   . ARG A 1 435 ? 8.913   -19.820 -63.121 1.00 37.07  ? 413  ARG A C   1 
ATOM   2886 O  O   . ARG A 1 435 ? 8.229   -19.950 -64.121 1.00 35.05  ? 413  ARG A O   1 
ATOM   2887 C  CB  . ARG A 1 435 ? 9.402   -21.794 -61.674 1.00 42.57  ? 413  ARG A CB  1 
ATOM   2888 C  CG  . ARG A 1 435 ? 9.190   -22.411 -60.315 1.00 46.16  ? 413  ARG A CG  1 
ATOM   2889 C  CD  . ARG A 1 435 ? 10.130  -23.553 -60.075 1.00 50.58  ? 413  ARG A CD  1 
ATOM   2890 N  NE  . ARG A 1 435 ? 10.082  -23.925 -58.678 1.00 55.08  ? 413  ARG A NE  1 
ATOM   2891 C  CZ  . ARG A 1 435 ? 10.841  -24.866 -58.142 1.00 60.81  ? 413  ARG A CZ  1 
ATOM   2892 N  NH1 . ARG A 1 435 ? 11.707  -25.557 -58.896 1.00 62.62  ? 413  ARG A NH1 1 
ATOM   2893 N  NH2 . ARG A 1 435 ? 10.724  -25.119 -56.847 1.00 64.12  ? 413  ARG A NH2 1 
ATOM   2894 N  N   . VAL A 1 436 ? 10.009  -19.067 -63.059 1.00 35.94  ? 414  VAL A N   1 
ATOM   2895 C  CA  . VAL A 1 436 ? 10.530  -18.318 -64.194 1.00 35.91  ? 414  VAL A CA  1 
ATOM   2896 C  C   . VAL A 1 436 ? 10.699  -19.258 -65.398 1.00 35.88  ? 414  VAL A C   1 
ATOM   2897 O  O   . VAL A 1 436 ? 10.370  -18.897 -66.520 1.00 35.61  ? 414  VAL A O   1 
ATOM   2898 C  CB  . VAL A 1 436 ? 11.864  -17.633 -63.801 1.00 36.56  ? 414  VAL A CB  1 
ATOM   2899 C  CG1 . VAL A 1 436 ? 12.633  -17.153 -65.021 1.00 37.90  ? 414  VAL A CG1 1 
ATOM   2900 C  CG2 . VAL A 1 436 ? 11.597  -16.467 -62.853 1.00 36.39  ? 414  VAL A CG2 1 
ATOM   2901 N  N   . GLN A 1 437 ? 11.195  -20.467 -65.148 1.00 36.49  ? 415  GLN A N   1 
ATOM   2902 C  CA  . GLN A 1 437 ? 11.383  -21.474 -66.188 1.00 38.61  ? 415  GLN A CA  1 
ATOM   2903 C  C   . GLN A 1 437 ? 10.125  -21.765 -67.035 1.00 39.40  ? 415  GLN A C   1 
ATOM   2904 O  O   . GLN A 1 437 ? 10.218  -22.078 -68.227 1.00 39.93  ? 415  GLN A O   1 
ATOM   2905 C  CB  . GLN A 1 437 ? 11.854  -22.790 -65.563 1.00 41.15  ? 415  GLN A CB  1 
ATOM   2906 C  CG  . GLN A 1 437 ? 12.209  -23.842 -66.590 1.00 42.93  ? 415  GLN A CG  1 
ATOM   2907 C  CD  . GLN A 1 437 ? 12.941  -25.003 -65.956 1.00 45.57  ? 415  GLN A CD  1 
ATOM   2908 O  OE1 . GLN A 1 437 ? 13.779  -24.805 -65.066 1.00 46.69  ? 415  GLN A OE1 1 
ATOM   2909 N  NE2 . GLN A 1 437 ? 12.648  -26.217 -66.412 1.00 46.51  ? 415  GLN A NE2 1 
ATOM   2910 N  N   . GLU A 1 438 ? 8.964   -21.671 -66.407 1.00 38.00  ? 416  GLU A N   1 
ATOM   2911 C  CA  . GLU A 1 438 ? 7.712   -21.934 -67.087 1.00 39.19  ? 416  GLU A CA  1 
ATOM   2912 C  C   . GLU A 1 438 ? 7.310   -20.847 -68.096 1.00 37.87  ? 416  GLU A C   1 
ATOM   2913 O  O   . GLU A 1 438 ? 6.390   -21.049 -68.859 1.00 37.98  ? 416  GLU A O   1 
ATOM   2914 C  CB  . GLU A 1 438 ? 6.607   -22.162 -66.054 1.00 39.83  ? 416  GLU A CB  1 
ATOM   2915 C  CG  . GLU A 1 438 ? 6.856   -23.397 -65.195 1.00 41.43  ? 416  GLU A CG  1 
ATOM   2916 C  CD  . GLU A 1 438 ? 5.735   -23.647 -64.202 1.00 42.28  ? 416  GLU A CD  1 
ATOM   2917 O  OE1 . GLU A 1 438 ? 4.684   -24.180 -64.597 1.00 44.36  ? 416  GLU A OE1 1 
ATOM   2918 O  OE2 . GLU A 1 438 ? 5.930   -23.332 -63.019 1.00 41.28  ? 416  GLU A OE2 1 
ATOM   2919 N  N   . LEU A 1 439 ? 7.986   -19.701 -68.092 1.00 36.95  ? 417  LEU A N   1 
ATOM   2920 C  CA  . LEU A 1 439 ? 7.764   -18.701 -69.131 1.00 37.98  ? 417  LEU A CA  1 
ATOM   2921 C  C   . LEU A 1 439 ? 8.146   -19.225 -70.526 1.00 38.77  ? 417  LEU A C   1 
ATOM   2922 O  O   . LEU A 1 439 ? 7.634   -18.743 -71.502 1.00 41.79  ? 417  LEU A O   1 
ATOM   2923 C  CB  . LEU A 1 439 ? 8.553   -17.416 -68.860 1.00 35.90  ? 417  LEU A CB  1 
ATOM   2924 C  CG  . LEU A 1 439 ? 8.129   -16.618 -67.634 1.00 35.95  ? 417  LEU A CG  1 
ATOM   2925 C  CD1 . LEU A 1 439 ? 9.116   -15.507 -67.358 1.00 34.07  ? 417  LEU A CD1 1 
ATOM   2926 C  CD2 . LEU A 1 439 ? 6.708   -16.096 -67.782 1.00 36.70  ? 417  LEU A CD2 1 
ATOM   2927 N  N   . GLY A 1 440 ? 9.047   -20.188 -70.615 1.00 40.16  ? 418  GLY A N   1 
ATOM   2928 C  CA  . GLY A 1 440 ? 9.443   -20.738 -71.913 1.00 43.00  ? 418  GLY A CA  1 
ATOM   2929 C  C   . GLY A 1 440 ? 10.432  -19.779 -72.557 1.00 43.23  ? 418  GLY A C   1 
ATOM   2930 O  O   . GLY A 1 440 ? 10.193  -19.250 -73.622 1.00 44.14  ? 418  GLY A O   1 
ATOM   2931 N  N   . LEU A 1 441 ? 11.556  -19.592 -71.888 1.00 43.59  ? 419  LEU A N   1 
ATOM   2932 C  CA  . LEU A 1 441 ? 12.529  -18.565 -72.210 1.00 43.93  ? 419  LEU A CA  1 
ATOM   2933 C  C   . LEU A 1 441 ? 13.298  -18.840 -73.511 1.00 46.23  ? 419  LEU A C   1 
ATOM   2934 O  O   . LEU A 1 441 ? 13.618  -19.967 -73.812 1.00 48.72  ? 419  LEU A O   1 
ATOM   2935 C  CB  . LEU A 1 441 ? 13.539  -18.469 -71.065 1.00 43.69  ? 419  LEU A CB  1 
ATOM   2936 C  CG  . LEU A 1 441 ? 12.970  -18.153 -69.667 1.00 43.77  ? 419  LEU A CG  1 
ATOM   2937 C  CD1 . LEU A 1 441 ? 14.036  -18.372 -68.607 1.00 43.75  ? 419  LEU A CD1 1 
ATOM   2938 C  CD2 . LEU A 1 441 ? 12.453  -16.723 -69.607 1.00 42.58  ? 419  LEU A CD2 1 
ATOM   2939 N  N   . SER A 1 442 ? 13.600  -17.792 -74.266 1.00 49.23  ? 420  SER A N   1 
ATOM   2940 C  CA  . SER A 1 442 ? 14.487  -17.919 -75.428 1.00 53.43  ? 420  SER A CA  1 
ATOM   2941 C  C   . SER A 1 442 ? 15.911  -17.621 -75.014 1.00 48.41  ? 420  SER A C   1 
ATOM   2942 O  O   . SER A 1 442 ? 16.172  -16.631 -74.351 1.00 47.17  ? 420  SER A O   1 
ATOM   2943 C  CB  . SER A 1 442 ? 14.076  -16.943 -76.531 1.00 56.59  ? 420  SER A CB  1 
ATOM   2944 O  OG  . SER A 1 442 ? 12.908  -17.395 -77.183 1.00 61.68  ? 420  SER A OG  1 
ATOM   2945 N  N   . ALA A 1 443 ? 16.827  -18.483 -75.407 1.00 46.35  ? 421  ALA A N   1 
ATOM   2946 C  CA  . ALA A 1 443 ? 18.249  -18.227 -75.245 1.00 46.59  ? 421  ALA A CA  1 
ATOM   2947 C  C   . ALA A 1 443 ? 18.601  -16.877 -75.909 1.00 44.46  ? 421  ALA A C   1 
ATOM   2948 O  O   . ALA A 1 443 ? 18.313  -16.665 -77.104 1.00 43.30  ? 421  ALA A O   1 
ATOM   2949 C  CB  . ALA A 1 443 ? 19.049  -19.351 -75.885 1.00 48.86  ? 421  ALA A CB  1 
ATOM   2950 N  N   . PRO A 1 444 ? 19.182  -15.949 -75.136 1.00 41.55  ? 422  PRO A N   1 
ATOM   2951 C  CA  . PRO A 1 444 ? 19.484  -14.677 -75.748 1.00 41.14  ? 422  PRO A CA  1 
ATOM   2952 C  C   . PRO A 1 444 ? 20.825  -14.713 -76.490 1.00 41.32  ? 422  PRO A C   1 
ATOM   2953 O  O   . PRO A 1 444 ? 21.746  -15.437 -76.103 1.00 41.72  ? 422  PRO A O   1 
ATOM   2954 C  CB  . PRO A 1 444 ? 19.534  -13.722 -74.550 1.00 39.68  ? 422  PRO A CB  1 
ATOM   2955 C  CG  . PRO A 1 444 ? 20.089  -14.564 -73.466 1.00 41.18  ? 422  PRO A CG  1 
ATOM   2956 C  CD  . PRO A 1 444 ? 19.555  -15.959 -73.711 1.00 42.28  ? 422  PRO A CD  1 
ATOM   2957 N  N   . LEU A 1 445 ? 20.901  -13.950 -77.568 1.00 40.19  ? 423  LEU A N   1 
ATOM   2958 C  CA  . LEU A 1 445 ? 22.168  -13.588 -78.185 1.00 41.37  ? 423  LEU A CA  1 
ATOM   2959 C  C   . LEU A 1 445 ? 22.909  -12.687 -77.201 1.00 38.81  ? 423  LEU A C   1 
ATOM   2960 O  O   . LEU A 1 445 ? 22.299  -11.787 -76.650 1.00 38.21  ? 423  LEU A O   1 
ATOM   2961 C  CB  . LEU A 1 445 ? 21.877  -12.796 -79.465 1.00 41.25  ? 423  LEU A CB  1 
ATOM   2962 C  CG  . LEU A 1 445 ? 23.049  -12.094 -80.139 1.00 43.39  ? 423  LEU A CG  1 
ATOM   2963 C  CD1 . LEU A 1 445 ? 23.900  -13.120 -80.848 1.00 46.16  ? 423  LEU A CD1 1 
ATOM   2964 C  CD2 . LEU A 1 445 ? 22.548  -11.030 -81.106 1.00 44.37  ? 423  LEU A CD2 1 
ATOM   2965 N  N   . THR A 1 446 ? 24.194  -12.924 -76.964 1.00 37.41  ? 424  THR A N   1 
ATOM   2966 C  CA  . THR A 1 446 ? 24.990  -11.992 -76.176 1.00 36.30  ? 424  THR A CA  1 
ATOM   2967 C  C   . THR A 1 446 ? 26.091  -11.427 -77.054 1.00 37.26  ? 424  THR A C   1 
ATOM   2968 O  O   . THR A 1 446 ? 26.422  -12.007 -78.072 1.00 37.45  ? 424  THR A O   1 
ATOM   2969 C  CB  . THR A 1 446 ? 25.613  -12.638 -74.930 1.00 37.23  ? 424  THR A CB  1 
ATOM   2970 O  OG1 . THR A 1 446 ? 26.625  -13.542 -75.325 1.00 40.99  ? 424  THR A OG1 1 
ATOM   2971 C  CG2 . THR A 1 446 ? 24.571  -13.372 -74.106 1.00 36.58  ? 424  THR A CG2 1 
ATOM   2972 N  N   . VAL A 1 447 ? 26.629  -10.279 -76.677 1.00 36.61  ? 425  VAL A N   1 
ATOM   2973 C  CA  . VAL A 1 447 ? 27.703  -9.633  -77.430 1.00 37.66  ? 425  VAL A CA  1 
ATOM   2974 C  C   . VAL A 1 447 ? 28.816  -9.237  -76.468 1.00 38.36  ? 425  VAL A C   1 
ATOM   2975 O  O   . VAL A 1 447 ? 28.559  -9.011  -75.289 1.00 37.95  ? 425  VAL A O   1 
ATOM   2976 C  CB  . VAL A 1 447 ? 27.211  -8.368  -78.169 1.00 37.06  ? 425  VAL A CB  1 
ATOM   2977 C  CG1 . VAL A 1 447 ? 26.072  -8.704  -79.119 1.00 36.32  ? 425  VAL A CG1 1 
ATOM   2978 C  CG2 . VAL A 1 447 ? 26.774  -7.278  -77.194 1.00 36.01  ? 425  VAL A CG2 1 
ATOM   2979 N  N   . LEU A 1 448 ? 30.038  -9.126  -76.977 1.00 39.24  ? 426  LEU A N   1 
ATOM   2980 C  CA  . LEU A 1 448 ? 31.194  -8.735  -76.171 1.00 41.67  ? 426  LEU A CA  1 
ATOM   2981 C  C   . LEU A 1 448 ? 31.215  -7.221  -75.961 1.00 41.22  ? 426  LEU A C   1 
ATOM   2982 O  O   . LEU A 1 448 ? 30.658  -6.476  -76.755 1.00 38.65  ? 426  LEU A O   1 
ATOM   2983 C  CB  . LEU A 1 448 ? 32.499  -9.173  -76.851 1.00 44.57  ? 426  LEU A CB  1 
ATOM   2984 C  CG  . LEU A 1 448 ? 32.737  -10.679 -77.020 1.00 46.51  ? 426  LEU A CG  1 
ATOM   2985 C  CD1 . LEU A 1 448 ? 33.903  -10.964 -77.971 1.00 48.60  ? 426  LEU A CD1 1 
ATOM   2986 C  CD2 . LEU A 1 448 ? 32.982  -11.322 -75.672 1.00 48.42  ? 426  LEU A CD2 1 
ATOM   2987 N  N   . PRO A 1 449 ? 31.884  -6.753  -74.891 1.00 43.46  ? 427  PRO A N   1 
ATOM   2988 C  CA  . PRO A 1 449 ? 31.876  -5.307  -74.620 1.00 42.77  ? 427  PRO A CA  1 
ATOM   2989 C  C   . PRO A 1 449 ? 32.745  -4.500  -75.576 1.00 43.56  ? 427  PRO A C   1 
ATOM   2990 O  O   . PRO A 1 449 ? 32.657  -3.272  -75.608 1.00 43.00  ? 427  PRO A O   1 
ATOM   2991 C  CB  . PRO A 1 449 ? 32.392  -5.201  -73.183 1.00 45.09  ? 427  PRO A CB  1 
ATOM   2992 C  CG  . PRO A 1 449 ? 33.120  -6.489  -72.912 1.00 46.99  ? 427  PRO A CG  1 
ATOM   2993 C  CD  . PRO A 1 449 ? 32.608  -7.530  -73.867 1.00 45.51  ? 427  PRO A CD  1 
ATOM   2994 N  N   . THR A 1 450 ? 33.574  -5.177  -76.361 1.00 44.48  ? 428  THR A N   1 
ATOM   2995 C  CA  . THR A 1 450 ? 34.350  -4.501  -77.372 1.00 45.07  ? 428  THR A CA  1 
ATOM   2996 C  C   . THR A 1 450 ? 33.574  -4.307  -78.682 1.00 43.14  ? 428  THR A C   1 
ATOM   2997 O  O   . THR A 1 450 ? 34.118  -3.786  -79.622 1.00 43.45  ? 428  THR A O   1 
ATOM   2998 C  CB  . THR A 1 450 ? 35.617  -5.296  -77.665 1.00 48.92  ? 428  THR A CB  1 
ATOM   2999 O  OG1 . THR A 1 450 ? 35.241  -6.619  -78.042 1.00 49.81  ? 428  THR A OG1 1 
ATOM   3000 C  CG2 . THR A 1 450 ? 36.516  -5.344  -76.420 1.00 51.24  ? 428  THR A CG2 1 
ATOM   3001 N  N   . ILE A 1 451 ? 32.322  -4.748  -78.757 1.00 41.01  ? 429  ILE A N   1 
ATOM   3002 C  CA  . ILE A 1 451 ? 31.529  -4.590  -79.987 1.00 40.43  ? 429  ILE A CA  1 
ATOM   3003 C  C   . ILE A 1 451 ? 31.260  -3.116  -80.261 1.00 39.46  ? 429  ILE A C   1 
ATOM   3004 O  O   . ILE A 1 451 ? 31.078  -2.341  -79.331 1.00 38.16  ? 429  ILE A O   1 
ATOM   3005 C  CB  . ILE A 1 451 ? 30.190  -5.373  -79.902 1.00 38.42  ? 429  ILE A CB  1 
ATOM   3006 C  CG1 . ILE A 1 451 ? 29.546  -5.521  -81.287 1.00 38.72  ? 429  ILE A CG1 1 
ATOM   3007 C  CG2 . ILE A 1 451 ? 29.217  -4.735  -78.918 1.00 36.93  ? 429  ILE A CG2 1 
ATOM   3008 C  CD1 . ILE A 1 451 ? 28.285  -6.379  -81.285 1.00 38.11  ? 429  ILE A CD1 1 
ATOM   3009 N  N   . THR A 1 452 ? 31.248  -2.721  -81.532 1.00 39.97  ? 430  THR A N   1 
ATOM   3010 C  CA  . THR A 1 452 ? 30.896  -1.341  -81.869 1.00 39.51  ? 430  THR A CA  1 
ATOM   3011 C  C   . THR A 1 452 ? 29.389  -1.133  -81.917 1.00 37.95  ? 430  THR A C   1 
ATOM   3012 O  O   . THR A 1 452 ? 28.613  -2.089  -82.056 1.00 37.47  ? 430  THR A O   1 
ATOM   3013 C  CB  . THR A 1 452 ? 31.484  -0.894  -83.221 1.00 41.58  ? 430  THR A CB  1 
ATOM   3014 O  OG1 . THR A 1 452 ? 30.804  -1.566  -84.295 1.00 39.78  ? 430  THR A OG1 1 
ATOM   3015 C  CG2 . THR A 1 452 ? 33.011  -1.157  -83.276 1.00 43.24  ? 430  THR A CG2 1 
ATOM   3016 N  N   . CYS A 1 453 ? 28.987  0.127   -81.822 1.00 37.23  ? 431  CYS A N   1 
ATOM   3017 C  CA  . CYS A 1 453 ? 27.586  0.527   -81.958 1.00 37.61  ? 431  CYS A CA  1 
ATOM   3018 C  C   . CYS A 1 453 ? 26.996  0.110   -83.302 1.00 38.06  ? 431  CYS A C   1 
ATOM   3019 O  O   . CYS A 1 453 ? 25.861  -0.376  -83.365 1.00 37.43  ? 431  CYS A O   1 
ATOM   3020 C  CB  . CYS A 1 453 ? 27.463  2.037   -81.806 1.00 40.09  ? 431  CYS A CB  1 
ATOM   3021 S  SG  . CYS A 1 453 ? 27.838  2.626   -80.126 1.00 43.86  ? 431  CYS A SG  1 
ATOM   3022 N  N   . GLY A 1 454 ? 27.777  0.289   -84.364 1.00 37.20  ? 432  GLY A N   1 
ATOM   3023 C  CA  . GLY A 1 454 ? 27.385  -0.121  -85.696 1.00 37.86  ? 432  GLY A CA  1 
ATOM   3024 C  C   . GLY A 1 454 ? 27.196  -1.620  -85.862 1.00 38.03  ? 432  GLY A C   1 
ATOM   3025 O  O   . GLY A 1 454 ? 26.181  -2.059  -86.418 1.00 37.83  ? 432  GLY A O   1 
ATOM   3026 N  N   A HIS A 1 455 ? 28.170  -2.390  -85.391 0.50 37.23  ? 433  HIS A N   1 
ATOM   3027 N  N   B HIS A 1 455 ? 28.159  -2.423  -85.401 0.50 38.99  ? 433  HIS A N   1 
ATOM   3028 C  CA  A HIS A 1 455 ? 28.090  -3.835  -85.436 0.50 36.85  ? 433  HIS A CA  1 
ATOM   3029 C  CA  B HIS A 1 455 ? 28.017  -3.885  -85.457 0.50 39.91  ? 433  HIS A CA  1 
ATOM   3030 C  C   A HIS A 1 455 ? 26.953  -4.384  -84.522 0.50 36.73  ? 433  HIS A C   1 
ATOM   3031 C  C   B HIS A 1 455 ? 26.878  -4.376  -84.547 0.50 38.34  ? 433  HIS A C   1 
ATOM   3032 O  O   A HIS A 1 455 ? 26.407  -5.447  -84.787 0.50 36.71  ? 433  HIS A O   1 
ATOM   3033 O  O   B HIS A 1 455 ? 26.258  -5.394  -84.828 0.50 37.86  ? 433  HIS A O   1 
ATOM   3034 C  CB  A HIS A 1 455 ? 29.469  -4.435  -85.114 0.50 37.50  ? 433  HIS A CB  1 
ATOM   3035 C  CB  B HIS A 1 455 ? 29.336  -4.595  -85.120 0.50 42.89  ? 433  HIS A CB  1 
ATOM   3036 C  CG  A HIS A 1 455 ? 30.526  -4.128  -86.144 0.50 38.21  ? 433  HIS A CG  1 
ATOM   3037 C  CG  B HIS A 1 455 ? 29.314  -6.078  -85.371 0.50 45.91  ? 433  HIS A CG  1 
ATOM   3038 N  ND1 A HIS A 1 455 ? 31.878  -4.169  -85.868 0.50 38.88  ? 433  HIS A ND1 1 
ATOM   3039 N  ND1 B HIS A 1 455 ? 28.563  -6.657  -86.373 0.50 46.87  ? 433  HIS A ND1 1 
ATOM   3040 C  CD2 A HIS A 1 455 ? 30.425  -3.785  -87.453 0.50 38.05  ? 433  HIS A CD2 1 
ATOM   3041 C  CD2 B HIS A 1 455 ? 29.975  -7.096  -84.764 0.50 47.88  ? 433  HIS A CD2 1 
ATOM   3042 C  CE1 A HIS A 1 455 ? 32.561  -3.871  -86.958 0.50 39.49  ? 433  HIS A CE1 1 
ATOM   3043 C  CE1 B HIS A 1 455 ? 28.739  -7.967  -86.355 0.50 47.80  ? 433  HIS A CE1 1 
ATOM   3044 N  NE2 A HIS A 1 455 ? 31.703  -3.631  -87.932 0.50 38.98  ? 433  HIS A NE2 1 
ATOM   3045 N  NE2 B HIS A 1 455 ? 29.593  -8.258  -85.390 0.50 48.82  ? 433  HIS A NE2 1 
ATOM   3046 N  N   . THR A 1 456 ? 26.581  -3.641  -83.482 1.00 36.68  ? 434  THR A N   1 
ATOM   3047 C  CA  . THR A 1 456 ? 25.430  -3.997  -82.617 1.00 36.84  ? 434  THR A CA  1 
ATOM   3048 C  C   . THR A 1 456 ? 24.110  -3.898  -83.399 1.00 35.57  ? 434  THR A C   1 
ATOM   3049 O  O   . THR A 1 456 ? 23.305  -4.826  -83.388 1.00 33.18  ? 434  THR A O   1 
ATOM   3050 C  CB  . THR A 1 456 ? 25.354  -3.108  -81.365 1.00 38.01  ? 434  THR A CB  1 
ATOM   3051 O  OG1 . THR A 1 456 ? 26.508  -3.329  -80.549 1.00 38.25  ? 434  THR A OG1 1 
ATOM   3052 C  CG2 . THR A 1 456 ? 24.047  -3.395  -80.535 1.00 38.04  ? 434  THR A CG2 1 
ATOM   3053 N  N   . ILE A 1 457 ? 23.926  -2.791  -84.110 1.00 35.10  ? 435  ILE A N   1 
ATOM   3054 C  CA  . ILE A 1 457 ? 22.781  -2.659  -85.007 1.00 36.07  ? 435  ILE A CA  1 
ATOM   3055 C  C   . ILE A 1 457 ? 22.739  -3.856  -85.976 1.00 37.40  ? 435  ILE A C   1 
ATOM   3056 O  O   . ILE A 1 457 ? 21.713  -4.521  -86.110 1.00 36.79  ? 435  ILE A O   1 
ATOM   3057 C  CB  . ILE A 1 457 ? 22.837  -1.368  -85.855 1.00 37.16  ? 435  ILE A CB  1 
ATOM   3058 C  CG1 . ILE A 1 457 ? 22.871  -0.102  -84.970 1.00 37.25  ? 435  ILE A CG1 1 
ATOM   3059 C  CG2 . ILE A 1 457 ? 21.660  -1.312  -86.835 1.00 38.09  ? 435  ILE A CG2 1 
ATOM   3060 C  CD1 . ILE A 1 457 ? 21.715  0.019   -84.049 1.00 36.88  ? 435  ILE A CD1 1 
ATOM   3061 N  N   . GLU A 1 458 ? 23.855  -4.114  -86.648 1.00 36.88  ? 436  GLU A N   1 
ATOM   3062 C  CA  . GLU A 1 458 ? 23.895  -5.148  -87.676 1.00 40.46  ? 436  GLU A CA  1 
ATOM   3063 C  C   . GLU A 1 458 ? 23.537  -6.524  -87.119 1.00 40.87  ? 436  GLU A C   1 
ATOM   3064 O  O   . GLU A 1 458 ? 22.695  -7.224  -87.699 1.00 39.77  ? 436  GLU A O   1 
ATOM   3065 C  CB  . GLU A 1 458 ? 25.271  -5.202  -88.368 1.00 42.16  ? 436  GLU A CB  1 
ATOM   3066 C  CG  . GLU A 1 458 ? 25.634  -3.937  -89.144 1.00 43.92  ? 436  GLU A CG  1 
ATOM   3067 C  CD  . GLU A 1 458 ? 27.049  -3.968  -89.711 1.00 48.69  ? 436  GLU A CD  1 
ATOM   3068 O  OE1 . GLU A 1 458 ? 27.827  -4.880  -89.356 1.00 52.19  ? 436  GLU A OE1 1 
ATOM   3069 O  OE2 . GLU A 1 458 ? 27.393  -3.068  -90.502 1.00 49.74  ? 436  GLU A OE2 1 
ATOM   3070 N  N   . ILE A 1 459 ? 24.149  -6.918  -85.992 1.00 39.32  ? 437  ILE A N   1 
ATOM   3071 C  CA  . ILE A 1 459 ? 23.976  -8.295  -85.529 1.00 40.09  ? 437  ILE A CA  1 
ATOM   3072 C  C   . ILE A 1 459 ? 22.578  -8.512  -84.943 1.00 38.09  ? 437  ILE A C   1 
ATOM   3073 O  O   . ILE A 1 459 ? 21.976  -9.573  -85.131 1.00 36.87  ? 437  ILE A O   1 
ATOM   3074 C  CB  . ILE A 1 459 ? 25.101  -8.770  -84.559 1.00 42.17  ? 437  ILE A CB  1 
ATOM   3075 C  CG1 . ILE A 1 459 ? 25.032  -10.294 -84.392 1.00 46.73  ? 437  ILE A CG1 1 
ATOM   3076 C  CG2 . ILE A 1 459 ? 25.001  -8.097  -83.208 1.00 42.35  ? 437  ILE A CG2 1 
ATOM   3077 C  CD1 . ILE A 1 459 ? 26.295  -10.943 -83.855 1.00 49.40  ? 437  ILE A CD1 1 
ATOM   3078 N  N   . LEU A 1 460 ? 22.054  -7.510  -84.247 1.00 36.12  ? 438  LEU A N   1 
ATOM   3079 C  CA  . LEU A 1 460 ? 20.684  -7.579  -83.760 1.00 36.86  ? 438  LEU A CA  1 
ATOM   3080 C  C   . LEU A 1 460 ? 19.711  -7.724  -84.937 1.00 37.84  ? 438  LEU A C   1 
ATOM   3081 O  O   . LEU A 1 460 ? 18.864  -8.609  -84.939 1.00 38.84  ? 438  LEU A O   1 
ATOM   3082 C  CB  . LEU A 1 460 ? 20.337  -6.366  -82.904 1.00 34.65  ? 438  LEU A CB  1 
ATOM   3083 C  CG  . LEU A 1 460 ? 21.136  -6.231  -81.610 1.00 34.94  ? 438  LEU A CG  1 
ATOM   3084 C  CD1 . LEU A 1 460 ? 20.811  -4.897  -80.941 1.00 35.09  ? 438  LEU A CD1 1 
ATOM   3085 C  CD2 . LEU A 1 460 ? 20.870  -7.365  -80.649 1.00 34.08  ? 438  LEU A CD2 1 
ATOM   3086 N  N   . ARG A 1 461 ? 19.847  -6.884  -85.947 1.00 39.27  ? 439  ARG A N   1 
ATOM   3087 C  CA  . ARG A 1 461 ? 18.938  -6.977  -87.079 1.00 42.41  ? 439  ARG A CA  1 
ATOM   3088 C  C   . ARG A 1 461 ? 19.127  -8.319  -87.800 1.00 46.47  ? 439  ARG A C   1 
ATOM   3089 O  O   . ARG A 1 461 ? 18.154  -9.014  -88.088 1.00 45.98  ? 439  ARG A O   1 
ATOM   3090 C  CB  . ARG A 1 461 ? 19.128  -5.806  -88.054 1.00 43.76  ? 439  ARG A CB  1 
ATOM   3091 C  CG  . ARG A 1 461 ? 18.434  -4.516  -87.607 1.00 44.19  ? 439  ARG A CG  1 
ATOM   3092 C  CD  . ARG A 1 461 ? 18.576  -3.360  -88.586 1.00 45.42  ? 439  ARG A CD  1 
ATOM   3093 N  NE  . ARG A 1 461 ? 18.597  -3.755  -90.019 1.00 51.40  ? 439  ARG A NE  1 
ATOM   3094 C  CZ  . ARG A 1 461 ? 17.542  -3.836  -90.818 1.00 50.60  ? 439  ARG A CZ  1 
ATOM   3095 N  NH1 . ARG A 1 461 ? 16.319  -3.556  -90.404 1.00 50.94  ? 439  ARG A NH1 1 
ATOM   3096 N  NH2 . ARG A 1 461 ? 17.723  -4.197  -92.059 1.00 59.12  ? 439  ARG A NH2 1 
ATOM   3097 N  N   . GLU A 1 462 ? 20.377  -8.675  -88.082 1.00 48.42  ? 440  GLU A N   1 
ATOM   3098 C  CA  . GLU A 1 462 ? 20.667  -9.915  -88.777 1.00 53.32  ? 440  GLU A CA  1 
ATOM   3099 C  C   . GLU A 1 462 ? 20.134  -11.153 -88.052 1.00 53.14  ? 440  GLU A C   1 
ATOM   3100 O  O   . GLU A 1 462 ? 19.602  -12.054 -88.687 1.00 54.25  ? 440  GLU A O   1 
ATOM   3101 C  CB  . GLU A 1 462 ? 22.165  -10.077 -88.981 1.00 57.31  ? 440  GLU A CB  1 
ATOM   3102 C  CG  . GLU A 1 462 ? 22.513  -11.430 -89.592 1.00 65.05  ? 440  GLU A CG  1 
ATOM   3103 C  CD  . GLU A 1 462 ? 23.992  -11.610 -89.854 1.00 69.96  ? 440  GLU A CD  1 
ATOM   3104 O  OE1 . GLU A 1 462 ? 24.725  -10.597 -89.950 1.00 71.84  ? 440  GLU A OE1 1 
ATOM   3105 O  OE2 . GLU A 1 462 ? 24.413  -12.783 -89.964 1.00 78.35  ? 440  GLU A OE2 1 
ATOM   3106 N  N   . LYS A 1 463 ? 20.294  -11.212 -86.735 1.00 49.68  ? 441  LYS A N   1 
ATOM   3107 C  CA  . LYS A 1 463 ? 19.930  -12.413 -85.990 1.00 50.69  ? 441  LYS A CA  1 
ATOM   3108 C  C   . LYS A 1 463 ? 18.499  -12.377 -85.476 1.00 50.34  ? 441  LYS A C   1 
ATOM   3109 O  O   . LYS A 1 463 ? 18.012  -13.360 -84.948 1.00 52.61  ? 441  LYS A O   1 
ATOM   3110 C  CB  . LYS A 1 463 ? 20.903  -12.627 -84.821 1.00 51.84  ? 441  LYS A CB  1 
ATOM   3111 C  CG  . LYS A 1 463 ? 22.321  -12.989 -85.234 1.00 54.90  ? 441  LYS A CG  1 
ATOM   3112 C  CD  . LYS A 1 463 ? 22.409  -14.453 -85.642 1.00 61.02  ? 441  LYS A CD  1 
ATOM   3113 C  CE  . LYS A 1 463 ? 23.217  -14.666 -86.918 1.00 68.90  ? 441  LYS A CE  1 
ATOM   3114 N  NZ  . LYS A 1 463 ? 24.654  -14.973 -86.669 1.00 72.48  ? 441  LYS A NZ  1 
ATOM   3115 N  N   . GLY A 1 464 ? 17.821  -11.246 -85.605 1.00 49.51  ? 442  GLY A N   1 
ATOM   3116 C  CA  . GLY A 1 464 ? 16.418  -11.162 -85.221 1.00 47.81  ? 442  GLY A CA  1 
ATOM   3117 C  C   . GLY A 1 464 ? 16.169  -10.875 -83.754 1.00 46.58  ? 442  GLY A C   1 
ATOM   3118 O  O   . GLY A 1 464 ? 15.162  -11.317 -83.208 1.00 48.14  ? 442  GLY A O   1 
ATOM   3119 N  N   . PHE A 1 465 ? 17.063  -10.139 -83.095 1.00 42.61  ? 443  PHE A N   1 
ATOM   3120 C  CA  . PHE A 1 465 ? 16.867  -9.811  -81.691 1.00 41.87  ? 443  PHE A CA  1 
ATOM   3121 C  C   . PHE A 1 465 ? 16.753  -8.292  -81.541 1.00 41.11  ? 443  PHE A C   1 
ATOM   3122 O  O   . PHE A 1 465 ? 17.332  -7.533  -82.318 1.00 41.66  ? 443  PHE A O   1 
ATOM   3123 C  CB  . PHE A 1 465 ? 18.030  -10.341 -80.834 1.00 42.48  ? 443  PHE A CB  1 
ATOM   3124 C  CG  . PHE A 1 465 ? 18.073  -11.841 -80.721 1.00 43.56  ? 443  PHE A CG  1 
ATOM   3125 C  CD1 . PHE A 1 465 ? 18.578  -12.613 -81.758 1.00 46.57  ? 443  PHE A CD1 1 
ATOM   3126 C  CD2 . PHE A 1 465 ? 17.625  -12.480 -79.575 1.00 43.17  ? 443  PHE A CD2 1 
ATOM   3127 C  CE1 . PHE A 1 465 ? 18.621  -14.005 -81.671 1.00 48.29  ? 443  PHE A CE1 1 
ATOM   3128 C  CE2 . PHE A 1 465 ? 17.657  -13.865 -79.483 1.00 45.55  ? 443  PHE A CE2 1 
ATOM   3129 C  CZ  . PHE A 1 465 ? 18.155  -14.625 -80.522 1.00 46.81  ? 443  PHE A CZ  1 
ATOM   3130 N  N   . ASP A 1 466 ? 15.994  -7.866  -80.549 1.00 39.99  ? 444  ASP A N   1 
ATOM   3131 C  CA  . ASP A 1 466 ? 15.828  -6.454  -80.236 1.00 40.17  ? 444  ASP A CA  1 
ATOM   3132 C  C   . ASP A 1 466 ? 16.762  -5.966  -79.145 1.00 36.33  ? 444  ASP A C   1 
ATOM   3133 O  O   . ASP A 1 466 ? 16.838  -4.770  -78.885 1.00 34.31  ? 444  ASP A O   1 
ATOM   3134 C  CB  . ASP A 1 466 ? 14.379  -6.175  -79.831 1.00 46.01  ? 444  ASP A CB  1 
ATOM   3135 C  CG  . ASP A 1 466 ? 13.448  -6.086  -81.041 1.00 55.25  ? 444  ASP A CG  1 
ATOM   3136 O  OD1 . ASP A 1 466 ? 13.935  -5.860  -82.177 1.00 63.54  ? 444  ASP A OD1 1 
ATOM   3137 O  OD2 . ASP A 1 466 ? 12.225  -6.255  -80.863 1.00 64.53  ? 444  ASP A OD2 1 
ATOM   3138 N  N   . GLN A 1 467 ? 17.471  -6.889  -78.512 1.00 34.83  ? 445  GLN A N   1 
ATOM   3139 C  CA  . GLN A 1 467 ? 18.310  -6.555  -77.384 1.00 34.78  ? 445  GLN A CA  1 
ATOM   3140 C  C   . GLN A 1 467 ? 19.319  -7.669  -77.199 1.00 34.90  ? 445  GLN A C   1 
ATOM   3141 O  O   . GLN A 1 467 ? 19.135  -8.765  -77.704 1.00 35.10  ? 445  GLN A O   1 
ATOM   3142 C  CB  . GLN A 1 467 ? 17.442  -6.442  -76.132 1.00 37.36  ? 445  GLN A CB  1 
ATOM   3143 C  CG  . GLN A 1 467 ? 16.666  -7.722  -75.892 1.00 39.80  ? 445  GLN A CG  1 
ATOM   3144 C  CD  . GLN A 1 467 ? 15.704  -7.642  -74.750 1.00 45.38  ? 445  GLN A CD  1 
ATOM   3145 O  OE1 . GLN A 1 467 ? 15.330  -6.558  -74.293 1.00 47.54  ? 445  GLN A OE1 1 
ATOM   3146 N  NE2 . GLN A 1 467 ? 15.281  -8.813  -74.271 1.00 47.37  ? 445  GLN A NE2 1 
ATOM   3147 N  N   . ALA A 1 468 ? 20.378  -7.378  -76.457 1.00 33.96  ? 446  ALA A N   1 
ATOM   3148 C  CA  . ALA A 1 468 ? 21.417  -8.345  -76.181 1.00 33.73  ? 446  ALA A CA  1 
ATOM   3149 C  C   . ALA A 1 468 ? 22.102  -7.979  -74.873 1.00 33.21  ? 446  ALA A C   1 
ATOM   3150 O  O   . ALA A 1 468 ? 22.460  -6.806  -74.658 1.00 32.22  ? 446  ALA A O   1 
ATOM   3151 C  CB  . ALA A 1 468 ? 22.434  -8.377  -77.310 1.00 34.38  ? 446  ALA A CB  1 
ATOM   3152 N  N   . PRO A 1 469 ? 22.259  -8.969  -73.979 1.00 33.04  ? 447  PRO A N   1 
ATOM   3153 C  CA  . PRO A 1 469 ? 23.160  -8.747  -72.873 1.00 32.35  ? 447  PRO A CA  1 
ATOM   3154 C  C   . PRO A 1 469 ? 24.576  -8.610  -73.380 1.00 32.01  ? 447  PRO A C   1 
ATOM   3155 O  O   . PRO A 1 469 ? 24.971  -9.270  -74.356 1.00 31.61  ? 447  PRO A O   1 
ATOM   3156 C  CB  . PRO A 1 469 ? 23.018  -10.012 -72.027 1.00 33.66  ? 447  PRO A CB  1 
ATOM   3157 C  CG  . PRO A 1 469 ? 21.759  -10.652 -72.463 1.00 33.47  ? 447  PRO A CG  1 
ATOM   3158 C  CD  . PRO A 1 469 ? 21.606  -10.288 -73.895 1.00 33.39  ? 447  PRO A CD  1 
ATOM   3159 N  N   . VAL A 1 470 ? 25.314  -7.739  -72.712 1.00 31.63  ? 448  VAL A N   1 
ATOM   3160 C  CA  . VAL A 1 470 ? 26.720  -7.554  -72.938 1.00 32.73  ? 448  VAL A CA  1 
ATOM   3161 C  C   . VAL A 1 470 ? 27.466  -8.355  -71.892 1.00 35.00  ? 448  VAL A C   1 
ATOM   3162 O  O   . VAL A 1 470 ? 27.323  -8.104  -70.693 1.00 34.42  ? 448  VAL A O   1 
ATOM   3163 C  CB  . VAL A 1 470 ? 27.112  -6.071  -72.838 1.00 32.17  ? 448  VAL A CB  1 
ATOM   3164 C  CG1 . VAL A 1 470 ? 28.596  -5.881  -73.095 1.00 33.96  ? 448  VAL A CG1 1 
ATOM   3165 C  CG2 . VAL A 1 470 ? 26.298  -5.245  -73.811 1.00 31.01  ? 448  VAL A CG2 1 
ATOM   3166 N  N   . VAL A 1 471 ? 28.287  -9.291  -72.364 1.00 36.40  ? 449  VAL A N   1 
ATOM   3167 C  CA  . VAL A 1 471 ? 28.907  -10.296 -71.525 1.00 39.64  ? 449  VAL A CA  1 
ATOM   3168 C  C   . VAL A 1 471 ? 30.372  -10.407 -71.918 1.00 43.07  ? 449  VAL A C   1 
ATOM   3169 O  O   . VAL A 1 471 ? 30.682  -10.665 -73.074 1.00 43.42  ? 449  VAL A O   1 
ATOM   3170 C  CB  . VAL A 1 471 ? 28.248  -11.677 -71.705 1.00 39.78  ? 449  VAL A CB  1 
ATOM   3171 C  CG1 . VAL A 1 471 ? 28.944  -12.713 -70.819 1.00 42.74  ? 449  VAL A CG1 1 
ATOM   3172 C  CG2 . VAL A 1 471 ? 26.757  -11.610 -71.402 1.00 38.67  ? 449  VAL A CG2 1 
ATOM   3173 N  N   . ASP A 1 472 ? 31.273  -10.213 -70.968 1.00 46.62  ? 450  ASP A N   1 
ATOM   3174 C  CA  . ASP A 1 472 ? 32.691  -10.267 -71.296 1.00 52.77  ? 450  ASP A CA  1 
ATOM   3175 C  C   . ASP A 1 472 ? 33.181  -11.713 -71.392 1.00 56.81  ? 450  ASP A C   1 
ATOM   3176 O  O   . ASP A 1 472 ? 32.419  -12.667 -71.236 1.00 54.79  ? 450  ASP A O   1 
ATOM   3177 C  CB  . ASP A 1 472 ? 33.542  -9.409  -70.332 1.00 55.08  ? 450  ASP A CB  1 
ATOM   3178 C  CG  . ASP A 1 472 ? 33.729  -10.036 -68.969 1.00 58.30  ? 450  ASP A CG  1 
ATOM   3179 O  OD1 . ASP A 1 472 ? 33.543  -11.260 -68.799 1.00 60.69  ? 450  ASP A OD1 1 
ATOM   3180 O  OD2 . ASP A 1 472 ? 34.073  -9.278  -68.043 1.00 61.71  ? 450  ASP A OD2 1 
ATOM   3181 N  N   . GLU A 1 473 ? 34.475  -11.849 -71.632 1.00 63.49  ? 451  GLU A N   1 
ATOM   3182 C  CA  . GLU A 1 473 ? 35.080  -13.102 -72.042 1.00 69.13  ? 451  GLU A CA  1 
ATOM   3183 C  C   . GLU A 1 473 ? 35.044  -14.051 -70.844 1.00 69.59  ? 451  GLU A C   1 
ATOM   3184 O  O   . GLU A 1 473 ? 34.816  -15.251 -70.994 1.00 71.62  ? 451  GLU A O   1 
ATOM   3185 C  CB  . GLU A 1 473 ? 36.512  -12.843 -72.572 1.00 75.49  ? 451  GLU A CB  1 
ATOM   3186 C  CG  . GLU A 1 473 ? 36.610  -11.763 -73.685 1.00 78.26  ? 451  GLU A CG  1 
ATOM   3187 C  CD  . GLU A 1 473 ? 36.196  -10.334 -73.241 1.00 81.09  ? 451  GLU A CD  1 
ATOM   3188 O  OE1 . GLU A 1 473 ? 36.427  -9.984  -72.062 1.00 86.40  ? 451  GLU A OE1 1 
ATOM   3189 O  OE2 . GLU A 1 473 ? 35.628  -9.543  -74.046 1.00 79.90  ? 451  GLU A OE2 1 
ATOM   3190 N  N   . ALA A 1 474 ? 35.184  -13.480 -69.649 1.00 67.89  ? 452  ALA A N   1 
ATOM   3191 C  CA  . ALA A 1 474 ? 35.138  -14.228 -68.396 1.00 66.73  ? 452  ALA A CA  1 
ATOM   3192 C  C   . ALA A 1 474 ? 33.722  -14.589 -67.938 1.00 64.18  ? 452  ALA A C   1 
ATOM   3193 O  O   . ALA A 1 474 ? 33.558  -15.230 -66.901 1.00 65.93  ? 452  ALA A O   1 
ATOM   3194 C  CB  . ALA A 1 474 ? 35.841  -13.431 -67.314 1.00 67.80  ? 452  ALA A CB  1 
ATOM   3195 N  N   . GLY A 1 475 ? 32.696  -14.174 -68.684 1.00 58.59  ? 453  GLY A N   1 
ATOM   3196 C  CA  . GLY A 1 475 ? 31.319  -14.510 -68.335 1.00 54.84  ? 453  GLY A CA  1 
ATOM   3197 C  C   . GLY A 1 475 ? 30.617  -13.473 -67.469 1.00 52.44  ? 453  GLY A C   1 
ATOM   3198 O  O   . GLY A 1 475 ? 29.475  -13.673 -67.085 1.00 50.47  ? 453  GLY A O   1 
ATOM   3199 N  N   . VAL A 1 476 ? 31.275  -12.356 -67.170 1.00 52.20  ? 454  VAL A N   1 
ATOM   3200 C  CA  . VAL A 1 476 ? 30.638  -11.292 -66.383 1.00 50.22  ? 454  VAL A CA  1 
ATOM   3201 C  C   . VAL A 1 476 ? 29.614  -10.495 -67.214 1.00 46.38  ? 454  VAL A C   1 
ATOM   3202 O  O   . VAL A 1 476 ? 29.921  -10.018 -68.306 1.00 45.48  ? 454  VAL A O   1 
ATOM   3203 C  CB  . VAL A 1 476 ? 31.681  -10.307 -65.814 1.00 52.95  ? 454  VAL A CB  1 
ATOM   3204 C  CG1 . VAL A 1 476 ? 30.993  -9.218  -64.991 1.00 52.14  ? 454  VAL A CG1 1 
ATOM   3205 C  CG2 . VAL A 1 476 ? 32.722  -11.053 -64.972 1.00 55.63  ? 454  VAL A CG2 1 
ATOM   3206 N  N   . ILE A 1 477 ? 28.410  -10.338 -66.675 1.00 43.61  ? 455  ILE A N   1 
ATOM   3207 C  CA  . ILE A 1 477 ? 27.365  -9.566  -67.335 1.00 41.39  ? 455  ILE A CA  1 
ATOM   3208 C  C   . ILE A 1 477 ? 27.533  -8.073  -67.048 1.00 40.96  ? 455  ILE A C   1 
ATOM   3209 O  O   . ILE A 1 477 ? 27.418  -7.650  -65.903 1.00 40.34  ? 455  ILE A O   1 
ATOM   3210 C  CB  . ILE A 1 477 ? 25.976  -9.988  -66.866 1.00 40.02  ? 455  ILE A CB  1 
ATOM   3211 C  CG1 . ILE A 1 477 ? 25.768  -11.491 -67.057 1.00 40.80  ? 455  ILE A CG1 1 
ATOM   3212 C  CG2 . ILE A 1 477 ? 24.908  -9.215  -67.627 1.00 38.19  ? 455  ILE A CG2 1 
ATOM   3213 C  CD1 . ILE A 1 477 ? 24.444  -11.954 -66.476 1.00 40.44  ? 455  ILE A CD1 1 
ATOM   3214 N  N   . LEU A 1 478 ? 27.784  -7.283  -68.091 1.00 39.76  ? 456  LEU A N   1 
ATOM   3215 C  CA  . LEU A 1 478 ? 28.012  -5.853  -67.927 1.00 40.69  ? 456  LEU A CA  1 
ATOM   3216 C  C   . LEU A 1 478 ? 26.744  -5.009  -68.063 1.00 38.08  ? 456  LEU A C   1 
ATOM   3217 O  O   . LEU A 1 478 ? 26.678  -3.902  -67.548 1.00 38.50  ? 456  LEU A O   1 
ATOM   3218 C  CB  . LEU A 1 478 ? 29.084  -5.380  -68.905 1.00 42.20  ? 456  LEU A CB  1 
ATOM   3219 C  CG  . LEU A 1 478 ? 30.453  -6.070  -68.746 1.00 45.29  ? 456  LEU A CG  1 
ATOM   3220 C  CD1 . LEU A 1 478 ? 31.372  -5.648  -69.873 1.00 46.74  ? 456  LEU A CD1 1 
ATOM   3221 C  CD2 . LEU A 1 478 ? 31.095  -5.769  -67.408 1.00 47.62  ? 456  LEU A CD2 1 
ATOM   3222 N  N   . GLY A 1 479 ? 25.739  -5.534  -68.752 1.00 36.68  ? 457  GLY A N   1 
ATOM   3223 C  CA  . GLY A 1 479 ? 24.487  -4.814  -68.937 1.00 33.90  ? 457  GLY A CA  1 
ATOM   3224 C  C   . GLY A 1 479 ? 23.759  -5.269  -70.177 1.00 32.41  ? 457  GLY A C   1 
ATOM   3225 O  O   . GLY A 1 479 ? 24.017  -6.362  -70.676 1.00 32.87  ? 457  GLY A O   1 
ATOM   3226 N  N   . MET A 1 480 ? 22.853  -4.422  -70.661 1.00 30.72  ? 458  MET A N   1 
ATOM   3227 C  CA  . MET A 1 480 ? 22.055  -4.671  -71.834 1.00 30.56  ? 458  MET A CA  1 
ATOM   3228 C  C   . MET A 1 480 ? 22.258  -3.586  -72.887 1.00 30.64  ? 458  MET A C   1 
ATOM   3229 O  O   . MET A 1 480 ? 22.397  -2.406  -72.542 1.00 31.00  ? 458  MET A O   1 
ATOM   3230 C  CB  . MET A 1 480 ? 20.571  -4.639  -71.438 1.00 31.67  ? 458  MET A CB  1 
ATOM   3231 C  CG  . MET A 1 480 ? 20.139  -5.779  -70.538 1.00 31.89  ? 458  MET A CG  1 
ATOM   3232 S  SD  . MET A 1 480 ? 20.290  -7.377  -71.349 1.00 34.12  ? 458  MET A SD  1 
ATOM   3233 C  CE  . MET A 1 480 ? 19.130  -7.300  -72.703 1.00 32.66  ? 458  MET A CE  1 
ATOM   3234 N  N   . VAL A 1 481 ? 22.235  -3.975  -74.164 1.00 30.69  ? 459  VAL A N   1 
ATOM   3235 C  CA  . VAL A 1 481 ? 22.018  -3.008  -75.249 1.00 31.18  ? 459  VAL A CA  1 
ATOM   3236 C  C   . VAL A 1 481 ? 20.742  -3.348  -75.998 1.00 30.27  ? 459  VAL A C   1 
ATOM   3237 O  O   . VAL A 1 481 ? 20.379  -4.513  -76.104 1.00 30.59  ? 459  VAL A O   1 
ATOM   3238 C  CB  . VAL A 1 481 ? 23.188  -2.926  -76.245 1.00 32.97  ? 459  VAL A CB  1 
ATOM   3239 C  CG1 . VAL A 1 481 ? 24.371  -2.275  -75.562 1.00 34.92  ? 459  VAL A CG1 1 
ATOM   3240 C  CG2 . VAL A 1 481 ? 23.550  -4.306  -76.799 1.00 33.53  ? 459  VAL A CG2 1 
ATOM   3241 N  N   . THR A 1 482 ? 20.081  -2.330  -76.537 1.00 30.53  ? 460  THR A N   1 
ATOM   3242 C  CA  . THR A 1 482 ? 18.897  -2.534  -77.333 1.00 30.38  ? 460  THR A CA  1 
ATOM   3243 C  C   . THR A 1 482 ? 19.056  -1.896  -78.699 1.00 30.64  ? 460  THR A C   1 
ATOM   3244 O  O   . THR A 1 482 ? 19.740  -0.886  -78.875 1.00 30.06  ? 460  THR A O   1 
ATOM   3245 C  CB  . THR A 1 482 ? 17.649  -1.941  -76.670 1.00 31.13  ? 460  THR A CB  1 
ATOM   3246 O  OG1 . THR A 1 482 ? 17.751  -0.517  -76.641 1.00 32.61  ? 460  THR A OG1 1 
ATOM   3247 C  CG2 . THR A 1 482 ? 17.461  -2.474  -75.253 1.00 32.24  ? 460  THR A CG2 1 
ATOM   3248 N  N   . LEU A 1 483 ? 18.378  -2.486  -79.664 1.00 29.98  ? 461  LEU A N   1 
ATOM   3249 C  CA  . LEU A 1 483 ? 18.369  -1.980  -81.019 1.00 30.11  ? 461  LEU A CA  1 
ATOM   3250 C  C   . LEU A 1 483 ? 17.798  -0.562  -81.065 1.00 30.53  ? 461  LEU A C   1 
ATOM   3251 O  O   . LEU A 1 483 ? 18.356  0.317   -81.704 1.00 29.49  ? 461  LEU A O   1 
ATOM   3252 C  CB  . LEU A 1 483 ? 17.494  -2.903  -81.867 1.00 30.67  ? 461  LEU A CB  1 
ATOM   3253 C  CG  . LEU A 1 483 ? 17.353  -2.529  -83.323 1.00 32.00  ? 461  LEU A CG  1 
ATOM   3254 C  CD1 . LEU A 1 483 ? 18.705  -2.386  -83.981 1.00 31.75  ? 461  LEU A CD1 1 
ATOM   3255 C  CD2 . LEU A 1 483 ? 16.479  -3.569  -84.026 1.00 34.54  ? 461  LEU A CD2 1 
ATOM   3256 N  N   . GLY A 1 484 ? 16.662  -0.361  -80.386 1.00 31.53  ? 462  GLY A N   1 
ATOM   3257 C  CA  . GLY A 1 484 ? 15.959  0.917   -80.407 1.00 31.56  ? 462  GLY A CA  1 
ATOM   3258 C  C   . GLY A 1 484 ? 16.772  2.060   -79.805 1.00 32.10  ? 462  GLY A C   1 
ATOM   3259 O  O   . GLY A 1 484 ? 16.872  3.160   -80.387 1.00 32.51  ? 462  GLY A O   1 
ATOM   3260 N  N   . ASN A 1 485 ? 17.380  1.812   -78.653 1.00 31.10  ? 463  ASN A N   1 
ATOM   3261 C  CA  . ASN A 1 485 ? 18.193  2.848   -78.031 1.00 31.54  ? 463  ASN A CA  1 
ATOM   3262 C  C   . ASN A 1 485 ? 19.509  3.118   -78.757 1.00 31.60  ? 463  ASN A C   1 
ATOM   3263 O  O   . ASN A 1 485 ? 19.950  4.266   -78.866 1.00 33.31  ? 463  ASN A O   1 
ATOM   3264 C  CB  . ASN A 1 485 ? 18.452  2.519   -76.574 1.00 32.36  ? 463  ASN A CB  1 
ATOM   3265 C  CG  . ASN A 1 485 ? 18.826  3.734   -75.794 1.00 33.92  ? 463  ASN A CG  1 
ATOM   3266 O  OD1 . ASN A 1 485 ? 18.137  4.766   -75.842 1.00 32.69  ? 463  ASN A OD1 1 
ATOM   3267 N  ND2 . ASN A 1 485 ? 19.942  3.641   -75.092 1.00 35.39  ? 463  ASN A ND2 1 
ATOM   3268 N  N   . MET A 1 486 ? 20.131  2.072   -79.277 1.00 30.79  ? 464  MET A N   1 
ATOM   3269 C  CA  . MET A 1 486 ? 21.309  2.273   -80.094 1.00 32.82  ? 464  MET A CA  1 
ATOM   3270 C  C   . MET A 1 486 ? 20.985  3.131   -81.332 1.00 31.80  ? 464  MET A C   1 
ATOM   3271 O  O   . MET A 1 486 ? 21.728  4.032   -81.682 1.00 31.14  ? 464  MET A O   1 
ATOM   3272 C  CB  . MET A 1 486 ? 21.910  0.941   -80.514 1.00 35.45  ? 464  MET A CB  1 
ATOM   3273 C  CG  . MET A 1 486 ? 23.243  1.104   -81.220 1.00 38.41  ? 464  MET A CG  1 
ATOM   3274 S  SD  . MET A 1 486 ? 24.469  1.748   -80.080 1.00 42.87  ? 464  MET A SD  1 
ATOM   3275 C  CE  . MET A 1 486 ? 24.648  0.355   -78.971 1.00 43.19  ? 464  MET A CE  1 
ATOM   3276 N  N   . LEU A 1 487 ? 19.864  2.865   -81.976 1.00 32.59  ? 465  LEU A N   1 
ATOM   3277 C  CA  . LEU A 1 487 ? 19.513  3.599   -83.190 1.00 34.75  ? 465  LEU A CA  1 
ATOM   3278 C  C   . LEU A 1 487 ? 19.142  5.046   -82.875 1.00 34.83  ? 465  LEU A C   1 
ATOM   3279 O  O   . LEU A 1 487 ? 19.517  5.937   -83.607 1.00 35.28  ? 465  LEU A O   1 
ATOM   3280 C  CB  . LEU A 1 487 ? 18.346  2.954   -83.929 1.00 35.88  ? 465  LEU A CB  1 
ATOM   3281 C  CG  . LEU A 1 487 ? 18.705  1.861   -84.912 1.00 37.76  ? 465  LEU A CG  1 
ATOM   3282 C  CD1 . LEU A 1 487 ? 17.436  1.114   -85.324 1.00 39.16  ? 465  LEU A CD1 1 
ATOM   3283 C  CD2 . LEU A 1 487 ? 19.452  2.451   -86.107 1.00 38.96  ? 465  LEU A CD2 1 
ATOM   3284 N  N   . SER A 1 488 ? 18.356  5.256   -81.819 1.00 33.48  ? 466  SER A N   1 
ATOM   3285 C  CA  . SER A 1 488 ? 17.977  6.606   -81.451 1.00 34.81  ? 466  SER A CA  1 
ATOM   3286 C  C   . SER A 1 488 ? 19.264  7.382   -81.145 1.00 35.92  ? 466  SER A C   1 
ATOM   3287 O  O   . SER A 1 488 ? 19.414  8.537   -81.573 1.00 38.76  ? 466  SER A O   1 
ATOM   3288 C  CB  . SER A 1 488 ? 17.022  6.589   -80.257 1.00 35.15  ? 466  SER A CB  1 
ATOM   3289 O  OG  . SER A 1 488 ? 16.621  7.901   -79.890 1.00 38.00  ? 466  SER A OG  1 
ATOM   3290 N  N   . SER A 1 489 ? 20.201  6.743   -80.439 1.00 35.22  ? 467  SER A N   1 
ATOM   3291 C  CA  . SER A 1 489 ? 21.463  7.392   -80.082 1.00 36.82  ? 467  SER A CA  1 
ATOM   3292 C  C   . SER A 1 489 ? 22.284  7.777   -81.307 1.00 38.90  ? 467  SER A C   1 
ATOM   3293 O  O   . SER A 1 489 ? 22.858  8.860   -81.360 1.00 39.67  ? 467  SER A O   1 
ATOM   3294 C  CB  . SER A 1 489 ? 22.283  6.505   -79.145 1.00 36.54  ? 467  SER A CB  1 
ATOM   3295 O  OG  . SER A 1 489 ? 21.554  6.275   -77.945 1.00 35.62  ? 467  SER A OG  1 
ATOM   3296 N  N   . LEU A 1 490 ? 22.319  6.883   -82.290 1.00 39.83  ? 468  LEU A N   1 
ATOM   3297 C  CA  . LEU A 1 490 ? 23.058  7.101   -83.520 1.00 41.72  ? 468  LEU A CA  1 
ATOM   3298 C  C   . LEU A 1 490 ? 22.411  8.197   -84.321 1.00 41.69  ? 468  LEU A C   1 
ATOM   3299 O  O   . LEU A 1 490 ? 23.076  9.098   -84.785 1.00 43.66  ? 468  LEU A O   1 
ATOM   3300 C  CB  . LEU A 1 490 ? 23.062  5.829   -84.365 1.00 44.18  ? 468  LEU A CB  1 
ATOM   3301 C  CG  . LEU A 1 490 ? 24.242  4.891   -84.118 1.00 47.44  ? 468  LEU A CG  1 
ATOM   3302 C  CD1 . LEU A 1 490 ? 23.926  3.455   -84.535 1.00 48.37  ? 468  LEU A CD1 1 
ATOM   3303 C  CD2 . LEU A 1 490 ? 25.475  5.419   -84.845 1.00 48.95  ? 468  LEU A CD2 1 
ATOM   3304 N  N   . LEU A 1 491 ? 21.105  8.106   -84.503 1.00 42.07  ? 469  LEU A N   1 
ATOM   3305 C  CA  . LEU A 1 491 ? 20.396  9.103   -85.296 1.00 45.31  ? 469  LEU A CA  1 
ATOM   3306 C  C   . LEU A 1 491 ? 20.476  10.491  -84.670 1.00 46.67  ? 469  LEU A C   1 
ATOM   3307 O  O   . LEU A 1 491 ? 20.470  11.482  -85.373 1.00 49.42  ? 469  LEU A O   1 
ATOM   3308 C  CB  . LEU A 1 491 ? 18.935  8.704   -85.490 1.00 45.39  ? 469  LEU A CB  1 
ATOM   3309 C  CG  . LEU A 1 491 ? 18.726  7.417   -86.287 1.00 45.32  ? 469  LEU A CG  1 
ATOM   3310 C  CD1 . LEU A 1 491 ? 17.240  7.171   -86.478 1.00 46.01  ? 469  LEU A CD1 1 
ATOM   3311 C  CD2 . LEU A 1 491 ? 19.465  7.456   -87.614 1.00 46.11  ? 469  LEU A CD2 1 
ATOM   3312 N  N   . ALA A 1 492 ? 20.571  10.566  -83.353 1.00 47.01  ? 470  ALA A N   1 
ATOM   3313 C  CA  . ALA A 1 492 ? 20.690  11.860  -82.688 1.00 49.62  ? 470  ALA A CA  1 
ATOM   3314 C  C   . ALA A 1 492 ? 22.130  12.330  -82.629 1.00 51.08  ? 470  ALA A C   1 
ATOM   3315 O  O   . ALA A 1 492 ? 22.385  13.404  -82.119 1.00 55.34  ? 470  ALA A O   1 
ATOM   3316 C  CB  . ALA A 1 492 ? 20.098  11.806  -81.284 1.00 48.18  ? 470  ALA A CB  1 
ATOM   3317 N  N   . GLY A 1 493 ? 23.074  11.537  -83.120 1.00 51.14  ? 471  GLY A N   1 
ATOM   3318 C  CA  . GLY A 1 493 ? 24.485  11.928  -83.109 1.00 51.93  ? 471  GLY A CA  1 
ATOM   3319 C  C   . GLY A 1 493 ? 25.210  11.734  -81.786 1.00 53.48  ? 471  GLY A C   1 
ATOM   3320 O  O   . GLY A 1 493 ? 26.325  12.230  -81.625 1.00 55.16  ? 471  GLY A O   1 
ATOM   3321 N  N   . LYS A 1 494 ? 24.611  11.004  -80.844 1.00 53.18  ? 472  LYS A N   1 
ATOM   3322 C  CA  . LYS A 1 494 ? 25.224  10.812  -79.519 1.00 53.64  ? 472  LYS A CA  1 
ATOM   3323 C  C   . LYS A 1 494 ? 26.410  9.853   -79.581 1.00 52.42  ? 472  LYS A C   1 
ATOM   3324 O  O   . LYS A 1 494 ? 27.307  9.919   -78.752 1.00 51.74  ? 472  LYS A O   1 
ATOM   3325 C  CB  . LYS A 1 494 ? 24.235  10.238  -78.513 1.00 54.15  ? 472  LYS A CB  1 
ATOM   3326 C  CG  . LYS A 1 494 ? 22.903  10.953  -78.378 1.00 58.37  ? 472  LYS A CG  1 
ATOM   3327 C  CD  . LYS A 1 494 ? 23.054  12.437  -78.123 1.00 62.23  ? 472  LYS A CD  1 
ATOM   3328 C  CE  . LYS A 1 494 ? 21.769  13.026  -77.557 1.00 66.03  ? 472  LYS A CE  1 
ATOM   3329 N  NZ  . LYS A 1 494 ? 21.735  14.498  -77.776 1.00 70.42  ? 472  LYS A NZ  1 
ATOM   3330 N  N   . VAL A 1 495 ? 26.380  8.925   -80.537 1.00 49.09  ? 473  VAL A N   1 
ATOM   3331 C  CA  . VAL A 1 495 ? 27.481  7.983   -80.741 1.00 46.05  ? 473  VAL A CA  1 
ATOM   3332 C  C   . VAL A 1 495 ? 27.682  7.877   -82.225 1.00 44.39  ? 473  VAL A C   1 
ATOM   3333 O  O   . VAL A 1 495 ? 26.797  8.237   -82.993 1.00 42.20  ? 473  VAL A O   1 
ATOM   3334 C  CB  . VAL A 1 495 ? 27.189  6.558   -80.178 1.00 44.74  ? 473  VAL A CB  1 
ATOM   3335 C  CG1 . VAL A 1 495 ? 27.112  6.589   -78.659 1.00 45.95  ? 473  VAL A CG1 1 
ATOM   3336 C  CG2 . VAL A 1 495 ? 25.911  5.965   -80.766 1.00 42.47  ? 473  VAL A CG2 1 
ATOM   3337 N  N   . GLN A 1 496 ? 28.843  7.361   -82.604 1.00 44.72  ? 474  GLN A N   1 
ATOM   3338 C  CA  . GLN A 1 496 ? 29.183  7.081   -83.988 1.00 45.35  ? 474  GLN A CA  1 
ATOM   3339 C  C   . GLN A 1 496 ? 29.237  5.567   -84.173 1.00 43.26  ? 474  GLN A C   1 
ATOM   3340 O  O   . GLN A 1 496 ? 29.489  4.829   -83.217 1.00 42.75  ? 474  GLN A O   1 
ATOM   3341 C  CB  . GLN A 1 496 ? 30.561  7.681   -84.345 1.00 47.57  ? 474  GLN A CB  1 
ATOM   3342 C  CG  . GLN A 1 496 ? 30.638  9.189   -84.175 1.00 50.72  ? 474  GLN A CG  1 
ATOM   3343 C  CD  . GLN A 1 496 ? 29.708  9.924   -85.123 1.00 51.85  ? 474  GLN A CD  1 
ATOM   3344 O  OE1 . GLN A 1 496 ? 29.659  9.628   -86.321 1.00 54.64  ? 474  GLN A OE1 1 
ATOM   3345 N  NE2 . GLN A 1 496 ? 28.959  10.880  -84.594 1.00 52.80  ? 474  GLN A NE2 1 
ATOM   3346 N  N   . PRO A 1 497 ? 29.029  5.103   -85.406 1.00 42.37  ? 475  PRO A N   1 
ATOM   3347 C  CA  . PRO A 1 497 ? 29.031  3.673   -85.701 1.00 42.06  ? 475  PRO A CA  1 
ATOM   3348 C  C   . PRO A 1 497 ? 30.248  2.912   -85.143 1.00 43.02  ? 475  PRO A C   1 
ATOM   3349 O  O   . PRO A 1 497 ? 30.097  1.806   -84.618 1.00 41.36  ? 475  PRO A O   1 
ATOM   3350 C  CB  . PRO A 1 497 ? 29.034  3.651   -87.235 1.00 43.29  ? 475  PRO A CB  1 
ATOM   3351 C  CG  . PRO A 1 497 ? 28.273  4.889   -87.610 1.00 42.66  ? 475  PRO A CG  1 
ATOM   3352 C  CD  . PRO A 1 497 ? 28.700  5.912   -86.602 1.00 43.19  ? 475  PRO A CD  1 
ATOM   3353 N  N   . SER A 1 498 ? 31.430  3.525   -85.209 1.00 43.27  ? 476  SER A N   1 
ATOM   3354 C  CA  . SER A 1 498 ? 32.653  2.859   -84.787 1.00 44.21  ? 476  SER A CA  1 
ATOM   3355 C  C   . SER A 1 498 ? 32.943  2.968   -83.296 1.00 45.26  ? 476  SER A C   1 
ATOM   3356 O  O   . SER A 1 498 ? 33.900  2.362   -82.824 1.00 46.64  ? 476  SER A O   1 
ATOM   3357 C  CB  . SER A 1 498 ? 33.844  3.392   -85.585 1.00 46.55  ? 476  SER A CB  1 
ATOM   3358 O  OG  . SER A 1 498 ? 34.053  4.762   -85.287 1.00 48.20  ? 476  SER A OG  1 
ATOM   3359 N  N   . ASP A 1 499 ? 32.141  3.725   -82.554 1.00 44.54  ? 477  ASP A N   1 
ATOM   3360 C  CA  . ASP A 1 499 ? 32.270  3.760   -81.095 1.00 46.62  ? 477  ASP A CA  1 
ATOM   3361 C  C   . ASP A 1 499 ? 31.945  2.406   -80.425 1.00 45.84  ? 477  ASP A C   1 
ATOM   3362 O  O   . ASP A 1 499 ? 31.097  1.638   -80.880 1.00 40.84  ? 477  ASP A O   1 
ATOM   3363 C  CB  . ASP A 1 499 ? 31.316  4.799   -80.481 1.00 46.74  ? 477  ASP A CB  1 
ATOM   3364 C  CG  . ASP A 1 499 ? 31.704  6.236   -80.789 1.00 48.59  ? 477  ASP A CG  1 
ATOM   3365 O  OD1 . ASP A 1 499 ? 32.862  6.518   -81.142 1.00 52.13  ? 477  ASP A OD1 1 
ATOM   3366 O  OD2 . ASP A 1 499 ? 30.820  7.104   -80.663 1.00 50.19  ? 477  ASP A OD2 1 
ATOM   3367 N  N   . GLN A 1 500 ? 32.609  2.153   -79.309 1.00 47.96  ? 478  GLN A N   1 
ATOM   3368 C  CA  . GLN A 1 500 ? 32.206  1.092   -78.396 1.00 49.69  ? 478  GLN A CA  1 
ATOM   3369 C  C   . GLN A 1 500 ? 30.925  1.536   -77.669 1.00 47.14  ? 478  GLN A C   1 
ATOM   3370 O  O   . GLN A 1 500 ? 30.541  2.694   -77.720 1.00 46.14  ? 478  GLN A O   1 
ATOM   3371 C  CB  . GLN A 1 500 ? 33.357  0.763   -77.446 1.00 53.45  ? 478  GLN A CB  1 
ATOM   3372 C  CG  . GLN A 1 500 ? 34.587  0.313   -78.230 1.00 57.90  ? 478  GLN A CG  1 
ATOM   3373 C  CD  . GLN A 1 500 ? 35.314  -0.860  -77.610 1.00 62.52  ? 478  GLN A CD  1 
ATOM   3374 O  OE1 . GLN A 1 500 ? 35.408  -0.977  -76.387 1.00 65.45  ? 478  GLN A OE1 1 
ATOM   3375 N  NE2 . GLN A 1 500 ? 35.861  -1.731  -78.459 1.00 66.01  ? 478  GLN A NE2 1 
ATOM   3376 N  N   . VAL A 1 501 ? 30.251  0.608   -77.020 1.00 47.16  ? 479  VAL A N   1 
ATOM   3377 C  CA  . VAL A 1 501 ? 28.877  0.842   -76.553 1.00 46.85  ? 479  VAL A CA  1 
ATOM   3378 C  C   . VAL A 1 501 ? 28.759  1.427   -75.126 1.00 49.12  ? 479  VAL A C   1 
ATOM   3379 O  O   . VAL A 1 501 ? 27.645  1.576   -74.611 1.00 46.54  ? 479  VAL A O   1 
ATOM   3380 C  CB  . VAL A 1 501 ? 28.061  -0.466  -76.632 1.00 45.68  ? 479  VAL A CB  1 
ATOM   3381 C  CG1 . VAL A 1 501 ? 28.009  -0.968  -78.074 1.00 45.60  ? 479  VAL A CG1 1 
ATOM   3382 C  CG2 . VAL A 1 501 ? 28.645  -1.528  -75.702 1.00 46.13  ? 479  VAL A CG2 1 
ATOM   3383 N  N   . GLY A 1 502 ? 29.895  1.769   -74.514 1.00 61.63  ? 480  GLY A N   1 
ATOM   3384 C  CA  . GLY A 1 502 ? 29.934  2.339   -73.166 1.00 59.63  ? 480  GLY A CA  1 
ATOM   3385 C  C   . GLY A 1 502 ? 28.904  3.405   -72.876 1.00 58.33  ? 480  GLY A C   1 
ATOM   3386 O  O   . GLY A 1 502 ? 28.307  3.411   -71.800 1.00 57.49  ? 480  GLY A O   1 
ATOM   3387 N  N   . LYS A 1 503 ? 28.668  4.298   -73.831 1.00 59.22  ? 481  LYS A N   1 
ATOM   3388 C  CA  . LYS A 1 503 ? 27.768  5.434   -73.593 1.00 58.42  ? 481  LYS A CA  1 
ATOM   3389 C  C   . LYS A 1 503 ? 26.293  5.097   -73.774 1.00 56.35  ? 481  LYS A C   1 
ATOM   3390 O  O   . LYS A 1 503 ? 25.451  5.883   -73.379 1.00 59.70  ? 481  LYS A O   1 
ATOM   3391 C  CB  . LYS A 1 503 ? 28.148  6.631   -74.481 1.00 62.03  ? 481  LYS A CB  1 
ATOM   3392 N  N   . VAL A 1 504 ? 25.970  3.938   -74.355 1.00 53.73  ? 482  VAL A N   1 
ATOM   3393 C  CA  . VAL A 1 504 ? 24.569  3.542   -74.611 1.00 50.01  ? 482  VAL A CA  1 
ATOM   3394 C  C   . VAL A 1 504 ? 24.086  2.351   -73.756 1.00 45.30  ? 482  VAL A C   1 
ATOM   3395 O  O   . VAL A 1 504 ? 22.884  2.091   -73.653 1.00 42.63  ? 482  VAL A O   1 
ATOM   3396 C  CB  . VAL A 1 504 ? 24.372  3.167   -76.107 1.00 51.03  ? 482  VAL A CB  1 
ATOM   3397 C  CG1 . VAL A 1 504 ? 22.937  2.710   -76.382 1.00 49.46  ? 482  VAL A CG1 1 
ATOM   3398 C  CG2 . VAL A 1 504 ? 24.722  4.339   -77.001 1.00 53.52  ? 482  VAL A CG2 1 
ATOM   3399 N  N   . ILE A 1 505 ? 25.026  1.596   -73.198 1.00 44.70  ? 483  ILE A N   1 
ATOM   3400 C  CA  . ILE A 1 505 ? 24.699  0.379   -72.444 1.00 41.84  ? 483  ILE A CA  1 
ATOM   3401 C  C   . ILE A 1 505 ? 23.871  0.679   -71.195 1.00 39.54  ? 483  ILE A C   1 
ATOM   3402 O  O   . ILE A 1 505 ? 24.100  1.662   -70.503 1.00 39.40  ? 483  ILE A O   1 
ATOM   3403 C  CB  . ILE A 1 505 ? 25.980  -0.361  -72.033 1.00 44.33  ? 483  ILE A CB  1 
ATOM   3404 C  CG1 . ILE A 1 505 ? 25.675  -1.708  -71.401 1.00 42.52  ? 483  ILE A CG1 1 
ATOM   3405 C  CG2 . ILE A 1 505 ? 26.809  0.483   -71.070 1.00 47.07  ? 483  ILE A CG2 1 
ATOM   3406 C  CD1 . ILE A 1 505 ? 26.904  -2.583  -71.283 1.00 44.86  ? 483  ILE A CD1 1 
ATOM   3407 N  N   . TYR A 1 506 ? 22.878  -0.161  -70.955 1.00 36.14  ? 484  TYR A N   1 
ATOM   3408 C  CA  . TYR A 1 506 ? 22.115  -0.119  -69.716 1.00 35.07  ? 484  TYR A CA  1 
ATOM   3409 C  C   . TYR A 1 506 ? 22.822  -1.014  -68.703 1.00 35.98  ? 484  TYR A C   1 
ATOM   3410 O  O   . TYR A 1 506 ? 22.791  -2.249  -68.830 1.00 34.56  ? 484  TYR A O   1 
ATOM   3411 C  CB  . TYR A 1 506 ? 20.722  -0.652  -69.976 1.00 32.61  ? 484  TYR A CB  1 
ATOM   3412 C  CG  . TYR A 1 506 ? 19.878  0.136   -70.974 1.00 32.43  ? 484  TYR A CG  1 
ATOM   3413 C  CD1 . TYR A 1 506 ? 19.846  1.520   -70.950 1.00 33.98  ? 484  TYR A CD1 1 
ATOM   3414 C  CD2 . TYR A 1 506 ? 19.041  -0.519  -71.869 1.00 32.23  ? 484  TYR A CD2 1 
ATOM   3415 C  CE1 . TYR A 1 506 ? 19.023  2.229   -71.805 1.00 34.72  ? 484  TYR A CE1 1 
ATOM   3416 C  CE2 . TYR A 1 506 ? 18.208  0.178   -72.723 1.00 33.27  ? 484  TYR A CE2 1 
ATOM   3417 C  CZ  . TYR A 1 506 ? 18.211  1.559   -72.685 1.00 34.16  ? 484  TYR A CZ  1 
ATOM   3418 O  OH  . TYR A 1 506 ? 17.397  2.277   -73.510 1.00 35.61  ? 484  TYR A OH  1 
ATOM   3419 N  N   . LYS A 1 507 ? 23.487  -0.397  -67.731 1.00 36.13  ? 485  LYS A N   1 
ATOM   3420 C  CA  . LYS A 1 507 ? 24.274  -1.134  -66.752 1.00 37.98  ? 485  LYS A CA  1 
ATOM   3421 C  C   . LYS A 1 507 ? 23.456  -1.706  -65.619 1.00 36.50  ? 485  LYS A C   1 
ATOM   3422 O  O   . LYS A 1 507 ? 23.936  -2.584  -64.907 1.00 37.50  ? 485  LYS A O   1 
ATOM   3423 C  CB  . LYS A 1 507 ? 25.364  -0.258  -66.171 1.00 41.88  ? 485  LYS A CB  1 
ATOM   3424 C  CG  . LYS A 1 507 ? 26.468  0.031   -67.169 1.00 45.04  ? 485  LYS A CG  1 
ATOM   3425 C  CD  . LYS A 1 507 ? 27.281  1.230   -66.743 1.00 49.19  ? 485  LYS A CD  1 
ATOM   3426 C  CE  . LYS A 1 507 ? 28.288  1.601   -67.811 1.00 53.52  ? 485  LYS A CE  1 
ATOM   3427 N  NZ  . LYS A 1 507 ? 28.981  2.871   -67.466 1.00 58.23  ? 485  LYS A NZ  1 
ATOM   3428 N  N   . GLN A 1 508 ? 22.239  -1.214  -65.431 1.00 34.64  ? 486  GLN A N   1 
ATOM   3429 C  CA  . GLN A 1 508 ? 21.394  -1.671  -64.328 1.00 33.11  ? 486  GLN A CA  1 
ATOM   3430 C  C   . GLN A 1 508 ? 20.477  -2.820  -64.727 1.00 32.13  ? 486  GLN A C   1 
ATOM   3431 O  O   . GLN A 1 508 ? 19.774  -2.767  -65.744 1.00 32.48  ? 486  GLN A O   1 
ATOM   3432 C  CB  . GLN A 1 508 ? 20.571  -0.527  -63.707 1.00 32.22  ? 486  GLN A CB  1 
ATOM   3433 C  CG  . GLN A 1 508 ? 19.667  -1.017  -62.572 1.00 31.89  ? 486  GLN A CG  1 
ATOM   3434 C  CD  . GLN A 1 508 ? 18.906  0.073   -61.847 1.00 32.80  ? 486  GLN A CD  1 
ATOM   3435 O  OE1 . GLN A 1 508 ? 19.366  1.195   -61.735 1.00 33.04  ? 486  GLN A OE1 1 
ATOM   3436 N  NE2 . GLN A 1 508 ? 17.738  -0.272  -61.320 1.00 32.56  ? 486  GLN A NE2 1 
ATOM   3437 N  N   . PHE A 1 509 ? 20.491  -3.869  -63.916 1.00 32.61  ? 487  PHE A N   1 
ATOM   3438 C  CA  . PHE A 1 509 ? 19.616  -5.043  -64.135 1.00 32.47  ? 487  PHE A CA  1 
ATOM   3439 C  C   . PHE A 1 509 ? 19.607  -5.865  -62.866 1.00 33.65  ? 487  PHE A C   1 
ATOM   3440 O  O   . PHE A 1 509 ? 20.456  -5.683  -62.002 1.00 34.18  ? 487  PHE A O   1 
ATOM   3441 C  CB  . PHE A 1 509 ? 20.084  -5.908  -65.313 1.00 31.78  ? 487  PHE A CB  1 
ATOM   3442 C  CG  . PHE A 1 509 ? 21.478  -6.435  -65.162 1.00 33.27  ? 487  PHE A CG  1 
ATOM   3443 C  CD1 . PHE A 1 509 ? 22.561  -5.695  -65.605 1.00 33.91  ? 487  PHE A CD1 1 
ATOM   3444 C  CD2 . PHE A 1 509 ? 21.709  -7.672  -64.587 1.00 33.74  ? 487  PHE A CD2 1 
ATOM   3445 C  CE1 . PHE A 1 509 ? 23.857  -6.164  -65.453 1.00 37.07  ? 487  PHE A CE1 1 
ATOM   3446 C  CE2 . PHE A 1 509 ? 23.003  -8.148  -64.433 1.00 36.67  ? 487  PHE A CE2 1 
ATOM   3447 C  CZ  . PHE A 1 509 ? 24.083  -7.394  -64.855 1.00 37.86  ? 487  PHE A CZ  1 
ATOM   3448 N  N   . LYS A 1 510 ? 18.656  -6.781  -62.775 1.00 34.04  ? 488  LYS A N   1 
ATOM   3449 C  CA  . LYS A 1 510 ? 18.579  -7.685  -61.650 1.00 35.89  ? 488  LYS A CA  1 
ATOM   3450 C  C   . LYS A 1 510 ? 18.672  -9.137  -62.112 1.00 36.24  ? 488  LYS A C   1 
ATOM   3451 O  O   . LYS A 1 510 ? 17.951  -9.549  -63.022 1.00 36.01  ? 488  LYS A O   1 
ATOM   3452 C  CB  . LYS A 1 510 ? 17.250  -7.465  -60.941 1.00 35.93  ? 488  LYS A CB  1 
ATOM   3453 C  CG  . LYS A 1 510 ? 17.066  -8.306  -59.712 1.00 38.43  ? 488  LYS A CG  1 
ATOM   3454 C  CD  . LYS A 1 510 ? 17.930  -7.789  -58.581 1.00 43.03  ? 488  LYS A CD  1 
ATOM   3455 C  CE  . LYS A 1 510 ? 17.540  -8.515  -57.315 1.00 47.39  ? 488  LYS A CE  1 
ATOM   3456 N  NZ  . LYS A 1 510 ? 18.478  -8.173  -56.223 1.00 52.81  ? 488  LYS A NZ  1 
ATOM   3457 N  N   . GLN A 1 511 ? 19.515  -9.927  -61.460 1.00 37.04  ? 489  GLN A N   1 
ATOM   3458 C  CA  . GLN A 1 511 ? 19.572  -11.347 -61.763 1.00 39.44  ? 489  GLN A CA  1 
ATOM   3459 C  C   . GLN A 1 511 ? 18.464  -12.108 -61.050 1.00 39.97  ? 489  GLN A C   1 
ATOM   3460 O  O   . GLN A 1 511 ? 18.076  -11.789 -59.925 1.00 40.07  ? 489  GLN A O   1 
ATOM   3461 C  CB  . GLN A 1 511 ? 20.926  -11.940 -61.413 1.00 42.96  ? 489  GLN A CB  1 
ATOM   3462 C  CG  . GLN A 1 511 ? 22.016  -11.390 -62.300 1.00 45.42  ? 489  GLN A CG  1 
ATOM   3463 C  CD  . GLN A 1 511 ? 23.368  -12.018 -62.055 1.00 50.66  ? 489  GLN A CD  1 
ATOM   3464 O  OE1 . GLN A 1 511 ? 23.479  -13.040 -61.402 1.00 55.05  ? 489  GLN A OE1 1 
ATOM   3465 N  NE2 . GLN A 1 511 ? 24.411  -11.401 -62.592 1.00 54.55  ? 489  GLN A NE2 1 
ATOM   3466 N  N   . ILE A 1 512 ? 17.950  -13.112 -61.730 1.00 38.50  ? 490  ILE A N   1 
ATOM   3467 C  CA  . ILE A 1 512 ? 16.926  -13.956 -61.176 1.00 39.24  ? 490  ILE A CA  1 
ATOM   3468 C  C   . ILE A 1 512 ? 17.248  -15.396 -61.603 1.00 41.32  ? 490  ILE A C   1 
ATOM   3469 O  O   . ILE A 1 512 ? 17.944  -15.618 -62.598 1.00 39.45  ? 490  ILE A O   1 
ATOM   3470 C  CB  . ILE A 1 512 ? 15.524  -13.477 -61.598 1.00 37.34  ? 490  ILE A CB  1 
ATOM   3471 C  CG1 . ILE A 1 512 ? 14.442  -14.162 -60.760 1.00 39.64  ? 490  ILE A CG1 1 
ATOM   3472 C  CG2 . ILE A 1 512 ? 15.269  -13.744 -63.078 1.00 36.45  ? 490  ILE A CG2 1 
ATOM   3473 C  CD1 . ILE A 1 512 ? 13.047  -13.618 -61.002 1.00 37.95  ? 490  ILE A CD1 1 
ATOM   3474 N  N   . ARG A 1 513 ? 16.807  -16.364 -60.808 1.00 42.82  ? 491  ARG A N   1 
ATOM   3475 C  CA  . ARG A 1 513 ? 17.077  -17.768 -61.097 1.00 46.04  ? 491  ARG A CA  1 
ATOM   3476 C  C   . ARG A 1 513 ? 15.905  -18.402 -61.803 1.00 43.42  ? 491  ARG A C   1 
ATOM   3477 O  O   . ARG A 1 513 ? 14.759  -17.963 -61.639 1.00 41.64  ? 491  ARG A O   1 
ATOM   3478 C  CB  . ARG A 1 513 ? 17.373  -18.522 -59.808 1.00 51.68  ? 491  ARG A CB  1 
ATOM   3479 C  CG  . ARG A 1 513 ? 18.735  -18.194 -59.215 1.00 57.76  ? 491  ARG A CG  1 
ATOM   3480 C  CD  . ARG A 1 513 ? 18.904  -18.843 -57.850 1.00 66.59  ? 491  ARG A CD  1 
ATOM   3481 N  NE  . ARG A 1 513 ? 17.794  -18.447 -56.983 1.00 71.80  ? 491  ARG A NE  1 
ATOM   3482 C  CZ  . ARG A 1 513 ? 17.372  -19.100 -55.900 1.00 79.73  ? 491  ARG A CZ  1 
ATOM   3483 N  NH1 . ARG A 1 513 ? 17.967  -20.219 -55.485 1.00 84.57  ? 491  ARG A NH1 1 
ATOM   3484 N  NH2 . ARG A 1 513 ? 16.332  -18.612 -55.222 1.00 80.85  ? 491  ARG A NH2 1 
ATOM   3485 N  N   . LEU A 1 514 ? 16.197  -19.429 -62.600 1.00 43.92  ? 492  LEU A N   1 
ATOM   3486 C  CA  . LEU A 1 514 ? 15.169  -20.249 -63.252 1.00 43.51  ? 492  LEU A CA  1 
ATOM   3487 C  C   . LEU A 1 514 ? 14.110  -20.755 -62.288 1.00 43.23  ? 492  LEU A C   1 
ATOM   3488 O  O   . LEU A 1 514 ? 12.960  -20.909 -62.667 1.00 43.84  ? 492  LEU A O   1 
ATOM   3489 C  CB  . LEU A 1 514 ? 15.797  -21.476 -63.933 1.00 46.18  ? 492  LEU A CB  1 
ATOM   3490 C  CG  . LEU A 1 514 ? 16.308  -21.293 -65.353 1.00 46.20  ? 492  LEU A CG  1 
ATOM   3491 C  CD1 . LEU A 1 514 ? 17.086  -22.533 -65.765 1.00 49.83  ? 492  LEU A CD1 1 
ATOM   3492 C  CD2 . LEU A 1 514 ? 15.170  -20.985 -66.326 1.00 43.55  ? 492  LEU A CD2 1 
ATOM   3493 N  N   . THR A 1 515 ? 14.508  -21.050 -61.060 1.00 44.54  ? 493  THR A N   1 
ATOM   3494 C  CA  . THR A 1 515 ? 13.612  -21.625 -60.081 1.00 45.12  ? 493  THR A CA  1 
ATOM   3495 C  C   . THR A 1 515 ? 12.948  -20.595 -59.185 1.00 43.50  ? 493  THR A C   1 
ATOM   3496 O  O   . THR A 1 515 ? 12.217  -20.969 -58.291 1.00 43.57  ? 493  THR A O   1 
ATOM   3497 C  CB  . THR A 1 515 ? 14.374  -22.557 -59.169 1.00 48.68  ? 493  THR A CB  1 
ATOM   3498 O  OG1 . THR A 1 515 ? 15.443  -21.815 -58.606 1.00 49.33  ? 493  THR A OG1 1 
ATOM   3499 C  CG2 . THR A 1 515 ? 14.923  -23.770 -59.941 1.00 51.19  ? 493  THR A CG2 1 
ATOM   3500 N  N   . ASP A 1 516 ? 13.208  -19.308 -59.390 1.00 41.36  ? 494  ASP A N   1 
ATOM   3501 C  CA  . ASP A 1 516 ? 12.478  -18.279 -58.664 1.00 40.48  ? 494  ASP A CA  1 
ATOM   3502 C  C   . ASP A 1 516 ? 11.052  -18.221 -59.207 1.00 38.84  ? 494  ASP A C   1 
ATOM   3503 O  O   . ASP A 1 516 ? 10.775  -18.669 -60.318 1.00 37.81  ? 494  ASP A O   1 
ATOM   3504 C  CB  . ASP A 1 516 ? 13.163  -16.905 -58.767 1.00 39.08  ? 494  ASP A CB  1 
ATOM   3505 C  CG  . ASP A 1 516 ? 14.328  -16.746 -57.802 1.00 41.70  ? 494  ASP A CG  1 
ATOM   3506 O  OD1 . ASP A 1 516 ? 14.206  -17.154 -56.633 1.00 47.16  ? 494  ASP A OD1 1 
ATOM   3507 O  OD2 . ASP A 1 516 ? 15.363  -16.176 -58.195 1.00 42.19  ? 494  ASP A OD2 1 
ATOM   3508 N  N   . THR A 1 517 ? 10.133  -17.704 -58.404 1.00 38.48  ? 495  THR A N   1 
ATOM   3509 C  CA  . THR A 1 517 ? 8.725   -17.646 -58.808 1.00 37.12  ? 495  THR A CA  1 
ATOM   3510 C  C   . THR A 1 517 ? 8.424   -16.386 -59.611 1.00 34.63  ? 495  THR A C   1 
ATOM   3511 O  O   . THR A 1 517 ? 9.196   -15.421 -59.623 1.00 32.93  ? 495  THR A O   1 
ATOM   3512 C  CB  . THR A 1 517 ? 7.790   -17.598 -57.600 1.00 38.39  ? 495  THR A CB  1 
ATOM   3513 O  OG1 . THR A 1 517 ? 8.147   -16.455 -56.828 1.00 37.01  ? 495  THR A OG1 1 
ATOM   3514 C  CG2 . THR A 1 517 ? 7.870   -18.886 -56.753 1.00 41.40  ? 495  THR A CG2 1 
ATOM   3515 N  N   . LEU A 1 518 ? 7.275   -16.403 -60.274 1.00 34.75  ? 496  LEU A N   1 
ATOM   3516 C  CA  . LEU A 1 518 ? 6.816   -15.256 -61.014 1.00 33.03  ? 496  LEU A CA  1 
ATOM   3517 C  C   . LEU A 1 518 ? 6.425   -14.142 -60.054 1.00 33.67  ? 496  LEU A C   1 
ATOM   3518 O  O   . LEU A 1 518 ? 6.530   -12.991 -60.417 1.00 31.43  ? 496  LEU A O   1 
ATOM   3519 C  CB  . LEU A 1 518 ? 5.658   -15.626 -61.938 1.00 32.88  ? 496  LEU A CB  1 
ATOM   3520 C  CG  . LEU A 1 518 ? 6.013   -16.586 -63.081 1.00 33.71  ? 496  LEU A CG  1 
ATOM   3521 C  CD1 . LEU A 1 518 ? 4.858   -16.704 -64.060 1.00 34.50  ? 496  LEU A CD1 1 
ATOM   3522 C  CD2 . LEU A 1 518 ? 7.289   -16.205 -63.830 1.00 32.79  ? 496  LEU A CD2 1 
ATOM   3523 N  N   . GLY A 1 519 ? 5.976   -14.493 -58.843 1.00 35.87  ? 497  GLY A N   1 
ATOM   3524 C  CA  . GLY A 1 519 ? 5.740   -13.504 -57.768 1.00 37.49  ? 497  GLY A CA  1 
ATOM   3525 C  C   . GLY A 1 519 ? 7.006   -12.727 -57.427 1.00 36.47  ? 497  GLY A C   1 
ATOM   3526 O  O   . GLY A 1 519 ? 7.008   -11.491 -57.302 1.00 35.00  ? 497  GLY A O   1 
ATOM   3527 N  N   . ARG A 1 520 ? 8.100   -13.464 -57.307 1.00 36.86  ? 498  ARG A N   1 
ATOM   3528 C  CA  . ARG A 1 520 ? 9.411   -12.857 -57.105 1.00 37.53  ? 498  ARG A CA  1 
ATOM   3529 C  C   . ARG A 1 520 ? 9.815   -11.975 -58.300 1.00 34.44  ? 498  ARG A C   1 
ATOM   3530 O  O   . ARG A 1 520 ? 10.349  -10.885 -58.116 1.00 32.91  ? 498  ARG A O   1 
ATOM   3531 C  CB  . ARG A 1 520 ? 10.453  -13.943 -56.811 1.00 39.68  ? 498  ARG A CB  1 
ATOM   3532 C  CG  . ARG A 1 520 ? 11.885  -13.461 -56.735 1.00 43.18  ? 498  ARG A CG  1 
ATOM   3533 C  CD  . ARG A 1 520 ? 12.193  -12.633 -55.506 1.00 47.49  ? 498  ARG A CD  1 
ATOM   3534 N  NE  . ARG A 1 520 ? 13.557  -12.116 -55.638 1.00 53.62  ? 498  ARG A NE  1 
ATOM   3535 C  CZ  . ARG A 1 520 ? 14.013  -10.962 -55.138 1.00 54.35  ? 498  ARG A CZ  1 
ATOM   3536 N  NH1 . ARG A 1 520 ? 13.227  -10.159 -54.433 1.00 55.66  ? 498  ARG A NH1 1 
ATOM   3537 N  NH2 . ARG A 1 520 ? 15.276  -10.608 -55.354 1.00 53.99  ? 498  ARG A NH2 1 
ATOM   3538 N  N   . LEU A 1 521 ? 9.568   -12.448 -59.514 1.00 32.89  ? 499  LEU A N   1 
ATOM   3539 C  CA  . LEU A 1 521 ? 9.861   -11.656 -60.705 1.00 32.13  ? 499  LEU A CA  1 
ATOM   3540 C  C   . LEU A 1 521 ? 9.086   -10.337 -60.672 1.00 31.79  ? 499  LEU A C   1 
ATOM   3541 O  O   . LEU A 1 521 ? 9.636   -9.250  -60.897 1.00 29.94  ? 499  LEU A O   1 
ATOM   3542 C  CB  . LEU A 1 521 ? 9.487   -12.436 -61.953 1.00 32.57  ? 499  LEU A CB  1 
ATOM   3543 C  CG  . LEU A 1 521 ? 9.624   -11.715 -63.297 1.00 31.79  ? 499  LEU A CG  1 
ATOM   3544 C  CD1 . LEU A 1 521 ? 11.060  -11.318 -63.530 1.00 31.50  ? 499  LEU A CD1 1 
ATOM   3545 C  CD2 . LEU A 1 521 ? 9.102   -12.591 -64.434 1.00 31.86  ? 499  LEU A CD2 1 
ATOM   3546 N  N   . SER A 1 522 ? 7.803   -10.462 -60.370 1.00 32.82  ? 500  SER A N   1 
ATOM   3547 C  CA  . SER A 1 522 ? 6.928   -9.322  -60.248 1.00 33.34  ? 500  SER A CA  1 
ATOM   3548 C  C   . SER A 1 522 ? 7.477   -8.265  -59.268 1.00 33.36  ? 500  SER A C   1 
ATOM   3549 O  O   . SER A 1 522 ? 7.534   -7.087  -59.610 1.00 31.70  ? 500  SER A O   1 
ATOM   3550 C  CB  . SER A 1 522 ? 5.552   -9.797  -59.797 1.00 34.68  ? 500  SER A CB  1 
ATOM   3551 O  OG  . SER A 1 522 ? 4.715   -8.689  -59.632 1.00 34.77  ? 500  SER A OG  1 
ATOM   3552 N  N   . HIS A 1 523 ? 7.891   -8.681  -58.071 1.00 34.41  ? 501  HIS A N   1 
ATOM   3553 C  CA  . HIS A 1 523 ? 8.532   -7.754  -57.127 1.00 35.53  ? 501  HIS A CA  1 
ATOM   3554 C  C   . HIS A 1 523 ? 9.785   -7.121  -57.733 1.00 34.24  ? 501  HIS A C   1 
ATOM   3555 O  O   . HIS A 1 523 ? 9.995   -5.917  -57.647 1.00 32.08  ? 501  HIS A O   1 
ATOM   3556 C  CB  . HIS A 1 523 ? 8.923   -8.456  -55.837 1.00 39.37  ? 501  HIS A CB  1 
ATOM   3557 C  CG  . HIS A 1 523 ? 7.765   -8.864  -54.994 1.00 43.80  ? 501  HIS A CG  1 
ATOM   3558 N  ND1 . HIS A 1 523 ? 6.558   -8.193  -54.998 1.00 47.04  ? 501  HIS A ND1 1 
ATOM   3559 C  CD2 . HIS A 1 523 ? 7.625   -9.885  -54.113 1.00 47.50  ? 501  HIS A CD2 1 
ATOM   3560 C  CE1 . HIS A 1 523 ? 5.731   -8.777  -54.147 1.00 48.79  ? 501  HIS A CE1 1 
ATOM   3561 N  NE2 . HIS A 1 523 ? 6.355   -9.802  -53.594 1.00 48.67  ? 501  HIS A NE2 1 
ATOM   3562 N  N   . ILE A 1 524 ? 10.619  -7.941  -58.357 1.00 33.24  ? 502  ILE A N   1 
ATOM   3563 C  CA  . ILE A 1 524 ? 11.841  -7.453  -58.968 1.00 32.21  ? 502  ILE A CA  1 
ATOM   3564 C  C   . ILE A 1 524 ? 11.557  -6.390  -60.025 1.00 31.78  ? 502  ILE A C   1 
ATOM   3565 O  O   . ILE A 1 524 ? 12.297  -5.382  -60.146 1.00 30.37  ? 502  ILE A O   1 
ATOM   3566 C  CB  . ILE A 1 524 ? 12.622  -8.635  -59.575 1.00 33.52  ? 502  ILE A CB  1 
ATOM   3567 C  CG1 . ILE A 1 524 ? 13.371  -9.352  -58.467 1.00 36.59  ? 502  ILE A CG1 1 
ATOM   3568 C  CG2 . ILE A 1 524 ? 13.569  -8.192  -60.685 1.00 33.48  ? 502  ILE A CG2 1 
ATOM   3569 C  CD1 . ILE A 1 524 ? 13.871  -10.718 -58.864 1.00 39.37  ? 502  ILE A CD1 1 
ATOM   3570 N  N   . LEU A 1 525 ? 10.489  -6.604  -60.787 1.00 30.48  ? 503  LEU A N   1 
ATOM   3571 C  CA  . LEU A 1 525 ? 10.140  -5.684  -61.861 1.00 29.78  ? 503  LEU A CA  1 
ATOM   3572 C  C   . LEU A 1 525 ? 9.533   -4.360  -61.349 1.00 30.34  ? 503  LEU A C   1 
ATOM   3573 O  O   . LEU A 1 525 ? 9.275   -3.444  -62.124 1.00 29.93  ? 503  LEU A O   1 
ATOM   3574 C  CB  . LEU A 1 525 ? 9.242   -6.370  -62.888 1.00 30.44  ? 503  LEU A CB  1 
ATOM   3575 C  CG  . LEU A 1 525 ? 9.915   -7.501  -63.695 1.00 31.02  ? 503  LEU A CG  1 
ATOM   3576 C  CD1 . LEU A 1 525 ? 8.877   -8.274  -64.490 1.00 31.78  ? 503  LEU A CD1 1 
ATOM   3577 C  CD2 . LEU A 1 525 ? 11.016  -7.007  -64.616 1.00 30.07  ? 503  LEU A CD2 1 
ATOM   3578 N  N   . GLU A 1 526 ? 9.297   -4.241  -60.048 1.00 30.36  ? 504  GLU A N   1 
ATOM   3579 C  CA  . GLU A 1 526 ? 8.959   -2.922  -59.480 1.00 30.43  ? 504  GLU A CA  1 
ATOM   3580 C  C   . GLU A 1 526 ? 10.207  -2.055  -59.221 1.00 29.99  ? 504  GLU A C   1 
ATOM   3581 O  O   . GLU A 1 526 ? 10.090  -0.888  -58.880 1.00 29.60  ? 504  GLU A O   1 
ATOM   3582 C  CB  . GLU A 1 526 ? 8.130   -3.109  -58.220 1.00 33.14  ? 504  GLU A CB  1 
ATOM   3583 C  CG  . GLU A 1 526 ? 6.884   -3.944  -58.495 1.00 34.33  ? 504  GLU A CG  1 
ATOM   3584 C  CD  . GLU A 1 526 ? 5.996   -4.138  -57.299 1.00 39.03  ? 504  GLU A CD  1 
ATOM   3585 O  OE1 . GLU A 1 526 ? 6.479   -4.042  -56.159 1.00 41.70  ? 504  GLU A OE1 1 
ATOM   3586 O  OE2 . GLU A 1 526 ? 4.794   -4.398  -57.504 1.00 41.69  ? 504  GLU A OE2 1 
ATOM   3587 N  N   . MET A 1 527 ? 11.398  -2.628  -59.397 1.00 29.31  ? 505  MET A N   1 
ATOM   3588 C  CA  . MET A 1 527 ? 12.655  -1.929  -59.134 1.00 30.43  ? 505  MET A CA  1 
ATOM   3589 C  C   . MET A 1 527 ? 13.606  -1.853  -60.331 1.00 29.59  ? 505  MET A C   1 
ATOM   3590 O  O   . MET A 1 527 ? 14.384  -0.884  -60.441 1.00 30.70  ? 505  MET A O   1 
ATOM   3591 C  CB  . MET A 1 527 ? 13.359  -2.577  -57.928 1.00 33.18  ? 505  MET A CB  1 
ATOM   3592 C  CG  . MET A 1 527 ? 12.619  -2.391  -56.612 1.00 34.15  ? 505  MET A CG  1 
ATOM   3593 S  SD  . MET A 1 527 ? 12.495  -0.647  -56.163 1.00 39.29  ? 505  MET A SD  1 
ATOM   3594 C  CE  . MET A 1 527 ? 14.172  -0.252  -55.641 1.00 40.10  ? 505  MET A CE  1 
ATOM   3595 N  N   . ASP A 1 528 ? 13.518  -2.830  -61.228 1.00 27.74  ? 506  ASP A N   1 
ATOM   3596 C  CA  . ASP A 1 528 ? 14.372  -2.927  -62.402 1.00 29.58  ? 506  ASP A CA  1 
ATOM   3597 C  C   . ASP A 1 528 ? 13.560  -3.241  -63.641 1.00 29.02  ? 506  ASP A C   1 
ATOM   3598 O  O   . ASP A 1 528 ? 12.559  -3.974  -63.573 1.00 31.31  ? 506  ASP A O   1 
ATOM   3599 C  CB  . ASP A 1 528 ? 15.410  -4.053  -62.228 1.00 31.53  ? 506  ASP A CB  1 
ATOM   3600 C  CG  . ASP A 1 528 ? 16.465  -3.719  -61.186 1.00 35.06  ? 506  ASP A CG  1 
ATOM   3601 O  OD1 . ASP A 1 528 ? 16.226  -3.998  -60.015 1.00 38.39  ? 506  ASP A OD1 1 
ATOM   3602 O  OD2 . ASP A 1 528 ? 17.537  -3.173  -61.539 1.00 39.57  ? 506  ASP A OD2 1 
ATOM   3603 N  N   . HIS A 1 529 ? 14.036  -2.733  -64.773 1.00 28.02  ? 507  HIS A N   1 
ATOM   3604 C  CA  . HIS A 1 529 ? 13.445  -2.994  -66.079 1.00 28.63  ? 507  HIS A CA  1 
ATOM   3605 C  C   . HIS A 1 529 ? 13.712  -4.414  -66.580 1.00 28.81  ? 507  HIS A C   1 
ATOM   3606 O  O   . HIS A 1 529 ? 12.798  -5.084  -67.055 1.00 28.64  ? 507  HIS A O   1 
ATOM   3607 C  CB  . HIS A 1 529 ? 13.962  -1.990  -67.126 1.00 29.54  ? 507  HIS A CB  1 
ATOM   3608 C  CG  . HIS A 1 529 ? 13.335  -2.162  -68.478 1.00 30.67  ? 507  HIS A CG  1 
ATOM   3609 N  ND1 . HIS A 1 529 ? 12.026  -1.816  -68.735 1.00 32.34  ? 507  HIS A ND1 1 
ATOM   3610 C  CD2 . HIS A 1 529 ? 13.821  -2.680  -69.635 1.00 33.09  ? 507  HIS A CD2 1 
ATOM   3611 C  CE1 . HIS A 1 529 ? 11.727  -2.116  -69.990 1.00 34.04  ? 507  HIS A CE1 1 
ATOM   3612 N  NE2 . HIS A 1 529 ? 12.804  -2.628  -70.562 1.00 35.05  ? 507  HIS A NE2 1 
ATOM   3613 N  N   . PHE A 1 530 ? 14.965  -4.851  -66.462 1.00 29.05  ? 508  PHE A N   1 
ATOM   3614 C  CA  . PHE A 1 530 ? 15.427  -6.121  -66.988 1.00 30.38  ? 508  PHE A CA  1 
ATOM   3615 C  C   . PHE A 1 530 ? 15.754  -7.104  -65.850 1.00 29.97  ? 508  PHE A C   1 
ATOM   3616 O  O   . PHE A 1 530 ? 16.534  -6.783  -64.955 1.00 30.72  ? 508  PHE A O   1 
ATOM   3617 C  CB  . PHE A 1 530 ? 16.736  -5.959  -67.766 1.00 31.57  ? 508  PHE A CB  1 
ATOM   3618 C  CG  . PHE A 1 530 ? 16.656  -5.139  -69.014 1.00 32.36  ? 508  PHE A CG  1 
ATOM   3619 C  CD1 . PHE A 1 530 ? 16.089  -5.651  -70.181 1.00 33.46  ? 508  PHE A CD1 1 
ATOM   3620 C  CD2 . PHE A 1 530 ? 17.280  -3.886  -69.062 1.00 32.84  ? 508  PHE A CD2 1 
ATOM   3621 C  CE1 . PHE A 1 530 ? 16.080  -4.905  -71.359 1.00 34.66  ? 508  PHE A CE1 1 
ATOM   3622 C  CE2 . PHE A 1 530 ? 17.274  -3.140  -70.221 1.00 33.36  ? 508  PHE A CE2 1 
ATOM   3623 C  CZ  . PHE A 1 530 ? 16.677  -3.639  -71.374 1.00 34.62  ? 508  PHE A CZ  1 
ATOM   3624 N  N   . ALA A 1 531 ? 15.167  -8.290  -65.915 1.00 29.25  ? 509  ALA A N   1 
ATOM   3625 C  CA  . ALA A 1 531 ? 15.598  -9.438  -65.137 1.00 32.11  ? 509  ALA A CA  1 
ATOM   3626 C  C   . ALA A 1 531 ? 16.356  -10.412 -66.032 1.00 32.89  ? 509  ALA A C   1 
ATOM   3627 O  O   . ALA A 1 531 ? 15.834  -10.885 -67.052 1.00 34.42  ? 509  ALA A O   1 
ATOM   3628 C  CB  . ALA A 1 531 ? 14.401  -10.136 -64.530 1.00 31.69  ? 509  ALA A CB  1 
ATOM   3629 N  N   . LEU A 1 532 ? 17.585  -10.706 -65.646 1.00 32.77  ? 510  LEU A N   1 
ATOM   3630 C  CA  . LEU A 1 532 ? 18.424  -11.645 -66.368 1.00 35.06  ? 510  LEU A CA  1 
ATOM   3631 C  C   . LEU A 1 532 ? 18.430  -12.960 -65.627 1.00 35.95  ? 510  LEU A C   1 
ATOM   3632 O  O   . LEU A 1 532 ? 18.852  -13.032 -64.469 1.00 34.38  ? 510  LEU A O   1 
ATOM   3633 C  CB  . LEU A 1 532 ? 19.838  -11.098 -66.502 1.00 37.36  ? 510  LEU A CB  1 
ATOM   3634 C  CG  . LEU A 1 532 ? 19.975  -10.299 -67.804 1.00 39.24  ? 510  LEU A CG  1 
ATOM   3635 C  CD1 . LEU A 1 532 ? 19.217  -8.993  -67.710 1.00 38.39  ? 510  LEU A CD1 1 
ATOM   3636 C  CD2 . LEU A 1 532 ? 21.428  -10.064 -68.134 1.00 41.76  ? 510  LEU A CD2 1 
ATOM   3637 N  N   . VAL A 1 533 ? 17.935  -13.986 -66.304 1.00 36.54  ? 511  VAL A N   1 
ATOM   3638 C  CA  . VAL A 1 533 ? 17.857  -15.329 -65.758 1.00 37.50  ? 511  VAL A CA  1 
ATOM   3639 C  C   . VAL A 1 533 ? 19.182  -16.035 -65.901 1.00 42.23  ? 511  VAL A C   1 
ATOM   3640 O  O   . VAL A 1 533 ? 19.684  -16.231 -67.027 1.00 43.72  ? 511  VAL A O   1 
ATOM   3641 C  CB  . VAL A 1 533 ? 16.742  -16.142 -66.423 1.00 37.44  ? 511  VAL A CB  1 
ATOM   3642 C  CG1 . VAL A 1 533 ? 16.526  -17.450 -65.680 1.00 40.15  ? 511  VAL A CG1 1 
ATOM   3643 C  CG2 . VAL A 1 533 ? 15.445  -15.341 -66.442 1.00 35.04  ? 511  VAL A CG2 1 
ATOM   3644 N  N   . VAL A 1 534 ? 19.734  -16.422 -64.751 1.00 45.95  ? 512  VAL A N   1 
ATOM   3645 C  CA  . VAL A 1 534 ? 21.016  -17.121 -64.642 1.00 52.57  ? 512  VAL A CA  1 
ATOM   3646 C  C   . VAL A 1 534 ? 20.890  -18.348 -63.735 1.00 57.86  ? 512  VAL A C   1 
ATOM   3647 O  O   . VAL A 1 534 ? 19.931  -18.451 -62.974 1.00 59.03  ? 512  VAL A O   1 
ATOM   3648 C  CB  . VAL A 1 534 ? 22.082  -16.190 -64.042 1.00 53.96  ? 512  VAL A CB  1 
ATOM   3649 C  CG1 . VAL A 1 534 ? 22.208  -14.927 -64.878 1.00 51.51  ? 512  VAL A CG1 1 
ATOM   3650 C  CG2 . VAL A 1 534 ? 21.733  -15.835 -62.588 1.00 55.23  ? 512  VAL A CG2 1 
ATOM   3651 N  N   . HIS A 1 535 ? 21.848  -19.272 -63.811 1.00 66.60  ? 513  HIS A N   1 
ATOM   3652 C  CA  . HIS A 1 535 ? 21.892  -20.434 -62.891 1.00 73.27  ? 513  HIS A CA  1 
ATOM   3653 C  C   . HIS A 1 535 ? 23.301  -20.746 -62.399 1.00 79.12  ? 513  HIS A C   1 
ATOM   3654 O  O   . HIS A 1 535 ? 24.287  -20.384 -63.045 1.00 81.01  ? 513  HIS A O   1 
ATOM   3655 C  CB  . HIS A 1 535 ? 21.308  -21.692 -63.550 1.00 75.58  ? 513  HIS A CB  1 
ATOM   3656 N  N   . GLU A 1 536 ? 23.371  -21.438 -61.258 1.00 84.55  ? 514  GLU A N   1 
ATOM   3657 C  CA  . GLU A 1 536 ? 24.635  -21.875 -60.647 1.00 88.07  ? 514  GLU A CA  1 
ATOM   3658 C  C   . GLU A 1 536 ? 25.484  -22.671 -61.627 1.00 91.55  ? 514  GLU A C   1 
ATOM   3659 O  O   . GLU A 1 536 ? 24.962  -23.493 -62.379 1.00 92.44  ? 514  GLU A O   1 
ATOM   3660 C  CB  . GLU A 1 536 ? 24.361  -22.730 -59.402 1.00 89.80  ? 514  GLU A CB  1 
ATOM   3661 N  N   . GLN A 1 540 ? 28.192  -19.723 -66.025 1.00 93.47  ? 528  GLN A N   1 
ATOM   3662 C  CA  . GLN A 1 540 ? 27.253  -18.638 -65.773 1.00 90.95  ? 528  GLN A CA  1 
ATOM   3663 C  C   . GLN A 1 540 ? 26.581  -18.186 -67.068 1.00 87.56  ? 528  GLN A C   1 
ATOM   3664 O  O   . GLN A 1 540 ? 26.694  -17.016 -67.462 1.00 85.62  ? 528  GLN A O   1 
ATOM   3665 C  CB  . GLN A 1 540 ? 27.952  -17.433 -65.133 1.00 92.03  ? 528  GLN A CB  1 
ATOM   3666 C  CG  . GLN A 1 540 ? 28.954  -17.762 -64.040 1.00 97.90  ? 528  GLN A CG  1 
ATOM   3667 C  CD  . GLN A 1 540 ? 30.048  -16.716 -63.960 1.00 99.25  ? 528  GLN A CD  1 
ATOM   3668 O  OE1 . GLN A 1 540 ? 31.136  -16.896 -64.502 1.00 102.36 ? 528  GLN A OE1 1 
ATOM   3669 N  NE2 . GLN A 1 540 ? 29.750  -15.602 -63.311 1.00 97.27  ? 528  GLN A NE2 1 
ATOM   3670 N  N   . MET A 1 541 ? 25.873  -19.102 -67.725 1.00 84.41  ? 529  MET A N   1 
ATOM   3671 C  CA  . MET A 1 541 ? 25.144  -18.749 -68.939 1.00 79.30  ? 529  MET A CA  1 
ATOM   3672 C  C   . MET A 1 541 ? 23.840  -18.003 -68.624 1.00 67.76  ? 529  MET A C   1 
ATOM   3673 O  O   . MET A 1 541 ? 23.224  -18.181 -67.567 1.00 65.80  ? 529  MET A O   1 
ATOM   3674 C  CB  . MET A 1 541 ? 24.892  -19.982 -69.821 1.00 85.91  ? 529  MET A CB  1 
ATOM   3675 C  CG  . MET A 1 541 ? 23.654  -20.806 -69.491 1.00 87.13  ? 529  MET A CG  1 
ATOM   3676 S  SD  . MET A 1 541 ? 23.099  -21.766 -70.922 1.00 93.74  ? 529  MET A SD  1 
ATOM   3677 C  CE  . MET A 1 541 ? 22.288  -20.529 -71.947 1.00 86.60  ? 529  MET A CE  1 
ATOM   3678 N  N   . VAL A 1 542 ? 23.448  -17.137 -69.550 1.00 60.09  ? 530  VAL A N   1 
ATOM   3679 C  CA  . VAL A 1 542 ? 22.196  -16.416 -69.453 1.00 52.03  ? 530  VAL A CA  1 
ATOM   3680 C  C   . VAL A 1 542 ? 21.141  -17.258 -70.136 1.00 49.94  ? 530  VAL A C   1 
ATOM   3681 O  O   . VAL A 1 542 ? 21.295  -17.630 -71.291 1.00 52.68  ? 530  VAL A O   1 
ATOM   3682 C  CB  . VAL A 1 542 ? 22.279  -15.043 -70.134 1.00 49.41  ? 530  VAL A CB  1 
ATOM   3683 C  CG1 . VAL A 1 542 ? 21.013  -14.242 -69.876 1.00 45.54  ? 530  VAL A CG1 1 
ATOM   3684 C  CG2 . VAL A 1 542 ? 23.495  -14.283 -69.633 1.00 50.73  ? 530  VAL A CG2 1 
ATOM   3685 N  N   . PHE A 1 543 ? 20.079  -17.573 -69.414 1.00 46.25  ? 531  PHE A N   1 
ATOM   3686 C  CA  . PHE A 1 543 ? 18.985  -18.382 -69.946 1.00 46.73  ? 531  PHE A CA  1 
ATOM   3687 C  C   . PHE A 1 543 ? 17.948  -17.513 -70.627 1.00 43.52  ? 531  PHE A C   1 
ATOM   3688 O  O   . PHE A 1 543 ? 17.248  -17.971 -71.517 1.00 44.71  ? 531  PHE A O   1 
ATOM   3689 C  CB  . PHE A 1 543 ? 18.299  -19.179 -68.818 1.00 47.28  ? 531  PHE A CB  1 
ATOM   3690 C  CG  . PHE A 1 543 ? 19.037  -20.425 -68.443 1.00 51.08  ? 531  PHE A CG  1 
ATOM   3691 C  CD1 . PHE A 1 543 ? 18.847  -21.598 -69.162 1.00 53.30  ? 531  PHE A CD1 1 
ATOM   3692 C  CD2 . PHE A 1 543 ? 19.952  -20.418 -67.394 1.00 52.87  ? 531  PHE A CD2 1 
ATOM   3693 C  CE1 . PHE A 1 543 ? 19.544  -22.750 -68.835 1.00 57.22  ? 531  PHE A CE1 1 
ATOM   3694 C  CE2 . PHE A 1 543 ? 20.653  -21.569 -67.061 1.00 57.08  ? 531  PHE A CE2 1 
ATOM   3695 C  CZ  . PHE A 1 543 ? 20.451  -22.737 -67.784 1.00 58.94  ? 531  PHE A CZ  1 
ATOM   3696 N  N   . GLY A 1 544 ? 17.840  -16.263 -70.199 1.00 39.05  ? 532  GLY A N   1 
ATOM   3697 C  CA  . GLY A 1 544 ? 16.770  -15.420 -70.677 1.00 37.74  ? 532  GLY A CA  1 
ATOM   3698 C  C   . GLY A 1 544 ? 16.855  -14.001 -70.168 1.00 34.67  ? 532  GLY A C   1 
ATOM   3699 O  O   . GLY A 1 544 ? 17.575  -13.710 -69.226 1.00 35.10  ? 532  GLY A O   1 
ATOM   3700 N  N   . VAL A 1 545 ? 16.164  -13.113 -70.855 1.00 34.54  ? 533  VAL A N   1 
ATOM   3701 C  CA  . VAL A 1 545 ? 15.989  -11.732 -70.441 1.00 34.57  ? 533  VAL A CA  1 
ATOM   3702 C  C   . VAL A 1 545 ? 14.483  -11.537 -70.323 1.00 34.03  ? 533  VAL A C   1 
ATOM   3703 O  O   . VAL A 1 545 ? 13.772  -11.809 -71.264 1.00 34.98  ? 533  VAL A O   1 
ATOM   3704 C  CB  . VAL A 1 545 ? 16.552  -10.722 -71.460 1.00 35.61  ? 533  VAL A CB  1 
ATOM   3705 C  CG1 . VAL A 1 545 ? 16.205  -9.296  -71.019 1.00 34.96  ? 533  VAL A CG1 1 
ATOM   3706 C  CG2 . VAL A 1 545 ? 18.054  -10.870 -71.592 1.00 37.01  ? 533  VAL A CG2 1 
ATOM   3707 N  N   . VAL A 1 546 ? 14.004  -11.087 -69.173 1.00 32.56  ? 534  VAL A N   1 
ATOM   3708 C  CA  . VAL A 1 546 ? 12.573  -10.915 -68.945 1.00 33.13  ? 534  VAL A CA  1 
ATOM   3709 C  C   . VAL A 1 546 ? 12.251  -9.505  -68.464 1.00 31.80  ? 534  VAL A C   1 
ATOM   3710 O  O   . VAL A 1 546 ? 12.945  -8.945  -67.607 1.00 31.84  ? 534  VAL A O   1 
ATOM   3711 C  CB  . VAL A 1 546 ? 12.039  -11.951 -67.938 1.00 34.35  ? 534  VAL A CB  1 
ATOM   3712 C  CG1 . VAL A 1 546 ? 10.525  -11.849 -67.818 1.00 34.12  ? 534  VAL A CG1 1 
ATOM   3713 C  CG2 . VAL A 1 546 ? 12.425  -13.365 -68.383 1.00 37.56  ? 534  VAL A CG2 1 
ATOM   3714 N  N   . THR A 1 547 ? 11.211  -8.925  -69.044 1.00 31.90  ? 535  THR A N   1 
ATOM   3715 C  CA  . THR A 1 547 ? 10.706  -7.612  -68.642 1.00 30.32  ? 535  THR A CA  1 
ATOM   3716 C  C   . THR A 1 547 ? 9.242   -7.782  -68.296 1.00 31.32  ? 535  THR A C   1 
ATOM   3717 O  O   . THR A 1 547 ? 8.680   -8.872  -68.493 1.00 30.89  ? 535  THR A O   1 
ATOM   3718 C  CB  . THR A 1 547 ? 10.788  -6.605  -69.787 1.00 33.01  ? 535  THR A CB  1 
ATOM   3719 O  OG1 . THR A 1 547 ? 9.936   -7.052  -70.869 1.00 32.53  ? 535  THR A OG1 1 
ATOM   3720 C  CG2 . THR A 1 547 ? 12.255  -6.457  -70.265 1.00 34.37  ? 535  THR A CG2 1 
ATOM   3721 N  N   . ALA A 1 548 ? 8.633   -6.703  -67.792 1.00 31.15  ? 536  ALA A N   1 
ATOM   3722 C  CA  . ALA A 1 548 ? 7.207   -6.659  -67.466 1.00 31.21  ? 536  ALA A CA  1 
ATOM   3723 C  C   . ALA A 1 548 ? 6.303   -6.995  -68.649 1.00 31.65  ? 536  ALA A C   1 
ATOM   3724 O  O   . ALA A 1 548 ? 5.257   -7.646  -68.490 1.00 29.30  ? 536  ALA A O   1 
ATOM   3725 C  CB  . ALA A 1 548 ? 6.850   -5.284  -66.917 1.00 31.78  ? 536  ALA A CB  1 
ATOM   3726 N  N   . ILE A 1 549 ? 6.704   -6.543  -69.839 1.00 31.51  ? 537  ILE A N   1 
ATOM   3727 C  CA  . ILE A 1 549 ? 5.942   -6.837  -71.053 1.00 33.28  ? 537  ILE A CA  1 
ATOM   3728 C  C   . ILE A 1 549 ? 5.939   -8.345  -71.340 1.00 33.59  ? 537  ILE A C   1 
ATOM   3729 O  O   . ILE A 1 549 ? 4.904   -8.875  -71.724 1.00 34.21  ? 537  ILE A O   1 
ATOM   3730 C  CB  . ILE A 1 549 ? 6.434   -5.987  -72.249 1.00 35.69  ? 537  ILE A CB  1 
ATOM   3731 C  CG1 . ILE A 1 549 ? 6.122   -4.521  -71.914 1.00 38.16  ? 537  ILE A CG1 1 
ATOM   3732 C  CG2 . ILE A 1 549 ? 5.747   -6.412  -73.551 1.00 38.74  ? 537  ILE A CG2 1 
ATOM   3733 C  CD1 . ILE A 1 549 ? 6.542   -3.477  -72.927 1.00 41.53  ? 537  ILE A CD1 1 
ATOM   3734 N  N   . ASP A 1 550 ? 7.059   -9.036  -71.104 1.00 31.75  ? 538  ASP A N   1 
ATOM   3735 C  CA  . ASP A 1 550 ? 7.107   -10.500 -71.300 1.00 33.88  ? 538  ASP A CA  1 
ATOM   3736 C  C   . ASP A 1 550 ? 6.201   -11.210 -70.308 1.00 33.01  ? 538  ASP A C   1 
ATOM   3737 O  O   . ASP A 1 550 ? 5.466   -12.138 -70.672 1.00 34.18  ? 538  ASP A O   1 
ATOM   3738 C  CB  . ASP A 1 550 ? 8.535   -11.050 -71.141 1.00 34.33  ? 538  ASP A CB  1 
ATOM   3739 C  CG  . ASP A 1 550 ? 9.518   -10.427 -72.118 1.00 35.80  ? 538  ASP A CG  1 
ATOM   3740 O  OD1 . ASP A 1 550 ? 9.183   -10.356 -73.299 1.00 37.06  ? 538  ASP A OD1 1 
ATOM   3741 O  OD2 . ASP A 1 550 ? 10.603  -9.956  -71.694 1.00 36.15  ? 538  ASP A OD2 1 
ATOM   3742 N  N   . LEU A 1 551 ? 6.246   -10.772 -69.047 1.00 31.70  ? 539  LEU A N   1 
ATOM   3743 C  CA  . LEU A 1 551 ? 5.352   -11.334 -68.044 1.00 32.25  ? 539  LEU A CA  1 
ATOM   3744 C  C   . LEU A 1 551 ? 3.874   -11.134 -68.391 1.00 32.96  ? 539  LEU A C   1 
ATOM   3745 O  O   . LEU A 1 551 ? 3.082   -12.075 -68.349 1.00 32.55  ? 539  LEU A O   1 
ATOM   3746 C  CB  . LEU A 1 551 ? 5.668   -10.783 -66.665 1.00 32.34  ? 539  LEU A CB  1 
ATOM   3747 C  CG  . LEU A 1 551 ? 4.788   -11.347 -65.537 1.00 33.17  ? 539  LEU A CG  1 
ATOM   3748 C  CD1 . LEU A 1 551 ? 4.850   -12.863 -65.455 1.00 34.83  ? 539  LEU A CD1 1 
ATOM   3749 C  CD2 . LEU A 1 551 ? 5.114   -10.710 -64.193 1.00 32.68  ? 539  LEU A CD2 1 
ATOM   3750 N  N   . LEU A 1 552 ? 3.516   -9.909  -68.751 1.00 33.53  ? 540  LEU A N   1 
ATOM   3751 C  CA  . LEU A 1 552 ? 2.178   -9.598  -69.235 1.00 36.03  ? 540  LEU A CA  1 
ATOM   3752 C  C   . LEU A 1 552 ? 1.769   -10.528 -70.394 1.00 37.90  ? 540  LEU A C   1 
ATOM   3753 O  O   . LEU A 1 552 ? 0.695   -11.138 -70.359 1.00 38.46  ? 540  LEU A O   1 
ATOM   3754 C  CB  . LEU A 1 552 ? 2.105   -8.134  -69.657 1.00 37.74  ? 540  LEU A CB  1 
ATOM   3755 C  CG  . LEU A 1 552 ? 0.811   -7.634  -70.284 1.00 41.66  ? 540  LEU A CG  1 
ATOM   3756 C  CD1 . LEU A 1 552 ? -0.373  -8.021  -69.420 1.00 44.72  ? 540  LEU A CD1 1 
ATOM   3757 C  CD2 . LEU A 1 552 ? 0.875   -6.130  -70.429 1.00 43.28  ? 540  LEU A CD2 1 
ATOM   3758 N  N   . ASN A 1 553 ? 2.623   -10.640 -71.405 1.00 37.55  ? 541  ASN A N   1 
ATOM   3759 C  CA  . ASN A 1 553 ? 2.296   -11.445 -72.584 1.00 40.93  ? 541  ASN A CA  1 
ATOM   3760 C  C   . ASN A 1 553 ? 2.037   -12.907 -72.215 1.00 39.97  ? 541  ASN A C   1 
ATOM   3761 O  O   . ASN A 1 553 ? 1.090   -13.518 -72.705 1.00 41.35  ? 541  ASN A O   1 
ATOM   3762 C  CB  . ASN A 1 553 ? 3.411   -11.366 -73.624 1.00 41.37  ? 541  ASN A CB  1 
ATOM   3763 C  CG  . ASN A 1 553 ? 3.423   -10.059 -74.365 1.00 43.48  ? 541  ASN A CG  1 
ATOM   3764 O  OD1 . ASN A 1 553 ? 2.405   -9.385  -74.513 1.00 47.98  ? 541  ASN A OD1 1 
ATOM   3765 N  ND2 . ASN A 1 553 ? 4.581   -9.699  -74.860 1.00 44.74  ? 541  ASN A ND2 1 
ATOM   3766 N  N   . PHE A 1 554 ? 2.856   -13.435 -71.308 1.00 38.33  ? 542  PHE A N   1 
ATOM   3767 C  CA  . PHE A 1 554 ? 2.715   -14.811 -70.868 1.00 40.27  ? 542  PHE A CA  1 
ATOM   3768 C  C   . PHE A 1 554 ? 1.375   -15.014 -70.168 1.00 40.77  ? 542  PHE A C   1 
ATOM   3769 O  O   . PHE A 1 554 ? 0.666   -15.968 -70.467 1.00 41.77  ? 542  PHE A O   1 
ATOM   3770 C  CB  . PHE A 1 554 ? 3.874   -15.226 -69.945 1.00 39.08  ? 542  PHE A CB  1 
ATOM   3771 C  CG  . PHE A 1 554 ? 3.636   -16.521 -69.213 1.00 41.61  ? 542  PHE A CG  1 
ATOM   3772 C  CD1 . PHE A 1 554 ? 3.881   -17.742 -69.832 1.00 42.95  ? 542  PHE A CD1 1 
ATOM   3773 C  CD2 . PHE A 1 554 ? 3.162   -16.519 -67.896 1.00 41.20  ? 542  PHE A CD2 1 
ATOM   3774 C  CE1 . PHE A 1 554 ? 3.665   -18.924 -69.154 1.00 44.26  ? 542  PHE A CE1 1 
ATOM   3775 C  CE2 . PHE A 1 554 ? 2.940   -17.704 -67.220 1.00 42.49  ? 542  PHE A CE2 1 
ATOM   3776 C  CZ  . PHE A 1 554 ? 3.196   -18.911 -67.845 1.00 43.60  ? 542  PHE A CZ  1 
ATOM   3777 N  N   . VAL A 1 555 ? 1.025   -14.114 -69.251 1.00 38.84  ? 543  VAL A N   1 
ATOM   3778 C  CA  . VAL A 1 555 ? -0.236  -14.246 -68.508 1.00 40.29  ? 543  VAL A CA  1 
ATOM   3779 C  C   . VAL A 1 555 ? -1.407  -14.125 -69.458 1.00 42.73  ? 543  VAL A C   1 
ATOM   3780 O  O   . VAL A 1 555 ? -2.342  -14.930 -69.408 1.00 45.81  ? 543  VAL A O   1 
ATOM   3781 C  CB  . VAL A 1 555 ? -0.386  -13.193 -67.395 1.00 39.05  ? 543  VAL A CB  1 
ATOM   3782 C  CG1 . VAL A 1 555 ? -1.784  -13.234 -66.791 1.00 41.98  ? 543  VAL A CG1 1 
ATOM   3783 C  CG2 . VAL A 1 555 ? 0.652   -13.424 -66.321 1.00 37.92  ? 543  VAL A CG2 1 
ATOM   3784 N  N   . ALA A 1 556 ? -1.346  -13.143 -70.346 1.00 42.19  ? 544  ALA A N   1 
ATOM   3785 C  CA  . ALA A 1 556 ? -2.424  -12.943 -71.286 1.00 45.26  ? 544  ALA A CA  1 
ATOM   3786 C  C   . ALA A 1 556 ? -2.596  -14.172 -72.192 1.00 47.87  ? 544  ALA A C   1 
ATOM   3787 O  O   . ALA A 1 556 ? -3.720  -14.588 -72.444 1.00 51.09  ? 544  ALA A O   1 
ATOM   3788 C  CB  . ALA A 1 556 ? -2.175  -11.699 -72.103 1.00 45.47  ? 544  ALA A CB  1 
ATOM   3789 N  N   . ALA A 1 557 ? -1.492  -14.752 -72.667 1.00 47.14  ? 545  ALA A N   1 
ATOM   3790 C  CA  . ALA A 1 557 ? -1.551  -15.924 -73.538 1.00 50.17  ? 545  ALA A CA  1 
ATOM   3791 C  C   . ALA A 1 557 ? -2.150  -17.151 -72.836 1.00 53.14  ? 545  ALA A C   1 
ATOM   3792 O  O   . ALA A 1 557 ? -2.973  -17.862 -73.419 1.00 54.33  ? 545  ALA A O   1 
ATOM   3793 C  CB  . ALA A 1 557 ? -0.176  -16.254 -74.101 1.00 49.48  ? 545  ALA A CB  1 
ATOM   3794 N  N   . GLN A 1 558 ? -1.768  -17.385 -71.587 1.00 52.52  ? 546  GLN A N   1 
ATOM   3795 C  CA  . GLN A 1 558 ? -2.333  -18.501 -70.830 1.00 56.22  ? 546  GLN A CA  1 
ATOM   3796 C  C   . GLN A 1 558 ? -3.820  -18.292 -70.534 1.00 59.21  ? 546  GLN A C   1 
ATOM   3797 O  O   . GLN A 1 558 ? -4.568  -19.249 -70.511 1.00 61.86  ? 546  GLN A O   1 
ATOM   3798 C  CB  . GLN A 1 558 ? -1.593  -18.711 -69.507 1.00 54.55  ? 546  GLN A CB  1 
ATOM   3799 C  CG  . GLN A 1 558 ? -0.111  -19.006 -69.642 1.00 54.19  ? 546  GLN A CG  1 
ATOM   3800 C  CD  . GLN A 1 558 ? 0.156   -20.291 -70.390 1.00 59.51  ? 546  GLN A CD  1 
ATOM   3801 O  OE1 . GLN A 1 558 ? 0.763   -20.279 -71.461 1.00 64.00  ? 546  GLN A OE1 1 
ATOM   3802 N  NE2 . GLN A 1 558 ? -0.300  -21.409 -69.837 1.00 62.69  ? 546  GLN A NE2 1 
ATOM   3803 N  N   . GLU A 1 559 ? -4.241  -17.051 -70.296 1.00 60.36  ? 547  GLU A N   1 
ATOM   3804 C  CA  . GLU A 1 559 ? -5.643  -16.772 -69.964 1.00 64.01  ? 547  GLU A CA  1 
ATOM   3805 C  C   . GLU A 1 559 ? -6.589  -16.771 -71.172 1.00 70.19  ? 547  GLU A C   1 
ATOM   3806 O  O   . GLU A 1 559 ? -7.800  -16.752 -70.995 1.00 73.21  ? 547  GLU A O   1 
ATOM   3807 C  CB  . GLU A 1 559 ? -5.763  -15.443 -69.222 1.00 62.05  ? 547  GLU A CB  1 
ATOM   3808 C  CG  . GLU A 1 559 ? -5.189  -15.472 -67.818 1.00 59.75  ? 547  GLU A CG  1 
ATOM   3809 C  CD  . GLU A 1 559 ? -5.357  -14.154 -67.103 1.00 59.09  ? 547  GLU A CD  1 
ATOM   3810 O  OE1 . GLU A 1 559 ? -5.845  -13.202 -67.746 1.00 61.21  ? 547  GLU A OE1 1 
ATOM   3811 O  OE2 . GLU A 1 559 ? -5.000  -14.061 -65.908 1.00 56.57  ? 547  GLU A OE2 1 
ATOM   3812 N  N   . ARG A 1 560 ? -6.037  -16.811 -72.385 1.00 73.75  ? 548  ARG A N   1 
ATOM   3813 C  CA  . ARG A 1 560 ? -6.828  -16.788 -73.619 1.00 79.42  ? 548  ARG A CA  1 
ATOM   3814 C  C   . ARG A 1 560 ? -7.513  -18.123 -73.876 1.00 82.72  ? 548  ARG A C   1 
ATOM   3815 O  O   . ARG A 1 560 ? -6.857  -19.121 -74.159 1.00 84.43  ? 548  ARG A O   1 
ATOM   3816 C  CB  . ARG A 1 560 ? -5.920  -16.423 -74.799 1.00 80.64  ? 548  ARG A CB  1 
ATOM   3817 C  CG  . ARG A 1 560 ? -6.634  -15.924 -76.052 1.00 85.83  ? 548  ARG A CG  1 
ATOM   3818 C  CD  . ARG A 1 560 ? -5.974  -14.636 -76.550 1.00 85.13  ? 548  ARG A CD  1 
ATOM   3819 N  NE  . ARG A 1 560 ? -4.537  -14.809 -76.813 1.00 81.72  ? 548  ARG A NE  1 
ATOM   3820 C  CZ  . ARG A 1 560 ? -3.564  -13.962 -76.453 1.00 78.82  ? 548  ARG A CZ  1 
ATOM   3821 N  NH1 . ARG A 1 560 ? -3.822  -12.840 -75.780 1.00 76.47  ? 548  ARG A NH1 1 
ATOM   3822 N  NH2 . ARG A 1 560 ? -2.301  -14.251 -76.759 1.00 76.35  ? 548  ARG A NH2 1 
ATOM   3823 N  N   . TRP B 1 65  ? 1.030   5.106   -82.010 1.00 82.94  ? 43   TRP B N   1 
ATOM   3824 C  CA  . TRP B 1 65  ? 1.719   5.815   -80.888 1.00 78.50  ? 43   TRP B CA  1 
ATOM   3825 C  C   . TRP B 1 65  ? 1.635   7.303   -81.139 1.00 75.39  ? 43   TRP B C   1 
ATOM   3826 O  O   . TRP B 1 65  ? 1.759   7.734   -82.284 1.00 77.76  ? 43   TRP B O   1 
ATOM   3827 C  CB  . TRP B 1 65  ? 3.193   5.403   -80.825 1.00 79.62  ? 43   TRP B CB  1 
ATOM   3828 C  CG  . TRP B 1 65  ? 4.011   6.158   -79.810 1.00 77.48  ? 43   TRP B CG  1 
ATOM   3829 C  CD1 . TRP B 1 65  ? 3.718   6.326   -78.492 1.00 77.91  ? 43   TRP B CD1 1 
ATOM   3830 C  CD2 . TRP B 1 65  ? 5.262   6.828   -80.033 1.00 74.42  ? 43   TRP B CD2 1 
ATOM   3831 N  NE1 . TRP B 1 65  ? 4.707   7.059   -77.871 1.00 79.96  ? 43   TRP B NE1 1 
ATOM   3832 C  CE2 . TRP B 1 65  ? 5.669   7.379   -78.794 1.00 75.79  ? 43   TRP B CE2 1 
ATOM   3833 C  CE3 . TRP B 1 65  ? 6.072   7.022   -81.157 1.00 69.72  ? 43   TRP B CE3 1 
ATOM   3834 C  CZ2 . TRP B 1 65  ? 6.859   8.103   -78.645 1.00 72.38  ? 43   TRP B CZ2 1 
ATOM   3835 C  CZ3 . TRP B 1 65  ? 7.247   7.743   -81.012 1.00 69.17  ? 43   TRP B CZ3 1 
ATOM   3836 C  CH2 . TRP B 1 65  ? 7.629   8.280   -79.764 1.00 71.57  ? 43   TRP B CH2 1 
ATOM   3837 N  N   . ILE B 1 66  ? 1.424   8.097   -80.092 1.00 72.20  ? 44   ILE B N   1 
ATOM   3838 C  CA  . ILE B 1 66  ? 1.519   9.557   -80.253 1.00 67.44  ? 44   ILE B CA  1 
ATOM   3839 C  C   . ILE B 1 66  ? 2.634   10.097  -79.346 1.00 56.22  ? 44   ILE B C   1 
ATOM   3840 O  O   . ILE B 1 66  ? 2.631   9.908   -78.115 1.00 57.71  ? 44   ILE B O   1 
ATOM   3841 C  CB  . ILE B 1 66  ? 0.143   10.279  -80.117 1.00 70.84  ? 44   ILE B CB  1 
ATOM   3842 C  CG1 . ILE B 1 66  ? 0.312   11.811  -80.127 1.00 71.68  ? 44   ILE B CG1 1 
ATOM   3843 C  CG2 . ILE B 1 66  ? -0.621  9.795   -78.892 1.00 72.83  ? 44   ILE B CG2 1 
ATOM   3844 C  CD1 . ILE B 1 66  ? 0.967   12.376  -81.378 1.00 74.71  ? 44   ILE B CD1 1 
ATOM   3845 N  N   . ARG B 1 67  ? 3.618   10.710  -79.992 1.00 80.63  ? 45   ARG B N   1 
ATOM   3846 C  CA  . ARG B 1 67  ? 4.828   11.119  -79.324 1.00 71.27  ? 45   ARG B CA  1 
ATOM   3847 C  C   . ARG B 1 67  ? 4.563   12.264  -78.359 1.00 61.52  ? 45   ARG B C   1 
ATOM   3848 O  O   . ARG B 1 67  ? 3.769   13.151  -78.644 1.00 58.93  ? 45   ARG B O   1 
ATOM   3849 C  CB  . ARG B 1 67  ? 5.935   11.467  -80.327 1.00 73.43  ? 45   ARG B CB  1 
ATOM   3850 C  CG  . ARG B 1 67  ? 5.559   12.433  -81.449 1.00 74.95  ? 45   ARG B CG  1 
ATOM   3851 C  CD  . ARG B 1 67  ? 6.494   12.276  -82.645 1.00 77.52  ? 45   ARG B CD  1 
ATOM   3852 N  NE  . ARG B 1 67  ? 7.881   12.613  -82.301 1.00 76.81  ? 45   ARG B NE  1 
ATOM   3853 C  CZ  . ARG B 1 67  ? 8.878   11.747  -82.087 1.00 77.99  ? 45   ARG B CZ  1 
ATOM   3854 N  NH1 . ARG B 1 67  ? 8.694   10.432  -82.185 1.00 80.77  ? 45   ARG B NH1 1 
ATOM   3855 N  NH2 . ARG B 1 67  ? 10.089  12.212  -81.780 1.00 76.67  ? 45   ARG B NH2 1 
ATOM   3856 N  N   . PRO B 1 68  ? 5.235   12.236  -77.207 1.00 54.80  ? 46   PRO B N   1 
ATOM   3857 C  CA  . PRO B 1 68  ? 5.009   13.221  -76.163 1.00 50.51  ? 46   PRO B CA  1 
ATOM   3858 C  C   . PRO B 1 68  ? 5.560   14.600  -76.469 1.00 47.81  ? 46   PRO B C   1 
ATOM   3859 O  O   . PRO B 1 68  ? 5.339   15.509  -75.679 1.00 44.43  ? 46   PRO B O   1 
ATOM   3860 C  CB  . PRO B 1 68  ? 5.769   12.628  -74.972 1.00 49.53  ? 46   PRO B CB  1 
ATOM   3861 C  CG  . PRO B 1 68  ? 6.893   11.886  -75.598 1.00 51.90  ? 46   PRO B CG  1 
ATOM   3862 C  CD  . PRO B 1 68  ? 6.283   11.269  -76.822 1.00 55.40  ? 46   PRO B CD  1 
ATOM   3863 N  N   . ASP B 1 69  ? 6.288   14.752  -77.583 1.00 48.98  ? 47   ASP B N   1 
ATOM   3864 C  CA  . ASP B 1 69  ? 6.866   16.041  -77.966 1.00 48.10  ? 47   ASP B CA  1 
ATOM   3865 C  C   . ASP B 1 69  ? 6.331   16.649  -79.273 1.00 50.73  ? 47   ASP B C   1 
ATOM   3866 O  O   . ASP B 1 69  ? 6.976   17.520  -79.845 1.00 51.00  ? 47   ASP B O   1 
ATOM   3867 C  CB  . ASP B 1 69  ? 8.388   15.921  -78.052 1.00 48.74  ? 47   ASP B CB  1 
ATOM   3868 C  CG  . ASP B 1 69  ? 8.859   15.100  -79.252 1.00 51.61  ? 47   ASP B CG  1 
ATOM   3869 O  OD1 . ASP B 1 69  ? 8.063   14.318  -79.822 1.00 52.06  ? 47   ASP B OD1 1 
ATOM   3870 O  OD2 . ASP B 1 69  ? 10.053  15.227  -79.589 1.00 52.38  ? 47   ASP B OD2 1 
ATOM   3871 N  N   . ALA B 1 70  ? 5.158   16.227  -79.734 1.00 52.72  ? 48   ALA B N   1 
ATOM   3872 C  CA  . ALA B 1 70  ? 4.659   16.721  -81.003 1.00 55.65  ? 48   ALA B CA  1 
ATOM   3873 C  C   . ALA B 1 70  ? 4.318   18.189  -80.829 1.00 54.98  ? 48   ALA B C   1 
ATOM   3874 O  O   . ALA B 1 70  ? 3.924   18.605  -79.732 1.00 53.32  ? 48   ALA B O   1 
ATOM   3875 C  CB  . ALA B 1 70  ? 3.448   15.926  -81.482 1.00 58.08  ? 48   ALA B CB  1 
ATOM   3876 N  N   . PRO B 1 71  ? 4.475   18.988  -81.900 1.00 56.36  ? 49   PRO B N   1 
ATOM   3877 C  CA  . PRO B 1 71  ? 4.264   20.430  -81.740 1.00 54.74  ? 49   PRO B CA  1 
ATOM   3878 C  C   . PRO B 1 71  ? 2.822   20.721  -81.335 1.00 53.29  ? 49   PRO B C   1 
ATOM   3879 O  O   . PRO B 1 71  ? 1.899   20.075  -81.814 1.00 55.23  ? 49   PRO B O   1 
ATOM   3880 C  CB  . PRO B 1 71  ? 4.603   20.996  -83.129 1.00 58.50  ? 49   PRO B CB  1 
ATOM   3881 C  CG  . PRO B 1 71  ? 4.396   19.859  -84.077 1.00 61.19  ? 49   PRO B CG  1 
ATOM   3882 C  CD  . PRO B 1 71  ? 4.702   18.603  -83.309 1.00 60.22  ? 49   PRO B CD  1 
ATOM   3883 N  N   . SER B 1 72  ? 2.632   21.665  -80.434 1.00 51.60  ? 50   SER B N   1 
ATOM   3884 C  CA  . SER B 1 72  ? 1.292   21.966  -79.945 1.00 52.24  ? 50   SER B CA  1 
ATOM   3885 C  C   . SER B 1 72  ? 0.484   22.629  -81.033 1.00 55.63  ? 50   SER B C   1 
ATOM   3886 O  O   . SER B 1 72  ? 1.014   23.453  -81.769 1.00 56.26  ? 50   SER B O   1 
ATOM   3887 C  CB  . SER B 1 72  ? 1.341   22.895  -78.732 1.00 50.48  ? 50   SER B CB  1 
ATOM   3888 O  OG  . SER B 1 72  ? 0.021   23.263  -78.368 1.00 51.73  ? 50   SER B OG  1 
ATOM   3889 N  N   . ARG B 1 73  ? -0.794  22.267  -81.111 1.00 57.29  ? 51   ARG B N   1 
ATOM   3890 C  CA  . ARG B 1 73  ? -1.751  22.902  -82.001 1.00 60.56  ? 51   ARG B CA  1 
ATOM   3891 C  C   . ARG B 1 73  ? -2.628  23.936  -81.274 1.00 59.90  ? 51   ARG B C   1 
ATOM   3892 O  O   . ARG B 1 73  ? -3.650  24.380  -81.809 1.00 61.84  ? 51   ARG B O   1 
ATOM   3893 C  CB  . ARG B 1 73  ? -2.634  21.838  -82.631 1.00 63.79  ? 51   ARG B CB  1 
ATOM   3894 C  CG  . ARG B 1 73  ? -1.891  20.921  -83.591 1.00 66.85  ? 51   ARG B CG  1 
ATOM   3895 C  CD  . ARG B 1 73  ? -2.658  19.625  -83.776 1.00 69.18  ? 51   ARG B CD  1 
ATOM   3896 N  NE  . ARG B 1 73  ? -2.652  18.871  -82.532 1.00 67.68  ? 51   ARG B NE  1 
ATOM   3897 C  CZ  . ARG B 1 73  ? -3.280  17.718  -82.327 1.00 68.97  ? 51   ARG B CZ  1 
ATOM   3898 N  NH1 . ARG B 1 73  ? -3.993  17.151  -83.288 1.00 73.03  ? 51   ARG B NH1 1 
ATOM   3899 N  NH2 . ARG B 1 73  ? -3.192  17.130  -81.136 1.00 66.32  ? 51   ARG B NH2 1 
ATOM   3900 N  N   . CYS B 1 74  ? -2.237  24.319  -80.062 1.00 56.27  ? 52   CYS B N   1 
ATOM   3901 C  CA  . CYS B 1 74  ? -2.990  25.331  -79.328 1.00 56.55  ? 52   CYS B CA  1 
ATOM   3902 C  C   . CYS B 1 74  ? -2.831  26.665  -80.007 1.00 57.10  ? 52   CYS B C   1 
ATOM   3903 O  O   . CYS B 1 74  ? -1.723  27.119  -80.262 1.00 56.33  ? 52   CYS B O   1 
ATOM   3904 C  CB  . CYS B 1 74  ? -2.527  25.457  -77.876 1.00 53.16  ? 52   CYS B CB  1 
ATOM   3905 S  SG  . CYS B 1 74  ? -3.608  26.476  -76.833 1.00 54.18  ? 52   CYS B SG  1 
ATOM   3906 N  N   . THR B 1 75  ? -3.946  27.310  -80.268 1.00 59.09  ? 53   THR B N   1 
ATOM   3907 C  CA  . THR B 1 75  ? -3.920  28.603  -80.919 1.00 61.26  ? 53   THR B CA  1 
ATOM   3908 C  C   . THR B 1 75  ? -4.157  29.714  -79.909 1.00 61.07  ? 53   THR B C   1 
ATOM   3909 O  O   . THR B 1 75  ? -4.669  30.765  -80.266 1.00 63.61  ? 53   THR B O   1 
ATOM   3910 C  CB  . THR B 1 75  ? -5.009  28.662  -81.968 1.00 64.14  ? 53   THR B CB  1 
ATOM   3911 O  OG1 . THR B 1 75  ? -6.266  28.680  -81.293 1.00 65.55  ? 53   THR B OG1 1 
ATOM   3912 C  CG2 . THR B 1 75  ? -4.923  27.439  -82.879 1.00 64.67  ? 53   THR B CG2 1 
ATOM   3913 N  N   . TRP B 1 76  ? -3.817  29.467  -78.646 1.00 57.24  ? 54   TRP B N   1 
ATOM   3914 C  CA  . TRP B 1 76  ? -3.834  30.518  -77.646 1.00 57.70  ? 54   TRP B CA  1 
ATOM   3915 C  C   . TRP B 1 76  ? -2.818  31.579  -78.024 1.00 59.68  ? 54   TRP B C   1 
ATOM   3916 O  O   . TRP B 1 76  ? -1.688  31.251  -78.416 1.00 58.77  ? 54   TRP B O   1 
ATOM   3917 C  CB  . TRP B 1 76  ? -3.447  29.967  -76.268 1.00 53.85  ? 54   TRP B CB  1 
ATOM   3918 C  CG  . TRP B 1 76  ? -3.267  31.009  -75.203 1.00 53.48  ? 54   TRP B CG  1 
ATOM   3919 C  CD1 . TRP B 1 76  ? -4.221  31.464  -74.349 1.00 55.17  ? 54   TRP B CD1 1 
ATOM   3920 C  CD2 . TRP B 1 76  ? -2.056  31.708  -74.860 1.00 52.47  ? 54   TRP B CD2 1 
ATOM   3921 N  NE1 . TRP B 1 76  ? -3.691  32.404  -73.493 1.00 55.84  ? 54   TRP B NE1 1 
ATOM   3922 C  CE2 . TRP B 1 76  ? -2.363  32.574  -73.784 1.00 53.97  ? 54   TRP B CE2 1 
ATOM   3923 C  CE3 . TRP B 1 76  ? -0.741  31.679  -75.347 1.00 50.89  ? 54   TRP B CE3 1 
ATOM   3924 C  CZ2 . TRP B 1 76  ? -1.412  33.413  -73.194 1.00 54.34  ? 54   TRP B CZ2 1 
ATOM   3925 C  CZ3 . TRP B 1 76  ? 0.208   32.515  -74.759 1.00 51.15  ? 54   TRP B CZ3 1 
ATOM   3926 C  CH2 . TRP B 1 76  ? -0.136  33.375  -73.696 1.00 53.25  ? 54   TRP B CH2 1 
ATOM   3927 N  N   . GLN B 1 77  ? -3.209  32.840  -77.863 1.00 62.12  ? 55   GLN B N   1 
ATOM   3928 C  CA  . GLN B 1 77  ? -2.270  33.945  -77.950 1.00 63.92  ? 55   GLN B CA  1 
ATOM   3929 C  C   . GLN B 1 77  ? -2.616  34.941  -76.852 1.00 66.18  ? 55   GLN B C   1 
ATOM   3930 O  O   . GLN B 1 77  ? -3.790  35.106  -76.506 1.00 68.13  ? 55   GLN B O   1 
ATOM   3931 C  CB  . GLN B 1 77  ? -2.353  34.617  -79.334 1.00 66.35  ? 55   GLN B CB  1 
ATOM   3932 N  N   . LEU B 1 78  ? -1.596  35.591  -76.303 1.00 66.39  ? 56   LEU B N   1 
ATOM   3933 C  CA  . LEU B 1 78  ? -1.795  36.677  -75.355 1.00 69.54  ? 56   LEU B CA  1 
ATOM   3934 C  C   . LEU B 1 78  ? -2.549  37.833  -76.029 1.00 74.20  ? 56   LEU B C   1 
ATOM   3935 O  O   . LEU B 1 78  ? -2.147  38.322  -77.087 1.00 75.32  ? 56   LEU B O   1 
ATOM   3936 C  CB  . LEU B 1 78  ? -0.446  37.167  -74.826 1.00 69.90  ? 56   LEU B CB  1 
ATOM   3937 C  CG  . LEU B 1 78  ? -0.486  38.361  -73.867 1.00 73.70  ? 56   LEU B CG  1 
ATOM   3938 C  CD1 . LEU B 1 78  ? -1.164  37.961  -72.560 1.00 73.74  ? 56   LEU B CD1 1 
ATOM   3939 C  CD2 . LEU B 1 78  ? 0.923   38.894  -73.631 1.00 74.29  ? 56   LEU B CD2 1 
ATOM   3940 N  N   . GLY B 1 79  ? -3.639  38.266  -75.405 1.00 76.85  ? 57   GLY B N   1 
ATOM   3941 C  CA  . GLY B 1 79  ? -4.511  39.270  -75.991 1.00 81.42  ? 57   GLY B CA  1 
ATOM   3942 C  C   . GLY B 1 79  ? -5.772  38.645  -76.556 1.00 82.40  ? 57   GLY B C   1 
ATOM   3943 O  O   . GLY B 1 79  ? -6.697  39.351  -76.942 1.00 86.35  ? 57   GLY B O   1 
ATOM   3944 N  N   . ARG B 1 80  ? -5.820  37.318  -76.600 1.00 80.06  ? 58   ARG B N   1 
ATOM   3945 C  CA  . ARG B 1 80  ? -7.005  36.617  -77.082 1.00 81.57  ? 58   ARG B CA  1 
ATOM   3946 C  C   . ARG B 1 80  ? -7.979  36.390  -75.915 1.00 83.06  ? 58   ARG B C   1 
ATOM   3947 O  O   . ARG B 1 80  ? -7.563  35.920  -74.853 1.00 81.63  ? 58   ARG B O   1 
ATOM   3948 C  CB  . ARG B 1 80  ? -6.594  35.293  -77.723 1.00 78.17  ? 58   ARG B CB  1 
ATOM   3949 C  CG  . ARG B 1 80  ? -7.648  34.727  -78.644 1.00 80.06  ? 58   ARG B CG  1 
ATOM   3950 C  CD  . ARG B 1 80  ? -7.084  33.636  -79.534 1.00 77.74  ? 58   ARG B CD  1 
ATOM   3951 N  NE  . ARG B 1 80  ? -8.157  33.026  -80.323 1.00 79.89  ? 58   ARG B NE  1 
ATOM   3952 C  CZ  . ARG B 1 80  ? -7.978  32.159  -81.315 1.00 78.88  ? 58   ARG B CZ  1 
ATOM   3953 N  NH1 . ARG B 1 80  ? -6.758  31.771  -81.672 1.00 76.10  ? 58   ARG B NH1 1 
ATOM   3954 N  NH2 . ARG B 1 80  ? -9.033  31.676  -81.955 1.00 82.04  ? 58   ARG B NH2 1 
ATOM   3955 N  N   . PRO B 1 81  ? -9.268  36.753  -76.090 1.00 87.31  ? 59   PRO B N   1 
ATOM   3956 C  CA  . PRO B 1 81  ? -10.223 36.615  -74.978 1.00 89.09  ? 59   PRO B CA  1 
ATOM   3957 C  C   . PRO B 1 81  ? -10.627 35.167  -74.675 1.00 86.49  ? 59   PRO B C   1 
ATOM   3958 O  O   . PRO B 1 81  ? -10.549 34.292  -75.548 1.00 83.82  ? 59   PRO B O   1 
ATOM   3959 C  CB  . PRO B 1 81  ? -11.433 37.435  -75.442 1.00 93.74  ? 59   PRO B CB  1 
ATOM   3960 C  CG  . PRO B 1 81  ? -11.361 37.406  -76.927 1.00 93.81  ? 59   PRO B CG  1 
ATOM   3961 C  CD  . PRO B 1 81  ? -9.901  37.344  -77.286 1.00 90.23  ? 59   PRO B CD  1 
ATOM   3962 N  N   . ALA B 1 82  ? -11.063 34.948  -73.435 1.00 87.37  ? 60   ALA B N   1 
ATOM   3963 C  CA  . ALA B 1 82  ? -11.335 33.611  -72.896 1.00 85.37  ? 60   ALA B CA  1 
ATOM   3964 C  C   . ALA B 1 82  ? -12.523 32.928  -73.576 1.00 86.47  ? 60   ALA B C   1 
ATOM   3965 O  O   . ALA B 1 82  ? -12.558 31.701  -73.693 1.00 83.67  ? 60   ALA B O   1 
ATOM   3966 C  CB  . ALA B 1 82  ? -11.569 33.700  -71.394 1.00 87.18  ? 60   ALA B CB  1 
ATOM   3967 N  N   . SER B 1 83  ? -13.490 33.728  -74.018 1.00 89.99  ? 61   SER B N   1 
ATOM   3968 C  CA  . SER B 1 83  ? -14.615 33.235  -74.818 1.00 92.37  ? 61   SER B CA  1 
ATOM   3969 C  C   . SER B 1 83  ? -14.175 32.297  -75.945 1.00 89.25  ? 61   SER B C   1 
ATOM   3970 O  O   . SER B 1 83  ? -14.862 31.320  -76.249 1.00 89.71  ? 61   SER B O   1 
ATOM   3971 C  CB  . SER B 1 83  ? -15.383 34.414  -75.426 1.00 96.98  ? 61   SER B CB  1 
ATOM   3972 O  OG  . SER B 1 83  ? -14.524 35.216  -76.221 1.00 95.26  ? 61   SER B OG  1 
ATOM   3973 N  N   . GLU B 1 84  ? -13.023 32.595  -76.546 1.00 86.33  ? 62   GLU B N   1 
ATOM   3974 C  CA  . GLU B 1 84  ? -12.534 31.862  -77.716 1.00 83.88  ? 62   GLU B CA  1 
ATOM   3975 C  C   . GLU B 1 84  ? -11.878 30.530  -77.380 1.00 78.92  ? 62   GLU B C   1 
ATOM   3976 O  O   . GLU B 1 84  ? -11.503 29.786  -78.283 1.00 77.67  ? 62   GLU B O   1 
ATOM   3977 C  CB  . GLU B 1 84  ? -11.566 32.740  -78.522 1.00 83.71  ? 62   GLU B CB  1 
ATOM   3978 C  CG  . GLU B 1 84  ? -12.218 34.027  -79.017 1.00 88.22  ? 62   GLU B CG  1 
ATOM   3979 C  CD  . GLU B 1 84  ? -11.329 34.872  -79.910 1.00 88.44  ? 62   GLU B CD  1 
ATOM   3980 O  OE1 . GLU B 1 84  ? -10.265 34.404  -80.344 1.00 85.90  ? 62   GLU B OE1 1 
ATOM   3981 O  OE2 . GLU B 1 84  ? -11.712 36.023  -80.196 1.00 93.49  ? 62   GLU B OE2 1 
ATOM   3982 N  N   . SER B 1 85  ? -11.731 30.224  -76.093 1.00 76.29  ? 63   SER B N   1 
ATOM   3983 C  CA  . SER B 1 85  ? -11.124 28.970  -75.685 1.00 71.47  ? 63   SER B CA  1 
ATOM   3984 C  C   . SER B 1 85  ? -12.043 27.799  -76.008 1.00 71.90  ? 63   SER B C   1 
ATOM   3985 O  O   . SER B 1 85  ? -13.201 27.801  -75.605 1.00 74.94  ? 63   SER B O   1 
ATOM   3986 C  CB  . SER B 1 85  ? -10.824 28.971  -74.184 1.00 70.17  ? 63   SER B CB  1 
ATOM   3987 O  OG  . SER B 1 85  ? -10.327 27.708  -73.788 1.00 65.79  ? 63   SER B OG  1 
ATOM   3988 N  N   . PRO B 1 86  ? -11.519 26.783  -76.713 1.00 69.29  ? 64   PRO B N   1 
ATOM   3989 C  CA  . PRO B 1 86  ? -12.286 25.559  -76.915 1.00 70.97  ? 64   PRO B CA  1 
ATOM   3990 C  C   . PRO B 1 86  ? -12.285 24.642  -75.676 1.00 69.92  ? 64   PRO B C   1 
ATOM   3991 O  O   . PRO B 1 86  ? -12.986 23.634  -75.667 1.00 72.05  ? 64   PRO B O   1 
ATOM   3992 C  CB  . PRO B 1 86  ? -11.545 24.883  -78.068 1.00 68.99  ? 64   PRO B CB  1 
ATOM   3993 C  CG  . PRO B 1 86  ? -10.123 25.285  -77.863 1.00 65.40  ? 64   PRO B CG  1 
ATOM   3994 C  CD  . PRO B 1 86  ? -10.140 26.650  -77.221 1.00 65.87  ? 64   PRO B CD  1 
ATOM   3995 N  N   . HIS B 1 87  ? -11.527 25.003  -74.640 1.00 67.23  ? 65   HIS B N   1 
ATOM   3996 C  CA  . HIS B 1 87  ? -11.355 24.152  -73.467 1.00 66.29  ? 65   HIS B CA  1 
ATOM   3997 C  C   . HIS B 1 87  ? -12.408 24.395  -72.402 1.00 70.89  ? 65   HIS B C   1 
ATOM   3998 O  O   . HIS B 1 87  ? -12.926 25.501  -72.271 1.00 72.70  ? 65   HIS B O   1 
ATOM   3999 C  CB  . HIS B 1 87  ? -9.978  24.389  -72.869 1.00 61.85  ? 65   HIS B CB  1 
ATOM   4000 C  CG  . HIS B 1 87  ? -8.871  24.239  -73.858 1.00 58.67  ? 65   HIS B CG  1 
ATOM   4001 N  ND1 . HIS B 1 87  ? -8.601  23.046  -74.493 1.00 57.23  ? 65   HIS B ND1 1 
ATOM   4002 C  CD2 . HIS B 1 87  ? -7.970  25.131  -74.328 1.00 57.27  ? 65   HIS B CD2 1 
ATOM   4003 C  CE1 . HIS B 1 87  ? -7.574  23.208  -75.306 1.00 55.69  ? 65   HIS B CE1 1 
ATOM   4004 N  NE2 . HIS B 1 87  ? -7.176  24.464  -75.228 1.00 54.85  ? 65   HIS B NE2 1 
ATOM   4005 N  N   . HIS B 1 88  ? -12.717 23.342  -71.648 1.00 73.36  ? 66   HIS B N   1 
ATOM   4006 C  CA  . HIS B 1 88  ? -13.568 23.443  -70.469 1.00 78.07  ? 66   HIS B CA  1 
ATOM   4007 C  C   . HIS B 1 88  ? -12.738 24.009  -69.323 1.00 77.43  ? 66   HIS B C   1 
ATOM   4008 O  O   . HIS B 1 88  ? -11.653 23.499  -69.038 1.00 74.76  ? 66   HIS B O   1 
ATOM   4009 C  CB  . HIS B 1 88  ? -14.106 22.068  -70.081 1.00 80.03  ? 66   HIS B CB  1 
ATOM   4010 C  CG  . HIS B 1 88  ? -15.076 22.102  -68.940 1.00 85.17  ? 66   HIS B CG  1 
ATOM   4011 N  ND1 . HIS B 1 88  ? -14.676 22.192  -67.623 1.00 85.27  ? 66   HIS B ND1 1 
ATOM   4012 C  CD2 . HIS B 1 88  ? -16.430 22.065  -68.921 1.00 90.63  ? 66   HIS B CD2 1 
ATOM   4013 C  CE1 . HIS B 1 88  ? -15.741 22.206  -66.842 1.00 90.26  ? 66   HIS B CE1 1 
ATOM   4014 N  NE2 . HIS B 1 88  ? -16.818 22.130  -67.604 1.00 93.85  ? 66   HIS B NE2 1 
ATOM   4015 N  N   . HIS B 1 89  ? -13.233 25.060  -68.671 1.00 81.33  ? 67   HIS B N   1 
ATOM   4016 C  CA  . HIS B 1 89  ? -12.531 25.653  -67.532 1.00 81.54  ? 67   HIS B CA  1 
ATOM   4017 C  C   . HIS B 1 89  ? -13.340 25.416  -66.270 1.00 86.17  ? 67   HIS B C   1 
ATOM   4018 O  O   . HIS B 1 89  ? -14.517 25.741  -66.222 1.00 89.81  ? 67   HIS B O   1 
ATOM   4019 C  CB  . HIS B 1 89  ? -12.277 27.143  -67.764 1.00 82.28  ? 67   HIS B CB  1 
ATOM   4020 C  CG  . HIS B 1 89  ? -11.113 27.417  -68.669 1.00 78.84  ? 67   HIS B CG  1 
ATOM   4021 N  ND1 . HIS B 1 89  ? -10.943 26.784  -69.881 1.00 77.44  ? 67   HIS B ND1 1 
ATOM   4022 C  CD2 . HIS B 1 89  ? -10.062 28.260  -68.540 1.00 77.53  ? 67   HIS B CD2 1 
ATOM   4023 C  CE1 . HIS B 1 89  ? -9.840  27.223  -70.459 1.00 74.69  ? 67   HIS B CE1 1 
ATOM   4024 N  NE2 . HIS B 1 89  ? -9.283  28.116  -69.662 1.00 75.29  ? 67   HIS B NE2 1 
ATOM   4025 N  N   . THR B 1 90  ? -12.705 24.817  -65.264 1.00 86.29  ? 68   THR B N   1 
ATOM   4026 C  CA  . THR B 1 90  ? -13.365 24.501  -64.000 1.00 91.54  ? 68   THR B CA  1 
ATOM   4027 C  C   . THR B 1 90  ? -13.110 25.636  -63.007 1.00 94.44  ? 68   THR B C   1 
ATOM   4028 O  O   . THR B 1 90  ? -11.956 25.932  -62.683 1.00 92.42  ? 68   THR B O   1 
ATOM   4029 C  CB  . THR B 1 90  ? -12.873 23.154  -63.413 1.00 90.02  ? 68   THR B CB  1 
ATOM   4030 O  OG1 . THR B 1 90  ? -11.443 23.139  -63.374 1.00 85.35  ? 68   THR B OG1 1 
ATOM   4031 C  CG2 . THR B 1 90  ? -13.362 21.968  -64.249 1.00 89.22  ? 68   THR B CG2 1 
ATOM   4032 N  N   . ALA B 1 91  ? -14.182 26.262  -62.533 1.00 100.48 ? 69   ALA B N   1 
ATOM   4033 C  CA  . ALA B 1 91  ? -14.069 27.361  -61.581 1.00 104.79 ? 69   ALA B CA  1 
ATOM   4034 C  C   . ALA B 1 91  ? -13.989 26.844  -60.148 1.00 108.09 ? 69   ALA B C   1 
ATOM   4035 O  O   . ALA B 1 91  ? -14.452 25.735  -59.858 1.00 109.15 ? 69   ALA B O   1 
ATOM   4036 C  CB  . ALA B 1 91  ? -15.240 28.319  -61.737 1.00 109.73 ? 69   ALA B CB  1 
ATOM   4037 N  N   . PRO B 1 92  ? -13.422 27.633  -59.242 1.00 110.44 ? 70   PRO B N   1 
ATOM   4038 C  CA  . PRO B 1 92  ? -13.342 27.221  -57.835 1.00 113.18 ? 70   PRO B CA  1 
ATOM   4039 C  C   . PRO B 1 92  ? -14.710 26.798  -57.298 1.00 118.52 ? 70   PRO B C   1 
ATOM   4040 O  O   . PRO B 1 92  ? -15.685 27.525  -57.492 1.00 122.02 ? 70   PRO B O   1 
ATOM   4041 C  CB  . PRO B 1 92  ? -12.869 28.492  -57.129 1.00 116.04 ? 70   PRO B CB  1 
ATOM   4042 C  CG  . PRO B 1 92  ? -12.100 29.231  -58.171 1.00 111.33 ? 70   PRO B CG  1 
ATOM   4043 C  CD  . PRO B 1 92  ? -12.797 28.948  -59.472 1.00 109.55 ? 70   PRO B CD  1 
ATOM   4044 N  N   . ALA B 1 93  ? -14.785 25.644  -56.638 1.00 119.30 ? 71   ALA B N   1 
ATOM   4045 C  CA  . ALA B 1 93  ? -16.055 25.157  -56.113 1.00 125.44 ? 71   ALA B CA  1 
ATOM   4046 C  C   . ALA B 1 93  ? -16.074 25.191  -54.589 1.00 131.19 ? 71   ALA B C   1 
ATOM   4047 O  O   . ALA B 1 93  ? -15.258 24.544  -53.933 1.00 129.08 ? 71   ALA B O   1 
ATOM   4048 C  CB  . ALA B 1 93  ? -16.333 23.749  -56.618 1.00 123.07 ? 71   ALA B CB  1 
ATOM   4049 N  N   . LYS B 1 94  ? -17.012 25.950  -54.031 1.00 93.64  ? 72   LYS B N   1 
ATOM   4050 C  CA  . LYS B 1 94  ? -17.144 26.067  -52.579 1.00 92.18  ? 72   LYS B CA  1 
ATOM   4051 C  C   . LYS B 1 94  ? -16.962 24.700  -51.962 1.00 85.53  ? 72   LYS B C   1 
ATOM   4052 O  O   . LYS B 1 94  ? -17.664 23.762  -52.323 1.00 86.52  ? 72   LYS B O   1 
ATOM   4053 C  CB  . LYS B 1 94  ? -18.536 26.587  -52.209 1.00 96.87  ? 72   LYS B CB  1 
ATOM   4054 C  CG  . LYS B 1 94  ? -18.826 26.673  -50.710 1.00 95.94  ? 72   LYS B CG  1 
ATOM   4055 C  CD  . LYS B 1 94  ? -18.989 28.112  -50.240 1.00 101.48 ? 72   LYS B CD  1 
ATOM   4056 C  CE  . LYS B 1 94  ? -19.660 28.178  -48.878 1.00 101.26 ? 72   LYS B CE  1 
ATOM   4057 N  NZ  . LYS B 1 94  ? -19.848 29.586  -48.434 1.00 107.61 ? 72   LYS B NZ  1 
ATOM   4058 N  N   . SER B 1 95  ? -16.034 24.593  -51.020 1.00 81.11  ? 73   SER B N   1 
ATOM   4059 C  CA  . SER B 1 95  ? -15.765 23.325  -50.358 1.00 74.46  ? 73   SER B CA  1 
ATOM   4060 C  C   . SER B 1 95  ? -16.713 23.098  -49.174 1.00 71.55  ? 73   SER B C   1 
ATOM   4061 O  O   . SER B 1 95  ? -16.867 23.981  -48.341 1.00 72.25  ? 73   SER B O   1 
ATOM   4062 C  CB  . SER B 1 95  ? -14.316 23.284  -49.868 1.00 72.90  ? 73   SER B CB  1 
ATOM   4063 O  OG  . SER B 1 95  ? -13.885 21.943  -49.697 1.00 69.71  ? 73   SER B OG  1 
ATOM   4064 N  N   . PRO B 1 96  ? -17.314 21.895  -49.072 1.00 67.36  ? 74   PRO B N   1 
ATOM   4065 C  CA  . PRO B 1 96  ? -18.181 21.628  -47.929 1.00 64.44  ? 74   PRO B CA  1 
ATOM   4066 C  C   . PRO B 1 96  ? -17.349 21.434  -46.663 1.00 59.85  ? 74   PRO B C   1 
ATOM   4067 O  O   . PRO B 1 96  ? -16.155 21.187  -46.755 1.00 59.01  ? 74   PRO B O   1 
ATOM   4068 C  CB  . PRO B 1 96  ? -18.881 20.328  -48.323 1.00 63.19  ? 74   PRO B CB  1 
ATOM   4069 C  CG  . PRO B 1 96  ? -17.889 19.620  -49.202 1.00 62.92  ? 74   PRO B CG  1 
ATOM   4070 C  CD  . PRO B 1 96  ? -16.947 20.647  -49.776 1.00 64.80  ? 74   PRO B CD  1 
ATOM   4071 N  N   . LYS B 1 97  ? -17.976 21.560  -45.498 1.00 57.58  ? 75   LYS B N   1 
ATOM   4072 C  CA  . LYS B 1 97  ? -17.266 21.410  -44.232 1.00 55.90  ? 75   LYS B CA  1 
ATOM   4073 C  C   . LYS B 1 97  ? -16.653 20.019  -44.109 1.00 51.92  ? 75   LYS B C   1 
ATOM   4074 O  O   . LYS B 1 97  ? -15.511 19.865  -43.678 1.00 51.07  ? 75   LYS B O   1 
ATOM   4075 C  CB  . LYS B 1 97  ? -18.206 21.678  -43.055 1.00 57.42  ? 75   LYS B CB  1 
ATOM   4076 C  CG  . LYS B 1 97  ? -18.682 23.118  -42.955 1.00 61.84  ? 75   LYS B CG  1 
ATOM   4077 C  CD  . LYS B 1 97  ? -19.658 23.299  -41.805 1.00 63.94  ? 75   LYS B CD  1 
ATOM   4078 C  CE  . LYS B 1 97  ? -20.967 23.907  -42.282 1.00 66.63  ? 75   LYS B CE  1 
ATOM   4079 N  NZ  . LYS B 1 97  ? -21.686 24.611  -41.184 1.00 70.30  ? 75   LYS B NZ  1 
ATOM   4080 N  N   . ILE B 1 98  ? -17.428 19.011  -44.493 1.00 49.92  ? 76   ILE B N   1 
ATOM   4081 C  CA  . ILE B 1 98  ? -16.996 17.646  -44.446 1.00 48.39  ? 76   ILE B CA  1 
ATOM   4082 C  C   . ILE B 1 98  ? -16.671 17.235  -45.869 1.00 47.75  ? 76   ILE B C   1 
ATOM   4083 O  O   . ILE B 1 98  ? -17.531 17.269  -46.748 1.00 48.60  ? 76   ILE B O   1 
ATOM   4084 C  CB  . ILE B 1 98  ? -18.077 16.722  -43.871 1.00 48.09  ? 76   ILE B CB  1 
ATOM   4085 C  CG1 . ILE B 1 98  ? -18.411 17.126  -42.433 1.00 50.13  ? 76   ILE B CG1 1 
ATOM   4086 C  CG2 . ILE B 1 98  ? -17.614 15.271  -43.921 1.00 46.89  ? 76   ILE B CG2 1 
ATOM   4087 C  CD1 . ILE B 1 98  ? -19.635 16.447  -41.846 1.00 50.07  ? 76   ILE B CD1 1 
ATOM   4088 N  N   . LEU B 1 99  ? -15.427 16.836  -46.103 1.00 46.83  ? 77   LEU B N   1 
ATOM   4089 C  CA  . LEU B 1 99  ? -15.018 16.474  -47.461 1.00 46.75  ? 77   LEU B CA  1 
ATOM   4090 C  C   . LEU B 1 99  ? -15.570 15.089  -47.758 1.00 45.87  ? 77   LEU B C   1 
ATOM   4091 O  O   . LEU B 1 99  ? -15.460 14.226  -46.913 1.00 45.49  ? 77   LEU B O   1 
ATOM   4092 C  CB  . LEU B 1 99  ? -13.495 16.510  -47.573 1.00 46.51  ? 77   LEU B CB  1 
ATOM   4093 C  CG  . LEU B 1 99  ? -12.830 17.831  -47.161 1.00 47.51  ? 77   LEU B CG  1 
ATOM   4094 C  CD1 . LEU B 1 99  ? -11.349 17.731  -47.451 1.00 47.65  ? 77   LEU B CD1 1 
ATOM   4095 C  CD2 . LEU B 1 99  ? -13.450 19.032  -47.869 1.00 49.24  ? 77   LEU B CD2 1 
ATOM   4096 N  N   . PRO B 1 100 ? -16.212 14.893  -48.924 1.00 47.56  ? 78   PRO B N   1 
ATOM   4097 C  CA  . PRO B 1 100 ? -16.736 13.569  -49.244 1.00 48.17  ? 78   PRO B CA  1 
ATOM   4098 C  C   . PRO B 1 100 ? -15.647 12.505  -49.421 1.00 48.67  ? 78   PRO B C   1 
ATOM   4099 O  O   . PRO B 1 100 ? -15.910 11.307  -49.242 1.00 49.47  ? 78   PRO B O   1 
ATOM   4100 C  CB  . PRO B 1 100 ? -17.468 13.782  -50.574 1.00 50.23  ? 78   PRO B CB  1 
ATOM   4101 C  CG  . PRO B 1 100 ? -16.863 15.005  -51.165 1.00 50.91  ? 78   PRO B CG  1 
ATOM   4102 C  CD  . PRO B 1 100 ? -16.503 15.867  -49.992 1.00 49.03  ? 78   PRO B CD  1 
ATOM   4103 N  N   . ASP B 1 101 ? -14.458 12.924  -49.842 1.00 48.86  ? 79   ASP B N   1 
ATOM   4104 C  CA  . ASP B 1 101 ? -13.286 12.012  -49.910 1.00 47.86  ? 79   ASP B CA  1 
ATOM   4105 C  C   . ASP B 1 101 ? -11.994 12.828  -49.902 1.00 46.68  ? 79   ASP B C   1 
ATOM   4106 O  O   . ASP B 1 101 ? -12.037 14.064  -49.894 1.00 45.67  ? 79   ASP B O   1 
ATOM   4107 C  CB  . ASP B 1 101 ? -13.366 11.085  -51.119 1.00 49.92  ? 79   ASP B CB  1 
ATOM   4108 C  CG  . ASP B 1 101 ? -13.420 11.834  -52.447 1.00 51.48  ? 79   ASP B CG  1 
ATOM   4109 O  OD1 . ASP B 1 101 ? -12.670 12.816  -52.643 1.00 50.19  ? 79   ASP B OD1 1 
ATOM   4110 O  OD2 . ASP B 1 101 ? -14.223 11.432  -53.309 1.00 54.18  ? 79   ASP B OD2 1 
ATOM   4111 N  N   . ILE B 1 102 ? -10.841 12.158  -49.891 1.00 46.32  ? 80   ILE B N   1 
ATOM   4112 C  CA  . ILE B 1 102 ? -9.585  12.899  -49.727 1.00 45.60  ? 80   ILE B CA  1 
ATOM   4113 C  C   . ILE B 1 102 ? -9.212  13.709  -50.998 1.00 45.42  ? 80   ILE B C   1 
ATOM   4114 O  O   . ILE B 1 102 ? -8.437  14.645  -50.922 1.00 46.11  ? 80   ILE B O   1 
ATOM   4115 C  CB  . ILE B 1 102 ? -8.428  11.974  -49.274 1.00 45.63  ? 80   ILE B CB  1 
ATOM   4116 C  CG1 . ILE B 1 102 ? -7.282  12.794  -48.662 1.00 45.13  ? 80   ILE B CG1 1 
ATOM   4117 C  CG2 . ILE B 1 102 ? -7.936  11.143  -50.434 1.00 46.71  ? 80   ILE B CG2 1 
ATOM   4118 C  CD1 . ILE B 1 102 ? -7.665  13.651  -47.481 1.00 44.89  ? 80   ILE B CD1 1 
ATOM   4119 N  N   . LEU B 1 103 ? -9.822  13.418  -52.128 1.00 46.33  ? 81   LEU B N   1 
ATOM   4120 C  CA  . LEU B 1 103 ? -9.508  14.134  -53.365 1.00 47.55  ? 81   LEU B CA  1 
ATOM   4121 C  C   . LEU B 1 103 ? -9.955  15.606  -53.358 1.00 48.50  ? 81   LEU B C   1 
ATOM   4122 O  O   . LEU B 1 103 ? -9.488  16.400  -54.181 1.00 48.99  ? 81   LEU B O   1 
ATOM   4123 C  CB  . LEU B 1 103 ? -10.102 13.410  -54.569 1.00 49.84  ? 81   LEU B CB  1 
ATOM   4124 C  CG  . LEU B 1 103 ? -9.762  11.921  -54.692 1.00 50.93  ? 81   LEU B CG  1 
ATOM   4125 C  CD1 . LEU B 1 103 ? -10.434 11.320  -55.911 1.00 53.65  ? 81   LEU B CD1 1 
ATOM   4126 C  CD2 . LEU B 1 103 ? -8.253  11.692  -54.731 1.00 50.73  ? 81   LEU B CD2 1 
ATOM   4127 N  N   . LYS B 1 104 ? -10.847 15.976  -52.444 1.00 48.31  ? 82   LYS B N   1 
ATOM   4128 C  CA  . LYS B 1 104 ? -11.169 17.373  -52.254 1.00 49.85  ? 82   LYS B CA  1 
ATOM   4129 C  C   . LYS B 1 104 ? -10.056 18.095  -51.501 1.00 48.07  ? 82   LYS B C   1 
ATOM   4130 O  O   . LYS B 1 104 ? -10.056 19.302  -51.443 1.00 47.80  ? 82   LYS B O   1 
ATOM   4131 C  CB  . LYS B 1 104 ? -12.505 17.543  -51.518 1.00 51.62  ? 82   LYS B CB  1 
ATOM   4132 C  CG  . LYS B 1 104 ? -13.679 17.645  -52.448 1.00 56.55  ? 82   LYS B CG  1 
ATOM   4133 C  CD  . LYS B 1 104 ? -13.699 19.019  -53.110 1.00 60.34  ? 82   LYS B CD  1 
ATOM   4134 C  CE  . LYS B 1 104 ? -15.102 19.524  -53.349 1.00 65.25  ? 82   LYS B CE  1 
ATOM   4135 N  NZ  . LYS B 1 104 ? -15.649 19.002  -54.633 1.00 69.56  ? 82   LYS B NZ  1 
ATOM   4136 N  N   . LYS B 1 105 ? -9.084  17.377  -50.948 1.00 46.38  ? 83   LYS B N   1 
ATOM   4137 C  CA  . LYS B 1 105 ? -7.973  18.046  -50.292 1.00 46.31  ? 83   LYS B CA  1 
ATOM   4138 C  C   . LYS B 1 105 ? -6.780  18.175  -51.264 1.00 45.52  ? 83   LYS B C   1 
ATOM   4139 O  O   . LYS B 1 105 ? -5.666  17.682  -51.012 1.00 44.48  ? 83   LYS B O   1 
ATOM   4140 C  CB  . LYS B 1 105 ? -7.613  17.277  -49.020 1.00 46.91  ? 83   LYS B CB  1 
ATOM   4141 C  CG  . LYS B 1 105 ? -6.651  17.982  -48.118 1.00 48.78  ? 83   LYS B CG  1 
ATOM   4142 C  CD  . LYS B 1 105 ? -7.086  19.388  -47.786 1.00 51.51  ? 83   LYS B CD  1 
ATOM   4143 C  CE  . LYS B 1 105 ? -6.000  20.106  -46.998 1.00 54.56  ? 83   LYS B CE  1 
ATOM   4144 N  NZ  . LYS B 1 105 ? -4.638  19.876  -47.596 1.00 54.68  ? 83   LYS B NZ  1 
ATOM   4145 N  N   . ILE B 1 106 ? -7.046  18.845  -52.375 1.00 45.64  ? 84   ILE B N   1 
ATOM   4146 C  CA  . ILE B 1 106 ? -6.089  19.064  -53.452 1.00 45.94  ? 84   ILE B CA  1 
ATOM   4147 C  C   . ILE B 1 106 ? -6.363  20.480  -53.888 1.00 47.51  ? 84   ILE B C   1 
ATOM   4148 O  O   . ILE B 1 106 ? -7.484  20.794  -54.216 1.00 49.49  ? 84   ILE B O   1 
ATOM   4149 C  CB  . ILE B 1 106 ? -6.333  18.098  -54.624 1.00 46.25  ? 84   ILE B CB  1 
ATOM   4150 C  CG1 . ILE B 1 106 ? -5.970  16.673  -54.233 1.00 45.14  ? 84   ILE B CG1 1 
ATOM   4151 C  CG2 . ILE B 1 106 ? -5.546  18.522  -55.851 1.00 47.80  ? 84   ILE B CG2 1 
ATOM   4152 C  CD1 . ILE B 1 106 ? -6.400  15.618  -55.238 1.00 46.75  ? 84   ILE B CD1 1 
ATOM   4153 N  N   . GLY B 1 107 ? -5.358  21.340  -53.824 1.00 47.53  ? 85   GLY B N   1 
ATOM   4154 C  CA  . GLY B 1 107 ? -5.525  22.747  -54.095 1.00 49.52  ? 85   GLY B CA  1 
ATOM   4155 C  C   . GLY B 1 107 ? -5.637  23.571  -52.830 1.00 50.29  ? 85   GLY B C   1 
ATOM   4156 O  O   . GLY B 1 107 ? -5.568  23.050  -51.717 1.00 48.87  ? 85   GLY B O   1 
ATOM   4157 N  N   . ASP B 1 108 ? -5.815  24.870  -53.027 1.00 52.91  ? 86   ASP B N   1 
ATOM   4158 C  CA  . ASP B 1 108 ? -5.767  25.883  -51.961 1.00 55.35  ? 86   ASP B CA  1 
ATOM   4159 C  C   . ASP B 1 108 ? -4.598  25.688  -50.994 1.00 53.14  ? 86   ASP B C   1 
ATOM   4160 O  O   . ASP B 1 108 ? -4.758  25.708  -49.774 1.00 53.24  ? 86   ASP B O   1 
ATOM   4161 C  CB  . ASP B 1 108 ? -7.101  25.988  -51.223 1.00 57.08  ? 86   ASP B CB  1 
ATOM   4162 C  CG  . ASP B 1 108 ? -8.183  26.636  -52.075 1.00 61.19  ? 86   ASP B CG  1 
ATOM   4163 O  OD1 . ASP B 1 108 ? -8.099  27.848  -52.417 1.00 65.23  ? 86   ASP B OD1 1 
ATOM   4164 O  OD2 . ASP B 1 108 ? -9.143  25.915  -52.397 1.00 61.56  ? 86   ASP B OD2 1 
ATOM   4165 N  N   . THR B 1 109 ? -3.417  25.573  -51.574 1.00 51.03  ? 87   THR B N   1 
ATOM   4166 C  CA  . THR B 1 109 ? -2.197  25.327  -50.825 1.00 49.81  ? 87   THR B CA  1 
ATOM   4167 C  C   . THR B 1 109 ? -1.655  26.611  -50.227 1.00 53.61  ? 87   THR B C   1 
ATOM   4168 O  O   . THR B 1 109 ? -1.916  27.709  -50.744 1.00 55.78  ? 87   THR B O   1 
ATOM   4169 C  CB  . THR B 1 109 ? -1.144  24.733  -51.762 1.00 47.33  ? 87   THR B CB  1 
ATOM   4170 O  OG1 . THR B 1 109 ? -1.007  25.589  -52.899 1.00 48.22  ? 87   THR B OG1 1 
ATOM   4171 C  CG2 . THR B 1 109 ? -1.589  23.351  -52.221 1.00 44.46  ? 87   THR B CG2 1 
ATOM   4172 N  N   . PRO B 1 110 ? -0.897  26.487  -49.129 1.00 54.90  ? 88   PRO B N   1 
ATOM   4173 C  CA  . PRO B 1 110 ? -0.461  27.708  -48.468 1.00 60.22  ? 88   PRO B CA  1 
ATOM   4174 C  C   . PRO B 1 110 ? 0.604   28.488  -49.210 1.00 63.15  ? 88   PRO B C   1 
ATOM   4175 O  O   . PRO B 1 110 ? 1.382   27.944  -49.958 1.00 59.91  ? 88   PRO B O   1 
ATOM   4176 C  CB  . PRO B 1 110 ? 0.072   27.227  -47.114 1.00 60.32  ? 88   PRO B CB  1 
ATOM   4177 C  CG  . PRO B 1 110 ? 0.232   25.772  -47.215 1.00 55.86  ? 88   PRO B CG  1 
ATOM   4178 C  CD  . PRO B 1 110 ? -0.595  25.277  -48.352 1.00 52.76  ? 88   PRO B CD  1 
ATOM   4179 N  N   . MET B 1 111 ? 0.601   29.788  -48.973 1.00 33.90  ? 89   MET B N   1 
ATOM   4180 C  CA  . MET B 1 111 ? 1.635   30.696  -49.463 1.00 36.40  ? 89   MET B CA  1 
ATOM   4181 C  C   . MET B 1 111 ? 2.309   31.223  -48.216 1.00 36.77  ? 89   MET B C   1 
ATOM   4182 O  O   . MET B 1 111 ? 1.659   31.827  -47.370 1.00 38.56  ? 89   MET B O   1 
ATOM   4183 C  CB  . MET B 1 111 ? 1.017   31.831  -50.275 1.00 40.10  ? 89   MET B CB  1 
ATOM   4184 C  CG  . MET B 1 111 ? 2.033   32.783  -50.907 1.00 42.10  ? 89   MET B CG  1 
ATOM   4185 S  SD  . MET B 1 111 ? 2.754   32.146  -52.438 1.00 43.29  ? 89   MET B SD  1 
ATOM   4186 C  CE  . MET B 1 111 ? 1.479   32.626  -53.609 1.00 44.88  ? 89   MET B CE  1 
ATOM   4187 N  N   . VAL B 1 112 ? 3.613   30.993  -48.105 1.00 36.46  ? 90   VAL B N   1 
ATOM   4188 C  CA  . VAL B 1 112 ? 4.337   31.210  -46.857 1.00 37.26  ? 90   VAL B CA  1 
ATOM   4189 C  C   . VAL B 1 112 ? 5.531   32.093  -47.147 1.00 38.18  ? 90   VAL B C   1 
ATOM   4190 O  O   . VAL B 1 112 ? 6.308   31.819  -48.070 1.00 36.88  ? 90   VAL B O   1 
ATOM   4191 C  CB  . VAL B 1 112 ? 4.856   29.876  -46.273 1.00 36.87  ? 90   VAL B CB  1 
ATOM   4192 C  CG1 . VAL B 1 112 ? 5.388   30.082  -44.859 1.00 37.22  ? 90   VAL B CG1 1 
ATOM   4193 C  CG2 . VAL B 1 112 ? 3.749   28.838  -46.257 1.00 37.37  ? 90   VAL B CG2 1 
ATOM   4194 N  N   . ARG B 1 113 ? 5.691   33.141  -46.361 1.00 39.99  ? 91   ARG B N   1 
ATOM   4195 C  CA  . ARG B 1 113 ? 6.851   33.985  -46.494 1.00 42.89  ? 91   ARG B CA  1 
ATOM   4196 C  C   . ARG B 1 113 ? 8.105   33.219  -46.071 1.00 41.29  ? 91   ARG B C   1 
ATOM   4197 O  O   . ARG B 1 113 ? 8.106   32.546  -45.047 1.00 40.02  ? 91   ARG B O   1 
ATOM   4198 C  CB  . ARG B 1 113 ? 6.723   35.247  -45.650 1.00 45.63  ? 91   ARG B CB  1 
ATOM   4199 C  CG  . ARG B 1 113 ? 7.943   36.145  -45.812 1.00 50.65  ? 91   ARG B CG  1 
ATOM   4200 C  CD  . ARG B 1 113 ? 7.867   37.466  -45.057 1.00 55.33  ? 91   ARG B CD  1 
ATOM   4201 N  NE  . ARG B 1 113 ? 6.581   38.122  -45.196 1.00 58.87  ? 91   ARG B NE  1 
ATOM   4202 C  CZ  . ARG B 1 113 ? 5.694   38.271  -44.210 1.00 65.73  ? 91   ARG B CZ  1 
ATOM   4203 N  NH1 . ARG B 1 113 ? 5.928   37.809  -42.975 1.00 66.16  ? 91   ARG B NH1 1 
ATOM   4204 N  NH2 . ARG B 1 113 ? 4.553   38.902  -44.462 1.00 68.43  ? 91   ARG B NH2 1 
ATOM   4205 N  N   . ILE B 1 114 ? 9.161   33.370  -46.864 1.00 40.88  ? 92   ILE B N   1 
ATOM   4206 C  CA  . ILE B 1 114 ? 10.493  32.847  -46.568 1.00 41.01  ? 92   ILE B CA  1 
ATOM   4207 C  C   . ILE B 1 114 ? 11.267  33.925  -45.818 1.00 41.57  ? 92   ILE B C   1 
ATOM   4208 O  O   . ILE B 1 114 ? 11.435  35.027  -46.315 1.00 41.58  ? 92   ILE B O   1 
ATOM   4209 C  CB  . ILE B 1 114 ? 11.236  32.512  -47.876 1.00 41.17  ? 92   ILE B CB  1 
ATOM   4210 C  CG1 . ILE B 1 114 ? 10.526  31.382  -48.594 1.00 41.11  ? 92   ILE B CG1 1 
ATOM   4211 C  CG2 . ILE B 1 114 ? 12.699  32.167  -47.631 1.00 41.19  ? 92   ILE B CG2 1 
ATOM   4212 C  CD1 . ILE B 1 114 ? 10.779  30.042  -48.002 1.00 41.31  ? 92   ILE B CD1 1 
ATOM   4213 N  N   . ASN B 1 115 ? 11.736  33.600  -44.620 1.00 40.98  ? 93   ASN B N   1 
ATOM   4214 C  CA  . ASN B 1 115 ? 12.206  34.617  -43.686 1.00 43.17  ? 93   ASN B CA  1 
ATOM   4215 C  C   . ASN B 1 115 ? 13.714  34.751  -43.537 1.00 43.86  ? 93   ASN B C   1 
ATOM   4216 O  O   . ASN B 1 115 ? 14.188  35.811  -43.166 1.00 45.10  ? 93   ASN B O   1 
ATOM   4217 C  CB  . ASN B 1 115 ? 11.567  34.361  -42.316 1.00 43.75  ? 93   ASN B CB  1 
ATOM   4218 C  CG  . ASN B 1 115 ? 10.066  34.608  -42.329 1.00 43.29  ? 93   ASN B CG  1 
ATOM   4219 O  OD1 . ASN B 1 115 ? 9.616   35.696  -42.681 1.00 43.67  ? 93   ASN B OD1 1 
ATOM   4220 N  ND2 . ASN B 1 115 ? 9.297   33.605  -41.961 1.00 41.78  ? 93   ASN B ND2 1 
ATOM   4221 N  N   . LYS B 1 116 ? 14.461  33.678  -43.788 1.00 42.61  ? 94   LYS B N   1 
ATOM   4222 C  CA  . LYS B 1 116 ? 15.904  33.697  -43.564 1.00 44.16  ? 94   LYS B CA  1 
ATOM   4223 C  C   . LYS B 1 116 ? 16.719  33.552  -44.864 1.00 42.64  ? 94   LYS B C   1 
ATOM   4224 O  O   . LYS B 1 116 ? 17.711  34.241  -45.034 1.00 44.51  ? 94   LYS B O   1 
ATOM   4225 C  CB  . LYS B 1 116 ? 16.319  32.639  -42.530 1.00 46.06  ? 94   LYS B CB  1 
ATOM   4226 C  CG  . LYS B 1 116 ? 15.499  32.665  -41.232 1.00 49.91  ? 94   LYS B CG  1 
ATOM   4227 C  CD  . LYS B 1 116 ? 16.310  32.240  -40.010 1.00 53.71  ? 94   LYS B CD  1 
ATOM   4228 C  CE  . LYS B 1 116 ? 15.442  31.904  -38.787 1.00 53.55  ? 94   LYS B CE  1 
ATOM   4229 N  NZ  . LYS B 1 116 ? 15.022  30.462  -38.805 1.00 49.72  ? 94   LYS B NZ  1 
ATOM   4230 N  N   . ILE B 1 117 ? 16.276  32.709  -45.790 1.00 40.23  ? 95   ILE B N   1 
ATOM   4231 C  CA  . ILE B 1 117 ? 17.102  32.336  -46.948 1.00 40.30  ? 95   ILE B CA  1 
ATOM   4232 C  C   . ILE B 1 117 ? 17.275  33.504  -47.928 1.00 42.33  ? 95   ILE B C   1 
ATOM   4233 O  O   . ILE B 1 117 ? 18.383  33.777  -48.411 1.00 43.11  ? 95   ILE B O   1 
ATOM   4234 C  CB  . ILE B 1 117 ? 16.533  31.091  -47.653 1.00 38.44  ? 95   ILE B CB  1 
ATOM   4235 C  CG1 . ILE B 1 117 ? 16.564  29.911  -46.683 1.00 36.91  ? 95   ILE B CG1 1 
ATOM   4236 C  CG2 . ILE B 1 117 ? 17.315  30.764  -48.930 1.00 38.44  ? 95   ILE B CG2 1 
ATOM   4237 C  CD1 . ILE B 1 117 ? 15.938  28.678  -47.261 1.00 35.49  ? 95   ILE B CD1 1 
ATOM   4238 N  N   . GLY B 1 118 ? 16.189  34.207  -48.211 1.00 44.03  ? 96   GLY B N   1 
ATOM   4239 C  CA  . GLY B 1 118 ? 16.267  35.405  -49.050 1.00 46.60  ? 96   GLY B CA  1 
ATOM   4240 C  C   . GLY B 1 118 ? 17.254  36.410  -48.495 1.00 48.87  ? 96   GLY B C   1 
ATOM   4241 O  O   . GLY B 1 118 ? 18.160  36.833  -49.205 1.00 52.19  ? 96   GLY B O   1 
ATOM   4242 N  N   . LYS B 1 119 ? 17.111  36.748  -47.216 1.00 49.48  ? 97   LYS B N   1 
ATOM   4243 C  CA  . LYS B 1 119 ? 17.964  37.759  -46.580 1.00 52.55  ? 97   LYS B CA  1 
ATOM   4244 C  C   . LYS B 1 119 ? 19.414  37.309  -46.601 1.00 52.55  ? 97   LYS B C   1 
ATOM   4245 O  O   . LYS B 1 119 ? 20.301  38.096  -46.890 1.00 51.46  ? 97   LYS B O   1 
ATOM   4246 C  CB  . LYS B 1 119 ? 17.546  38.046  -45.131 1.00 54.24  ? 97   LYS B CB  1 
ATOM   4247 C  CG  . LYS B 1 119 ? 16.163  38.677  -44.945 1.00 56.44  ? 97   LYS B CG  1 
ATOM   4248 N  N   . LYS B 1 120 ? 19.646  36.036  -46.302 1.00 50.72  ? 98   LYS B N   1 
ATOM   4249 C  CA  . LYS B 1 120 ? 21.001  35.485  -46.294 1.00 52.34  ? 98   LYS B CA  1 
ATOM   4250 C  C   . LYS B 1 120 ? 21.742  35.672  -47.630 1.00 51.59  ? 98   LYS B C   1 
ATOM   4251 O  O   . LYS B 1 120 ? 22.946  35.872  -47.643 1.00 50.81  ? 98   LYS B O   1 
ATOM   4252 C  CB  . LYS B 1 120 ? 20.959  33.999  -45.938 1.00 52.08  ? 98   LYS B CB  1 
ATOM   4253 C  CG  . LYS B 1 120 ? 22.331  33.358  -45.795 1.00 55.85  ? 98   LYS B CG  1 
ATOM   4254 C  CD  . LYS B 1 120 ? 22.233  31.860  -45.515 1.00 57.36  ? 98   LYS B CD  1 
ATOM   4255 C  CE  . LYS B 1 120 ? 23.603  31.302  -45.156 1.00 60.03  ? 98   LYS B CE  1 
ATOM   4256 N  NZ  . LYS B 1 120 ? 23.692  29.865  -45.502 1.00 60.97  ? 98   LYS B NZ  1 
ATOM   4257 N  N   . PHE B 1 121 ? 21.019  35.573  -48.741 1.00 50.77  ? 99   PHE B N   1 
ATOM   4258 C  CA  . PHE B 1 121 ? 21.617  35.686  -50.075 1.00 51.65  ? 99   PHE B CA  1 
ATOM   4259 C  C   . PHE B 1 121 ? 21.417  37.075  -50.671 1.00 54.17  ? 99   PHE B C   1 
ATOM   4260 O  O   . PHE B 1 121 ? 21.601  37.293  -51.873 1.00 55.33  ? 99   PHE B O   1 
ATOM   4261 C  CB  . PHE B 1 121 ? 21.087  34.562  -50.977 1.00 50.00  ? 99   PHE B CB  1 
ATOM   4262 C  CG  . PHE B 1 121 ? 21.687  33.224  -50.649 1.00 48.99  ? 99   PHE B CG  1 
ATOM   4263 C  CD1 . PHE B 1 121 ? 21.116  32.411  -49.685 1.00 48.05  ? 99   PHE B CD1 1 
ATOM   4264 C  CD2 . PHE B 1 121 ? 22.882  32.824  -51.237 1.00 50.83  ? 99   PHE B CD2 1 
ATOM   4265 C  CE1 . PHE B 1 121 ? 21.684  31.193  -49.343 1.00 48.11  ? 99   PHE B CE1 1 
ATOM   4266 C  CE2 . PHE B 1 121 ? 23.465  31.610  -50.897 1.00 50.79  ? 99   PHE B CE2 1 
ATOM   4267 C  CZ  . PHE B 1 121 ? 22.865  30.791  -49.947 1.00 49.40  ? 99   PHE B CZ  1 
ATOM   4268 N  N   . GLY B 1 122 ? 21.060  38.022  -49.812 1.00 55.23  ? 100  GLY B N   1 
ATOM   4269 C  CA  . GLY B 1 122 ? 21.037  39.423  -50.180 1.00 57.69  ? 100  GLY B CA  1 
ATOM   4270 C  C   . GLY B 1 122 ? 19.845  39.827  -51.011 1.00 56.94  ? 100  GLY B C   1 
ATOM   4271 O  O   . GLY B 1 122 ? 19.894  40.845  -51.673 1.00 58.46  ? 100  GLY B O   1 
ATOM   4272 N  N   . LEU B 1 123 ? 18.756  39.064  -50.985 1.00 54.89  ? 101  LEU B N   1 
ATOM   4273 C  CA  . LEU B 1 123 ? 17.535  39.577  -51.605 1.00 55.03  ? 101  LEU B CA  1 
ATOM   4274 C  C   . LEU B 1 123 ? 17.028  40.747  -50.765 1.00 57.05  ? 101  LEU B C   1 
ATOM   4275 O  O   . LEU B 1 123 ? 17.199  40.754  -49.554 1.00 56.39  ? 101  LEU B O   1 
ATOM   4276 C  CB  . LEU B 1 123 ? 16.461  38.509  -51.731 1.00 52.08  ? 101  LEU B CB  1 
ATOM   4277 C  CG  . LEU B 1 123 ? 16.659  37.421  -52.791 1.00 50.48  ? 101  LEU B CG  1 
ATOM   4278 C  CD1 . LEU B 1 123 ? 15.464  36.495  -52.735 1.00 48.15  ? 101  LEU B CD1 1 
ATOM   4279 C  CD2 . LEU B 1 123 ? 16.817  37.977  -54.201 1.00 51.50  ? 101  LEU B CD2 1 
ATOM   4280 N  N   . LYS B 1 124 ? 16.478  41.753  -51.437 1.00 60.63  ? 102  LYS B N   1 
ATOM   4281 C  CA  . LYS B 1 124 ? 15.804  42.879  -50.803 1.00 63.60  ? 102  LYS B CA  1 
ATOM   4282 C  C   . LYS B 1 124 ? 14.282  42.718  -50.862 1.00 61.96  ? 102  LYS B C   1 
ATOM   4283 O  O   . LYS B 1 124 ? 13.562  43.257  -50.033 1.00 62.27  ? 102  LYS B O   1 
ATOM   4284 C  CB  . LYS B 1 124 ? 16.193  44.183  -51.500 1.00 68.59  ? 102  LYS B CB  1 
ATOM   4285 C  CG  . LYS B 1 124 ? 17.686  44.461  -51.539 1.00 72.85  ? 102  LYS B CG  1 
ATOM   4286 C  CD  . LYS B 1 124 ? 17.945  45.913  -51.909 1.00 78.98  ? 102  LYS B CD  1 
ATOM   4287 C  CE  . LYS B 1 124 ? 19.415  46.206  -52.174 1.00 83.21  ? 102  LYS B CE  1 
ATOM   4288 N  NZ  . LYS B 1 124 ? 19.857  45.774  -53.531 1.00 84.09  ? 102  LYS B NZ  1 
ATOM   4289 N  N   . CYS B 1 125 ? 13.803  41.977  -51.856 1.00 59.85  ? 103  CYS B N   1 
ATOM   4290 C  CA  . CYS B 1 125 ? 12.375  41.777  -52.068 1.00 58.25  ? 103  CYS B CA  1 
ATOM   4291 C  C   . CYS B 1 125 ? 11.776  40.797  -51.080 1.00 55.53  ? 103  CYS B C   1 
ATOM   4292 O  O   . CYS B 1 125 ? 12.491  40.153  -50.309 1.00 54.26  ? 103  CYS B O   1 
ATOM   4293 C  CB  . CYS B 1 125 ? 12.129  41.262  -53.487 1.00 57.95  ? 103  CYS B CB  1 
ATOM   4294 S  SG  . CYS B 1 125 ? 12.811  39.618  -53.819 1.00 55.56  ? 103  CYS B SG  1 
ATOM   4295 N  N   . GLU B 1 126 ? 10.451  40.696  -51.113 1.00 53.89  ? 104  GLU B N   1 
ATOM   4296 C  CA  . GLU B 1 126 ? 9.728   39.668  -50.375 1.00 51.90  ? 104  GLU B CA  1 
ATOM   4297 C  C   . GLU B 1 126 ? 9.806   38.367  -51.179 1.00 49.37  ? 104  GLU B C   1 
ATOM   4298 O  O   . GLU B 1 126 ? 9.634   38.385  -52.390 1.00 48.90  ? 104  GLU B O   1 
ATOM   4299 C  CB  . GLU B 1 126 ? 8.271   40.075  -50.185 1.00 52.82  ? 104  GLU B CB  1 
ATOM   4300 C  CG  . GLU B 1 126 ? 7.415   39.027  -49.506 1.00 52.64  ? 104  GLU B CG  1 
ATOM   4301 C  CD  . GLU B 1 126 ? 6.089   39.583  -49.025 1.00 54.57  ? 104  GLU B CD  1 
ATOM   4302 O  OE1 . GLU B 1 126 ? 5.287   40.019  -49.864 1.00 56.13  ? 104  GLU B OE1 1 
ATOM   4303 O  OE2 . GLU B 1 126 ? 5.843   39.574  -47.806 1.00 55.91  ? 104  GLU B OE2 1 
ATOM   4304 N  N   . LEU B 1 127 ? 10.073  37.256  -50.501 1.00 46.58  ? 105  LEU B N   1 
ATOM   4305 C  CA  . LEU B 1 127 ? 10.153  35.944  -51.143 1.00 45.22  ? 105  LEU B CA  1 
ATOM   4306 C  C   . LEU B 1 127 ? 9.123   35.031  -50.502 1.00 43.10  ? 105  LEU B C   1 
ATOM   4307 O  O   . LEU B 1 127 ? 9.126   34.850  -49.298 1.00 43.38  ? 105  LEU B O   1 
ATOM   4308 C  CB  . LEU B 1 127 ? 11.554  35.347  -51.001 1.00 44.82  ? 105  LEU B CB  1 
ATOM   4309 C  CG  . LEU B 1 127 ? 11.798  33.971  -51.640 1.00 43.69  ? 105  LEU B CG  1 
ATOM   4310 C  CD1 . LEU B 1 127 ? 11.686  34.029  -53.163 1.00 44.06  ? 105  LEU B CD1 1 
ATOM   4311 C  CD2 . LEU B 1 127 ? 13.159  33.429  -51.229 1.00 43.58  ? 105  LEU B CD2 1 
ATOM   4312 N  N   . LEU B 1 128 ? 8.249   34.469  -51.327 1.00 42.13  ? 106  LEU B N   1 
ATOM   4313 C  CA  . LEU B 1 128 ? 7.113   33.701  -50.872 1.00 41.39  ? 106  LEU B CA  1 
ATOM   4314 C  C   . LEU B 1 128 ? 7.151   32.346  -51.551 1.00 39.35  ? 106  LEU B C   1 
ATOM   4315 O  O   . LEU B 1 128 ? 7.520   32.248  -52.718 1.00 40.57  ? 106  LEU B O   1 
ATOM   4316 C  CB  . LEU B 1 128 ? 5.807   34.384  -51.263 1.00 42.81  ? 106  LEU B CB  1 
ATOM   4317 C  CG  . LEU B 1 128 ? 5.538   35.812  -50.789 1.00 44.93  ? 106  LEU B CG  1 
ATOM   4318 C  CD1 . LEU B 1 128 ? 4.138   36.218  -51.216 1.00 46.15  ? 106  LEU B CD1 1 
ATOM   4319 C  CD2 . LEU B 1 128 ? 5.682   35.941  -49.276 1.00 44.18  ? 106  LEU B CD2 1 
ATOM   4320 N  N   . ALA B 1 129 ? 6.738   31.321  -50.818 1.00 37.12  ? 107  ALA B N   1 
ATOM   4321 C  CA  . ALA B 1 129 ? 6.736   29.954  -51.309 1.00 36.30  ? 107  ALA B CA  1 
ATOM   4322 C  C   . ALA B 1 129 ? 5.324   29.420  -51.365 1.00 35.67  ? 107  ALA B C   1 
ATOM   4323 O  O   . ALA B 1 129 ? 4.577   29.505  -50.386 1.00 35.42  ? 107  ALA B O   1 
ATOM   4324 C  CB  . ALA B 1 129 ? 7.592   29.082  -50.409 1.00 34.97  ? 107  ALA B CB  1 
ATOM   4325 N  N   . LYS B 1 130 ? 4.967   28.880  -52.521 1.00 35.53  ? 108  LYS B N   1 
ATOM   4326 C  CA  . LYS B 1 130 ? 3.685   28.214  -52.736 1.00 36.13  ? 108  LYS B CA  1 
ATOM   4327 C  C   . LYS B 1 130 ? 3.956   26.745  -52.477 1.00 35.83  ? 108  LYS B C   1 
ATOM   4328 O  O   . LYS B 1 130 ? 4.685   26.086  -53.228 1.00 33.55  ? 108  LYS B O   1 
ATOM   4329 C  CB  . LYS B 1 130 ? 3.202   28.478  -54.176 1.00 37.66  ? 108  LYS B CB  1 
ATOM   4330 C  CG  . LYS B 1 130 ? 1.866   27.866  -54.576 1.00 37.07  ? 108  LYS B CG  1 
ATOM   4331 C  CD  . LYS B 1 130 ? 0.688   28.421  -53.790 1.00 37.23  ? 108  LYS B CD  1 
ATOM   4332 C  CE  . LYS B 1 130 ? -0.596  28.141  -54.546 1.00 37.10  ? 108  LYS B CE  1 
ATOM   4333 N  NZ  . LYS B 1 130 ? -1.787  28.303  -53.670 1.00 38.18  ? 108  LYS B NZ  1 
ATOM   4334 N  N   . CYS B 1 131 ? 3.402   26.250  -51.378 1.00 35.69  ? 109  CYS B N   1 
ATOM   4335 C  CA  . CYS B 1 131 ? 3.791   24.963  -50.818 1.00 34.27  ? 109  CYS B CA  1 
ATOM   4336 C  C   . CYS B 1 131 ? 2.876   23.833  -51.273 1.00 32.80  ? 109  CYS B C   1 
ATOM   4337 O  O   . CYS B 1 131 ? 1.900   23.491  -50.611 1.00 33.21  ? 109  CYS B O   1 
ATOM   4338 C  CB  . CYS B 1 131 ? 3.837   25.057  -49.284 1.00 35.10  ? 109  CYS B CB  1 
ATOM   4339 S  SG  . CYS B 1 131 ? 5.072   26.232  -48.664 1.00 35.75  ? 109  CYS B SG  1 
ATOM   4340 N  N   . GLU B 1 132 ? 3.220   23.223  -52.399 1.00 32.58  ? 110  GLU B N   1 
ATOM   4341 C  CA  . GLU B 1 132 ? 2.341   22.227  -53.014 1.00 32.48  ? 110  GLU B CA  1 
ATOM   4342 C  C   . GLU B 1 132 ? 2.425   20.861  -52.352 1.00 30.37  ? 110  GLU B C   1 
ATOM   4343 O  O   . GLU B 1 132 ? 1.648   19.977  -52.639 1.00 30.46  ? 110  GLU B O   1 
ATOM   4344 C  CB  . GLU B 1 132 ? 2.617   22.149  -54.521 1.00 32.82  ? 110  GLU B CB  1 
ATOM   4345 C  CG  . GLU B 1 132 ? 2.164   23.407  -55.249 1.00 34.37  ? 110  GLU B CG  1 
ATOM   4346 C  CD  . GLU B 1 132 ? 0.656   23.544  -55.240 1.00 36.08  ? 110  GLU B CD  1 
ATOM   4347 O  OE1 . GLU B 1 132 ? -0.004  22.532  -55.577 1.00 36.29  ? 110  GLU B OE1 1 
ATOM   4348 O  OE2 . GLU B 1 132 ? 0.141   24.641  -54.891 1.00 34.83  ? 110  GLU B OE2 1 
ATOM   4349 N  N   . PHE B 1 133 ? 3.332   20.707  -51.409 1.00 32.69  ? 111  PHE B N   1 
ATOM   4350 C  CA  . PHE B 1 133 ? 3.471   19.436  -50.712 1.00 32.09  ? 111  PHE B CA  1 
ATOM   4351 C  C   . PHE B 1 133 ? 2.379   19.181  -49.647 1.00 33.71  ? 111  PHE B C   1 
ATOM   4352 O  O   . PHE B 1 133 ? 2.303   18.095  -49.070 1.00 33.68  ? 111  PHE B O   1 
ATOM   4353 C  CB  . PHE B 1 133 ? 4.890   19.281  -50.157 1.00 32.96  ? 111  PHE B CB  1 
ATOM   4354 C  CG  . PHE B 1 133 ? 5.370   20.421  -49.298 1.00 32.67  ? 111  PHE B CG  1 
ATOM   4355 C  CD1 . PHE B 1 133 ? 6.050   21.493  -49.858 1.00 33.40  ? 111  PHE B CD1 1 
ATOM   4356 C  CD2 . PHE B 1 133 ? 5.183   20.389  -47.909 1.00 32.49  ? 111  PHE B CD2 1 
ATOM   4357 C  CE1 . PHE B 1 133 ? 6.513   22.525  -49.070 1.00 32.25  ? 111  PHE B CE1 1 
ATOM   4358 C  CE2 . PHE B 1 133 ? 5.650   21.415  -47.125 1.00 32.73  ? 111  PHE B CE2 1 
ATOM   4359 C  CZ  . PHE B 1 133 ? 6.306   22.485  -47.704 1.00 32.94  ? 111  PHE B CZ  1 
ATOM   4360 N  N   . PHE B 1 134 ? 1.490   20.153  -49.437 1.00 33.28  ? 112  PHE B N   1 
ATOM   4361 C  CA  . PHE B 1 134 ? 0.323   19.944  -48.580 1.00 33.81  ? 112  PHE B CA  1 
ATOM   4362 C  C   . PHE B 1 134 ? -0.870  19.310  -49.286 1.00 33.90  ? 112  PHE B C   1 
ATOM   4363 O  O   . PHE B 1 134 ? -1.869  19.062  -48.650 1.00 34.06  ? 112  PHE B O   1 
ATOM   4364 C  CB  . PHE B 1 134 ? -0.091  21.266  -47.916 1.00 35.85  ? 112  PHE B CB  1 
ATOM   4365 C  CG  . PHE B 1 134 ? 0.881   21.714  -46.860 1.00 37.52  ? 112  PHE B CG  1 
ATOM   4366 C  CD1 . PHE B 1 134 ? 0.852   21.135  -45.596 1.00 40.23  ? 112  PHE B CD1 1 
ATOM   4367 C  CD2 . PHE B 1 134 ? 1.858   22.666  -47.137 1.00 35.95  ? 112  PHE B CD2 1 
ATOM   4368 C  CE1 . PHE B 1 134 ? 1.768   21.514  -44.614 1.00 40.22  ? 112  PHE B CE1 1 
ATOM   4369 C  CE2 . PHE B 1 134 ? 2.767   23.055  -46.168 1.00 37.02  ? 112  PHE B CE2 1 
ATOM   4370 C  CZ  . PHE B 1 134 ? 2.724   22.487  -44.900 1.00 38.77  ? 112  PHE B CZ  1 
ATOM   4371 N  N   . ASN B 1 135 ? -0.774  19.023  -50.585 1.00 32.79  ? 113  ASN B N   1 
ATOM   4372 C  CA  . ASN B 1 135 ? -1.845  18.280  -51.255 1.00 32.35  ? 113  ASN B CA  1 
ATOM   4373 C  C   . ASN B 1 135 ? -1.911  16.845  -50.711 1.00 32.55  ? 113  ASN B C   1 
ATOM   4374 O  O   . ASN B 1 135 ? -0.932  16.310  -50.163 1.00 33.13  ? 113  ASN B O   1 
ATOM   4375 C  CB  . ASN B 1 135 ? -1.649  18.298  -52.793 1.00 32.05  ? 113  ASN B CB  1 
ATOM   4376 C  CG  . ASN B 1 135 ? -1.899  19.672  -53.410 1.00 32.62  ? 113  ASN B CG  1 
ATOM   4377 O  OD1 . ASN B 1 135 ? -2.841  20.378  -53.048 1.00 33.71  ? 113  ASN B OD1 1 
ATOM   4378 N  ND2 . ASN B 1 135 ? -1.068  20.044  -54.366 1.00 33.85  ? 113  ASN B ND2 1 
ATOM   4379 N  N   . ALA B 1 136 ? -3.070  16.226  -50.872 1.00 32.09  ? 114  ALA B N   1 
ATOM   4380 C  CA  . ALA B 1 136 ? -3.375  14.918  -50.324 1.00 32.04  ? 114  ALA B CA  1 
ATOM   4381 C  C   . ALA B 1 136 ? -2.311  13.857  -50.596 1.00 31.97  ? 114  ALA B C   1 
ATOM   4382 O  O   . ALA B 1 136 ? -2.050  13.020  -49.747 1.00 32.49  ? 114  ALA B O   1 
ATOM   4383 C  CB  . ALA B 1 136 ? -4.718  14.440  -50.891 1.00 33.19  ? 114  ALA B CB  1 
ATOM   4384 N  N   . GLY B 1 137 ? -1.744  13.846  -51.799 1.00 32.58  ? 115  GLY B N   1 
ATOM   4385 C  CA  . GLY B 1 137 ? -0.700  12.870  -52.151 1.00 31.96  ? 115  GLY B CA  1 
ATOM   4386 C  C   . GLY B 1 137 ? 0.716   13.365  -51.907 1.00 30.87  ? 115  GLY B C   1 
ATOM   4387 O  O   . GLY B 1 137 ? 1.679   12.644  -52.160 1.00 34.30  ? 115  GLY B O   1 
ATOM   4388 N  N   . GLY B 1 138 ? 0.845   14.599  -51.438 1.00 29.83  ? 116  GLY B N   1 
ATOM   4389 C  CA  . GLY B 1 138 ? 2.141   15.194  -51.133 1.00 28.72  ? 116  GLY B CA  1 
ATOM   4390 C  C   . GLY B 1 138 ? 2.807   15.990  -52.236 1.00 28.53  ? 116  GLY B C   1 
ATOM   4391 O  O   . GLY B 1 138 ? 3.968   16.368  -52.097 1.00 28.42  ? 116  GLY B O   1 
ATOM   4392 N  N   . SER B 1 139 ? 2.107   16.267  -53.342 1.00 30.66  ? 117  SER B N   1 
ATOM   4393 C  CA  . SER B 1 139 ? 2.717   17.052  -54.422 1.00 31.27  ? 117  SER B CA  1 
ATOM   4394 C  C   . SER B 1 139 ? 1.736   17.874  -55.252 1.00 32.28  ? 117  SER B C   1 
ATOM   4395 O  O   . SER B 1 139 ? 0.524   17.648  -55.244 1.00 32.91  ? 117  SER B O   1 
ATOM   4396 C  CB  . SER B 1 139 ? 3.521   16.144  -55.394 1.00 32.20  ? 117  SER B CB  1 
ATOM   4397 O  OG  . SER B 1 139 ? 2.702   15.646  -56.452 1.00 30.33  ? 117  SER B OG  1 
ATOM   4398 N  N   . VAL B 1 140 ? 2.317   18.827  -55.978 1.00 32.36  ? 118  VAL B N   1 
ATOM   4399 C  CA  . VAL B 1 140 ? 1.634   19.625  -57.002 1.00 32.41  ? 118  VAL B CA  1 
ATOM   4400 C  C   . VAL B 1 140 ? 0.874   18.791  -58.038 1.00 34.15  ? 118  VAL B C   1 
ATOM   4401 O  O   . VAL B 1 140 ? -0.162  19.245  -58.565 1.00 32.86  ? 118  VAL B O   1 
ATOM   4402 C  CB  . VAL B 1 140 ? 2.666   20.512  -57.738 1.00 32.71  ? 118  VAL B CB  1 
ATOM   4403 C  CG1 . VAL B 1 140 ? 3.698   19.660  -58.480 1.00 32.83  ? 118  VAL B CG1 1 
ATOM   4404 C  CG2 . VAL B 1 140 ? 1.969   21.478  -58.685 1.00 34.24  ? 118  VAL B CG2 1 
ATOM   4405 N  N   . LYS B 1 141 ? 1.393   17.591  -58.350 1.00 32.28  ? 119  LYS B N   1 
ATOM   4406 C  CA  . LYS B 1 141 ? 0.766   16.712  -59.340 1.00 32.96  ? 119  LYS B CA  1 
ATOM   4407 C  C   . LYS B 1 141 ? -0.602  16.182  -58.973 1.00 34.45  ? 119  LYS B C   1 
ATOM   4408 O  O   . LYS B 1 141 ? -1.347  15.775  -59.858 1.00 34.31  ? 119  LYS B O   1 
ATOM   4409 C  CB  . LYS B 1 141 ? 1.638   15.521  -59.651 1.00 33.89  ? 119  LYS B CB  1 
ATOM   4410 C  CG  . LYS B 1 141 ? 2.953   15.886  -60.297 1.00 34.94  ? 119  LYS B CG  1 
ATOM   4411 C  CD  . LYS B 1 141 ? 2.721   16.782  -61.513 1.00 38.79  ? 119  LYS B CD  1 
ATOM   4412 C  CE  . LYS B 1 141 ? 3.777   16.573  -62.575 1.00 40.06  ? 119  LYS B CE  1 
ATOM   4413 N  NZ  . LYS B 1 141 ? 5.072   16.456  -61.888 1.00 38.69  ? 119  LYS B NZ  1 
ATOM   4414 N  N   . ASP B 1 142 ? -0.947  16.160  -57.689 1.00 33.83  ? 120  ASP B N   1 
ATOM   4415 C  CA  . ASP B 1 142 ? -2.314  15.839  -57.324 1.00 35.04  ? 120  ASP B CA  1 
ATOM   4416 C  C   . ASP B 1 142 ? -3.337  16.713  -58.095 1.00 36.23  ? 120  ASP B C   1 
ATOM   4417 O  O   . ASP B 1 142 ? -4.427  16.227  -58.417 1.00 37.29  ? 120  ASP B O   1 
ATOM   4418 C  CB  . ASP B 1 142 ? -2.507  15.952  -55.814 1.00 36.44  ? 120  ASP B CB  1 
ATOM   4419 C  CG  . ASP B 1 142 ? -1.564  15.021  -55.036 1.00 38.65  ? 120  ASP B CG  1 
ATOM   4420 O  OD1 . ASP B 1 142 ? -1.176  13.948  -55.568 1.00 38.71  ? 120  ASP B OD1 1 
ATOM   4421 O  OD2 . ASP B 1 142 ? -1.179  15.380  -53.901 1.00 41.01  ? 120  ASP B OD2 1 
ATOM   4422 N  N   . ARG B 1 143 ? -3.007  17.986  -58.366 1.00 34.60  ? 121  ARG B N   1 
ATOM   4423 C  CA  . ARG B 1 143 ? -3.923  18.869  -59.142 1.00 37.03  ? 121  ARG B CA  1 
ATOM   4424 C  C   . ARG B 1 143 ? -4.147  18.327  -60.558 1.00 36.03  ? 121  ARG B C   1 
ATOM   4425 O  O   . ARG B 1 143 ? -5.281  18.270  -61.016 1.00 36.55  ? 121  ARG B O   1 
ATOM   4426 C  CB  . ARG B 1 143 ? -3.403  20.302  -59.258 1.00 36.39  ? 121  ARG B CB  1 
ATOM   4427 C  CG  . ARG B 1 143 ? -3.171  21.038  -57.954 1.00 36.33  ? 121  ARG B CG  1 
ATOM   4428 C  CD  . ARG B 1 143 ? -2.541  22.373  -58.270 1.00 37.29  ? 121  ARG B CD  1 
ATOM   4429 N  NE  . ARG B 1 143 ? -2.194  23.160  -57.093 1.00 37.55  ? 121  ARG B NE  1 
ATOM   4430 C  CZ  . ARG B 1 143 ? -2.970  24.076  -56.527 1.00 38.14  ? 121  ARG B CZ  1 
ATOM   4431 N  NH1 . ARG B 1 143 ? -4.178  24.345  -56.994 1.00 41.71  ? 121  ARG B NH1 1 
ATOM   4432 N  NH2 . ARG B 1 143 ? -2.521  24.748  -55.482 1.00 39.03  ? 121  ARG B NH2 1 
ATOM   4433 N  N   . ILE B 1 144 ? -3.084  17.902  -61.240 1.00 36.32  ? 122  ILE B N   1 
ATOM   4434 C  CA  . ILE B 1 144 ? -3.258  17.436  -62.628 1.00 38.36  ? 122  ILE B CA  1 
ATOM   4435 C  C   . ILE B 1 144 ? -3.830  16.025  -62.689 1.00 38.48  ? 122  ILE B C   1 
ATOM   4436 O  O   . ILE B 1 144 ? -4.640  15.720  -63.560 1.00 40.36  ? 122  ILE B O   1 
ATOM   4437 C  CB  . ILE B 1 144 ? -2.004  17.608  -63.507 1.00 37.74  ? 122  ILE B CB  1 
ATOM   4438 C  CG1 . ILE B 1 144 ? -0.942  16.549  -63.229 1.00 37.19  ? 122  ILE B CG1 1 
ATOM   4439 C  CG2 . ILE B 1 144 ? -1.457  19.014  -63.326 1.00 38.26  ? 122  ILE B CG2 1 
ATOM   4440 C  CD1 . ILE B 1 144 ? 0.152   16.521  -64.278 1.00 37.89  ? 122  ILE B CD1 1 
ATOM   4441 N  N   . SER B 1 145 ? -3.450  15.188  -61.734 1.00 38.03  ? 123  SER B N   1 
ATOM   4442 C  CA  . SER B 1 145 ? -4.023  13.858  -61.616 1.00 39.30  ? 123  SER B CA  1 
ATOM   4443 C  C   . SER B 1 145 ? -5.540  13.950  -61.521 1.00 39.09  ? 123  SER B C   1 
ATOM   4444 O  O   . SER B 1 145 ? -6.271  13.276  -62.256 1.00 40.45  ? 123  SER B O   1 
ATOM   4445 C  CB  . SER B 1 145 ? -3.461  13.186  -60.373 1.00 39.18  ? 123  SER B CB  1 
ATOM   4446 O  OG  . SER B 1 145 ? -2.050  13.105  -60.511 1.00 44.75  ? 123  SER B OG  1 
ATOM   4447 N  N   . LEU B 1 146 ? -6.017  14.792  -60.615 1.00 38.11  ? 124  LEU B N   1 
ATOM   4448 C  CA  . LEU B 1 146 ? -7.440  14.918  -60.419 1.00 40.48  ? 124  LEU B CA  1 
ATOM   4449 C  C   . LEU B 1 146 ? -8.102  15.483  -61.682 1.00 41.70  ? 124  LEU B C   1 
ATOM   4450 O  O   . LEU B 1 146 ? -9.123  14.977  -62.133 1.00 42.02  ? 124  LEU B O   1 
ATOM   4451 C  CB  . LEU B 1 146 ? -7.749  15.803  -59.202 1.00 41.63  ? 124  LEU B CB  1 
ATOM   4452 C  CG  . LEU B 1 146 ? -9.241  15.950  -58.898 1.00 44.77  ? 124  LEU B CG  1 
ATOM   4453 C  CD1 . LEU B 1 146 ? -9.872  14.581  -58.665 1.00 46.92  ? 124  LEU B CD1 1 
ATOM   4454 C  CD2 . LEU B 1 146 ? -9.500  16.883  -57.726 1.00 45.94  ? 124  LEU B CD2 1 
ATOM   4455 N  N   . ARG B 1 147 ? -7.522  16.539  -62.238 1.00 41.82  ? 125  ARG B N   1 
ATOM   4456 C  CA  . ARG B 1 147 ? -8.111  17.209  -63.392 1.00 43.82  ? 125  ARG B CA  1 
ATOM   4457 C  C   . ARG B 1 147 ? -8.104  16.294  -64.621 1.00 43.74  ? 125  ARG B C   1 
ATOM   4458 O  O   . ARG B 1 147 ? -9.096  16.232  -65.364 1.00 45.41  ? 125  ARG B O   1 
ATOM   4459 C  CB  . ARG B 1 147 ? -7.384  18.536  -63.662 1.00 45.29  ? 125  ARG B CB  1 
ATOM   4460 C  CG  . ARG B 1 147 ? -7.915  19.375  -64.828 1.00 47.76  ? 125  ARG B CG  1 
ATOM   4461 C  CD  . ARG B 1 147 ? -9.312  19.909  -64.629 1.00 50.65  ? 125  ARG B CD  1 
ATOM   4462 N  NE  . ARG B 1 147 ? -9.729  20.673  -65.816 1.00 54.75  ? 125  ARG B NE  1 
ATOM   4463 C  CZ  . ARG B 1 147 ? -9.571  21.989  -65.999 1.00 55.60  ? 125  ARG B CZ  1 
ATOM   4464 N  NH1 . ARG B 1 147 ? -9.031  22.770  -65.071 1.00 54.85  ? 125  ARG B NH1 1 
ATOM   4465 N  NH2 . ARG B 1 147 ? -9.963  22.533  -67.137 1.00 57.97  ? 125  ARG B NH2 1 
ATOM   4466 N  N   . MET B 1 148 ? -7.017  15.557  -64.839 1.00 42.08  ? 126  MET B N   1 
ATOM   4467 C  CA  . MET B 1 148 ? -6.980  14.673  -66.008 1.00 42.78  ? 126  MET B CA  1 
ATOM   4468 C  C   . MET B 1 148 ? -8.072  13.614  -65.915 1.00 43.65  ? 126  MET B C   1 
ATOM   4469 O  O   . MET B 1 148 ? -8.710  13.300  -66.914 1.00 43.85  ? 126  MET B O   1 
ATOM   4470 C  CB  . MET B 1 148 ? -5.609  14.017  -66.181 1.00 42.53  ? 126  MET B CB  1 
ATOM   4471 C  CG  . MET B 1 148 ? -4.564  14.957  -66.751 1.00 42.85  ? 126  MET B CG  1 
ATOM   4472 S  SD  . MET B 1 148 ? -3.095  14.072  -67.274 1.00 41.71  ? 126  MET B SD  1 
ATOM   4473 C  CE  . MET B 1 148 ? -2.495  13.418  -65.726 1.00 40.91  ? 126  MET B CE  1 
ATOM   4474 N  N   . ILE B 1 149 ? -8.281  13.063  -64.719 1.00 42.20  ? 127  ILE B N   1 
ATOM   4475 C  CA  . ILE B 1 149 ? -9.295  12.024  -64.521 1.00 42.79  ? 127  ILE B CA  1 
ATOM   4476 C  C   . ILE B 1 149 ? -10.709 12.564  -64.665 1.00 46.01  ? 127  ILE B C   1 
ATOM   4477 O  O   . ILE B 1 149 ? -11.559 11.907  -65.272 1.00 46.81  ? 127  ILE B O   1 
ATOM   4478 C  CB  . ILE B 1 149 ? -9.154  11.336  -63.146 1.00 41.30  ? 127  ILE B CB  1 
ATOM   4479 C  CG1 . ILE B 1 149 ? -7.958  10.397  -63.147 1.00 39.75  ? 127  ILE B CG1 1 
ATOM   4480 C  CG2 . ILE B 1 149 ? -10.397 10.520  -62.800 1.00 42.37  ? 127  ILE B CG2 1 
ATOM   4481 C  CD1 . ILE B 1 149 ? -7.630  9.855   -61.771 1.00 39.67  ? 127  ILE B CD1 1 
ATOM   4482 N  N   . GLU B 1 150 ? -10.978 13.733  -64.082 1.00 46.93  ? 128  GLU B N   1 
ATOM   4483 C  CA  . GLU B 1 150 ? -12.329 14.317  -64.133 1.00 50.45  ? 128  GLU B CA  1 
ATOM   4484 C  C   . GLU B 1 150 ? -12.735 14.674  -65.555 1.00 50.31  ? 128  GLU B C   1 
ATOM   4485 O  O   . GLU B 1 150 ? -13.860 14.406  -65.959 1.00 51.74  ? 128  GLU B O   1 
ATOM   4486 C  CB  . GLU B 1 150 ? -12.427 15.545  -63.227 1.00 53.31  ? 128  GLU B CB  1 
ATOM   4487 C  CG  . GLU B 1 150 ? -12.297 15.182  -61.754 1.00 56.61  ? 128  GLU B CG  1 
ATOM   4488 C  CD  . GLU B 1 150 ? -12.554 16.347  -60.816 1.00 60.45  ? 128  GLU B CD  1 
ATOM   4489 O  OE1 . GLU B 1 150 ? -11.976 17.449  -61.022 1.00 62.20  ? 128  GLU B OE1 1 
ATOM   4490 O  OE2 . GLU B 1 150 ? -13.322 16.139  -59.856 1.00 63.61  ? 128  GLU B OE2 1 
ATOM   4491 N  N   . ASP B 1 151 ? -11.812 15.274  -66.308 1.00 48.97  ? 129  ASP B N   1 
ATOM   4492 C  CA  . ASP B 1 151 ? -12.075 15.645  -67.710 1.00 51.01  ? 129  ASP B CA  1 
ATOM   4493 C  C   . ASP B 1 151 ? -12.291 14.412  -68.588 1.00 50.72  ? 129  ASP B C   1 
ATOM   4494 O  O   . ASP B 1 151 ? -13.170 14.405  -69.449 1.00 53.34  ? 129  ASP B O   1 
ATOM   4495 C  CB  . ASP B 1 151 ? -10.938 16.514  -68.262 1.00 50.51  ? 129  ASP B CB  1 
ATOM   4496 C  CG  . ASP B 1 151 ? -10.894 17.902  -67.627 1.00 50.96  ? 129  ASP B CG  1 
ATOM   4497 O  OD1 . ASP B 1 151 ? -11.886 18.314  -67.009 1.00 53.69  ? 129  ASP B OD1 1 
ATOM   4498 O  OD2 . ASP B 1 151 ? -9.876  18.609  -67.749 1.00 50.79  ? 129  ASP B OD2 1 
ATOM   4499 N  N   . ALA B 1 152 ? -11.495 13.371  -68.348 1.00 48.30  ? 130  ALA B N   1 
ATOM   4500 C  CA  . ALA B 1 152 ? -11.638 12.086  -69.034 1.00 49.54  ? 130  ALA B CA  1 
ATOM   4501 C  C   . ALA B 1 152 ? -12.957 11.410  -68.693 1.00 52.22  ? 130  ALA B C   1 
ATOM   4502 O  O   . ALA B 1 152 ? -13.567 10.787  -69.564 1.00 53.72  ? 130  ALA B O   1 
ATOM   4503 C  CB  . ALA B 1 152 ? -10.474 11.159  -68.704 1.00 46.95  ? 130  ALA B CB  1 
ATOM   4504 N  N   . GLU B 1 153 ? -13.403 11.532  -67.442 1.00 52.57  ? 131  GLU B N   1 
ATOM   4505 C  CA  . GLU B 1 153 ? -14.744 11.045  -67.052 1.00 56.22  ? 131  GLU B CA  1 
ATOM   4506 C  C   . GLU B 1 153 ? -15.863 11.838  -67.726 1.00 60.59  ? 131  GLU B C   1 
ATOM   4507 O  O   . GLU B 1 153 ? -16.847 11.257  -68.201 1.00 62.60  ? 131  GLU B O   1 
ATOM   4508 C  CB  . GLU B 1 153 ? -14.930 11.053  -65.521 1.00 55.84  ? 131  GLU B CB  1 
ATOM   4509 C  CG  . GLU B 1 153 ? -14.099 9.993   -64.786 1.00 53.37  ? 131  GLU B CG  1 
ATOM   4510 C  CD  . GLU B 1 153 ? -14.181 10.083  -63.271 1.00 52.96  ? 131  GLU B CD  1 
ATOM   4511 O  OE1 . GLU B 1 153 ? -14.573 11.134  -62.738 1.00 53.83  ? 131  GLU B OE1 1 
ATOM   4512 O  OE2 . GLU B 1 153 ? -13.824 9.102   -62.588 1.00 52.83  ? 131  GLU B OE2 1 
ATOM   4513 N  N   . ARG B 1 154 ? -15.712 13.158  -67.786 1.00 63.07  ? 132  ARG B N   1 
ATOM   4514 C  CA  . ARG B 1 154 ? -16.694 14.019  -68.472 1.00 67.93  ? 132  ARG B CA  1 
ATOM   4515 C  C   . ARG B 1 154 ? -16.778 13.736  -69.974 1.00 68.50  ? 132  ARG B C   1 
ATOM   4516 O  O   . ARG B 1 154 ? -17.855 13.705  -70.538 1.00 70.89  ? 132  ARG B O   1 
ATOM   4517 C  CB  . ARG B 1 154 ? -16.339 15.487  -68.267 1.00 70.75  ? 132  ARG B CB  1 
ATOM   4518 C  CG  . ARG B 1 154 ? -17.423 16.475  -68.701 1.00 78.14  ? 132  ARG B CG  1 
ATOM   4519 C  CD  . ARG B 1 154 ? -16.924 17.918  -68.693 1.00 81.26  ? 132  ARG B CD  1 
ATOM   4520 N  NE  . ARG B 1 154 ? -15.801 18.126  -67.768 1.00 83.79  ? 132  ARG B NE  1 
ATOM   4521 C  CZ  . ARG B 1 154 ? -15.899 18.206  -66.437 1.00 84.31  ? 132  ARG B CZ  1 
ATOM   4522 N  NH1 . ARG B 1 154 ? -17.082 18.099  -65.838 1.00 89.76  ? 132  ARG B NH1 1 
ATOM   4523 N  NH2 . ARG B 1 154 ? -14.810 18.392  -65.698 1.00 78.85  ? 132  ARG B NH2 1 
ATOM   4524 N  N   . ASP B 1 155 ? -15.618 13.569  -70.598 1.00 67.08  ? 133  ASP B N   1 
ATOM   4525 C  CA  . ASP B 1 155 ? -15.455 13.168  -72.005 1.00 68.41  ? 133  ASP B CA  1 
ATOM   4526 C  C   . ASP B 1 155 ? -16.091 11.853  -72.405 1.00 69.71  ? 133  ASP B C   1 
ATOM   4527 O  O   . ASP B 1 155 ? -16.267 11.601  -73.589 1.00 73.60  ? 133  ASP B O   1 
ATOM   4528 C  CB  . ASP B 1 155 ? -13.960 12.945  -72.291 1.00 68.16  ? 133  ASP B CB  1 
ATOM   4529 C  CG  . ASP B 1 155 ? -13.228 14.205  -72.597 1.00 67.99  ? 133  ASP B CG  1 
ATOM   4530 O  OD1 . ASP B 1 155 ? -13.871 15.214  -72.944 1.00 73.08  ? 133  ASP B OD1 1 
ATOM   4531 O  OD2 . ASP B 1 155 ? -11.996 14.166  -72.512 1.00 66.08  ? 133  ASP B OD2 1 
ATOM   4532 N  N   . GLY B 1 156 ? -16.342 10.976  -71.442 1.00 68.98  ? 134  GLY B N   1 
ATOM   4533 C  CA  . GLY B 1 156 ? -16.725 9.606   -71.741 1.00 69.59  ? 134  GLY B CA  1 
ATOM   4534 C  C   . GLY B 1 156 ? -15.539 8.704   -72.056 1.00 67.48  ? 134  GLY B C   1 
ATOM   4535 O  O   . GLY B 1 156 ? -15.728 7.529   -72.335 1.00 68.11  ? 134  GLY B O   1 
ATOM   4536 N  N   . THR B 1 157 ? -14.320 9.236   -71.996 1.00 64.77  ? 135  THR B N   1 
ATOM   4537 C  CA  . THR B 1 157 ? -13.117 8.441   -72.230 1.00 63.42  ? 135  THR B CA  1 
ATOM   4538 C  C   . THR B 1 157 ? -12.928 7.362   -71.169 1.00 61.01  ? 135  THR B C   1 
ATOM   4539 O  O   . THR B 1 157 ? -12.688 6.201   -71.473 1.00 60.83  ? 135  THR B O   1 
ATOM   4540 C  CB  . THR B 1 157 ? -11.861 9.320   -72.161 1.00 62.17  ? 135  THR B CB  1 
ATOM   4541 O  OG1 . THR B 1 157 ? -12.016 10.437  -73.036 1.00 66.19  ? 135  THR B OG1 1 
ATOM   4542 C  CG2 . THR B 1 157 ? -10.609 8.520   -72.530 1.00 61.52  ? 135  THR B CG2 1 
ATOM   4543 N  N   . LEU B 1 158 ? -13.024 7.778   -69.915 1.00 58.47  ? 136  LEU B N   1 
ATOM   4544 C  CA  . LEU B 1 158 ? -12.754 6.922   -68.792 1.00 55.42  ? 136  LEU B CA  1 
ATOM   4545 C  C   . LEU B 1 158 ? -14.064 6.417   -68.196 1.00 55.64  ? 136  LEU B C   1 
ATOM   4546 O  O   . LEU B 1 158 ? -14.846 7.196   -67.667 1.00 54.03  ? 136  LEU B O   1 
ATOM   4547 C  CB  . LEU B 1 158 ? -11.970 7.722   -67.757 1.00 53.10  ? 136  LEU B CB  1 
ATOM   4548 C  CG  . LEU B 1 158 ? -11.271 6.929   -66.672 1.00 52.31  ? 136  LEU B CG  1 
ATOM   4549 C  CD1 . LEU B 1 158 ? -10.275 5.940   -67.258 1.00 50.56  ? 136  LEU B CD1 1 
ATOM   4550 C  CD2 . LEU B 1 158 ? -10.572 7.910   -65.739 1.00 50.50  ? 136  LEU B CD2 1 
ATOM   4551 N  N   . LYS B 1 159 ? -14.278 5.107   -68.275 1.00 56.99  ? 137  LYS B N   1 
ATOM   4552 C  CA  . LYS B 1 159 ? -15.492 4.468   -67.764 1.00 59.74  ? 137  LYS B CA  1 
ATOM   4553 C  C   . LYS B 1 159 ? -15.176 3.724   -66.463 1.00 59.50  ? 137  LYS B C   1 
ATOM   4554 O  O   . LYS B 1 159 ? -14.010 3.403   -66.210 1.00 55.69  ? 137  LYS B O   1 
ATOM   4555 C  CB  . LYS B 1 159 ? -16.078 3.528   -68.826 1.00 62.52  ? 137  LYS B CB  1 
ATOM   4556 C  CG  . LYS B 1 159 ? -16.540 4.264   -70.084 1.00 64.29  ? 137  LYS B CG  1 
ATOM   4557 C  CD  . LYS B 1 159 ? -17.582 3.497   -70.891 1.00 67.84  ? 137  LYS B CD  1 
ATOM   4558 N  N   . PRO B 1 160 ? -16.201 3.464   -65.622 1.00 61.41  ? 138  PRO B N   1 
ATOM   4559 C  CA  . PRO B 1 160 ? -15.970 2.837   -64.312 1.00 61.04  ? 138  PRO B CA  1 
ATOM   4560 C  C   . PRO B 1 160 ? -15.108 1.572   -64.376 1.00 60.08  ? 138  PRO B C   1 
ATOM   4561 O  O   . PRO B 1 160 ? -15.263 0.774   -65.293 1.00 59.91  ? 138  PRO B O   1 
ATOM   4562 C  CB  . PRO B 1 160 ? -17.386 2.501   -63.836 1.00 64.39  ? 138  PRO B CB  1 
ATOM   4563 C  CG  . PRO B 1 160 ? -18.252 3.536   -64.468 1.00 65.66  ? 138  PRO B CG  1 
ATOM   4564 C  CD  . PRO B 1 160 ? -17.606 3.887   -65.786 1.00 65.05  ? 138  PRO B CD  1 
ATOM   4565 N  N   . GLY B 1 161 ? -14.184 1.416   -63.427 1.00 58.51  ? 139  GLY B N   1 
ATOM   4566 C  CA  . GLY B 1 161 ? -13.321 0.228   -63.382 1.00 58.58  ? 139  GLY B CA  1 
ATOM   4567 C  C   . GLY B 1 161 ? -12.309 0.032   -64.521 1.00 58.87  ? 139  GLY B C   1 
ATOM   4568 O  O   . GLY B 1 161 ? -11.646 -0.999  -64.572 1.00 60.89  ? 139  GLY B O   1 
ATOM   4569 N  N   . ASP B 1 162 ? -12.187 0.998   -65.436 1.00 58.44  ? 140  ASP B N   1 
ATOM   4570 C  CA  . ASP B 1 162 ? -11.155 0.969   -66.486 1.00 55.12  ? 140  ASP B CA  1 
ATOM   4571 C  C   . ASP B 1 162 ? -9.754  1.016   -65.873 1.00 49.45  ? 140  ASP B C   1 
ATOM   4572 O  O   . ASP B 1 162 ? -9.603  1.136   -64.658 1.00 50.82  ? 140  ASP B O   1 
ATOM   4573 C  CB  . ASP B 1 162 ? -11.316 2.161   -67.455 1.00 55.60  ? 140  ASP B CB  1 
ATOM   4574 C  CG  . ASP B 1 162 ? -12.357 1.923   -68.534 1.00 58.78  ? 140  ASP B CG  1 
ATOM   4575 O  OD1 . ASP B 1 162 ? -12.959 0.834   -68.592 1.00 60.38  ? 140  ASP B OD1 1 
ATOM   4576 O  OD2 . ASP B 1 162 ? -12.563 2.845   -69.343 1.00 58.96  ? 140  ASP B OD2 1 
ATOM   4577 N  N   . THR B 1 163 ? -8.740  0.906   -66.731 1.00 46.66  ? 141  THR B N   1 
ATOM   4578 C  CA  . THR B 1 163 ? -7.344  0.887   -66.337 1.00 42.89  ? 141  THR B CA  1 
ATOM   4579 C  C   . THR B 1 163 ? -6.622  2.148   -66.803 1.00 42.03  ? 141  THR B C   1 
ATOM   4580 O  O   . THR B 1 163 ? -6.676  2.535   -67.972 1.00 42.99  ? 141  THR B O   1 
ATOM   4581 C  CB  . THR B 1 163 ? -6.639  -0.349  -66.916 1.00 43.51  ? 141  THR B CB  1 
ATOM   4582 O  OG1 . THR B 1 163 ? -7.221  -1.519  -66.343 1.00 44.49  ? 141  THR B OG1 1 
ATOM   4583 C  CG2 . THR B 1 163 ? -5.147  -0.341  -66.605 1.00 40.85  ? 141  THR B CG2 1 
ATOM   4584 N  N   . ILE B 1 164 ? -5.959  2.788   -65.860 1.00 40.25  ? 142  ILE B N   1 
ATOM   4585 C  CA  . ILE B 1 164 ? -5.156  3.976   -66.096 1.00 40.92  ? 142  ILE B CA  1 
ATOM   4586 C  C   . ILE B 1 164 ? -3.689  3.559   -66.112 1.00 38.15  ? 142  ILE B C   1 
ATOM   4587 O  O   . ILE B 1 164 ? -3.241  2.923   -65.177 1.00 37.55  ? 142  ILE B O   1 
ATOM   4588 C  CB  . ILE B 1 164 ? -5.394  4.982   -64.960 1.00 42.67  ? 142  ILE B CB  1 
ATOM   4589 C  CG1 . ILE B 1 164 ? -6.809  5.569   -65.102 1.00 46.10  ? 142  ILE B CG1 1 
ATOM   4590 C  CG2 . ILE B 1 164 ? -4.353  6.092   -64.966 1.00 43.14  ? 142  ILE B CG2 1 
ATOM   4591 C  CD1 . ILE B 1 164 ? -7.250  6.368   -63.897 1.00 47.01  ? 142  ILE B CD1 1 
ATOM   4592 N  N   . ILE B 1 165 ? -2.970  3.909   -67.171 1.00 37.74  ? 143  ILE B N   1 
ATOM   4593 C  CA  . ILE B 1 165 ? -1.540  3.644   -67.294 1.00 36.97  ? 143  ILE B CA  1 
ATOM   4594 C  C   . ILE B 1 165 ? -0.847  4.976   -67.502 1.00 36.54  ? 143  ILE B C   1 
ATOM   4595 O  O   . ILE B 1 165 ? -1.216  5.714   -68.401 1.00 37.84  ? 143  ILE B O   1 
ATOM   4596 C  CB  . ILE B 1 165 ? -1.230  2.744   -68.512 1.00 38.55  ? 143  ILE B CB  1 
ATOM   4597 C  CG1 . ILE B 1 165 ? -1.955  1.384   -68.384 1.00 38.93  ? 143  ILE B CG1 1 
ATOM   4598 C  CG2 . ILE B 1 165 ? 0.281   2.545   -68.635 1.00 38.38  ? 143  ILE B CG2 1 
ATOM   4599 C  CD1 . ILE B 1 165 ? -2.038  0.560   -69.641 1.00 39.54  ? 143  ILE B CD1 1 
ATOM   4600 N  N   . GLU B 1 166 ? 0.154   5.306   -66.699 1.00 34.46  ? 144  GLU B N   1 
ATOM   4601 C  CA  . GLU B 1 166 ? 0.823   6.611   -66.884 1.00 36.03  ? 144  GLU B CA  1 
ATOM   4602 C  C   . GLU B 1 166 ? 2.335   6.513   -66.751 1.00 34.40  ? 144  GLU B C   1 
ATOM   4603 O  O   . GLU B 1 166 ? 2.831   5.923   -65.806 1.00 33.61  ? 144  GLU B O   1 
ATOM   4604 C  CB  . GLU B 1 166 ? 0.286   7.680   -65.932 1.00 35.73  ? 144  GLU B CB  1 
ATOM   4605 C  CG  . GLU B 1 166 ? 0.762   9.117   -66.215 1.00 37.47  ? 144  GLU B CG  1 
ATOM   4606 C  CD  . GLU B 1 166 ? 0.105   9.793   -67.419 1.00 41.94  ? 144  GLU B CD  1 
ATOM   4607 O  OE1 . GLU B 1 166 ? -0.887  9.263   -67.971 1.00 43.98  ? 144  GLU B OE1 1 
ATOM   4608 O  OE2 . GLU B 1 166 ? 0.584   10.877  -67.825 1.00 42.71  ? 144  GLU B OE2 1 
ATOM   4609 N  N   . PRO B 1 167 ? 3.063   7.073   -67.730 1.00 34.17  ? 145  PRO B N   1 
ATOM   4610 C  CA  . PRO B 1 167 ? 4.492   7.237   -67.573 1.00 32.67  ? 145  PRO B CA  1 
ATOM   4611 C  C   . PRO B 1 167 ? 4.744   8.438   -66.670 1.00 31.57  ? 145  PRO B C   1 
ATOM   4612 O  O   . PRO B 1 167 ? 4.182   9.509   -66.895 1.00 32.40  ? 145  PRO B O   1 
ATOM   4613 C  CB  . PRO B 1 167 ? 4.967   7.497   -69.002 1.00 33.35  ? 145  PRO B CB  1 
ATOM   4614 C  CG  . PRO B 1 167 ? 3.809   8.123   -69.678 1.00 35.52  ? 145  PRO B CG  1 
ATOM   4615 C  CD  . PRO B 1 167 ? 2.564   7.701   -68.962 1.00 34.46  ? 145  PRO B CD  1 
ATOM   4616 N  N   . THR B 1 168 ? 5.590   8.280   -65.666 1.00 30.52  ? 146  THR B N   1 
ATOM   4617 C  CA  . THR B 1 168 ? 5.722   9.331   -64.676 1.00 30.24  ? 146  THR B CA  1 
ATOM   4618 C  C   . THR B 1 168 ? 7.083   9.257   -64.016 1.00 29.98  ? 146  THR B C   1 
ATOM   4619 O  O   . THR B 1 168 ? 7.694   8.175   -63.930 1.00 28.01  ? 146  THR B O   1 
ATOM   4620 C  CB  . THR B 1 168 ? 4.584   9.178   -63.621 1.00 32.06  ? 146  THR B CB  1 
ATOM   4621 O  OG1 . THR B 1 168 ? 4.791   10.027  -62.477 1.00 31.41  ? 146  THR B OG1 1 
ATOM   4622 C  CG2 . THR B 1 168 ? 4.520   7.769   -63.147 1.00 33.62  ? 146  THR B CG2 1 
ATOM   4623 N  N   . SER B 1 169 ? 7.551   10.402  -63.530 1.00 29.80  ? 147  SER B N   1 
ATOM   4624 C  CA  . SER B 1 169 ? 8.748   10.445  -62.670 1.00 30.07  ? 147  SER B CA  1 
ATOM   4625 C  C   . SER B 1 169 ? 8.369   10.126  -61.216 1.00 29.83  ? 147  SER B C   1 
ATOM   4626 O  O   . SER B 1 169 ? 9.235   10.005  -60.351 1.00 31.14  ? 147  SER B O   1 
ATOM   4627 C  CB  . SER B 1 169 ? 9.412   11.822  -62.760 1.00 31.10  ? 147  SER B CB  1 
ATOM   4628 O  OG  . SER B 1 169 ? 8.454   12.868  -62.526 1.00 31.44  ? 147  SER B OG  1 
ATOM   4629 N  N   . GLY B 1 170 ? 7.083   9.971   -60.938 1.00 29.26  ? 148  GLY B N   1 
ATOM   4630 C  CA  . GLY B 1 170 ? 6.653   9.486   -59.617 1.00 28.48  ? 148  GLY B CA  1 
ATOM   4631 C  C   . GLY B 1 170 ? 5.429   10.163  -59.058 1.00 28.51  ? 148  GLY B C   1 
ATOM   4632 O  O   . GLY B 1 170 ? 4.489   9.496   -58.602 1.00 29.20  ? 148  GLY B O   1 
ATOM   4633 N  N   . ASN B 1 171 ? 5.429   11.492  -59.074 1.00 27.42  ? 149  ASN B N   1 
ATOM   4634 C  CA  . ASN B 1 171 ? 4.358   12.231  -58.409 1.00 28.37  ? 149  ASN B CA  1 
ATOM   4635 C  C   . ASN B 1 171 ? 3.025   12.207  -59.127 1.00 29.05  ? 149  ASN B C   1 
ATOM   4636 O  O   . ASN B 1 171 ? 1.983   12.104  -58.484 1.00 27.49  ? 149  ASN B O   1 
ATOM   4637 C  CB  . ASN B 1 171 ? 4.794   13.660  -58.114 1.00 28.39  ? 149  ASN B CB  1 
ATOM   4638 C  CG  . ASN B 1 171 ? 5.785   13.734  -56.970 1.00 28.27  ? 149  ASN B CG  1 
ATOM   4639 O  OD1 . ASN B 1 171 ? 5.675   12.984  -55.998 1.00 30.33  ? 149  ASN B OD1 1 
ATOM   4640 N  ND2 . ASN B 1 171 ? 6.737   14.656  -57.063 1.00 27.08  ? 149  ASN B ND2 1 
ATOM   4641 N  N   . THR B 1 172 ? 3.036   12.265  -60.453 1.00 28.15  ? 150  THR B N   1 
ATOM   4642 C  CA  . THR B 1 172 ? 1.786   12.120  -61.180 1.00 29.86  ? 150  THR B CA  1 
ATOM   4643 C  C   . THR B 1 172 ? 1.261   10.704  -60.957 1.00 30.22  ? 150  THR B C   1 
ATOM   4644 O  O   . THR B 1 172 ? 0.068   10.511  -60.816 1.00 31.23  ? 150  THR B O   1 
ATOM   4645 C  CB  . THR B 1 172 ? 1.960   12.387  -62.658 1.00 30.96  ? 150  THR B CB  1 
ATOM   4646 O  OG1 . THR B 1 172 ? 2.267   13.763  -62.826 1.00 33.12  ? 150  THR B OG1 1 
ATOM   4647 C  CG2 . THR B 1 172 ? 0.640   12.104  -63.432 1.00 34.24  ? 150  THR B CG2 1 
ATOM   4648 N  N   . GLY B 1 173 ? 2.167   9.728   -60.879 1.00 28.62  ? 151  GLY B N   1 
ATOM   4649 C  CA  . GLY B 1 173 ? 1.781   8.352   -60.587 1.00 29.60  ? 151  GLY B CA  1 
ATOM   4650 C  C   . GLY B 1 173 ? 1.122   8.210   -59.232 1.00 29.30  ? 151  GLY B C   1 
ATOM   4651 O  O   . GLY B 1 173 ? 0.134   7.502   -59.077 1.00 28.39  ? 151  GLY B O   1 
ATOM   4652 N  N   . ILE B 1 174 ? 1.678   8.890   -58.239 1.00 28.80  ? 152  ILE B N   1 
ATOM   4653 C  CA  . ILE B 1 174 ? 1.132   8.822   -56.898 1.00 28.29  ? 152  ILE B CA  1 
ATOM   4654 C  C   . ILE B 1 174 ? -0.259  9.470   -56.864 1.00 29.24  ? 152  ILE B C   1 
ATOM   4655 O  O   . ILE B 1 174 ? -1.201  8.916   -56.285 1.00 28.08  ? 152  ILE B O   1 
ATOM   4656 C  CB  . ILE B 1 174 ? 2.106   9.439   -55.864 1.00 28.15  ? 152  ILE B CB  1 
ATOM   4657 C  CG1 . ILE B 1 174 ? 3.235   8.452   -55.581 1.00 29.36  ? 152  ILE B CG1 1 
ATOM   4658 C  CG2 . ILE B 1 174 ? 1.374   9.797   -54.566 1.00 27.98  ? 152  ILE B CG2 1 
ATOM   4659 C  CD1 . ILE B 1 174 ? 4.432   9.028   -54.846 1.00 30.16  ? 152  ILE B CD1 1 
ATOM   4660 N  N   . GLY B 1 175 ? -0.383  10.621  -57.527 1.00 29.45  ? 153  GLY B N   1 
ATOM   4661 C  CA  . GLY B 1 175 ? -1.661  11.334  -57.623 1.00 29.84  ? 153  GLY B CA  1 
ATOM   4662 C  C   . GLY B 1 175 ? -2.730  10.507  -58.290 1.00 30.17  ? 153  GLY B C   1 
ATOM   4663 O  O   . GLY B 1 175 ? -3.867  10.447  -57.818 1.00 29.09  ? 153  GLY B O   1 
ATOM   4664 N  N   . LEU B 1 176 ? -2.362  9.891   -59.416 1.00 30.33  ? 154  LEU B N   1 
ATOM   4665 C  CA  . LEU B 1 176 ? -3.268  9.001   -60.132 1.00 30.95  ? 154  LEU B CA  1 
ATOM   4666 C  C   . LEU B 1 176 ? -3.602  7.741   -59.345 1.00 31.32  ? 154  LEU B C   1 
ATOM   4667 O  O   . LEU B 1 176 ? -4.738  7.279   -59.369 1.00 32.29  ? 154  LEU B O   1 
ATOM   4668 C  CB  . LEU B 1 176 ? -2.685  8.629   -61.498 1.00 31.70  ? 154  LEU B CB  1 
ATOM   4669 C  CG  . LEU B 1 176 ? -2.631  9.789   -62.501 1.00 32.88  ? 154  LEU B CG  1 
ATOM   4670 C  CD1 . LEU B 1 176 ? -1.809  9.440   -63.753 1.00 34.12  ? 154  LEU B CD1 1 
ATOM   4671 C  CD2 . LEU B 1 176 ? -4.034  10.224  -62.868 1.00 34.10  ? 154  LEU B CD2 1 
ATOM   4672 N  N   . ALA B 1 177 ? -2.619  7.183   -58.641 1.00 30.26  ? 155  ALA B N   1 
ATOM   4673 C  CA  . ALA B 1 177 ? -2.852  5.963   -57.858 1.00 30.76  ? 155  ALA B CA  1 
ATOM   4674 C  C   . ALA B 1 177 ? -3.801  6.250   -56.707 1.00 31.38  ? 155  ALA B C   1 
ATOM   4675 O  O   . ALA B 1 177 ? -4.650  5.418   -56.329 1.00 31.40  ? 155  ALA B O   1 
ATOM   4676 C  CB  . ALA B 1 177 ? -1.532  5.418   -57.329 1.00 29.54  ? 155  ALA B CB  1 
ATOM   4677 N  N   . LEU B 1 178 ? -3.675  7.451   -56.161 1.00 32.64  ? 156  LEU B N   1 
ATOM   4678 C  CA  . LEU B 1 178 ? -4.495  7.846   -55.024 1.00 33.40  ? 156  LEU B CA  1 
ATOM   4679 C  C   . LEU B 1 178 ? -5.941  8.027   -55.490 1.00 33.72  ? 156  LEU B C   1 
ATOM   4680 O  O   . LEU B 1 178 ? -6.867  7.498   -54.880 1.00 35.91  ? 156  LEU B O   1 
ATOM   4681 C  CB  . LEU B 1 178 ? -3.905  9.112   -54.377 1.00 35.47  ? 156  LEU B CB  1 
ATOM   4682 C  CG  . LEU B 1 178 ? -4.371  9.322   -52.936 1.00 37.29  ? 156  LEU B CG  1 
ATOM   4683 C  CD1 . LEU B 1 178 ? -3.370  10.140  -52.150 1.00 38.26  ? 156  LEU B CD1 1 
ATOM   4684 C  CD2 . LEU B 1 178 ? -5.730  9.972   -52.921 1.00 40.34  ? 156  LEU B CD2 1 
ATOM   4685 N  N   . ALA B 1 179 ? -6.139  8.721   -56.603 1.00 33.22  ? 157  ALA B N   1 
ATOM   4686 C  CA  . ALA B 1 179 ? -7.473  8.870   -57.159 1.00 34.73  ? 157  ALA B CA  1 
ATOM   4687 C  C   . ALA B 1 179 ? -8.037  7.514   -57.588 1.00 35.41  ? 157  ALA B C   1 
ATOM   4688 O  O   . ALA B 1 179 ? -9.211  7.221   -57.352 1.00 37.17  ? 157  ALA B O   1 
ATOM   4689 C  CB  . ALA B 1 179 ? -7.448  9.835   -58.314 1.00 35.26  ? 157  ALA B CB  1 
ATOM   4690 N  N   . ALA B 1 180 ? -7.184  6.678   -58.181 1.00 35.27  ? 158  ALA B N   1 
ATOM   4691 C  CA  . ALA B 1 180 ? -7.595  5.343   -58.641 1.00 35.84  ? 158  ALA B CA  1 
ATOM   4692 C  C   . ALA B 1 180 ? -8.063  4.500   -57.466 1.00 36.21  ? 158  ALA B C   1 
ATOM   4693 O  O   . ALA B 1 180 ? -9.052  3.784   -57.564 1.00 36.93  ? 158  ALA B O   1 
ATOM   4694 C  CB  . ALA B 1 180 ? -6.454  4.651   -59.357 1.00 35.29  ? 158  ALA B CB  1 
ATOM   4695 N  N   . ALA B 1 181 ? -7.350  4.604   -56.350 1.00 33.59  ? 159  ALA B N   1 
ATOM   4696 C  CA  . ALA B 1 181 ? -7.707  3.866   -55.155 1.00 34.25  ? 159  ALA B CA  1 
ATOM   4697 C  C   . ALA B 1 181 ? -9.061  4.299   -54.651 1.00 35.88  ? 159  ALA B C   1 
ATOM   4698 O  O   . ALA B 1 181 ? -9.886  3.462   -54.280 1.00 36.49  ? 159  ALA B O   1 
ATOM   4699 C  CB  . ALA B 1 181 ? -6.660  4.096   -54.073 1.00 34.02  ? 159  ALA B CB  1 
ATOM   4700 N  N   . VAL B 1 182 ? -9.278  5.620   -54.630 1.00 36.12  ? 160  VAL B N   1 
ATOM   4701 C  CA  . VAL B 1 182 ? -10.526 6.203   -54.154 1.00 37.98  ? 160  VAL B CA  1 
ATOM   4702 C  C   . VAL B 1 182 ? -11.710 5.892   -55.086 1.00 40.76  ? 160  VAL B C   1 
ATOM   4703 O  O   . VAL B 1 182 ? -12.785 5.564   -54.599 1.00 42.62  ? 160  VAL B O   1 
ATOM   4704 C  CB  . VAL B 1 182 ? -10.387 7.736   -53.965 1.00 37.04  ? 160  VAL B CB  1 
ATOM   4705 C  CG1 . VAL B 1 182 ? -11.730 8.394   -53.749 1.00 39.17  ? 160  VAL B CG1 1 
ATOM   4706 C  CG2 . VAL B 1 182 ? -9.484  8.056   -52.793 1.00 36.27  ? 160  VAL B CG2 1 
ATOM   4707 N  N   A ARG B 1 183 ? -11.479 5.987   -56.399 0.50 41.48  ? 161  ARG B N   1 
ATOM   4708 N  N   B ARG B 1 183 ? -11.529 6.000   -56.403 0.50 40.73  ? 161  ARG B N   1 
ATOM   4709 C  CA  A ARG B 1 183 ? -12.550 5.912   -57.414 0.50 44.72  ? 161  ARG B CA  1 
ATOM   4710 C  CA  B ARG B 1 183 ? -12.673 5.867   -57.341 0.50 43.39  ? 161  ARG B CA  1 
ATOM   4711 C  C   A ARG B 1 183 ? -12.806 4.497   -57.942 0.50 44.93  ? 161  ARG B C   1 
ATOM   4712 C  C   B ARG B 1 183 ? -12.802 4.488   -57.988 0.50 44.10  ? 161  ARG B C   1 
ATOM   4713 O  O   A ARG B 1 183 ? -13.837 4.250   -58.550 0.50 47.62  ? 161  ARG B O   1 
ATOM   4714 O  O   B ARG B 1 183 ? -13.735 4.262   -58.743 0.50 46.60  ? 161  ARG B O   1 
ATOM   4715 C  CB  A ARG B 1 183 ? -12.219 6.834   -58.605 0.50 45.72  ? 161  ARG B CB  1 
ATOM   4716 C  CB  B ARG B 1 183 ? -12.616 6.931   -58.449 0.50 43.65  ? 161  ARG B CB  1 
ATOM   4717 C  CG  A ARG B 1 183 ? -12.099 8.327   -58.275 0.50 46.62  ? 161  ARG B CG  1 
ATOM   4718 C  CG  B ARG B 1 183 ? -12.606 8.384   -57.975 0.50 43.48  ? 161  ARG B CG  1 
ATOM   4719 C  CD  A ARG B 1 183 ? -13.253 9.149   -58.832 0.50 50.04  ? 161  ARG B CD  1 
ATOM   4720 C  CD  B ARG B 1 183 ? -14.000 8.980   -57.829 0.50 46.17  ? 161  ARG B CD  1 
ATOM   4721 N  NE  A ARG B 1 183 ? -13.232 10.539  -58.371 0.50 52.01  ? 161  ARG B NE  1 
ATOM   4722 N  NE  B ARG B 1 183 ? -13.938 10.426  -57.601 0.50 46.29  ? 161  ARG B NE  1 
ATOM   4723 C  CZ  A ARG B 1 183 ? -13.178 11.603  -59.169 0.50 52.49  ? 161  ARG B CZ  1 
ATOM   4724 C  CZ  B ARG B 1 183 ? -14.226 11.017  -56.448 0.50 46.14  ? 161  ARG B CZ  1 
ATOM   4725 N  NH1 A ARG B 1 183 ? -13.145 11.452  -60.475 0.50 53.02  ? 161  ARG B NH1 1 
ATOM   4726 N  NH1 B ARG B 1 183 ? -14.625 10.295  -55.417 0.50 46.26  ? 161  ARG B NH1 1 
ATOM   4727 N  NH2 A ARG B 1 183 ? -13.170 12.822  -58.655 0.50 52.80  ? 161  ARG B NH2 1 
ATOM   4728 N  NH2 B ARG B 1 183 ? -14.126 12.331  -56.329 0.50 46.14  ? 161  ARG B NH2 1 
ATOM   4729 N  N   . GLY B 1 184 ? -11.870 3.578   -57.733 1.00 42.98  ? 162  GLY B N   1 
ATOM   4730 C  CA  . GLY B 1 184 ? -12.003 2.200   -58.214 1.00 44.33  ? 162  GLY B CA  1 
ATOM   4731 C  C   . GLY B 1 184 ? -11.434 1.895   -59.595 1.00 43.90  ? 162  GLY B C   1 
ATOM   4732 O  O   . GLY B 1 184 ? -11.971 1.061   -60.324 1.00 45.17  ? 162  GLY B O   1 
ATOM   4733 N  N   . TYR B 1 185 ? -10.343 2.551   -59.965 1.00 42.50  ? 163  TYR B N   1 
ATOM   4734 C  CA  . TYR B 1 185 ? -9.673  2.229   -61.223 1.00 42.61  ? 163  TYR B CA  1 
ATOM   4735 C  C   . TYR B 1 185 ? -8.455  1.354   -60.967 1.00 42.00  ? 163  TYR B C   1 
ATOM   4736 O  O   . TYR B 1 185 ? -7.815  1.474   -59.941 1.00 41.55  ? 163  TYR B O   1 
ATOM   4737 C  CB  . TYR B 1 185 ? -9.225  3.506   -61.932 1.00 41.74  ? 163  TYR B CB  1 
ATOM   4738 C  CG  . TYR B 1 185 ? -10.348 4.426   -62.322 1.00 43.74  ? 163  TYR B CG  1 
ATOM   4739 C  CD1 . TYR B 1 185 ? -11.267 4.057   -63.297 1.00 45.85  ? 163  TYR B CD1 1 
ATOM   4740 C  CD2 . TYR B 1 185 ? -10.491 5.682   -61.724 1.00 43.43  ? 163  TYR B CD2 1 
ATOM   4741 C  CE1 . TYR B 1 185 ? -12.301 4.900   -63.660 1.00 47.36  ? 163  TYR B CE1 1 
ATOM   4742 C  CE2 . TYR B 1 185 ? -11.523 6.536   -62.094 1.00 44.77  ? 163  TYR B CE2 1 
ATOM   4743 C  CZ  . TYR B 1 185 ? -12.416 6.134   -63.065 1.00 47.41  ? 163  TYR B CZ  1 
ATOM   4744 O  OH  . TYR B 1 185 ? -13.449 6.965   -63.430 1.00 49.36  ? 163  TYR B OH  1 
ATOM   4745 N  N   . ARG B 1 186 ? -8.125  0.497   -61.918 1.00 42.59  ? 164  ARG B N   1 
ATOM   4746 C  CA  . ARG B 1 186 ? -6.846  -0.192  -61.908 1.00 41.26  ? 164  ARG B CA  1 
ATOM   4747 C  C   . ARG B 1 186 ? -5.793  0.807   -62.360 1.00 40.05  ? 164  ARG B C   1 
ATOM   4748 O  O   . ARG B 1 186 ? -6.020  1.575   -63.287 1.00 43.37  ? 164  ARG B O   1 
ATOM   4749 C  CB  . ARG B 1 186 ? -6.898  -1.367  -62.862 1.00 42.38  ? 164  ARG B CB  1 
ATOM   4750 C  CG  . ARG B 1 186 ? -5.662  -2.243  -62.864 1.00 42.19  ? 164  ARG B CG  1 
ATOM   4751 C  CD  . ARG B 1 186 ? -5.712  -3.234  -64.021 1.00 43.67  ? 164  ARG B CD  1 
ATOM   4752 N  NE  . ARG B 1 186 ? -4.501  -4.039  -64.058 1.00 43.93  ? 164  ARG B NE  1 
ATOM   4753 C  CZ  . ARG B 1 186 ? -4.128  -4.792  -65.092 1.00 44.67  ? 164  ARG B CZ  1 
ATOM   4754 N  NH1 . ARG B 1 186 ? -4.851  -4.845  -66.181 1.00 46.28  ? 164  ARG B NH1 1 
ATOM   4755 N  NH2 . ARG B 1 186 ? -3.012  -5.489  -65.032 1.00 45.32  ? 164  ARG B NH2 1 
ATOM   4756 N  N   . CYS B 1 187 ? -4.638  0.803   -61.719 1.00 37.58  ? 165  CYS B N   1 
ATOM   4757 C  CA  . CYS B 1 187 ? -3.645  1.833   -61.966 1.00 36.25  ? 165  CYS B CA  1 
ATOM   4758 C  C   . CYS B 1 187 ? -2.282  1.201   -62.183 1.00 34.00  ? 165  CYS B C   1 
ATOM   4759 O  O   . CYS B 1 187 ? -1.805  0.473   -61.328 1.00 32.53  ? 165  CYS B O   1 
ATOM   4760 C  CB  . CYS B 1 187 ? -3.582  2.825   -60.818 1.00 36.10  ? 165  CYS B CB  1 
ATOM   4761 S  SG  . CYS B 1 187 ? -2.445  4.182   -61.145 1.00 37.26  ? 165  CYS B SG  1 
ATOM   4762 N  N   . ILE B 1 188 ? -1.700  1.447   -63.357 1.00 33.21  ? 166  ILE B N   1 
ATOM   4763 C  CA  . ILE B 1 188 ? -0.359  0.967   -63.678 1.00 32.64  ? 166  ILE B CA  1 
ATOM   4764 C  C   . ILE B 1 188 ? 0.563   2.155   -63.953 1.00 33.20  ? 166  ILE B C   1 
ATOM   4765 O  O   . ILE B 1 188 ? 0.272   2.980   -64.814 1.00 33.51  ? 166  ILE B O   1 
ATOM   4766 C  CB  . ILE B 1 188 ? -0.371  0.062   -64.915 1.00 32.96  ? 166  ILE B CB  1 
ATOM   4767 C  CG1 . ILE B 1 188 ? -1.270  -1.163  -64.677 1.00 34.33  ? 166  ILE B CG1 1 
ATOM   4768 C  CG2 . ILE B 1 188 ? 1.052   -0.370  -65.256 1.00 32.13  ? 166  ILE B CG2 1 
ATOM   4769 C  CD1 . ILE B 1 188 ? -1.633  -1.917  -65.938 1.00 36.44  ? 166  ILE B CD1 1 
ATOM   4770 N  N   . ILE B 1 189 ? 1.679   2.215   -63.231 1.00 31.44  ? 167  ILE B N   1 
ATOM   4771 C  CA  . ILE B 1 189 ? 2.621   3.319   -63.295 1.00 32.87  ? 167  ILE B CA  1 
ATOM   4772 C  C   . ILE B 1 189 ? 3.931   2.824   -63.918 1.00 32.23  ? 167  ILE B C   1 
ATOM   4773 O  O   . ILE B 1 189 ? 4.419   1.744   -63.560 1.00 32.49  ? 167  ILE B O   1 
ATOM   4774 C  CB  . ILE B 1 189 ? 2.888   3.817   -61.852 1.00 35.13  ? 167  ILE B CB  1 
ATOM   4775 C  CG1 . ILE B 1 189 ? 1.631   4.498   -61.272 1.00 37.32  ? 167  ILE B CG1 1 
ATOM   4776 C  CG2 . ILE B 1 189 ? 4.153   4.632   -61.752 1.00 38.13  ? 167  ILE B CG2 1 
ATOM   4777 C  CD1 . ILE B 1 189 ? 0.835   5.307   -62.237 1.00 39.48  ? 167  ILE B CD1 1 
ATOM   4778 N  N   . VAL B 1 190 ? 4.490   3.619   -64.830 1.00 31.22  ? 168  VAL B N   1 
ATOM   4779 C  CA  . VAL B 1 190 ? 5.754   3.302   -65.499 1.00 30.90  ? 168  VAL B CA  1 
ATOM   4780 C  C   . VAL B 1 190 ? 6.745   4.409   -65.161 1.00 30.46  ? 168  VAL B C   1 
ATOM   4781 O  O   . VAL B 1 190 ? 6.549   5.558   -65.541 1.00 29.51  ? 168  VAL B O   1 
ATOM   4782 C  CB  . VAL B 1 190 ? 5.587   3.206   -67.018 1.00 32.06  ? 168  VAL B CB  1 
ATOM   4783 C  CG1 . VAL B 1 190 ? 6.866   2.676   -67.647 1.00 33.10  ? 168  VAL B CG1 1 
ATOM   4784 C  CG2 . VAL B 1 190 ? 4.437   2.269   -67.379 1.00 33.89  ? 168  VAL B CG2 1 
ATOM   4785 N  N   . MET B 1 191 ? 7.820   4.045   -64.466 1.00 30.63  ? 169  MET B N   1 
ATOM   4786 C  CA  . MET B 1 191 ? 8.686   5.019   -63.815 1.00 29.58  ? 169  MET B CA  1 
ATOM   4787 C  C   . MET B 1 191 ? 10.178  4.703   -64.012 1.00 28.62  ? 169  MET B C   1 
ATOM   4788 O  O   . MET B 1 191 ? 10.590  3.564   -63.808 1.00 29.21  ? 169  MET B O   1 
ATOM   4789 C  CB  . MET B 1 191 ? 8.311   5.031   -62.330 1.00 28.66  ? 169  MET B CB  1 
ATOM   4790 C  CG  . MET B 1 191 ? 9.052   6.047   -61.480 1.00 30.17  ? 169  MET B CG  1 
ATOM   4791 S  SD  . MET B 1 191 ? 8.345   6.257   -59.821 1.00 30.23  ? 169  MET B SD  1 
ATOM   4792 C  CE  . MET B 1 191 ? 8.813   4.749   -59.032 1.00 28.90  ? 169  MET B CE  1 
ATOM   4793 N  N   . PRO B 1 192 ? 11.001  5.705   -64.401 1.00 28.16  ? 170  PRO B N   1 
ATOM   4794 C  CA  . PRO B 1 192 ? 12.428  5.402   -64.555 1.00 28.51  ? 170  PRO B CA  1 
ATOM   4795 C  C   . PRO B 1 192 ? 13.083  4.829   -63.311 1.00 27.11  ? 170  PRO B C   1 
ATOM   4796 O  O   . PRO B 1 192 ? 12.649  5.111   -62.192 1.00 25.55  ? 170  PRO B O   1 
ATOM   4797 C  CB  . PRO B 1 192 ? 13.047  6.766   -64.941 1.00 28.27  ? 170  PRO B CB  1 
ATOM   4798 C  CG  . PRO B 1 192 ? 11.914  7.488   -65.611 1.00 28.25  ? 170  PRO B CG  1 
ATOM   4799 C  CD  . PRO B 1 192 ? 10.711  7.096   -64.796 1.00 27.29  ? 170  PRO B CD  1 
ATOM   4800 N  N   . GLU B 1 193 ? 14.134  4.049   -63.520 1.00 27.47  ? 171  GLU B N   1 
ATOM   4801 C  CA  . GLU B 1 193 ? 14.864  3.403   -62.428 1.00 28.26  ? 171  GLU B CA  1 
ATOM   4802 C  C   . GLU B 1 193 ? 15.497  4.348   -61.406 1.00 28.34  ? 171  GLU B C   1 
ATOM   4803 O  O   . GLU B 1 193 ? 15.651  3.972   -60.251 1.00 27.71  ? 171  GLU B O   1 
ATOM   4804 C  CB  . GLU B 1 193 ? 15.941  2.466   -62.970 1.00 30.32  ? 171  GLU B CB  1 
ATOM   4805 C  CG  . GLU B 1 193 ? 15.377  1.170   -63.527 1.00 30.77  ? 171  GLU B CG  1 
ATOM   4806 C  CD  . GLU B 1 193 ? 16.357  0.366   -64.364 1.00 31.88  ? 171  GLU B CD  1 
ATOM   4807 O  OE1 . GLU B 1 193 ? 17.434  0.867   -64.779 1.00 32.00  ? 171  GLU B OE1 1 
ATOM   4808 O  OE2 . GLU B 1 193 ? 16.058  -0.826  -64.562 1.00 32.68  ? 171  GLU B OE2 1 
ATOM   4809 N  N   . LYS B 1 194 ? 15.850  5.560   -61.795 1.00 29.01  ? 172  LYS B N   1 
ATOM   4810 C  CA  . LYS B 1 194 ? 16.468  6.476   -60.840 1.00 31.07  ? 172  LYS B CA  1 
ATOM   4811 C  C   . LYS B 1 194 ? 15.492  6.914   -59.734 1.00 28.96  ? 172  LYS B C   1 
ATOM   4812 O  O   . LYS B 1 194 ? 15.935  7.343   -58.701 1.00 27.29  ? 172  LYS B O   1 
ATOM   4813 C  CB  . LYS B 1 194 ? 17.054  7.723   -61.530 1.00 32.39  ? 172  LYS B CB  1 
ATOM   4814 C  CG  . LYS B 1 194 ? 16.080  8.844   -61.855 1.00 34.92  ? 172  LYS B CG  1 
ATOM   4815 C  CD  . LYS B 1 194 ? 16.797  10.071  -62.399 1.00 37.31  ? 172  LYS B CD  1 
ATOM   4816 C  CE  . LYS B 1 194 ? 16.309  11.374  -61.799 1.00 38.53  ? 172  LYS B CE  1 
ATOM   4817 N  NZ  . LYS B 1 194 ? 16.891  12.586  -62.469 1.00 37.82  ? 172  LYS B NZ  1 
ATOM   4818 N  N   . MET B 1 195 ? 14.185  6.838   -59.963 1.00 26.90  ? 173  MET B N   1 
ATOM   4819 C  CA  . MET B 1 195 ? 13.235  7.402   -59.003 1.00 27.56  ? 173  MET B CA  1 
ATOM   4820 C  C   . MET B 1 195 ? 13.271  6.656   -57.670 1.00 26.29  ? 173  MET B C   1 
ATOM   4821 O  O   . MET B 1 195 ? 13.622  5.463   -57.624 1.00 25.22  ? 173  MET B O   1 
ATOM   4822 C  CB  . MET B 1 195 ? 11.822  7.512   -59.571 1.00 26.96  ? 173  MET B CB  1 
ATOM   4823 C  CG  . MET B 1 195 ? 11.766  8.239   -60.913 1.00 29.07  ? 173  MET B CG  1 
ATOM   4824 S  SD  . MET B 1 195 ? 12.585  9.852   -60.949 1.00 32.93  ? 173  MET B SD  1 
ATOM   4825 C  CE  . MET B 1 195 ? 12.730  10.004  -62.748 1.00 35.04  ? 173  MET B CE  1 
ATOM   4826 N  N   . SER B 1 196 ? 12.938  7.377   -56.584 1.00 25.38  ? 174  SER B N   1 
ATOM   4827 C  CA  . SER B 1 196 ? 13.199  6.885   -55.234 1.00 25.49  ? 174  SER B CA  1 
ATOM   4828 C  C   . SER B 1 196 ? 12.371  5.667   -54.850 1.00 25.61  ? 174  SER B C   1 
ATOM   4829 O  O   . SER B 1 196 ? 11.226  5.508   -55.287 1.00 25.72  ? 174  SER B O   1 
ATOM   4830 C  CB  . SER B 1 196 ? 12.956  7.979   -54.201 1.00 26.00  ? 174  SER B CB  1 
ATOM   4831 O  OG  . SER B 1 196 ? 11.565  8.244   -54.092 1.00 26.13  ? 174  SER B OG  1 
ATOM   4832 N  N   . SER B 1 197 ? 12.932  4.824   -53.990 1.00 24.57  ? 175  SER B N   1 
ATOM   4833 C  CA  . SER B 1 197 ? 12.181  3.689   -53.493 1.00 26.09  ? 175  SER B CA  1 
ATOM   4834 C  C   . SER B 1 197 ? 10.991  4.145   -52.595 1.00 27.04  ? 175  SER B C   1 
ATOM   4835 O  O   . SER B 1 197 ? 9.987   3.435   -52.483 1.00 26.30  ? 175  SER B O   1 
ATOM   4836 C  CB  . SER B 1 197 ? 13.121  2.703   -52.827 1.00 29.71  ? 175  SER B CB  1 
ATOM   4837 O  OG  . SER B 1 197 ? 13.569  3.217   -51.611 1.00 33.32  ? 175  SER B OG  1 
ATOM   4838 N  N   . GLU B 1 198 ? 11.055  5.366   -52.049 1.00 24.62  ? 176  GLU B N   1 
ATOM   4839 C  CA  . GLU B 1 198 ? 9.973   5.893   -51.240 1.00 25.31  ? 176  GLU B CA  1 
ATOM   4840 C  C   . GLU B 1 198 ? 8.738   6.087   -52.118 1.00 25.33  ? 176  GLU B C   1 
ATOM   4841 O  O   . GLU B 1 198 ? 7.603   5.897   -51.671 1.00 26.35  ? 176  GLU B O   1 
ATOM   4842 C  CB  . GLU B 1 198 ? 10.377  7.207   -50.564 1.00 25.16  ? 176  GLU B CB  1 
ATOM   4843 C  CG  . GLU B 1 198 ? 11.328  7.006   -49.385 1.00 24.32  ? 176  GLU B CG  1 
ATOM   4844 C  CD  . GLU B 1 198 ? 12.801  6.956   -49.758 1.00 27.01  ? 176  GLU B CD  1 
ATOM   4845 O  OE1 . GLU B 1 198 ? 13.122  6.942   -50.980 1.00 27.16  ? 176  GLU B OE1 1 
ATOM   4846 O  OE2 . GLU B 1 198 ? 13.645  6.878   -48.808 1.00 26.78  ? 176  GLU B OE2 1 
ATOM   4847 N  N   . LYS B 1 199 ? 8.958   6.462   -53.365 1.00 26.13  ? 177  LYS B N   1 
ATOM   4848 C  CA  . LYS B 1 199 ? 7.847   6.552   -54.330 1.00 27.14  ? 177  LYS B CA  1 
ATOM   4849 C  C   . LYS B 1 199 ? 7.231   5.166   -54.570 1.00 27.61  ? 177  LYS B C   1 
ATOM   4850 O  O   . LYS B 1 199 ? 6.012   5.033   -54.580 1.00 29.99  ? 177  LYS B O   1 
ATOM   4851 C  CB  . LYS B 1 199 ? 8.289   7.208   -55.636 1.00 26.75  ? 177  LYS B CB  1 
ATOM   4852 C  CG  . LYS B 1 199 ? 8.516   8.709   -55.551 1.00 27.67  ? 177  LYS B CG  1 
ATOM   4853 C  CD  . LYS B 1 199 ? 9.411   9.187   -56.691 1.00 28.81  ? 177  LYS B CD  1 
ATOM   4854 C  CE  . LYS B 1 199 ? 9.404   10.700  -56.855 1.00 30.17  ? 177  LYS B CE  1 
ATOM   4855 N  NZ  . LYS B 1 199 ? 10.337  11.106  -57.945 1.00 29.11  ? 177  LYS B NZ  1 
ATOM   4856 N  N   . VAL B 1 200 ? 8.064   4.138   -54.717 1.00 27.69  ? 178  VAL B N   1 
ATOM   4857 C  CA  . VAL B 1 200 ? 7.578   2.789   -54.955 1.00 27.07  ? 178  VAL B CA  1 
ATOM   4858 C  C   . VAL B 1 200 ? 6.745   2.332   -53.760 1.00 28.14  ? 178  VAL B C   1 
ATOM   4859 O  O   . VAL B 1 200 ? 5.665   1.777   -53.951 1.00 27.95  ? 178  VAL B O   1 
ATOM   4860 C  CB  . VAL B 1 200 ? 8.741   1.802   -55.183 1.00 28.56  ? 178  VAL B CB  1 
ATOM   4861 C  CG1 . VAL B 1 200 ? 8.262   0.357   -55.183 1.00 29.66  ? 178  VAL B CG1 1 
ATOM   4862 C  CG2 . VAL B 1 200 ? 9.445   2.121   -56.501 1.00 29.32  ? 178  VAL B CG2 1 
ATOM   4863 N  N   . ASP B 1 201 ? 7.262   2.553   -52.554 1.00 25.93  ? 179  ASP B N   1 
ATOM   4864 C  CA  . ASP B 1 201 ? 6.590   2.158   -51.316 1.00 28.30  ? 179  ASP B CA  1 
ATOM   4865 C  C   . ASP B 1 201 ? 5.128   2.702   -51.238 1.00 27.01  ? 179  ASP B C   1 
ATOM   4866 O  O   . ASP B 1 201 ? 4.213   1.996   -50.855 1.00 28.03  ? 179  ASP B O   1 
ATOM   4867 C  CB  . ASP B 1 201 ? 7.327   2.753   -50.119 1.00 30.54  ? 179  ASP B CB  1 
ATOM   4868 C  CG  . ASP B 1 201 ? 8.720   2.145   -49.845 1.00 36.02  ? 179  ASP B CG  1 
ATOM   4869 O  OD1 . ASP B 1 201 ? 8.968   0.964   -50.160 1.00 35.10  ? 179  ASP B OD1 1 
ATOM   4870 O  OD2 . ASP B 1 201 ? 9.535   2.893   -49.221 1.00 40.84  ? 179  ASP B OD2 1 
ATOM   4871 N  N   . VAL B 1 202 ? 4.950   3.980   -51.551 1.00 25.81  ? 180  VAL B N   1 
ATOM   4872 C  CA  . VAL B 1 202 ? 3.645   4.634   -51.493 1.00 26.79  ? 180  VAL B CA  1 
ATOM   4873 C  C   . VAL B 1 202 ? 2.770   4.135   -52.635 1.00 26.35  ? 180  VAL B C   1 
ATOM   4874 O  O   . VAL B 1 202 ? 1.597   3.832   -52.435 1.00 26.70  ? 180  VAL B O   1 
ATOM   4875 C  CB  . VAL B 1 202 ? 3.785   6.183   -51.557 1.00 27.89  ? 180  VAL B CB  1 
ATOM   4876 C  CG1 . VAL B 1 202 ? 2.446   6.865   -51.765 1.00 28.98  ? 180  VAL B CG1 1 
ATOM   4877 C  CG2 . VAL B 1 202 ? 4.418   6.709   -50.274 1.00 29.28  ? 180  VAL B CG2 1 
ATOM   4878 N  N   . LEU B 1 203 ? 3.347   4.015   -53.824 1.00 25.51  ? 181  LEU B N   1 
ATOM   4879 C  CA  . LEU B 1 203 ? 2.610   3.471   -54.963 1.00 28.18  ? 181  LEU B CA  1 
ATOM   4880 C  C   . LEU B 1 203 ? 2.063   2.062   -54.675 1.00 27.42  ? 181  LEU B C   1 
ATOM   4881 O  O   . LEU B 1 203 ? 0.886   1.777   -54.971 1.00 28.03  ? 181  LEU B O   1 
ATOM   4882 C  CB  . LEU B 1 203 ? 3.483   3.466   -56.236 1.00 28.28  ? 181  LEU B CB  1 
ATOM   4883 C  CG  . LEU B 1 203 ? 3.710   4.823   -56.895 1.00 29.14  ? 181  LEU B CG  1 
ATOM   4884 C  CD1 . LEU B 1 203 ? 4.850   4.730   -57.916 1.00 29.97  ? 181  LEU B CD1 1 
ATOM   4885 C  CD2 . LEU B 1 203 ? 2.439   5.297   -57.575 1.00 30.19  ? 181  LEU B CD2 1 
ATOM   4886 N  N   . ARG B 1 204 ? 2.885   1.198   -54.087 1.00 25.76  ? 182  ARG B N   1 
ATOM   4887 C  CA  . ARG B 1 204 ? 2.450   -0.159  -53.756 1.00 29.23  ? 182  ARG B CA  1 
ATOM   4888 C  C   . ARG B 1 204 ? 1.302   -0.115  -52.740 1.00 28.97  ? 182  ARG B C   1 
ATOM   4889 O  O   . ARG B 1 204 ? 0.303   -0.796  -52.910 1.00 28.62  ? 182  ARG B O   1 
ATOM   4890 C  CB  . ARG B 1 204 ? 3.569   -0.961  -53.108 1.00 32.40  ? 182  ARG B CB  1 
ATOM   4891 C  CG  . ARG B 1 204 ? 4.670   -1.434  -54.013 1.00 35.06  ? 182  ARG B CG  1 
ATOM   4892 C  CD  . ARG B 1 204 ? 5.783   -2.097  -53.171 1.00 36.85  ? 182  ARG B CD  1 
ATOM   4893 N  NE  . ARG B 1 204 ? 6.705   -2.834  -54.038 1.00 39.28  ? 182  ARG B NE  1 
ATOM   4894 C  CZ  . ARG B 1 204 ? 7.996   -3.060  -53.784 1.00 42.69  ? 182  ARG B CZ  1 
ATOM   4895 N  NH1 . ARG B 1 204 ? 8.563   -2.612  -52.661 1.00 42.99  ? 182  ARG B NH1 1 
ATOM   4896 N  NH2 . ARG B 1 204 ? 8.725   -3.773  -54.653 1.00 43.51  ? 182  ARG B NH2 1 
ATOM   4897 N  N   . ALA B 1 205 ? 1.459   0.713   -51.701 1.00 28.93  ? 183  ALA B N   1 
ATOM   4898 C  CA  . ALA B 1 205 ? 0.472   0.798   -50.638 1.00 30.28  ? 183  ALA B CA  1 
ATOM   4899 C  C   . ALA B 1 205 ? -0.864  1.312   -51.185 1.00 30.31  ? 183  ALA B C   1 
ATOM   4900 O  O   . ALA B 1 205 ? -1.906  0.938   -50.680 1.00 31.10  ? 183  ALA B O   1 
ATOM   4901 C  CB  . ALA B 1 205 ? 0.963   1.696   -49.514 1.00 29.29  ? 183  ALA B CB  1 
ATOM   4902 N  N   . LEU B 1 206 ? -0.808  2.169   -52.198 1.00 29.85  ? 184  LEU B N   1 
ATOM   4903 C  CA  . LEU B 1 206 ? -2.003  2.648   -52.871 1.00 31.62  ? 184  LEU B CA  1 
ATOM   4904 C  C   . LEU B 1 206 ? -2.586  1.641   -53.866 1.00 31.81  ? 184  LEU B C   1 
ATOM   4905 O  O   . LEU B 1 206 ? -3.655  1.885   -54.416 1.00 36.21  ? 184  LEU B O   1 
ATOM   4906 C  CB  . LEU B 1 206 ? -1.764  3.993   -53.557 1.00 31.31  ? 184  LEU B CB  1 
ATOM   4907 C  CG  . LEU B 1 206 ? -1.511  5.213   -52.672 1.00 30.68  ? 184  LEU B CG  1 
ATOM   4908 C  CD1 . LEU B 1 206 ? -0.916  6.356   -53.473 1.00 30.82  ? 184  LEU B CD1 1 
ATOM   4909 C  CD2 . LEU B 1 206 ? -2.774  5.672   -51.967 1.00 32.64  ? 184  LEU B CD2 1 
ATOM   4910 N  N   . GLY B 1 207 ? -1.920  0.520   -54.082 1.00 31.86  ? 185  GLY B N   1 
ATOM   4911 C  CA  . GLY B 1 207 ? -2.439  -0.542  -54.940 1.00 32.28  ? 185  GLY B CA  1 
ATOM   4912 C  C   . GLY B 1 207 ? -2.075  -0.352  -56.408 1.00 31.81  ? 185  GLY B C   1 
ATOM   4913 O  O   . GLY B 1 207 ? -2.662  -0.967  -57.257 1.00 31.70  ? 185  GLY B O   1 
ATOM   4914 N  N   . ALA B 1 208 ? -1.116  0.512   -56.720 1.00 30.05  ? 186  ALA B N   1 
ATOM   4915 C  CA  . ALA B 1 208 ? -0.673  0.654   -58.087 1.00 31.16  ? 186  ALA B CA  1 
ATOM   4916 C  C   . ALA B 1 208 ? 0.217   -0.512  -58.483 1.00 32.14  ? 186  ALA B C   1 
ATOM   4917 O  O   . ALA B 1 208 ? 0.927   -1.060  -57.651 1.00 32.47  ? 186  ALA B O   1 
ATOM   4918 C  CB  . ALA B 1 208 ? 0.081   1.949   -58.283 1.00 30.94  ? 186  ALA B CB  1 
ATOM   4919 N  N   . GLU B 1 209 ? 0.166   -0.882  -59.754 1.00 31.76  ? 187  GLU B N   1 
ATOM   4920 C  CA  . GLU B 1 209 ? 1.125   -1.838  -60.314 1.00 34.35  ? 187  GLU B CA  1 
ATOM   4921 C  C   . GLU B 1 209 ? 2.251   -0.981  -60.857 1.00 33.61  ? 187  GLU B C   1 
ATOM   4922 O  O   . GLU B 1 209 ? 2.007   0.149   -61.287 1.00 33.42  ? 187  GLU B O   1 
ATOM   4923 C  CB  . GLU B 1 209 ? 0.499   -2.675  -61.428 1.00 35.73  ? 187  GLU B CB  1 
ATOM   4924 C  CG  . GLU B 1 209 ? -0.587  -3.594  -60.906 1.00 38.29  ? 187  GLU B CG  1 
ATOM   4925 C  CD  . GLU B 1 209 ? -1.498  -4.123  -61.981 1.00 41.29  ? 187  GLU B CD  1 
ATOM   4926 O  OE1 . GLU B 1 209 ? -1.005  -4.616  -63.009 1.00 42.41  ? 187  GLU B OE1 1 
ATOM   4927 O  OE2 . GLU B 1 209 ? -2.729  -4.044  -61.804 1.00 43.33  ? 187  GLU B OE2 1 
ATOM   4928 N  N   . ILE B 1 210 ? 3.476   -1.493  -60.802 1.00 31.80  ? 188  ILE B N   1 
ATOM   4929 C  CA  . ILE B 1 210 ? 4.649   -0.651  -61.083 1.00 31.29  ? 188  ILE B CA  1 
ATOM   4930 C  C   . ILE B 1 210 ? 5.577   -1.345  -62.063 1.00 30.50  ? 188  ILE B C   1 
ATOM   4931 O  O   . ILE B 1 210 ? 5.979   -2.476  -61.846 1.00 31.77  ? 188  ILE B O   1 
ATOM   4932 C  CB  . ILE B 1 210 ? 5.439   -0.317  -59.812 1.00 31.28  ? 188  ILE B CB  1 
ATOM   4933 C  CG1 . ILE B 1 210 ? 4.567   0.474   -58.816 1.00 32.16  ? 188  ILE B CG1 1 
ATOM   4934 C  CG2 . ILE B 1 210 ? 6.678   0.508   -60.137 1.00 31.43  ? 188  ILE B CG2 1 
ATOM   4935 C  CD1 . ILE B 1 210 ? 4.843   0.080   -57.396 1.00 33.87  ? 188  ILE B CD1 1 
ATOM   4936 N  N   . VAL B 1 211 ? 5.917   -0.631  -63.123 1.00 29.27  ? 189  VAL B N   1 
ATOM   4937 C  CA  . VAL B 1 211 ? 6.926   -1.065  -64.079 1.00 29.78  ? 189  VAL B CA  1 
ATOM   4938 C  C   . VAL B 1 211 ? 8.037   -0.019  -64.102 1.00 28.45  ? 189  VAL B C   1 
ATOM   4939 O  O   . VAL B 1 211 ? 7.758   1.179   -64.002 1.00 27.88  ? 189  VAL B O   1 
ATOM   4940 C  CB  . VAL B 1 211 ? 6.317   -1.175  -65.493 1.00 30.36  ? 189  VAL B CB  1 
ATOM   4941 C  CG1 . VAL B 1 211 ? 7.380   -1.489  -66.528 1.00 32.22  ? 189  VAL B CG1 1 
ATOM   4942 C  CG2 . VAL B 1 211 ? 5.204   -2.207  -65.482 1.00 32.26  ? 189  VAL B CG2 1 
ATOM   4943 N  N   . ARG B 1 212 ? 9.272   -0.464  -64.291 1.00 27.81  ? 190  ARG B N   1 
ATOM   4944 C  CA  . ARG B 1 212 ? 10.435  0.451   -64.329 1.00 27.82  ? 190  ARG B CA  1 
ATOM   4945 C  C   . ARG B 1 212 ? 11.161  0.402   -65.661 1.00 28.18  ? 190  ARG B C   1 
ATOM   4946 O  O   . ARG B 1 212 ? 11.202  -0.648  -66.312 1.00 28.88  ? 190  ARG B O   1 
ATOM   4947 C  CB  . ARG B 1 212 ? 11.428  0.073   -63.229 1.00 27.50  ? 190  ARG B CB  1 
ATOM   4948 C  CG  . ARG B 1 212 ? 10.857  -0.024  -61.812 1.00 26.75  ? 190  ARG B CG  1 
ATOM   4949 C  CD  . ARG B 1 212 ? 10.126  1.227   -61.348 1.00 26.27  ? 190  ARG B CD  1 
ATOM   4950 N  NE  . ARG B 1 212 ? 11.017  2.365   -61.064 1.00 25.89  ? 190  ARG B NE  1 
ATOM   4951 C  CZ  . ARG B 1 212 ? 11.659  2.553   -59.909 1.00 25.71  ? 190  ARG B CZ  1 
ATOM   4952 N  NH1 . ARG B 1 212 ? 11.579  1.661   -58.914 1.00 26.09  ? 190  ARG B NH1 1 
ATOM   4953 N  NH2 . ARG B 1 212 ? 12.427  3.626   -59.767 1.00 25.79  ? 190  ARG B NH2 1 
ATOM   4954 N  N   . THR B 1 213 ? 11.784  1.525   -66.027 1.00 27.93  ? 191  THR B N   1 
ATOM   4955 C  CA  . THR B 1 213 ? 12.503  1.650   -67.279 1.00 28.15  ? 191  THR B CA  1 
ATOM   4956 C  C   . THR B 1 213 ? 13.915  2.225   -67.065 1.00 28.73  ? 191  THR B C   1 
ATOM   4957 O  O   . THR B 1 213 ? 14.161  2.966   -66.117 1.00 28.00  ? 191  THR B O   1 
ATOM   4958 C  CB  . THR B 1 213 ? 11.697  2.545   -68.240 1.00 28.51  ? 191  THR B CB  1 
ATOM   4959 O  OG1 . THR B 1 213 ? 11.378  3.771   -67.603 1.00 28.01  ? 191  THR B OG1 1 
ATOM   4960 C  CG2 . THR B 1 213 ? 10.393  1.860   -68.632 1.00 29.04  ? 191  THR B CG2 1 
ATOM   4961 N  N   . PRO B 1 214 ? 14.857  1.872   -67.933 1.00 30.06  ? 192  PRO B N   1 
ATOM   4962 C  CA  . PRO B 1 214 ? 16.212  2.359   -67.702 1.00 31.12  ? 192  PRO B CA  1 
ATOM   4963 C  C   . PRO B 1 214 ? 16.237  3.893   -67.753 1.00 32.17  ? 192  PRO B C   1 
ATOM   4964 O  O   . PRO B 1 214 ? 15.644  4.514   -68.656 1.00 30.71  ? 192  PRO B O   1 
ATOM   4965 C  CB  . PRO B 1 214 ? 17.011  1.771   -68.857 1.00 32.36  ? 192  PRO B CB  1 
ATOM   4966 C  CG  . PRO B 1 214 ? 16.168  0.668   -69.408 1.00 32.89  ? 192  PRO B CG  1 
ATOM   4967 C  CD  . PRO B 1 214 ? 14.760  1.108   -69.183 1.00 31.19  ? 192  PRO B CD  1 
ATOM   4968 N  N   . THR B 1 215 ? 16.906  4.483   -66.771 1.00 31.37  ? 193  THR B N   1 
ATOM   4969 C  CA  . THR B 1 215 ? 17.006  5.939   -66.665 1.00 31.72  ? 193  THR B CA  1 
ATOM   4970 C  C   . THR B 1 215 ? 17.561  6.617   -67.913 1.00 32.32  ? 193  THR B C   1 
ATOM   4971 O  O   . THR B 1 215 ? 17.069  7.651   -68.317 1.00 32.53  ? 193  THR B O   1 
ATOM   4972 C  CB  . THR B 1 215 ? 17.890  6.307   -65.454 1.00 31.58  ? 193  THR B CB  1 
ATOM   4973 O  OG1 . THR B 1 215 ? 17.261  5.784   -64.280 1.00 30.26  ? 193  THR B OG1 1 
ATOM   4974 C  CG2 . THR B 1 215 ? 17.992  7.845   -65.310 1.00 33.13  ? 193  THR B CG2 1 
ATOM   4975 N  N   . ASN B 1 216 ? 18.558  6.009   -68.527 1.00 32.79  ? 194  ASN B N   1 
ATOM   4976 C  CA  A ASN B 1 216 ? 19.231  6.546   -69.696 0.50 34.96  ? 194  ASN B CA  1 
ATOM   4977 C  CA  B ASN B 1 216 ? 19.183  6.612   -69.693 0.50 35.58  ? 194  ASN B CA  1 
ATOM   4978 C  C   . ASN B 1 216 ? 18.584  6.150   -71.034 1.00 36.76  ? 194  ASN B C   1 
ATOM   4979 O  O   . ASN B 1 216 ? 19.173  6.343   -72.072 1.00 37.56  ? 194  ASN B O   1 
ATOM   4980 C  CB  A ASN B 1 216 ? 20.730  6.146   -69.699 0.50 35.81  ? 194  ASN B CB  1 
ATOM   4981 C  CB  B ASN B 1 216 ? 20.697  6.388   -69.649 0.50 37.26  ? 194  ASN B CB  1 
ATOM   4982 C  CG  A ASN B 1 216 ? 20.976  4.667   -69.364 0.50 35.90  ? 194  ASN B CG  1 
ATOM   4983 C  CG  B ASN B 1 216 ? 21.320  6.953   -68.383 0.50 38.18  ? 194  ASN B CG  1 
ATOM   4984 O  OD1 A ASN B 1 216 ? 20.164  3.992   -68.722 0.50 35.84  ? 194  ASN B OD1 1 
ATOM   4985 O  OD1 B ASN B 1 216 ? 20.844  7.954   -67.835 0.50 37.55  ? 194  ASN B OD1 1 
ATOM   4986 N  ND2 A ASN B 1 216 ? 22.130  4.187   -69.748 0.50 37.28  ? 194  ASN B ND2 1 
ATOM   4987 N  ND2 B ASN B 1 216 ? 22.379  6.315   -67.910 0.50 40.07  ? 194  ASN B ND2 1 
ATOM   4988 N  N   . ALA B 1 217 ? 17.387  5.567   -71.008 1.00 35.81  ? 195  ALA B N   1 
ATOM   4989 C  CA  . ALA B 1 217 ? 16.701  5.217   -72.263 1.00 36.31  ? 195  ALA B CA  1 
ATOM   4990 C  C   . ALA B 1 217 ? 16.261  6.506   -72.969 1.00 36.31  ? 195  ALA B C   1 
ATOM   4991 O  O   . ALA B 1 217 ? 15.595  7.343   -72.390 1.00 35.38  ? 195  ALA B O   1 
ATOM   4992 C  CB  . ALA B 1 217 ? 15.500  4.336   -71.984 1.00 35.68  ? 195  ALA B CB  1 
ATOM   4993 N  N   . ARG B 1 218 ? 16.642  6.683   -74.214 1.00 37.53  ? 196  ARG B N   1 
ATOM   4994 C  CA  . ARG B 1 218 ? 16.122  7.838   -74.968 1.00 39.17  ? 196  ARG B CA  1 
ATOM   4995 C  C   . ARG B 1 218 ? 14.596  7.735   -75.063 1.00 38.43  ? 196  ARG B C   1 
ATOM   4996 O  O   . ARG B 1 218 ? 14.041  6.638   -75.151 1.00 36.79  ? 196  ARG B O   1 
ATOM   4997 C  CB  . ARG B 1 218 ? 16.803  7.956   -76.319 1.00 42.45  ? 196  ARG B CB  1 
ATOM   4998 C  CG  . ARG B 1 218 ? 18.247  8.405   -76.154 1.00 44.46  ? 196  ARG B CG  1 
ATOM   4999 C  CD  . ARG B 1 218 ? 18.931  8.757   -77.446 1.00 48.02  ? 196  ARG B CD  1 
ATOM   5000 N  NE  . ARG B 1 218 ? 18.127  9.636   -78.284 1.00 51.30  ? 196  ARG B NE  1 
ATOM   5001 C  CZ  . ARG B 1 218 ? 17.973  10.951  -78.133 1.00 54.02  ? 196  ARG B CZ  1 
ATOM   5002 N  NH1 . ARG B 1 218 ? 18.559  11.621  -77.155 1.00 56.43  ? 196  ARG B NH1 1 
ATOM   5003 N  NH2 . ARG B 1 218 ? 17.199  11.604  -78.977 1.00 56.73  ? 196  ARG B NH2 1 
ATOM   5004 N  N   . PHE B 1 219 ? 13.927  8.883   -74.972 1.00 38.75  ? 197  PHE B N   1 
ATOM   5005 C  CA  . PHE B 1 219 ? 12.453  8.944   -74.838 1.00 38.57  ? 197  PHE B CA  1 
ATOM   5006 C  C   . PHE B 1 219 ? 11.695  8.245   -75.980 1.00 39.34  ? 197  PHE B C   1 
ATOM   5007 O  O   . PHE B 1 219 ? 10.576  7.766   -75.786 1.00 38.70  ? 197  PHE B O   1 
ATOM   5008 C  CB  . PHE B 1 219 ? 11.978  10.400  -74.761 1.00 39.27  ? 197  PHE B CB  1 
ATOM   5009 C  CG  . PHE B 1 219 ? 12.062  11.144  -76.076 1.00 41.74  ? 197  PHE B CG  1 
ATOM   5010 C  CD1 . PHE B 1 219 ? 13.280  11.638  -76.552 1.00 42.89  ? 197  PHE B CD1 1 
ATOM   5011 C  CD2 . PHE B 1 219 ? 10.916  11.350  -76.848 1.00 44.32  ? 197  PHE B CD2 1 
ATOM   5012 C  CE1 . PHE B 1 219 ? 13.359  12.319  -77.770 1.00 45.88  ? 197  PHE B CE1 1 
ATOM   5013 C  CE2 . PHE B 1 219 ? 10.990  12.039  -78.061 1.00 46.55  ? 197  PHE B CE2 1 
ATOM   5014 C  CZ  . PHE B 1 219 ? 12.215  12.521  -78.525 1.00 47.07  ? 197  PHE B CZ  1 
ATOM   5015 N  N   . ASP B 1 220 ? 12.296  8.221   -77.163 1.00 39.92  ? 198  ASP B N   1 
ATOM   5016 C  CA  . ASP B 1 220 ? 11.683  7.579   -78.322 1.00 41.49  ? 198  ASP B CA  1 
ATOM   5017 C  C   . ASP B 1 220 ? 12.130  6.130   -78.539 1.00 40.41  ? 198  ASP B C   1 
ATOM   5018 O  O   . ASP B 1 220 ? 11.795  5.527   -79.553 1.00 40.68  ? 198  ASP B O   1 
ATOM   5019 C  CB  . ASP B 1 220 ? 11.931  8.418   -79.573 1.00 44.94  ? 198  ASP B CB  1 
ATOM   5020 C  CG  . ASP B 1 220 ? 13.403  8.553   -79.908 1.00 47.10  ? 198  ASP B CG  1 
ATOM   5021 O  OD1 . ASP B 1 220 ? 14.299  8.283   -79.072 1.00 47.86  ? 198  ASP B OD1 1 
ATOM   5022 O  OD2 . ASP B 1 220 ? 13.665  8.946   -81.025 1.00 48.54  ? 198  ASP B OD2 1 
ATOM   5023 N  N   . SER B 1 221 ? 12.864  5.563   -77.586 1.00 38.44  ? 199  SER B N   1 
ATOM   5024 C  CA  . SER B 1 221 ? 13.220  4.152   -77.641 1.00 38.42  ? 199  SER B CA  1 
ATOM   5025 C  C   . SER B 1 221 ? 12.055  3.339   -77.052 1.00 37.14  ? 199  SER B C   1 
ATOM   5026 O  O   . SER B 1 221 ? 11.278  3.865   -76.290 1.00 36.94  ? 199  SER B O   1 
ATOM   5027 C  CB  . SER B 1 221 ? 14.534  3.866   -76.887 1.00 37.58  ? 199  SER B CB  1 
ATOM   5028 O  OG  . SER B 1 221 ? 14.354  3.849   -75.468 1.00 36.29  ? 199  SER B OG  1 
ATOM   5029 N  N   . PRO B 1 222 ? 11.935  2.057   -77.425 1.00 37.99  ? 200  PRO B N   1 
ATOM   5030 C  CA  . PRO B 1 222 ? 10.863  1.208   -76.902 1.00 37.88  ? 200  PRO B CA  1 
ATOM   5031 C  C   . PRO B 1 222 ? 10.884  1.035   -75.410 1.00 37.03  ? 200  PRO B C   1 
ATOM   5032 O  O   . PRO B 1 222 ? 9.855   0.735   -74.826 1.00 38.91  ? 200  PRO B O   1 
ATOM   5033 C  CB  . PRO B 1 222 ? 11.145  -0.163  -77.556 1.00 38.47  ? 200  PRO B CB  1 
ATOM   5034 C  CG  . PRO B 1 222 ? 11.897  0.153   -78.794 1.00 39.90  ? 200  PRO B CG  1 
ATOM   5035 C  CD  . PRO B 1 222 ? 12.716  1.376   -78.478 1.00 39.12  ? 200  PRO B CD  1 
ATOM   5036 N  N   . GLU B 1 223 ? 12.040  1.202   -74.783 1.00 37.47  ? 201  GLU B N   1 
ATOM   5037 C  CA  . GLU B 1 223 ? 12.140  0.959   -73.339 1.00 37.18  ? 201  GLU B CA  1 
ATOM   5038 C  C   . GLU B 1 223 ? 12.083  2.196   -72.461 1.00 35.29  ? 201  GLU B C   1 
ATOM   5039 O  O   . GLU B 1 223 ? 12.280  2.111   -71.244 1.00 34.01  ? 201  GLU B O   1 
ATOM   5040 C  CB  . GLU B 1 223 ? 13.378  0.136   -73.025 1.00 38.79  ? 201  GLU B CB  1 
ATOM   5041 C  CG  . GLU B 1 223 ? 14.674  0.765   -73.441 1.00 41.55  ? 201  GLU B CG  1 
ATOM   5042 C  CD  . GLU B 1 223 ? 15.123  0.436   -74.862 1.00 43.68  ? 201  GLU B CD  1 
ATOM   5043 O  OE1 . GLU B 1 223 ? 14.396  -0.169  -75.677 1.00 44.76  ? 201  GLU B OE1 1 
ATOM   5044 O  OE2 . GLU B 1 223 ? 16.253  0.806   -75.171 1.00 46.20  ? 201  GLU B OE2 1 
ATOM   5045 N  N   . SER B 1 224 ? 11.793  3.352   -73.035 1.00 35.07  ? 202  SER B N   1 
ATOM   5046 C  CA  . SER B 1 224 ? 11.572  4.528   -72.210 1.00 33.94  ? 202  SER B CA  1 
ATOM   5047 C  C   . SER B 1 224 ? 10.283  4.369   -71.420 1.00 33.25  ? 202  SER B C   1 
ATOM   5048 O  O   . SER B 1 224 ? 9.439   3.544   -71.752 1.00 33.08  ? 202  SER B O   1 
ATOM   5049 C  CB  . SER B 1 224 ? 11.488  5.801   -73.044 1.00 35.94  ? 202  SER B CB  1 
ATOM   5050 O  OG  . SER B 1 224 ? 10.307  5.840   -73.831 1.00 36.58  ? 202  SER B OG  1 
ATOM   5051 N  N   . HIS B 1 225 ? 10.127  5.174   -70.390 1.00 30.91  ? 203  HIS B N   1 
ATOM   5052 C  CA  . HIS B 1 225 ? 8.887   5.158   -69.623 1.00 32.90  ? 203  HIS B CA  1 
ATOM   5053 C  C   . HIS B 1 225 ? 7.654   5.465   -70.515 1.00 33.96  ? 203  HIS B C   1 
ATOM   5054 O  O   . HIS B 1 225 ? 6.626   4.798   -70.402 1.00 32.50  ? 203  HIS B O   1 
ATOM   5055 C  CB  . HIS B 1 225 ? 8.998   6.048   -68.374 1.00 32.56  ? 203  HIS B CB  1 
ATOM   5056 C  CG  . HIS B 1 225 ? 9.016   7.522   -68.654 1.00 33.14  ? 203  HIS B CG  1 
ATOM   5057 N  ND1 . HIS B 1 225 ? 9.870   8.106   -69.566 1.00 35.32  ? 203  HIS B ND1 1 
ATOM   5058 C  CD2 . HIS B 1 225 ? 8.298   8.532   -68.109 1.00 34.12  ? 203  HIS B CD2 1 
ATOM   5059 C  CE1 . HIS B 1 225 ? 9.659   9.412   -69.588 1.00 36.71  ? 203  HIS B CE1 1 
ATOM   5060 N  NE2 . HIS B 1 225 ? 8.709   9.695   -68.715 1.00 36.16  ? 203  HIS B NE2 1 
ATOM   5061 N  N   . VAL B 1 226 ? 7.797   6.408   -71.443 1.00 35.13  ? 204  VAL B N   1 
ATOM   5062 C  CA  . VAL B 1 226 ? 6.738   6.686   -72.409 1.00 38.50  ? 204  VAL B CA  1 
ATOM   5063 C  C   . VAL B 1 226 ? 6.497   5.509   -73.380 1.00 39.90  ? 204  VAL B C   1 
ATOM   5064 O  O   . VAL B 1 226 ? 5.354   5.156   -73.653 1.00 41.23  ? 204  VAL B O   1 
ATOM   5065 C  CB  . VAL B 1 226 ? 7.026   7.997   -73.181 1.00 40.53  ? 204  VAL B CB  1 
ATOM   5066 C  CG1 . VAL B 1 226 ? 6.028   8.191   -74.320 1.00 44.19  ? 204  VAL B CG1 1 
ATOM   5067 C  CG2 . VAL B 1 226 ? 6.968   9.187   -72.229 1.00 40.58  ? 204  VAL B CG2 1 
ATOM   5068 N  N   . GLY B 1 227 ? 7.568   4.926   -73.919 1.00 38.18  ? 205  GLY B N   1 
ATOM   5069 C  CA  . GLY B 1 227 ? 7.451   3.805   -74.851 1.00 38.81  ? 205  GLY B CA  1 
ATOM   5070 C  C   . GLY B 1 227 ? 6.802   2.592   -74.206 1.00 37.99  ? 205  GLY B C   1 
ATOM   5071 O  O   . GLY B 1 227 ? 5.926   1.956   -74.777 1.00 37.54  ? 205  GLY B O   1 
ATOM   5072 N  N   . VAL B 1 228 ? 7.210   2.287   -72.990 1.00 35.43  ? 206  VAL B N   1 
ATOM   5073 C  CA  . VAL B 1 228 ? 6.677   1.127   -72.298 1.00 35.40  ? 206  VAL B CA  1 
ATOM   5074 C  C   . VAL B 1 228 ? 5.215   1.363   -71.893 1.00 35.21  ? 206  VAL B C   1 
ATOM   5075 O  O   . VAL B 1 228 ? 4.393   0.444   -72.011 1.00 36.32  ? 206  VAL B O   1 
ATOM   5076 C  CB  . VAL B 1 228 ? 7.572   0.744   -71.114 1.00 34.38  ? 206  VAL B CB  1 
ATOM   5077 C  CG1 . VAL B 1 228 ? 6.865   -0.216  -70.165 1.00 34.27  ? 206  VAL B CG1 1 
ATOM   5078 C  CG2 . VAL B 1 228 ? 8.859   0.126   -71.645 1.00 35.21  ? 206  VAL B CG2 1 
ATOM   5079 N  N   . ALA B 1 229 ? 4.863   2.582   -71.484 1.00 34.17  ? 207  ALA B N   1 
ATOM   5080 C  CA  . ALA B 1 229 ? 3.454   2.866   -71.187 1.00 35.19  ? 207  ALA B CA  1 
ATOM   5081 C  C   . ALA B 1 229 ? 2.547   2.582   -72.416 1.00 38.27  ? 207  ALA B C   1 
ATOM   5082 O  O   . ALA B 1 229 ? 1.527   1.916   -72.287 1.00 37.87  ? 207  ALA B O   1 
ATOM   5083 C  CB  . ALA B 1 229 ? 3.268   4.281   -70.694 1.00 34.55  ? 207  ALA B CB  1 
ATOM   5084 N  N   . TRP B 1 230 ? 2.946   3.063   -73.589 1.00 39.63  ? 208  TRP B N   1 
ATOM   5085 C  CA  A TRP B 1 230 ? 2.151   2.861   -74.794 0.50 42.20  ? 208  TRP B CA  1 
ATOM   5086 C  CA  B TRP B 1 230 ? 2.184   2.863   -74.834 0.50 42.85  ? 208  TRP B CA  1 
ATOM   5087 C  C   . TRP B 1 230 ? 2.089   1.380   -75.175 1.00 43.05  ? 208  TRP B C   1 
ATOM   5088 O  O   . TRP B 1 230 ? 1.045   0.918   -75.639 1.00 45.10  ? 208  TRP B O   1 
ATOM   5089 C  CB  A TRP B 1 230 ? 2.640   3.755   -75.949 0.50 43.45  ? 208  TRP B CB  1 
ATOM   5090 C  CB  B TRP B 1 230 ? 2.812   3.646   -76.009 0.50 44.80  ? 208  TRP B CB  1 
ATOM   5091 C  CG  A TRP B 1 230 ? 2.203   5.192   -75.754 0.50 44.43  ? 208  TRP B CG  1 
ATOM   5092 C  CG  B TRP B 1 230 ? 2.362   3.202   -77.389 0.50 49.14  ? 208  TRP B CG  1 
ATOM   5093 C  CD1 A TRP B 1 230 ? 2.875   6.176   -75.083 0.50 43.61  ? 208  TRP B CD1 1 
ATOM   5094 C  CD1 B TRP B 1 230 ? 3.045   2.386   -78.257 0.50 50.16  ? 208  TRP B CD1 1 
ATOM   5095 C  CD2 A TRP B 1 230 ? 0.979   5.784   -76.200 0.50 45.99  ? 208  TRP B CD2 1 
ATOM   5096 C  CD2 B TRP B 1 230 ? 1.143   3.560   -78.060 0.50 52.84  ? 208  TRP B CD2 1 
ATOM   5097 N  NE1 A TRP B 1 230 ? 2.151   7.344   -75.094 0.50 44.18  ? 208  TRP B NE1 1 
ATOM   5098 N  NE1 B TRP B 1 230 ? 2.327   2.217   -79.411 0.50 53.20  ? 208  TRP B NE1 1 
ATOM   5099 C  CE2 A TRP B 1 230 ? 0.983   7.129   -75.776 0.50 45.93  ? 208  TRP B CE2 1 
ATOM   5100 C  CE2 B TRP B 1 230 ? 1.156   2.921   -79.319 0.50 54.23  ? 208  TRP B CE2 1 
ATOM   5101 C  CE3 A TRP B 1 230 ? -0.118  5.311   -76.914 0.50 48.26  ? 208  TRP B CE3 1 
ATOM   5102 C  CE3 B TRP B 1 230 ? 0.045   4.354   -77.720 0.50 54.31  ? 208  TRP B CE3 1 
ATOM   5103 C  CZ2 A TRP B 1 230 ? -0.070  8.000   -76.044 0.50 47.49  ? 208  TRP B CZ2 1 
ATOM   5104 C  CZ2 B TRP B 1 230 ? 0.105   3.039   -80.231 0.50 58.36  ? 208  TRP B CZ2 1 
ATOM   5105 C  CZ3 A TRP B 1 230 ? -1.160  6.189   -77.192 0.50 50.07  ? 208  TRP B CZ3 1 
ATOM   5106 C  CZ3 B TRP B 1 230 ? -0.998  4.484   -78.640 0.50 56.79  ? 208  TRP B CZ3 1 
ATOM   5107 C  CH2 A TRP B 1 230 ? -1.127  7.511   -76.748 0.50 49.14  ? 208  TRP B CH2 1 
ATOM   5108 C  CH2 B TRP B 1 230 ? -0.958  3.828   -79.876 0.50 58.59  ? 208  TRP B CH2 1 
ATOM   5109 N  N   A ARG B 1 231 ? 3.161   0.624   -74.940 0.50 41.88  ? 209  ARG B N   1 
ATOM   5110 N  N   B ARG B 1 231 ? 3.178   0.643   -74.933 0.50 41.89  ? 209  ARG B N   1 
ATOM   5111 C  CA  A ARG B 1 231 ? 3.151   -0.804  -75.255 0.50 42.86  ? 209  ARG B CA  1 
ATOM   5112 C  CA  B ARG B 1 231 ? 3.232   -0.791  -75.208 0.50 42.72  ? 209  ARG B CA  1 
ATOM   5113 C  C   A ARG B 1 231 ? 2.275   -1.610  -74.302 0.50 42.78  ? 209  ARG B C   1 
ATOM   5114 C  C   B ARG B 1 231 ? 2.267   -1.567  -74.315 0.50 42.74  ? 209  ARG B C   1 
ATOM   5115 O  O   A ARG B 1 231 ? 1.660   -2.591  -74.719 0.50 44.26  ? 209  ARG B O   1 
ATOM   5116 O  O   B ARG B 1 231 ? 1.573   -2.465  -74.788 0.50 44.42  ? 209  ARG B O   1 
ATOM   5117 C  CB  A ARG B 1 231 ? 4.573   -1.367  -75.318 0.50 42.42  ? 209  ARG B CB  1 
ATOM   5118 C  CB  B ARG B 1 231 ? 4.672   -1.323  -75.062 0.50 41.94  ? 209  ARG B CB  1 
ATOM   5119 C  CG  A ARG B 1 231 ? 5.205   -1.196  -76.700 0.50 43.95  ? 209  ARG B CG  1 
ATOM   5120 C  CG  B ARG B 1 231 ? 5.610   -0.912  -76.207 0.50 43.17  ? 209  ARG B CG  1 
ATOM   5121 C  CD  A ARG B 1 231 ? 6.723   -1.118  -76.630 0.50 43.14  ? 209  ARG B CD  1 
ATOM   5122 C  CD  B ARG B 1 231 ? 7.093   -1.050  -75.848 0.50 42.13  ? 209  ARG B CD  1 
ATOM   5123 N  NE  A ARG B 1 231 ? 7.308   -0.699  -77.898 0.50 44.49  ? 209  ARG B NE  1 
ATOM   5124 N  NE  B ARG B 1 231 ? 7.612   -2.401  -76.079 0.50 42.47  ? 209  ARG B NE  1 
ATOM   5125 C  CZ  A ARG B 1 231 ? 7.306   0.554   -78.347 0.50 44.36  ? 209  ARG B CZ  1 
ATOM   5126 C  CZ  B ARG B 1 231 ? 8.683   -2.914  -75.471 0.50 41.50  ? 209  ARG B CZ  1 
ATOM   5127 N  NH1 A ARG B 1 231 ? 6.739   1.527   -77.638 0.50 42.65  ? 209  ARG B NH1 1 
ATOM   5128 N  NH1 B ARG B 1 231 ? 9.369   -2.204  -74.580 0.50 38.88  ? 209  ARG B NH1 1 
ATOM   5129 N  NH2 A ARG B 1 231 ? 7.863   0.825   -79.514 0.50 45.20  ? 209  ARG B NH2 1 
ATOM   5130 N  NH2 B ARG B 1 231 ? 9.067   -4.145  -75.758 0.50 42.15  ? 209  ARG B NH2 1 
ATOM   5131 N  N   . LEU B 1 232 ? 2.218   -1.215  -73.031 1.00 41.49  ? 210  LEU B N   1 
ATOM   5132 C  CA  . LEU B 1 232 ? 1.280   -1.843  -72.082 1.00 42.29  ? 210  LEU B CA  1 
ATOM   5133 C  C   . LEU B 1 232 ? -0.189  -1.527  -72.461 1.00 43.51  ? 210  LEU B C   1 
ATOM   5134 O  O   . LEU B 1 232 ? -1.038  -2.419  -72.502 1.00 43.19  ? 210  LEU B O   1 
ATOM   5135 C  CB  . LEU B 1 232 ? 1.569   -1.392  -70.643 1.00 42.04  ? 210  LEU B CB  1 
ATOM   5136 C  CG  . LEU B 1 232 ? 2.893   -1.863  -70.040 1.00 41.40  ? 210  LEU B CG  1 
ATOM   5137 C  CD1 . LEU B 1 232 ? 3.218   -1.110  -68.764 1.00 40.63  ? 210  LEU B CD1 1 
ATOM   5138 C  CD2 . LEU B 1 232 ? 2.843   -3.349  -69.789 1.00 42.88  ? 210  LEU B CD2 1 
ATOM   5139 N  N   . LYS B 1 233 ? -0.469  -0.269  -72.782 1.00 44.41  ? 211  LYS B N   1 
ATOM   5140 C  CA  . LYS B 1 233 ? -1.804  0.100   -73.173 1.00 48.41  ? 211  LYS B CA  1 
ATOM   5141 C  C   . LYS B 1 233 ? -2.271  -0.747  -74.337 1.00 51.31  ? 211  LYS B C   1 
ATOM   5142 O  O   . LYS B 1 233 ? -3.410  -1.191  -74.334 1.00 52.20  ? 211  LYS B O   1 
ATOM   5143 C  CB  . LYS B 1 233 ? -1.925  1.571   -73.558 1.00 51.55  ? 211  LYS B CB  1 
ATOM   5144 C  CG  . LYS B 1 233 ? -3.350  1.908   -74.005 1.00 57.08  ? 211  LYS B CG  1 
ATOM   5145 C  CD  . LYS B 1 233 ? -3.509  3.209   -74.764 1.00 63.57  ? 211  LYS B CD  1 
ATOM   5146 C  CE  . LYS B 1 233 ? -2.569  3.394   -75.948 1.00 67.80  ? 211  LYS B CE  1 
ATOM   5147 N  NZ  . LYS B 1 233 ? -2.684  2.435   -77.086 1.00 73.49  ? 211  LYS B NZ  1 
ATOM   5148 N  N   . ASN B 1 234 ? -1.401  -0.945  -75.330 1.00 51.64  ? 212  ASN B N   1 
ATOM   5149 C  CA  . ASN B 1 234 ? -1.731  -1.754  -76.499 1.00 55.33  ? 212  ASN B CA  1 
ATOM   5150 C  C   . ASN B 1 234 ? -2.087  -3.199  -76.172 1.00 54.91  ? 212  ASN B C   1 
ATOM   5151 O  O   . ASN B 1 234 ? -2.766  -3.835  -76.957 1.00 56.91  ? 212  ASN B O   1 
ATOM   5152 C  CB  . ASN B 1 234 ? -0.583  -1.749  -77.520 1.00 57.04  ? 212  ASN B CB  1 
ATOM   5153 C  CG  . ASN B 1 234 ? -0.381  -0.395  -78.172 1.00 60.29  ? 212  ASN B CG  1 
ATOM   5154 O  OD1 . ASN B 1 234 ? -1.293  0.433   -78.224 1.00 63.53  ? 212  ASN B OD1 1 
ATOM   5155 N  ND2 . ASN B 1 234 ? 0.829   -0.159  -78.670 1.00 62.10  ? 212  ASN B ND2 1 
ATOM   5156 N  N   . GLU B 1 235 ? -1.620  -3.725  -75.046 1.00 51.41  ? 213  GLU B N   1 
ATOM   5157 C  CA  . GLU B 1 235 ? -1.933  -5.097  -74.656 1.00 53.06  ? 213  GLU B CA  1 
ATOM   5158 C  C   . GLU B 1 235 ? -3.084  -5.237  -73.655 1.00 52.43  ? 213  GLU B C   1 
ATOM   5159 O  O   . GLU B 1 235 ? -3.507  -6.351  -73.387 1.00 53.81  ? 213  GLU B O   1 
ATOM   5160 C  CB  . GLU B 1 235 ? -0.707  -5.754  -74.024 1.00 53.27  ? 213  GLU B CB  1 
ATOM   5161 C  CG  . GLU B 1 235 ? 0.520   -5.791  -74.908 1.00 55.37  ? 213  GLU B CG  1 
ATOM   5162 C  CD  . GLU B 1 235 ? 0.258   -6.439  -76.240 1.00 58.90  ? 213  GLU B CD  1 
ATOM   5163 O  OE1 . GLU B 1 235 ? -0.258  -7.580  -76.277 1.00 60.19  ? 213  GLU B OE1 1 
ATOM   5164 O  OE2 . GLU B 1 235 ? 0.561   -5.787  -77.257 1.00 62.74  ? 213  GLU B OE2 1 
ATOM   5165 N  N   . ILE B 1 236 ? -3.559  -4.139  -73.069 1.00 49.87  ? 214  ILE B N   1 
ATOM   5166 C  CA  . ILE B 1 236 ? -4.560  -4.223  -72.009 1.00 49.25  ? 214  ILE B CA  1 
ATOM   5167 C  C   . ILE B 1 236 ? -5.869  -3.601  -72.468 1.00 51.25  ? 214  ILE B C   1 
ATOM   5168 O  O   . ILE B 1 236 ? -5.935  -2.393  -72.631 1.00 48.90  ? 214  ILE B O   1 
ATOM   5169 C  CB  . ILE B 1 236 ? -4.075  -3.521  -70.716 1.00 46.58  ? 214  ILE B CB  1 
ATOM   5170 C  CG1 . ILE B 1 236 ? -2.816  -4.220  -70.211 1.00 44.52  ? 214  ILE B CG1 1 
ATOM   5171 C  CG2 . ILE B 1 236 ? -5.162  -3.575  -69.653 1.00 46.44  ? 214  ILE B CG2 1 
ATOM   5172 C  CD1 . ILE B 1 236 ? -2.090  -3.528  -69.077 1.00 43.47  ? 214  ILE B CD1 1 
ATOM   5173 N  N   . PRO B 1 237 ? -6.928  -4.422  -72.655 1.00 55.13  ? 215  PRO B N   1 
ATOM   5174 C  CA  . PRO B 1 237 ? -8.184  -3.819  -73.106 1.00 56.36  ? 215  PRO B CA  1 
ATOM   5175 C  C   . PRO B 1 237 ? -8.766  -2.890  -72.041 1.00 55.47  ? 215  PRO B C   1 
ATOM   5176 O  O   . PRO B 1 237 ? -8.502  -3.063  -70.834 1.00 54.63  ? 215  PRO B O   1 
ATOM   5177 C  CB  . PRO B 1 237 ? -9.101  -5.039  -73.375 1.00 60.37  ? 215  PRO B CB  1 
ATOM   5178 C  CG  . PRO B 1 237 ? -8.226  -6.255  -73.249 1.00 59.38  ? 215  PRO B CG  1 
ATOM   5179 C  CD  . PRO B 1 237 ? -7.101  -5.851  -72.338 1.00 55.98  ? 215  PRO B CD  1 
ATOM   5180 N  N   . ASN B 1 238 ? -9.491  -1.873  -72.495 1.00 56.04  ? 216  ASN B N   1 
ATOM   5181 C  CA  . ASN B 1 238 ? -10.055 -0.847  -71.606 1.00 56.76  ? 216  ASN B CA  1 
ATOM   5182 C  C   . ASN B 1 238 ? -9.026  -0.107  -70.757 1.00 52.67  ? 216  ASN B C   1 
ATOM   5183 O  O   . ASN B 1 238 ? -9.306  0.264   -69.590 1.00 52.23  ? 216  ASN B O   1 
ATOM   5184 C  CB  . ASN B 1 238 ? -11.131 -1.461  -70.707 1.00 58.45  ? 216  ASN B CB  1 
ATOM   5185 C  CG  . ASN B 1 238 ? -12.207 -2.149  -71.510 1.00 61.93  ? 216  ASN B CG  1 
ATOM   5186 O  OD1 . ASN B 1 238 ? -12.728 -1.578  -72.465 1.00 65.41  ? 216  ASN B OD1 1 
ATOM   5187 N  ND2 . ASN B 1 238 ? -12.527 -3.387  -71.155 1.00 62.94  ? 216  ASN B ND2 1 
ATOM   5188 N  N   . SER B 1 239 ? -7.843  0.112   -71.338 1.00 48.99  ? 217  SER B N   1 
ATOM   5189 C  CA  . SER B 1 239 ? -6.801  0.897   -70.683 1.00 46.66  ? 217  SER B CA  1 
ATOM   5190 C  C   . SER B 1 239 ? -6.661  2.250   -71.368 1.00 46.97  ? 217  SER B C   1 
ATOM   5191 O  O   . SER B 1 239 ? -6.965  2.383   -72.545 1.00 48.53  ? 217  SER B O   1 
ATOM   5192 C  CB  . SER B 1 239 ? -5.463  0.140   -70.650 1.00 44.69  ? 217  SER B CB  1 
ATOM   5193 O  OG  . SER B 1 239 ? -4.956  -0.121  -71.949 1.00 45.25  ? 217  SER B OG  1 
ATOM   5194 N  N   . HIS B 1 240 ? -6.243  3.261   -70.617 1.00 46.53  ? 218  HIS B N   1 
ATOM   5195 C  CA  . HIS B 1 240 ? -6.013  4.606   -71.172 1.00 47.41  ? 218  HIS B CA  1 
ATOM   5196 C  C   . HIS B 1 240 ? -4.739  5.159   -70.622 1.00 43.67  ? 218  HIS B C   1 
ATOM   5197 O  O   . HIS B 1 240 ? -4.398  4.900   -69.460 1.00 42.19  ? 218  HIS B O   1 
ATOM   5198 C  CB  . HIS B 1 240 ? -7.119  5.584   -70.790 1.00 49.59  ? 218  HIS B CB  1 
ATOM   5199 C  CG  . HIS B 1 240 ? -8.480  5.041   -71.009 1.00 54.49  ? 218  HIS B CG  1 
ATOM   5200 N  ND1 . HIS B 1 240 ? -9.143  5.164   -72.209 1.00 58.57  ? 218  HIS B ND1 1 
ATOM   5201 C  CD2 . HIS B 1 240 ? -9.288  4.318   -70.199 1.00 57.67  ? 218  HIS B CD2 1 
ATOM   5202 C  CE1 . HIS B 1 240 ? -10.310 4.549   -72.125 1.00 61.28  ? 218  HIS B CE1 1 
ATOM   5203 N  NE2 . HIS B 1 240 ? -10.425 4.031   -70.913 1.00 60.05  ? 218  HIS B NE2 1 
ATOM   5204 N  N   . ILE B 1 241 ? -4.047  5.924   -71.461 1.00 43.24  ? 219  ILE B N   1 
ATOM   5205 C  CA  . ILE B 1 241 ? -2.953  6.791   -71.028 1.00 42.90  ? 219  ILE B CA  1 
ATOM   5206 C  C   . ILE B 1 241 ? -3.489  8.216   -71.069 1.00 43.34  ? 219  ILE B C   1 
ATOM   5207 O  O   . ILE B 1 241 ? -3.724  8.774   -72.138 1.00 43.06  ? 219  ILE B O   1 
ATOM   5208 C  CB  . ILE B 1 241 ? -1.706  6.662   -71.938 1.00 44.15  ? 219  ILE B CB  1 
ATOM   5209 C  CG1 . ILE B 1 241 ? -1.180  5.222   -71.901 1.00 44.76  ? 219  ILE B CG1 1 
ATOM   5210 C  CG2 . ILE B 1 241 ? -0.595  7.613   -71.491 1.00 41.43  ? 219  ILE B CG2 1 
ATOM   5211 C  CD1 . ILE B 1 241 ? -0.151  4.930   -72.969 1.00 46.01  ? 219  ILE B CD1 1 
ATOM   5212 N  N   . LEU B 1 242 ? -3.708  8.798   -69.903 1.00 43.07  ? 220  LEU B N   1 
ATOM   5213 C  CA  . LEU B 1 242 ? -4.189  10.172  -69.838 1.00 45.46  ? 220  LEU B CA  1 
ATOM   5214 C  C   . LEU B 1 242 ? -3.140  11.145  -70.412 1.00 45.07  ? 220  LEU B C   1 
ATOM   5215 O  O   . LEU B 1 242 ? -3.504  12.145  -71.037 1.00 44.06  ? 220  LEU B O   1 
ATOM   5216 C  CB  . LEU B 1 242 ? -4.557  10.527  -68.397 1.00 45.53  ? 220  LEU B CB  1 
ATOM   5217 C  CG  . LEU B 1 242 ? -5.717  9.713   -67.821 1.00 46.94  ? 220  LEU B CG  1 
ATOM   5218 C  CD1 . LEU B 1 242 ? -5.810  9.876   -66.307 1.00 47.31  ? 220  LEU B CD1 1 
ATOM   5219 C  CD2 . LEU B 1 242 ? -7.017  10.091  -68.486 1.00 50.39  ? 220  LEU B CD2 1 
ATOM   5220 N  N   . ASP B 1 243 ? -1.856  10.829  -70.194 1.00 42.37  ? 221  ASP B N   1 
ATOM   5221 C  CA  . ASP B 1 243 ? -0.722  11.470  -70.895 1.00 42.57  ? 221  ASP B CA  1 
ATOM   5222 C  C   . ASP B 1 243 ? -0.496  12.916  -70.491 1.00 41.71  ? 221  ASP B C   1 
ATOM   5223 O  O   . ASP B 1 243 ? -0.884  13.862  -71.189 1.00 44.76  ? 221  ASP B O   1 
ATOM   5224 C  CB  . ASP B 1 243 ? -0.847  11.363  -72.426 1.00 45.12  ? 221  ASP B CB  1 
ATOM   5225 C  CG  . ASP B 1 243 ? 0.488   11.623  -73.144 1.00 47.00  ? 221  ASP B CG  1 
ATOM   5226 O  OD1 . ASP B 1 243 ? 1.440   12.161  -72.525 1.00 48.25  ? 221  ASP B OD1 1 
ATOM   5227 O  OD2 . ASP B 1 243 ? 0.608   11.258  -74.322 1.00 49.99  ? 221  ASP B OD2 1 
ATOM   5228 N  N   . GLN B 1 244 ? 0.168   13.072  -69.369 1.00 39.22  ? 222  GLN B N   1 
ATOM   5229 C  CA  . GLN B 1 244 ? 0.471   14.387  -68.817 1.00 39.84  ? 222  GLN B CA  1 
ATOM   5230 C  C   . GLN B 1 244 ? 1.338   15.256  -69.745 1.00 39.89  ? 222  GLN B C   1 
ATOM   5231 O  O   . GLN B 1 244 ? 1.370   16.468  -69.593 1.00 38.13  ? 222  GLN B O   1 
ATOM   5232 C  CB  . GLN B 1 244 ? 1.150   14.237  -67.441 1.00 37.66  ? 222  GLN B CB  1 
ATOM   5233 C  CG  . GLN B 1 244 ? 2.442   13.438  -67.493 1.00 36.80  ? 222  GLN B CG  1 
ATOM   5234 C  CD  . GLN B 1 244 ? 3.160   13.331  -66.179 1.00 35.74  ? 222  GLN B CD  1 
ATOM   5235 O  OE1 . GLN B 1 244 ? 3.900   12.386  -65.960 1.00 37.20  ? 222  GLN B OE1 1 
ATOM   5236 N  NE2 . GLN B 1 244 ? 2.978   14.300  -65.310 1.00 35.01  ? 222  GLN B NE2 1 
ATOM   5237 N  N   . TYR B 1 245 ? 2.046   14.637  -70.687 1.00 39.65  ? 223  TYR B N   1 
ATOM   5238 C  CA  . TYR B 1 245 ? 2.931   15.374  -71.584 1.00 40.16  ? 223  TYR B CA  1 
ATOM   5239 C  C   . TYR B 1 245 ? 2.186   16.086  -72.695 1.00 41.69  ? 223  TYR B C   1 
ATOM   5240 O  O   . TYR B 1 245 ? 2.696   17.059  -73.224 1.00 40.76  ? 223  TYR B O   1 
ATOM   5241 C  CB  . TYR B 1 245 ? 4.007   14.450  -72.187 1.00 41.10  ? 223  TYR B CB  1 
ATOM   5242 C  CG  . TYR B 1 245 ? 4.845   13.788  -71.121 1.00 38.81  ? 223  TYR B CG  1 
ATOM   5243 C  CD1 . TYR B 1 245 ? 5.789   14.512  -70.406 1.00 37.84  ? 223  TYR B CD1 1 
ATOM   5244 C  CD2 . TYR B 1 245 ? 4.664   12.452  -70.794 1.00 39.09  ? 223  TYR B CD2 1 
ATOM   5245 C  CE1 . TYR B 1 245 ? 6.526   13.928  -69.399 1.00 36.81  ? 223  TYR B CE1 1 
ATOM   5246 C  CE2 . TYR B 1 245 ? 5.408   11.860  -69.776 1.00 37.53  ? 223  TYR B CE2 1 
ATOM   5247 C  CZ  . TYR B 1 245 ? 6.339   12.596  -69.094 1.00 35.60  ? 223  TYR B CZ  1 
ATOM   5248 O  OH  . TYR B 1 245 ? 7.077   12.002  -68.098 1.00 35.75  ? 223  TYR B OH  1 
ATOM   5249 N  N   . ARG B 1 246 ? 0.990   15.598  -73.030 1.00 42.61  ? 224  ARG B N   1 
ATOM   5250 C  CA  . ARG B 1 246 ? 0.155   16.164  -74.098 1.00 46.00  ? 224  ARG B CA  1 
ATOM   5251 C  C   . ARG B 1 246 ? -1.212  16.682  -73.645 1.00 44.60  ? 224  ARG B C   1 
ATOM   5252 O  O   . ARG B 1 246 ? -1.791  17.492  -74.318 1.00 45.30  ? 224  ARG B O   1 
ATOM   5253 C  CB  . ARG B 1 246 ? -0.116  15.109  -75.173 1.00 49.00  ? 224  ARG B CB  1 
ATOM   5254 C  CG  . ARG B 1 246 ? 1.114   14.439  -75.752 1.00 52.23  ? 224  ARG B CG  1 
ATOM   5255 C  CD  . ARG B 1 246 ? 0.736   13.423  -76.834 1.00 56.90  ? 224  ARG B CD  1 
ATOM   5256 N  NE  . ARG B 1 246 ? -0.255  13.971  -77.765 1.00 62.72  ? 224  ARG B NE  1 
ATOM   5257 C  CZ  . ARG B 1 246 ? -0.009  14.922  -78.674 1.00 69.02  ? 224  ARG B CZ  1 
ATOM   5258 N  NH1 . ARG B 1 246 ? 1.213   15.450  -78.800 1.00 72.16  ? 224  ARG B NH1 1 
ATOM   5259 N  NH2 . ARG B 1 246 ? -0.993  15.358  -79.466 1.00 69.83  ? 224  ARG B NH2 1 
ATOM   5260 N  N   . ASN B 1 247 ? -1.723  16.210  -72.511 1.00 43.96  ? 225  ASN B N   1 
ATOM   5261 C  CA  . ASN B 1 247 ? -3.109  16.490  -72.098 1.00 44.64  ? 225  ASN B CA  1 
ATOM   5262 C  C   . ASN B 1 247 ? -3.253  17.923  -71.570 1.00 43.96  ? 225  ASN B C   1 
ATOM   5263 O  O   . ASN B 1 247 ? -2.590  18.308  -70.602 1.00 42.43  ? 225  ASN B O   1 
ATOM   5264 C  CB  . ASN B 1 247 ? -3.513  15.469  -71.023 1.00 43.39  ? 225  ASN B CB  1 
ATOM   5265 C  CG  . ASN B 1 247 ? -5.001  15.432  -70.761 1.00 45.04  ? 225  ASN B CG  1 
ATOM   5266 O  OD1 . ASN B 1 247 ? -5.713  16.430  -70.912 1.00 47.19  ? 225  ASN B OD1 1 
ATOM   5267 N  ND2 . ASN B 1 247 ? -5.480  14.271  -70.348 1.00 43.68  ? 225  ASN B ND2 1 
ATOM   5268 N  N   . ALA B 1 248 ? -4.126  18.696  -72.194 1.00 45.21  ? 226  ALA B N   1 
ATOM   5269 C  CA  . ALA B 1 248 ? -4.373  20.087  -71.803 1.00 46.66  ? 226  ALA B CA  1 
ATOM   5270 C  C   . ALA B 1 248 ? -4.851  20.220  -70.361 1.00 46.44  ? 226  ALA B C   1 
ATOM   5271 O  O   . ALA B 1 248 ? -4.615  21.247  -69.740 1.00 46.29  ? 226  ALA B O   1 
ATOM   5272 C  CB  . ALA B 1 248 ? -5.356  20.754  -72.754 1.00 49.04  ? 226  ALA B CB  1 
ATOM   5273 N  N   . SER B 1 249 ? -5.482  19.176  -69.823 1.00 46.29  ? 227  SER B N   1 
ATOM   5274 C  CA  . SER B 1 249 ? -5.892  19.159  -68.419 1.00 45.80  ? 227  SER B CA  1 
ATOM   5275 C  C   . SER B 1 249 ? -4.762  19.415  -67.444 1.00 44.25  ? 227  SER B C   1 
ATOM   5276 O  O   . SER B 1 249 ? -5.004  19.837  -66.311 1.00 44.56  ? 227  SER B O   1 
ATOM   5277 C  CB  . SER B 1 249 ? -6.537  17.823  -68.081 1.00 45.38  ? 227  SER B CB  1 
ATOM   5278 O  OG  . SER B 1 249 ? -7.784  17.700  -68.716 1.00 47.56  ? 227  SER B OG  1 
ATOM   5279 N  N   . ASN B 1 250 ? -3.534  19.114  -67.855 1.00 43.77  ? 228  ASN B N   1 
ATOM   5280 C  CA  . ASN B 1 250 ? -2.370  19.372  -67.018 1.00 42.05  ? 228  ASN B CA  1 
ATOM   5281 C  C   . ASN B 1 250 ? -2.153  20.892  -66.851 1.00 42.72  ? 228  ASN B C   1 
ATOM   5282 O  O   . ASN B 1 250 ? -2.341  21.409  -65.748 1.00 40.42  ? 228  ASN B O   1 
ATOM   5283 C  CB  . ASN B 1 250 ? -1.150  18.600  -67.559 1.00 41.85  ? 228  ASN B CB  1 
ATOM   5284 C  CG  . ASN B 1 250 ? 0.178   19.015  -66.938 1.00 39.47  ? 228  ASN B CG  1 
ATOM   5285 O  OD1 . ASN B 1 250 ? 0.257   19.870  -66.067 1.00 39.51  ? 228  ASN B OD1 1 
ATOM   5286 N  ND2 . ASN B 1 250 ? 1.241   18.391  -67.415 1.00 38.97  ? 228  ASN B ND2 1 
ATOM   5287 N  N   . PRO B 1 251 ? -1.784  21.614  -67.931 1.00 44.37  ? 229  PRO B N   1 
ATOM   5288 C  CA  . PRO B 1 251 ? -1.553  23.053  -67.749 1.00 45.30  ? 229  PRO B CA  1 
ATOM   5289 C  C   . PRO B 1 251 ? -2.814  23.843  -67.385 1.00 46.26  ? 229  PRO B C   1 
ATOM   5290 O  O   . PRO B 1 251 ? -2.725  24.835  -66.665 1.00 45.59  ? 229  PRO B O   1 
ATOM   5291 C  CB  . PRO B 1 251 ? -0.991  23.504  -69.107 1.00 46.69  ? 229  PRO B CB  1 
ATOM   5292 C  CG  . PRO B 1 251 ? -1.407  22.443  -70.073 1.00 47.33  ? 229  PRO B CG  1 
ATOM   5293 C  CD  . PRO B 1 251 ? -1.406  21.175  -69.282 1.00 45.18  ? 229  PRO B CD  1 
ATOM   5294 N  N   . LEU B 1 252 ? -3.969  23.411  -67.875 1.00 47.36  ? 230  LEU B N   1 
ATOM   5295 C  CA  . LEU B 1 252 ? -5.229  24.050  -67.513 1.00 49.53  ? 230  LEU B CA  1 
ATOM   5296 C  C   . LEU B 1 252 ? -5.542  23.966  -66.011 1.00 48.12  ? 230  LEU B C   1 
ATOM   5297 O  O   . LEU B 1 252 ? -6.172  24.873  -65.475 1.00 47.92  ? 230  LEU B O   1 
ATOM   5298 C  CB  . LEU B 1 252 ? -6.394  23.479  -68.330 1.00 51.89  ? 230  LEU B CB  1 
ATOM   5299 C  CG  . LEU B 1 252 ? -6.514  24.011  -69.758 1.00 55.03  ? 230  LEU B CG  1 
ATOM   5300 C  CD1 . LEU B 1 252 ? -7.645  23.322  -70.512 1.00 56.83  ? 230  LEU B CD1 1 
ATOM   5301 C  CD2 . LEU B 1 252 ? -6.735  25.526  -69.751 1.00 57.80  ? 230  LEU B CD2 1 
ATOM   5302 N  N   . ALA B 1 253 ? -5.102  22.901  -65.332 1.00 45.90  ? 231  ALA B N   1 
ATOM   5303 C  CA  . ALA B 1 253 ? -5.312  22.815  -63.870 1.00 45.14  ? 231  ALA B CA  1 
ATOM   5304 C  C   . ALA B 1 253 ? -4.605  23.980  -63.204 1.00 44.82  ? 231  ALA B C   1 
ATOM   5305 O  O   . ALA B 1 253 ? -5.139  24.614  -62.288 1.00 45.60  ? 231  ALA B O   1 
ATOM   5306 C  CB  . ALA B 1 253 ? -4.800  21.500  -63.308 1.00 43.25  ? 231  ALA B CB  1 
ATOM   5307 N  N   . HIS B 1 254 ? -3.415  24.289  -63.702 1.00 42.82  ? 232  HIS B N   1 
ATOM   5308 C  CA  . HIS B 1 254 ? -2.612  25.354  -63.130 1.00 42.88  ? 232  HIS B CA  1 
ATOM   5309 C  C   . HIS B 1 254 ? -3.117  26.736  -63.567 1.00 44.47  ? 232  HIS B C   1 
ATOM   5310 O  O   . HIS B 1 254 ? -3.162  27.665  -62.755 1.00 44.59  ? 232  HIS B O   1 
ATOM   5311 C  CB  . HIS B 1 254 ? -1.139  25.120  -63.453 1.00 41.29  ? 232  HIS B CB  1 
ATOM   5312 C  CG  . HIS B 1 254 ? -0.612  23.839  -62.894 1.00 39.95  ? 232  HIS B CG  1 
ATOM   5313 N  ND1 . HIS B 1 254 ? -0.493  23.618  -61.540 1.00 38.86  ? 232  HIS B ND1 1 
ATOM   5314 C  CD2 . HIS B 1 254 ? -0.186  22.702  -63.501 1.00 38.82  ? 232  HIS B CD2 1 
ATOM   5315 C  CE1 . HIS B 1 254 ? -0.021  22.404  -61.340 1.00 37.13  ? 232  HIS B CE1 1 
ATOM   5316 N  NE2 . HIS B 1 254 ? 0.176   21.829  -62.513 1.00 36.45  ? 232  HIS B NE2 1 
ATOM   5317 N  N   . TYR B 1 255 ? -3.528  26.846  -64.831 1.00 45.99  ? 233  TYR B N   1 
ATOM   5318 C  CA  . TYR B 1 255 ? -4.185  28.052  -65.370 1.00 48.32  ? 233  TYR B CA  1 
ATOM   5319 C  C   . TYR B 1 255 ? -5.464  28.426  -64.620 1.00 50.08  ? 233  TYR B C   1 
ATOM   5320 O  O   . TYR B 1 255 ? -5.659  29.592  -64.268 1.00 51.75  ? 233  TYR B O   1 
ATOM   5321 C  CB  . TYR B 1 255 ? -4.525  27.839  -66.848 1.00 49.10  ? 233  TYR B CB  1 
ATOM   5322 C  CG  . TYR B 1 255 ? -5.130  29.035  -67.554 1.00 51.19  ? 233  TYR B CG  1 
ATOM   5323 C  CD1 . TYR B 1 255 ? -4.323  30.040  -68.061 1.00 52.41  ? 233  TYR B CD1 1 
ATOM   5324 C  CD2 . TYR B 1 255 ? -6.497  29.138  -67.752 1.00 52.94  ? 233  TYR B CD2 1 
ATOM   5325 C  CE1 . TYR B 1 255 ? -4.860  31.131  -68.728 1.00 54.38  ? 233  TYR B CE1 1 
ATOM   5326 C  CE2 . TYR B 1 255 ? -7.053  30.232  -68.418 1.00 55.78  ? 233  TYR B CE2 1 
ATOM   5327 C  CZ  . TYR B 1 255 ? -6.228  31.222  -68.899 1.00 56.47  ? 233  TYR B CZ  1 
ATOM   5328 O  OH  . TYR B 1 255 ? -6.753  32.305  -69.572 1.00 60.20  ? 233  TYR B OH  1 
ATOM   5329 N  N   . ASP B 1 256 ? -6.336  27.447  -64.398 1.00 50.78  ? 234  ASP B N   1 
ATOM   5330 C  CA  . ASP B 1 256 ? -7.606  27.670  -63.690 1.00 53.36  ? 234  ASP B CA  1 
ATOM   5331 C  C   . ASP B 1 256 ? -7.460  27.822  -62.163 1.00 52.09  ? 234  ASP B C   1 
ATOM   5332 O  O   . ASP B 1 256 ? -8.199  28.585  -61.544 1.00 54.28  ? 234  ASP B O   1 
ATOM   5333 C  CB  . ASP B 1 256 ? -8.586  26.518  -63.958 1.00 54.17  ? 234  ASP B CB  1 
ATOM   5334 C  CG  . ASP B 1 256 ? -9.064  26.470  -65.387 1.00 56.48  ? 234  ASP B CG  1 
ATOM   5335 O  OD1 . ASP B 1 256 ? -8.917  27.465  -66.105 1.00 59.63  ? 234  ASP B OD1 1 
ATOM   5336 O  OD2 . ASP B 1 256 ? -9.611  25.435  -65.800 1.00 57.07  ? 234  ASP B OD2 1 
ATOM   5337 N  N   . THR B 1 257 ? -6.540  27.096  -61.545 1.00 50.25  ? 235  THR B N   1 
ATOM   5338 C  CA  . THR B 1 257 ? -6.552  27.025  -60.079 1.00 50.04  ? 235  THR B CA  1 
ATOM   5339 C  C   . THR B 1 257 ? -5.287  27.561  -59.445 1.00 47.08  ? 235  THR B C   1 
ATOM   5340 O  O   . THR B 1 257 ? -5.339  28.568  -58.754 1.00 47.76  ? 235  THR B O   1 
ATOM   5341 C  CB  . THR B 1 257 ? -6.865  25.602  -59.570 1.00 49.33  ? 235  THR B CB  1 
ATOM   5342 O  OG1 . THR B 1 257 ? -5.774  24.732  -59.865 1.00 52.44  ? 235  THR B OG1 1 
ATOM   5343 C  CG2 . THR B 1 257 ? -8.113  25.057  -60.227 1.00 51.80  ? 235  THR B CG2 1 
ATOM   5344 N  N   . THR B 1 258 ? -4.155  26.899  -59.664 1.00 45.03  ? 236  THR B N   1 
ATOM   5345 C  CA  . THR B 1 258 ? -2.902  27.308  -59.038 1.00 42.47  ? 236  THR B CA  1 
ATOM   5346 C  C   . THR B 1 258 ? -2.632  28.796  -59.268 1.00 44.26  ? 236  THR B C   1 
ATOM   5347 O  O   . THR B 1 258 ? -2.249  29.516  -58.355 1.00 43.50  ? 236  THR B O   1 
ATOM   5348 C  CB  . THR B 1 258 ? -1.713  26.488  -59.556 1.00 40.18  ? 236  THR B CB  1 
ATOM   5349 O  OG1 . THR B 1 258 ? -2.084  25.109  -59.678 1.00 38.59  ? 236  THR B OG1 1 
ATOM   5350 C  CG2 . THR B 1 258 ? -0.544  26.590  -58.595 1.00 38.79  ? 236  THR B CG2 1 
ATOM   5351 N  N   . ALA B 1 259 ? -2.875  29.264  -60.486 1.00 45.65  ? 237  ALA B N   1 
ATOM   5352 C  CA  . ALA B 1 259 ? -2.572  30.645  -60.842 1.00 46.74  ? 237  ALA B CA  1 
ATOM   5353 C  C   . ALA B 1 259 ? -3.525  31.618  -60.159 1.00 48.64  ? 237  ALA B C   1 
ATOM   5354 O  O   . ALA B 1 259 ? -3.106  32.685  -59.709 1.00 47.94  ? 237  ALA B O   1 
ATOM   5355 C  CB  . ALA B 1 259 ? -2.614  30.821  -62.356 1.00 48.59  ? 237  ALA B CB  1 
ATOM   5356 N  N   . ASP B 1 260 ? -4.800  31.238  -60.088 1.00 49.69  ? 238  ASP B N   1 
ATOM   5357 C  CA  . ASP B 1 260 ? -5.822  32.067  -59.463 1.00 52.44  ? 238  ASP B CA  1 
ATOM   5358 C  C   . ASP B 1 260 ? -5.624  32.117  -57.940 1.00 49.27  ? 238  ASP B C   1 
ATOM   5359 O  O   . ASP B 1 260 ? -5.917  33.124  -57.311 1.00 49.40  ? 238  ASP B O   1 
ATOM   5360 C  CB  . ASP B 1 260 ? -7.244  31.588  -59.834 1.00 56.01  ? 238  ASP B CB  1 
ATOM   5361 C  CG  . ASP B 1 260 ? -7.748  32.135  -61.221 1.00 61.57  ? 238  ASP B CG  1 
ATOM   5362 O  OD1 . ASP B 1 260 ? -7.084  32.980  -61.887 1.00 62.65  ? 238  ASP B OD1 1 
ATOM   5363 O  OD2 . ASP B 1 260 ? -8.850  31.714  -61.650 1.00 64.41  ? 238  ASP B OD2 1 
ATOM   5364 N  N   . GLU B 1 261 ? -5.104  31.048  -57.349 1.00 45.74  ? 239  GLU B N   1 
ATOM   5365 C  CA  . GLU B 1 261 ? -4.784  31.082  -55.936 1.00 44.02  ? 239  GLU B CA  1 
ATOM   5366 C  C   . GLU B 1 261 ? -3.641  32.043  -55.688 1.00 44.01  ? 239  GLU B C   1 
ATOM   5367 O  O   . GLU B 1 261 ? -3.695  32.828  -54.758 1.00 43.37  ? 239  GLU B O   1 
ATOM   5368 C  CB  . GLU B 1 261 ? -4.406  29.702  -55.410 1.00 43.18  ? 239  GLU B CB  1 
ATOM   5369 C  CG  . GLU B 1 261 ? -5.538  28.697  -55.379 1.00 43.32  ? 239  GLU B CG  1 
ATOM   5370 C  CD  . GLU B 1 261 ? -5.022  27.300  -55.103 1.00 41.27  ? 239  GLU B CD  1 
ATOM   5371 O  OE1 . GLU B 1 261 ? -3.955  27.162  -54.469 1.00 39.08  ? 239  GLU B OE1 1 
ATOM   5372 O  OE2 . GLU B 1 261 ? -5.672  26.331  -55.519 1.00 41.60  ? 239  GLU B OE2 1 
ATOM   5373 N  N   . ILE B 1 262 ? -2.597  31.972  -56.512 1.00 43.70  ? 240  ILE B N   1 
ATOM   5374 C  CA  . ILE B 1 262 ? -1.431  32.850  -56.354 1.00 44.13  ? 240  ILE B CA  1 
ATOM   5375 C  C   . ILE B 1 262 ? -1.850  34.320  -56.444 1.00 48.07  ? 240  ILE B C   1 
ATOM   5376 O  O   . ILE B 1 262 ? -1.471  35.138  -55.593 1.00 47.58  ? 240  ILE B O   1 
ATOM   5377 C  CB  . ILE B 1 262 ? -0.327  32.546  -57.401 1.00 43.55  ? 240  ILE B CB  1 
ATOM   5378 C  CG1 . ILE B 1 262 ? 0.277   31.172  -57.145 1.00 41.03  ? 240  ILE B CG1 1 
ATOM   5379 C  CG2 . ILE B 1 262 ? 0.770   33.612  -57.382 1.00 43.98  ? 240  ILE B CG2 1 
ATOM   5380 C  CD1 . ILE B 1 262 ? 1.013   30.584  -58.333 1.00 41.16  ? 240  ILE B CD1 1 
ATOM   5381 N  N   . LEU B 1 263 ? -2.642  34.657  -57.460 1.00 50.40  ? 241  LEU B N   1 
ATOM   5382 C  CA  . LEU B 1 263 ? -3.106  36.028  -57.610 1.00 53.42  ? 241  LEU B CA  1 
ATOM   5383 C  C   . LEU B 1 263 ? -3.878  36.466  -56.374 1.00 53.70  ? 241  LEU B C   1 
ATOM   5384 O  O   . LEU B 1 263 ? -3.606  37.543  -55.819 1.00 53.88  ? 241  LEU B O   1 
ATOM   5385 C  CB  . LEU B 1 263 ? -3.973  36.199  -58.869 1.00 56.70  ? 241  LEU B CB  1 
ATOM   5386 C  CG  . LEU B 1 263 ? -3.220  36.085  -60.211 1.00 57.72  ? 241  LEU B CG  1 
ATOM   5387 C  CD1 . LEU B 1 263 ? -4.175  36.012  -61.400 1.00 59.47  ? 241  LEU B CD1 1 
ATOM   5388 C  CD2 . LEU B 1 263 ? -2.268  37.265  -60.376 1.00 59.70  ? 241  LEU B CD2 1 
ATOM   5389 N  N   . GLN B 1 264 ? -4.823  35.624  -55.947 1.00 52.83  ? 242  GLN B N   1 
ATOM   5390 C  CA  . GLN B 1 264 ? -5.679  35.905  -54.781 1.00 53.64  ? 242  GLN B CA  1 
ATOM   5391 C  C   . GLN B 1 264 ? -4.820  36.083  -53.525 1.00 51.93  ? 242  GLN B C   1 
ATOM   5392 O  O   . GLN B 1 264 ? -4.974  37.056  -52.798 1.00 53.55  ? 242  GLN B O   1 
ATOM   5393 C  CB  . GLN B 1 264 ? -6.710  34.780  -54.582 1.00 53.26  ? 242  GLN B CB  1 
ATOM   5394 C  CG  . GLN B 1 264 ? -7.833  35.093  -53.605 1.00 56.48  ? 242  GLN B CG  1 
ATOM   5395 N  N   . GLN B 1 265 ? -3.891  35.163  -53.293 1.00 48.41  ? 243  GLN B N   1 
ATOM   5396 C  CA  . GLN B 1 265 ? -3.025  35.234  -52.121 1.00 47.76  ? 243  GLN B CA  1 
ATOM   5397 C  C   . GLN B 1 265 ? -2.105  36.458  -52.115 1.00 49.47  ? 243  GLN B C   1 
ATOM   5398 O  O   . GLN B 1 265 ? -1.776  36.977  -51.046 1.00 49.90  ? 243  GLN B O   1 
ATOM   5399 C  CB  . GLN B 1 265 ? -2.211  33.948  -51.986 1.00 44.71  ? 243  GLN B CB  1 
ATOM   5400 C  CG  . GLN B 1 265 ? -3.081  32.765  -51.599 1.00 43.70  ? 243  GLN B CG  1 
ATOM   5401 C  CD  . GLN B 1 265 ? -2.371  31.440  -51.691 1.00 42.06  ? 243  GLN B CD  1 
ATOM   5402 O  OE1 . GLN B 1 265 ? -1.747  31.095  -52.704 1.00 40.96  ? 243  GLN B OE1 1 
ATOM   5403 N  NE2 . GLN B 1 265 ? -2.487  30.668  -50.638 1.00 41.60  ? 243  GLN B NE2 1 
ATOM   5404 N  N   . CYS B 1 266 ? -1.700  36.919  -53.295 1.00 50.35  ? 244  CYS B N   1 
ATOM   5405 C  CA  . CYS B 1 266 ? -0.849  38.113  -53.422 1.00 53.15  ? 244  CYS B CA  1 
ATOM   5406 C  C   . CYS B 1 266 ? -1.606  39.443  -53.613 1.00 56.85  ? 244  CYS B C   1 
ATOM   5407 O  O   . CYS B 1 266 ? -0.982  40.482  -53.853 1.00 56.78  ? 244  CYS B O   1 
ATOM   5408 C  CB  . CYS B 1 266 ? 0.127   37.911  -54.588 1.00 52.84  ? 244  CYS B CB  1 
ATOM   5409 S  SG  . CYS B 1 266 ? 1.322   36.577  -54.297 1.00 50.46  ? 244  CYS B SG  1 
ATOM   5410 N  N   . ASP B 1 267 ? -2.934  39.414  -53.508 1.00 60.46  ? 245  ASP B N   1 
ATOM   5411 C  CA  . ASP B 1 267 ? -3.793  40.550  -53.890 1.00 64.52  ? 245  ASP B CA  1 
ATOM   5412 C  C   . ASP B 1 267 ? -3.403  41.111  -55.254 1.00 65.93  ? 245  ASP B C   1 
ATOM   5413 O  O   . ASP B 1 267 ? -3.312  42.320  -55.455 1.00 67.02  ? 245  ASP B O   1 
ATOM   5414 C  CB  . ASP B 1 267 ? -3.785  41.631  -52.806 1.00 68.95  ? 245  ASP B CB  1 
ATOM   5415 C  CG  . ASP B 1 267 ? -4.306  41.109  -51.462 1.00 71.80  ? 245  ASP B CG  1 
ATOM   5416 O  OD1 . ASP B 1 267 ? -5.118  40.157  -51.459 1.00 77.84  ? 245  ASP B OD1 1 
ATOM   5417 O  OD2 . ASP B 1 267 ? -3.902  41.623  -50.403 1.00 72.42  ? 245  ASP B OD2 1 
ATOM   5418 N  N   . GLY B 1 268 ? -3.160  40.196  -56.188 1.00 65.13  ? 246  GLY B N   1 
ATOM   5419 C  CA  . GLY B 1 268 ? -2.844  40.526  -57.573 1.00 67.13  ? 246  GLY B CA  1 
ATOM   5420 C  C   . GLY B 1 268 ? -1.502  41.203  -57.812 1.00 67.64  ? 246  GLY B C   1 
ATOM   5421 O  O   . GLY B 1 268 ? -1.238  41.619  -58.940 1.00 68.59  ? 246  GLY B O   1 
ATOM   5422 N  N   . LYS B 1 269 ? -0.665  41.304  -56.769 1.00 65.52  ? 247  LYS B N   1 
ATOM   5423 C  CA  . LYS B 1 269 ? 0.613   42.028  -56.825 1.00 64.89  ? 247  LYS B CA  1 
ATOM   5424 C  C   . LYS B 1 269 ? 1.775   41.026  -56.743 1.00 61.45  ? 247  LYS B C   1 
ATOM   5425 O  O   . LYS B 1 269 ? 2.000   40.390  -55.712 1.00 58.91  ? 247  LYS B O   1 
ATOM   5426 C  CB  . LYS B 1 269 ? 0.736   43.058  -55.691 1.00 66.28  ? 247  LYS B CB  1 
ATOM   5427 C  CG  . LYS B 1 269 ? -0.330  44.153  -55.651 1.00 69.62  ? 247  LYS B CG  1 
ATOM   5428 N  N   . LEU B 1 270 ? 2.527   40.925  -57.825 1.00 59.89  ? 248  LEU B N   1 
ATOM   5429 C  CA  . LEU B 1 270 ? 3.561   39.943  -57.955 1.00 59.91  ? 248  LEU B CA  1 
ATOM   5430 C  C   . LEU B 1 270 ? 4.528   40.365  -59.074 1.00 58.94  ? 248  LEU B C   1 
ATOM   5431 O  O   . LEU B 1 270 ? 4.098   40.613  -60.182 1.00 58.51  ? 248  LEU B O   1 
ATOM   5432 C  CB  . LEU B 1 270 ? 2.879   38.603  -58.270 1.00 60.49  ? 248  LEU B CB  1 
ATOM   5433 C  CG  . LEU B 1 270 ? 3.745   37.461  -58.692 1.00 62.48  ? 248  LEU B CG  1 
ATOM   5434 C  CD1 . LEU B 1 270 ? 4.763   37.220  -57.594 1.00 64.57  ? 248  LEU B CD1 1 
ATOM   5435 C  CD2 . LEU B 1 270 ? 2.895   36.226  -58.943 1.00 62.83  ? 248  LEU B CD2 1 
ATOM   5436 N  N   . ASP B 1 271 ? 5.824   40.425  -58.776 1.00 57.14  ? 249  ASP B N   1 
ATOM   5437 C  CA  . ASP B 1 271 ? 6.833   40.879  -59.732 1.00 57.29  ? 249  ASP B CA  1 
ATOM   5438 C  C   . ASP B 1 271 ? 7.597   39.751  -60.403 1.00 55.98  ? 249  ASP B C   1 
ATOM   5439 O  O   . ASP B 1 271 ? 8.120   39.932  -61.501 1.00 56.94  ? 249  ASP B O   1 
ATOM   5440 C  CB  . ASP B 1 271 ? 7.842   41.772  -59.029 1.00 57.82  ? 249  ASP B CB  1 
ATOM   5441 C  CG  . ASP B 1 271 ? 7.197   42.972  -58.386 1.00 58.83  ? 249  ASP B CG  1 
ATOM   5442 O  OD1 . ASP B 1 271 ? 6.892   43.934  -59.102 1.00 61.16  ? 249  ASP B OD1 1 
ATOM   5443 O  OD2 . ASP B 1 271 ? 7.000   42.953  -57.167 1.00 58.07  ? 249  ASP B OD2 1 
ATOM   5444 N  N   . MET B 1 272 ? 7.704   38.605  -59.743 1.00 52.26  ? 250  MET B N   1 
ATOM   5445 C  CA  . MET B 1 272 ? 8.435   37.490  -60.319 1.00 51.33  ? 250  MET B CA  1 
ATOM   5446 C  C   . MET B 1 272 ? 7.865   36.156  -59.869 1.00 49.12  ? 250  MET B C   1 
ATOM   5447 O  O   . MET B 1 272 ? 7.461   35.991  -58.713 1.00 48.51  ? 250  MET B O   1 
ATOM   5448 C  CB  . MET B 1 272 ? 9.922   37.580  -59.954 1.00 51.37  ? 250  MET B CB  1 
ATOM   5449 C  CG  . MET B 1 272 ? 10.803  36.489  -60.555 1.00 50.41  ? 250  MET B CG  1 
ATOM   5450 S  SD  . MET B 1 272 ? 12.553  36.750  -60.217 1.00 52.69  ? 250  MET B SD  1 
ATOM   5451 C  CE  . MET B 1 272 ? 12.932  38.057  -61.387 1.00 54.18  ? 250  MET B CE  1 
ATOM   5452 N  N   . LEU B 1 273 ? 7.832   35.213  -60.800 1.00 48.03  ? 251  LEU B N   1 
ATOM   5453 C  CA  . LEU B 1 273 ? 7.499   33.847  -60.489 1.00 46.86  ? 251  LEU B CA  1 
ATOM   5454 C  C   . LEU B 1 273 ? 8.635   32.936  -60.942 1.00 44.96  ? 251  LEU B C   1 
ATOM   5455 O  O   . LEU B 1 273 ? 9.042   33.006  -62.102 1.00 45.79  ? 251  LEU B O   1 
ATOM   5456 C  CB  . LEU B 1 273 ? 6.220   33.409  -61.190 1.00 48.43  ? 251  LEU B CB  1 
ATOM   5457 C  CG  . LEU B 1 273 ? 5.898   31.977  -60.716 1.00 48.63  ? 251  LEU B CG  1 
ATOM   5458 C  CD1 . LEU B 1 273 ? 4.792   31.973  -59.669 1.00 48.92  ? 251  LEU B CD1 1 
ATOM   5459 C  CD2 . LEU B 1 273 ? 5.566   31.078  -61.885 1.00 49.09  ? 251  LEU B CD2 1 
ATOM   5460 N  N   . VAL B 1 274 ? 9.121   32.094  -60.029 1.00 40.59  ? 252  VAL B N   1 
ATOM   5461 C  CA  . VAL B 1 274 ? 10.148  31.103  -60.333 1.00 40.33  ? 252  VAL B CA  1 
ATOM   5462 C  C   . VAL B 1 274 ? 9.589   29.687  -60.175 1.00 37.49  ? 252  VAL B C   1 
ATOM   5463 O  O   . VAL B 1 274 ? 9.084   29.301  -59.109 1.00 36.47  ? 252  VAL B O   1 
ATOM   5464 C  CB  . VAL B 1 274 ? 11.391  31.231  -59.423 1.00 40.13  ? 252  VAL B CB  1 
ATOM   5465 C  CG1 . VAL B 1 274 ? 12.502  30.315  -59.920 1.00 39.38  ? 252  VAL B CG1 1 
ATOM   5466 C  CG2 . VAL B 1 274 ? 11.873  32.673  -59.353 1.00 41.79  ? 252  VAL B CG2 1 
ATOM   5467 N  N   . ALA B 1 275 ? 9.706   28.902  -61.229 1.00 36.78  ? 253  ALA B N   1 
ATOM   5468 C  CA  . ALA B 1 275 ? 9.172   27.541  -61.212 1.00 35.89  ? 253  ALA B CA  1 
ATOM   5469 C  C   . ALA B 1 275 ? 10.092  26.548  -61.938 1.00 36.14  ? 253  ALA B C   1 
ATOM   5470 O  O   . ALA B 1 275 ? 10.596  26.842  -63.032 1.00 37.78  ? 253  ALA B O   1 
ATOM   5471 C  CB  . ALA B 1 275 ? 7.784   27.539  -61.829 1.00 35.88  ? 253  ALA B CB  1 
ATOM   5472 N  N   . SER B 1 276 ? 10.318  25.379  -61.331 1.00 35.79  ? 254  SER B N   1 
ATOM   5473 C  CA  . SER B 1 276 ? 11.059  24.321  -61.998 1.00 34.90  ? 254  SER B CA  1 
ATOM   5474 C  C   . SER B 1 276 ? 10.154  23.623  -63.022 1.00 35.89  ? 254  SER B C   1 
ATOM   5475 O  O   . SER B 1 276 ? 8.923   23.640  -62.919 1.00 37.38  ? 254  SER B O   1 
ATOM   5476 C  CB  . SER B 1 276 ? 11.709  23.354  -61.010 1.00 33.99  ? 254  SER B CB  1 
ATOM   5477 O  OG  . SER B 1 276 ? 10.772  22.630  -60.219 1.00 33.33  ? 254  SER B OG  1 
ATOM   5478 N  N   . VAL B 1 277 ? 10.781  23.049  -64.040 1.00 35.66  ? 255  VAL B N   1 
ATOM   5479 C  CA  . VAL B 1 277 ? 10.052  22.526  -65.183 1.00 35.49  ? 255  VAL B CA  1 
ATOM   5480 C  C   . VAL B 1 277 ? 10.359  21.048  -65.456 1.00 34.91  ? 255  VAL B C   1 
ATOM   5481 O  O   . VAL B 1 277 ? 11.523  20.669  -65.636 1.00 33.29  ? 255  VAL B O   1 
ATOM   5482 C  CB  . VAL B 1 277 ? 10.354  23.341  -66.451 1.00 36.43  ? 255  VAL B CB  1 
ATOM   5483 C  CG1 . VAL B 1 277 ? 9.449   22.895  -67.582 1.00 37.54  ? 255  VAL B CG1 1 
ATOM   5484 C  CG2 . VAL B 1 277 ? 10.161  24.825  -66.182 1.00 37.28  ? 255  VAL B CG2 1 
ATOM   5485 N  N   . GLY B 1 278 ? 9.285   20.252  -65.493 1.00 33.86  ? 256  GLY B N   1 
ATOM   5486 C  CA  . GLY B 1 278 ? 9.307   18.863  -65.941 1.00 32.90  ? 256  GLY B CA  1 
ATOM   5487 C  C   . GLY B 1 278 ? 8.442   18.772  -67.188 1.00 34.34  ? 256  GLY B C   1 
ATOM   5488 O  O   . GLY B 1 278 ? 8.936   18.952  -68.302 1.00 34.47  ? 256  GLY B O   1 
ATOM   5489 N  N   . THR B 1 279 ? 7.139   18.529  -67.015 1.00 34.41  ? 257  THR B N   1 
ATOM   5490 C  CA  . THR B 1 279 ? 6.217   18.529  -68.161 1.00 35.16  ? 257  THR B CA  1 
ATOM   5491 C  C   . THR B 1 279 ? 6.056   19.937  -68.715 1.00 37.27  ? 257  THR B C   1 
ATOM   5492 O  O   . THR B 1 279 ? 5.749   20.130  -69.889 1.00 38.05  ? 257  THR B O   1 
ATOM   5493 C  CB  . THR B 1 279 ? 4.808   18.035  -67.774 1.00 35.66  ? 257  THR B CB  1 
ATOM   5494 O  OG1 . THR B 1 279 ? 4.188   18.957  -66.859 1.00 35.41  ? 257  THR B OG1 1 
ATOM   5495 C  CG2 . THR B 1 279 ? 4.844   16.625  -67.171 1.00 34.54  ? 257  THR B CG2 1 
ATOM   5496 N  N   . GLY B 1 280 ? 6.218   20.924  -67.833 1.00 36.99  ? 258  GLY B N   1 
ATOM   5497 C  CA  . GLY B 1 280 ? 5.973   22.300  -68.166 1.00 38.84  ? 258  GLY B CA  1 
ATOM   5498 C  C   . GLY B 1 280 ? 4.553   22.775  -67.925 1.00 39.46  ? 258  GLY B C   1 
ATOM   5499 O  O   . GLY B 1 280 ? 4.246   23.914  -68.227 1.00 40.47  ? 258  GLY B O   1 
ATOM   5500 N  N   . GLY B 1 281 ? 3.692   21.932  -67.355 1.00 39.28  ? 259  GLY B N   1 
ATOM   5501 C  CA  . GLY B 1 281 ? 2.306   22.329  -67.127 1.00 39.66  ? 259  GLY B CA  1 
ATOM   5502 C  C   . GLY B 1 281 ? 2.177   23.427  -66.085 1.00 39.47  ? 259  GLY B C   1 
ATOM   5503 O  O   . GLY B 1 281 ? 1.398   24.352  -66.255 1.00 41.55  ? 259  GLY B O   1 
ATOM   5504 N  N   . THR B 1 282 ? 2.939   23.321  -65.000 1.00 38.18  ? 260  THR B N   1 
ATOM   5505 C  CA  . THR B 1 282 ? 2.895   24.311  -63.951 1.00 38.65  ? 260  THR B CA  1 
ATOM   5506 C  C   . THR B 1 282 ? 3.287   25.695  -64.487 1.00 40.54  ? 260  THR B C   1 
ATOM   5507 O  O   . THR B 1 282 ? 2.495   26.638  -64.425 1.00 41.27  ? 260  THR B O   1 
ATOM   5508 C  CB  . THR B 1 282 ? 3.790   23.930  -62.740 1.00 37.13  ? 260  THR B CB  1 
ATOM   5509 O  OG1 . THR B 1 282 ? 3.374   22.674  -62.204 1.00 34.92  ? 260  THR B OG1 1 
ATOM   5510 C  CG2 . THR B 1 282 ? 3.673   24.982  -61.663 1.00 37.76  ? 260  THR B CG2 1 
ATOM   5511 N  N   . ILE B 1 283 ? 4.499   25.814  -65.013 1.00 40.16  ? 261  ILE B N   1 
ATOM   5512 C  CA  . ILE B 1 283 ? 4.986   27.111  -65.481 1.00 42.45  ? 261  ILE B CA  1 
ATOM   5513 C  C   . ILE B 1 283 ? 4.134   27.664  -66.635 1.00 44.34  ? 261  ILE B C   1 
ATOM   5514 O  O   . ILE B 1 283 ? 3.873   28.867  -66.695 1.00 46.00  ? 261  ILE B O   1 
ATOM   5515 C  CB  . ILE B 1 283 ? 6.499   27.081  -65.857 1.00 42.96  ? 261  ILE B CB  1 
ATOM   5516 C  CG1 . ILE B 1 283 ? 7.065   28.513  -65.939 1.00 46.45  ? 261  ILE B CG1 1 
ATOM   5517 C  CG2 . ILE B 1 283 ? 6.744   26.331  -67.163 1.00 42.15  ? 261  ILE B CG2 1 
ATOM   5518 C  CD1 . ILE B 1 283 ? 8.570   28.579  -65.755 1.00 46.79  ? 261  ILE B CD1 1 
ATOM   5519 N  N   . THR B 1 284 ? 3.675   26.780  -67.519 1.00 44.91  ? 262  THR B N   1 
ATOM   5520 C  CA  . THR B 1 284 ? 2.852   27.175  -68.664 1.00 47.05  ? 262  THR B CA  1 
ATOM   5521 C  C   . THR B 1 284 ? 1.455   27.651  -68.241 1.00 48.17  ? 262  THR B C   1 
ATOM   5522 O  O   . THR B 1 284 ? 0.995   28.699  -68.675 1.00 48.85  ? 262  THR B O   1 
ATOM   5523 C  CB  . THR B 1 284 ? 2.731   26.025  -69.689 1.00 46.33  ? 262  THR B CB  1 
ATOM   5524 O  OG1 . THR B 1 284 ? 4.038   25.669  -70.156 1.00 45.05  ? 262  THR B OG1 1 
ATOM   5525 C  CG2 . THR B 1 284 ? 1.885   26.447  -70.869 1.00 48.55  ? 262  THR B CG2 1 
ATOM   5526 N  N   . GLY B 1 285 ? 0.787   26.876  -67.398 1.00 47.91  ? 263  GLY B N   1 
ATOM   5527 C  CA  . GLY B 1 285 ? -0.524  27.272  -66.897 1.00 48.42  ? 263  GLY B CA  1 
ATOM   5528 C  C   . GLY B 1 285 ? -0.482  28.550  -66.082 1.00 48.52  ? 263  GLY B C   1 
ATOM   5529 O  O   . GLY B 1 285 ? -1.288  29.460  -66.292 1.00 49.86  ? 263  GLY B O   1 
ATOM   5530 N  N   . ILE B 1 286 ? 0.456   28.628  -65.150 1.00 45.78  ? 264  ILE B N   1 
ATOM   5531 C  CA  . ILE B 1 286 ? 0.597   29.835  -64.343 1.00 46.34  ? 264  ILE B CA  1 
ATOM   5532 C  C   . ILE B 1 286 ? 0.977   31.038  -65.219 1.00 48.30  ? 264  ILE B C   1 
ATOM   5533 O  O   . ILE B 1 286 ? 0.447   32.128  -65.039 1.00 49.37  ? 264  ILE B O   1 
ATOM   5534 C  CB  . ILE B 1 286 ? 1.626   29.660  -63.211 1.00 44.07  ? 264  ILE B CB  1 
ATOM   5535 C  CG1 . ILE B 1 286 ? 1.106   28.674  -62.162 1.00 42.75  ? 264  ILE B CG1 1 
ATOM   5536 C  CG2 . ILE B 1 286 ? 1.921   30.995  -62.531 1.00 46.01  ? 264  ILE B CG2 1 
ATOM   5537 C  CD1 . ILE B 1 286 ? 2.172   28.144  -61.219 1.00 40.80  ? 264  ILE B CD1 1 
ATOM   5538 N  N   . ALA B 1 287 ? 1.899   30.848  -66.160 1.00 48.70  ? 265  ALA B N   1 
ATOM   5539 C  CA  . ALA B 1 287 ? 2.382   31.987  -66.967 1.00 49.96  ? 265  ALA B CA  1 
ATOM   5540 C  C   . ALA B 1 287 ? 1.333   32.546  -67.911 1.00 51.65  ? 265  ALA B C   1 
ATOM   5541 O  O   . ALA B 1 287 ? 1.242   33.752  -68.070 1.00 52.32  ? 265  ALA B O   1 
ATOM   5542 C  CB  . ALA B 1 287 ? 3.617   31.618  -67.754 1.00 49.98  ? 265  ALA B CB  1 
ATOM   5543 N  N   . ARG B 1 288 ? 0.564   31.679  -68.558 1.00 51.48  ? 266  ARG B N   1 
ATOM   5544 C  CA  . ARG B 1 288 ? -0.455  32.160  -69.476 1.00 55.01  ? 266  ARG B CA  1 
ATOM   5545 C  C   . ARG B 1 288 ? -1.448  33.016  -68.714 1.00 56.00  ? 266  ARG B C   1 
ATOM   5546 O  O   . ARG B 1 288 ? -1.837  34.085  -69.185 1.00 57.93  ? 266  ARG B O   1 
ATOM   5547 C  CB  . ARG B 1 288 ? -1.157  31.007  -70.192 1.00 55.71  ? 266  ARG B CB  1 
ATOM   5548 C  CG  . ARG B 1 288 ? -0.267  30.338  -71.232 1.00 56.34  ? 266  ARG B CG  1 
ATOM   5549 C  CD  . ARG B 1 288 ? -1.002  29.268  -72.020 1.00 57.31  ? 266  ARG B CD  1 
ATOM   5550 N  NE  . ARG B 1 288 ? -0.327  28.985  -73.287 1.00 58.23  ? 266  ARG B NE  1 
ATOM   5551 C  CZ  . ARG B 1 288 ? -0.848  28.270  -74.283 1.00 60.06  ? 266  ARG B CZ  1 
ATOM   5552 N  NH1 . ARG B 1 288 ? -2.056  27.733  -74.188 1.00 59.96  ? 266  ARG B NH1 1 
ATOM   5553 N  NH2 . ARG B 1 288 ? -0.142  28.079  -75.389 1.00 61.08  ? 266  ARG B NH2 1 
ATOM   5554 N  N   . LYS B 1 289 ? -1.825  32.567  -67.520 1.00 54.33  ? 267  LYS B N   1 
ATOM   5555 C  CA  . LYS B 1 289 ? -2.754  33.345  -66.703 1.00 56.43  ? 267  LYS B CA  1 
ATOM   5556 C  C   . LYS B 1 289 ? -2.130  34.659  -66.210 1.00 58.10  ? 267  LYS B C   1 
ATOM   5557 O  O   . LYS B 1 289 ? -2.773  35.710  -66.293 1.00 60.13  ? 267  LYS B O   1 
ATOM   5558 C  CB  . LYS B 1 289 ? -3.283  32.523  -65.522 1.00 53.80  ? 267  LYS B CB  1 
ATOM   5559 C  CG  . LYS B 1 289 ? -4.273  33.274  -64.628 1.00 54.86  ? 267  LYS B CG  1 
ATOM   5560 C  CD  . LYS B 1 289 ? -5.525  33.725  -65.360 1.00 57.99  ? 267  LYS B CD  1 
ATOM   5561 C  CE  . LYS B 1 289 ? -6.469  32.565  -65.622 1.00 58.19  ? 267  LYS B CE  1 
ATOM   5562 N  NZ  . LYS B 1 289 ? -7.062  32.042  -64.361 1.00 56.93  ? 267  LYS B NZ  1 
ATOM   5563 N  N   . LEU B 1 290 ? -0.893  34.599  -65.706 1.00 57.34  ? 268  LEU B N   1 
ATOM   5564 C  CA  . LEU B 1 290 ? -0.210  35.801  -65.194 1.00 59.93  ? 268  LEU B CA  1 
ATOM   5565 C  C   . LEU B 1 290 ? 0.085   36.833  -66.288 1.00 63.62  ? 268  LEU B C   1 
ATOM   5566 O  O   . LEU B 1 290 ? -0.034  38.026  -66.054 1.00 65.93  ? 268  LEU B O   1 
ATOM   5567 C  CB  . LEU B 1 290 ? 1.079   35.448  -64.433 1.00 57.94  ? 268  LEU B CB  1 
ATOM   5568 C  CG  . LEU B 1 290 ? 0.904   34.724  -63.091 1.00 57.21  ? 268  LEU B CG  1 
ATOM   5569 C  CD1 . LEU B 1 290 ? 2.235   34.575  -62.369 1.00 55.86  ? 268  LEU B CD1 1 
ATOM   5570 C  CD2 . LEU B 1 290 ? -0.098  35.416  -62.180 1.00 58.92  ? 268  LEU B CD2 1 
ATOM   5571 N  N   . LYS B 1 291 ? 0.444   36.388  -67.483 1.00 65.73  ? 269  LYS B N   1 
ATOM   5572 C  CA  . LYS B 1 291 ? 0.647   37.310  -68.593 1.00 69.06  ? 269  LYS B CA  1 
ATOM   5573 C  C   . LYS B 1 291 ? -0.654  38.063  -68.923 1.00 71.54  ? 269  LYS B C   1 
ATOM   5574 O  O   . LYS B 1 291 ? -0.612  39.224  -69.324 1.00 72.74  ? 269  LYS B O   1 
ATOM   5575 C  CB  . LYS B 1 291 ? 1.139   36.566  -69.835 1.00 71.51  ? 269  LYS B CB  1 
ATOM   5576 C  CG  . LYS B 1 291 ? 2.500   35.899  -69.702 1.00 71.22  ? 269  LYS B CG  1 
ATOM   5577 C  CD  . LYS B 1 291 ? 3.652   36.853  -69.939 1.00 74.10  ? 269  LYS B CD  1 
ATOM   5578 C  CE  . LYS B 1 291 ? 4.956   36.074  -69.961 1.00 73.92  ? 269  LYS B CE  1 
ATOM   5579 N  NZ  . LYS B 1 291 ? 6.104   36.957  -70.282 1.00 76.83  ? 269  LYS B NZ  1 
ATOM   5580 N  N   . GLU B 1 292 ? -1.797  37.397  -68.751 1.00 70.63  ? 270  GLU B N   1 
ATOM   5581 C  CA  . GLU B 1 292 ? -3.107  38.022  -68.940 1.00 73.26  ? 270  GLU B CA  1 
ATOM   5582 C  C   . GLU B 1 292 ? -3.451  38.974  -67.804 1.00 73.95  ? 270  GLU B C   1 
ATOM   5583 O  O   . GLU B 1 292 ? -3.858  40.081  -68.049 1.00 75.18  ? 270  GLU B O   1 
ATOM   5584 C  CB  . GLU B 1 292 ? -4.207  36.967  -69.056 1.00 73.08  ? 270  GLU B CB  1 
ATOM   5585 C  CG  . GLU B 1 292 ? -4.292  36.312  -70.427 1.00 75.53  ? 270  GLU B CG  1 
ATOM   5586 C  CD  . GLU B 1 292 ? -4.903  34.923  -70.383 1.00 74.80  ? 270  GLU B CD  1 
ATOM   5587 O  OE1 . GLU B 1 292 ? -5.598  34.604  -69.399 1.00 74.24  ? 270  GLU B OE1 1 
ATOM   5588 O  OE2 . GLU B 1 292 ? -4.693  34.152  -71.335 1.00 76.34  ? 270  GLU B OE2 1 
ATOM   5589 N  N   . LYS B 1 293 ? -3.284  38.528  -66.562 1.00 73.81  ? 271  LYS B N   1 
ATOM   5590 C  CA  . LYS B 1 293 ? -3.700  39.298  -65.385 1.00 75.32  ? 271  LYS B CA  1 
ATOM   5591 C  C   . LYS B 1 293 ? -2.620  40.234  -64.864 1.00 75.22  ? 271  LYS B C   1 
ATOM   5592 O  O   . LYS B 1 293 ? -2.925  41.282  -64.336 1.00 75.86  ? 271  LYS B O   1 
ATOM   5593 C  CB  . LYS B 1 293 ? -4.077  38.358  -64.237 1.00 73.28  ? 271  LYS B CB  1 
ATOM   5594 C  CG  . LYS B 1 293 ? -5.198  37.378  -64.534 1.00 74.14  ? 271  LYS B CG  1 
ATOM   5595 C  CD  . LYS B 1 293 ? -6.542  38.059  -64.671 1.00 78.17  ? 271  LYS B CD  1 
ATOM   5596 C  CE  . LYS B 1 293 ? -7.659  37.093  -64.317 1.00 79.07  ? 271  LYS B CE  1 
ATOM   5597 N  NZ  . LYS B 1 293 ? -8.968  37.649  -64.750 1.00 82.95  ? 271  LYS B NZ  1 
ATOM   5598 N  N   . CYS B 1 294 ? -1.360  39.836  -64.996 1.00 73.99  ? 272  CYS B N   1 
ATOM   5599 C  CA  . CYS B 1 294 ? -0.267  40.489  -64.290 1.00 74.12  ? 272  CYS B CA  1 
ATOM   5600 C  C   . CYS B 1 294 ? 0.992   40.517  -65.164 1.00 73.81  ? 272  CYS B C   1 
ATOM   5601 O  O   . CYS B 1 294 ? 1.994   39.858  -64.855 1.00 71.09  ? 272  CYS B O   1 
ATOM   5602 C  CB  . CYS B 1 294 ? -0.024  39.738  -62.986 1.00 72.89  ? 272  CYS B CB  1 
ATOM   5603 S  SG  . CYS B 1 294 ? 1.067   40.568  -61.824 1.00 75.77  ? 272  CYS B SG  1 
ATOM   5604 N  N   . PRO B 1 295 ? 0.945   41.285  -66.269 1.00 75.56  ? 273  PRO B N   1 
ATOM   5605 C  CA  . PRO B 1 295 ? 1.988   41.223  -67.301 1.00 76.59  ? 273  PRO B CA  1 
ATOM   5606 C  C   . PRO B 1 295 ? 3.350   41.749  -66.845 1.00 76.36  ? 273  PRO B C   1 
ATOM   5607 O  O   . PRO B 1 295 ? 4.366   41.468  -67.487 1.00 76.66  ? 273  PRO B O   1 
ATOM   5608 C  CB  . PRO B 1 295 ? 1.418   42.086  -68.430 1.00 79.17  ? 273  PRO B CB  1 
ATOM   5609 C  CG  . PRO B 1 295 ? 0.514   43.043  -67.744 1.00 80.64  ? 273  PRO B CG  1 
ATOM   5610 C  CD  . PRO B 1 295 ? -0.068  42.306  -66.573 1.00 78.15  ? 273  PRO B CD  1 
ATOM   5611 N  N   . GLY B 1 296 ? 3.368   42.505  -65.750 1.00 75.49  ? 274  GLY B N   1 
ATOM   5612 C  CA  . GLY B 1 296 ? 4.614   42.936  -65.141 1.00 73.58  ? 274  GLY B CA  1 
ATOM   5613 C  C   . GLY B 1 296 ? 5.363   41.817  -64.455 1.00 70.07  ? 274  GLY B C   1 
ATOM   5614 O  O   . GLY B 1 296 ? 6.520   42.000  -64.088 1.00 69.86  ? 274  GLY B O   1 
ATOM   5615 N  N   . CYS B 1 297 ? 4.709   40.668  -64.263 1.00 67.15  ? 275  CYS B N   1 
ATOM   5616 C  CA  . CYS B 1 297 ? 5.335   39.541  -63.589 1.00 64.93  ? 275  CYS B CA  1 
ATOM   5617 C  C   . CYS B 1 297 ? 6.294   38.785  -64.498 1.00 63.09  ? 275  CYS B C   1 
ATOM   5618 O  O   . CYS B 1 297 ? 5.878   38.188  -65.490 1.00 62.00  ? 275  CYS B O   1 
ATOM   5619 C  CB  . CYS B 1 297 ? 4.293   38.557  -63.050 1.00 63.41  ? 275  CYS B CB  1 
ATOM   5620 S  SG  . CYS B 1 297 ? 5.029   37.277  -61.995 1.00 62.41  ? 275  CYS B SG  1 
ATOM   5621 N  N   . ARG B 1 298 ? 7.569   38.789  -64.125 1.00 61.84  ? 276  ARG B N   1 
ATOM   5622 C  CA  . ARG B 1 298 ? 8.593   38.037  -64.835 1.00 61.32  ? 276  ARG B CA  1 
ATOM   5623 C  C   . ARG B 1 298 ? 8.531   36.547  -64.490 1.00 57.25  ? 276  ARG B C   1 
ATOM   5624 O  O   . ARG B 1 298 ? 8.355   36.156  -63.332 1.00 52.80  ? 276  ARG B O   1 
ATOM   5625 C  CB  . ARG B 1 298 ? 9.979   38.634  -64.558 1.00 64.96  ? 276  ARG B CB  1 
ATOM   5626 C  CG  . ARG B 1 298 ? 10.168  39.994  -65.256 1.00 72.90  ? 276  ARG B CG  1 
ATOM   5627 C  CD  . ARG B 1 298 ? 11.603  40.533  -65.237 1.00 76.28  ? 276  ARG B CD  1 
ATOM   5628 N  NE  . ARG B 1 298 ? 12.624  39.493  -65.424 1.00 76.84  ? 276  ARG B NE  1 
ATOM   5629 C  CZ  . ARG B 1 298 ? 13.042  39.013  -66.596 1.00 76.47  ? 276  ARG B CZ  1 
ATOM   5630 N  NH1 . ARG B 1 298 ? 12.549  39.460  -67.751 1.00 75.75  ? 276  ARG B NH1 1 
ATOM   5631 N  NH2 . ARG B 1 298 ? 13.972  38.064  -66.602 1.00 75.78  ? 276  ARG B NH2 1 
ATOM   5632 N  N   . ILE B 1 299 ? 8.654   35.725  -65.526 1.00 55.14  ? 277  ILE B N   1 
ATOM   5633 C  CA  . ILE B 1 299 ? 8.510   34.281  -65.408 1.00 51.57  ? 277  ILE B CA  1 
ATOM   5634 C  C   . ILE B 1 299 ? 9.889   33.651  -65.589 1.00 48.86  ? 277  ILE B C   1 
ATOM   5635 O  O   . ILE B 1 299 ? 10.526  33.785  -66.648 1.00 47.72  ? 277  ILE B O   1 
ATOM   5636 C  CB  . ILE B 1 299 ? 7.538   33.738  -66.481 1.00 52.97  ? 277  ILE B CB  1 
ATOM   5637 C  CG1 . ILE B 1 299 ? 6.201   34.490  -66.446 1.00 54.83  ? 277  ILE B CG1 1 
ATOM   5638 C  CG2 . ILE B 1 299 ? 7.307   32.246  -66.300 1.00 51.69  ? 277  ILE B CG2 1 
ATOM   5639 C  CD1 . ILE B 1 299 ? 5.413   34.322  -65.162 1.00 54.29  ? 277  ILE B CD1 1 
ATOM   5640 N  N   . ILE B 1 300 ? 10.353  32.988  -64.543 1.00 45.39  ? 278  ILE B N   1 
ATOM   5641 C  CA  . ILE B 1 300 ? 11.668  32.385  -64.529 1.00 44.44  ? 278  ILE B CA  1 
ATOM   5642 C  C   . ILE B 1 300 ? 11.564  30.861  -64.458 1.00 43.49  ? 278  ILE B C   1 
ATOM   5643 O  O   . ILE B 1 300 ? 11.042  30.313  -63.483 1.00 43.06  ? 278  ILE B O   1 
ATOM   5644 C  CB  . ILE B 1 300 ? 12.471  32.878  -63.313 1.00 43.93  ? 278  ILE B CB  1 
ATOM   5645 C  CG1 . ILE B 1 300 ? 12.518  34.422  -63.257 1.00 46.20  ? 278  ILE B CG1 1 
ATOM   5646 C  CG2 . ILE B 1 300 ? 13.853  32.241  -63.298 1.00 43.30  ? 278  ILE B CG2 1 
ATOM   5647 C  CD1 . ILE B 1 300 ? 13.067  35.105  -64.490 1.00 47.44  ? 278  ILE B CD1 1 
ATOM   5648 N  N   . GLY B 1 301 ? 12.091  30.188  -65.480 1.00 42.87  ? 279  GLY B N   1 
ATOM   5649 C  CA  . GLY B 1 301 ? 12.087  28.734  -65.563 1.00 41.65  ? 279  GLY B CA  1 
ATOM   5650 C  C   . GLY B 1 301 ? 13.379  28.100  -65.084 1.00 40.52  ? 279  GLY B C   1 
ATOM   5651 O  O   . GLY B 1 301 ? 14.472  28.577  -65.388 1.00 42.59  ? 279  GLY B O   1 
ATOM   5652 N  N   . VAL B 1 302 ? 13.255  27.023  -64.331 1.00 38.69  ? 280  VAL B N   1 
ATOM   5653 C  CA  . VAL B 1 302 ? 14.421  26.302  -63.831 1.00 39.23  ? 280  VAL B CA  1 
ATOM   5654 C  C   . VAL B 1 302 ? 14.503  24.906  -64.457 1.00 39.13  ? 280  VAL B C   1 
ATOM   5655 O  O   . VAL B 1 302 ? 13.565  24.099  -64.352 1.00 38.85  ? 280  VAL B O   1 
ATOM   5656 C  CB  . VAL B 1 302 ? 14.371  26.195  -62.294 1.00 38.38  ? 280  VAL B CB  1 
ATOM   5657 C  CG1 . VAL B 1 302 ? 15.594  25.459  -61.755 1.00 38.23  ? 280  VAL B CG1 1 
ATOM   5658 C  CG2 . VAL B 1 302 ? 14.257  27.594  -61.692 1.00 40.65  ? 280  VAL B CG2 1 
ATOM   5659 N  N   . ASP B 1 303 ? 15.651  24.628  -65.066 1.00 38.47  ? 281  ASP B N   1 
ATOM   5660 C  CA  . ASP B 1 303 ? 15.912  23.403  -65.784 1.00 37.50  ? 281  ASP B CA  1 
ATOM   5661 C  C   . ASP B 1 303 ? 17.216  22.811  -65.269 1.00 36.91  ? 281  ASP B C   1 
ATOM   5662 O  O   . ASP B 1 303 ? 18.215  23.518  -65.152 1.00 39.00  ? 281  ASP B O   1 
ATOM   5663 C  CB  . ASP B 1 303 ? 16.085  23.749  -67.267 1.00 39.75  ? 281  ASP B CB  1 
ATOM   5664 C  CG  . ASP B 1 303 ? 16.088  22.530  -68.174 1.00 39.70  ? 281  ASP B CG  1 
ATOM   5665 O  OD1 . ASP B 1 303 ? 15.324  21.582  -67.891 1.00 39.01  ? 281  ASP B OD1 1 
ATOM   5666 O  OD2 . ASP B 1 303 ? 16.824  22.545  -69.190 1.00 40.25  ? 281  ASP B OD2 1 
ATOM   5667 N  N   . PRO B 1 304 ? 17.243  21.504  -64.987 1.00 35.89  ? 282  PRO B N   1 
ATOM   5668 C  CA  . PRO B 1 304 ? 18.492  20.935  -64.489 1.00 35.54  ? 282  PRO B CA  1 
ATOM   5669 C  C   . PRO B 1 304 ? 19.540  20.798  -65.581 1.00 38.13  ? 282  PRO B C   1 
ATOM   5670 O  O   . PRO B 1 304 ? 19.183  20.608  -66.742 1.00 39.55  ? 282  PRO B O   1 
ATOM   5671 C  CB  . PRO B 1 304 ? 18.053  19.551  -63.993 1.00 34.40  ? 282  PRO B CB  1 
ATOM   5672 C  CG  . PRO B 1 304 ? 16.928  19.194  -64.881 1.00 33.89  ? 282  PRO B CG  1 
ATOM   5673 C  CD  . PRO B 1 304 ? 16.175  20.489  -65.054 1.00 33.77  ? 282  PRO B CD  1 
ATOM   5674 N  N   . GLU B 1 305 ? 20.817  20.909  -65.216 1.00 40.11  ? 283  GLU B N   1 
ATOM   5675 C  CA  . GLU B 1 305 ? 21.908  20.571  -66.117 1.00 42.16  ? 283  GLU B CA  1 
ATOM   5676 C  C   . GLU B 1 305 ? 21.762  19.117  -66.539 1.00 40.60  ? 283  GLU B C   1 
ATOM   5677 O  O   . GLU B 1 305 ? 21.593  18.221  -65.706 1.00 36.06  ? 283  GLU B O   1 
ATOM   5678 C  CB  . GLU B 1 305 ? 23.266  20.785  -65.460 1.00 46.61  ? 283  GLU B CB  1 
ATOM   5679 C  CG  . GLU B 1 305 ? 23.626  22.252  -65.287 1.00 52.43  ? 283  GLU B CG  1 
ATOM   5680 C  CD  . GLU B 1 305 ? 24.996  22.492  -64.656 1.00 57.56  ? 283  GLU B CD  1 
ATOM   5681 O  OE1 . GLU B 1 305 ? 25.564  21.581  -64.013 1.00 61.30  ? 283  GLU B OE1 1 
ATOM   5682 O  OE2 . GLU B 1 305 ? 25.509  23.619  -64.800 1.00 65.98  ? 283  GLU B OE2 1 
ATOM   5683 N  N   . GLY B 1 306 ? 21.800  18.908  -67.846 1.00 40.62  ? 284  GLY B N   1 
ATOM   5684 C  CA  . GLY B 1 306 ? 21.558  17.612  -68.428 1.00 41.93  ? 284  GLY B CA  1 
ATOM   5685 C  C   . GLY B 1 306 ? 20.286  17.616  -69.243 1.00 42.04  ? 284  GLY B C   1 
ATOM   5686 O  O   . GLY B 1 306 ? 20.172  16.848  -70.167 1.00 46.28  ? 284  GLY B O   1 
ATOM   5687 N  N   . SER B 1 307 ? 19.354  18.506  -68.920 1.00 40.55  ? 285  SER B N   1 
ATOM   5688 C  CA  . SER B 1 307 ? 18.092  18.645  -69.646 1.00 39.54  ? 285  SER B CA  1 
ATOM   5689 C  C   . SER B 1 307 ? 18.263  19.625  -70.814 1.00 41.58  ? 285  SER B C   1 
ATOM   5690 O  O   . SER B 1 307 ? 19.217  20.401  -70.855 1.00 42.29  ? 285  SER B O   1 
ATOM   5691 C  CB  . SER B 1 307 ? 17.010  19.131  -68.683 1.00 37.57  ? 285  SER B CB  1 
ATOM   5692 O  OG  . SER B 1 307 ? 15.829  19.527  -69.346 1.00 38.03  ? 285  SER B OG  1 
ATOM   5693 N  N   . ILE B 1 308 ? 17.325  19.583  -71.755 1.00 42.55  ? 286  ILE B N   1 
ATOM   5694 C  CA  . ILE B 1 308 ? 17.348  20.465  -72.922 1.00 44.16  ? 286  ILE B CA  1 
ATOM   5695 C  C   . ILE B 1 308 ? 16.140  21.411  -72.991 1.00 43.71  ? 286  ILE B C   1 
ATOM   5696 O  O   . ILE B 1 308 ? 15.885  21.988  -74.041 1.00 42.53  ? 286  ILE B O   1 
ATOM   5697 C  CB  . ILE B 1 308 ? 17.392  19.664  -74.238 1.00 46.22  ? 286  ILE B CB  1 
ATOM   5698 C  CG1 . ILE B 1 308 ? 16.116  18.836  -74.407 1.00 45.86  ? 286  ILE B CG1 1 
ATOM   5699 C  CG2 . ILE B 1 308 ? 18.620  18.771  -74.285 1.00 46.93  ? 286  ILE B CG2 1 
ATOM   5700 C  CD1 . ILE B 1 308 ? 15.929  18.333  -75.823 1.00 48.93  ? 286  ILE B CD1 1 
ATOM   5701 N  N   . LEU B 1 309 ? 15.395  21.577  -71.895 1.00 41.39  ? 287  LEU B N   1 
ATOM   5702 C  CA  . LEU B 1 309 ? 14.211  22.439  -71.918 1.00 41.31  ? 287  LEU B CA  1 
ATOM   5703 C  C   . LEU B 1 309 ? 14.568  23.922  -72.021 1.00 43.66  ? 287  LEU B C   1 
ATOM   5704 O  O   . LEU B 1 309 ? 13.849  24.689  -72.665 1.00 44.69  ? 287  LEU B O   1 
ATOM   5705 C  CB  . LEU B 1 309 ? 13.325  22.210  -70.687 1.00 40.48  ? 287  LEU B CB  1 
ATOM   5706 C  CG  . LEU B 1 309 ? 12.751  20.805  -70.468 1.00 38.98  ? 287  LEU B CG  1 
ATOM   5707 C  CD1 . LEU B 1 309 ? 11.923  20.747  -69.190 1.00 38.60  ? 287  LEU B CD1 1 
ATOM   5708 C  CD2 . LEU B 1 309 ? 11.911  20.381  -71.655 1.00 40.83  ? 287  LEU B CD2 1 
ATOM   5709 N  N   . ALA B 1 310 ? 15.686  24.322  -71.422 1.00 44.10  ? 288  ALA B N   1 
ATOM   5710 C  CA  . ALA B 1 310 ? 16.034  25.739  -71.328 1.00 45.59  ? 288  ALA B CA  1 
ATOM   5711 C  C   . ALA B 1 310 ? 16.330  26.382  -72.680 1.00 49.06  ? 288  ALA B C   1 
ATOM   5712 O  O   . ALA B 1 310 ? 16.803  25.712  -73.575 1.00 48.37  ? 288  ALA B O   1 
ATOM   5713 C  CB  . ALA B 1 310 ? 17.221  25.922  -70.405 1.00 45.88  ? 288  ALA B CB  1 
ATOM   5714 N  N   . GLU B 1 311 ? 16.017  27.676  -72.806 1.00 51.38  ? 289  GLU B N   1 
ATOM   5715 C  CA  . GLU B 1 311 ? 16.474  28.519  -73.922 1.00 55.00  ? 289  GLU B CA  1 
ATOM   5716 C  C   . GLU B 1 311 ? 17.224  29.715  -73.349 1.00 56.10  ? 289  GLU B C   1 
ATOM   5717 O  O   . GLU B 1 311 ? 16.900  30.140  -72.238 1.00 56.02  ? 289  GLU B O   1 
ATOM   5718 C  CB  . GLU B 1 311 ? 15.295  29.013  -74.756 1.00 56.43  ? 289  GLU B CB  1 
ATOM   5719 C  CG  . GLU B 1 311 ? 14.487  27.883  -75.384 1.00 56.73  ? 289  GLU B CG  1 
ATOM   5720 C  CD  . GLU B 1 311 ? 13.473  28.407  -76.378 1.00 59.74  ? 289  GLU B CD  1 
ATOM   5721 O  OE1 . GLU B 1 311 ? 12.544  29.109  -75.941 1.00 62.29  ? 289  GLU B OE1 1 
ATOM   5722 O  OE2 . GLU B 1 311 ? 13.607  28.135  -77.589 1.00 60.09  ? 289  GLU B OE2 1 
ATOM   5723 N  N   . PRO B 1 312 ? 18.226  30.256  -74.086 1.00 57.58  ? 290  PRO B N   1 
ATOM   5724 C  CA  . PRO B 1 312 ? 18.661  29.777  -75.405 1.00 59.78  ? 290  PRO B CA  1 
ATOM   5725 C  C   . PRO B 1 312 ? 19.426  28.464  -75.314 1.00 59.38  ? 290  PRO B C   1 
ATOM   5726 O  O   . PRO B 1 312 ? 19.851  28.055  -74.225 1.00 55.95  ? 290  PRO B O   1 
ATOM   5727 C  CB  . PRO B 1 312 ? 19.562  30.912  -75.923 1.00 61.45  ? 290  PRO B CB  1 
ATOM   5728 C  CG  . PRO B 1 312 ? 20.120  31.539  -74.692 1.00 61.46  ? 290  PRO B CG  1 
ATOM   5729 C  CD  . PRO B 1 312 ? 19.072  31.368  -73.605 1.00 58.51  ? 290  PRO B CD  1 
ATOM   5730 N  N   . GLU B 1 313 ? 19.606  27.818  -76.461 1.00 61.49  ? 291  GLU B N   1 
ATOM   5731 C  CA  . GLU B 1 313 ? 20.135  26.463  -76.503 1.00 62.82  ? 291  GLU B CA  1 
ATOM   5732 C  C   . GLU B 1 313 ? 21.555  26.362  -75.971 1.00 61.44  ? 291  GLU B C   1 
ATOM   5733 O  O   . GLU B 1 313 ? 21.969  25.300  -75.519 1.00 58.80  ? 291  GLU B O   1 
ATOM   5734 C  CB  . GLU B 1 313 ? 20.049  25.897  -77.936 1.00 67.94  ? 291  GLU B CB  1 
ATOM   5735 C  CG  . GLU B 1 313 ? 20.192  24.373  -78.047 1.00 71.47  ? 291  GLU B CG  1 
ATOM   5736 C  CD  . GLU B 1 313 ? 19.310  23.581  -77.073 1.00 72.67  ? 291  GLU B CD  1 
ATOM   5737 O  OE1 . GLU B 1 313 ? 18.293  24.121  -76.568 1.00 80.51  ? 291  GLU B OE1 1 
ATOM   5738 O  OE2 . GLU B 1 313 ? 19.634  22.405  -76.791 1.00 73.44  ? 291  GLU B OE2 1 
ATOM   5739 N  N   . GLU B 1 314 ? 22.282  27.470  -75.999 1.00 63.90  ? 292  GLU B N   1 
ATOM   5740 C  CA  . GLU B 1 314 ? 23.644  27.542  -75.465 1.00 67.05  ? 292  GLU B CA  1 
ATOM   5741 C  C   . GLU B 1 314 ? 23.699  27.219  -73.970 1.00 63.00  ? 292  GLU B C   1 
ATOM   5742 O  O   . GLU B 1 314 ? 24.729  26.769  -73.472 1.00 61.39  ? 292  GLU B O   1 
ATOM   5743 C  CB  . GLU B 1 314 ? 24.265  28.934  -75.693 1.00 71.83  ? 292  GLU B CB  1 
ATOM   5744 C  CG  . GLU B 1 314 ? 24.352  29.378  -77.149 1.00 79.34  ? 292  GLU B CG  1 
ATOM   5745 C  CD  . GLU B 1 314 ? 23.095  30.099  -77.617 1.00 83.02  ? 292  GLU B CD  1 
ATOM   5746 O  OE1 . GLU B 1 314 ? 22.029  29.452  -77.703 1.00 82.54  ? 292  GLU B OE1 1 
ATOM   5747 O  OE2 . GLU B 1 314 ? 23.161  31.316  -77.876 1.00 90.15  ? 292  GLU B OE2 1 
ATOM   5748 N  N   . LEU B 1 315 ? 22.603  27.456  -73.250 1.00 60.54  ? 293  LEU B N   1 
ATOM   5749 C  CA  . LEU B 1 315 ? 22.516  27.040  -71.853 1.00 58.88  ? 293  LEU B CA  1 
ATOM   5750 C  C   . LEU B 1 315 ? 22.610  25.532  -71.641 1.00 56.70  ? 293  LEU B C   1 
ATOM   5751 O  O   . LEU B 1 315 ? 22.868  25.085  -70.529 1.00 55.25  ? 293  LEU B O   1 
ATOM   5752 C  CB  . LEU B 1 315 ? 21.207  27.530  -71.218 1.00 57.66  ? 293  LEU B CB  1 
ATOM   5753 C  CG  . LEU B 1 315 ? 21.028  29.032  -71.036 1.00 60.49  ? 293  LEU B CG  1 
ATOM   5754 C  CD1 . LEU B 1 315 ? 19.767  29.305  -70.233 1.00 59.64  ? 293  LEU B CD1 1 
ATOM   5755 C  CD2 . LEU B 1 315 ? 22.230  29.650  -70.337 1.00 62.61  ? 293  LEU B CD2 1 
ATOM   5756 N  N   . ASN B 1 316 ? 22.375  24.739  -72.675 1.00 58.31  ? 294  ASN B N   1 
ATOM   5757 C  CA  . ASN B 1 316 ? 22.274  23.295  -72.487 1.00 58.21  ? 294  ASN B CA  1 
ATOM   5758 C  C   . ASN B 1 316 ? 23.525  22.512  -72.898 1.00 63.40  ? 294  ASN B C   1 
ATOM   5759 O  O   . ASN B 1 316 ? 23.480  21.285  -72.968 1.00 69.16  ? 294  ASN B O   1 
ATOM   5760 C  CB  . ASN B 1 316 ? 21.051  22.768  -73.235 1.00 55.44  ? 294  ASN B CB  1 
ATOM   5761 C  CG  . ASN B 1 316 ? 19.756  23.414  -72.775 1.00 53.81  ? 294  ASN B CG  1 
ATOM   5762 O  OD1 . ASN B 1 316 ? 19.588  23.754  -71.594 1.00 51.05  ? 294  ASN B OD1 1 
ATOM   5763 N  ND2 . ASN B 1 316 ? 18.826  23.586  -73.710 1.00 53.10  ? 294  ASN B ND2 1 
ATOM   5764 N  N   . GLN B 1 317 ? 24.644  23.193  -73.108 1.00 66.58  ? 295  GLN B N   1 
ATOM   5765 C  CA  . GLN B 1 317 ? 25.851  22.538  -73.630 1.00 72.98  ? 295  GLN B CA  1 
ATOM   5766 C  C   . GLN B 1 317 ? 26.657  21.855  -72.524 1.00 75.66  ? 295  GLN B C   1 
ATOM   5767 O  O   . GLN B 1 317 ? 27.540  22.460  -71.918 1.00 83.47  ? 295  GLN B O   1 
ATOM   5768 C  CB  . GLN B 1 317 ? 26.740  23.534  -74.406 1.00 71.43  ? 295  GLN B CB  1 
ATOM   5769 N  N   . THR B 1 318 ? 26.334  20.595  -72.261 1.00 75.34  ? 296  THR B N   1 
ATOM   5770 C  CA  . THR B 1 318 ? 27.185  19.717  -71.458 1.00 74.08  ? 296  THR B CA  1 
ATOM   5771 C  C   . THR B 1 318 ? 27.146  18.300  -72.038 1.00 73.82  ? 296  THR B C   1 
ATOM   5772 O  O   . THR B 1 318 ? 26.272  17.986  -72.845 1.00 74.70  ? 296  THR B O   1 
ATOM   5773 C  CB  . THR B 1 318 ? 26.760  19.690  -69.979 1.00 70.29  ? 296  THR B CB  1 
ATOM   5774 O  OG1 . THR B 1 318 ? 27.517  18.683  -69.303 1.00 71.52  ? 296  THR B OG1 1 
ATOM   5775 C  CG2 . THR B 1 318 ? 25.265  19.400  -69.820 1.00 65.64  ? 296  THR B CG2 1 
ATOM   5776 N  N   . GLU B 1 319 ? 28.097  17.454  -71.645 1.00 74.90  ? 297  GLU B N   1 
ATOM   5777 C  CA  . GLU B 1 319 ? 28.043  16.025  -71.979 1.00 75.01  ? 297  GLU B CA  1 
ATOM   5778 C  C   . GLU B 1 319 ? 27.020  15.308  -71.079 1.00 74.47  ? 297  GLU B C   1 
ATOM   5779 O  O   . GLU B 1 319 ? 26.084  14.661  -71.570 1.00 72.22  ? 297  GLU B O   1 
ATOM   5780 C  CB  . GLU B 1 319 ? 29.419  15.377  -71.819 1.00 76.01  ? 297  GLU B CB  1 
ATOM   5781 N  N   . GLN B 1 320 ? 27.196  15.432  -69.762 1.00 74.73  ? 298  GLN B N   1 
ATOM   5782 C  CA  . GLN B 1 320 ? 26.313  14.750  -68.804 1.00 73.40  ? 298  GLN B CA  1 
ATOM   5783 C  C   . GLN B 1 320 ? 24.856  14.988  -69.151 1.00 65.89  ? 298  GLN B C   1 
ATOM   5784 O  O   . GLN B 1 320 ? 24.462  16.110  -69.465 1.00 63.84  ? 298  GLN B O   1 
ATOM   5785 C  CB  . GLN B 1 320 ? 26.579  15.217  -67.373 1.00 75.71  ? 298  GLN B CB  1 
ATOM   5786 C  CG  . GLN B 1 320 ? 26.487  16.721  -67.171 1.00 77.64  ? 298  GLN B CG  1 
ATOM   5787 C  CD  . GLN B 1 320 ? 26.176  17.080  -65.737 1.00 76.46  ? 298  GLN B CD  1 
ATOM   5788 O  OE1 . GLN B 1 320 ? 27.001  16.879  -64.844 1.00 79.22  ? 298  GLN B OE1 1 
ATOM   5789 N  NE2 . GLN B 1 320 ? 24.991  17.618  -65.508 1.00 71.96  ? 298  GLN B NE2 1 
ATOM   5790 N  N   . THR B 1 321 ? 24.073  13.917  -69.153 1.00 63.17  ? 299  THR B N   1 
ATOM   5791 C  CA  . THR B 1 321 ? 22.622  14.044  -69.301 1.00 61.55  ? 299  THR B CA  1 
ATOM   5792 C  C   . THR B 1 321 ? 21.851  13.402  -68.143 1.00 56.96  ? 299  THR B C   1 
ATOM   5793 O  O   . THR B 1 321 ? 20.611  13.386  -68.192 1.00 56.41  ? 299  THR B O   1 
ATOM   5794 C  CB  . THR B 1 321 ? 22.099  13.476  -70.649 1.00 65.18  ? 299  THR B CB  1 
ATOM   5795 O  OG1 . THR B 1 321 ? 22.024  12.044  -70.579 1.00 64.44  ? 299  THR B OG1 1 
ATOM   5796 C  CG2 . THR B 1 321 ? 22.995  13.925  -71.862 1.00 66.68  ? 299  THR B CG2 1 
ATOM   5797 N  N   . THR B 1 322 ? 22.562  12.900  -67.115 1.00 53.72  ? 300  THR B N   1 
ATOM   5798 C  CA  . THR B 1 322 ? 21.916  12.401  -65.873 1.00 48.97  ? 300  THR B CA  1 
ATOM   5799 C  C   . THR B 1 322 ? 22.207  13.243  -64.640 1.00 43.67  ? 300  THR B C   1 
ATOM   5800 O  O   . THR B 1 322 ? 23.251  13.869  -64.506 1.00 43.34  ? 300  THR B O   1 
ATOM   5801 C  CB  . THR B 1 322 ? 22.363  10.978  -65.474 1.00 51.39  ? 300  THR B CB  1 
ATOM   5802 O  OG1 . THR B 1 322 ? 23.762  10.987  -65.170 1.00 54.64  ? 300  THR B OG1 1 
ATOM   5803 C  CG2 . THR B 1 322 ? 22.081  9.995   -66.567 1.00 55.19  ? 300  THR B CG2 1 
ATOM   5804 N  N   . TYR B 1 323 ? 21.282  13.179  -63.701 1.00 39.32  ? 301  TYR B N   1 
ATOM   5805 C  CA  . TYR B 1 323 ? 21.360  13.982  -62.498 1.00 36.89  ? 301  TYR B CA  1 
ATOM   5806 C  C   . TYR B 1 323 ? 20.470  13.302  -61.470 1.00 34.22  ? 301  TYR B C   1 
ATOM   5807 O  O   . TYR B 1 323 ? 19.578  12.525  -61.830 1.00 31.84  ? 301  TYR B O   1 
ATOM   5808 C  CB  . TYR B 1 323 ? 20.913  15.433  -62.782 1.00 36.24  ? 301  TYR B CB  1 
ATOM   5809 C  CG  . TYR B 1 323 ? 19.644  15.552  -63.616 1.00 34.22  ? 301  TYR B CG  1 
ATOM   5810 C  CD1 . TYR B 1 323 ? 18.398  15.555  -63.022 1.00 33.12  ? 301  TYR B CD1 1 
ATOM   5811 C  CD2 . TYR B 1 323 ? 19.707  15.653  -65.002 1.00 36.06  ? 301  TYR B CD2 1 
ATOM   5812 C  CE1 . TYR B 1 323 ? 17.238  15.651  -63.780 1.00 32.44  ? 301  TYR B CE1 1 
ATOM   5813 C  CE2 . TYR B 1 323 ? 18.561  15.762  -65.771 1.00 36.12  ? 301  TYR B CE2 1 
ATOM   5814 C  CZ  . TYR B 1 323 ? 17.328  15.750  -65.156 1.00 33.88  ? 301  TYR B CZ  1 
ATOM   5815 O  OH  . TYR B 1 323 ? 16.188  15.873  -65.918 1.00 33.13  ? 301  TYR B OH  1 
ATOM   5816 N  N   . GLU B 1 324 ? 20.719  13.606  -60.203 1.00 34.73  ? 302  GLU B N   1 
ATOM   5817 C  CA  . GLU B 1 324 ? 20.002  13.003  -59.065 1.00 32.84  ? 302  GLU B CA  1 
ATOM   5818 C  C   . GLU B 1 324 ? 18.640  13.632  -58.730 1.00 32.64  ? 302  GLU B C   1 
ATOM   5819 O  O   . GLU B 1 324 ? 17.750  12.954  -58.191 1.00 33.22  ? 302  GLU B O   1 
ATOM   5820 C  CB  . GLU B 1 324 ? 20.903  13.018  -57.826 1.00 33.76  ? 302  GLU B CB  1 
ATOM   5821 C  CG  . GLU B 1 324 ? 22.250  12.318  -58.013 1.00 36.17  ? 302  GLU B CG  1 
ATOM   5822 C  CD  . GLU B 1 324 ? 22.117  10.811  -58.091 1.00 37.18  ? 302  GLU B CD  1 
ATOM   5823 O  OE1 . GLU B 1 324 ? 21.076  10.271  -57.696 1.00 37.28  ? 302  GLU B OE1 1 
ATOM   5824 O  OE2 . GLU B 1 324 ? 23.054  10.147  -58.529 1.00 41.51  ? 302  GLU B OE2 1 
ATOM   5825 N  N   . VAL B 1 325 ? 18.444  14.907  -59.029 1.00 32.82  ? 303  VAL B N   1 
ATOM   5826 C  CA  . VAL B 1 325 ? 17.183  15.553  -58.682 1.00 32.82  ? 303  VAL B CA  1 
ATOM   5827 C  C   . VAL B 1 325 ? 16.088  14.894  -59.493 1.00 31.22  ? 303  VAL B C   1 
ATOM   5828 O  O   . VAL B 1 325 ? 16.308  14.567  -60.663 1.00 32.62  ? 303  VAL B O   1 
ATOM   5829 C  CB  . VAL B 1 325 ? 17.194  17.084  -58.920 1.00 33.96  ? 303  VAL B CB  1 
ATOM   5830 C  CG1 . VAL B 1 325 ? 15.783  17.656  -58.794 1.00 33.75  ? 303  VAL B CG1 1 
ATOM   5831 C  CG2 . VAL B 1 325 ? 18.135  17.765  -57.934 1.00 35.20  ? 303  VAL B CG2 1 
ATOM   5832 N  N   . GLU B 1 326 ? 14.934  14.679  -58.864 1.00 29.34  ? 304  GLU B N   1 
ATOM   5833 C  CA  . GLU B 1 326 ? 13.808  13.973  -59.482 1.00 29.86  ? 304  GLU B CA  1 
ATOM   5834 C  C   . GLU B 1 326 ? 12.623  14.899  -59.781 1.00 31.24  ? 304  GLU B C   1 
ATOM   5835 O  O   . GLU B 1 326 ? 12.255  15.723  -58.952 1.00 32.31  ? 304  GLU B O   1 
ATOM   5836 C  CB  . GLU B 1 326 ? 13.324  12.819  -58.574 1.00 28.69  ? 304  GLU B CB  1 
ATOM   5837 C  CG  . GLU B 1 326 ? 14.366  11.749  -58.314 1.00 28.32  ? 304  GLU B CG  1 
ATOM   5838 C  CD  . GLU B 1 326 ? 13.960  10.780  -57.215 1.00 28.27  ? 304  GLU B CD  1 
ATOM   5839 O  OE1 . GLU B 1 326 ? 12.832  10.247  -57.278 1.00 27.80  ? 304  GLU B OE1 1 
ATOM   5840 O  OE2 . GLU B 1 326 ? 14.781  10.553  -56.307 1.00 26.95  ? 304  GLU B OE2 1 
ATOM   5841 N  N   . GLY B 1 327 ? 12.004  14.714  -60.950 1.00 31.24  ? 305  GLY B N   1 
ATOM   5842 C  CA  . GLY B 1 327 ? 10.782  15.420  -61.340 1.00 32.01  ? 305  GLY B CA  1 
ATOM   5843 C  C   . GLY B 1 327 ? 10.921  16.556  -62.342 1.00 32.81  ? 305  GLY B C   1 
ATOM   5844 O  O   . GLY B 1 327 ? 9.905   17.097  -62.810 1.00 35.80  ? 305  GLY B O   1 
ATOM   5845 N  N   . ILE B 1 328 ? 12.158  16.937  -62.663 1.00 32.18  ? 306  ILE B N   1 
ATOM   5846 C  CA  . ILE B 1 328 ? 12.405  18.065  -63.571 1.00 32.58  ? 306  ILE B CA  1 
ATOM   5847 C  C   . ILE B 1 328 ? 13.408  17.699  -64.661 1.00 32.51  ? 306  ILE B C   1 
ATOM   5848 O  O   . ILE B 1 328 ? 14.263  16.825  -64.473 1.00 31.46  ? 306  ILE B O   1 
ATOM   5849 C  CB  . ILE B 1 328 ? 12.873  19.321  -62.802 1.00 32.56  ? 306  ILE B CB  1 
ATOM   5850 C  CG1 . ILE B 1 328 ? 14.151  19.040  -61.995 1.00 32.32  ? 306  ILE B CG1 1 
ATOM   5851 C  CG2 . ILE B 1 328 ? 11.771  19.803  -61.877 1.00 32.29  ? 306  ILE B CG2 1 
ATOM   5852 C  CD1 . ILE B 1 328 ? 14.827  20.279  -61.393 1.00 32.09  ? 306  ILE B CD1 1 
ATOM   5853 N  N   . GLY B 1 329 ? 13.284  18.381  -65.794 1.00 33.35  ? 307  GLY B N   1 
ATOM   5854 C  CA  . GLY B 1 329 ? 14.157  18.173  -66.935 1.00 34.27  ? 307  GLY B CA  1 
ATOM   5855 C  C   . GLY B 1 329 ? 13.747  16.989  -67.775 1.00 34.82  ? 307  GLY B C   1 
ATOM   5856 O  O   . GLY B 1 329 ? 13.192  16.010  -67.260 1.00 32.40  ? 307  GLY B O   1 
ATOM   5857 N  N   . TYR B 1 330 ? 13.989  17.103  -69.081 1.00 35.96  ? 308  TYR B N   1 
ATOM   5858 C  CA  . TYR B 1 330 ? 13.706  16.027  -70.039 1.00 36.79  ? 308  TYR B CA  1 
ATOM   5859 C  C   . TYR B 1 330 ? 14.642  16.117  -71.240 1.00 37.60  ? 308  TYR B C   1 
ATOM   5860 O  O   . TYR B 1 330 ? 15.327  17.136  -71.455 1.00 39.65  ? 308  TYR B O   1 
ATOM   5861 C  CB  . TYR B 1 330 ? 12.228  16.067  -70.518 1.00 37.92  ? 308  TYR B CB  1 
ATOM   5862 C  CG  . TYR B 1 330 ? 11.285  15.382  -69.584 1.00 37.53  ? 308  TYR B CG  1 
ATOM   5863 C  CD1 . TYR B 1 330 ? 11.313  14.000  -69.432 1.00 38.18  ? 308  TYR B CD1 1 
ATOM   5864 C  CD2 . TYR B 1 330 ? 10.409  16.117  -68.780 1.00 37.30  ? 308  TYR B CD2 1 
ATOM   5865 C  CE1 . TYR B 1 330 ? 10.476  13.360  -68.523 1.00 37.27  ? 308  TYR B CE1 1 
ATOM   5866 C  CE2 . TYR B 1 330 ? 9.571   15.486  -67.877 1.00 37.43  ? 308  TYR B CE2 1 
ATOM   5867 C  CZ  . TYR B 1 330 ? 9.601   14.111  -67.760 1.00 37.44  ? 308  TYR B CZ  1 
ATOM   5868 O  OH  . TYR B 1 330 ? 8.773   13.486  -66.874 1.00 36.85  ? 308  TYR B OH  1 
ATOM   5869 N  N   . ASP B 1 331 ? 14.663  15.026  -72.006 1.00 38.03  ? 309  ASP B N   1 
ATOM   5870 C  CA  . ASP B 1 331 ? 15.373  14.948  -73.278 1.00 39.79  ? 309  ASP B CA  1 
ATOM   5871 C  C   . ASP B 1 331 ? 14.487  15.290  -74.471 1.00 40.81  ? 309  ASP B C   1 
ATOM   5872 O  O   . ASP B 1 331 ? 14.875  15.055  -75.600 1.00 41.11  ? 309  ASP B O   1 
ATOM   5873 C  CB  . ASP B 1 331 ? 16.033  13.568  -73.487 1.00 39.91  ? 309  ASP B CB  1 
ATOM   5874 C  CG  . ASP B 1 331 ? 15.053  12.373  -73.367 1.00 39.32  ? 309  ASP B CG  1 
ATOM   5875 O  OD1 . ASP B 1 331 ? 13.954  12.492  -72.784 1.00 40.23  ? 309  ASP B OD1 1 
ATOM   5876 O  OD2 . ASP B 1 331 ? 15.425  11.277  -73.830 1.00 39.55  ? 309  ASP B OD2 1 
ATOM   5877 N  N   . PHE B 1 332 ? 13.300  15.825  -74.233 1.00 39.95  ? 310  PHE B N   1 
ATOM   5878 C  CA  . PHE B 1 332 ? 12.413  16.239  -75.326 1.00 41.98  ? 310  PHE B CA  1 
ATOM   5879 C  C   . PHE B 1 332 ? 11.615  17.425  -74.839 1.00 41.54  ? 310  PHE B C   1 
ATOM   5880 O  O   . PHE B 1 332 ? 11.595  17.676  -73.642 1.00 41.04  ? 310  PHE B O   1 
ATOM   5881 C  CB  . PHE B 1 332 ? 11.476  15.095  -75.737 1.00 42.03  ? 310  PHE B CB  1 
ATOM   5882 C  CG  . PHE B 1 332 ? 10.554  14.611  -74.634 1.00 39.86  ? 310  PHE B CG  1 
ATOM   5883 C  CD1 . PHE B 1 332 ? 10.961  13.628  -73.752 1.00 38.95  ? 310  PHE B CD1 1 
ATOM   5884 C  CD2 . PHE B 1 332 ? 9.256   15.107  -74.519 1.00 40.96  ? 310  PHE B CD2 1 
ATOM   5885 C  CE1 . PHE B 1 332 ? 10.112  13.160  -72.764 1.00 38.38  ? 310  PHE B CE1 1 
ATOM   5886 C  CE2 . PHE B 1 332 ? 8.396   14.656  -73.517 1.00 39.60  ? 310  PHE B CE2 1 
ATOM   5887 C  CZ  . PHE B 1 332 ? 8.821   13.680  -72.637 1.00 38.44  ? 310  PHE B CZ  1 
ATOM   5888 N  N   . ILE B 1 333 ? 10.957  18.138  -75.741 1.00 42.90  ? 311  ILE B N   1 
ATOM   5889 C  CA  . ILE B 1 333 ? 10.110  19.272  -75.348 1.00 44.74  ? 311  ILE B CA  1 
ATOM   5890 C  C   . ILE B 1 333 ? 8.658   18.803  -75.232 1.00 44.17  ? 311  ILE B C   1 
ATOM   5891 O  O   . ILE B 1 333 ? 8.041   18.446  -76.237 1.00 44.85  ? 311  ILE B O   1 
ATOM   5892 C  CB  . ILE B 1 333 ? 10.184  20.424  -76.350 1.00 48.00  ? 311  ILE B CB  1 
ATOM   5893 C  CG1 . ILE B 1 333 ? 11.646  20.788  -76.658 1.00 49.24  ? 311  ILE B CG1 1 
ATOM   5894 C  CG2 . ILE B 1 333 ? 9.434   21.633  -75.809 1.00 48.48  ? 311  ILE B CG2 1 
ATOM   5895 C  CD1 . ILE B 1 333 ? 12.489  21.072  -75.435 1.00 47.00  ? 311  ILE B CD1 1 
ATOM   5896 N  N   . PRO B 1 334 ? 8.113   18.757  -74.004 1.00 41.39  ? 312  PRO B N   1 
ATOM   5897 C  CA  . PRO B 1 334 ? 6.738   18.279  -73.931 1.00 40.65  ? 312  PRO B CA  1 
ATOM   5898 C  C   . PRO B 1 334 ? 5.750   19.198  -74.650 1.00 42.63  ? 312  PRO B C   1 
ATOM   5899 O  O   . PRO B 1 334 ? 5.866   20.421  -74.615 1.00 43.69  ? 312  PRO B O   1 
ATOM   5900 C  CB  . PRO B 1 334 ? 6.456   18.224  -72.429 1.00 39.26  ? 312  PRO B CB  1 
ATOM   5901 C  CG  . PRO B 1 334 ? 7.798   18.142  -71.781 1.00 38.00  ? 312  PRO B CG  1 
ATOM   5902 C  CD  . PRO B 1 334 ? 8.732   18.889  -72.676 1.00 39.96  ? 312  PRO B CD  1 
ATOM   5903 N  N   . THR B 1 335 ? 4.777   18.597  -75.310 1.00 43.72  ? 313  THR B N   1 
ATOM   5904 C  CA  . THR B 1 335 ? 3.738   19.344  -76.007 1.00 45.84  ? 313  THR B CA  1 
ATOM   5905 C  C   . THR B 1 335 ? 3.061   20.430  -75.139 1.00 46.03  ? 313  THR B C   1 
ATOM   5906 O  O   . THR B 1 335 ? 2.717   21.532  -75.635 1.00 46.71  ? 313  THR B O   1 
ATOM   5907 C  CB  . THR B 1 335 ? 2.679   18.360  -76.545 1.00 47.02  ? 313  THR B CB  1 
ATOM   5908 O  OG1 . THR B 1 335 ? 3.310   17.401  -77.418 1.00 46.58  ? 313  THR B OG1 1 
ATOM   5909 C  CG2 . THR B 1 335 ? 1.554   19.095  -77.279 1.00 49.99  ? 313  THR B CG2 1 
ATOM   5910 N  N   . VAL B 1 336 ? 2.850   20.126  -73.860 1.00 43.52  ? 314  VAL B N   1 
ATOM   5911 C  CA  . VAL B 1 336 ? 2.191   21.079  -72.966 1.00 43.72  ? 314  VAL B CA  1 
ATOM   5912 C  C   . VAL B 1 336 ? 3.083   22.253  -72.530 1.00 44.33  ? 314  VAL B C   1 
ATOM   5913 O  O   . VAL B 1 336 ? 2.590   23.216  -71.969 1.00 45.33  ? 314  VAL B O   1 
ATOM   5914 C  CB  . VAL B 1 336 ? 1.565   20.411  -71.714 1.00 42.50  ? 314  VAL B CB  1 
ATOM   5915 C  CG1 . VAL B 1 336 ? 0.461   19.442  -72.117 1.00 43.46  ? 314  VAL B CG1 1 
ATOM   5916 C  CG2 . VAL B 1 336 ? 2.616   19.744  -70.827 1.00 40.10  ? 314  VAL B CG2 1 
ATOM   5917 N  N   . LEU B 1 337 ? 4.388   22.177  -72.766 1.00 44.23  ? 315  LEU B N   1 
ATOM   5918 C  CA  . LEU B 1 337 ? 5.264   23.278  -72.403 1.00 44.32  ? 315  LEU B CA  1 
ATOM   5919 C  C   . LEU B 1 337 ? 5.219   24.377  -73.468 1.00 46.80  ? 315  LEU B C   1 
ATOM   5920 O  O   . LEU B 1 337 ? 5.522   24.148  -74.616 1.00 45.89  ? 315  LEU B O   1 
ATOM   5921 C  CB  . LEU B 1 337 ? 6.693   22.785  -72.169 1.00 43.71  ? 315  LEU B CB  1 
ATOM   5922 C  CG  . LEU B 1 337 ? 7.801   23.812  -71.915 1.00 45.23  ? 315  LEU B CG  1 
ATOM   5923 C  CD1 . LEU B 1 337 ? 7.482   24.717  -70.726 1.00 46.12  ? 315  LEU B CD1 1 
ATOM   5924 C  CD2 . LEU B 1 337 ? 9.139   23.121  -71.697 1.00 44.79  ? 315  LEU B CD2 1 
ATOM   5925 N  N   . ASP B 1 338 ? 4.836   25.585  -73.069 1.00 47.81  ? 316  ASP B N   1 
ATOM   5926 C  CA  . ASP B 1 338 ? 4.910   26.723  -73.966 1.00 50.11  ? 316  ASP B CA  1 
ATOM   5927 C  C   . ASP B 1 338 ? 6.082   27.583  -73.522 1.00 51.08  ? 316  ASP B C   1 
ATOM   5928 O  O   . ASP B 1 338 ? 5.976   28.363  -72.574 1.00 50.53  ? 316  ASP B O   1 
ATOM   5929 C  CB  . ASP B 1 338 ? 3.598   27.492  -73.959 1.00 51.34  ? 316  ASP B CB  1 
ATOM   5930 C  CG  . ASP B 1 338 ? 3.625   28.702  -74.859 1.00 53.52  ? 316  ASP B CG  1 
ATOM   5931 O  OD1 . ASP B 1 338 ? 4.677   28.996  -75.452 1.00 53.19  ? 316  ASP B OD1 1 
ATOM   5932 O  OD2 . ASP B 1 338 ? 2.582   29.375  -74.952 1.00 55.31  ? 316  ASP B OD2 1 
ATOM   5933 N  N   . ARG B 1 339 ? 7.203   27.431  -74.219 1.00 52.88  ? 317  ARG B N   1 
ATOM   5934 C  CA  . ARG B 1 339 ? 8.446   28.122  -73.865 1.00 54.28  ? 317  ARG B CA  1 
ATOM   5935 C  C   . ARG B 1 339 ? 8.437   29.633  -74.171 1.00 55.63  ? 317  ARG B C   1 
ATOM   5936 O  O   . ARG B 1 339 ? 9.280   30.368  -73.646 1.00 54.01  ? 317  ARG B O   1 
ATOM   5937 C  CB  . ARG B 1 339 ? 9.629   27.467  -74.575 1.00 55.88  ? 317  ARG B CB  1 
ATOM   5938 C  CG  . ARG B 1 339 ? 9.848   25.993  -74.237 1.00 54.78  ? 317  ARG B CG  1 
ATOM   5939 C  CD  . ARG B 1 339 ? 10.555  25.298  -75.398 1.00 60.03  ? 317  ARG B CD  1 
ATOM   5940 N  NE  . ARG B 1 339 ? 11.973  25.140  -75.152 1.00 60.25  ? 317  ARG B NE  1 
ATOM   5941 C  CZ  . ARG B 1 339 ? 12.869  24.785  -76.056 1.00 60.52  ? 317  ARG B CZ  1 
ATOM   5942 N  NH1 . ARG B 1 339 ? 12.535  24.562  -77.324 1.00 63.72  ? 317  ARG B NH1 1 
ATOM   5943 N  NH2 . ARG B 1 339 ? 14.125  24.656  -75.671 1.00 61.21  ? 317  ARG B NH2 1 
ATOM   5944 N  N   . THR B 1 340 ? 7.486   30.080  -74.995 1.00 56.74  ? 318  THR B N   1 
ATOM   5945 C  CA  . THR B 1 340 ? 7.328   31.499  -75.312 1.00 60.19  ? 318  THR B CA  1 
ATOM   5946 C  C   . THR B 1 340 ? 6.835   32.330  -74.141 1.00 59.61  ? 318  THR B C   1 
ATOM   5947 O  O   . THR B 1 340 ? 7.018   33.531  -74.137 1.00 61.25  ? 318  THR B O   1 
ATOM   5948 C  CB  . THR B 1 340 ? 6.339   31.745  -76.482 1.00 63.24  ? 318  THR B CB  1 
ATOM   5949 O  OG1 . THR B 1 340 ? 5.025   31.310  -76.100 1.00 63.90  ? 318  THR B OG1 1 
ATOM   5950 C  CG2 . THR B 1 340 ? 6.785   31.025  -77.747 1.00 63.24  ? 318  THR B CG2 1 
ATOM   5951 N  N   . VAL B 1 341 ? 6.209   31.707  -73.146 1.00 59.72  ? 319  VAL B N   1 
ATOM   5952 C  CA  . VAL B 1 341 ? 5.758   32.455  -71.960 1.00 59.69  ? 319  VAL B CA  1 
ATOM   5953 C  C   . VAL B 1 341 ? 6.801   32.487  -70.825 1.00 57.20  ? 319  VAL B C   1 
ATOM   5954 O  O   . VAL B 1 341 ? 6.557   33.068  -69.767 1.00 57.01  ? 319  VAL B O   1 
ATOM   5955 C  CB  . VAL B 1 341 ? 4.357   31.989  -71.464 1.00 59.59  ? 319  VAL B CB  1 
ATOM   5956 C  CG1 . VAL B 1 341 ? 3.292   32.340  -72.494 1.00 62.87  ? 319  VAL B CG1 1 
ATOM   5957 C  CG2 . VAL B 1 341 ? 4.319   30.503  -71.166 1.00 58.41  ? 319  VAL B CG2 1 
ATOM   5958 N  N   . VAL B 1 342 ? 7.965   31.875  -71.042 1.00 55.16  ? 320  VAL B N   1 
ATOM   5959 C  CA  . VAL B 1 342 ? 9.037   31.929  -70.060 1.00 53.22  ? 320  VAL B CA  1 
ATOM   5960 C  C   . VAL B 1 342 ? 9.997   33.035  -70.475 1.00 55.41  ? 320  VAL B C   1 
ATOM   5961 O  O   . VAL B 1 342 ? 10.506  33.041  -71.603 1.00 57.42  ? 320  VAL B O   1 
ATOM   5962 C  CB  . VAL B 1 342 ? 9.772   30.590  -69.943 1.00 51.49  ? 320  VAL B CB  1 
ATOM   5963 C  CG1 . VAL B 1 342 ? 10.895  30.683  -68.915 1.00 50.48  ? 320  VAL B CG1 1 
ATOM   5964 C  CG2 . VAL B 1 342 ? 8.786   29.484  -69.579 1.00 49.88  ? 320  VAL B CG2 1 
ATOM   5965 N  N   . ASP B 1 343 ? 10.219  33.990  -69.580 1.00 55.17  ? 321  ASP B N   1 
ATOM   5966 C  CA  . ASP B 1 343 ? 11.026  35.160  -69.912 1.00 57.51  ? 321  ASP B CA  1 
ATOM   5967 C  C   . ASP B 1 343 ? 12.508  34.848  -69.846 1.00 56.71  ? 321  ASP B C   1 
ATOM   5968 O  O   . ASP B 1 343 ? 13.275  35.370  -70.621 1.00 56.97  ? 321  ASP B O   1 
ATOM   5969 C  CB  . ASP B 1 343 ? 10.678  36.313  -68.987 1.00 58.20  ? 321  ASP B CB  1 
ATOM   5970 C  CG  . ASP B 1 343 ? 9.236   36.743  -69.138 1.00 59.87  ? 321  ASP B CG  1 
ATOM   5971 O  OD1 . ASP B 1 343 ? 8.819   36.949  -70.286 1.00 62.38  ? 321  ASP B OD1 1 
ATOM   5972 O  OD2 . ASP B 1 343 ? 8.512   36.861  -68.131 1.00 59.07  ? 321  ASP B OD2 1 
ATOM   5973 N  N   . LYS B 1 344 ? 12.900  33.970  -68.933 1.00 54.24  ? 322  LYS B N   1 
ATOM   5974 C  CA  . LYS B 1 344 ? 14.303  33.679  -68.719 1.00 54.27  ? 322  LYS B CA  1 
ATOM   5975 C  C   . LYS B 1 344 ? 14.449  32.341  -68.007 1.00 50.74  ? 322  LYS B C   1 
ATOM   5976 O  O   . LYS B 1 344 ? 13.667  32.019  -67.097 1.00 48.33  ? 322  LYS B O   1 
ATOM   5977 C  CB  . LYS B 1 344 ? 14.938  34.781  -67.868 1.00 56.25  ? 322  LYS B CB  1 
ATOM   5978 C  CG  . LYS B 1 344 ? 16.461  34.775  -67.873 1.00 58.18  ? 322  LYS B CG  1 
ATOM   5979 C  CD  . LYS B 1 344 ? 17.007  35.774  -66.864 1.00 59.59  ? 322  LYS B CD  1 
ATOM   5980 C  CE  . LYS B 1 344 ? 18.380  36.300  -67.244 1.00 62.67  ? 322  LYS B CE  1 
ATOM   5981 N  NZ  . LYS B 1 344 ? 19.432  35.269  -67.061 1.00 62.46  ? 322  LYS B NZ  1 
ATOM   5982 N  N   . TRP B 1 345 ? 15.447  31.570  -68.433 1.00 49.32  ? 323  TRP B N   1 
ATOM   5983 C  CA  . TRP B 1 345 ? 15.765  30.294  -67.826 1.00 46.46  ? 323  TRP B CA  1 
ATOM   5984 C  C   . TRP B 1 345 ? 17.081  30.378  -67.063 1.00 46.28  ? 323  TRP B C   1 
ATOM   5985 O  O   . TRP B 1 345 ? 17.989  31.135  -67.441 1.00 47.80  ? 323  TRP B O   1 
ATOM   5986 C  CB  . TRP B 1 345 ? 15.895  29.215  -68.892 1.00 47.06  ? 323  TRP B CB  1 
ATOM   5987 C  CG  . TRP B 1 345 ? 14.652  28.915  -69.634 1.00 47.09  ? 323  TRP B CG  1 
ATOM   5988 C  CD1 . TRP B 1 345 ? 14.128  29.628  -70.669 1.00 49.22  ? 323  TRP B CD1 1 
ATOM   5989 C  CD2 . TRP B 1 345 ? 13.775  27.809  -69.421 1.00 45.45  ? 323  TRP B CD2 1 
ATOM   5990 N  NE1 . TRP B 1 345 ? 12.979  29.029  -71.117 1.00 49.20  ? 323  TRP B NE1 1 
ATOM   5991 C  CE2 . TRP B 1 345 ? 12.737  27.914  -70.362 1.00 46.65  ? 323  TRP B CE2 1 
ATOM   5992 C  CE3 . TRP B 1 345 ? 13.775  26.724  -68.535 1.00 43.25  ? 323  TRP B CE3 1 
ATOM   5993 C  CZ2 . TRP B 1 345 ? 11.703  26.986  -70.437 1.00 45.72  ? 323  TRP B CZ2 1 
ATOM   5994 C  CZ3 . TRP B 1 345 ? 12.736  25.808  -68.604 1.00 41.80  ? 323  TRP B CZ3 1 
ATOM   5995 C  CH2 . TRP B 1 345 ? 11.714  25.950  -69.546 1.00 43.33  ? 323  TRP B CH2 1 
ATOM   5996 N  N   . PHE B 1 346 ? 17.168  29.587  -65.991 1.00 44.47  ? 324  PHE B N   1 
ATOM   5997 C  CA  . PHE B 1 346 ? 18.429  29.317  -65.298 1.00 44.19  ? 324  PHE B CA  1 
ATOM   5998 C  C   . PHE B 1 346 ? 18.613  27.797  -65.272 1.00 42.73  ? 324  PHE B C   1 
ATOM   5999 O  O   . PHE B 1 346 ? 17.644  27.046  -65.151 1.00 41.33  ? 324  PHE B O   1 
ATOM   6000 C  CB  . PHE B 1 346 ? 18.403  29.874  -63.860 1.00 43.81  ? 324  PHE B CB  1 
ATOM   6001 C  CG  . PHE B 1 346 ? 18.395  31.385  -63.779 1.00 46.20  ? 324  PHE B CG  1 
ATOM   6002 C  CD1 . PHE B 1 346 ? 17.254  32.102  -64.105 1.00 46.23  ? 324  PHE B CD1 1 
ATOM   6003 C  CD2 . PHE B 1 346 ? 19.522  32.078  -63.362 1.00 47.96  ? 324  PHE B CD2 1 
ATOM   6004 C  CE1 . PHE B 1 346 ? 17.234  33.483  -64.017 1.00 48.81  ? 324  PHE B CE1 1 
ATOM   6005 C  CE2 . PHE B 1 346 ? 19.518  33.464  -63.277 1.00 50.54  ? 324  PHE B CE2 1 
ATOM   6006 C  CZ  . PHE B 1 346 ? 18.368  34.167  -63.601 1.00 50.50  ? 324  PHE B CZ  1 
ATOM   6007 N  N   . LYS B 1 347 ? 19.858  27.357  -65.368 1.00 43.10  ? 325  LYS B N   1 
ATOM   6008 C  CA  . LYS B 1 347 ? 20.201  25.965  -65.186 1.00 43.36  ? 325  LYS B CA  1 
ATOM   6009 C  C   . LYS B 1 347 ? 20.499  25.734  -63.717 1.00 42.91  ? 325  LYS B C   1 
ATOM   6010 O  O   . LYS B 1 347 ? 21.130  26.573  -63.099 1.00 45.07  ? 325  LYS B O   1 
ATOM   6011 C  CB  . LYS B 1 347 ? 21.426  25.608  -66.014 1.00 44.07  ? 325  LYS B CB  1 
ATOM   6012 C  CG  . LYS B 1 347 ? 21.250  25.854  -67.498 1.00 45.59  ? 325  LYS B CG  1 
ATOM   6013 C  CD  . LYS B 1 347 ? 20.145  25.002  -68.117 1.00 44.54  ? 325  LYS B CD  1 
ATOM   6014 C  CE  . LYS B 1 347 ? 20.558  23.538  -68.210 1.00 44.01  ? 325  LYS B CE  1 
ATOM   6015 N  NZ  . LYS B 1 347 ? 19.645  22.771  -69.097 1.00 43.57  ? 325  LYS B NZ  1 
ATOM   6016 N  N   . SER B 1 348 ? 20.035  24.615  -63.161 1.00 41.03  ? 326  SER B N   1 
ATOM   6017 C  CA  . SER B 1 348 ? 20.402  24.218  -61.786 1.00 40.33  ? 326  SER B CA  1 
ATOM   6018 C  C   . SER B 1 348 ? 21.212  22.920  -61.782 1.00 40.96  ? 326  SER B C   1 
ATOM   6019 O  O   . SER B 1 348 ? 21.169  22.170  -62.762 1.00 42.57  ? 326  SER B O   1 
ATOM   6020 C  CB  . SER B 1 348 ? 19.163  24.057  -60.911 1.00 38.47  ? 326  SER B CB  1 
ATOM   6021 O  OG  . SER B 1 348 ? 18.276  23.099  -61.461 1.00 37.97  ? 326  SER B OG  1 
ATOM   6022 N  N   . ASN B 1 349 ? 21.963  22.666  -60.704 1.00 39.57  ? 327  ASN B N   1 
ATOM   6023 C  CA  . ASN B 1 349 ? 22.665  21.385  -60.530 1.00 39.06  ? 327  ASN B CA  1 
ATOM   6024 C  C   . ASN B 1 349 ? 22.207  20.700  -59.249 1.00 37.07  ? 327  ASN B C   1 
ATOM   6025 O  O   . ASN B 1 349 ? 21.468  21.292  -58.437 1.00 36.45  ? 327  ASN B O   1 
ATOM   6026 C  CB  . ASN B 1 349 ? 24.207  21.547  -60.619 1.00 40.50  ? 327  ASN B CB  1 
ATOM   6027 C  CG  . ASN B 1 349 ? 24.790  22.404  -59.499 1.00 41.91  ? 327  ASN B CG  1 
ATOM   6028 O  OD1 . ASN B 1 349 ? 24.386  22.327  -58.352 1.00 41.07  ? 327  ASN B OD1 1 
ATOM   6029 N  ND2 . ASN B 1 349 ? 25.766  23.209  -59.834 1.00 44.33  ? 327  ASN B ND2 1 
ATOM   6030 N  N   . ASP B 1 350 ? 22.599  19.444  -59.087 1.00 35.43  ? 328  ASP B N   1 
ATOM   6031 C  CA  . ASP B 1 350 ? 22.190  18.641  -57.942 1.00 34.60  ? 328  ASP B CA  1 
ATOM   6032 C  C   . ASP B 1 350 ? 22.703  19.219  -56.626 1.00 35.88  ? 328  ASP B C   1 
ATOM   6033 O  O   . ASP B 1 350 ? 21.964  19.277  -55.641 1.00 36.06  ? 328  ASP B O   1 
ATOM   6034 C  CB  . ASP B 1 350 ? 22.706  17.199  -58.066 1.00 35.67  ? 328  ASP B CB  1 
ATOM   6035 C  CG  . ASP B 1 350 ? 21.991  16.389  -59.135 1.00 35.47  ? 328  ASP B CG  1 
ATOM   6036 O  OD1 . ASP B 1 350 ? 20.846  16.728  -59.521 1.00 36.25  ? 328  ASP B OD1 1 
ATOM   6037 O  OD2 . ASP B 1 350 ? 22.569  15.365  -59.569 1.00 34.56  ? 328  ASP B OD2 1 
ATOM   6038 N  N   . GLU B 1 351 ? 23.968  19.611  -56.592 1.00 37.32  ? 329  GLU B N   1 
ATOM   6039 C  CA  . GLU B 1 351 ? 24.552  20.094  -55.347 1.00 40.69  ? 329  GLU B CA  1 
ATOM   6040 C  C   . GLU B 1 351 ? 23.795  21.292  -54.761 1.00 39.44  ? 329  GLU B C   1 
ATOM   6041 O  O   . GLU B 1 351 ? 23.489  21.324  -53.566 1.00 37.02  ? 329  GLU B O   1 
ATOM   6042 C  CB  . GLU B 1 351 ? 26.010  20.458  -55.528 1.00 45.03  ? 329  GLU B CB  1 
ATOM   6043 C  CG  . GLU B 1 351 ? 26.743  20.574  -54.204 1.00 50.81  ? 329  GLU B CG  1 
ATOM   6044 C  CD  . GLU B 1 351 ? 28.211  20.936  -54.378 1.00 58.95  ? 329  GLU B CD  1 
ATOM   6045 O  OE1 . GLU B 1 351 ? 28.631  21.233  -55.524 1.00 64.15  ? 329  GLU B OE1 1 
ATOM   6046 O  OE2 . GLU B 1 351 ? 28.946  20.927  -53.365 1.00 64.77  ? 329  GLU B OE2 1 
ATOM   6047 N  N   . GLU B 1 352 ? 23.472  22.267  -55.596 1.00 38.42  ? 330  GLU B N   1 
ATOM   6048 C  CA  . GLU B 1 352 ? 22.752  23.416  -55.079 1.00 39.55  ? 330  GLU B CA  1 
ATOM   6049 C  C   . GLU B 1 352 ? 21.310  23.047  -54.744 1.00 35.72  ? 330  GLU B C   1 
ATOM   6050 O  O   . GLU B 1 352 ? 20.768  23.545  -53.766 1.00 35.13  ? 330  GLU B O   1 
ATOM   6051 C  CB  . GLU B 1 352 ? 22.853  24.644  -56.009 1.00 41.86  ? 330  GLU B CB  1 
ATOM   6052 C  CG  . GLU B 1 352 ? 21.987  24.580  -57.257 1.00 42.68  ? 330  GLU B CG  1 
ATOM   6053 C  CD  . GLU B 1 352 ? 22.434  25.597  -58.305 1.00 45.74  ? 330  GLU B CD  1 
ATOM   6054 O  OE1 . GLU B 1 352 ? 22.859  26.718  -57.948 1.00 46.20  ? 330  GLU B OE1 1 
ATOM   6055 O  OE2 . GLU B 1 352 ? 22.356  25.269  -59.490 1.00 45.33  ? 330  GLU B OE2 1 
ATOM   6056 N  N   . ALA B 1 353 ? 20.698  22.169  -55.533 1.00 33.83  ? 331  ALA B N   1 
ATOM   6057 C  CA  . ALA B 1 353 ? 19.342  21.749  -55.259 1.00 32.67  ? 331  ALA B CA  1 
ATOM   6058 C  C   . ALA B 1 353 ? 19.238  21.165  -53.837 1.00 32.34  ? 331  ALA B C   1 
ATOM   6059 O  O   . ALA B 1 353 ? 18.355  21.534  -53.063 1.00 30.56  ? 331  ALA B O   1 
ATOM   6060 C  CB  . ALA B 1 353 ? 18.870  20.733  -56.270 1.00 31.52  ? 331  ALA B CB  1 
ATOM   6061 N  N   . PHE B 1 354 ? 20.153  20.266  -53.498 1.00 31.92  ? 332  PHE B N   1 
ATOM   6062 C  CA  . PHE B 1 354 ? 20.055  19.565  -52.242 1.00 31.71  ? 332  PHE B CA  1 
ATOM   6063 C  C   . PHE B 1 354 ? 20.532  20.433  -51.074 1.00 32.14  ? 332  PHE B C   1 
ATOM   6064 O  O   . PHE B 1 354 ? 20.020  20.328  -49.948 1.00 31.05  ? 332  PHE B O   1 
ATOM   6065 C  CB  . PHE B 1 354 ? 20.814  18.246  -52.319 1.00 32.28  ? 332  PHE B CB  1 
ATOM   6066 C  CG  . PHE B 1 354 ? 20.282  17.301  -53.362 1.00 31.07  ? 332  PHE B CG  1 
ATOM   6067 C  CD1 . PHE B 1 354 ? 18.931  17.140  -53.558 1.00 30.53  ? 332  PHE B CD1 1 
ATOM   6068 C  CD2 . PHE B 1 354 ? 21.144  16.548  -54.123 1.00 32.71  ? 332  PHE B CD2 1 
ATOM   6069 C  CE1 . PHE B 1 354 ? 18.439  16.253  -54.501 1.00 30.75  ? 332  PHE B CE1 1 
ATOM   6070 C  CE2 . PHE B 1 354 ? 20.659  15.670  -55.082 1.00 31.54  ? 332  PHE B CE2 1 
ATOM   6071 C  CZ  . PHE B 1 354 ? 19.315  15.520  -55.272 1.00 30.23  ? 332  PHE B CZ  1 
ATOM   6072 N  N   . THR B 1 355 ? 21.491  21.300  -51.344 1.00 32.24  ? 333  THR B N   1 
ATOM   6073 C  CA  . THR B 1 355 ? 21.946  22.281  -50.358 1.00 34.70  ? 333  THR B CA  1 
ATOM   6074 C  C   . THR B 1 355 ? 20.772  23.168  -49.945 1.00 33.24  ? 333  THR B C   1 
ATOM   6075 O  O   . THR B 1 355 ? 20.496  23.345  -48.745 1.00 31.09  ? 333  THR B O   1 
ATOM   6076 C  CB  . THR B 1 355 ? 23.120  23.096  -50.932 1.00 38.84  ? 333  THR B CB  1 
ATOM   6077 O  OG1 . THR B 1 355 ? 24.221  22.207  -51.200 1.00 39.77  ? 333  THR B OG1 1 
ATOM   6078 C  CG2 . THR B 1 355 ? 23.568  24.178  -49.965 1.00 42.31  ? 333  THR B CG2 1 
ATOM   6079 N  N   . PHE B 1 356 ? 20.044  23.665  -50.948 1.00 31.98  ? 334  PHE B N   1 
ATOM   6080 C  CA  . PHE B 1 356 ? 18.908  24.522  -50.702 1.00 32.30  ? 334  PHE B CA  1 
ATOM   6081 C  C   . PHE B 1 356 ? 17.691  23.800  -50.130 1.00 31.14  ? 334  PHE B C   1 
ATOM   6082 O  O   . PHE B 1 356 ? 16.977  24.386  -49.304 1.00 29.89  ? 334  PHE B O   1 
ATOM   6083 C  CB  . PHE B 1 356 ? 18.539  25.351  -51.925 1.00 33.12  ? 334  PHE B CB  1 
ATOM   6084 C  CG  . PHE B 1 356 ? 19.348  26.619  -52.048 1.00 35.55  ? 334  PHE B CG  1 
ATOM   6085 C  CD1 . PHE B 1 356 ? 20.611  26.601  -52.614 1.00 36.34  ? 334  PHE B CD1 1 
ATOM   6086 C  CD2 . PHE B 1 356 ? 18.848  27.835  -51.571 1.00 36.35  ? 334  PHE B CD2 1 
ATOM   6087 C  CE1 . PHE B 1 356 ? 21.359  27.760  -52.723 1.00 37.87  ? 334  PHE B CE1 1 
ATOM   6088 C  CE2 . PHE B 1 356 ? 19.598  28.991  -51.669 1.00 38.39  ? 334  PHE B CE2 1 
ATOM   6089 C  CZ  . PHE B 1 356 ? 20.856  28.954  -52.246 1.00 39.00  ? 334  PHE B CZ  1 
ATOM   6090 N  N   . ALA B 1 357 ? 17.482  22.540  -50.494 1.00 30.21  ? 335  ALA B N   1 
ATOM   6091 C  CA  . ALA B 1 357 ? 16.390  21.773  -49.891 1.00 29.38  ? 335  ALA B CA  1 
ATOM   6092 C  C   . ALA B 1 357 ? 16.646  21.568  -48.401 1.00 29.85  ? 335  ALA B C   1 
ATOM   6093 O  O   . ALA B 1 357 ? 15.738  21.750  -47.587 1.00 29.91  ? 335  ALA B O   1 
ATOM   6094 C  CB  . ALA B 1 357 ? 16.174  20.450  -50.606 1.00 29.47  ? 335  ALA B CB  1 
ATOM   6095 N  N   . ARG B 1 358 ? 17.890  21.259  -48.037 1.00 29.76  ? 336  ARG B N   1 
ATOM   6096 C  CA  . ARG B 1 358 ? 18.245  21.097  -46.646 1.00 31.25  ? 336  ARG B CA  1 
ATOM   6097 C  C   . ARG B 1 358 ? 18.154  22.411  -45.863 1.00 32.70  ? 336  ARG B C   1 
ATOM   6098 O  O   . ARG B 1 358 ? 17.753  22.428  -44.697 1.00 29.49  ? 336  ARG B O   1 
ATOM   6099 C  CB  . ARG B 1 358 ? 19.602  20.384  -46.538 1.00 33.19  ? 336  ARG B CB  1 
ATOM   6100 C  CG  . ARG B 1 358 ? 19.454  18.904  -46.954 1.00 33.14  ? 336  ARG B CG  1 
ATOM   6101 C  CD  . ARG B 1 358 ? 20.739  18.233  -47.402 1.00 34.98  ? 336  ARG B CD  1 
ATOM   6102 N  NE  . ARG B 1 358 ? 21.734  18.158  -46.350 1.00 36.29  ? 336  ARG B NE  1 
ATOM   6103 C  CZ  . ARG B 1 358 ? 22.005  17.105  -45.587 1.00 36.24  ? 336  ARG B CZ  1 
ATOM   6104 N  NH1 . ARG B 1 358 ? 21.365  15.957  -45.708 1.00 35.51  ? 336  ARG B NH1 1 
ATOM   6105 N  NH2 . ARG B 1 358 ? 22.959  17.217  -44.679 1.00 38.57  ? 336  ARG B NH2 1 
ATOM   6106 N  N   . MET B 1 359 ? 18.469  23.515  -46.536 1.00 33.00  ? 337  MET B N   1 
ATOM   6107 C  CA  . MET B 1 359 ? 18.349  24.835  -45.947 1.00 35.07  ? 337  MET B CA  1 
ATOM   6108 C  C   . MET B 1 359 ? 16.870  25.206  -45.693 1.00 33.19  ? 337  MET B C   1 
ATOM   6109 O  O   . MET B 1 359 ? 16.537  25.763  -44.660 1.00 32.24  ? 337  MET B O   1 
ATOM   6110 C  CB  . MET B 1 359 ? 19.001  25.847  -46.881 1.00 37.82  ? 337  MET B CB  1 
ATOM   6111 C  CG  . MET B 1 359 ? 19.558  27.087  -46.243 1.00 42.51  ? 337  MET B CG  1 
ATOM   6112 S  SD  . MET B 1 359 ? 20.352  28.142  -47.502 1.00 47.34  ? 337  MET B SD  1 
ATOM   6113 C  CE  . MET B 1 359 ? 21.868  27.250  -47.804 1.00 46.90  ? 337  MET B CE  1 
ATOM   6114 N  N   . LEU B 1 360 ? 16.013  24.946  -46.670 1.00 31.34  ? 338  LEU B N   1 
ATOM   6115 C  CA  . LEU B 1 360 ? 14.575  25.175  -46.554 1.00 31.50  ? 338  LEU B CA  1 
ATOM   6116 C  C   . LEU B 1 360 ? 13.994  24.435  -45.340 1.00 30.43  ? 338  LEU B C   1 
ATOM   6117 O  O   . LEU B 1 360 ? 13.164  24.970  -44.599 1.00 30.09  ? 338  LEU B O   1 
ATOM   6118 C  CB  . LEU B 1 360 ? 13.861  24.706  -47.844 1.00 31.21  ? 338  LEU B CB  1 
ATOM   6119 C  CG  . LEU B 1 360 ? 13.941  25.725  -48.990 1.00 32.31  ? 338  LEU B CG  1 
ATOM   6120 C  CD1 . LEU B 1 360 ? 13.578  25.085  -50.327 1.00 32.75  ? 338  LEU B CD1 1 
ATOM   6121 C  CD2 . LEU B 1 360 ? 13.058  26.937  -48.730 1.00 31.43  ? 338  LEU B CD2 1 
ATOM   6122 N  N   . ILE B 1 361 ? 14.463  23.211  -45.119 1.00 29.01  ? 339  ILE B N   1 
ATOM   6123 C  CA  . ILE B 1 361 ? 14.043  22.441  -43.948 1.00 28.22  ? 339  ILE B CA  1 
ATOM   6124 C  C   . ILE B 1 361 ? 14.597  23.030  -42.676 1.00 28.45  ? 339  ILE B C   1 
ATOM   6125 O  O   . ILE B 1 361 ? 13.839  23.300  -41.735 1.00 28.73  ? 339  ILE B O   1 
ATOM   6126 C  CB  . ILE B 1 361 ? 14.423  20.943  -44.059 1.00 27.83  ? 339  ILE B CB  1 
ATOM   6127 C  CG1 . ILE B 1 361 ? 13.652  20.292  -45.194 1.00 27.27  ? 339  ILE B CG1 1 
ATOM   6128 C  CG2 . ILE B 1 361 ? 14.100  20.228  -42.747 1.00 29.13  ? 339  ILE B CG2 1 
ATOM   6129 C  CD1 . ILE B 1 361 ? 14.279  18.995  -45.693 1.00 28.68  ? 339  ILE B CD1 1 
ATOM   6130 N  N   . ALA B 1 362 ? 15.905  23.253  -42.638 1.00 28.30  ? 340  ALA B N   1 
ATOM   6131 C  CA  . ALA B 1 362 ? 16.587  23.672  -41.419 1.00 29.63  ? 340  ALA B CA  1 
ATOM   6132 C  C   . ALA B 1 362 ? 16.300  25.113  -40.956 1.00 31.73  ? 340  ALA B C   1 
ATOM   6133 O  O   . ALA B 1 362 ? 16.329  25.403  -39.764 1.00 30.97  ? 340  ALA B O   1 
ATOM   6134 C  CB  . ALA B 1 362 ? 18.092  23.491  -41.577 1.00 30.78  ? 340  ALA B CB  1 
ATOM   6135 N  N   . GLN B 1 363 ? 16.052  26.007  -41.896 1.00 33.05  ? 341  GLN B N   1 
ATOM   6136 C  CA  . GLN B 1 363 ? 15.876  27.421  -41.597 1.00 37.36  ? 341  GLN B CA  1 
ATOM   6137 C  C   . GLN B 1 363 ? 14.433  27.895  -41.680 1.00 36.13  ? 341  GLN B C   1 
ATOM   6138 O  O   . GLN B 1 363 ? 14.104  28.865  -41.023 1.00 38.12  ? 341  GLN B O   1 
ATOM   6139 C  CB  . GLN B 1 363 ? 16.733  28.288  -42.529 1.00 40.04  ? 341  GLN B CB  1 
ATOM   6140 C  CG  . GLN B 1 363 ? 18.225  28.064  -42.357 1.00 43.50  ? 341  GLN B CG  1 
ATOM   6141 C  CD  . GLN B 1 363 ? 19.034  29.237  -42.831 1.00 49.85  ? 341  GLN B CD  1 
ATOM   6142 O  OE1 . GLN B 1 363 ? 19.616  29.203  -43.901 1.00 55.22  ? 341  GLN B OE1 1 
ATOM   6143 N  NE2 . GLN B 1 363 ? 19.067  30.295  -42.035 1.00 56.09  ? 341  GLN B NE2 1 
ATOM   6144 N  N   . GLU B 1 364 ? 13.601  27.246  -42.493 1.00 33.98  ? 342  GLU B N   1 
ATOM   6145 C  CA  . GLU B 1 364 ? 12.198  27.672  -42.687 1.00 33.36  ? 342  GLU B CA  1 
ATOM   6146 C  C   . GLU B 1 364 ? 11.176  26.648  -42.197 1.00 32.13  ? 342  GLU B C   1 
ATOM   6147 O  O   . GLU B 1 364 ? 9.981   26.914  -42.180 1.00 32.09  ? 342  GLU B O   1 
ATOM   6148 C  CB  . GLU B 1 364 ? 11.924  27.940  -44.161 1.00 32.55  ? 342  GLU B CB  1 
ATOM   6149 C  CG  . GLU B 1 364 ? 12.951  28.845  -44.834 1.00 35.37  ? 342  GLU B CG  1 
ATOM   6150 C  CD  . GLU B 1 364 ? 12.889  30.299  -44.396 1.00 38.08  ? 342  GLU B CD  1 
ATOM   6151 O  OE1 . GLU B 1 364 ? 11.822  30.757  -43.877 1.00 39.26  ? 342  GLU B OE1 1 
ATOM   6152 O  OE2 . GLU B 1 364 ? 13.929  30.999  -44.554 1.00 39.72  ? 342  GLU B OE2 1 
ATOM   6153 N  N   . GLY B 1 365 ? 11.640  25.463  -41.812 1.00 31.79  ? 343  GLY B N   1 
ATOM   6154 C  CA  . GLY B 1 365 ? 10.753  24.399  -41.378 1.00 29.94  ? 343  GLY B CA  1 
ATOM   6155 C  C   . GLY B 1 365 ? 9.857   23.920  -42.500 1.00 29.56  ? 343  GLY B C   1 
ATOM   6156 O  O   . GLY B 1 365 ? 8.787   23.418  -42.238 1.00 28.62  ? 343  GLY B O   1 
ATOM   6157 N  N   . LEU B 1 366 ? 10.291  24.077  -43.751 1.00 28.29  ? 344  LEU B N   1 
ATOM   6158 C  CA  . LEU B 1 366 ? 9.493   23.648  -44.884 1.00 28.58  ? 344  LEU B CA  1 
ATOM   6159 C  C   . LEU B 1 366 ? 9.944   22.264  -45.359 1.00 28.44  ? 344  LEU B C   1 
ATOM   6160 O  O   . LEU B 1 366 ? 10.999  22.146  -45.962 1.00 29.97  ? 344  LEU B O   1 
ATOM   6161 C  CB  . LEU B 1 366 ? 9.608   24.673  -46.011 1.00 30.24  ? 344  LEU B CB  1 
ATOM   6162 C  CG  . LEU B 1 366 ? 9.093   26.096  -45.727 1.00 31.80  ? 344  LEU B CG  1 
ATOM   6163 C  CD1 . LEU B 1 366 ? 9.436   27.049  -46.863 1.00 33.34  ? 344  LEU B CD1 1 
ATOM   6164 C  CD2 . LEU B 1 366 ? 7.587   26.077  -45.484 1.00 33.42  ? 344  LEU B CD2 1 
ATOM   6165 N  N   . LEU B 1 367 ? 9.139   21.235  -45.099 1.00 26.97  ? 345  LEU B N   1 
ATOM   6166 C  CA  . LEU B 1 367 ? 9.535   19.836  -45.337 1.00 27.74  ? 345  LEU B CA  1 
ATOM   6167 C  C   . LEU B 1 367 ? 9.346   19.414  -46.807 1.00 27.28  ? 345  LEU B C   1 
ATOM   6168 O  O   . LEU B 1 367 ? 8.523   18.557  -47.122 1.00 25.19  ? 345  LEU B O   1 
ATOM   6169 C  CB  . LEU B 1 367 ? 8.791   18.912  -44.365 1.00 28.09  ? 345  LEU B CB  1 
ATOM   6170 C  CG  . LEU B 1 367 ? 9.254   19.120  -42.926 1.00 30.97  ? 345  LEU B CG  1 
ATOM   6171 C  CD1 . LEU B 1 367 ? 8.280   18.481  -41.948 1.00 32.71  ? 345  LEU B CD1 1 
ATOM   6172 C  CD2 . LEU B 1 367 ? 10.659  18.587  -42.686 1.00 31.63  ? 345  LEU B CD2 1 
ATOM   6173 N  N   . CYS B 1 368 ? 10.118  20.051  -47.690 1.00 27.06  ? 346  CYS B N   1 
ATOM   6174 C  CA  . CYS B 1 368 ? 9.950   19.952  -49.140 1.00 28.15  ? 346  CYS B CA  1 
ATOM   6175 C  C   . CYS B 1 368 ? 11.020  19.054  -49.790 1.00 28.33  ? 346  CYS B C   1 
ATOM   6176 O  O   . CYS B 1 368 ? 11.952  18.590  -49.120 1.00 26.88  ? 346  CYS B O   1 
ATOM   6177 C  CB  . CYS B 1 368 ? 10.031  21.351  -49.756 1.00 30.44  ? 346  CYS B CB  1 
ATOM   6178 S  SG  . CYS B 1 368 ? 11.656  22.116  -49.491 1.00 34.78  ? 346  CYS B SG  1 
ATOM   6179 N  N   . GLY B 1 369 ? 10.891  18.843  -51.099 1.00 27.98  ? 347  GLY B N   1 
ATOM   6180 C  CA  . GLY B 1 369 ? 11.794  17.948  -51.849 1.00 28.46  ? 347  GLY B CA  1 
ATOM   6181 C  C   . GLY B 1 369 ? 12.902  18.618  -52.641 1.00 28.96  ? 347  GLY B C   1 
ATOM   6182 O  O   . GLY B 1 369 ? 13.233  19.786  -52.433 1.00 30.09  ? 347  GLY B O   1 
ATOM   6183 N  N   . GLY B 1 370 ? 13.468  17.869  -53.586 1.00 30.31  ? 348  GLY B N   1 
ATOM   6184 C  CA  . GLY B 1 370 ? 14.695  18.287  -54.274 1.00 29.93  ? 348  GLY B CA  1 
ATOM   6185 C  C   . GLY B 1 370 ? 14.509  19.424  -55.242 1.00 30.86  ? 348  GLY B C   1 
ATOM   6186 O  O   . GLY B 1 370 ? 15.297  20.382  -55.270 1.00 33.04  ? 348  GLY B O   1 
ATOM   6187 N  N   . SER B 1 371 ? 13.485  19.316  -56.069 1.00 29.81  ? 349  SER B N   1 
ATOM   6188 C  CA  . SER B 1 371 ? 13.230  20.345  -57.030 1.00 30.42  ? 349  SER B CA  1 
ATOM   6189 C  C   . SER B 1 371 ? 12.814  21.664  -56.369 1.00 29.97  ? 349  SER B C   1 
ATOM   6190 O  O   . SER B 1 371 ? 12.990  22.713  -56.978 1.00 31.10  ? 349  SER B O   1 
ATOM   6191 C  CB  . SER B 1 371 ? 12.175  19.898  -58.019 1.00 30.66  ? 349  SER B CB  1 
ATOM   6192 O  OG  . SER B 1 371 ? 10.925  19.783  -57.374 1.00 29.65  ? 349  SER B OG  1 
ATOM   6193 N  N   . ALA B 1 372 ? 12.235  21.616  -55.167 1.00 28.17  ? 350  ALA B N   1 
ATOM   6194 C  CA  . ALA B 1 372 ? 11.953  22.844  -54.396 1.00 28.84  ? 350  ALA B CA  1 
ATOM   6195 C  C   . ALA B 1 372 ? 13.269  23.571  -54.120 1.00 29.30  ? 350  ALA B C   1 
ATOM   6196 O  O   . ALA B 1 372 ? 13.350  24.783  -54.233 1.00 30.59  ? 350  ALA B O   1 
ATOM   6197 C  CB  . ALA B 1 372 ? 11.232  22.539  -53.084 1.00 28.27  ? 350  ALA B CB  1 
ATOM   6198 N  N   . GLY B 1 373 ? 14.295  22.804  -53.759 1.00 29.39  ? 351  GLY B N   1 
ATOM   6199 C  CA  . GLY B 1 373 ? 15.640  23.331  -53.573 1.00 29.90  ? 351  GLY B CA  1 
ATOM   6200 C  C   . GLY B 1 373 ? 16.225  23.941  -54.851 1.00 30.39  ? 351  GLY B C   1 
ATOM   6201 O  O   . GLY B 1 373 ? 16.859  24.996  -54.804 1.00 31.15  ? 351  GLY B O   1 
ATOM   6202 N  N   . SER B 1 374 ? 16.029  23.265  -55.980 1.00 29.76  ? 352  SER B N   1 
ATOM   6203 C  CA  . SER B 1 374 ? 16.486  23.772  -57.281 1.00 31.65  ? 352  SER B CA  1 
ATOM   6204 C  C   . SER B 1 374 ? 15.924  25.152  -57.534 1.00 31.96  ? 352  SER B C   1 
ATOM   6205 O  O   . SER B 1 374 ? 16.632  26.084  -57.968 1.00 34.19  ? 352  SER B O   1 
ATOM   6206 C  CB  . SER B 1 374 ? 16.022  22.853  -58.419 1.00 30.54  ? 352  SER B CB  1 
ATOM   6207 O  OG  . SER B 1 374 ? 16.527  21.544  -58.295 1.00 30.83  ? 352  SER B OG  1 
ATOM   6208 N  N   . THR B 1 375 ? 14.633  25.266  -57.260 1.00 32.86  ? 353  THR B N   1 
ATOM   6209 C  CA  . THR B 1 375 ? 13.877  26.475  -57.525 1.00 34.51  ? 353  THR B CA  1 
ATOM   6210 C  C   . THR B 1 375 ? 14.362  27.628  -56.670 1.00 35.88  ? 353  THR B C   1 
ATOM   6211 O  O   . THR B 1 375 ? 14.577  28.725  -57.190 1.00 38.21  ? 353  THR B O   1 
ATOM   6212 C  CB  . THR B 1 375 ? 12.386  26.224  -57.295 1.00 34.14  ? 353  THR B CB  1 
ATOM   6213 O  OG1 . THR B 1 375 ? 11.990  25.080  -58.045 1.00 33.55  ? 353  THR B OG1 1 
ATOM   6214 C  CG2 . THR B 1 375 ? 11.534  27.410  -57.730 1.00 35.90  ? 353  THR B CG2 1 
ATOM   6215 N  N   . VAL B 1 376 ? 14.543  27.392  -55.375 1.00 34.14  ? 354  VAL B N   1 
ATOM   6216 C  CA  . VAL B 1 376 ? 14.967  28.464  -54.487 1.00 35.23  ? 354  VAL B CA  1 
ATOM   6217 C  C   . VAL B 1 376 ? 16.429  28.848  -54.739 1.00 36.16  ? 354  VAL B C   1 
ATOM   6218 O  O   . VAL B 1 376 ? 16.801  30.017  -54.632 1.00 36.10  ? 354  VAL B O   1 
ATOM   6219 C  CB  . VAL B 1 376 ? 14.699  28.138  -52.992 1.00 34.91  ? 354  VAL B CB  1 
ATOM   6220 C  CG1 . VAL B 1 376 ? 15.262  29.224  -52.076 1.00 37.08  ? 354  VAL B CG1 1 
ATOM   6221 C  CG2 . VAL B 1 376 ? 13.205  28.064  -52.749 1.00 35.03  ? 354  VAL B CG2 1 
ATOM   6222 N  N   . ALA B 1 377 ? 17.252  27.865  -55.073 1.00 36.73  ? 355  ALA B N   1 
ATOM   6223 C  CA  . ALA B 1 377 ? 18.631  28.124  -55.478 1.00 38.05  ? 355  ALA B CA  1 
ATOM   6224 C  C   . ALA B 1 377 ? 18.690  29.121  -56.638 1.00 39.89  ? 355  ALA B C   1 
ATOM   6225 O  O   . ALA B 1 377 ? 19.553  30.010  -56.665 1.00 42.79  ? 355  ALA B O   1 
ATOM   6226 C  CB  . ALA B 1 377 ? 19.315  26.819  -55.864 1.00 37.75  ? 355  ALA B CB  1 
ATOM   6227 N  N   . VAL B 1 378 ? 17.781  28.976  -57.596 1.00 38.96  ? 356  VAL B N   1 
ATOM   6228 C  CA  . VAL B 1 378 ? 17.709  29.923  -58.699 1.00 39.96  ? 356  VAL B CA  1 
ATOM   6229 C  C   . VAL B 1 378 ? 17.117  31.242  -58.225 1.00 40.98  ? 356  VAL B C   1 
ATOM   6230 O  O   . VAL B 1 378 ? 17.615  32.298  -58.594 1.00 41.71  ? 356  VAL B O   1 
ATOM   6231 C  CB  . VAL B 1 378 ? 16.885  29.377  -59.881 1.00 39.98  ? 356  VAL B CB  1 
ATOM   6232 C  CG1 . VAL B 1 378 ? 16.486  30.491  -60.840 1.00 41.69  ? 356  VAL B CG1 1 
ATOM   6233 C  CG2 . VAL B 1 378 ? 17.681  28.314  -60.624 1.00 39.47  ? 356  VAL B CG2 1 
ATOM   6234 N  N   . ALA B 1 379 ? 16.064  31.181  -57.408 1.00 39.61  ? 357  ALA B N   1 
ATOM   6235 C  CA  . ALA B 1 379 ? 15.329  32.382  -57.052 1.00 40.94  ? 357  ALA B CA  1 
ATOM   6236 C  C   . ALA B 1 379 ? 16.203  33.414  -56.337 1.00 42.37  ? 357  ALA B C   1 
ATOM   6237 O  O   . ALA B 1 379 ? 16.024  34.607  -56.547 1.00 42.41  ? 357  ALA B O   1 
ATOM   6238 C  CB  . ALA B 1 379 ? 14.093  32.053  -56.232 1.00 40.08  ? 357  ALA B CB  1 
ATOM   6239 N  N   . VAL B 1 380 ? 17.161  32.969  -55.527 1.00 41.97  ? 358  VAL B N   1 
ATOM   6240 C  CA  . VAL B 1 380 ? 18.055  33.926  -54.862 1.00 44.23  ? 358  VAL B CA  1 
ATOM   6241 C  C   . VAL B 1 380 ? 19.067  34.602  -55.806 1.00 46.55  ? 358  VAL B C   1 
ATOM   6242 O  O   . VAL B 1 380 ? 19.609  35.653  -55.464 1.00 49.59  ? 358  VAL B O   1 
ATOM   6243 C  CB  . VAL B 1 380 ? 18.750  33.336  -53.608 1.00 43.65  ? 358  VAL B CB  1 
ATOM   6244 C  CG1 . VAL B 1 380 ? 17.698  32.880  -52.602 1.00 41.97  ? 358  VAL B CG1 1 
ATOM   6245 C  CG2 . VAL B 1 380 ? 19.721  32.216  -53.956 1.00 43.66  ? 358  VAL B CG2 1 
ATOM   6246 N  N   . LYS B 1 381 ? 19.302  34.024  -56.980 1.00 46.78  ? 359  LYS B N   1 
ATOM   6247 C  CA  . LYS B 1 381 ? 20.046  34.700  -58.045 1.00 50.19  ? 359  LYS B CA  1 
ATOM   6248 C  C   . LYS B 1 381 ? 19.099  35.558  -58.879 1.00 49.68  ? 359  LYS B C   1 
ATOM   6249 O  O   . LYS B 1 381 ? 19.353  36.731  -59.091 1.00 50.92  ? 359  LYS B O   1 
ATOM   6250 C  CB  . LYS B 1 381 ? 20.705  33.707  -59.001 1.00 51.97  ? 359  LYS B CB  1 
ATOM   6251 C  CG  . LYS B 1 381 ? 21.616  32.667  -58.393 1.00 53.38  ? 359  LYS B CG  1 
ATOM   6252 C  CD  . LYS B 1 381 ? 21.843  31.540  -59.406 1.00 55.74  ? 359  LYS B CD  1 
ATOM   6253 C  CE  . LYS B 1 381 ? 22.934  30.582  -58.949 1.00 58.16  ? 359  LYS B CE  1 
ATOM   6254 N  NZ  . LYS B 1 381 ? 22.692  29.173  -59.373 1.00 56.95  ? 359  LYS B NZ  1 
ATOM   6255 N  N   . ALA B 1 382 ? 18.002  34.966  -59.341 1.00 47.87  ? 360  ALA B N   1 
ATOM   6256 C  CA  . ALA B 1 382 ? 17.119  35.625  -60.305 1.00 48.42  ? 360  ALA B CA  1 
ATOM   6257 C  C   . ALA B 1 382 ? 16.431  36.859  -59.758 1.00 49.32  ? 360  ALA B C   1 
ATOM   6258 O  O   . ALA B 1 382 ? 16.114  37.760  -60.504 1.00 50.82  ? 360  ALA B O   1 
ATOM   6259 C  CB  . ALA B 1 382 ? 16.069  34.643  -60.808 1.00 46.54  ? 360  ALA B CB  1 
ATOM   6260 N  N   . ALA B 1 383 ? 16.162  36.891  -58.458 1.00 49.03  ? 361  ALA B N   1 
ATOM   6261 C  CA  . ALA B 1 383 ? 15.406  37.997  -57.885 1.00 50.16  ? 361  ALA B CA  1 
ATOM   6262 C  C   . ALA B 1 383 ? 16.313  39.064  -57.294 1.00 52.46  ? 361  ALA B C   1 
ATOM   6263 O  O   . ALA B 1 383 ? 15.821  39.970  -56.627 1.00 52.60  ? 361  ALA B O   1 
ATOM   6264 C  CB  . ALA B 1 383 ? 14.431  37.469  -56.829 1.00 48.54  ? 361  ALA B CB  1 
ATOM   6265 N  N   . GLN B 1 384 ? 17.626  38.972  -57.535 1.00 53.71  ? 362  GLN B N   1 
ATOM   6266 C  CA  . GLN B 1 384 ? 18.576  39.963  -57.011 1.00 57.00  ? 362  GLN B CA  1 
ATOM   6267 C  C   . GLN B 1 384 ? 18.253  41.379  -57.511 1.00 61.46  ? 362  GLN B C   1 
ATOM   6268 O  O   . GLN B 1 384 ? 18.452  42.334  -56.785 1.00 62.69  ? 362  GLN B O   1 
ATOM   6269 C  CB  . GLN B 1 384 ? 20.034  39.616  -57.379 1.00 57.48  ? 362  GLN B CB  1 
ATOM   6270 C  CG  . GLN B 1 384 ? 20.662  38.459  -56.611 1.00 55.21  ? 362  GLN B CG  1 
ATOM   6271 C  CD  . GLN B 1 384 ? 21.121  38.816  -55.212 1.00 54.89  ? 362  GLN B CD  1 
ATOM   6272 O  OE1 . GLN B 1 384 ? 21.609  39.902  -54.956 1.00 57.59  ? 362  GLN B OE1 1 
ATOM   6273 N  NE2 . GLN B 1 384 ? 20.970  37.885  -54.299 1.00 53.63  ? 362  GLN B NE2 1 
ATOM   6274 N  N   . GLU B 1 385 ? 17.757  41.502  -58.741 1.00 64.65  ? 363  GLU B N   1 
ATOM   6275 C  CA  . GLU B 1 385 ? 17.389  42.818  -59.322 1.00 70.81  ? 363  GLU B CA  1 
ATOM   6276 C  C   . GLU B 1 385 ? 16.176  43.469  -58.641 1.00 69.77  ? 363  GLU B C   1 
ATOM   6277 O  O   . GLU B 1 385 ? 15.990  44.673  -58.746 1.00 73.26  ? 363  GLU B O   1 
ATOM   6278 C  CB  . GLU B 1 385 ? 17.100  42.694  -60.832 1.00 73.87  ? 363  GLU B CB  1 
ATOM   6279 C  CG  . GLU B 1 385 ? 15.918  41.756  -61.157 1.00 76.26  ? 363  GLU B CG  1 
ATOM   6280 C  CD  . GLU B 1 385 ? 15.737  41.445  -62.642 1.00 79.14  ? 363  GLU B CD  1 
ATOM   6281 O  OE1 . GLU B 1 385 ? 16.541  41.930  -63.472 1.00 84.92  ? 363  GLU B OE1 1 
ATOM   6282 O  OE2 . GLU B 1 385 ? 14.778  40.711  -62.981 1.00 78.88  ? 363  GLU B OE2 1 
ATOM   6283 N  N   . LEU B 1 386 ? 15.342  42.683  -57.965 1.00 66.07  ? 364  LEU B N   1 
ATOM   6284 C  CA  . LEU B 1 386 ? 14.125  43.222  -57.354 1.00 65.68  ? 364  LEU B CA  1 
ATOM   6285 C  C   . LEU B 1 386 ? 14.467  44.113  -56.172 1.00 67.20  ? 364  LEU B C   1 
ATOM   6286 O  O   . LEU B 1 386 ? 15.519  43.963  -55.569 1.00 66.27  ? 364  LEU B O   1 
ATOM   6287 C  CB  . LEU B 1 386 ? 13.193  42.083  -56.914 1.00 61.65  ? 364  LEU B CB  1 
ATOM   6288 C  CG  . LEU B 1 386 ? 12.715  41.140  -58.029 1.00 59.63  ? 364  LEU B CG  1 
ATOM   6289 C  CD1 . LEU B 1 386 ? 11.658  40.176  -57.525 1.00 57.32  ? 364  LEU B CD1 1 
ATOM   6290 C  CD2 . LEU B 1 386 ? 12.183  41.923  -59.219 1.00 61.52  ? 364  LEU B CD2 1 
ATOM   6291 N  N   . GLN B 1 387 ? 13.581  45.044  -55.844 1.00 70.26  ? 365  GLN B N   1 
ATOM   6292 C  CA  . GLN B 1 387 ? 13.820  45.968  -54.731 1.00 73.99  ? 365  GLN B CA  1 
ATOM   6293 C  C   . GLN B 1 387 ? 12.876  45.710  -53.581 1.00 73.18  ? 365  GLN B C   1 
ATOM   6294 O  O   . GLN B 1 387 ? 11.907  44.960  -53.715 1.00 71.91  ? 365  GLN B O   1 
ATOM   6295 C  CB  . GLN B 1 387 ? 13.649  47.409  -55.189 1.00 78.86  ? 365  GLN B CB  1 
ATOM   6296 C  CG  . GLN B 1 387 ? 14.622  47.822  -56.275 1.00 82.56  ? 365  GLN B CG  1 
ATOM   6297 C  CD  . GLN B 1 387 ? 13.987  48.779  -57.255 1.00 89.40  ? 365  GLN B CD  1 
ATOM   6298 O  OE1 . GLN B 1 387 ? 12.787  48.695  -57.526 1.00 94.07  ? 365  GLN B OE1 1 
ATOM   6299 N  NE2 . GLN B 1 387 ? 14.781  49.696  -57.796 1.00 92.19  ? 365  GLN B NE2 1 
ATOM   6300 N  N   . GLU B 1 388 ? 13.163  46.340  -52.445 1.00 74.75  ? 366  GLU B N   1 
ATOM   6301 C  CA  . GLU B 1 388 ? 12.259  46.307  -51.306 1.00 74.80  ? 366  GLU B CA  1 
ATOM   6302 C  C   . GLU B 1 388 ? 10.897  46.768  -51.809 1.00 74.36  ? 366  GLU B C   1 
ATOM   6303 O  O   . GLU B 1 388 ? 10.824  47.680  -52.631 1.00 76.47  ? 366  GLU B O   1 
ATOM   6304 C  CB  . GLU B 1 388 ? 12.749  47.223  -50.174 1.00 78.60  ? 366  GLU B CB  1 
ATOM   6305 C  CG  . GLU B 1 388 ? 12.249  46.786  -48.804 1.00 81.20  ? 366  GLU B CG  1 
ATOM   6306 C  CD  . GLU B 1 388 ? 12.185  47.904  -47.776 1.00 85.92  ? 366  GLU B CD  1 
ATOM   6307 O  OE1 . GLU B 1 388 ? 12.680  49.022  -48.029 1.00 92.61  ? 366  GLU B OE1 1 
ATOM   6308 O  OE2 . GLU B 1 388 ? 11.621  47.662  -46.693 1.00 91.00  ? 366  GLU B OE2 1 
ATOM   6309 N  N   . GLY B 1 389 ? 9.831   46.126  -51.341 1.00 72.15  ? 367  GLY B N   1 
ATOM   6310 C  CA  . GLY B 1 389 ? 8.482   46.427  -51.817 1.00 71.98  ? 367  GLY B CA  1 
ATOM   6311 C  C   . GLY B 1 389 ? 8.029   45.479  -52.916 1.00 70.60  ? 367  GLY B C   1 
ATOM   6312 O  O   . GLY B 1 389 ? 6.828   45.310  -53.132 1.00 72.94  ? 367  GLY B O   1 
ATOM   6313 N  N   . GLN B 1 390 ? 8.982   44.853  -53.611 1.00 67.22  ? 368  GLN B N   1 
ATOM   6314 C  CA  . GLN B 1 390 ? 8.665   43.911  -54.685 1.00 63.07  ? 368  GLN B CA  1 
ATOM   6315 C  C   . GLN B 1 390 ? 8.591   42.484  -54.165 1.00 58.55  ? 368  GLN B C   1 
ATOM   6316 O  O   . GLN B 1 390 ? 8.948   42.200  -53.024 1.00 56.64  ? 368  GLN B O   1 
ATOM   6317 C  CB  . GLN B 1 390 ? 9.683   44.020  -55.816 1.00 63.97  ? 368  GLN B CB  1 
ATOM   6318 C  CG  . GLN B 1 390 ? 9.776   45.413  -56.416 1.00 66.38  ? 368  GLN B CG  1 
ATOM   6319 C  CD  . GLN B 1 390 ? 10.504  45.408  -57.741 1.00 67.48  ? 368  GLN B CD  1 
ATOM   6320 O  OE1 . GLN B 1 390 ? 11.713  45.598  -57.798 1.00 68.35  ? 368  GLN B OE1 1 
ATOM   6321 N  NE2 . GLN B 1 390 ? 9.777   45.147  -58.808 1.00 67.87  ? 368  GLN B NE2 1 
ATOM   6322 N  N   . ARG B 1 391 ? 8.125   41.587  -55.017 1.00 55.94  ? 369  ARG B N   1 
ATOM   6323 C  CA  . ARG B 1 391 ? 7.706   40.273  -54.585 1.00 53.09  ? 369  ARG B CA  1 
ATOM   6324 C  C   . ARG B 1 391 ? 8.059   39.165  -55.591 1.00 50.12  ? 369  ARG B C   1 
ATOM   6325 O  O   . ARG B 1 391 ? 7.761   39.274  -56.777 1.00 49.97  ? 369  ARG B O   1 
ATOM   6326 C  CB  . ARG B 1 391 ? 6.203   40.320  -54.358 1.00 53.67  ? 369  ARG B CB  1 
ATOM   6327 C  CG  . ARG B 1 391 ? 5.583   38.991  -53.989 1.00 52.92  ? 369  ARG B CG  1 
ATOM   6328 C  CD  . ARG B 1 391 ? 4.120   39.200  -53.658 1.00 54.00  ? 369  ARG B CD  1 
ATOM   6329 N  NE  . ARG B 1 391 ? 3.942   39.736  -52.316 1.00 54.18  ? 369  ARG B NE  1 
ATOM   6330 C  CZ  . ARG B 1 391 ? 2.839   40.327  -51.882 1.00 54.25  ? 369  ARG B CZ  1 
ATOM   6331 N  NH1 . ARG B 1 391 ? 1.802   40.474  -52.689 1.00 54.94  ? 369  ARG B NH1 1 
ATOM   6332 N  NH2 . ARG B 1 391 ? 2.783   40.768  -50.631 1.00 54.68  ? 369  ARG B NH2 1 
ATOM   6333 N  N   . CYS B 1 392 ? 8.680   38.095  -55.090 1.00 48.41  ? 370  CYS B N   1 
ATOM   6334 C  CA  . CYS B 1 392 ? 9.034   36.919  -55.879 1.00 45.93  ? 370  CYS B CA  1 
ATOM   6335 C  C   . CYS B 1 392 ? 8.348   35.703  -55.291 1.00 44.99  ? 370  CYS B C   1 
ATOM   6336 O  O   . CYS B 1 392 ? 8.456   35.454  -54.099 1.00 46.26  ? 370  CYS B O   1 
ATOM   6337 C  CB  . CYS B 1 392 ? 10.539  36.701  -55.843 1.00 45.28  ? 370  CYS B CB  1 
ATOM   6338 S  SG  . CYS B 1 392 ? 11.096  35.307  -56.856 1.00 44.42  ? 370  CYS B SG  1 
ATOM   6339 N  N   . VAL B 1 393 ? 7.639   34.952  -56.121 1.00 44.45  ? 371  VAL B N   1 
ATOM   6340 C  CA  . VAL B 1 393 ? 6.982   33.732  -55.682 1.00 42.95  ? 371  VAL B CA  1 
ATOM   6341 C  C   . VAL B 1 393 ? 7.689   32.521  -56.277 1.00 41.35  ? 371  VAL B C   1 
ATOM   6342 O  O   . VAL B 1 393 ? 7.980   32.496  -57.463 1.00 42.11  ? 371  VAL B O   1 
ATOM   6343 C  CB  . VAL B 1 393 ? 5.512   33.726  -56.109 1.00 43.12  ? 371  VAL B CB  1 
ATOM   6344 C  CG1 . VAL B 1 393 ? 4.885   32.365  -55.859 1.00 41.59  ? 371  VAL B CG1 1 
ATOM   6345 C  CG2 . VAL B 1 393 ? 4.759   34.794  -55.338 1.00 45.68  ? 371  VAL B CG2 1 
ATOM   6346 N  N   . VAL B 1 394 ? 7.962   31.522  -55.446 1.00 39.88  ? 372  VAL B N   1 
ATOM   6347 C  CA  . VAL B 1 394 ? 8.501   30.258  -55.913 1.00 39.16  ? 372  VAL B CA  1 
ATOM   6348 C  C   . VAL B 1 394 ? 7.502   29.128  -55.700 1.00 38.43  ? 372  VAL B C   1 
ATOM   6349 O  O   . VAL B 1 394 ? 6.733   29.123  -54.737 1.00 39.37  ? 372  VAL B O   1 
ATOM   6350 C  CB  . VAL B 1 394 ? 9.825   29.895  -55.198 1.00 39.24  ? 372  VAL B CB  1 
ATOM   6351 C  CG1 . VAL B 1 394 ? 10.893  30.928  -55.502 1.00 40.61  ? 372  VAL B CG1 1 
ATOM   6352 C  CG2 . VAL B 1 394 ? 9.631   29.773  -53.672 1.00 40.32  ? 372  VAL B CG2 1 
ATOM   6353 N  N   . ILE B 1 395 ? 7.552   28.136  -56.573 1.00 36.82  ? 373  ILE B N   1 
ATOM   6354 C  CA  . ILE B 1 395 ? 6.732   26.951  -56.429 1.00 34.77  ? 373  ILE B CA  1 
ATOM   6355 C  C   . ILE B 1 395 ? 7.582   25.863  -55.782 1.00 34.33  ? 373  ILE B C   1 
ATOM   6356 O  O   . ILE B 1 395 ? 8.667   25.550  -56.292 1.00 35.77  ? 373  ILE B O   1 
ATOM   6357 C  CB  . ILE B 1 395 ? 6.235   26.464  -57.800 1.00 34.99  ? 373  ILE B CB  1 
ATOM   6358 C  CG1 . ILE B 1 395 ? 5.585   27.612  -58.590 1.00 36.07  ? 373  ILE B CG1 1 
ATOM   6359 C  CG2 . ILE B 1 395 ? 5.280   25.283  -57.623 1.00 34.20  ? 373  ILE B CG2 1 
ATOM   6360 C  CD1 . ILE B 1 395 ? 4.368   28.213  -57.924 1.00 36.85  ? 373  ILE B CD1 1 
ATOM   6361 N  N   . LEU B 1 396 ? 7.098   25.298  -54.670 1.00 32.70  ? 374  LEU B N   1 
ATOM   6362 C  CA  . LEU B 1 396 ? 7.751   24.165  -53.997 1.00 31.82  ? 374  LEU B CA  1 
ATOM   6363 C  C   . LEU B 1 396 ? 6.949   22.883  -54.302 1.00 32.45  ? 374  LEU B C   1 
ATOM   6364 O  O   . LEU B 1 396 ? 5.899   22.661  -53.695 1.00 33.21  ? 374  LEU B O   1 
ATOM   6365 C  CB  . LEU B 1 396 ? 7.845   24.414  -52.488 1.00 31.50  ? 374  LEU B CB  1 
ATOM   6366 C  CG  . LEU B 1 396 ? 8.502   25.738  -52.043 1.00 32.70  ? 374  LEU B CG  1 
ATOM   6367 C  CD1 . LEU B 1 396 ? 8.866   25.645  -50.565 1.00 33.06  ? 374  LEU B CD1 1 
ATOM   6368 C  CD2 . LEU B 1 396 ? 9.726   26.085  -52.891 1.00 33.49  ? 374  LEU B CD2 1 
ATOM   6369 N  N   . PRO B 1 397 ? 7.426   22.043  -55.255 1.00 29.65  ? 375  PRO B N   1 
ATOM   6370 C  CA  . PRO B 1 397 ? 6.529   21.020  -55.781 1.00 29.92  ? 375  PRO B CA  1 
ATOM   6371 C  C   . PRO B 1 397 ? 6.176   19.811  -54.916 1.00 29.99  ? 375  PRO B C   1 
ATOM   6372 O  O   . PRO B 1 397 ? 5.033   19.370  -54.970 1.00 29.47  ? 375  PRO B O   1 
ATOM   6373 C  CB  . PRO B 1 397 ? 7.240   20.557  -57.075 1.00 30.30  ? 375  PRO B CB  1 
ATOM   6374 C  CG  . PRO B 1 397 ? 8.114   21.687  -57.447 1.00 31.01  ? 375  PRO B CG  1 
ATOM   6375 C  CD  . PRO B 1 397 ? 8.601   22.212  -56.125 1.00 30.76  ? 375  PRO B CD  1 
ATOM   6376 N  N   . ASP B 1 398 ? 7.119   19.237  -54.170 1.00 29.83  ? 376  ASP B N   1 
ATOM   6377 C  CA  . ASP B 1 398 ? 6.795   17.989  -53.460 1.00 29.36  ? 376  ASP B CA  1 
ATOM   6378 C  C   . ASP B 1 398 ? 7.465   17.905  -52.104 1.00 28.92  ? 376  ASP B C   1 
ATOM   6379 O  O   . ASP B 1 398 ? 8.145   18.834  -51.669 1.00 27.80  ? 376  ASP B O   1 
ATOM   6380 C  CB  . ASP B 1 398 ? 7.030   16.733  -54.340 1.00 28.32  ? 376  ASP B CB  1 
ATOM   6381 C  CG  . ASP B 1 398 ? 8.514   16.309  -54.465 1.00 30.36  ? 376  ASP B CG  1 
ATOM   6382 O  OD1 . ASP B 1 398 ? 9.406   17.091  -54.073 1.00 31.29  ? 376  ASP B OD1 1 
ATOM   6383 O  OD2 . ASP B 1 398 ? 8.793   15.179  -54.992 1.00 28.86  ? 376  ASP B OD2 1 
ATOM   6384 N  N   . SER B 1 399 ? 7.244   16.797  -51.422 1.00 29.44  ? 377  SER B N   1 
ATOM   6385 C  CA  . SER B 1 399 ? 7.624   16.690  -50.030 1.00 30.26  ? 377  SER B CA  1 
ATOM   6386 C  C   . SER B 1 399 ? 8.877   15.865  -49.783 1.00 30.69  ? 377  SER B C   1 
ATOM   6387 O  O   . SER B 1 399 ? 9.332   15.092  -50.625 1.00 30.06  ? 377  SER B O   1 
ATOM   6388 C  CB  . SER B 1 399 ? 6.418   16.149  -49.248 1.00 33.76  ? 377  SER B CB  1 
ATOM   6389 O  OG  . SER B 1 399 ? 6.061   14.871  -49.626 1.00 32.38  ? 377  SER B OG  1 
ATOM   6390 N  N   . VAL B 1 400 ? 9.438   16.042  -48.596 1.00 28.68  ? 378  VAL B N   1 
ATOM   6391 C  CA  . VAL B 1 400 ? 10.620  15.328  -48.181 1.00 27.74  ? 378  VAL B CA  1 
ATOM   6392 C  C   . VAL B 1 400 ? 10.369  13.820  -48.072 1.00 26.68  ? 378  VAL B C   1 
ATOM   6393 O  O   . VAL B 1 400 ? 11.302  13.031  -48.170 1.00 22.73  ? 378  VAL B O   1 
ATOM   6394 C  CB  . VAL B 1 400 ? 11.132  15.888  -46.834 1.00 29.57  ? 378  VAL B CB  1 
ATOM   6395 C  CG1 . VAL B 1 400 ? 10.251  15.401  -45.680 1.00 30.14  ? 378  VAL B CG1 1 
ATOM   6396 C  CG2 . VAL B 1 400 ? 12.590  15.538  -46.636 1.00 30.69  ? 378  VAL B CG2 1 
ATOM   6397 N  N   . ARG B 1 401 ? 9.110   13.410  -47.918 1.00 24.64  ? 379  ARG B N   1 
ATOM   6398 C  CA  . ARG B 1 401 ? 8.767   11.986  -47.861 1.00 27.02  ? 379  ARG B CA  1 
ATOM   6399 C  C   . ARG B 1 401 ? 9.370   11.153  -49.028 1.00 24.85  ? 379  ARG B C   1 
ATOM   6400 O  O   . ARG B 1 401 ? 9.781   10.018  -48.831 1.00 23.96  ? 379  ARG B O   1 
ATOM   6401 C  CB  . ARG B 1 401 ? 7.246   11.808  -47.824 1.00 28.33  ? 379  ARG B CB  1 
ATOM   6402 C  CG  . ARG B 1 401 ? 6.743   10.383  -47.597 1.00 30.42  ? 379  ARG B CG  1 
ATOM   6403 C  CD  . ARG B 1 401 ? 5.262   10.278  -47.993 1.00 31.46  ? 379  ARG B CD  1 
ATOM   6404 N  NE  . ARG B 1 401 ? 5.215   10.257  -49.430 1.00 32.26  ? 379  ARG B NE  1 
ATOM   6405 C  CZ  . ARG B 1 401 ? 4.291   10.776  -50.241 1.00 35.75  ? 379  ARG B CZ  1 
ATOM   6406 N  NH1 . ARG B 1 401 ? 3.259   11.434  -49.804 1.00 34.61  ? 379  ARG B NH1 1 
ATOM   6407 N  NH2 . ARG B 1 401 ? 4.475   10.675  -51.572 1.00 36.50  ? 379  ARG B NH2 1 
ATOM   6408 N  N   . ASN B 1 402 ? 9.384   11.709  -50.232 1.00 24.50  ? 380  ASN B N   1 
ATOM   6409 C  CA  . ASN B 1 402 ? 9.954   11.024  -51.392 1.00 24.92  ? 380  ASN B CA  1 
ATOM   6410 C  C   . ASN B 1 402 ? 11.465  10.806  -51.332 1.00 24.93  ? 380  ASN B C   1 
ATOM   6411 O  O   . ASN B 1 402 ? 11.992  10.075  -52.167 1.00 25.28  ? 380  ASN B O   1 
ATOM   6412 C  CB  . ASN B 1 402 ? 9.635   11.788  -52.686 1.00 26.65  ? 380  ASN B CB  1 
ATOM   6413 C  CG  . ASN B 1 402 ? 8.213   11.575  -53.166 1.00 28.29  ? 380  ASN B CG  1 
ATOM   6414 O  OD1 . ASN B 1 402 ? 7.554   10.594  -52.815 1.00 27.70  ? 380  ASN B OD1 1 
ATOM   6415 N  ND2 . ASN B 1 402 ? 7.749   12.481  -54.018 1.00 29.19  ? 380  ASN B ND2 1 
ATOM   6416 N  N   . TYR B 1 403 ? 12.164  11.436  -50.382 1.00 24.68  ? 381  TYR B N   1 
ATOM   6417 C  CA  . TYR B 1 403 ? 13.626  11.512  -50.411 1.00 25.18  ? 381  TYR B CA  1 
ATOM   6418 C  C   . TYR B 1 403 ? 14.264  11.169  -49.083 1.00 25.39  ? 381  TYR B C   1 
ATOM   6419 O  O   . TYR B 1 403 ? 15.425  11.517  -48.853 1.00 25.04  ? 381  TYR B O   1 
ATOM   6420 C  CB  . TYR B 1 403 ? 14.105  12.898  -50.941 1.00 25.88  ? 381  TYR B CB  1 
ATOM   6421 C  CG  . TYR B 1 403 ? 13.321  13.295  -52.163 1.00 25.45  ? 381  TYR B CG  1 
ATOM   6422 C  CD1 . TYR B 1 403 ? 13.566  12.694  -53.399 1.00 26.83  ? 381  TYR B CD1 1 
ATOM   6423 C  CD2 . TYR B 1 403 ? 12.303  14.193  -52.081 1.00 25.79  ? 381  TYR B CD2 1 
ATOM   6424 C  CE1 . TYR B 1 403 ? 12.808  13.006  -54.513 1.00 27.78  ? 381  TYR B CE1 1 
ATOM   6425 C  CE2 . TYR B 1 403 ? 11.536  14.498  -53.193 1.00 27.64  ? 381  TYR B CE2 1 
ATOM   6426 C  CZ  . TYR B 1 403 ? 11.790  13.907  -54.407 1.00 27.02  ? 381  TYR B CZ  1 
ATOM   6427 O  OH  . TYR B 1 403 ? 10.991  14.207  -55.503 1.00 29.08  ? 381  TYR B OH  1 
ATOM   6428 N  N   . MET B 1 404 ? 13.541  10.431  -48.233 1.00 26.37  ? 382  MET B N   1 
ATOM   6429 C  CA  . MET B 1 404 ? 13.988  10.145  -46.855 1.00 26.65  ? 382  MET B CA  1 
ATOM   6430 C  C   . MET B 1 404 ? 15.374  9.494   -46.783 1.00 28.10  ? 382  MET B C   1 
ATOM   6431 O  O   . MET B 1 404 ? 16.185  9.818   -45.891 1.00 27.48  ? 382  MET B O   1 
ATOM   6432 C  CB  . MET B 1 404 ? 12.998  9.233   -46.115 1.00 27.22  ? 382  MET B CB  1 
ATOM   6433 C  CG  . MET B 1 404 ? 11.566  9.757   -46.004 1.00 27.77  ? 382  MET B CG  1 
ATOM   6434 S  SD  . MET B 1 404 ? 11.449  11.266  -45.042 1.00 28.35  ? 382  MET B SD  1 
ATOM   6435 C  CE  . MET B 1 404 ? 11.702  10.625  -43.405 1.00 29.12  ? 382  MET B CE  1 
ATOM   6436 N  N   . THR B 1 405 ? 15.627  8.555   -47.685 1.00 26.24  ? 383  THR B N   1 
ATOM   6437 C  CA  . THR B 1 405 ? 16.925  7.869   -47.733 1.00 27.66  ? 383  THR B CA  1 
ATOM   6438 C  C   . THR B 1 405 ? 17.823  8.432   -48.847 1.00 28.03  ? 383  THR B C   1 
ATOM   6439 O  O   . THR B 1 405 ? 18.879  7.873   -49.129 1.00 26.78  ? 383  THR B O   1 
ATOM   6440 C  CB  . THR B 1 405 ? 16.784  6.341   -47.945 1.00 26.93  ? 383  THR B CB  1 
ATOM   6441 O  OG1 . THR B 1 405 ? 16.038  6.088   -49.140 1.00 25.50  ? 383  THR B OG1 1 
ATOM   6442 C  CG2 . THR B 1 405 ? 16.100  5.672   -46.749 1.00 28.70  ? 383  THR B CG2 1 
ATOM   6443 N  N   . LYS B 1 406 ? 17.425  9.545   -49.451 1.00 26.90  ? 384  LYS B N   1 
ATOM   6444 C  CA  . LYS B 1 406 ? 18.269  10.213  -50.413 1.00 27.24  ? 384  LYS B CA  1 
ATOM   6445 C  C   . LYS B 1 406 ? 18.867  11.500  -49.832 1.00 27.32  ? 384  LYS B C   1 
ATOM   6446 O  O   . LYS B 1 406 ? 19.738  11.398  -48.945 1.00 28.78  ? 384  LYS B O   1 
ATOM   6447 C  CB  . LYS B 1 406 ? 17.557  10.317  -51.766 1.00 28.34  ? 384  LYS B CB  1 
ATOM   6448 C  CG  . LYS B 1 406 ? 17.189  8.930   -52.300 1.00 30.42  ? 384  LYS B CG  1 
ATOM   6449 C  CD  . LYS B 1 406 ? 16.458  8.953   -53.644 1.00 32.36  ? 384  LYS B CD  1 
ATOM   6450 C  CE  . LYS B 1 406 ? 17.423  9.007   -54.805 1.00 33.91  ? 384  LYS B CE  1 
ATOM   6451 N  NZ  . LYS B 1 406 ? 16.747  8.669   -56.101 1.00 33.31  ? 384  LYS B NZ  1 
ATOM   6452 N  N   . PHE B 1 407 ? 18.458  12.693  -50.265 1.00 26.15  ? 385  PHE B N   1 
ATOM   6453 C  CA  . PHE B 1 407 ? 19.218  13.899  -49.861 1.00 27.86  ? 385  PHE B CA  1 
ATOM   6454 C  C   . PHE B 1 407 ? 19.056  14.176  -48.371 1.00 28.59  ? 385  PHE B C   1 
ATOM   6455 O  O   . PHE B 1 407 ? 19.872  14.897  -47.783 1.00 27.57  ? 385  PHE B O   1 
ATOM   6456 C  CB  . PHE B 1 407 ? 18.860  15.159  -50.680 1.00 28.04  ? 385  PHE B CB  1 
ATOM   6457 C  CG  . PHE B 1 407 ? 17.517  15.786  -50.337 1.00 27.40  ? 385  PHE B CG  1 
ATOM   6458 C  CD1 . PHE B 1 407 ? 17.366  16.597  -49.241 1.00 29.19  ? 385  PHE B CD1 1 
ATOM   6459 C  CD2 . PHE B 1 407 ? 16.420  15.601  -51.160 1.00 28.88  ? 385  PHE B CD2 1 
ATOM   6460 C  CE1 . PHE B 1 407 ? 16.125  17.179  -48.924 1.00 29.58  ? 385  PHE B CE1 1 
ATOM   6461 C  CE2 . PHE B 1 407 ? 15.190  16.193  -50.876 1.00 28.72  ? 385  PHE B CE2 1 
ATOM   6462 C  CZ  . PHE B 1 407 ? 15.040  16.985  -49.755 1.00 29.15  ? 385  PHE B CZ  1 
ATOM   6463 N  N   . LEU B 1 408 ? 18.010  13.602  -47.776 1.00 28.21  ? 386  LEU B N   1 
ATOM   6464 C  CA  . LEU B 1 408 ? 17.773  13.785  -46.343 1.00 31.61  ? 386  LEU B CA  1 
ATOM   6465 C  C   . LEU B 1 408 ? 18.818  13.051  -45.547 1.00 34.19  ? 386  LEU B C   1 
ATOM   6466 O  O   . LEU B 1 408 ? 19.118  13.467  -44.439 1.00 36.09  ? 386  LEU B O   1 
ATOM   6467 C  CB  . LEU B 1 408 ? 16.358  13.371  -45.952 1.00 31.92  ? 386  LEU B CB  1 
ATOM   6468 C  CG  . LEU B 1 408 ? 15.905  13.823  -44.565 1.00 35.47  ? 386  LEU B CG  1 
ATOM   6469 C  CD1 . LEU B 1 408 ? 15.828  15.335  -44.519 1.00 36.86  ? 386  LEU B CD1 1 
ATOM   6470 C  CD2 . LEU B 1 408 ? 14.574  13.197  -44.206 1.00 35.07  ? 386  LEU B CD2 1 
ATOM   6471 N  N   . SER B 1 409 ? 19.407  11.993  -46.128 1.00 34.31  ? 387  SER B N   1 
ATOM   6472 C  CA  . SER B 1 409 ? 20.455  11.216  -45.483 1.00 35.66  ? 387  SER B CA  1 
ATOM   6473 C  C   . SER B 1 409 ? 21.859  11.793  -45.709 1.00 39.95  ? 387  SER B C   1 
ATOM   6474 O  O   . SER B 1 409 ? 22.296  11.962  -46.859 1.00 37.89  ? 387  SER B O   1 
ATOM   6475 C  CB  . SER B 1 409 ? 20.427  9.776   -46.027 1.00 36.94  ? 387  SER B CB  1 
ATOM   6476 O  OG  . SER B 1 409 ? 21.695  9.163   -45.840 1.00 39.26  ? 387  SER B OG  1 
ATOM   6477 N  N   . ASP B 1 410 ? 22.577  12.083  -44.624 1.00 42.70  ? 388  ASP B N   1 
ATOM   6478 C  CA  . ASP B 1 410 ? 23.963  12.534  -44.741 1.00 47.15  ? 388  ASP B CA  1 
ATOM   6479 C  C   . ASP B 1 410 ? 24.886  11.497  -45.390 1.00 49.22  ? 388  ASP B C   1 
ATOM   6480 O  O   . ASP B 1 410 ? 25.804  11.875  -46.120 1.00 50.99  ? 388  ASP B O   1 
ATOM   6481 C  CB  . ASP B 1 410 ? 24.538  12.933  -43.379 1.00 50.35  ? 388  ASP B CB  1 
ATOM   6482 C  CG  . ASP B 1 410 ? 23.952  14.221  -42.842 1.00 51.24  ? 388  ASP B CG  1 
ATOM   6483 O  OD1 . ASP B 1 410 ? 23.105  14.871  -43.502 1.00 51.47  ? 388  ASP B OD1 1 
ATOM   6484 O  OD2 . ASP B 1 410 ? 24.353  14.592  -41.733 1.00 56.01  ? 388  ASP B OD2 1 
ATOM   6485 N  N   . ARG B 1 411 ? 24.655  10.209  -45.127 1.00 50.10  ? 389  ARG B N   1 
ATOM   6486 C  CA  . ARG B 1 411 ? 25.442  9.143   -45.758 1.00 51.83  ? 389  ARG B CA  1 
ATOM   6487 C  C   . ARG B 1 411 ? 25.261  9.175   -47.273 1.00 48.80  ? 389  ARG B C   1 
ATOM   6488 O  O   . ARG B 1 411 ? 26.223  9.013   -48.017 1.00 50.06  ? 389  ARG B O   1 
ATOM   6489 C  CB  . ARG B 1 411 ? 25.062  7.746   -45.226 1.00 55.18  ? 389  ARG B CB  1 
ATOM   6490 C  CG  . ARG B 1 411 ? 25.489  7.473   -43.788 1.00 60.59  ? 389  ARG B CG  1 
ATOM   6491 C  CD  . ARG B 1 411 ? 25.143  6.050   -43.348 1.00 62.87  ? 389  ARG B CD  1 
ATOM   6492 N  N   . TRP B 1 412 ? 24.030  9.367   -47.731 1.00 42.40  ? 390  TRP B N   1 
ATOM   6493 C  CA  . TRP B 1 412 ? 23.771  9.442   -49.161 1.00 40.93  ? 390  TRP B CA  1 
ATOM   6494 C  C   . TRP B 1 412 ? 24.478  10.641  -49.761 1.00 42.81  ? 390  TRP B C   1 
ATOM   6495 O  O   . TRP B 1 412 ? 25.171  10.502  -50.768 1.00 43.80  ? 390  TRP B O   1 
ATOM   6496 C  CB  . TRP B 1 412 ? 22.290  9.559   -49.421 1.00 38.12  ? 390  TRP B CB  1 
ATOM   6497 C  CG  . TRP B 1 412 ? 21.881  9.458   -50.853 1.00 37.70  ? 390  TRP B CG  1 
ATOM   6498 C  CD1 . TRP B 1 412 ? 21.579  8.313   -51.538 1.00 36.34  ? 390  TRP B CD1 1 
ATOM   6499 C  CD2 . TRP B 1 412 ? 21.653  10.542  -51.761 1.00 35.46  ? 390  TRP B CD2 1 
ATOM   6500 N  NE1 . TRP B 1 412 ? 21.189  8.624   -52.808 1.00 36.24  ? 390  TRP B NE1 1 
ATOM   6501 C  CE2 . TRP B 1 412 ? 21.232  9.983   -52.975 1.00 35.35  ? 390  TRP B CE2 1 
ATOM   6502 C  CE3 . TRP B 1 412 ? 21.752  11.932  -51.657 1.00 35.60  ? 390  TRP B CE3 1 
ATOM   6503 C  CZ2 . TRP B 1 412 ? 20.907  10.765  -54.088 1.00 35.25  ? 390  TRP B CZ2 1 
ATOM   6504 C  CZ3 . TRP B 1 412 ? 21.443  12.711  -52.763 1.00 34.80  ? 390  TRP B CZ3 1 
ATOM   6505 C  CH2 . TRP B 1 412 ? 21.043  12.124  -53.966 1.00 35.00  ? 390  TRP B CH2 1 
ATOM   6506 N  N   . MET B 1 413 ? 24.302  11.810  -49.145 1.00 41.29  ? 391  MET B N   1 
ATOM   6507 C  CA  . MET B 1 413 ? 24.925  13.032  -49.630 1.00 43.30  ? 391  MET B CA  1 
ATOM   6508 C  C   . MET B 1 413 ? 26.447  12.842  -49.750 1.00 48.41  ? 391  MET B C   1 
ATOM   6509 O  O   . MET B 1 413 ? 27.055  13.291  -50.724 1.00 50.01  ? 391  MET B O   1 
ATOM   6510 C  CB  . MET B 1 413 ? 24.620  14.214  -48.702 1.00 41.47  ? 391  MET B CB  1 
ATOM   6511 C  CG  . MET B 1 413 ? 23.163  14.670  -48.699 1.00 39.47  ? 391  MET B CG  1 
ATOM   6512 S  SD  . MET B 1 413 ? 22.739  15.565  -50.195 1.00 38.00  ? 391  MET B SD  1 
ATOM   6513 C  CE  . MET B 1 413 ? 23.487  17.139  -49.811 1.00 40.00  ? 391  MET B CE  1 
ATOM   6514 N  N   . LEU B 1 414 ? 27.047  12.175  -48.768 1.00 51.57  ? 392  LEU B N   1 
ATOM   6515 C  CA  . LEU B 1 414 ? 28.488  11.884  -48.804 1.00 56.52  ? 392  LEU B CA  1 
ATOM   6516 C  C   . LEU B 1 414 ? 28.863  10.950  -49.938 1.00 57.94  ? 392  LEU B C   1 
ATOM   6517 O  O   . LEU B 1 414 ? 29.739  11.276  -50.730 1.00 61.78  ? 392  LEU B O   1 
ATOM   6518 C  CB  . LEU B 1 414 ? 28.965  11.295  -47.478 1.00 57.87  ? 392  LEU B CB  1 
ATOM   6519 C  CG  . LEU B 1 414 ? 29.043  12.317  -46.355 1.00 59.67  ? 392  LEU B CG  1 
ATOM   6520 C  CD1 . LEU B 1 414 ? 29.325  11.608  -45.035 1.00 61.55  ? 392  LEU B CD1 1 
ATOM   6521 C  CD2 . LEU B 1 414 ? 30.100  13.378  -46.666 1.00 62.79  ? 392  LEU B CD2 1 
ATOM   6522 N  N   . GLN B 1 415 ? 28.195  9.804   -50.031 1.00 57.62  ? 393  GLN B N   1 
ATOM   6523 C  CA  . GLN B 1 415 ? 28.419  8.878   -51.140 1.00 59.31  ? 393  GLN B CA  1 
ATOM   6524 C  C   . GLN B 1 415 ? 28.370  9.585   -52.487 1.00 57.84  ? 393  GLN B C   1 
ATOM   6525 O  O   . GLN B 1 415 ? 29.190  9.303   -53.353 1.00 58.15  ? 393  GLN B O   1 
ATOM   6526 C  CB  . GLN B 1 415 ? 27.385  7.755   -51.155 1.00 61.24  ? 393  GLN B CB  1 
ATOM   6527 C  CG  . GLN B 1 415 ? 27.561  6.717   -50.059 1.00 68.14  ? 393  GLN B CG  1 
ATOM   6528 C  CD  . GLN B 1 415 ? 26.281  5.932   -49.755 1.00 73.22  ? 393  GLN B CD  1 
ATOM   6529 O  OE1 . GLN B 1 415 ? 25.265  6.054   -50.452 1.00 74.48  ? 393  GLN B OE1 1 
ATOM   6530 N  NE2 . GLN B 1 415 ? 26.329  5.120   -48.702 1.00 75.94  ? 393  GLN B NE2 1 
ATOM   6531 N  N   . LYS B 1 416 ? 27.405  10.485  -52.673 1.00 50.89  ? 394  LYS B N   1 
ATOM   6532 C  CA  . LYS B 1 416 ? 27.246  11.178  -53.955 1.00 49.34  ? 394  LYS B CA  1 
ATOM   6533 C  C   . LYS B 1 416 ? 28.177  12.370  -54.132 1.00 50.10  ? 394  LYS B C   1 
ATOM   6534 O  O   . LYS B 1 416 ? 28.186  12.976  -55.193 1.00 49.90  ? 394  LYS B O   1 
ATOM   6535 C  CB  . LYS B 1 416 ? 25.812  11.657  -54.120 1.00 47.50  ? 394  LYS B CB  1 
ATOM   6536 C  CG  . LYS B 1 416 ? 24.792  10.541  -54.106 1.00 47.05  ? 394  LYS B CG  1 
ATOM   6537 C  CD  . LYS B 1 416 ? 24.910  9.671   -55.338 1.00 46.71  ? 394  LYS B CD  1 
ATOM   6538 C  CE  . LYS B 1 416 ? 24.149  8.386   -55.143 1.00 47.14  ? 394  LYS B CE  1 
ATOM   6539 N  NZ  . LYS B 1 416 ? 23.867  7.796   -56.474 1.00 49.40  ? 394  LYS B NZ  1 
ATOM   6540 N  N   . GLY B 1 417 ? 28.928  12.718  -53.087 1.00 51.01  ? 395  GLY B N   1 
ATOM   6541 C  CA  . GLY B 1 417 ? 29.871  13.837  -53.122 1.00 52.54  ? 395  GLY B CA  1 
ATOM   6542 C  C   . GLY B 1 417 ? 29.244  15.210  -53.010 1.00 52.26  ? 395  GLY B C   1 
ATOM   6543 O  O   . GLY B 1 417 ? 29.806  16.184  -53.488 1.00 53.40  ? 395  GLY B O   1 
ATOM   6544 N  N   . PHE B 1 418 ? 28.081  15.319  -52.380 1.00 51.85  ? 396  PHE B N   1 
ATOM   6545 C  CA  . PHE B 1 418 ? 27.407  16.613  -52.302 1.00 50.98  ? 396  PHE B CA  1 
ATOM   6546 C  C   . PHE B 1 418 ? 27.695  17.401  -51.018 1.00 53.47  ? 396  PHE B C   1 
ATOM   6547 O  O   . PHE B 1 418 ? 27.226  18.532  -50.892 1.00 55.93  ? 396  PHE B O   1 
ATOM   6548 C  CB  . PHE B 1 418 ? 25.894  16.456  -52.466 1.00 48.04  ? 396  PHE B CB  1 
ATOM   6549 C  CG  . PHE B 1 418 ? 25.462  15.970  -53.821 1.00 46.76  ? 396  PHE B CG  1 
ATOM   6550 C  CD1 . PHE B 1 418 ? 25.939  16.562  -54.984 1.00 47.09  ? 396  PHE B CD1 1 
ATOM   6551 C  CD2 . PHE B 1 418 ? 24.535  14.944  -53.926 1.00 43.05  ? 396  PHE B CD2 1 
ATOM   6552 C  CE1 . PHE B 1 418 ? 25.521  16.115  -56.220 1.00 46.55  ? 396  PHE B CE1 1 
ATOM   6553 C  CE2 . PHE B 1 418 ? 24.110  14.498  -55.156 1.00 43.78  ? 396  PHE B CE2 1 
ATOM   6554 C  CZ  . PHE B 1 418 ? 24.614  15.071  -56.309 1.00 45.48  ? 396  PHE B CZ  1 
ATOM   6555 N  N   . LEU B 1 419 ? 28.437  16.840  -50.070 1.00 56.94  ? 397  LEU B N   1 
ATOM   6556 C  CA  . LEU B 1 419 ? 28.750  17.569  -48.831 1.00 60.88  ? 397  LEU B CA  1 
ATOM   6557 C  C   . LEU B 1 419 ? 30.233  17.909  -48.709 1.00 64.40  ? 397  LEU B C   1 
ATOM   6558 O  O   . LEU B 1 419 ? 31.059  17.030  -48.503 1.00 72.04  ? 397  LEU B O   1 
ATOM   6559 C  CB  . LEU B 1 419 ? 28.281  16.779  -47.605 1.00 61.55  ? 397  LEU B CB  1 
ATOM   6560 C  CG  . LEU B 1 419 ? 26.826  17.011  -47.198 1.00 62.68  ? 397  LEU B CG  1 
ATOM   6561 C  CD1 . LEU B 1 419 ? 26.472  16.140  -46.002 1.00 63.42  ? 397  LEU B CD1 1 
ATOM   6562 C  CD2 . LEU B 1 419 ? 26.550  18.480  -46.888 1.00 62.84  ? 397  LEU B CD2 1 
ATOM   6563 N  N   . LYS B 1 427 ? 32.377  24.481  -38.889 1.00 76.44  ? 405  LYS B N   1 
ATOM   6564 C  CA  . LYS B 1 427 ? 31.030  23.974  -38.663 1.00 74.06  ? 405  LYS B CA  1 
ATOM   6565 C  C   . LYS B 1 427 ? 30.940  23.050  -37.441 1.00 74.98  ? 405  LYS B C   1 
ATOM   6566 O  O   . LYS B 1 427 ? 29.882  22.935  -36.826 1.00 77.26  ? 405  LYS B O   1 
ATOM   6567 C  CB  . LYS B 1 427 ? 30.531  23.235  -39.907 1.00 71.41  ? 405  LYS B CB  1 
ATOM   6568 N  N   . LYS B 1 428 ? 32.047  22.406  -37.086 1.00 75.95  ? 406  LYS B N   1 
ATOM   6569 C  CA  . LYS B 1 428 ? 32.055  21.362  -36.056 1.00 75.05  ? 406  LYS B CA  1 
ATOM   6570 C  C   . LYS B 1 428 ? 32.409  21.900  -34.664 1.00 73.33  ? 406  LYS B C   1 
ATOM   6571 O  O   . LYS B 1 428 ? 33.319  22.711  -34.539 1.00 75.10  ? 406  LYS B O   1 
ATOM   6572 C  CB  . LYS B 1 428 ? 33.081  20.288  -36.422 1.00 78.11  ? 406  LYS B CB  1 
ATOM   6573 C  CG  . LYS B 1 428 ? 32.956  19.740  -37.831 1.00 76.42  ? 406  LYS B CG  1 
ATOM   6574 C  CD  . LYS B 1 428 ? 31.662  18.980  -38.018 1.00 74.11  ? 406  LYS B CD  1 
ATOM   6575 C  CE  . LYS B 1 428 ? 31.546  18.471  -39.443 1.00 73.32  ? 406  LYS B CE  1 
ATOM   6576 N  NZ  . LYS B 1 428 ? 30.121  18.421  -39.851 1.00 71.22  ? 406  LYS B NZ  1 
ATOM   6577 N  N   . PRO B 1 429 ? 31.717  21.421  -33.609 1.00 69.06  ? 407  PRO B N   1 
ATOM   6578 C  CA  . PRO B 1 429 ? 32.051  21.834  -32.245 1.00 69.38  ? 407  PRO B CA  1 
ATOM   6579 C  C   . PRO B 1 429 ? 33.480  21.512  -31.877 1.00 69.53  ? 407  PRO B C   1 
ATOM   6580 O  O   . PRO B 1 429 ? 34.115  20.682  -32.511 1.00 71.16  ? 407  PRO B O   1 
ATOM   6581 C  CB  . PRO B 1 429 ? 31.095  21.019  -31.374 1.00 68.60  ? 407  PRO B CB  1 
ATOM   6582 C  CG  . PRO B 1 429 ? 29.970  20.662  -32.262 1.00 66.50  ? 407  PRO B CG  1 
ATOM   6583 C  CD  . PRO B 1 429 ? 30.527  20.552  -33.646 1.00 66.46  ? 407  PRO B CD  1 
ATOM   6584 N  N   . TRP B 1 430 ? 33.976  22.155  -30.840 1.00 70.28  ? 408  TRP B N   1 
ATOM   6585 C  CA  . TRP B 1 430 ? 35.366  22.002  -30.467 1.00 71.58  ? 408  TRP B CA  1 
ATOM   6586 C  C   . TRP B 1 430 ? 35.760  20.589  -30.057 1.00 71.66  ? 408  TRP B C   1 
ATOM   6587 O  O   . TRP B 1 430 ? 36.932  20.238  -30.118 1.00 73.37  ? 408  TRP B O   1 
ATOM   6588 C  CB  . TRP B 1 430 ? 35.722  22.962  -29.338 1.00 74.37  ? 408  TRP B CB  1 
ATOM   6589 C  CG  . TRP B 1 430 ? 35.025  22.714  -28.033 1.00 73.56  ? 408  TRP B CG  1 
ATOM   6590 C  CD1 . TRP B 1 430 ? 33.876  23.303  -27.599 1.00 71.85  ? 408  TRP B CD1 1 
ATOM   6591 C  CD2 . TRP B 1 430 ? 35.445  21.833  -26.988 1.00 73.48  ? 408  TRP B CD2 1 
ATOM   6592 N  NE1 . TRP B 1 430 ? 33.563  22.850  -26.341 1.00 71.80  ? 408  TRP B NE1 1 
ATOM   6593 C  CE2 . TRP B 1 430 ? 34.502  21.938  -25.950 1.00 72.66  ? 408  TRP B CE2 1 
ATOM   6594 C  CE3 . TRP B 1 430 ? 36.511  20.946  -26.840 1.00 75.37  ? 408  TRP B CE3 1 
ATOM   6595 C  CZ2 . TRP B 1 430 ? 34.595  21.198  -24.779 1.00 74.11  ? 408  TRP B CZ2 1 
ATOM   6596 C  CZ3 . TRP B 1 430 ? 36.617  20.224  -25.663 1.00 76.97  ? 408  TRP B CZ3 1 
ATOM   6597 C  CH2 . TRP B 1 430 ? 35.660  20.352  -24.651 1.00 76.40  ? 408  TRP B CH2 1 
ATOM   6598 N  N   . TRP B 1 431 ? 34.792  19.787  -29.622 1.00 55.57  ? 409  TRP B N   1 
ATOM   6599 C  CA  . TRP B 1 431 ? 35.097  18.494  -29.013 1.00 52.77  ? 409  TRP B CA  1 
ATOM   6600 C  C   . TRP B 1 431 ? 34.957  17.353  -30.006 1.00 49.74  ? 409  TRP B C   1 
ATOM   6601 O  O   . TRP B 1 431 ? 35.252  16.199  -29.679 1.00 48.32  ? 409  TRP B O   1 
ATOM   6602 C  CB  . TRP B 1 431 ? 34.216  18.278  -27.788 1.00 52.42  ? 409  TRP B CB  1 
ATOM   6603 C  CG  . TRP B 1 431 ? 32.771  18.571  -28.045 1.00 51.83  ? 409  TRP B CG  1 
ATOM   6604 C  CD1 . TRP B 1 431 ? 32.113  19.728  -27.773 1.00 54.19  ? 409  TRP B CD1 1 
ATOM   6605 C  CD2 . TRP B 1 431 ? 31.823  17.703  -28.649 1.00 49.02  ? 409  TRP B CD2 1 
ATOM   6606 N  NE1 . TRP B 1 431 ? 30.807  19.635  -28.165 1.00 52.79  ? 409  TRP B NE1 1 
ATOM   6607 C  CE2 . TRP B 1 431 ? 30.597  18.395  -28.698 1.00 49.78  ? 409  TRP B CE2 1 
ATOM   6608 C  CE3 . TRP B 1 431 ? 31.880  16.394  -29.136 1.00 46.98  ? 409  TRP B CE3 1 
ATOM   6609 C  CZ2 . TRP B 1 431 ? 29.432  17.825  -29.223 1.00 47.92  ? 409  TRP B CZ2 1 
ATOM   6610 C  CZ3 . TRP B 1 431 ? 30.718  15.829  -29.662 1.00 44.84  ? 409  TRP B CZ3 1 
ATOM   6611 C  CH2 . TRP B 1 431 ? 29.514  16.546  -29.699 1.00 45.36  ? 409  TRP B CH2 1 
ATOM   6612 N  N   . TRP B 1 432 ? 34.546  17.689  -31.228 1.00 49.14  ? 410  TRP B N   1 
ATOM   6613 C  CA  . TRP B 1 432 ? 34.089  16.709  -32.220 1.00 46.48  ? 410  TRP B CA  1 
ATOM   6614 C  C   . TRP B 1 432 ? 35.178  15.735  -32.621 1.00 46.77  ? 410  TRP B C   1 
ATOM   6615 O  O   . TRP B 1 432 ? 34.918  14.546  -32.787 1.00 43.19  ? 410  TRP B O   1 
ATOM   6616 C  CB  . TRP B 1 432 ? 33.602  17.433  -33.473 1.00 46.48  ? 410  TRP B CB  1 
ATOM   6617 C  CG  . TRP B 1 432 ? 32.741  16.630  -34.377 1.00 43.83  ? 410  TRP B CG  1 
ATOM   6618 C  CD1 . TRP B 1 432 ? 33.094  16.088  -35.569 1.00 43.54  ? 410  TRP B CD1 1 
ATOM   6619 C  CD2 . TRP B 1 432 ? 31.356  16.301  -34.176 1.00 41.74  ? 410  TRP B CD2 1 
ATOM   6620 N  NE1 . TRP B 1 432 ? 32.006  15.441  -36.134 1.00 41.83  ? 410  TRP B NE1 1 
ATOM   6621 C  CE2 . TRP B 1 432 ? 30.933  15.562  -35.294 1.00 40.12  ? 410  TRP B CE2 1 
ATOM   6622 C  CE3 . TRP B 1 432 ? 30.436  16.564  -33.158 1.00 41.13  ? 410  TRP B CE3 1 
ATOM   6623 C  CZ2 . TRP B 1 432 ? 29.634  15.078  -35.423 1.00 38.85  ? 410  TRP B CZ2 1 
ATOM   6624 C  CZ3 . TRP B 1 432 ? 29.140  16.077  -33.289 1.00 39.58  ? 410  TRP B CZ3 1 
ATOM   6625 C  CH2 . TRP B 1 432 ? 28.754  15.348  -34.414 1.00 38.03  ? 410  TRP B CH2 1 
ATOM   6626 N  N   . HIS B 1 433 ? 36.401  16.241  -32.761 1.00 49.91  ? 411  HIS B N   1 
ATOM   6627 C  CA  . HIS B 1 433 ? 37.507  15.432  -33.238 1.00 52.56  ? 411  HIS B CA  1 
ATOM   6628 C  C   . HIS B 1 433 ? 38.300  14.782  -32.128 1.00 51.44  ? 411  HIS B C   1 
ATOM   6629 O  O   . HIS B 1 433 ? 39.169  13.966  -32.392 1.00 51.73  ? 411  HIS B O   1 
ATOM   6630 C  CB  . HIS B 1 433 ? 38.381  16.268  -34.175 1.00 59.87  ? 411  HIS B CB  1 
ATOM   6631 C  CG  . HIS B 1 433 ? 37.648  16.667  -35.423 1.00 65.76  ? 411  HIS B CG  1 
ATOM   6632 N  ND1 . HIS B 1 433 ? 37.244  17.965  -35.679 1.00 70.77  ? 411  HIS B ND1 1 
ATOM   6633 C  CD2 . HIS B 1 433 ? 37.161  15.916  -36.441 1.00 66.04  ? 411  HIS B CD2 1 
ATOM   6634 C  CE1 . HIS B 1 433 ? 36.590  18.003  -36.826 1.00 70.14  ? 411  HIS B CE1 1 
ATOM   6635 N  NE2 . HIS B 1 433 ? 36.522  16.772  -37.306 1.00 69.01  ? 411  HIS B NE2 1 
ATOM   6636 N  N   . LEU B 1 434 ? 37.970  15.086  -30.882 1.00 50.26  ? 412  LEU B N   1 
ATOM   6637 C  CA  . LEU B 1 434 ? 38.568  14.374  -29.765 1.00 50.16  ? 412  LEU B CA  1 
ATOM   6638 C  C   . LEU B 1 434 ? 38.087  12.924  -29.761 1.00 47.07  ? 412  LEU B C   1 
ATOM   6639 O  O   . LEU B 1 434 ? 37.095  12.587  -30.428 1.00 42.84  ? 412  LEU B O   1 
ATOM   6640 C  CB  . LEU B 1 434 ? 38.216  15.040  -28.438 1.00 51.60  ? 412  LEU B CB  1 
ATOM   6641 C  CG  . LEU B 1 434 ? 38.661  16.501  -28.253 1.00 54.55  ? 412  LEU B CG  1 
ATOM   6642 C  CD1 . LEU B 1 434 ? 38.223  16.993  -26.882 1.00 55.43  ? 412  LEU B CD1 1 
ATOM   6643 C  CD2 . LEU B 1 434 ? 40.154  16.653  -28.421 1.00 57.59  ? 412  LEU B CD2 1 
ATOM   6644 N  N   . ARG B 1 435 ? 38.805  12.083  -29.012 1.00 46.80  ? 413  ARG B N   1 
ATOM   6645 C  CA  . ARG B 1 435 ? 38.560  10.637  -28.971 1.00 45.65  ? 413  ARG B CA  1 
ATOM   6646 C  C   . ARG B 1 435 ? 37.835  10.195  -27.689 1.00 44.69  ? 413  ARG B C   1 
ATOM   6647 O  O   . ARG B 1 435 ? 37.923  10.847  -26.642 1.00 44.55  ? 413  ARG B O   1 
ATOM   6648 C  CB  . ARG B 1 435 ? 39.881  9.873   -29.071 1.00 47.56  ? 413  ARG B CB  1 
ATOM   6649 C  CG  . ARG B 1 435 ? 40.750  10.298  -30.237 1.00 49.29  ? 413  ARG B CG  1 
ATOM   6650 C  CD  . ARG B 1 435 ? 40.188  9.783   -31.540 1.00 47.53  ? 413  ARG B CD  1 
ATOM   6651 N  NE  . ARG B 1 435 ? 40.744  10.448  -32.710 1.00 47.81  ? 413  ARG B NE  1 
ATOM   6652 C  CZ  . ARG B 1 435 ? 40.613  10.006  -33.957 1.00 46.39  ? 413  ARG B CZ  1 
ATOM   6653 N  NH1 . ARG B 1 435 ? 39.978  8.871   -34.225 1.00 44.48  ? 413  ARG B NH1 1 
ATOM   6654 N  NH2 . ARG B 1 435 ? 41.143  10.694  -34.947 1.00 47.80  ? 413  ARG B NH2 1 
ATOM   6655 N  N   . VAL B 1 436 ? 37.160  9.055   -27.779 1.00 42.88  ? 414  VAL B N   1 
ATOM   6656 C  CA  . VAL B 1 436 ? 36.347  8.519   -26.684 1.00 42.07  ? 414  VAL B CA  1 
ATOM   6657 C  C   . VAL B 1 436 ? 37.132  8.319   -25.380 1.00 45.22  ? 414  VAL B C   1 
ATOM   6658 O  O   . VAL B 1 436 ? 36.634  8.575   -24.279 1.00 46.08  ? 414  VAL B O   1 
ATOM   6659 C  CB  . VAL B 1 436 ? 35.712  7.169   -27.102 1.00 40.54  ? 414  VAL B CB  1 
ATOM   6660 C  CG1 . VAL B 1 436 ? 35.159  6.402   -25.897 1.00 40.59  ? 414  VAL B CG1 1 
ATOM   6661 C  CG2 . VAL B 1 436 ? 34.638  7.396   -28.147 1.00 37.79  ? 414  VAL B CG2 1 
ATOM   6662 N  N   . GLN B 1 437 ? 38.349  7.843   -25.498 1.00 47.53  ? 415  GLN B N   1 
ATOM   6663 C  CA  . GLN B 1 437 ? 39.167  7.598   -24.330 1.00 51.33  ? 415  GLN B CA  1 
ATOM   6664 C  C   . GLN B 1 437 ? 39.430  8.855   -23.468 1.00 53.32  ? 415  GLN B C   1 
ATOM   6665 O  O   . GLN B 1 437 ? 39.756  8.739   -22.275 1.00 53.99  ? 415  GLN B O   1 
ATOM   6666 C  CB  . GLN B 1 437 ? 40.488  6.990   -24.774 1.00 54.83  ? 415  GLN B CB  1 
ATOM   6667 C  CG  . GLN B 1 437 ? 41.332  7.926   -25.614 1.00 57.68  ? 415  GLN B CG  1 
ATOM   6668 C  CD  . GLN B 1 437 ? 42.342  7.181   -26.459 1.00 61.54  ? 415  GLN B CD  1 
ATOM   6669 O  OE1 . GLN B 1 437 ? 42.678  6.030   -26.165 1.00 64.85  ? 415  GLN B OE1 1 
ATOM   6670 N  NE2 . GLN B 1 437 ? 42.841  7.836   -27.512 1.00 63.34  ? 415  GLN B NE2 1 
ATOM   6671 N  N   . GLU B 1 438 ? 39.276  10.040  -24.066 1.00 52.56  ? 416  GLU B N   1 
ATOM   6672 C  CA  . GLU B 1 438 ? 39.530  11.299  -23.368 1.00 54.37  ? 416  GLU B CA  1 
ATOM   6673 C  C   . GLU B 1 438 ? 38.415  11.630  -22.379 1.00 53.21  ? 416  GLU B C   1 
ATOM   6674 O  O   . GLU B 1 438 ? 38.535  12.575  -21.606 1.00 53.82  ? 416  GLU B O   1 
ATOM   6675 C  CB  . GLU B 1 438 ? 39.790  12.439  -24.376 1.00 55.97  ? 416  GLU B CB  1 
ATOM   6676 C  CG  . GLU B 1 438 ? 40.982  12.107  -25.285 1.00 58.17  ? 416  GLU B CG  1 
ATOM   6677 C  CD  . GLU B 1 438 ? 41.502  13.248  -26.145 1.00 61.04  ? 416  GLU B CD  1 
ATOM   6678 O  OE1 . GLU B 1 438 ? 42.243  14.099  -25.618 1.00 65.52  ? 416  GLU B OE1 1 
ATOM   6679 O  OE2 . GLU B 1 438 ? 41.230  13.261  -27.371 1.00 59.38  ? 416  GLU B OE2 1 
ATOM   6680 N  N   . LEU B 1 439 ? 37.349  10.827  -22.379 1.00 50.13  ? 417  LEU B N   1 
ATOM   6681 C  CA  . LEU B 1 439 ? 36.278  10.968  -21.396 1.00 50.02  ? 417  LEU B CA  1 
ATOM   6682 C  C   . LEU B 1 439 ? 36.687  10.517  -19.991 1.00 52.88  ? 417  LEU B C   1 
ATOM   6683 O  O   . LEU B 1 439 ? 36.040  10.890  -19.023 1.00 54.26  ? 417  LEU B O   1 
ATOM   6684 C  CB  . LEU B 1 439 ? 35.031  10.206  -21.831 1.00 46.01  ? 417  LEU B CB  1 
ATOM   6685 C  CG  . LEU B 1 439 ? 34.386  10.636  -23.153 1.00 44.57  ? 417  LEU B CG  1 
ATOM   6686 C  CD1 . LEU B 1 439 ? 33.331  9.620   -23.546 1.00 42.69  ? 417  LEU B CD1 1 
ATOM   6687 C  CD2 . LEU B 1 439 ? 33.784  12.039  -23.097 1.00 44.77  ? 417  LEU B CD2 1 
ATOM   6688 N  N   . GLY B 1 440 ? 37.753  9.739   -19.865 1.00 56.67  ? 418  GLY B N   1 
ATOM   6689 C  CA  . GLY B 1 440 ? 38.220  9.308   -18.543 1.00 60.06  ? 418  GLY B CA  1 
ATOM   6690 C  C   . GLY B 1 440 ? 37.226  8.282   -18.053 1.00 59.92  ? 418  GLY B C   1 
ATOM   6691 O  O   . GLY B 1 440 ? 36.448  8.525   -17.135 1.00 62.90  ? 418  GLY B O   1 
ATOM   6692 N  N   . LEU B 1 441 ? 37.253  7.137   -18.713 1.00 58.34  ? 419  LEU B N   1 
ATOM   6693 C  CA  . LEU B 1 441 ? 36.280  6.094   -18.532 1.00 56.98  ? 419  LEU B CA  1 
ATOM   6694 C  C   . LEU B 1 441 ? 36.541  5.333   -17.243 1.00 58.57  ? 419  LEU B C   1 
ATOM   6695 O  O   . LEU B 1 441 ? 37.680  5.139   -16.872 1.00 59.64  ? 419  LEU B O   1 
ATOM   6696 C  CB  . LEU B 1 441 ? 36.379  5.118   -19.709 1.00 56.50  ? 419  LEU B CB  1 
ATOM   6697 C  CG  . LEU B 1 441 ? 36.191  5.714   -21.104 1.00 55.42  ? 419  LEU B CG  1 
ATOM   6698 C  CD1 . LEU B 1 441 ? 36.639  4.727   -22.170 1.00 55.90  ? 419  LEU B CD1 1 
ATOM   6699 C  CD2 . LEU B 1 441 ? 34.733  6.099   -21.289 1.00 52.75  ? 419  LEU B CD2 1 
ATOM   6700 N  N   . SER B 1 442 ? 35.478  4.881   -16.584 1.00 59.48  ? 420  SER B N   1 
ATOM   6701 C  CA  . SER B 1 442 ? 35.591  3.983   -15.434 1.00 61.34  ? 420  SER B CA  1 
ATOM   6702 C  C   . SER B 1 442 ? 35.426  2.556   -15.928 1.00 57.27  ? 420  SER B C   1 
ATOM   6703 O  O   . SER B 1 442 ? 34.475  2.254   -16.639 1.00 52.20  ? 420  SER B O   1 
ATOM   6704 C  CB  . SER B 1 442 ? 34.492  4.279   -14.399 1.00 63.56  ? 420  SER B CB  1 
ATOM   6705 O  OG  . SER B 1 442 ? 34.680  5.548   -13.795 1.00 67.66  ? 420  SER B OG  1 
ATOM   6706 N  N   . ALA B 1 443 ? 36.343  1.679   -15.554 1.00 56.38  ? 421  ALA B N   1 
ATOM   6707 C  CA  . ALA B 1 443 ? 36.199  0.264   -15.864 1.00 56.03  ? 421  ALA B CA  1 
ATOM   6708 C  C   . ALA B 1 443 ? 34.906  -0.229  -15.212 1.00 53.13  ? 421  ALA B C   1 
ATOM   6709 O  O   . ALA B 1 443 ? 34.713  -0.027  -14.022 1.00 54.22  ? 421  ALA B O   1 
ATOM   6710 C  CB  . ALA B 1 443 ? 37.387  -0.511  -15.323 1.00 59.45  ? 421  ALA B CB  1 
ATOM   6711 N  N   . PRO B 1 444 ? 34.010  -0.863  -15.985 1.00 50.48  ? 422  PRO B N   1 
ATOM   6712 C  CA  . PRO B 1 444 ? 32.747  -1.260  -15.394 1.00 48.20  ? 422  PRO B CA  1 
ATOM   6713 C  C   . PRO B 1 444 ? 32.811  -2.598  -14.663 1.00 48.46  ? 422  PRO B C   1 
ATOM   6714 O  O   . PRO B 1 444 ? 33.581  -3.468  -15.012 1.00 50.24  ? 422  PRO B O   1 
ATOM   6715 C  CB  . PRO B 1 444 ? 31.811  -1.336  -16.604 1.00 46.70  ? 422  PRO B CB  1 
ATOM   6716 C  CG  . PRO B 1 444 ? 32.693  -1.728  -17.724 1.00 48.18  ? 422  PRO B CG  1 
ATOM   6717 C  CD  . PRO B 1 444 ? 34.069  -1.203  -17.417 1.00 50.01  ? 422  PRO B CD  1 
ATOM   6718 N  N   . LEU B 1 445 ? 32.005  -2.724  -13.625 1.00 47.07  ? 423  LEU B N   1 
ATOM   6719 C  CA  . LEU B 1 445 ? 31.648  -4.010  -13.082 1.00 47.35  ? 423  LEU B CA  1 
ATOM   6720 C  C   . LEU B 1 445 ? 30.805  -4.760  -14.117 1.00 44.27  ? 423  LEU B C   1 
ATOM   6721 O  O   . LEU B 1 445 ? 29.885  -4.194  -14.684 1.00 42.48  ? 423  LEU B O   1 
ATOM   6722 C  CB  . LEU B 1 445 ? 30.821  -3.795  -11.809 1.00 48.43  ? 423  LEU B CB  1 
ATOM   6723 C  CG  . LEU B 1 445 ? 30.158  -5.044  -11.228 1.00 50.09  ? 423  LEU B CG  1 
ATOM   6724 C  CD1 . LEU B 1 445 ? 31.205  -5.904  -10.543 1.00 52.22  ? 423  LEU B CD1 1 
ATOM   6725 C  CD2 . LEU B 1 445 ? 29.029  -4.651  -10.281 1.00 49.71  ? 423  LEU B CD2 1 
ATOM   6726 N  N   . THR B 1 446 ? 31.092  -6.032  -14.357 1.00 44.75  ? 424  THR B N   1 
ATOM   6727 C  CA  . THR B 1 446 ? 30.219  -6.838  -15.208 1.00 43.95  ? 424  THR B CA  1 
ATOM   6728 C  C   . THR B 1 446 ? 29.632  -7.969  -14.387 1.00 43.73  ? 424  THR B C   1 
ATOM   6729 O  O   . THR B 1 446 ? 30.197  -8.365  -13.386 1.00 46.03  ? 424  THR B O   1 
ATOM   6730 C  CB  . THR B 1 446 ? 30.949  -7.433  -16.435 1.00 44.96  ? 424  THR B CB  1 
ATOM   6731 O  OG1 . THR B 1 446 ? 31.878  -8.417  -16.000 1.00 48.92  ? 424  THR B OG1 1 
ATOM   6732 C  CG2 . THR B 1 446 ? 31.675  -6.354  -17.239 1.00 44.61  ? 424  THR B CG2 1 
ATOM   6733 N  N   . VAL B 1 447 ? 28.499  -8.494  -14.830 1.00 41.66  ? 425  VAL B N   1 
ATOM   6734 C  CA  . VAL B 1 447 ? 27.843  -9.610  -14.168 1.00 42.75  ? 425  VAL B CA  1 
ATOM   6735 C  C   . VAL B 1 447 ? 27.530  -10.715 -15.163 1.00 43.72  ? 425  VAL B C   1 
ATOM   6736 O  O   . VAL B 1 447 ? 27.399  -10.452 -16.359 1.00 42.57  ? 425  VAL B O   1 
ATOM   6737 C  CB  . VAL B 1 447 ? 26.558  -9.160  -13.444 1.00 41.65  ? 425  VAL B CB  1 
ATOM   6738 C  CG1 . VAL B 1 447 ? 26.894  -8.092  -12.409 1.00 41.19  ? 425  VAL B CG1 1 
ATOM   6739 C  CG2 . VAL B 1 447 ? 25.518  -8.648  -14.421 1.00 40.13  ? 425  VAL B CG2 1 
ATOM   6740 N  N   . LEU B 1 448 ? 27.438  -11.953 -14.665 1.00 46.27  ? 426  LEU B N   1 
ATOM   6741 C  CA  . LEU B 1 448 ? 27.065  -13.109 -15.491 1.00 48.28  ? 426  LEU B CA  1 
ATOM   6742 C  C   . LEU B 1 448 ? 25.576  -13.103 -15.775 1.00 47.87  ? 426  LEU B C   1 
ATOM   6743 O  O   . LEU B 1 448 ? 24.808  -12.567 -14.990 1.00 45.23  ? 426  LEU B O   1 
ATOM   6744 C  CB  . LEU B 1 448 ? 27.429  -14.419 -14.791 1.00 51.25  ? 426  LEU B CB  1 
ATOM   6745 C  CG  . LEU B 1 448 ? 28.912  -14.676 -14.569 1.00 53.01  ? 426  LEU B CG  1 
ATOM   6746 C  CD1 . LEU B 1 448 ? 29.118  -15.871 -13.641 1.00 55.99  ? 426  LEU B CD1 1 
ATOM   6747 C  CD2 . LEU B 1 448 ? 29.601  -14.895 -15.903 1.00 54.54  ? 426  LEU B CD2 1 
ATOM   6748 N  N   . PRO B 1 449 ? 25.154  -13.707 -16.904 1.00 50.42  ? 427  PRO B N   1 
ATOM   6749 C  CA  . PRO B 1 449 ? 23.716  -13.742 -17.235 1.00 50.23  ? 427  PRO B CA  1 
ATOM   6750 C  C   . PRO B 1 449 ? 22.900  -14.657 -16.308 1.00 51.58  ? 427  PRO B C   1 
ATOM   6751 O  O   . PRO B 1 449 ? 21.681  -14.640 -16.360 1.00 52.37  ? 427  PRO B O   1 
ATOM   6752 C  CB  . PRO B 1 449 ? 23.696  -14.273 -18.682 1.00 51.34  ? 427  PRO B CB  1 
ATOM   6753 C  CG  . PRO B 1 449 ? 24.950  -15.066 -18.812 1.00 53.71  ? 427  PRO B CG  1 
ATOM   6754 C  CD  . PRO B 1 449 ? 25.972  -14.392 -17.926 1.00 53.07  ? 427  PRO B CD  1 
ATOM   6755 N  N   . THR B 1 450 ? 23.582  -15.429 -15.466 1.00 54.42  ? 428  THR B N   1 
ATOM   6756 C  CA  . THR B 1 450 ? 22.954  -16.330 -14.501 1.00 56.11  ? 428  THR B CA  1 
ATOM   6757 C  C   . THR B 1 450 ? 22.609  -15.640 -13.175 1.00 54.43  ? 428  THR B C   1 
ATOM   6758 O  O   . THR B 1 450 ? 21.996  -16.244 -12.319 1.00 55.27  ? 428  THR B O   1 
ATOM   6759 C  CB  . THR B 1 450 ? 23.901  -17.502 -14.191 1.00 59.95  ? 428  THR B CB  1 
ATOM   6760 O  OG1 . THR B 1 450 ? 25.200  -16.977 -13.910 1.00 60.39  ? 428  THR B OG1 1 
ATOM   6761 C  CG2 . THR B 1 450 ? 24.006  -18.452 -15.383 1.00 62.38  ? 428  THR B CG2 1 
ATOM   6762 N  N   . ILE B 1 451 ? 23.007  -14.381 -13.006 1.00 52.42  ? 429  ILE B N   1 
ATOM   6763 C  CA  . ILE B 1 451 ? 22.732  -13.630 -11.783 1.00 49.56  ? 429  ILE B CA  1 
ATOM   6764 C  C   . ILE B 1 451 ? 21.231  -13.419 -11.592 1.00 47.70  ? 429  ILE B C   1 
ATOM   6765 O  O   . ILE B 1 451 ? 20.500  -13.279 -12.558 1.00 45.35  ? 429  ILE B O   1 
ATOM   6766 C  CB  . ILE B 1 451 ? 23.451  -12.260 -11.816 1.00 48.96  ? 429  ILE B CB  1 
ATOM   6767 C  CG1 . ILE B 1 451 ? 23.405  -11.578 -10.439 1.00 49.31  ? 429  ILE B CG1 1 
ATOM   6768 C  CG2 . ILE B 1 451 ? 22.842  -11.327 -12.866 1.00 46.79  ? 429  ILE B CG2 1 
ATOM   6769 C  CD1 . ILE B 1 451 ? 24.270  -10.332 -10.349 1.00 48.17  ? 429  ILE B CD1 1 
ATOM   6770 N  N   . THR B 1 452 ? 20.777  -13.401 -10.338 1.00 47.02  ? 430  THR B N   1 
ATOM   6771 C  CA  . THR B 1 452 ? 19.372  -13.102 -10.038 1.00 45.59  ? 430  THR B CA  1 
ATOM   6772 C  C   . THR B 1 452 ? 19.126  -11.607 -9.967  1.00 42.63  ? 430  THR B C   1 
ATOM   6773 O  O   . THR B 1 452 ? 20.055  -10.815 -9.869  1.00 41.75  ? 430  THR B O   1 
ATOM   6774 C  CB  . THR B 1 452 ? 18.898  -13.725 -8.720  1.00 46.98  ? 430  THR B CB  1 
ATOM   6775 O  OG1 . THR B 1 452 ? 19.591  -13.123 -7.618  1.00 46.99  ? 430  THR B OG1 1 
ATOM   6776 C  CG2 . THR B 1 452 ? 19.158  -15.217 -8.727  1.00 50.23  ? 430  THR B CG2 1 
ATOM   6777 N  N   . CYS B 1 453 ? 17.856  -11.234 -10.031 1.00 42.63  ? 431  CYS B N   1 
ATOM   6778 C  CA  . CYS B 1 453 ? 17.444  -9.851  -9.906  1.00 41.56  ? 431  CYS B CA  1 
ATOM   6779 C  C   . CYS B 1 453 ? 17.848  -9.305  -8.525  1.00 41.01  ? 431  CYS B C   1 
ATOM   6780 O  O   . CYS B 1 453 ? 18.345  -8.183  -8.402  1.00 40.94  ? 431  CYS B O   1 
ATOM   6781 C  CB  . CYS B 1 453 ? 15.937  -9.739  -10.166 1.00 42.10  ? 431  CYS B CB  1 
ATOM   6782 S  SG  . CYS B 1 453 ? 15.492  -9.992  -11.926 1.00 46.15  ? 431  CYS B SG  1 
ATOM   6783 N  N   . GLY B 1 454 ? 17.687  -10.127 -7.501  1.00 41.79  ? 432  GLY B N   1 
ATOM   6784 C  CA  . GLY B 1 454 ? 18.063  -9.763  -6.146  1.00 41.44  ? 432  GLY B CA  1 
ATOM   6785 C  C   . GLY B 1 454 ? 19.546  -9.556  -5.949  1.00 41.59  ? 432  GLY B C   1 
ATOM   6786 O  O   . GLY B 1 454 ? 19.962  -8.563  -5.364  1.00 41.66  ? 432  GLY B O   1 
ATOM   6787 N  N   A HIS B 1 455 ? 20.352  -10.484 -6.444  0.50 42.65  ? 433  HIS B N   1 
ATOM   6788 N  N   B HIS B 1 455 ? 20.369  -10.479 -6.431  0.50 43.45  ? 433  HIS B N   1 
ATOM   6789 C  CA  A HIS B 1 455 ? 21.799  -10.366 -6.300  0.50 43.27  ? 433  HIS B CA  1 
ATOM   6790 C  CA  B HIS B 1 455 ? 21.817  -10.313 -6.272  0.50 44.60  ? 433  HIS B CA  1 
ATOM   6791 C  C   A HIS B 1 455 ? 22.368  -9.217  -7.159  0.50 42.85  ? 433  HIS B C   1 
ATOM   6792 C  C   B HIS B 1 455 ? 22.358  -9.169  -7.139  0.50 43.58  ? 433  HIS B C   1 
ATOM   6793 O  O   A HIS B 1 455 ? 23.436  -8.676  -6.846  0.50 43.76  ? 433  HIS B O   1 
ATOM   6794 O  O   B HIS B 1 455 ? 23.399  -8.585  -6.815  0.50 44.32  ? 433  HIS B O   1 
ATOM   6795 C  CB  A HIS B 1 455 ? 22.482  -11.704 -6.608  0.50 44.72  ? 433  HIS B CB  1 
ATOM   6796 C  CB  B HIS B 1 455 ? 22.576  -11.610 -6.554  0.50 46.98  ? 433  HIS B CB  1 
ATOM   6797 C  CG  A HIS B 1 455 ? 22.132  -12.797 -5.644  0.50 46.06  ? 433  HIS B CG  1 
ATOM   6798 C  CG  B HIS B 1 455 ? 24.064  -11.477 -6.418  0.50 48.60  ? 433  HIS B CG  1 
ATOM   6799 N  ND1 A HIS B 1 455 ? 21.983  -12.576 -4.290  0.50 46.25  ? 433  HIS B ND1 1 
ATOM   6800 N  ND1 B HIS B 1 455 ? 24.660  -10.810 -5.368  0.50 49.14  ? 433  HIS B ND1 1 
ATOM   6801 C  CD2 A HIS B 1 455 ? 21.913  -14.121 -5.832  0.50 47.38  ? 433  HIS B CD2 1 
ATOM   6802 C  CD2 B HIS B 1 455 ? 25.076  -11.934 -7.194  0.50 49.97  ? 433  HIS B CD2 1 
ATOM   6803 C  CE1 A HIS B 1 455 ? 21.682  -13.712 -3.689  0.50 47.32  ? 433  HIS B CE1 1 
ATOM   6804 C  CE1 B HIS B 1 455 ? 25.972  -10.860 -5.504  0.50 50.40  ? 433  HIS B CE1 1 
ATOM   6805 N  NE2 A HIS B 1 455 ? 21.631  -14.663 -4.603  0.50 48.45  ? 433  HIS B NE2 1 
ATOM   6806 N  NE2 B HIS B 1 455 ? 26.251  -11.535 -6.606  0.50 51.13  ? 433  HIS B NE2 1 
ATOM   6807 N  N   . THR B 1 456 ? 21.651  -8.842  -8.223  1.00 42.13  ? 434  THR B N   1 
ATOM   6808 C  CA  . THR B 1 456 ? 22.009  -7.677  -9.056  1.00 41.67  ? 434  THR B CA  1 
ATOM   6809 C  C   . THR B 1 456 ? 21.886  -6.382  -8.237  1.00 39.83  ? 434  THR B C   1 
ATOM   6810 O  O   . THR B 1 456 ? 22.794  -5.572  -8.210  1.00 39.80  ? 434  THR B O   1 
ATOM   6811 C  CB  . THR B 1 456 ? 21.131  -7.593  -10.336 1.00 41.90  ? 434  THR B CB  1 
ATOM   6812 O  OG1 . THR B 1 456 ? 21.322  -8.770  -11.128 1.00 43.34  ? 434  THR B OG1 1 
ATOM   6813 C  CG2 . THR B 1 456 ? 21.484  -6.391  -11.172 1.00 42.18  ? 434  THR B CG2 1 
ATOM   6814 N  N   . ILE B 1 457 ? 20.761  -6.219  -7.558  1.00 39.71  ? 435  ILE B N   1 
ATOM   6815 C  CA  . ILE B 1 457 ? 20.553  -5.101  -6.649  1.00 38.99  ? 435  ILE B CA  1 
ATOM   6816 C  C   . ILE B 1 457 ? 21.685  -5.096  -5.614  1.00 40.21  ? 435  ILE B C   1 
ATOM   6817 O  O   . ILE B 1 457 ? 22.338  -4.076  -5.406  1.00 40.33  ? 435  ILE B O   1 
ATOM   6818 C  CB  . ILE B 1 457 ? 19.203  -5.231  -5.906  1.00 39.43  ? 435  ILE B CB  1 
ATOM   6819 C  CG1 . ILE B 1 457 ? 18.009  -5.201  -6.871  1.00 38.68  ? 435  ILE B CG1 1 
ATOM   6820 C  CG2 . ILE B 1 457 ? 19.058  -4.149  -4.841  1.00 39.23  ? 435  ILE B CG2 1 
ATOM   6821 C  CD1 . ILE B 1 457 ? 17.905  -3.922  -7.648  1.00 39.30  ? 435  ILE B CD1 1 
ATOM   6822 N  N   . GLU B 1 458 ? 21.935  -6.244  -4.987  1.00 41.93  ? 436  GLU B N   1 
ATOM   6823 C  CA  . GLU B 1 458 ? 22.919  -6.315  -3.903  1.00 43.86  ? 436  GLU B CA  1 
ATOM   6824 C  C   . GLU B 1 458 ? 24.310  -5.927  -4.380  1.00 43.70  ? 436  GLU B C   1 
ATOM   6825 O  O   . GLU B 1 458 ? 25.021  -5.167  -3.709  1.00 42.73  ? 436  GLU B O   1 
ATOM   6826 C  CB  . GLU B 1 458 ? 22.956  -7.710  -3.277  1.00 46.41  ? 436  GLU B CB  1 
ATOM   6827 C  CG  . GLU B 1 458 ? 21.749  -8.050  -2.403  1.00 47.55  ? 436  GLU B CG  1 
ATOM   6828 C  CD  . GLU B 1 458 ? 21.703  -9.519  -1.997  1.00 50.94  ? 436  GLU B CD  1 
ATOM   6829 O  OE1 . GLU B 1 458 ? 22.527  -10.312 -2.493  1.00 55.26  ? 436  GLU B OE1 1 
ATOM   6830 O  OE2 . GLU B 1 458 ? 20.832  -9.901  -1.190  1.00 52.36  ? 436  GLU B OE2 1 
ATOM   6831 N  N   . ILE B 1 459 ? 24.707  -6.431  -5.542  1.00 43.20  ? 437  ILE B N   1 
ATOM   6832 C  CA  . ILE B 1 459 ? 26.085  -6.225  -5.969  1.00 45.20  ? 437  ILE B CA  1 
ATOM   6833 C  C   . ILE B 1 459 ? 26.323  -4.796  -6.491  1.00 43.70  ? 437  ILE B C   1 
ATOM   6834 O  O   . ILE B 1 459 ? 27.378  -4.219  -6.255  1.00 44.70  ? 437  ILE B O   1 
ATOM   6835 C  CB  . ILE B 1 459 ? 26.542  -7.288  -6.999  1.00 47.87  ? 437  ILE B CB  1 
ATOM   6836 C  CG1 . ILE B 1 459 ? 28.066  -7.273  -7.111  1.00 50.79  ? 437  ILE B CG1 1 
ATOM   6837 C  CG2 . ILE B 1 459 ? 25.897  -7.069  -8.372  1.00 46.52  ? 437  ILE B CG2 1 
ATOM   6838 C  CD1 . ILE B 1 459 ? 28.664  -8.650  -7.023  1.00 54.94  ? 437  ILE B CD1 1 
ATOM   6839 N  N   . LEU B 1 460 ? 25.343  -4.228  -7.185  1.00 41.09  ? 438  LEU B N   1 
ATOM   6840 C  CA  . LEU B 1 460 ? 25.460  -2.842  -7.674  1.00 41.15  ? 438  LEU B CA  1 
ATOM   6841 C  C   . LEU B 1 460 ? 25.619  -1.872  -6.495  1.00 43.12  ? 438  LEU B C   1 
ATOM   6842 O  O   . LEU B 1 460 ? 26.529  -1.022  -6.481  1.00 45.53  ? 438  LEU B O   1 
ATOM   6843 C  CB  . LEU B 1 460 ? 24.251  -2.474  -8.528  1.00 38.44  ? 438  LEU B CB  1 
ATOM   6844 C  CG  . LEU B 1 460 ? 24.168  -3.229  -9.856  1.00 38.38  ? 438  LEU B CG  1 
ATOM   6845 C  CD1 . LEU B 1 460 ? 22.901  -2.895  -10.621 1.00 36.75  ? 438  LEU B CD1 1 
ATOM   6846 C  CD2 . LEU B 1 460 ? 25.393  -2.953  -10.711 1.00 40.44  ? 438  LEU B CD2 1 
ATOM   6847 N  N   . ARG B 1 461 ? 24.761  -2.044  -5.490  1.00 42.94  ? 439  ARG B N   1 
ATOM   6848 C  CA  . ARG B 1 461 ? 24.747  -1.181  -4.318  1.00 44.39  ? 439  ARG B CA  1 
ATOM   6849 C  C   . ARG B 1 461 ? 25.996  -1.394  -3.475  1.00 47.95  ? 439  ARG B C   1 
ATOM   6850 O  O   . ARG B 1 461 ? 26.614  -0.430  -3.038  1.00 48.12  ? 439  ARG B O   1 
ATOM   6851 C  CB  . ARG B 1 461 ? 23.497  -1.444  -3.469  1.00 42.93  ? 439  ARG B CB  1 
ATOM   6852 C  CG  . ARG B 1 461 ? 22.212  -1.073  -4.181  1.00 40.41  ? 439  ARG B CG  1 
ATOM   6853 C  CD  . ARG B 1 461 ? 20.999  -1.066  -3.272  1.00 39.87  ? 439  ARG B CD  1 
ATOM   6854 N  NE  . ARG B 1 461 ? 21.015  0.138   -2.443  1.00 40.40  ? 439  ARG B NE  1 
ATOM   6855 C  CZ  . ARG B 1 461 ? 21.241  0.175   -1.138  1.00 41.12  ? 439  ARG B CZ  1 
ATOM   6856 N  NH1 . ARG B 1 461 ? 21.450  -0.929  -0.438  1.00 41.76  ? 439  ARG B NH1 1 
ATOM   6857 N  NH2 . ARG B 1 461 ? 21.242  1.340   -0.526  1.00 42.21  ? 439  ARG B NH2 1 
ATOM   6858 N  N   . GLU B 1 462 ? 26.368  -2.654  -3.256  1.00 50.64  ? 440  GLU B N   1 
ATOM   6859 C  CA  . GLU B 1 462 ? 27.588  -2.975  -2.514  1.00 54.00  ? 440  GLU B CA  1 
ATOM   6860 C  C   . GLU B 1 462 ? 28.836  -2.395  -3.198  1.00 54.62  ? 440  GLU B C   1 
ATOM   6861 O  O   . GLU B 1 462 ? 29.710  -1.876  -2.518  1.00 56.88  ? 440  GLU B O   1 
ATOM   6862 C  CB  . GLU B 1 462 ? 27.727  -4.482  -2.347  1.00 57.08  ? 440  GLU B CB  1 
ATOM   6863 C  CG  . GLU B 1 462 ? 28.900  -4.934  -1.486  1.00 64.04  ? 440  GLU B CG  1 
ATOM   6864 C  CD  . GLU B 1 462 ? 29.024  -6.449  -1.422  1.00 67.67  ? 440  GLU B CD  1 
ATOM   6865 O  OE1 . GLU B 1 462 ? 28.511  -7.137  -2.341  1.00 71.77  ? 440  GLU B OE1 1 
ATOM   6866 O  OE2 . GLU B 1 462 ? 29.630  -6.957  -0.459  1.00 74.13  ? 440  GLU B OE2 1 
ATOM   6867 N  N   . LYS B 1 463 ? 28.913  -2.457  -4.526  1.00 52.67  ? 441  LYS B N   1 
ATOM   6868 C  CA  . LYS B 1 463 ? 30.115  -2.010  -5.243  1.00 54.60  ? 441  LYS B CA  1 
ATOM   6869 C  C   . LYS B 1 463 ? 30.063  -0.558  -5.688  1.00 54.21  ? 441  LYS B C   1 
ATOM   6870 O  O   . LYS B 1 463 ? 31.062  -0.037  -6.157  1.00 54.63  ? 441  LYS B O   1 
ATOM   6871 C  CB  . LYS B 1 463 ? 30.389  -2.890  -6.458  1.00 55.60  ? 441  LYS B CB  1 
ATOM   6872 C  CG  . LYS B 1 463 ? 30.682  -4.344  -6.132  1.00 60.60  ? 441  LYS B CG  1 
ATOM   6873 C  CD  . LYS B 1 463 ? 32.091  -4.535  -5.599  1.00 67.11  ? 441  LYS B CD  1 
ATOM   6874 C  CE  . LYS B 1 463 ? 32.364  -5.988  -5.222  1.00 73.09  ? 441  LYS B CE  1 
ATOM   6875 N  NZ  . LYS B 1 463 ? 32.198  -6.887  -6.402  1.00 74.48  ? 441  LYS B NZ  1 
ATOM   6876 N  N   . GLY B 1 464 ? 28.903  0.087   -5.566  1.00 52.65  ? 442  GLY B N   1 
ATOM   6877 C  CA  . GLY B 1 464 ? 28.760  1.498   -5.922  1.00 51.32  ? 442  GLY B CA  1 
ATOM   6878 C  C   . GLY B 1 464 ? 28.667  1.772   -7.409  1.00 49.65  ? 442  GLY B C   1 
ATOM   6879 O  O   . GLY B 1 464 ? 29.177  2.773   -7.881  1.00 50.73  ? 442  GLY B O   1 
ATOM   6880 N  N   . PHE B 1 465 ? 28.008  0.892   -8.153  1.00 47.12  ? 443  PHE B N   1 
ATOM   6881 C  CA  . PHE B 1 465 ? 27.755  1.114   -9.565  1.00 46.12  ? 443  PHE B CA  1 
ATOM   6882 C  C   . PHE B 1 465 ? 26.243  1.160   -9.745  1.00 44.93  ? 443  PHE B C   1 
ATOM   6883 O  O   . PHE B 1 465 ? 25.510  0.534   -8.983  1.00 44.60  ? 443  PHE B O   1 
ATOM   6884 C  CB  . PHE B 1 465 ? 28.312  -0.039  -10.427 1.00 47.07  ? 443  PHE B CB  1 
ATOM   6885 C  CG  . PHE B 1 465 ? 29.821  -0.095  -10.506 1.00 48.78  ? 443  PHE B CG  1 
ATOM   6886 C  CD1 . PHE B 1 465 ? 30.560  -0.689  -9.497  1.00 50.10  ? 443  PHE B CD1 1 
ATOM   6887 C  CD2 . PHE B 1 465 ? 30.493  0.416   -11.613 1.00 49.50  ? 443  PHE B CD2 1 
ATOM   6888 C  CE1 . PHE B 1 465 ? 31.941  -0.758  -9.573  1.00 53.21  ? 443  PHE B CE1 1 
ATOM   6889 C  CE2 . PHE B 1 465 ? 31.883  0.358   -11.688 1.00 51.27  ? 443  PHE B CE2 1 
ATOM   6890 C  CZ  . PHE B 1 465 ? 32.599  -0.232  -10.670 1.00 52.90  ? 443  PHE B CZ  1 
ATOM   6891 N  N   . ASP B 1 466 ? 25.791  1.912   -10.733 1.00 42.76  ? 444  ASP B N   1 
ATOM   6892 C  CA  . ASP B 1 466 ? 24.356  2.061   -11.012 1.00 43.78  ? 444  ASP B CA  1 
ATOM   6893 C  C   . ASP B 1 466 ? 23.898  1.181   -12.156 1.00 39.60  ? 444  ASP B C   1 
ATOM   6894 O  O   . ASP B 1 466 ? 22.694  1.075   -12.410 1.00 35.76  ? 444  ASP B O   1 
ATOM   6895 C  CB  . ASP B 1 466 ? 24.015  3.520   -11.328 1.00 47.52  ? 444  ASP B CB  1 
ATOM   6896 C  CG  . ASP B 1 466 ? 23.873  4.355   -10.075 1.00 54.52  ? 444  ASP B CG  1 
ATOM   6897 O  OD1 . ASP B 1 466 ? 23.403  3.822   -9.043  1.00 60.68  ? 444  ASP B OD1 1 
ATOM   6898 O  OD2 . ASP B 1 466 ? 24.257  5.541   -10.107 1.00 59.77  ? 444  ASP B OD2 1 
ATOM   6899 N  N   . GLN B 1 467 ? 24.866  0.540   -12.818 1.00 37.38  ? 445  GLN B N   1 
ATOM   6900 C  CA  . GLN B 1 467 ? 24.612  -0.283  -13.966 1.00 37.34  ? 445  GLN B CA  1 
ATOM   6901 C  C   . GLN B 1 467 ? 25.743  -1.287  -14.132 1.00 35.92  ? 445  GLN B C   1 
ATOM   6902 O  O   . GLN B 1 467 ? 26.810  -1.137  -13.535 1.00 35.30  ? 445  GLN B O   1 
ATOM   6903 C  CB  . GLN B 1 467 ? 24.533  0.604   -15.206 1.00 40.04  ? 445  GLN B CB  1 
ATOM   6904 C  CG  . GLN B 1 467 ? 25.801  1.439   -15.356 1.00 45.64  ? 445  GLN B CG  1 
ATOM   6905 C  CD  . GLN B 1 467 ? 25.725  2.434   -16.464 1.00 50.46  ? 445  GLN B CD  1 
ATOM   6906 O  OE1 . GLN B 1 467 ? 24.664  2.677   -17.038 1.00 56.91  ? 445  GLN B OE1 1 
ATOM   6907 N  NE2 . GLN B 1 467 ? 26.863  3.023   -16.789 1.00 55.96  ? 445  GLN B NE2 1 
ATOM   6908 N  N   . ALA B 1 468 ? 25.484  -2.326  -14.921 1.00 33.95  ? 446  ALA B N   1 
ATOM   6909 C  CA  . ALA B 1 468 ? 26.498  -3.329  -15.234 1.00 35.16  ? 446  ALA B CA  1 
ATOM   6910 C  C   . ALA B 1 468 ? 26.185  -4.014  -16.575 1.00 34.17  ? 446  ALA B C   1 
ATOM   6911 O  O   . ALA B 1 468 ? 25.050  -4.409  -16.819 1.00 33.82  ? 446  ALA B O   1 
ATOM   6912 C  CB  . ALA B 1 468 ? 26.595  -4.358  -14.113 1.00 36.18  ? 446  ALA B CB  1 
ATOM   6913 N  N   . PRO B 1 469 ? 27.194  -4.128  -17.459 1.00 33.87  ? 447  PRO B N   1 
ATOM   6914 C  CA  . PRO B 1 469 ? 27.040  -4.983  -18.621 1.00 33.74  ? 447  PRO B CA  1 
ATOM   6915 C  C   . PRO B 1 469 ? 26.904  -6.426  -18.162 1.00 34.81  ? 447  PRO B C   1 
ATOM   6916 O  O   . PRO B 1 469 ? 27.523  -6.822  -17.169 1.00 35.86  ? 447  PRO B O   1 
ATOM   6917 C  CB  . PRO B 1 469 ? 28.355  -4.784  -19.380 1.00 34.94  ? 447  PRO B CB  1 
ATOM   6918 C  CG  . PRO B 1 469 ? 28.874  -3.468  -18.916 1.00 33.93  ? 447  PRO B CG  1 
ATOM   6919 C  CD  . PRO B 1 469 ? 28.469  -3.388  -17.485 1.00 34.17  ? 447  PRO B CD  1 
ATOM   6920 N  N   . VAL B 1 470 ? 26.076  -7.186  -18.856 1.00 34.57  ? 448  VAL B N   1 
ATOM   6921 C  CA  . VAL B 1 470 ? 25.921  -8.592  -18.614 1.00 37.36  ? 448  VAL B CA  1 
ATOM   6922 C  C   . VAL B 1 470 ? 26.809  -9.277  -19.632 1.00 39.00  ? 448  VAL B C   1 
ATOM   6923 O  O   . VAL B 1 470 ? 26.638  -9.086  -20.830 1.00 38.60  ? 448  VAL B O   1 
ATOM   6924 C  CB  . VAL B 1 470 ? 24.459  -9.022  -18.780 1.00 37.32  ? 448  VAL B CB  1 
ATOM   6925 C  CG1 . VAL B 1 470 ? 24.291  -10.483 -18.420 1.00 40.19  ? 448  VAL B CG1 1 
ATOM   6926 C  CG2 . VAL B 1 470 ? 23.579  -8.162  -17.887 1.00 36.88  ? 448  VAL B CG2 1 
ATOM   6927 N  N   . VAL B 1 471 ? 27.786  -10.031 -19.156 1.00 41.49  ? 449  VAL B N   1 
ATOM   6928 C  CA  . VAL B 1 471 ? 28.761  -10.657 -20.027 1.00 44.30  ? 449  VAL B CA  1 
ATOM   6929 C  C   . VAL B 1 471 ? 28.879  -12.111 -19.634 1.00 48.14  ? 449  VAL B C   1 
ATOM   6930 O  O   . VAL B 1 471 ? 29.059  -12.405 -18.462 1.00 48.69  ? 449  VAL B O   1 
ATOM   6931 C  CB  . VAL B 1 471 ? 30.140  -9.982  -19.878 1.00 45.13  ? 449  VAL B CB  1 
ATOM   6932 C  CG1 . VAL B 1 471 ? 31.144  -10.583 -20.863 1.00 47.51  ? 449  VAL B CG1 1 
ATOM   6933 C  CG2 . VAL B 1 471 ? 30.030  -8.474  -20.062 1.00 42.46  ? 449  VAL B CG2 1 
ATOM   6934 N  N   . ASP B 1 472 ? 28.779  -13.019 -20.597 1.00 51.24  ? 450  ASP B N   1 
ATOM   6935 C  CA  . ASP B 1 472 ? 28.855  -14.451 -20.290 1.00 56.90  ? 450  ASP B CA  1 
ATOM   6936 C  C   . ASP B 1 472 ? 30.291  -14.949 -20.140 1.00 59.78  ? 450  ASP B C   1 
ATOM   6937 O  O   . ASP B 1 472 ? 31.244  -14.189 -20.304 1.00 59.65  ? 450  ASP B O   1 
ATOM   6938 C  CB  . ASP B 1 472 ? 28.066  -15.297 -21.314 1.00 59.88  ? 450  ASP B CB  1 
ATOM   6939 C  CG  . ASP B 1 472 ? 28.745  -15.399 -22.685 1.00 63.06  ? 450  ASP B CG  1 
ATOM   6940 O  OD1 . ASP B 1 472 ? 29.945  -15.066 -22.841 1.00 64.74  ? 450  ASP B OD1 1 
ATOM   6941 O  OD2 . ASP B 1 472 ? 28.045  -15.829 -23.628 1.00 65.21  ? 450  ASP B OD2 1 
ATOM   6942 N  N   . GLU B 1 473 ? 30.429  -16.230 -19.827 1.00 63.99  ? 451  GLU B N   1 
ATOM   6943 C  CA  . GLU B 1 473 ? 31.732  -16.844 -19.583 1.00 68.84  ? 451  GLU B CA  1 
ATOM   6944 C  C   . GLU B 1 473 ? 32.667  -16.776 -20.800 1.00 71.10  ? 451  GLU B C   1 
ATOM   6945 O  O   . GLU B 1 473 ? 33.878  -16.662 -20.636 1.00 75.53  ? 451  GLU B O   1 
ATOM   6946 C  CB  . GLU B 1 473 ? 31.561  -18.297 -19.117 1.00 71.39  ? 451  GLU B CB  1 
ATOM   6947 C  CG  . GLU B 1 473 ? 30.846  -18.427 -17.780 1.00 70.65  ? 451  GLU B CG  1 
ATOM   6948 N  N   . ALA B 1 474 ? 32.107  -16.828 -22.009 1.00 70.26  ? 452  ALA B N   1 
ATOM   6949 C  CA  . ALA B 1 474 ? 32.894  -16.672 -23.237 1.00 69.81  ? 452  ALA B CA  1 
ATOM   6950 C  C   . ALA B 1 474 ? 33.229  -15.209 -23.551 1.00 66.92  ? 452  ALA B C   1 
ATOM   6951 O  O   . ALA B 1 474 ? 33.899  -14.931 -24.540 1.00 67.80  ? 452  ALA B O   1 
ATOM   6952 C  CB  . ALA B 1 474 ? 32.161  -17.306 -24.409 1.00 70.41  ? 452  ALA B CB  1 
ATOM   6953 N  N   . GLY B 1 475 ? 32.759  -14.269 -22.729 1.00 64.01  ? 453  GLY B N   1 
ATOM   6954 C  CA  . GLY B 1 475 ? 33.033  -12.839 -22.938 1.00 60.42  ? 453  GLY B CA  1 
ATOM   6955 C  C   . GLY B 1 475 ? 32.068  -12.121 -23.874 1.00 56.89  ? 453  GLY B C   1 
ATOM   6956 O  O   . GLY B 1 475 ? 32.311  -10.976 -24.271 1.00 55.20  ? 453  GLY B O   1 
ATOM   6957 N  N   . VAL B 1 476 ? 30.968  -12.777 -24.228 1.00 56.11  ? 454  VAL B N   1 
ATOM   6958 C  CA  . VAL B 1 476 ? 29.976  -12.178 -25.125 1.00 53.04  ? 454  VAL B CA  1 
ATOM   6959 C  C   . VAL B 1 476 ? 29.133  -11.196 -24.315 1.00 49.52  ? 454  VAL B C   1 
ATOM   6960 O  O   . VAL B 1 476 ? 28.582  -11.557 -23.266 1.00 46.88  ? 454  VAL B O   1 
ATOM   6961 C  CB  . VAL B 1 476 ? 29.058  -13.253 -25.746 1.00 55.56  ? 454  VAL B CB  1 
ATOM   6962 C  CG1 . VAL B 1 476 ? 28.025  -12.622 -26.671 1.00 53.67  ? 454  VAL B CG1 1 
ATOM   6963 C  CG2 . VAL B 1 476 ? 29.891  -14.310 -26.487 1.00 59.46  ? 454  VAL B CG2 1 
ATOM   6964 N  N   . ILE B 1 477 ? 29.060  -9.955  -24.791 1.00 46.72  ? 455  ILE B N   1 
ATOM   6965 C  CA  . ILE B 1 477 ? 28.261  -8.944  -24.135 1.00 44.97  ? 455  ILE B CA  1 
ATOM   6966 C  C   . ILE B 1 477 ? 26.803  -9.149  -24.517 1.00 43.64  ? 455  ILE B C   1 
ATOM   6967 O  O   . ILE B 1 477 ? 26.449  -9.075  -25.693 1.00 42.37  ? 455  ILE B O   1 
ATOM   6968 C  CB  . ILE B 1 477 ? 28.656  -7.531  -24.537 1.00 45.21  ? 455  ILE B CB  1 
ATOM   6969 C  CG1 . ILE B 1 477 ? 30.150  -7.284  -24.304 1.00 47.49  ? 455  ILE B CG1 1 
ATOM   6970 C  CG2 . ILE B 1 477 ? 27.818  -6.535  -23.743 1.00 43.99  ? 455  ILE B CG2 1 
ATOM   6971 C  CD1 . ILE B 1 477 ? 30.617  -5.936  -24.813 1.00 47.28  ? 455  ILE B CD1 1 
ATOM   6972 N  N   . LEU B 1 478 ? 25.961  -9.393  -23.519 1.00 42.47  ? 456  LEU B N   1 
ATOM   6973 C  CA  . LEU B 1 478 ? 24.553  -9.736  -23.758 1.00 43.34  ? 456  LEU B CA  1 
ATOM   6974 C  C   . LEU B 1 478 ? 23.607  -8.542  -23.591 1.00 39.71  ? 456  LEU B C   1 
ATOM   6975 O  O   . LEU B 1 478 ? 22.465  -8.584  -24.048 1.00 40.14  ? 456  LEU B O   1 
ATOM   6976 C  CB  . LEU B 1 478 ? 24.128  -10.865 -22.817 1.00 45.13  ? 456  LEU B CB  1 
ATOM   6977 C  CG  . LEU B 1 478 ? 24.854  -12.192 -23.063 1.00 48.32  ? 456  LEU B CG  1 
ATOM   6978 C  CD1 . LEU B 1 478 ? 24.599  -13.174 -21.943 1.00 49.92  ? 456  LEU B CD1 1 
ATOM   6979 C  CD2 . LEU B 1 478 ? 24.445  -12.805 -24.395 1.00 50.98  ? 456  LEU B CD2 1 
ATOM   6980 N  N   . GLY B 1 479 ? 24.078  -7.489  -22.939 1.00 36.10  ? 457  GLY B N   1 
ATOM   6981 C  CA  . GLY B 1 479 ? 23.228  -6.344  -22.656 1.00 34.52  ? 457  GLY B CA  1 
ATOM   6982 C  C   . GLY B 1 479 ? 23.624  -5.629  -21.392 1.00 34.08  ? 457  GLY B C   1 
ATOM   6983 O  O   . GLY B 1 479 ? 24.726  -5.851  -20.876 1.00 33.96  ? 457  GLY B O   1 
ATOM   6984 N  N   . MET B 1 480 ? 22.721  -4.768  -20.896 1.00 32.53  ? 458  MET B N   1 
ATOM   6985 C  CA  . MET B 1 480 ? 22.958  -3.946  -19.718 1.00 32.15  ? 458  MET B CA  1 
ATOM   6986 C  C   . MET B 1 480 ? 21.840  -4.164  -18.701 1.00 31.26  ? 458  MET B C   1 
ATOM   6987 O  O   . MET B 1 480 ? 20.687  -4.323  -19.094 1.00 32.63  ? 458  MET B O   1 
ATOM   6988 C  CB  . MET B 1 480 ? 22.950  -2.460  -20.078 1.00 33.21  ? 458  MET B CB  1 
ATOM   6989 C  CG  . MET B 1 480 ? 24.091  -1.995  -20.958 1.00 35.13  ? 458  MET B CG  1 
ATOM   6990 S  SD  . MET B 1 480 ? 25.650  -2.019  -20.063 1.00 36.70  ? 458  MET B SD  1 
ATOM   6991 C  CE  . MET B 1 480 ? 25.328  -0.900  -18.688 1.00 36.58  ? 458  MET B CE  1 
ATOM   6992 N  N   . VAL B 1 481 ? 22.178  -4.174  -17.414 1.00 30.68  ? 459  VAL B N   1 
ATOM   6993 C  CA  . VAL B 1 481 ? 21.160  -4.023  -16.352 1.00 30.91  ? 459  VAL B CA  1 
ATOM   6994 C  C   . VAL B 1 481 ? 21.484  -2.774  -15.563 1.00 30.14  ? 459  VAL B C   1 
ATOM   6995 O  O   . VAL B 1 481 ? 22.661  -2.408  -15.430 1.00 31.48  ? 459  VAL B O   1 
ATOM   6996 C  CB  . VAL B 1 481 ? 21.081  -5.227  -15.379 1.00 32.95  ? 459  VAL B CB  1 
ATOM   6997 C  CG1 . VAL B 1 481 ? 20.465  -6.422  -16.066 1.00 35.02  ? 459  VAL B CG1 1 
ATOM   6998 C  CG2 . VAL B 1 481 ? 22.432  -5.608  -14.809 1.00 33.59  ? 459  VAL B CG2 1 
ATOM   6999 N  N   . THR B 1 482 ? 20.459  -2.129  -15.021 1.00 29.47  ? 460  THR B N   1 
ATOM   7000 C  CA  . THR B 1 482 ? 20.647  -0.956  -14.190 1.00 30.04  ? 460  THR B CA  1 
ATOM   7001 C  C   . THR B 1 482 ? 19.941  -1.135  -12.850 1.00 31.35  ? 460  THR B C   1 
ATOM   7002 O  O   . THR B 1 482 ? 18.926  -1.830  -12.752 1.00 30.80  ? 460  THR B O   1 
ATOM   7003 C  CB  . THR B 1 482 ? 20.079  0.321   -14.836 1.00 30.09  ? 460  THR B CB  1 
ATOM   7004 O  OG1 . THR B 1 482 ? 18.646  0.265   -14.835 1.00 30.61  ? 460  THR B OG1 1 
ATOM   7005 C  CG2 . THR B 1 482 ? 20.598  0.493   -16.250 1.00 28.84  ? 460  THR B CG2 1 
ATOM   7006 N  N   . LEU B 1 483 ? 20.486  -0.491  -11.833 1.00 31.62  ? 461  LEU B N   1 
ATOM   7007 C  CA  . LEU B 1 483 ? 19.921  -0.535  -10.474 1.00 32.69  ? 461  LEU B CA  1 
ATOM   7008 C  C   . LEU B 1 483 ? 18.506  -0.001  -10.460 1.00 32.31  ? 461  LEU B C   1 
ATOM   7009 O  O   . LEU B 1 483 ? 17.611  -0.625  -9.933  1.00 32.52  ? 461  LEU B O   1 
ATOM   7010 C  CB  . LEU B 1 483 ? 20.772  0.304   -9.524  1.00 33.37  ? 461  LEU B CB  1 
ATOM   7011 C  CG  . LEU B 1 483 ? 20.331  0.382   -8.065  1.00 35.16  ? 461  LEU B CG  1 
ATOM   7012 C  CD1 . LEU B 1 483 ? 20.084  -1.006  -7.520  1.00 34.98  ? 461  LEU B CD1 1 
ATOM   7013 C  CD2 . LEU B 1 483 ? 21.371  1.119   -7.219  1.00 37.15  ? 461  LEU B CD2 1 
ATOM   7014 N  N   . GLY B 1 484 ? 18.314  1.164   -11.060 1.00 32.80  ? 462  GLY B N   1 
ATOM   7015 C  CA  . GLY B 1 484 ? 17.020  1.800   -11.096 1.00 32.08  ? 462  GLY B CA  1 
ATOM   7016 C  C   . GLY B 1 484 ? 15.929  1.013   -11.789 1.00 32.03  ? 462  GLY B C   1 
ATOM   7017 O  O   . GLY B 1 484 ? 14.802  0.924   -11.301 1.00 32.07  ? 462  GLY B O   1 
ATOM   7018 N  N   . ASN B 1 485 ? 16.242  0.407   -12.920 1.00 30.10  ? 463  ASN B N   1 
ATOM   7019 C  CA  . ASN B 1 485 ? 15.222  -0.357  -13.595 1.00 30.98  ? 463  ASN B CA  1 
ATOM   7020 C  C   . ASN B 1 485 ? 14.936  -1.673  -12.890 1.00 31.48  ? 463  ASN B C   1 
ATOM   7021 O  O   . ASN B 1 485 ? 13.780  -2.139  -12.862 1.00 31.76  ? 463  ASN B O   1 
ATOM   7022 C  CB  . ASN B 1 485 ? 15.592  -0.588  -15.044 1.00 30.34  ? 463  ASN B CB  1 
ATOM   7023 C  CG  . ASN B 1 485 ? 14.417  -1.004  -15.882 1.00 31.30  ? 463  ASN B CG  1 
ATOM   7024 O  OD1 . ASN B 1 485 ? 13.357  -0.358  -15.913 1.00 31.81  ? 463  ASN B OD1 1 
ATOM   7025 N  ND2 . ASN B 1 485 ? 14.589  -2.100  -16.567 1.00 31.82  ? 463  ASN B ND2 1 
ATOM   7026 N  N   . MET B 1 486 ? 15.974  -2.274  -12.326 1.00 31.28  ? 464  MET B N   1 
ATOM   7027 C  CA  . MET B 1 486 ? 15.785  -3.527  -11.597 1.00 33.99  ? 464  MET B CA  1 
ATOM   7028 C  C   . MET B 1 486 ? 14.897  -3.271  -10.364 1.00 33.57  ? 464  MET B C   1 
ATOM   7029 O  O   . MET B 1 486 ? 13.965  -4.025  -10.106 1.00 32.15  ? 464  MET B O   1 
ATOM   7030 C  CB  . MET B 1 486 ? 17.130  -4.122  -11.215 1.00 36.39  ? 464  MET B CB  1 
ATOM   7031 C  CG  . MET B 1 486 ? 17.044  -5.492  -10.603 1.00 40.77  ? 464  MET B CG  1 
ATOM   7032 S  SD  . MET B 1 486 ? 16.389  -6.723  -11.740 1.00 45.77  ? 464  MET B SD  1 
ATOM   7033 C  CE  . MET B 1 486 ? 17.786  -6.935  -12.852 1.00 44.43  ? 464  MET B CE  1 
ATOM   7034 N  N   . LEU B 1 487 ? 15.165  -2.181  -9.639  1.00 34.28  ? 465  LEU B N   1 
ATOM   7035 C  CA  . LEU B 1 487 ? 14.365  -1.831  -8.450  1.00 36.10  ? 465  LEU B CA  1 
ATOM   7036 C  C   . LEU B 1 487 ? 12.932  -1.505  -8.830  1.00 34.72  ? 465  LEU B C   1 
ATOM   7037 O  O   . LEU B 1 487 ? 12.001  -2.013  -8.205  1.00 34.41  ? 465  LEU B O   1 
ATOM   7038 C  CB  . LEU B 1 487 ? 14.925  -0.636  -7.682  1.00 37.60  ? 465  LEU B CB  1 
ATOM   7039 C  CG  . LEU B 1 487 ? 15.977  -0.899  -6.641  1.00 40.95  ? 465  LEU B CG  1 
ATOM   7040 C  CD1 . LEU B 1 487 ? 16.372  0.434   -6.006  1.00 42.94  ? 465  LEU B CD1 1 
ATOM   7041 C  CD2 . LEU B 1 487 ? 15.459  -1.849  -5.567  1.00 43.44  ? 465  LEU B CD2 1 
ATOM   7042 N  N   . SER B 1 488 ? 12.759  -0.648  -9.827  1.00 33.16  ? 466  SER B N   1 
ATOM   7043 C  CA  . SER B 1 488 ? 11.407  -0.291  -10.285 1.00 34.16  ? 466  SER B CA  1 
ATOM   7044 C  C   . SER B 1 488 ? 10.629  -1.539  -10.738 1.00 34.79  ? 466  SER B C   1 
ATOM   7045 O  O   . SER B 1 488 ? 9.451   -1.680  -10.422 1.00 34.66  ? 466  SER B O   1 
ATOM   7046 C  CB  . SER B 1 488 ? 11.455  0.738   -11.392 1.00 34.50  ? 466  SER B CB  1 
ATOM   7047 O  OG  . SER B 1 488 ? 10.142  1.142   -11.786 1.00 35.65  ? 466  SER B OG  1 
ATOM   7048 N  N   . SER B 1 489 ? 11.298  -2.450  -11.451 1.00 35.11  ? 467  SER B N   1 
ATOM   7049 C  CA  . SER B 1 489 ? 10.653  -3.706  -11.877 1.00 36.68  ? 467  SER B CA  1 
ATOM   7050 C  C   . SER B 1 489 ? 10.292  -4.611  -10.701 1.00 37.81  ? 467  SER B C   1 
ATOM   7051 O  O   . SER B 1 489 ? 9.232   -5.226  -10.707 1.00 39.45  ? 467  SER B O   1 
ATOM   7052 C  CB  . SER B 1 489 ? 11.514  -4.459  -12.891 1.00 36.49  ? 467  SER B CB  1 
ATOM   7053 O  OG  . SER B 1 489 ? 11.772  -3.630  -14.019 1.00 36.12  ? 467  SER B OG  1 
ATOM   7054 N  N   . LEU B 1 490 ? 11.157  -4.680  -9.691  1.00 38.71  ? 468  LEU B N   1 
ATOM   7055 C  CA  . LEU B 1 490 ? 10.870  -5.471  -8.492  1.00 40.46  ? 468  LEU B CA  1 
ATOM   7056 C  C   . LEU B 1 490 ? 9.697   -4.915  -7.726  1.00 40.56  ? 468  LEU B C   1 
ATOM   7057 O  O   . LEU B 1 490 ? 8.777   -5.639  -7.371  1.00 42.22  ? 468  LEU B O   1 
ATOM   7058 C  CB  . LEU B 1 490 ? 12.073  -5.499  -7.566  1.00 41.90  ? 468  LEU B CB  1 
ATOM   7059 C  CG  . LEU B 1 490 ? 13.103  -6.539  -7.965  1.00 44.37  ? 468  LEU B CG  1 
ATOM   7060 C  CD1 . LEU B 1 490 ? 14.479  -6.171  -7.429  1.00 44.87  ? 468  LEU B CD1 1 
ATOM   7061 C  CD2 . LEU B 1 490 ? 12.664  -7.911  -7.452  1.00 47.52  ? 468  LEU B CD2 1 
ATOM   7062 N  N   . LEU B 1 491 ? 9.741   -3.622  -7.469  1.00 39.92  ? 469  LEU B N   1 
ATOM   7063 C  CA  . LEU B 1 491 ? 8.716   -2.967  -6.679  1.00 42.22  ? 469  LEU B CA  1 
ATOM   7064 C  C   . LEU B 1 491 ? 7.339   -2.992  -7.353  1.00 44.45  ? 469  LEU B C   1 
ATOM   7065 O  O   . LEU B 1 491 ? 6.333   -2.926  -6.656  1.00 46.70  ? 469  LEU B O   1 
ATOM   7066 C  CB  . LEU B 1 491 ? 9.112   -1.522  -6.392  1.00 41.35  ? 469  LEU B CB  1 
ATOM   7067 C  CG  . LEU B 1 491 ? 10.302  -1.333  -5.454  1.00 41.13  ? 469  LEU B CG  1 
ATOM   7068 C  CD1 . LEU B 1 491 ? 10.539  0.162   -5.278  1.00 41.32  ? 469  LEU B CD1 1 
ATOM   7069 C  CD2 . LEU B 1 491 ? 10.041  -1.988  -4.109  1.00 41.82  ? 469  LEU B CD2 1 
ATOM   7070 N  N   . ALA B 1 492 ? 7.296   -3.076  -8.684  1.00 44.11  ? 470  ALA B N   1 
ATOM   7071 C  CA  . ALA B 1 492 ? 6.021   -3.220  -9.409  1.00 46.90  ? 470  ALA B CA  1 
ATOM   7072 C  C   . ALA B 1 492 ? 5.596   -4.686  -9.598  1.00 49.17  ? 470  ALA B C   1 
ATOM   7073 O  O   . ALA B 1 492 ? 4.621   -4.953  -10.294 1.00 50.93  ? 470  ALA B O   1 
ATOM   7074 C  CB  . ALA B 1 492 ? 6.089   -2.525  -10.769 1.00 46.10  ? 470  ALA B CB  1 
ATOM   7075 N  N   . GLY B 1 493 ? 6.330   -5.628  -9.006  1.00 49.40  ? 471  GLY B N   1 
ATOM   7076 C  CA  . GLY B 1 493 ? 6.039   -7.047  -9.176  1.00 50.83  ? 471  GLY B CA  1 
ATOM   7077 C  C   . GLY B 1 493 ? 6.287   -7.628  -10.565 1.00 51.73  ? 471  GLY B C   1 
ATOM   7078 O  O   . GLY B 1 493 ? 5.787   -8.707  -10.859 1.00 53.82  ? 471  GLY B O   1 
ATOM   7079 N  N   . LYS B 1 494 ? 7.058   -6.946  -11.421 1.00 51.93  ? 472  LYS B N   1 
ATOM   7080 C  CA  . LYS B 1 494 ? 7.346   -7.465  -12.777 1.00 52.62  ? 472  LYS B CA  1 
ATOM   7081 C  C   . LYS B 1 494 ? 8.318   -8.632  -12.695 1.00 51.09  ? 472  LYS B C   1 
ATOM   7082 O  O   . LYS B 1 494 ? 8.244   -9.548  -13.493 1.00 52.65  ? 472  LYS B O   1 
ATOM   7083 C  CB  . LYS B 1 494 ? 7.956   -6.405  -13.703 1.00 53.82  ? 472  LYS B CB  1 
ATOM   7084 C  CG  . LYS B 1 494 ? 7.142   -5.137  -13.914 1.00 56.64  ? 472  LYS B CG  1 
ATOM   7085 C  CD  . LYS B 1 494 ? 5.780   -5.420  -14.514 1.00 62.45  ? 472  LYS B CD  1 
ATOM   7086 C  CE  . LYS B 1 494 ? 5.143   -4.142  -15.035 1.00 64.84  ? 472  LYS B CE  1 
ATOM   7087 N  NZ  . LYS B 1 494 ? 4.010   -4.406  -15.956 1.00 70.36  ? 472  LYS B NZ  1 
ATOM   7088 N  N   . VAL B 1 495 ? 9.245   -8.581  -11.742 1.00 48.67  ? 473  VAL B N   1 
ATOM   7089 C  CA  . VAL B 1 495 ? 10.154  -9.693  -11.482 1.00 47.50  ? 473  VAL B CA  1 
ATOM   7090 C  C   . VAL B 1 495 ? 10.172  -10.006 -9.997  1.00 46.87  ? 473  VAL B C   1 
ATOM   7091 O  O   . VAL B 1 495 ? 9.783   -9.171  -9.183  1.00 46.07  ? 473  VAL B O   1 
ATOM   7092 C  CB  . VAL B 1 495 ? 11.594  -9.397  -11.963 1.00 45.98  ? 473  VAL B CB  1 
ATOM   7093 C  CG1 . VAL B 1 495 ? 11.607  -9.133  -13.466 1.00 46.64  ? 473  VAL B CG1 1 
ATOM   7094 C  CG2 . VAL B 1 495 ? 12.216  -8.222  -11.218 1.00 43.62  ? 473  VAL B CG2 1 
ATOM   7095 N  N   . GLN B 1 496 ? 10.634  -11.207 -9.668  1.00 47.38  ? 474  GLN B N   1 
ATOM   7096 C  CA  . GLN B 1 496 ? 10.885  -11.604 -8.290  1.00 49.58  ? 474  GLN B CA  1 
ATOM   7097 C  C   . GLN B 1 496 ? 12.387  -11.563 -8.026  1.00 46.74  ? 474  GLN B C   1 
ATOM   7098 O  O   . GLN B 1 496 ? 13.186  -11.630 -8.953  1.00 44.78  ? 474  GLN B O   1 
ATOM   7099 C  CB  . GLN B 1 496 ? 10.328  -13.015 -8.001  1.00 53.53  ? 474  GLN B CB  1 
ATOM   7100 C  CG  . GLN B 1 496 ? 8.819   -13.156 -8.202  1.00 57.29  ? 474  GLN B CG  1 
ATOM   7101 C  CD  . GLN B 1 496 ? 8.010   -12.168 -7.368  1.00 58.59  ? 474  GLN B CD  1 
ATOM   7102 O  OE1 . GLN B 1 496 ? 7.262   -11.344 -7.904  1.00 62.35  ? 474  GLN B OE1 1 
ATOM   7103 N  NE2 . GLN B 1 496 ? 8.175   -12.228 -6.057  1.00 58.81  ? 474  GLN B NE2 1 
ATOM   7104 N  N   . PRO B 1 497 ? 12.778  -11.461 -6.752  1.00 45.56  ? 475  PRO B N   1 
ATOM   7105 C  CA  . PRO B 1 497 ? 14.196  -11.380 -6.454  1.00 45.47  ? 475  PRO B CA  1 
ATOM   7106 C  C   . PRO B 1 497 ? 15.016  -12.561 -6.981  1.00 47.43  ? 475  PRO B C   1 
ATOM   7107 O  O   . PRO B 1 497 ? 16.173  -12.370 -7.348  1.00 47.22  ? 475  PRO B O   1 
ATOM   7108 C  CB  . PRO B 1 497 ? 14.226  -11.336 -4.920  1.00 46.02  ? 475  PRO B CB  1 
ATOM   7109 C  CG  . PRO B 1 497 ? 12.917  -10.738 -4.549  1.00 45.53  ? 475  PRO B CG  1 
ATOM   7110 C  CD  . PRO B 1 497 ? 11.944  -11.257 -5.557  1.00 46.10  ? 475  PRO B CD  1 
ATOM   7111 N  N   . SER B 1 498 ? 14.435  -13.762 -7.021  1.00 49.29  ? 476  SER B N   1 
ATOM   7112 C  CA  . SER B 1 498 ? 15.161  -14.953 -7.500  1.00 51.24  ? 476  SER B CA  1 
ATOM   7113 C  C   . SER B 1 498 ? 15.115  -15.183 -9.024  1.00 51.69  ? 476  SER B C   1 
ATOM   7114 O  O   . SER B 1 498 ? 15.753  -16.113 -9.520  1.00 51.77  ? 476  SER B O   1 
ATOM   7115 C  CB  . SER B 1 498 ? 14.664  -16.211 -6.772  1.00 54.32  ? 476  SER B CB  1 
ATOM   7116 O  OG  . SER B 1 498 ? 13.286  -16.405 -7.007  1.00 55.36  ? 476  SER B OG  1 
ATOM   7117 N  N   . ASP B 1 499 ? 14.396  -14.344 -9.774  1.00 50.79  ? 477  ASP B N   1 
ATOM   7118 C  CA  . ASP B 1 499 ? 14.379  -14.483 -11.237 1.00 52.40  ? 477  ASP B CA  1 
ATOM   7119 C  C   . ASP B 1 499 ? 15.746  -14.162 -11.791 1.00 51.46  ? 477  ASP B C   1 
ATOM   7120 O  O   . ASP B 1 499 ? 16.439  -13.299 -11.251 1.00 49.00  ? 477  ASP B O   1 
ATOM   7121 C  CB  . ASP B 1 499 ? 13.386  -13.514 -11.896 1.00 52.05  ? 477  ASP B CB  1 
ATOM   7122 C  CG  . ASP B 1 499 ? 11.952  -13.829 -11.573 1.00 53.88  ? 477  ASP B CG  1 
ATOM   7123 O  OD1 . ASP B 1 499 ? 11.674  -14.958 -11.142 1.00 57.05  ? 477  ASP B OD1 1 
ATOM   7124 O  OD2 . ASP B 1 499 ? 11.095  -12.940 -11.749 1.00 53.15  ? 477  ASP B OD2 1 
ATOM   7125 N  N   . GLN B 1 500 ? 16.120  -14.840 -12.873 1.00 53.41  ? 478  GLN B N   1 
ATOM   7126 C  CA  . GLN B 1 500 ? 17.223  -14.381 -13.714 1.00 55.14  ? 478  GLN B CA  1 
ATOM   7127 C  C   . GLN B 1 500 ? 16.806  -13.082 -14.391 1.00 54.00  ? 478  GLN B C   1 
ATOM   7128 O  O   . GLN B 1 500 ? 15.641  -12.690 -14.333 1.00 54.35  ? 478  GLN B O   1 
ATOM   7129 C  CB  . GLN B 1 500 ? 17.638  -15.444 -14.730 1.00 58.07  ? 478  GLN B CB  1 
ATOM   7130 C  CG  . GLN B 1 500 ? 18.327  -16.628 -14.065 1.00 61.30  ? 478  GLN B CG  1 
ATOM   7131 C  CD  . GLN B 1 500 ? 19.032  -17.536 -15.054 1.00 65.45  ? 478  GLN B CD  1 
ATOM   7132 O  OE1 . GLN B 1 500 ? 18.868  -17.397 -16.267 1.00 68.01  ? 478  GLN B OE1 1 
ATOM   7133 N  NE2 . GLN B 1 500 ? 19.822  -18.474 -14.541 1.00 67.40  ? 478  GLN B NE2 1 
ATOM   7134 N  N   . VAL B 1 501 ? 17.754  -12.391 -15.004 1.00 54.17  ? 479  VAL B N   1 
ATOM   7135 C  CA  . VAL B 1 501 ? 17.507  -11.005 -15.422 1.00 53.26  ? 479  VAL B CA  1 
ATOM   7136 C  C   . VAL B 1 501 ? 16.871  -10.835 -16.821 1.00 53.55  ? 479  VAL B C   1 
ATOM   7137 O  O   . VAL B 1 501 ? 16.739  -9.713  -17.305 1.00 51.74  ? 479  VAL B O   1 
ATOM   7138 C  CB  . VAL B 1 501 ? 18.799  -10.155 -15.289 1.00 51.67  ? 479  VAL B CB  1 
ATOM   7139 C  CG1 . VAL B 1 501 ? 19.323  -10.224 -13.860 1.00 51.82  ? 479  VAL B CG1 1 
ATOM   7140 C  CG2 . VAL B 1 501 ? 19.882  -10.626 -16.249 1.00 52.57  ? 479  VAL B CG2 1 
ATOM   7141 N  N   . GLY B 1 502 ? 16.428  -11.929 -17.433 1.00 57.40  ? 480  GLY B N   1 
ATOM   7142 C  CA  . GLY B 1 502 ? 15.946  -11.924 -18.815 1.00 58.38  ? 480  GLY B CA  1 
ATOM   7143 C  C   . GLY B 1 502 ? 14.879  -10.889 -19.120 1.00 58.65  ? 480  GLY B C   1 
ATOM   7144 O  O   . GLY B 1 502 ? 14.903  -10.268 -20.176 1.00 58.22  ? 480  GLY B O   1 
ATOM   7145 N  N   . LYS B 1 503 ? 13.942  -10.690 -18.196 1.00 58.42  ? 481  LYS B N   1 
ATOM   7146 C  CA  . LYS B 1 503 ? 12.808  -9.799  -18.449 1.00 57.15  ? 481  LYS B CA  1 
ATOM   7147 C  C   . LYS B 1 503 ? 13.143  -8.327  -18.223 1.00 54.77  ? 481  LYS B C   1 
ATOM   7148 O  O   . LYS B 1 503 ? 12.360  -7.458  -18.602 1.00 58.64  ? 481  LYS B O   1 
ATOM   7149 C  CB  . LYS B 1 503 ? 11.592  -10.208 -17.595 1.00 60.64  ? 481  LYS B CB  1 
ATOM   7150 N  N   . VAL B 1 504 ? 14.296  -8.041  -17.613 1.00 60.45  ? 482  VAL B N   1 
ATOM   7151 C  CA  . VAL B 1 504 ? 14.698  -6.670  -17.277 1.00 54.71  ? 482  VAL B CA  1 
ATOM   7152 C  C   . VAL B 1 504 ? 15.912  -6.169  -18.094 1.00 49.55  ? 482  VAL B C   1 
ATOM   7153 O  O   . VAL B 1 504 ? 16.131  -4.960  -18.211 1.00 45.37  ? 482  VAL B O   1 
ATOM   7154 C  CB  . VAL B 1 504 ? 15.046  -6.583  -15.759 1.00 56.05  ? 482  VAL B CB  1 
ATOM   7155 C  CG1 . VAL B 1 504 ? 15.695  -5.251  -15.398 1.00 54.19  ? 482  VAL B CG1 1 
ATOM   7156 C  CG2 . VAL B 1 504 ? 13.807  -6.779  -14.916 1.00 59.08  ? 482  VAL B CG2 1 
ATOM   7157 N  N   . ILE B 1 505 ? 16.737  -7.092  -18.587 1.00 48.82  ? 483  ILE B N   1 
ATOM   7158 C  CA  . ILE B 1 505 ? 17.998  -6.739  -19.273 1.00 46.92  ? 483  ILE B CA  1 
ATOM   7159 C  C   . ILE B 1 505 ? 17.735  -5.872  -20.501 1.00 42.79  ? 483  ILE B C   1 
ATOM   7160 O  O   . ILE B 1 505 ? 16.818  -6.156  -21.244 1.00 44.23  ? 483  ILE B O   1 
ATOM   7161 C  CB  . ILE B 1 505 ? 18.787  -8.009  -19.688 1.00 49.32  ? 483  ILE B CB  1 
ATOM   7162 C  CG1 . ILE B 1 505 ? 20.128  -7.641  -20.331 1.00 47.80  ? 483  ILE B CG1 1 
ATOM   7163 C  CG2 . ILE B 1 505 ? 17.983  -8.877  -20.655 1.00 51.37  ? 483  ILE B CG2 1 
ATOM   7164 C  CD1 . ILE B 1 505 ? 21.085  -8.811  -20.447 1.00 51.06  ? 483  ILE B CD1 1 
ATOM   7165 N  N   . TYR B 1 506 ? 18.517  -4.807  -20.682 1.00 40.33  ? 484  TYR B N   1 
ATOM   7166 C  CA  . TYR B 1 506 ? 18.497  -4.018  -21.922 1.00 38.58  ? 484  TYR B CA  1 
ATOM   7167 C  C   . TYR B 1 506 ? 19.453  -4.658  -22.947 1.00 39.69  ? 484  TYR B C   1 
ATOM   7168 O  O   . TYR B 1 506 ? 20.680  -4.591  -22.771 1.00 37.14  ? 484  TYR B O   1 
ATOM   7169 C  CB  . TYR B 1 506 ? 18.942  -2.575  -21.682 1.00 35.25  ? 484  TYR B CB  1 
ATOM   7170 C  CG  . TYR B 1 506 ? 18.125  -1.768  -20.675 1.00 36.19  ? 484  TYR B CG  1 
ATOM   7171 C  CD1 . TYR B 1 506 ? 16.750  -1.730  -20.727 1.00 36.98  ? 484  TYR B CD1 1 
ATOM   7172 C  CD2 . TYR B 1 506 ? 18.754  -0.978  -19.727 1.00 36.10  ? 484  TYR B CD2 1 
ATOM   7173 C  CE1 . TYR B 1 506 ? 16.014  -0.983  -19.811 1.00 38.08  ? 484  TYR B CE1 1 
ATOM   7174 C  CE2 . TYR B 1 506 ? 18.029  -0.205  -18.841 1.00 36.97  ? 484  TYR B CE2 1 
ATOM   7175 C  CZ  . TYR B 1 506 ? 16.657  -0.208  -18.901 1.00 36.59  ? 484  TYR B CZ  1 
ATOM   7176 O  OH  . TYR B 1 506 ? 15.950  0.551   -18.008 1.00 37.90  ? 484  TYR B OH  1 
ATOM   7177 N  N   . LYS B 1 507 ? 18.876  -5.265  -23.992 1.00 41.01  ? 485  LYS B N   1 
ATOM   7178 C  CA  . LYS B 1 507 ? 19.622  -6.018  -25.019 1.00 42.07  ? 485  LYS B CA  1 
ATOM   7179 C  C   . LYS B 1 507 ? 20.244  -5.142  -26.076 1.00 37.71  ? 485  LYS B C   1 
ATOM   7180 O  O   . LYS B 1 507 ? 21.170  -5.549  -26.741 1.00 38.64  ? 485  LYS B O   1 
ATOM   7181 C  CB  . LYS B 1 507 ? 18.703  -7.009  -25.746 1.00 46.79  ? 485  LYS B CB  1 
ATOM   7182 C  CG  . LYS B 1 507 ? 18.000  -8.007  -24.839 1.00 52.61  ? 485  LYS B CG  1 
ATOM   7183 C  CD  . LYS B 1 507 ? 18.949  -9.077  -24.358 1.00 58.25  ? 485  LYS B CD  1 
ATOM   7184 C  CE  . LYS B 1 507 ? 19.122  -10.183 -25.387 1.00 63.29  ? 485  LYS B CE  1 
ATOM   7185 N  NZ  . LYS B 1 507 ? 20.144  -11.155 -24.914 1.00 67.09  ? 485  LYS B NZ  1 
ATOM   7186 N  N   . GLN B 1 508 ? 19.716  -3.944  -26.267 1.00 34.28  ? 486  GLN B N   1 
ATOM   7187 C  CA  . GLN B 1 508 ? 20.174  -3.089  -27.327 1.00 32.20  ? 486  GLN B CA  1 
ATOM   7188 C  C   . GLN B 1 508 ? 21.294  -2.171  -26.852 1.00 30.75  ? 486  GLN B C   1 
ATOM   7189 O  O   . GLN B 1 508 ? 21.159  -1.492  -25.840 1.00 30.27  ? 486  GLN B O   1 
ATOM   7190 C  CB  . GLN B 1 508 ? 19.011  -2.269  -27.878 1.00 31.35  ? 486  GLN B CB  1 
ATOM   7191 C  CG  . GLN B 1 508 ? 19.463  -1.370  -29.015 1.00 30.90  ? 486  GLN B CG  1 
ATOM   7192 C  CD  . GLN B 1 508 ? 18.337  -0.619  -29.701 1.00 30.86  ? 486  GLN B CD  1 
ATOM   7193 O  OE1 . GLN B 1 508 ? 17.230  -1.090  -29.768 1.00 31.99  ? 486  GLN B OE1 1 
ATOM   7194 N  NE2 . GLN B 1 508 ? 18.643  0.559   -30.225 1.00 29.96  ? 486  GLN B NE2 1 
ATOM   7195 N  N   . PHE B 1 509 ? 22.390  -2.149  -27.600 1.00 29.01  ? 487  PHE B N   1 
ATOM   7196 C  CA  . PHE B 1 509 ? 23.524  -1.282  -27.292 1.00 29.37  ? 487  PHE B CA  1 
ATOM   7197 C  C   . PHE B 1 509 ? 24.393  -1.258  -28.520 1.00 30.61  ? 487  PHE B C   1 
ATOM   7198 O  O   . PHE B 1 509 ? 24.266  -2.113  -29.378 1.00 30.56  ? 487  PHE B O   1 
ATOM   7199 C  CB  . PHE B 1 509 ? 24.343  -1.786  -26.073 1.00 30.27  ? 487  PHE B CB  1 
ATOM   7200 C  CG  . PHE B 1 509 ? 24.922  -3.166  -26.246 1.00 32.24  ? 487  PHE B CG  1 
ATOM   7201 C  CD1 . PHE B 1 509 ? 24.187  -4.286  -25.920 1.00 33.39  ? 487  PHE B CD1 1 
ATOM   7202 C  CD2 . PHE B 1 509 ? 26.207  -3.343  -26.758 1.00 34.03  ? 487  PHE B CD2 1 
ATOM   7203 C  CE1 . PHE B 1 509 ? 24.694  -5.560  -26.107 1.00 36.62  ? 487  PHE B CE1 1 
ATOM   7204 C  CE2 . PHE B 1 509 ? 26.735  -4.623  -26.939 1.00 36.17  ? 487  PHE B CE2 1 
ATOM   7205 C  CZ  . PHE B 1 509 ? 25.970  -5.735  -26.628 1.00 37.44  ? 487  PHE B CZ  1 
ATOM   7206 N  N   . LYS B 1 510 ? 25.322  -0.316  -28.558 1.00 31.34  ? 488  LYS B N   1 
ATOM   7207 C  CA  . LYS B 1 510 ? 26.247  -0.193  -29.663 1.00 33.87  ? 488  LYS B CA  1 
ATOM   7208 C  C   . LYS B 1 510 ? 27.684  -0.216  -29.146 1.00 34.75  ? 488  LYS B C   1 
ATOM   7209 O  O   . LYS B 1 510 ? 27.966  0.368   -28.116 1.00 35.28  ? 488  LYS B O   1 
ATOM   7210 C  CB  . LYS B 1 510 ? 25.959  1.118   -30.384 1.00 33.84  ? 488  LYS B CB  1 
ATOM   7211 C  CG  . LYS B 1 510 ? 26.769  1.349   -31.629 1.00 37.77  ? 488  LYS B CG  1 
ATOM   7212 C  CD  . LYS B 1 510 ? 26.252  0.590   -32.830 1.00 40.98  ? 488  LYS B CD  1 
ATOM   7213 C  CE  . LYS B 1 510 ? 27.160  0.928   -34.001 1.00 45.76  ? 488  LYS B CE  1 
ATOM   7214 N  NZ  . LYS B 1 510 ? 26.995  -0.021  -35.126 1.00 51.49  ? 488  LYS B NZ  1 
ATOM   7215 N  N   . GLN B 1 511 ? 28.571  -0.933  -29.836 1.00 36.12  ? 489  GLN B N   1 
ATOM   7216 C  CA  . GLN B 1 511 ? 29.967  -0.937  -29.465 1.00 38.59  ? 489  GLN B CA  1 
ATOM   7217 C  C   . GLN B 1 511 ? 30.639  0.262   -30.118 1.00 39.19  ? 489  GLN B C   1 
ATOM   7218 O  O   . GLN B 1 511 ? 30.218  0.722   -31.179 1.00 38.05  ? 489  GLN B O   1 
ATOM   7219 C  CB  . GLN B 1 511 ? 30.648  -2.231  -29.889 1.00 42.51  ? 489  GLN B CB  1 
ATOM   7220 C  CG  . GLN B 1 511 ? 29.965  -3.449  -29.296 1.00 45.68  ? 489  GLN B CG  1 
ATOM   7221 C  CD  . GLN B 1 511 ? 30.831  -4.680  -29.336 1.00 50.35  ? 489  GLN B CD  1 
ATOM   7222 O  OE1 . GLN B 1 511 ? 31.908  -4.670  -29.911 1.00 55.12  ? 489  GLN B OE1 1 
ATOM   7223 N  NE2 . GLN B 1 511 ? 30.371  -5.739  -28.714 1.00 53.70  ? 489  GLN B NE2 1 
ATOM   7224 N  N   . ILE B 1 512 ? 31.677  0.773   -29.471 1.00 39.61  ? 490  ILE B N   1 
ATOM   7225 C  CA  . ILE B 1 512 ? 32.435  1.885   -30.016 1.00 39.46  ? 490  ILE B CA  1 
ATOM   7226 C  C   . ILE B 1 512 ? 33.865  1.695   -29.538 1.00 40.09  ? 490  ILE B C   1 
ATOM   7227 O  O   . ILE B 1 512 ? 34.096  1.092   -28.505 1.00 41.43  ? 490  ILE B O   1 
ATOM   7228 C  CB  . ILE B 1 512 ? 31.823  3.253   -29.603 1.00 37.49  ? 490  ILE B CB  1 
ATOM   7229 C  CG1 . ILE B 1 512 ? 32.514  4.423   -30.331 1.00 39.93  ? 490  ILE B CG1 1 
ATOM   7230 C  CG2 . ILE B 1 512 ? 31.923  3.466   -28.101 1.00 37.55  ? 490  ILE B CG2 1 
ATOM   7231 C  CD1 . ILE B 1 512 ? 31.836  5.776   -30.106 1.00 38.81  ? 490  ILE B CD1 1 
ATOM   7232 N  N   . ARG B 1 513 ? 34.827  2.162   -30.319 1.00 41.07  ? 491  ARG B N   1 
ATOM   7233 C  CA  . ARG B 1 513 ? 36.228  1.987   -29.971 1.00 43.33  ? 491  ARG B CA  1 
ATOM   7234 C  C   . ARG B 1 513 ? 36.744  3.119   -29.074 1.00 42.05  ? 491  ARG B C   1 
ATOM   7235 O  O   . ARG B 1 513 ? 36.258  4.246   -29.147 1.00 38.12  ? 491  ARG B O   1 
ATOM   7236 C  CB  . ARG B 1 513 ? 37.086  1.866   -31.237 1.00 46.75  ? 491  ARG B CB  1 
ATOM   7237 C  CG  . ARG B 1 513 ? 36.835  0.602   -32.053 1.00 48.73  ? 491  ARG B CG  1 
ATOM   7238 C  CD  . ARG B 1 513 ? 37.446  0.718   -33.451 1.00 52.49  ? 491  ARG B CD  1 
ATOM   7239 N  NE  . ARG B 1 513 ? 36.739  1.741   -34.222 1.00 51.43  ? 491  ARG B NE  1 
ATOM   7240 C  CZ  . ARG B 1 513 ? 37.063  2.138   -35.451 1.00 53.56  ? 491  ARG B CZ  1 
ATOM   7241 N  NH1 . ARG B 1 513 ? 38.097  1.614   -36.089 1.00 56.96  ? 491  ARG B NH1 1 
ATOM   7242 N  NH2 . ARG B 1 513 ? 36.335  3.083   -36.036 1.00 52.11  ? 491  ARG B NH2 1 
ATOM   7243 N  N   . LEU B 1 514 ? 37.740  2.793   -28.246 1.00 45.18  ? 492  LEU B N   1 
ATOM   7244 C  CA  . LEU B 1 514 ? 38.507  3.775   -27.469 1.00 46.57  ? 492  LEU B CA  1 
ATOM   7245 C  C   . LEU B 1 514 ? 39.034  4.899   -28.345 1.00 47.53  ? 492  LEU B C   1 
ATOM   7246 O  O   . LEU B 1 514 ? 39.101  6.053   -27.919 1.00 48.56  ? 492  LEU B O   1 
ATOM   7247 C  CB  . LEU B 1 514 ? 39.727  3.113   -26.819 1.00 51.37  ? 492  LEU B CB  1 
ATOM   7248 C  CG  . LEU B 1 514 ? 39.595  2.496   -25.439 1.00 52.77  ? 492  LEU B CG  1 
ATOM   7249 C  CD1 . LEU B 1 514 ? 40.905  1.822   -25.067 1.00 58.48  ? 492  LEU B CD1 1 
ATOM   7250 C  CD2 . LEU B 1 514 ? 39.233  3.556   -24.421 1.00 52.24  ? 492  LEU B CD2 1 
ATOM   7251 N  N   . THR B 1 515 ? 39.452  4.528   -29.552 1.00 47.55  ? 493  THR B N   1 
ATOM   7252 C  CA  . THR B 1 515 ? 40.025  5.457   -30.498 1.00 49.06  ? 493  THR B CA  1 
ATOM   7253 C  C   . THR B 1 515 ? 39.015  6.174   -31.421 1.00 46.68  ? 493  THR B C   1 
ATOM   7254 O  O   . THR B 1 515 ? 39.426  6.962   -32.258 1.00 47.88  ? 493  THR B O   1 
ATOM   7255 C  CB  . THR B 1 515 ? 41.028  4.706   -31.371 1.00 52.84  ? 493  THR B CB  1 
ATOM   7256 O  OG1 . THR B 1 515 ? 40.384  3.543   -31.894 1.00 52.35  ? 493  THR B OG1 1 
ATOM   7257 C  CG2 . THR B 1 515 ? 42.237  4.278   -30.540 1.00 56.78  ? 493  THR B CG2 1 
ATOM   7258 N  N   . ASP B 1 516 ? 37.714  5.911   -31.292 1.00 42.51  ? 494  ASP B N   1 
ATOM   7259 C  CA  . ASP B 1 516 ? 36.726  6.596   -32.136 1.00 40.89  ? 494  ASP B CA  1 
ATOM   7260 C  C   . ASP B 1 516 ? 36.564  8.020   -31.656 1.00 40.26  ? 494  ASP B C   1 
ATOM   7261 O  O   . ASP B 1 516 ? 36.885  8.322   -30.517 1.00 41.96  ? 494  ASP B O   1 
ATOM   7262 C  CB  . ASP B 1 516 ? 35.349  5.910   -32.098 1.00 37.77  ? 494  ASP B CB  1 
ATOM   7263 C  CG  . ASP B 1 516 ? 35.225  4.767   -33.119 1.00 40.23  ? 494  ASP B CG  1 
ATOM   7264 O  OD1 . ASP B 1 516 ? 35.584  4.968   -34.293 1.00 41.62  ? 494  ASP B OD1 1 
ATOM   7265 O  OD2 . ASP B 1 516 ? 34.778  3.663   -32.741 1.00 39.21  ? 494  ASP B OD2 1 
ATOM   7266 N  N   . THR B 1 517 ? 36.039  8.882   -32.520 1.00 39.08  ? 495  THR B N   1 
ATOM   7267 C  CA  . THR B 1 517 ? 35.852  10.281  -32.164 1.00 38.37  ? 495  THR B CA  1 
ATOM   7268 C  C   . THR B 1 517 ? 34.566  10.493  -31.390 1.00 36.04  ? 495  THR B C   1 
ATOM   7269 O  O   . THR B 1 517 ? 33.627  9.678   -31.455 1.00 34.09  ? 495  THR B O   1 
ATOM   7270 C  CB  . THR B 1 517 ? 35.812  11.194  -33.397 1.00 38.67  ? 495  THR B CB  1 
ATOM   7271 O  OG1 . THR B 1 517 ? 34.677  10.849  -34.186 1.00 36.43  ? 495  THR B OG1 1 
ATOM   7272 C  CG2 . THR B 1 517 ? 37.087  11.077  -34.221 1.00 42.13  ? 495  THR B CG2 1 
ATOM   7273 N  N   . LEU B 1 518 ? 34.517  11.602  -30.660 1.00 37.04  ? 496  LEU B N   1 
ATOM   7274 C  CA  . LEU B 1 518 ? 33.322  11.991  -29.945 1.00 36.13  ? 496  LEU B CA  1 
ATOM   7275 C  C   . LEU B 1 518 ? 32.239  12.358  -30.932 1.00 35.96  ? 496  LEU B C   1 
ATOM   7276 O  O   . LEU B 1 518 ? 31.067  12.237  -30.618 1.00 34.91  ? 496  LEU B O   1 
ATOM   7277 C  CB  . LEU B 1 518 ? 33.591  13.159  -28.997 1.00 38.53  ? 496  LEU B CB  1 
ATOM   7278 C  CG  . LEU B 1 518 ? 34.588  12.893  -27.871 1.00 40.32  ? 496  LEU B CG  1 
ATOM   7279 C  CD1 . LEU B 1 518 ? 34.666  14.098  -26.947 1.00 43.13  ? 496  LEU B CD1 1 
ATOM   7280 C  CD2 . LEU B 1 518 ? 34.227  11.645  -27.080 1.00 39.29  ? 496  LEU B CD2 1 
ATOM   7281 N  N   . GLY B 1 519 ? 32.626  12.807  -32.121 1.00 37.56  ? 497  GLY B N   1 
ATOM   7282 C  CA  . GLY B 1 519 ? 31.652  13.008  -33.192 1.00 38.21  ? 497  GLY B CA  1 
ATOM   7283 C  C   . GLY B 1 519 ? 30.955  11.714  -33.549 1.00 36.88  ? 497  GLY B C   1 
ATOM   7284 O  O   . GLY B 1 519 ? 29.734  11.663  -33.694 1.00 34.75  ? 497  GLY B O   1 
ATOM   7285 N  N   . ARG B 1 520 ? 31.736  10.651  -33.679 1.00 37.45  ? 498  ARG B N   1 
ATOM   7286 C  CA  . ARG B 1 520 ? 31.188  9.329   -33.955 1.00 36.29  ? 498  ARG B CA  1 
ATOM   7287 C  C   . ARG B 1 520 ? 30.286  8.897   -32.817 1.00 32.59  ? 498  ARG B C   1 
ATOM   7288 O  O   . ARG B 1 520 ? 29.182  8.394   -33.041 1.00 31.31  ? 498  ARG B O   1 
ATOM   7289 C  CB  . ARG B 1 520 ? 32.326  8.320   -34.161 1.00 40.74  ? 498  ARG B CB  1 
ATOM   7290 C  CG  . ARG B 1 520 ? 31.891  6.874   -34.354 1.00 42.24  ? 498  ARG B CG  1 
ATOM   7291 C  CD  . ARG B 1 520 ? 31.072  6.649   -35.610 1.00 43.58  ? 498  ARG B CD  1 
ATOM   7292 N  NE  . ARG B 1 520 ? 30.636  5.260   -35.602 1.00 49.41  ? 498  ARG B NE  1 
ATOM   7293 C  CZ  . ARG B 1 520 ? 29.467  4.794   -36.048 1.00 50.25  ? 498  ARG B CZ  1 
ATOM   7294 N  NH1 . ARG B 1 520 ? 28.560  5.599   -36.590 1.00 51.45  ? 498  ARG B NH1 1 
ATOM   7295 N  NH2 . ARG B 1 520 ? 29.206  3.498   -35.934 1.00 49.54  ? 498  ARG B NH2 1 
ATOM   7296 N  N   . LEU B 1 521 ? 30.749  9.086   -31.594 1.00 31.28  ? 499  LEU B N   1 
ATOM   7297 C  CA  . LEU B 1 521 ? 29.907  8.830   -30.420 1.00 30.25  ? 499  LEU B CA  1 
ATOM   7298 C  C   . LEU B 1 521 ? 28.580  9.585   -30.476 1.00 29.58  ? 499  LEU B C   1 
ATOM   7299 O  O   . LEU B 1 521 ? 27.514  9.011   -30.224 1.00 28.10  ? 499  LEU B O   1 
ATOM   7300 C  CB  . LEU B 1 521 ? 30.637  9.212   -29.136 1.00 31.28  ? 499  LEU B CB  1 
ATOM   7301 C  CG  . LEU B 1 521 ? 29.854  9.055   -27.845 1.00 31.09  ? 499  LEU B CG  1 
ATOM   7302 C  CD1 . LEU B 1 521 ? 29.488  7.593   -27.616 1.00 30.78  ? 499  LEU B CD1 1 
ATOM   7303 C  CD2 . LEU B 1 521 ? 30.642  9.611   -26.672 1.00 32.90  ? 499  LEU B CD2 1 
ATOM   7304 N  N   . SER B 1 522 ? 28.652  10.871  -30.775 1.00 30.58  ? 500  SER B N   1 
ATOM   7305 C  CA  . SER B 1 522 ? 27.447  11.680  -30.862 1.00 31.58  ? 500  SER B CA  1 
ATOM   7306 C  C   . SER B 1 522 ? 26.444  11.083  -31.870 1.00 31.59  ? 500  SER B C   1 
ATOM   7307 O  O   . SER B 1 522 ? 25.237  11.022  -31.571 1.00 29.06  ? 500  SER B O   1 
ATOM   7308 C  CB  . SER B 1 522 ? 27.803  13.123  -31.204 1.00 33.42  ? 500  SER B CB  1 
ATOM   7309 O  OG  . SER B 1 522 ? 26.646  13.897  -31.420 1.00 34.83  ? 500  SER B OG  1 
ATOM   7310 N  N   . HIS B 1 523 ? 26.928  10.643  -33.041 1.00 31.25  ? 501  HIS B N   1 
ATOM   7311 C  CA  . HIS B 1 523 ? 26.055  9.996   -34.049 1.00 32.60  ? 501  HIS B CA  1 
ATOM   7312 C  C   . HIS B 1 523 ? 25.444  8.700   -33.509 1.00 30.05  ? 501  HIS B C   1 
ATOM   7313 O  O   . HIS B 1 523 ? 24.247  8.472   -33.660 1.00 29.77  ? 501  HIS B O   1 
ATOM   7314 C  CB  . HIS B 1 523 ? 26.798  9.684   -35.362 1.00 35.70  ? 501  HIS B CB  1 
ATOM   7315 C  CG  . HIS B 1 523 ? 27.127  10.891  -36.186 1.00 41.61  ? 501  HIS B CG  1 
ATOM   7316 N  ND1 . HIS B 1 523 ? 28.102  10.880  -37.162 1.00 46.12  ? 501  HIS B ND1 1 
ATOM   7317 C  CD2 . HIS B 1 523 ? 26.635  12.154  -36.169 1.00 45.05  ? 501  HIS B CD2 1 
ATOM   7318 C  CE1 . HIS B 1 523 ? 28.178  12.073  -37.729 1.00 47.65  ? 501  HIS B CE1 1 
ATOM   7319 N  NE2 . HIS B 1 523 ? 27.304  12.866  -37.139 1.00 47.93  ? 501  HIS B NE2 1 
ATOM   7320 N  N   . ILE B 1 524 ? 26.274  7.863   -32.891 1.00 28.39  ? 502  ILE B N   1 
ATOM   7321 C  CA  . ILE B 1 524 ? 25.846  6.602   -32.283 1.00 28.47  ? 502  ILE B CA  1 
ATOM   7322 C  C   . ILE B 1 524 ? 24.722  6.860   -31.267 1.00 28.49  ? 502  ILE B C   1 
ATOM   7323 O  O   . ILE B 1 524 ? 23.700  6.155   -31.264 1.00 27.54  ? 502  ILE B O   1 
ATOM   7324 C  CB  . ILE B 1 524 ? 27.061  5.868   -31.647 1.00 29.94  ? 502  ILE B CB  1 
ATOM   7325 C  CG1 . ILE B 1 524 ? 27.811  5.108   -32.716 1.00 32.01  ? 502  ILE B CG1 1 
ATOM   7326 C  CG2 . ILE B 1 524 ? 26.679  4.909   -30.532 1.00 30.06  ? 502  ILE B CG2 1 
ATOM   7327 C  CD1 . ILE B 1 524 ? 29.126  4.573   -32.230 1.00 35.82  ? 502  ILE B CD1 1 
ATOM   7328 N  N   . LEU B 1 525 ? 24.877  7.911   -30.467 1.00 27.72  ? 503  LEU B N   1 
ATOM   7329 C  CA  . LEU B 1 525 ? 23.882  8.265   -29.446 1.00 26.90  ? 503  LEU B CA  1 
ATOM   7330 C  C   . LEU B 1 525 ? 22.568  8.858   -29.981 1.00 26.49  ? 503  LEU B C   1 
ATOM   7331 O  O   . LEU B 1 525 ? 21.641  9.075   -29.222 1.00 28.43  ? 503  LEU B O   1 
ATOM   7332 C  CB  . LEU B 1 525 ? 24.501  9.164   -28.388 1.00 28.11  ? 503  LEU B CB  1 
ATOM   7333 C  CG  . LEU B 1 525 ? 25.655  8.518   -27.604 1.00 29.64  ? 503  LEU B CG  1 
ATOM   7334 C  CD1 . LEU B 1 525 ? 26.310  9.584   -26.742 1.00 30.00  ? 503  LEU B CD1 1 
ATOM   7335 C  CD2 . LEU B 1 525 ? 25.245  7.306   -26.752 1.00 29.27  ? 503  LEU B CD2 1 
ATOM   7336 N  N   . GLU B 1 526 ? 22.450  9.045   -31.283 1.00 25.93  ? 504  GLU B N   1 
ATOM   7337 C  CA  . GLU B 1 526 ? 21.170  9.361   -31.890 1.00 26.68  ? 504  GLU B CA  1 
ATOM   7338 C  C   . GLU B 1 526 ? 20.328  8.103   -32.138 1.00 26.65  ? 504  GLU B C   1 
ATOM   7339 O  O   . GLU B 1 526 ? 19.157  8.223   -32.491 1.00 25.04  ? 504  GLU B O   1 
ATOM   7340 C  CB  . GLU B 1 526 ? 21.383  10.140  -33.178 1.00 29.31  ? 504  GLU B CB  1 
ATOM   7341 C  CG  . GLU B 1 526 ? 22.150  11.424  -32.889 1.00 31.96  ? 504  GLU B CG  1 
ATOM   7342 C  CD  . GLU B 1 526 ? 22.359  12.319  -34.069 1.00 35.40  ? 504  GLU B CD  1 
ATOM   7343 O  OE1 . GLU B 1 526 ? 22.263  11.829  -35.201 1.00 38.87  ? 504  GLU B OE1 1 
ATOM   7344 O  OE2 . GLU B 1 526 ? 22.637  13.526  -33.854 1.00 37.68  ? 504  GLU B OE2 1 
ATOM   7345 N  N   . MET B 1 527 ? 20.935  6.916   -31.949 1.00 25.71  ? 505  MET B N   1 
ATOM   7346 C  CA  . MET B 1 527 ? 20.259  5.624   -32.189 1.00 28.52  ? 505  MET B CA  1 
ATOM   7347 C  C   . MET B 1 527 ? 20.244  4.682   -30.998 1.00 27.25  ? 505  MET B C   1 
ATOM   7348 O  O   . MET B 1 527 ? 19.323  3.900   -30.877 1.00 29.35  ? 505  MET B O   1 
ATOM   7349 C  CB  . MET B 1 527 ? 20.858  4.898   -33.420 1.00 30.25  ? 505  MET B CB  1 
ATOM   7350 C  CG  . MET B 1 527 ? 20.689  5.669   -34.713 1.00 33.25  ? 505  MET B CG  1 
ATOM   7351 S  SD  . MET B 1 527 ? 18.974  5.868   -35.259 1.00 36.67  ? 505  MET B SD  1 
ATOM   7352 C  CE  . MET B 1 527 ? 18.547  4.160   -35.610 1.00 38.91  ? 505  MET B CE  1 
ATOM   7353 N  N   . ASP B 1 528 ? 21.227  4.786   -30.108 1.00 28.17  ? 506  ASP B N   1 
ATOM   7354 C  CA  . ASP B 1 528 ? 21.325  3.922   -28.945 1.00 28.31  ? 506  ASP B CA  1 
ATOM   7355 C  C   . ASP B 1 528 ? 21.594  4.724   -27.697 1.00 28.09  ? 506  ASP B C   1 
ATOM   7356 O  O   . ASP B 1 528 ? 22.295  5.738   -27.740 1.00 28.63  ? 506  ASP B O   1 
ATOM   7357 C  CB  . ASP B 1 528 ? 22.462  2.927   -29.128 1.00 30.29  ? 506  ASP B CB  1 
ATOM   7358 C  CG  . ASP B 1 528 ? 22.142  1.880   -30.180 1.00 34.14  ? 506  ASP B CG  1 
ATOM   7359 O  OD1 . ASP B 1 528 ? 21.553  0.836   -29.838 1.00 36.34  ? 506  ASP B OD1 1 
ATOM   7360 O  OD2 . ASP B 1 528 ? 22.472  2.102   -31.349 1.00 34.78  ? 506  ASP B OD2 1 
ATOM   7361 N  N   . HIS B 1 529 ? 21.035  4.248   -26.589 1.00 26.73  ? 507  HIS B N   1 
ATOM   7362 C  CA  . HIS B 1 529 ? 21.265  4.832   -25.287 1.00 27.39  ? 507  HIS B CA  1 
ATOM   7363 C  C   . HIS B 1 529 ? 22.675  4.548   -24.786 1.00 27.68  ? 507  HIS B C   1 
ATOM   7364 O  O   . HIS B 1 529 ? 23.339  5.441   -24.270 1.00 28.69  ? 507  HIS B O   1 
ATOM   7365 C  CB  . HIS B 1 529 ? 20.261  4.293   -24.261 1.00 28.39  ? 507  HIS B CB  1 
ATOM   7366 C  CG  . HIS B 1 529 ? 20.426  4.915   -22.915 1.00 28.13  ? 507  HIS B CG  1 
ATOM   7367 N  ND1 . HIS B 1 529 ? 20.106  6.232   -22.669 1.00 28.87  ? 507  HIS B ND1 1 
ATOM   7368 C  CD2 . HIS B 1 529 ? 20.931  4.425   -21.763 1.00 30.06  ? 507  HIS B CD2 1 
ATOM   7369 C  CE1 . HIS B 1 529 ? 20.412  6.528   -21.417 1.00 31.06  ? 507  HIS B CE1 1 
ATOM   7370 N  NE2 . HIS B 1 529 ? 20.910  5.449   -20.846 1.00 31.66  ? 507  HIS B NE2 1 
ATOM   7371 N  N   . PHE B 1 530 ? 23.123  3.304   -24.938 1.00 28.39  ? 508  PHE B N   1 
ATOM   7372 C  CA  . PHE B 1 530 ? 24.404  2.871   -24.344 1.00 30.29  ? 508  PHE B CA  1 
ATOM   7373 C  C   . PHE B 1 530 ? 25.399  2.613   -25.456 1.00 30.32  ? 508  PHE B C   1 
ATOM   7374 O  O   . PHE B 1 530 ? 25.081  1.864   -26.389 1.00 30.69  ? 508  PHE B O   1 
ATOM   7375 C  CB  . PHE B 1 530 ? 24.282  1.532   -23.610 1.00 30.24  ? 508  PHE B CB  1 
ATOM   7376 C  CG  . PHE B 1 530 ? 23.431  1.556   -22.403 1.00 31.62  ? 508  PHE B CG  1 
ATOM   7377 C  CD1 . PHE B 1 530 ? 23.908  2.099   -21.214 1.00 34.18  ? 508  PHE B CD1 1 
ATOM   7378 C  CD2 . PHE B 1 530 ? 22.175  0.945   -22.408 1.00 32.29  ? 508  PHE B CD2 1 
ATOM   7379 C  CE1 . PHE B 1 530 ? 23.121  2.098   -20.060 1.00 35.42  ? 508  PHE B CE1 1 
ATOM   7380 C  CE2 . PHE B 1 530 ? 21.393  0.937   -21.253 1.00 32.93  ? 508  PHE B CE2 1 
ATOM   7381 C  CZ  . PHE B 1 530 ? 21.865  1.505   -20.083 1.00 34.58  ? 508  PHE B CZ  1 
ATOM   7382 N  N   . ALA B 1 531 ? 26.593  3.180   -25.308 1.00 29.93  ? 509  ALA B N   1 
ATOM   7383 C  CA  . ALA B 1 531 ? 27.748  2.845   -26.110 1.00 31.59  ? 509  ALA B CA  1 
ATOM   7384 C  C   . ALA B 1 531 ? 28.754  2.137   -25.210 1.00 31.92  ? 509  ALA B C   1 
ATOM   7385 O  O   . ALA B 1 531 ? 29.150  2.657   -24.167 1.00 34.16  ? 509  ALA B O   1 
ATOM   7386 C  CB  . ALA B 1 531 ? 28.350  4.109   -26.713 1.00 31.49  ? 509  ALA B CB  1 
ATOM   7387 N  N   . LEU B 1 532 ? 29.118  0.925   -25.587 1.00 32.96  ? 510  LEU B N   1 
ATOM   7388 C  CA  . LEU B 1 532 ? 30.059  0.119   -24.846 1.00 34.19  ? 510  LEU B CA  1 
ATOM   7389 C  C   . LEU B 1 532 ? 31.425  0.221   -25.509 1.00 36.90  ? 510  LEU B C   1 
ATOM   7390 O  O   . LEU B 1 532 ? 31.563  -0.081  -26.695 1.00 37.49  ? 510  LEU B O   1 
ATOM   7391 C  CB  . LEU B 1 532 ? 29.588  -1.328  -24.783 1.00 36.25  ? 510  LEU B CB  1 
ATOM   7392 C  CG  . LEU B 1 532 ? 28.733  -1.577  -23.529 1.00 39.00  ? 510  LEU B CG  1 
ATOM   7393 C  CD1 . LEU B 1 532 ? 27.425  -0.808  -23.603 1.00 35.83  ? 510  LEU B CD1 1 
ATOM   7394 C  CD2 . LEU B 1 532 ? 28.480  -3.051  -23.331 1.00 41.96  ? 510  LEU B CD2 1 
ATOM   7395 N  N   . VAL B 1 533 ? 32.438  0.621   -24.734 1.00 37.62  ? 511  VAL B N   1 
ATOM   7396 C  CA  . VAL B 1 533 ? 33.736  0.917   -25.288 1.00 39.84  ? 511  VAL B CA  1 
ATOM   7397 C  C   . VAL B 1 533 ? 34.584  -0.347  -25.292 1.00 44.23  ? 511  VAL B C   1 
ATOM   7398 O  O   . VAL B 1 533 ? 34.800  -0.982  -24.247 1.00 44.63  ? 511  VAL B O   1 
ATOM   7399 C  CB  . VAL B 1 533 ? 34.422  2.080   -24.545 1.00 40.88  ? 511  VAL B CB  1 
ATOM   7400 C  CG1 . VAL B 1 533 ? 35.719  2.482   -25.246 1.00 43.32  ? 511  VAL B CG1 1 
ATOM   7401 C  CG2 . VAL B 1 533 ? 33.486  3.279   -24.465 1.00 38.84  ? 511  VAL B CG2 1 
ATOM   7402 N  N   . VAL B 1 534 ? 35.038  -0.708  -26.490 1.00 46.87  ? 512  VAL B N   1 
ATOM   7403 C  CA  . VAL B 1 534 ? 35.829  -1.922  -26.719 1.00 53.55  ? 512  VAL B CA  1 
ATOM   7404 C  C   . VAL B 1 534 ? 37.101  -1.585  -27.536 1.00 59.13  ? 512  VAL B C   1 
ATOM   7405 O  O   . VAL B 1 534 ? 37.296  -0.437  -27.953 1.00 59.60  ? 512  VAL B O   1 
ATOM   7406 C  CB  . VAL B 1 534 ? 35.000  -3.007  -27.443 1.00 53.47  ? 512  VAL B CB  1 
ATOM   7407 C  CG1 . VAL B 1 534 ? 33.771  -3.378  -26.618 1.00 50.67  ? 512  VAL B CG1 1 
ATOM   7408 C  CG2 . VAL B 1 534 ? 34.588  -2.540  -28.840 1.00 52.22  ? 512  VAL B CG2 1 
ATOM   7409 N  N   . HIS B 1 535 ? 37.944  -2.590  -27.749 1.00 64.92  ? 513  HIS B N   1 
ATOM   7410 C  CA  . HIS B 1 535 ? 39.178  -2.414  -28.505 1.00 71.55  ? 513  HIS B CA  1 
ATOM   7411 C  C   . HIS B 1 535 ? 39.614  -3.727  -29.147 1.00 76.62  ? 513  HIS B C   1 
ATOM   7412 O  O   . HIS B 1 535 ? 39.600  -4.778  -28.504 1.00 77.19  ? 513  HIS B O   1 
ATOM   7413 C  CB  . HIS B 1 535 ? 40.289  -1.876  -27.602 1.00 74.79  ? 513  HIS B CB  1 
ATOM   7414 C  CG  . HIS B 1 535 ? 41.433  -1.265  -28.350 1.00 78.23  ? 513  HIS B CG  1 
ATOM   7415 N  ND1 . HIS B 1 535 ? 42.710  -1.782  -28.307 1.00 84.82  ? 513  HIS B ND1 1 
ATOM   7416 C  CD2 . HIS B 1 535 ? 41.493  -0.181  -29.159 1.00 76.79  ? 513  HIS B CD2 1 
ATOM   7417 C  CE1 . HIS B 1 535 ? 43.507  -1.043  -29.058 1.00 86.23  ? 513  HIS B CE1 1 
ATOM   7418 N  NE2 . HIS B 1 535 ? 42.793  -0.065  -29.586 1.00 82.24  ? 513  HIS B NE2 1 
ATOM   7419 N  N   . GLU B 1 536 ? 39.999  -3.661  -30.417 1.00 79.90  ? 514  GLU B N   1 
ATOM   7420 C  CA  . GLU B 1 536 ? 40.425  -4.846  -31.152 1.00 84.83  ? 514  GLU B CA  1 
ATOM   7421 C  C   . GLU B 1 536 ? 41.463  -5.649  -30.375 1.00 92.20  ? 514  GLU B C   1 
ATOM   7422 O  O   . GLU B 1 536 ? 41.264  -6.831  -30.094 1.00 95.57  ? 514  GLU B O   1 
ATOM   7423 C  CB  . GLU B 1 536 ? 40.983  -4.453  -32.522 1.00 86.72  ? 514  GLU B CB  1 
ATOM   7424 N  N   . GLN B 1 537 ? 42.574  -5.001  -30.038 1.00 95.35  ? 515  GLN B N   1 
ATOM   7425 C  CA  . GLN B 1 537 ? 43.637  -5.652  -29.282 1.00 102.65 ? 515  GLN B CA  1 
ATOM   7426 C  C   . GLN B 1 537 ? 43.051  -6.421  -28.105 1.00 101.33 ? 515  GLN B C   1 
ATOM   7427 O  O   . GLN B 1 537 ? 43.256  -7.628  -27.973 1.00 104.44 ? 515  GLN B O   1 
ATOM   7428 C  CB  . GLN B 1 537 ? 44.652  -4.621  -28.786 1.00 104.42 ? 515  GLN B CB  1 
ATOM   7429 C  CG  . GLN B 1 537 ? 45.502  -4.008  -29.886 1.00 107.25 ? 515  GLN B CG  1 
ATOM   7430 C  CD  . GLN B 1 537 ? 46.712  -3.271  -29.345 1.00 109.87 ? 515  GLN B CD  1 
ATOM   7431 O  OE1 . GLN B 1 537 ? 46.610  -2.506  -28.386 1.00 108.81 ? 515  GLN B OE1 1 
ATOM   7432 N  NE2 . GLN B 1 537 ? 47.867  -3.500  -29.959 1.00 114.67 ? 515  GLN B NE2 1 
ATOM   7433 N  N   . GLN B 1 540 ? 37.860  -8.014  -26.109 1.00 99.65  ? 518  GLN B N   1 
ATOM   7434 C  CA  . GLN B 1 540 ? 37.266  -8.965  -25.177 1.00 101.21 ? 518  GLN B CA  1 
ATOM   7435 C  C   . GLN B 1 540 ? 36.999  -8.310  -23.827 1.00 95.69  ? 518  GLN B C   1 
ATOM   7436 O  O   . GLN B 1 540 ? 36.364  -8.903  -22.955 1.00 96.70  ? 518  GLN B O   1 
ATOM   7437 C  CB  . GLN B 1 540 ? 38.176  -10.182 -25.001 1.00 109.76 ? 518  GLN B CB  1 
ATOM   7438 C  CG  . GLN B 1 540 ? 37.564  -11.488 -25.481 1.00 112.77 ? 518  GLN B CG  1 
ATOM   7439 C  CD  . GLN B 1 540 ? 37.012  -12.325 -24.343 1.00 114.80 ? 518  GLN B CD  1 
ATOM   7440 O  OE1 . GLN B 1 540 ? 35.814  -12.602 -24.286 1.00 111.11 ? 518  GLN B OE1 1 
ATOM   7441 N  NE2 . GLN B 1 540 ? 37.886  -12.732 -23.430 1.00 120.22 ? 518  GLN B NE2 1 
ATOM   7442 N  N   . MET B 1 541 ? 37.487  -7.085  -23.659 1.00 88.59  ? 519  MET B N   1 
ATOM   7443 C  CA  . MET B 1 541 ? 37.296  -6.370  -22.435 1.00 83.83  ? 519  MET B CA  1 
ATOM   7444 C  C   . MET B 1 541 ? 36.386  -5.168  -22.682 1.00 72.49  ? 519  MET B C   1 
ATOM   7445 O  O   . MET B 1 541 ? 36.417  -4.603  -23.753 1.00 67.63  ? 519  MET B O   1 
ATOM   7446 C  CB  . MET B 1 541 ? 38.681  -5.973  -21.934 1.00 90.60  ? 519  MET B CB  1 
ATOM   7447 C  CG  . MET B 1 541 ? 38.893  -4.557  -21.468 1.00 90.44  ? 519  MET B CG  1 
ATOM   7448 S  SD  . MET B 1 541 ? 39.043  -4.616  -19.703 1.00 97.73  ? 519  MET B SD  1 
ATOM   7449 C  CE  . MET B 1 541 ? 39.249  -2.913  -19.234 1.00 92.03  ? 519  MET B CE  1 
ATOM   7450 N  N   . VAL B 1 542 ? 35.573  -4.802  -21.696 1.00 65.42  ? 520  VAL B N   1 
ATOM   7451 C  CA  . VAL B 1 542 ? 34.797  -3.564  -21.768 1.00 57.53  ? 520  VAL B CA  1 
ATOM   7452 C  C   . VAL B 1 542 ? 35.499  -2.452  -21.004 1.00 56.34  ? 520  VAL B C   1 
ATOM   7453 O  O   . VAL B 1 542 ? 35.726  -2.568  -19.803 1.00 58.05  ? 520  VAL B O   1 
ATOM   7454 C  CB  . VAL B 1 542 ? 33.412  -3.773  -21.159 1.00 55.27  ? 520  VAL B CB  1 
ATOM   7455 C  CG1 . VAL B 1 542 ? 32.543  -2.546  -21.370 1.00 49.70  ? 520  VAL B CG1 1 
ATOM   7456 C  CG2 . VAL B 1 542 ? 32.760  -5.005  -21.769 1.00 57.06  ? 520  VAL B CG2 1 
ATOM   7457 N  N   . PHE B 1 543 ? 35.842  -1.374  -21.702 1.00 53.34  ? 521  PHE B N   1 
ATOM   7458 C  CA  . PHE B 1 543 ? 36.625  -0.289  -21.100 1.00 53.28  ? 521  PHE B CA  1 
ATOM   7459 C  C   . PHE B 1 543 ? 35.735  0.753   -20.451 1.00 49.15  ? 521  PHE B C   1 
ATOM   7460 O  O   . PHE B 1 543 ? 36.182  1.557   -19.639 1.00 48.41  ? 521  PHE B O   1 
ATOM   7461 C  CB  . PHE B 1 543 ? 37.510  0.386   -22.146 1.00 54.47  ? 521  PHE B CB  1 
ATOM   7462 C  CG  . PHE B 1 543 ? 38.668  -0.458  -22.592 1.00 58.97  ? 521  PHE B CG  1 
ATOM   7463 C  CD1 . PHE B 1 543 ? 38.510  -1.374  -23.623 1.00 60.01  ? 521  PHE B CD1 1 
ATOM   7464 C  CD2 . PHE B 1 543 ? 39.917  -0.336  -21.993 1.00 63.62  ? 521  PHE B CD2 1 
ATOM   7465 C  CE1 . PHE B 1 543 ? 39.573  -2.162  -24.043 1.00 64.56  ? 521  PHE B CE1 1 
ATOM   7466 C  CE2 . PHE B 1 543 ? 40.986  -1.120  -22.411 1.00 67.95  ? 521  PHE B CE2 1 
ATOM   7467 C  CZ  . PHE B 1 543 ? 40.804  -2.032  -23.439 1.00 68.64  ? 521  PHE B CZ  1 
ATOM   7468 N  N   . GLY B 1 544 ? 34.463  0.743   -20.810 1.00 45.59  ? 522  GLY B N   1 
ATOM   7469 C  CA  . GLY B 1 544 ? 33.579  1.766   -20.341 1.00 43.20  ? 522  GLY B CA  1 
ATOM   7470 C  C   . GLY B 1 544 ? 32.201  1.641   -20.926 1.00 40.29  ? 522  GLY B C   1 
ATOM   7471 O  O   . GLY B 1 544 ? 31.989  1.002   -21.965 1.00 39.43  ? 522  GLY B O   1 
ATOM   7472 N  N   . VAL B 1 545 ? 31.260  2.255   -20.223 1.00 39.80  ? 523  VAL B N   1 
ATOM   7473 C  CA  . VAL B 1 545 ? 29.899  2.434   -20.694 1.00 37.98  ? 523  VAL B CA  1 
ATOM   7474 C  C   . VAL B 1 545 ? 29.696  3.940   -20.757 1.00 37.69  ? 523  VAL B C   1 
ATOM   7475 O  O   . VAL B 1 545 ? 29.954  4.632   -19.772 1.00 38.58  ? 523  VAL B O   1 
ATOM   7476 C  CB  . VAL B 1 545 ? 28.880  1.845   -19.710 1.00 39.16  ? 523  VAL B CB  1 
ATOM   7477 C  CG1 . VAL B 1 545 ? 27.458  2.118   -20.188 1.00 37.59  ? 523  VAL B CG1 1 
ATOM   7478 C  CG2 . VAL B 1 545 ? 29.125  0.348   -19.528 1.00 41.20  ? 523  VAL B CG2 1 
ATOM   7479 N  N   . VAL B 1 546 ? 29.239  4.426   -21.908 1.00 33.71  ? 524  VAL B N   1 
ATOM   7480 C  CA  . VAL B 1 546 ? 29.089  5.839   -22.151 1.00 34.13  ? 524  VAL B CA  1 
ATOM   7481 C  C   . VAL B 1 546 ? 27.683  6.107   -22.673 1.00 32.92  ? 524  VAL B C   1 
ATOM   7482 O  O   . VAL B 1 546 ? 27.174  5.389   -23.548 1.00 32.87  ? 524  VAL B O   1 
ATOM   7483 C  CB  . VAL B 1 546 ? 30.166  6.315   -23.155 1.00 35.54  ? 524  VAL B CB  1 
ATOM   7484 C  CG1 . VAL B 1 546 ? 29.952  7.762   -23.549 1.00 35.43  ? 524  VAL B CG1 1 
ATOM   7485 C  CG2 . VAL B 1 546 ? 31.550  6.155   -22.534 1.00 37.74  ? 524  VAL B CG2 1 
ATOM   7486 N  N   . THR B 1 547 ? 27.046  7.124   -22.107 1.00 32.68  ? 525  THR B N   1 
ATOM   7487 C  CA  . THR B 1 547 ? 25.747  7.569   -22.551 1.00 31.40  ? 525  THR B CA  1 
ATOM   7488 C  C   . THR B 1 547 ? 25.828  9.081   -22.842 1.00 32.36  ? 525  THR B C   1 
ATOM   7489 O  O   . THR B 1 547 ? 26.873  9.733   -22.627 1.00 31.94  ? 525  THR B O   1 
ATOM   7490 C  CB  . THR B 1 547 ? 24.677  7.330   -21.472 1.00 33.58  ? 525  THR B CB  1 
ATOM   7491 O  OG1 . THR B 1 547 ? 24.910  8.228   -20.383 1.00 36.04  ? 525  THR B OG1 1 
ATOM   7492 C  CG2 . THR B 1 547 ? 24.656  5.854   -20.955 1.00 33.28  ? 525  THR B CG2 1 
ATOM   7493 N  N   . ALA B 1 548 ? 24.726  9.636   -23.324 1.00 31.61  ? 526  ALA B N   1 
ATOM   7494 C  CA  . ALA B 1 548 ? 24.671  11.059  -23.678 1.00 33.32  ? 526  ALA B CA  1 
ATOM   7495 C  C   . ALA B 1 548 ? 24.977  11.971  -22.496 1.00 35.13  ? 526  ALA B C   1 
ATOM   7496 O  O   . ALA B 1 548 ? 25.582  13.026  -22.677 1.00 34.72  ? 526  ALA B O   1 
ATOM   7497 C  CB  . ALA B 1 548 ? 23.328  11.419  -24.269 1.00 32.36  ? 526  ALA B CB  1 
ATOM   7498 N  N   . ILE B 1 549 ? 24.596  11.555  -21.298 1.00 35.63  ? 527  ILE B N   1 
ATOM   7499 C  CA  . ILE B 1 549 ? 24.901  12.329  -20.097 1.00 40.91  ? 527  ILE B CA  1 
ATOM   7500 C  C   . ILE B 1 549 ? 26.395  12.404  -19.808 1.00 40.18  ? 527  ILE B C   1 
ATOM   7501 O  O   . ILE B 1 549 ? 26.885  13.463  -19.426 1.00 40.48  ? 527  ILE B O   1 
ATOM   7502 C  CB  . ILE B 1 549 ? 24.093  11.833  -18.883 1.00 45.07  ? 527  ILE B CB  1 
ATOM   7503 C  CG1 . ILE B 1 549 ? 22.608  12.101  -19.161 1.00 49.21  ? 527  ILE B CG1 1 
ATOM   7504 C  CG2 . ILE B 1 549 ? 24.494  12.562  -17.609 1.00 48.39  ? 527  ILE B CG2 1 
ATOM   7505 C  CD1 . ILE B 1 549 ? 21.651  11.146  -18.481 1.00 52.24  ? 527  ILE B CD1 1 
ATOM   7506 N  N   . ASP B 1 550 ? 27.128  11.319  -20.053 1.00 38.62  ? 528  ASP B N   1 
ATOM   7507 C  CA  . ASP B 1 550 ? 28.596  11.359  -19.881 1.00 40.10  ? 528  ASP B CA  1 
ATOM   7508 C  C   . ASP B 1 550 ? 29.228  12.332  -20.857 1.00 39.43  ? 528  ASP B C   1 
ATOM   7509 O  O   . ASP B 1 550 ? 30.115  13.063  -20.500 1.00 40.40  ? 528  ASP B O   1 
ATOM   7510 C  CB  . ASP B 1 550 ? 29.199  9.973   -20.058 1.00 39.62  ? 528  ASP B CB  1 
ATOM   7511 C  CG  . ASP B 1 550 ? 28.605  8.979   -19.111 1.00 40.50  ? 528  ASP B CG  1 
ATOM   7512 O  OD1 . ASP B 1 550 ? 28.596  9.276   -17.920 1.00 45.46  ? 528  ASP B OD1 1 
ATOM   7513 O  OD2 . ASP B 1 550 ? 28.112  7.917   -19.534 1.00 40.11  ? 528  ASP B OD2 1 
ATOM   7514 N  N   . LEU B 1 551 ? 28.742  12.357  -22.099 1.00 37.23  ? 529  LEU B N   1 
ATOM   7515 C  CA  . LEU B 1 551 ? 29.312  13.248  -23.099 1.00 37.13  ? 529  LEU B CA  1 
ATOM   7516 C  C   . LEU B 1 551 ? 29.034  14.718  -22.738 1.00 38.60  ? 529  LEU B C   1 
ATOM   7517 O  O   . LEU B 1 551 ? 29.930  15.551  -22.812 1.00 40.18  ? 529  LEU B O   1 
ATOM   7518 C  CB  . LEU B 1 551 ? 28.788  12.901  -24.502 1.00 34.85  ? 529  LEU B CB  1 
ATOM   7519 C  CG  . LEU B 1 551 ? 29.282  13.794  -25.627 1.00 36.20  ? 529  LEU B CG  1 
ATOM   7520 C  CD1 . LEU B 1 551 ? 30.801  13.783  -25.694 1.00 38.50  ? 529  LEU B CD1 1 
ATOM   7521 C  CD2 . LEU B 1 551 ? 28.655  13.377  -26.959 1.00 36.45  ? 529  LEU B CD2 1 
ATOM   7522 N  N   . LEU B 1 552 ? 27.801  15.018  -22.345 1.00 38.95  ? 530  LEU B N   1 
ATOM   7523 C  CA  . LEU B 1 552 ? 27.435  16.359  -21.856 1.00 43.11  ? 530  LEU B CA  1 
ATOM   7524 C  C   . LEU B 1 552 ? 28.280  16.792  -20.668 1.00 46.23  ? 530  LEU B C   1 
ATOM   7525 O  O   . LEU B 1 552 ? 28.781  17.918  -20.628 1.00 49.27  ? 530  LEU B O   1 
ATOM   7526 C  CB  . LEU B 1 552 ? 25.955  16.389  -21.461 1.00 43.21  ? 530  LEU B CB  1 
ATOM   7527 C  CG  . LEU B 1 552 ? 25.354  17.682  -20.916 1.00 47.24  ? 530  LEU B CG  1 
ATOM   7528 C  CD1 . LEU B 1 552 ? 25.589  18.895  -21.799 1.00 49.14  ? 530  LEU B CD1 1 
ATOM   7529 C  CD2 . LEU B 1 552 ? 23.861  17.482  -20.706 1.00 48.03  ? 530  LEU B CD2 1 
ATOM   7530 N  N   . ASN B 1 553 ? 28.412  15.908  -19.690 1.00 47.24  ? 531  ASN B N   1 
ATOM   7531 C  CA  . ASN B 1 553 ? 29.213  16.208  -18.491 1.00 51.45  ? 531  ASN B CA  1 
ATOM   7532 C  C   . ASN B 1 553 ? 30.642  16.548  -18.836 1.00 52.14  ? 531  ASN B C   1 
ATOM   7533 O  O   . ASN B 1 553 ? 31.225  17.447  -18.246 1.00 55.11  ? 531  ASN B O   1 
ATOM   7534 C  CB  . ASN B 1 553 ? 29.204  15.038  -17.517 1.00 52.35  ? 531  ASN B CB  1 
ATOM   7535 C  CG  . ASN B 1 553 ? 27.978  15.036  -16.643 1.00 55.31  ? 531  ASN B CG  1 
ATOM   7536 O  OD1 . ASN B 1 553 ? 27.393  16.081  -16.385 1.00 60.90  ? 531  ASN B OD1 1 
ATOM   7537 N  ND2 . ASN B 1 553 ? 27.590  13.869  -16.169 1.00 55.15  ? 531  ASN B ND2 1 
ATOM   7538 N  N   . PHE B 1 554 ? 31.206  15.821  -19.794 1.00 49.33  ? 532  PHE B N   1 
ATOM   7539 C  CA  . PHE B 1 554 ? 32.533  16.138  -20.281 1.00 51.39  ? 532  PHE B CA  1 
ATOM   7540 C  C   . PHE B 1 554 ? 32.535  17.535  -20.901 1.00 53.69  ? 532  PHE B C   1 
ATOM   7541 O  O   . PHE B 1 554 ? 33.273  18.420  -20.457 1.00 56.56  ? 532  PHE B O   1 
ATOM   7542 C  CB  . PHE B 1 554 ? 32.992  15.087  -21.295 1.00 49.13  ? 532  PHE B CB  1 
ATOM   7543 C  CG  . PHE B 1 554 ? 34.315  15.404  -21.963 1.00 51.35  ? 532  PHE B CG  1 
ATOM   7544 C  CD1 . PHE B 1 554 ? 35.510  15.158  -21.316 1.00 54.02  ? 532  PHE B CD1 1 
ATOM   7545 C  CD2 . PHE B 1 554 ? 34.355  15.896  -23.259 1.00 51.22  ? 532  PHE B CD2 1 
ATOM   7546 C  CE1 . PHE B 1 554 ? 36.723  15.425  -21.934 1.00 57.26  ? 532  PHE B CE1 1 
ATOM   7547 C  CE2 . PHE B 1 554 ? 35.561  16.159  -23.888 1.00 53.28  ? 532  PHE B CE2 1 
ATOM   7548 C  CZ  . PHE B 1 554 ? 36.750  15.926  -23.222 1.00 56.25  ? 532  PHE B CZ  1 
ATOM   7549 N  N   . VAL B 1 555 ? 31.672  17.749  -21.890 1.00 50.98  ? 533  VAL B N   1 
ATOM   7550 C  CA  . VAL B 1 555 ? 31.701  18.992  -22.644 1.00 53.30  ? 533  VAL B CA  1 
ATOM   7551 C  C   . VAL B 1 555 ? 31.465  20.169  -21.718 1.00 58.22  ? 533  VAL B C   1 
ATOM   7552 O  O   . VAL B 1 555 ? 32.183  21.161  -21.781 1.00 62.54  ? 533  VAL B O   1 
ATOM   7553 C  CB  . VAL B 1 555 ? 30.683  19.003  -23.802 1.00 50.98  ? 533  VAL B CB  1 
ATOM   7554 C  CG1 . VAL B 1 555 ? 30.685  20.355  -24.504 1.00 53.49  ? 533  VAL B CG1 1 
ATOM   7555 C  CG2 . VAL B 1 555 ? 31.006  17.903  -24.806 1.00 47.38  ? 533  VAL B CG2 1 
ATOM   7556 N  N   . ALA B 1 556 ? 30.476  20.047  -20.844 1.00 58.88  ? 534  ALA B N   1 
ATOM   7557 C  CA  . ALA B 1 556 ? 30.124  21.121  -19.939 1.00 63.70  ? 534  ALA B CA  1 
ATOM   7558 C  C   . ALA B 1 556 ? 31.257  21.424  -18.969 1.00 68.44  ? 534  ALA B C   1 
ATOM   7559 O  O   . ALA B 1 556 ? 31.605  22.598  -18.768 1.00 75.01  ? 534  ALA B O   1 
ATOM   7560 C  CB  . ALA B 1 556 ? 28.847  20.773  -19.185 1.00 63.17  ? 534  ALA B CB  1 
ATOM   7561 N  N   . ALA B 1 557 ? 31.837  20.376  -18.380 1.00 67.69  ? 535  ALA B N   1 
ATOM   7562 C  CA  . ALA B 1 557 ? 32.931  20.540  -17.413 1.00 72.54  ? 535  ALA B CA  1 
ATOM   7563 C  C   . ALA B 1 557 ? 34.093  21.266  -18.053 1.00 76.32  ? 535  ALA B C   1 
ATOM   7564 O  O   . ALA B 1 557 ? 34.601  22.221  -17.484 1.00 80.09  ? 535  ALA B O   1 
ATOM   7565 C  CB  . ALA B 1 557 ? 33.394  19.206  -16.852 1.00 70.22  ? 535  ALA B CB  1 
ATOM   7566 N  N   . GLN B 1 558 ? 34.489  20.836  -19.247 1.00 74.94  ? 536  GLN B N   1 
ATOM   7567 C  CA  . GLN B 1 558 ? 35.571  21.496  -19.972 1.00 79.52  ? 536  GLN B CA  1 
ATOM   7568 C  C   . GLN B 1 558 ? 35.349  22.991  -20.175 1.00 83.38  ? 536  GLN B C   1 
ATOM   7569 O  O   . GLN B 1 558 ? 36.293  23.777  -20.076 1.00 89.18  ? 536  GLN B O   1 
ATOM   7570 C  CB  . GLN B 1 558 ? 35.763  20.886  -21.350 1.00 78.25  ? 536  GLN B CB  1 
ATOM   7571 C  CG  . GLN B 1 558 ? 37.211  20.961  -21.806 1.00 83.62  ? 536  GLN B CG  1 
ATOM   7572 C  CD  . GLN B 1 558 ? 37.972  19.704  -21.456 1.00 85.31  ? 536  GLN B CD  1 
ATOM   7573 O  OE1 . GLN B 1 558 ? 37.388  18.720  -20.991 1.00 86.30  ? 536  GLN B OE1 1 
ATOM   7574 N  NE2 . GLN B 1 558 ? 39.277  19.721  -21.685 1.00 90.15  ? 536  GLN B NE2 1 
ATOM   7575 N  N   . GLU B 1 559 ? 34.121  23.391  -20.486 1.00 81.65  ? 537  GLU B N   1 
ATOM   7576 C  CA  . GLU B 1 559 ? 33.860  24.809  -20.732 1.00 87.04  ? 537  GLU B CA  1 
ATOM   7577 C  C   . GLU B 1 559 ? 33.419  25.602  -19.485 1.00 90.80  ? 537  GLU B C   1 
ATOM   7578 O  O   . GLU B 1 559 ? 33.145  26.794  -19.583 1.00 93.74  ? 537  GLU B O   1 
ATOM   7579 C  CB  . GLU B 1 559 ? 32.931  25.013  -21.939 1.00 85.30  ? 537  GLU B CB  1 
ATOM   7580 C  CG  . GLU B 1 559 ? 31.551  24.390  -21.877 1.00 82.40  ? 537  GLU B CG  1 
ATOM   7581 C  CD  . GLU B 1 559 ? 30.958  24.163  -23.263 1.00 80.01  ? 537  GLU B CD  1 
ATOM   7582 O  OE1 . GLU B 1 559 ? 31.701  23.807  -24.202 1.00 78.85  ? 537  GLU B OE1 1 
ATOM   7583 O  OE2 . GLU B 1 559 ? 29.735  24.337  -23.421 1.00 80.47  ? 537  GLU B OE2 1 
ATOM   7584 N  N   . ARG B 1 560 ? 33.373  24.937  -18.328 1.00 90.26  ? 538  ARG B N   1 
ATOM   7585 C  CA  . ARG B 1 560 ? 33.261  25.595  -17.028 1.00 94.60  ? 538  ARG B CA  1 
ATOM   7586 C  C   . ARG B 1 560 ? 34.613  25.524  -16.326 1.00 98.39  ? 538  ARG B C   1 
ATOM   7587 O  O   . ARG B 1 560 ? 35.618  26.032  -16.833 1.00 101.41 ? 538  ARG B O   1 
ATOM   7588 C  CB  . ARG B 1 560 ? 32.185  24.927  -16.169 1.00 91.37  ? 538  ARG B CB  1 
HETATM 7589 C  CHA . HEM C 2 .   ? -4.421  23.152  -13.511 1.00 33.78  ? 1549 HEM A CHA 1 
HETATM 7590 C  CHB . HEM C 2 .   ? -8.873  24.732  -12.569 1.00 32.91  ? 1549 HEM A CHB 1 
HETATM 7591 C  CHC . HEM C 2 .   ? -10.408 23.909  -17.102 1.00 32.11  ? 1549 HEM A CHC 1 
HETATM 7592 C  CHD . HEM C 2 .   ? -6.326  21.285  -17.514 1.00 28.52  ? 1549 HEM A CHD 1 
HETATM 7593 C  C1A . HEM C 2 .   ? -5.492  23.767  -12.922 1.00 34.93  ? 1549 HEM A C1A 1 
HETATM 7594 C  C2A . HEM C 2 .   ? -5.441  24.429  -11.675 1.00 36.26  ? 1549 HEM A C2A 1 
HETATM 7595 C  C3A . HEM C 2 .   ? -6.704  24.877  -11.411 1.00 37.17  ? 1549 HEM A C3A 1 
HETATM 7596 C  C4A . HEM C 2 .   ? -7.535  24.447  -12.457 1.00 34.67  ? 1549 HEM A C4A 1 
HETATM 7597 C  CMA . HEM C 2 .   ? -7.135  25.668  -10.184 1.00 40.97  ? 1549 HEM A CMA 1 
HETATM 7598 C  CAA . HEM C 2 .   ? -4.192  24.685  -10.849 1.00 38.38  ? 1549 HEM A CAA 1 
HETATM 7599 C  CBA . HEM C 2 .   ? -3.706  23.521  -10.018 1.00 46.74  ? 1549 HEM A CBA 1 
HETATM 7600 C  CGA . HEM C 2 .   ? -2.667  23.987  -9.024  1.00 52.20  ? 1549 HEM A CGA 1 
HETATM 7601 O  O1A . HEM C 2 .   ? -3.014  24.239  -7.838  1.00 60.44  ? 1549 HEM A O1A 1 
HETATM 7602 O  O2A . HEM C 2 .   ? -1.464  24.111  -9.363  1.00 54.57  ? 1549 HEM A O2A 1 
HETATM 7603 C  C1B . HEM C 2 .   ? -9.652  24.651  -13.700 1.00 32.97  ? 1549 HEM A C1B 1 
HETATM 7604 C  C2B . HEM C 2 .   ? -10.966 25.173  -13.734 1.00 37.24  ? 1549 HEM A C2B 1 
HETATM 7605 C  C3B . HEM C 2 .   ? -11.451 24.994  -14.983 1.00 33.37  ? 1549 HEM A C3B 1 
HETATM 7606 C  C4B . HEM C 2 .   ? -10.355 24.331  -15.762 1.00 35.25  ? 1549 HEM A C4B 1 
HETATM 7607 C  CMB . HEM C 2 .   ? -11.765 25.817  -12.603 1.00 37.34  ? 1549 HEM A CMB 1 
HETATM 7608 C  CAB . HEM C 2 .   ? -12.817 25.445  -15.279 1.00 38.92  ? 1549 HEM A CAB 1 
HETATM 7609 C  CBB . HEM C 2 .   ? -13.375 25.318  -16.438 1.00 44.89  ? 1549 HEM A CBB 1 
HETATM 7610 C  C1C . HEM C 2 .   ? -9.403  23.098  -17.636 1.00 32.53  ? 1549 HEM A C1C 1 
HETATM 7611 C  C2C . HEM C 2 .   ? -9.439  22.513  -18.908 1.00 27.49  ? 1549 HEM A C2C 1 
HETATM 7612 C  C3C . HEM C 2 .   ? -8.267  21.755  -19.020 1.00 29.81  ? 1549 HEM A C3C 1 
HETATM 7613 C  C4C . HEM C 2 .   ? -7.529  21.874  -17.803 1.00 29.16  ? 1549 HEM A C4C 1 
HETATM 7614 C  CMC . HEM C 2 .   ? -10.563 22.707  -19.909 1.00 26.51  ? 1549 HEM A CMC 1 
HETATM 7615 C  CAC . HEM C 2 .   ? -7.815  20.946  -20.176 1.00 30.48  ? 1549 HEM A CAC 1 
HETATM 7616 C  CBC . HEM C 2 .   ? -8.486  20.843  -21.317 1.00 28.96  ? 1549 HEM A CBC 1 
HETATM 7617 C  C1D . HEM C 2 .   ? -5.505  21.596  -16.450 1.00 29.83  ? 1549 HEM A C1D 1 
HETATM 7618 C  C2D . HEM C 2 .   ? -4.148  21.039  -16.349 1.00 32.37  ? 1549 HEM A C2D 1 
HETATM 7619 C  C3D . HEM C 2 .   ? -3.593  21.572  -15.246 1.00 30.78  ? 1549 HEM A C3D 1 
HETATM 7620 C  C4D . HEM C 2 .   ? -4.637  22.453  -14.696 1.00 33.26  ? 1549 HEM A C4D 1 
HETATM 7621 C  CMD . HEM C 2 .   ? -3.499  20.064  -17.325 1.00 33.86  ? 1549 HEM A CMD 1 
HETATM 7622 C  CAD . HEM C 2 .   ? -2.217  21.343  -14.633 1.00 31.74  ? 1549 HEM A CAD 1 
HETATM 7623 C  CBD . HEM C 2 .   ? -2.470  20.308  -13.509 1.00 33.46  ? 1549 HEM A CBD 1 
HETATM 7624 C  CGD . HEM C 2 .   ? -1.383  20.182  -12.470 1.00 36.39  ? 1549 HEM A CGD 1 
HETATM 7625 O  O1D . HEM C 2 .   ? -1.582  19.431  -11.492 1.00 34.83  ? 1549 HEM A O1D 1 
HETATM 7626 O  O2D . HEM C 2 .   ? -0.281  20.776  -12.571 1.00 39.45  ? 1549 HEM A O2D 1 
HETATM 7627 N  NA  . HEM C 2 .   ? -6.769  23.802  -13.407 1.00 33.17  ? 1549 HEM A NA  1 
HETATM 7628 N  NB  . HEM C 2 .   ? -9.324  24.208  -14.905 1.00 33.53  ? 1549 HEM A NB  1 
HETATM 7629 N  NC  . HEM C 2 .   ? -8.249  22.707  -16.992 1.00 29.64  ? 1549 HEM A NC  1 
HETATM 7630 N  ND  . HEM C 2 .   ? -5.759  22.447  -15.454 1.00 32.85  ? 1549 HEM A ND  1 
HETATM 7631 FE FE  . HEM C 2 .   ? -7.465  23.301  -15.190 1.00 32.80  ? 1549 HEM A FE  1 
HETATM 7632 C  C   . ACT D 3 .   ? 4.974   12.460  -28.332 1.00 28.61  ? 1550 ACT A C   1 
HETATM 7633 O  O   . ACT D 3 .   ? 4.005   11.929  -27.646 1.00 42.38  ? 1550 ACT A O   1 
HETATM 7634 O  OXT . ACT D 3 .   ? 6.082   12.778  -27.893 1.00 29.35  ? 1550 ACT A OXT 1 
HETATM 7635 C  CH3 . ACT D 3 .   ? 4.803   12.673  -29.732 1.00 24.03  ? 1550 ACT A CH3 1 
HETATM 7636 N  N1  . PLP E 4 .   ? -0.634  8.831   -32.172 1.00 26.57  ? 1551 PLP A N1  1 
HETATM 7637 C  C2  . PLP E 4 .   ? 0.517   9.441   -32.511 1.00 26.48  ? 1551 PLP A C2  1 
HETATM 7638 C  C2A . PLP E 4 .   ? 1.268   9.078   -33.779 1.00 25.05  ? 1551 PLP A C2A 1 
HETATM 7639 C  C3  . PLP E 4 .   ? 1.007   10.471  -31.613 1.00 26.91  ? 1551 PLP A C3  1 
HETATM 7640 O  O3  . PLP E 4 .   ? 2.118   11.171  -31.834 1.00 25.88  ? 1551 PLP A O3  1 
HETATM 7641 C  C4  . PLP E 4 .   ? 0.193   10.732  -30.412 1.00 28.56  ? 1551 PLP A C4  1 
HETATM 7642 C  C4A . PLP E 4 .   ? 0.577   11.715  -29.449 1.00 31.00  ? 1551 PLP A C4A 1 
HETATM 7643 C  C5  . PLP E 4 .   ? -1.030  10.020  -30.141 1.00 27.42  ? 1551 PLP A C5  1 
HETATM 7644 C  C6  . PLP E 4 .   ? -1.381  9.080   -31.088 1.00 26.99  ? 1551 PLP A C6  1 
HETATM 7645 C  C5A . PLP E 4 .   ? -1.805  10.281  -28.848 1.00 28.26  ? 1551 PLP A C5A 1 
HETATM 7646 O  O4P . PLP E 4 .   ? -2.174  11.649  -28.644 1.00 26.78  ? 1551 PLP A O4P 1 
HETATM 7647 P  P   . PLP E 4 .   ? -2.153  12.265  -27.150 1.00 25.06  ? 1551 PLP A P   1 
HETATM 7648 O  O1P . PLP E 4 .   ? -2.940  11.279  -26.281 1.00 25.39  ? 1551 PLP A O1P 1 
HETATM 7649 O  O2P . PLP E 4 .   ? -0.715  12.345  -26.731 1.00 23.84  ? 1551 PLP A O2P 1 
HETATM 7650 O  O3P . PLP E 4 .   ? -2.807  13.637  -27.370 1.00 25.76  ? 1551 PLP A O3P 1 
HETATM 7651 C  C1  . EDO F 5 .   ? -6.649  16.971  -17.216 1.00 43.31  ? 1552 EDO A C1  1 
HETATM 7652 O  O1  . EDO F 5 .   ? -5.987  17.731  -18.254 1.00 43.10  ? 1552 EDO A O1  1 
HETATM 7653 C  C2  . EDO F 5 .   ? -6.394  17.525  -15.820 1.00 45.19  ? 1552 EDO A C2  1 
HETATM 7654 O  O2  . EDO F 5 .   ? -5.005  17.456  -15.536 1.00 45.39  ? 1552 EDO A O2  1 
HETATM 7655 C  C1  . EDO G 5 .   ? 9.774   5.175   -20.166 1.00 46.04  ? 1553 EDO A C1  1 
HETATM 7656 O  O1  . EDO G 5 .   ? 10.711  4.909   -21.218 1.00 49.21  ? 1553 EDO A O1  1 
HETATM 7657 C  C2  . EDO G 5 .   ? 8.443   4.512   -20.446 1.00 47.00  ? 1553 EDO A C2  1 
HETATM 7658 O  O2  . EDO G 5 .   ? 7.392   5.475   -20.464 1.00 34.61  ? 1553 EDO A O2  1 
HETATM 7659 C  C1  . EDO H 5 .   ? 22.421  16.407  -26.506 1.00 45.99  ? 1554 EDO A C1  1 
HETATM 7660 O  O1  . EDO H 5 .   ? 23.240  16.838  -27.611 1.00 47.89  ? 1554 EDO A O1  1 
HETATM 7661 C  C2  . EDO H 5 .   ? 22.679  17.279  -25.312 1.00 44.96  ? 1554 EDO A C2  1 
HETATM 7662 O  O2  . EDO H 5 .   ? 23.659  16.654  -24.483 1.00 47.53  ? 1554 EDO A O2  1 
HETATM 7663 C  C1  . EDO I 5 .   ? 23.721  -4.692  -62.379 1.00 54.41  ? 1555 EDO A C1  1 
HETATM 7664 O  O1  . EDO I 5 .   ? 23.753  -5.760  -61.435 1.00 58.63  ? 1555 EDO A O1  1 
HETATM 7665 C  C2  . EDO I 5 .   ? 23.369  -3.414  -61.650 1.00 55.90  ? 1555 EDO A C2  1 
HETATM 7666 O  O2  . EDO I 5 .   ? 22.008  -3.468  -61.210 1.00 54.78  ? 1555 EDO A O2  1 
HETATM 7667 C  C1  . EDO J 5 .   ? -6.371  9.795   -13.536 1.00 47.51  ? 1556 EDO A C1  1 
HETATM 7668 O  O1  . EDO J 5 .   ? -6.831  8.452   -13.681 1.00 41.19  ? 1556 EDO A O1  1 
HETATM 7669 C  C2  . EDO J 5 .   ? -7.068  10.692  -14.533 1.00 45.88  ? 1556 EDO A C2  1 
HETATM 7670 O  O2  . EDO J 5 .   ? -8.491  10.808  -14.316 1.00 47.37  ? 1556 EDO A O2  1 
HETATM 7671 C  C2  . PE4 K 6 .   ? 21.928  -6.128  -90.398 1.00 50.99  ? 1557 PE4 A C2  1 
HETATM 7672 O  O2  . PE4 K 6 .   ? 21.353  -4.771  -90.348 1.00 66.08  ? 1557 PE4 A O2  1 
HETATM 7673 C  C3  . PE4 K 6 .   ? 22.244  -3.650  -90.567 1.00 61.91  ? 1557 PE4 A C3  1 
HETATM 7674 C  C4  . PE4 K 6 .   ? 21.965  -2.815  -91.823 1.00 59.46  ? 1557 PE4 A C4  1 
HETATM 7675 O  O3  . PE4 K 6 .   ? 21.929  -3.662  -92.984 1.00 63.41  ? 1557 PE4 A O3  1 
HETATM 7676 C  C5  . PE4 K 6 .   ? 20.768  -3.562  -93.819 1.00 56.79  ? 1557 PE4 A C5  1 
HETATM 7677 C  C6  . PE4 K 6 .   ? 20.030  -4.896  -93.873 1.00 56.38  ? 1557 PE4 A C6  1 
HETATM 7678 NA NA  . NA  L 7 .   ? 4.947   4.322   -28.095 1.00 28.74  ? 1558 NA  A NA  1 
HETATM 7679 C  C1  . EDO M 5 .   ? 1.767   -9.459  -65.153 1.00 20.00  ? 1559 EDO A C1  1 
HETATM 7680 O  O1  . EDO M 5 .   ? 1.628   -8.572  -64.037 1.00 20.00  ? 1559 EDO A O1  1 
HETATM 7681 C  C2  . EDO M 5 .   ? 0.702   -9.136  -66.194 1.00 20.00  ? 1559 EDO A C2  1 
HETATM 7682 O  O2  . EDO M 5 .   ? -0.442  -8.568  -65.546 1.00 20.00  ? 1559 EDO A O2  1 
HETATM 7683 C  CHA . HEM N 2 .   ? -5.138  22.581  -77.780 1.00 60.70  ? 1539 HEM B CHA 1 
HETATM 7684 C  CHB . HEM N 2 .   ? -7.044  26.935  -78.727 1.00 59.47  ? 1539 HEM B CHB 1 
HETATM 7685 C  CHC . HEM N 2 .   ? -6.240  28.284  -74.111 1.00 66.64  ? 1539 HEM B CHC 1 
HETATM 7686 C  CHD . HEM N 2 .   ? -3.443  24.338  -73.596 1.00 55.03  ? 1539 HEM B CHD 1 
HETATM 7687 C  C1A . HEM N 2 .   ? -5.787  23.616  -78.391 1.00 62.16  ? 1539 HEM B C1A 1 
HETATM 7688 C  C2A . HEM N 2 .   ? -6.280  23.577  -79.713 1.00 63.98  ? 1539 HEM B C2A 1 
HETATM 7689 C  C3A . HEM N 2 .   ? -6.790  24.805  -79.997 1.00 66.04  ? 1539 HEM B C3A 1 
HETATM 7690 C  C4A . HEM N 2 .   ? -6.625  25.615  -78.846 1.00 62.02  ? 1539 HEM B C4A 1 
HETATM 7691 C  CMA . HEM N 2 .   ? -7.434  25.205  -81.309 1.00 63.94  ? 1539 HEM B CMA 1 
HETATM 7692 C  CAA . HEM N 2 .   ? -6.195  22.417  -80.673 1.00 61.54  ? 1539 HEM B CAA 1 
HETATM 7693 C  CBA . HEM N 2 .   ? -7.237  21.316  -80.499 1.00 63.08  ? 1539 HEM B CBA 1 
HETATM 7694 C  CGA . HEM N 2 .   ? -6.786  20.160  -81.387 1.00 70.27  ? 1539 HEM B CGA 1 
HETATM 7695 O  O1A . HEM N 2 .   ? -5.720  20.211  -82.072 1.00 68.60  ? 1539 HEM B O1A 1 
HETATM 7696 O  O2A . HEM N 2 .   ? -7.473  19.114  -81.446 1.00 73.97  ? 1539 HEM B O2A 1 
HETATM 7697 C  C1B . HEM N 2 .   ? -7.011  27.685  -77.546 1.00 62.42  ? 1539 HEM B C1B 1 
HETATM 7698 C  C2B . HEM N 2 .   ? -7.604  28.983  -77.416 1.00 69.70  ? 1539 HEM B C2B 1 
HETATM 7699 C  C3B . HEM N 2 .   ? -7.402  29.391  -76.112 1.00 72.18  ? 1539 HEM B C3B 1 
HETATM 7700 C  C4B . HEM N 2 .   ? -6.673  28.266  -75.450 1.00 69.57  ? 1539 HEM B C4B 1 
HETATM 7701 C  CMB . HEM N 2 .   ? -8.307  29.748  -78.519 1.00 65.39  ? 1539 HEM B CMB 1 
HETATM 7702 C  CAB . HEM N 2 .   ? -7.777  30.649  -75.410 1.00 71.68  ? 1539 HEM B CAB 1 
HETATM 7703 C  CBB . HEM N 2 .   ? -8.360  31.708  -75.972 1.00 74.10  ? 1539 HEM B CBB 1 
HETATM 7704 C  C1C . HEM N 2 .   ? -5.383  27.335  -73.542 1.00 60.73  ? 1539 HEM B C1C 1 
HETATM 7705 C  C2C . HEM N 2 .   ? -4.792  27.433  -72.273 1.00 57.64  ? 1539 HEM B C2C 1 
HETATM 7706 C  C3C . HEM N 2 .   ? -3.980  26.301  -72.123 1.00 57.69  ? 1539 HEM B C3C 1 
HETATM 7707 C  C4C . HEM N 2 .   ? -4.079  25.534  -73.330 1.00 56.95  ? 1539 HEM B C4C 1 
HETATM 7708 C  CMC . HEM N 2 .   ? -5.031  28.567  -71.289 1.00 52.95  ? 1539 HEM B CMC 1 
HETATM 7709 C  CAC . HEM N 2 .   ? -3.135  25.905  -70.970 1.00 55.85  ? 1539 HEM B CAC 1 
HETATM 7710 C  CBC . HEM N 2 .   ? -3.000  26.624  -69.856 1.00 52.24  ? 1539 HEM B CBC 1 
HETATM 7711 C  C1D . HEM N 2 .   ? -3.715  23.550  -74.718 1.00 53.64  ? 1539 HEM B C1D 1 
HETATM 7712 C  C2D . HEM N 2 .   ? -3.150  22.198  -74.871 1.00 55.81  ? 1539 HEM B C2D 1 
HETATM 7713 C  C3D . HEM N 2 .   ? -3.651  21.715  -76.021 1.00 56.51  ? 1539 HEM B C3D 1 
HETATM 7714 C  C4D . HEM N 2 .   ? -4.511  22.766  -76.563 1.00 56.32  ? 1539 HEM B C4D 1 
HETATM 7715 C  CMD . HEM N 2 .   ? -2.193  21.461  -73.949 1.00 53.07  ? 1539 HEM B CMD 1 
HETATM 7716 C  CAD . HEM N 2 .   ? -3.355  20.389  -76.678 1.00 48.71  ? 1539 HEM B CAD 1 
HETATM 7717 C  CBD . HEM N 2 .   ? -2.224  20.708  -77.672 1.00 49.76  ? 1539 HEM B CBD 1 
HETATM 7718 C  CGD . HEM N 2 .   ? -2.114  19.704  -78.805 1.00 53.60  ? 1539 HEM B CGD 1 
HETATM 7719 O  O1D . HEM N 2 .   ? -2.735  18.608  -78.809 1.00 48.59  ? 1539 HEM B O1D 1 
HETATM 7720 O  O2D . HEM N 2 .   ? -1.369  19.994  -79.767 1.00 55.70  ? 1539 HEM B O2D 1 
HETATM 7721 N  NA  . HEM N 2 .   ? -5.969  24.876  -77.887 1.00 61.58  ? 1539 HEM B NA  1 
HETATM 7722 N  NB  . HEM N 2 .   ? -6.501  27.305  -76.368 1.00 64.73  ? 1539 HEM B NB  1 
HETATM 7723 N  NC  . HEM N 2 .   ? -4.924  26.207  -74.161 1.00 56.93  ? 1539 HEM B NC  1 
HETATM 7724 N  ND  . HEM N 2 .   ? -4.529  23.839  -75.749 1.00 61.17  ? 1539 HEM B ND  1 
HETATM 7725 FE FE  . HEM N 2 .   ? -5.481  25.481  -76.041 1.00 53.51  ? 1539 HEM B FE  1 
HETATM 7726 C  C   . ACT O 3 .   ? 5.684   13.253  -63.231 1.00 34.67  ? 1540 ACT B C   1 
HETATM 7727 O  O   . ACT O 3 .   ? 6.267   14.121  -63.942 1.00 47.04  ? 1540 ACT B O   1 
HETATM 7728 O  OXT . ACT O 3 .   ? 5.279   12.164  -63.629 1.00 39.35  ? 1540 ACT B OXT 1 
HETATM 7729 C  CH3 . ACT O 3 .   ? 5.457   13.471  -61.815 1.00 29.53  ? 1540 ACT B CH3 1 
HETATM 7730 C  C   . ACT P 3 .   ? 1.751   -5.032  -65.192 1.00 55.78  ? 1541 ACT B C   1 
HETATM 7731 O  O   . ACT P 3 .   ? 1.221   -5.523  -66.214 1.00 56.99  ? 1541 ACT B O   1 
HETATM 7732 O  OXT . ACT P 3 .   ? 1.221   -5.003  -64.060 1.00 53.09  ? 1541 ACT B OXT 1 
HETATM 7733 C  CH3 . ACT P 3 .   ? 3.128   -4.505  -65.301 1.00 52.32  ? 1541 ACT B CH3 1 
HETATM 7734 C  C   . ACT Q 3 .   ? 26.858  17.540  -25.933 1.00 62.06  ? 1542 ACT B C   1 
HETATM 7735 O  O   . ACT Q 3 .   ? 27.130  18.740  -25.742 1.00 57.41  ? 1542 ACT B O   1 
HETATM 7736 O  OXT . ACT Q 3 .   ? 27.055  16.891  -26.986 1.00 62.59  ? 1542 ACT B OXT 1 
HETATM 7737 C  CH3 . ACT Q 3 .   ? 26.224  16.825  -24.810 1.00 64.89  ? 1542 ACT B CH3 1 
HETATM 7738 N  N1  . PLP R 4 .   ? 9.247   18.882  -59.195 1.00 32.54  ? 1543 PLP B N1  1 
HETATM 7739 C  C2  . PLP R 4 .   ? 8.644   17.722  -58.873 1.00 29.35  ? 1543 PLP B C2  1 
HETATM 7740 C  C2A . PLP R 4 .   ? 9.042   16.949  -57.652 1.00 30.37  ? 1543 PLP B C2A 1 
HETATM 7741 C  C3  . PLP R 4 .   ? 7.599   17.212  -59.732 1.00 32.01  ? 1543 PLP B C3  1 
HETATM 7742 O  O3  . PLP R 4 .   ? 6.936   16.056  -59.493 1.00 32.40  ? 1543 PLP B O3  1 
HETATM 7743 C  C4  . PLP R 4 .   ? 7.296   18.042  -60.899 1.00 33.95  ? 1543 PLP B C4  1 
HETATM 7744 C  C4A . PLP R 4 .   ? 6.262   17.625  -61.796 1.00 35.04  ? 1543 PLP B C4A 1 
HETATM 7745 C  C5  . PLP R 4 .   ? 7.982   19.303  -61.182 1.00 33.69  ? 1543 PLP B C5  1 
HETATM 7746 C  C6  . PLP R 4 .   ? 8.966   19.644  -60.278 1.00 33.55  ? 1543 PLP B C6  1 
HETATM 7747 C  C5A . PLP R 4 .   ? 7.683   20.135  -62.435 1.00 31.87  ? 1543 PLP B C5A 1 
HETATM 7748 O  O4P . PLP R 4 .   ? 6.326   20.398  -62.726 1.00 32.82  ? 1543 PLP B O4P 1 
HETATM 7749 P  P   . PLP R 4 .   ? 5.703   20.342  -64.249 1.00 34.22  ? 1543 PLP B P   1 
HETATM 7750 O  O1P . PLP R 4 .   ? 4.285   20.863  -64.039 1.00 34.30  ? 1543 PLP B O1P 1 
HETATM 7751 O  O2P . PLP R 4 .   ? 6.705   21.198  -64.985 1.00 30.44  ? 1543 PLP B O2P 1 
HETATM 7752 O  O3P . PLP R 4 .   ? 5.653   18.918  -64.634 1.00 34.19  ? 1543 PLP B O3P 1 
HETATM 7753 C  C1  . EDO S 5 .   ? 1.185   24.507  -75.263 1.00 51.90  ? 1544 EDO B C1  1 
HETATM 7754 O  O1  . EDO S 5 .   ? 0.224   23.576  -75.753 1.00 53.54  ? 1544 EDO B O1  1 
HETATM 7755 C  C2  . EDO S 5 .   ? 0.754   25.029  -73.899 1.00 53.46  ? 1544 EDO B C2  1 
HETATM 7756 O  O2  . EDO S 5 .   ? -0.091  24.094  -73.203 1.00 57.14  ? 1544 EDO B O2  1 
HETATM 7757 NA NA  . NA  T 7 .   ? 13.728  13.419  -63.309 1.00 34.26  ? 1545 NA  B NA  1 
HETATM 7758 C  C   . ACT U 3 .   ? 24.183  13.178  -28.794 1.00 64.33  ? 1546 ACT B C   1 
HETATM 7759 O  O   . ACT U 3 .   ? 23.543  12.585  -29.715 1.00 42.28  ? 1546 ACT B O   1 
HETATM 7760 O  OXT . ACT U 3 .   ? 25.419  13.152  -28.569 1.00 65.25  ? 1546 ACT B OXT 1 
HETATM 7761 C  CH3 . ACT U 3 .   ? 23.440  14.026  -27.838 1.00 67.92  ? 1546 ACT B CH3 1 
HETATM 7762 O  O   . HOH V 8 .   ? 7.358   15.177  -15.750 1.00 42.50  ? 2001 HOH A O   1 
HETATM 7763 O  O   . HOH V 8 .   ? -1.614  11.067  -13.086 1.00 34.11  ? 2002 HOH A O   1 
HETATM 7764 O  O   . HOH V 8 .   ? 1.103   6.389   -12.975 1.00 33.71  ? 2003 HOH A O   1 
HETATM 7765 O  O   . HOH V 8 .   ? -10.192 18.248  -12.832 1.00 47.11  ? 2004 HOH A O   1 
HETATM 7766 O  O   . HOH V 8 .   ? -16.395 16.137  -13.766 1.00 38.93  ? 2005 HOH A O   1 
HETATM 7767 O  O   . HOH V 8 .   ? -18.383 22.336  -17.541 1.00 40.86  ? 2006 HOH A O   1 
HETATM 7768 O  O   . HOH V 8 .   ? -16.021 24.860  -18.116 1.00 40.50  ? 2007 HOH A O   1 
HETATM 7769 O  O   . HOH V 8 .   ? -12.375 29.272  -10.711 1.00 49.51  ? 2008 HOH A O   1 
HETATM 7770 O  O   . HOH V 8 .   ? -20.809 31.878  -16.242 1.00 50.41  ? 2009 HOH A O   1 
HETATM 7771 O  O   . HOH V 8 .   ? -13.813 27.790  -23.040 1.00 38.75  ? 2010 HOH A O   1 
HETATM 7772 O  O   . HOH V 8 .   ? -5.014  32.548  -13.977 1.00 49.39  ? 2011 HOH A O   1 
HETATM 7773 O  O   . HOH V 8 .   ? -3.148  28.393  -19.208 1.00 33.92  ? 2012 HOH A O   1 
HETATM 7774 O  O   . HOH V 8 .   ? -12.971 27.737  -20.558 1.00 41.01  ? 2013 HOH A O   1 
HETATM 7775 O  O   . HOH V 8 .   ? -12.113 28.018  -28.217 1.00 59.51  ? 2014 HOH A O   1 
HETATM 7776 O  O   . HOH V 8 .   ? -4.074  26.545  -29.165 1.00 35.37  ? 2015 HOH A O   1 
HETATM 7777 O  O   . HOH V 8 .   ? -7.242  28.125  -36.723 1.00 51.19  ? 2016 HOH A O   1 
HETATM 7778 O  O   . HOH V 8 .   ? -21.301 7.433   -45.352 1.00 52.85  ? 2017 HOH A O   1 
HETATM 7779 O  O   . HOH V 8 .   ? -1.619  30.883  -47.468 1.00 35.62  ? 2018 HOH A O   1 
HETATM 7780 O  O   . HOH V 8 .   ? 8.468   29.199  -42.056 1.00 27.75  ? 2019 HOH A O   1 
HETATM 7781 O  O   . HOH V 8 .   ? -1.066  28.084  -36.311 1.00 48.46  ? 2020 HOH A O   1 
HETATM 7782 O  O   . HOH V 8 .   ? -3.078  22.189  -40.736 1.00 42.17  ? 2021 HOH A O   1 
HETATM 7783 O  O   . HOH V 8 .   ? -12.762 19.455  -43.888 1.00 31.27  ? 2022 HOH A O   1 
HETATM 7784 O  O   . HOH V 8 .   ? -11.839 8.651   -46.898 1.00 32.87  ? 2023 HOH A O   1 
HETATM 7785 O  O   . HOH V 8 .   ? -19.471 15.914  -47.854 1.00 46.98  ? 2024 HOH A O   1 
HETATM 7786 O  O   . HOH V 8 .   ? -17.447 3.511   -44.771 1.00 43.25  ? 2025 HOH A O   1 
HETATM 7787 O  O   . HOH V 8 .   ? -19.133 6.986   -43.615 1.00 32.03  ? 2026 HOH A O   1 
HETATM 7788 O  O   . HOH V 8 .   ? -19.731 7.009   -48.187 1.00 45.48  ? 2027 HOH A O   1 
HETATM 7789 O  O   . HOH V 8 .   ? -12.704 7.312   -50.043 1.00 37.66  ? 2028 HOH A O   1 
HETATM 7790 O  O   . HOH V 8 .   ? -16.249 7.401   -52.583 1.00 56.82  ? 2029 HOH A O   1 
HETATM 7791 O  O   . HOH V 8 .   ? -16.560 -1.089  -48.677 1.00 46.61  ? 2030 HOH A O   1 
HETATM 7792 O  O   . HOH V 8 .   ? -13.936 5.824   -52.051 1.00 48.82  ? 2031 HOH A O   1 
HETATM 7793 O  O   . HOH V 8 .   ? -25.711 6.771   -41.415 1.00 46.22  ? 2032 HOH A O   1 
HETATM 7794 O  O   . HOH V 8 .   ? 2.527   17.633  -43.592 1.00 44.54  ? 2033 HOH A O   1 
HETATM 7795 O  O   . HOH V 8 .   ? 4.937   17.632  -42.960 1.00 42.58  ? 2034 HOH A O   1 
HETATM 7796 O  O   . HOH V 8 .   ? 6.738   21.856  -43.555 1.00 25.53  ? 2035 HOH A O   1 
HETATM 7797 O  O   . HOH V 8 .   ? 5.439   14.227  -37.319 1.00 31.06  ? 2036 HOH A O   1 
HETATM 7798 O  O   . HOH V 8 .   ? 3.847   12.490  -39.298 1.00 34.37  ? 2037 HOH A O   1 
HETATM 7799 O  O   . HOH V 8 .   ? 4.808   16.679  -35.493 1.00 25.24  ? 2038 HOH A O   1 
HETATM 7800 O  O   . HOH V 8 .   ? 4.834   23.507  -33.709 1.00 47.80  ? 2039 HOH A O   1 
HETATM 7801 O  O   . HOH V 8 .   ? -2.098  25.180  -31.259 1.00 42.49  ? 2040 HOH A O   1 
HETATM 7802 O  O   . HOH V 8 .   ? -1.763  25.301  -15.626 1.00 49.01  ? 2041 HOH A O   1 
HETATM 7803 O  O   . HOH V 8 .   ? -16.134 26.806  -23.551 1.00 44.91  ? 2042 HOH A O   1 
HETATM 7804 O  O   . HOH V 8 .   ? 4.181   26.074  -21.857 1.00 29.72  ? 2043 HOH A O   1 
HETATM 7805 O  O   . HOH V 8 .   ? -1.412  30.722  -26.583 1.00 37.58  ? 2044 HOH A O   1 
HETATM 7806 O  O   . HOH V 8 .   ? 9.424   35.037  -22.729 1.00 45.01  ? 2045 HOH A O   1 
HETATM 7807 O  O   . HOH V 8 .   ? 10.398  20.984  -23.911 1.00 32.90  ? 2046 HOH A O   1 
HETATM 7808 O  O   . HOH V 8 .   ? 4.713   10.257  -31.409 1.00 31.16  ? 2047 HOH A O   1 
HETATM 7809 O  O   . HOH V 8 .   ? 3.624   9.013   -26.999 1.00 37.60  ? 2048 HOH A O   1 
HETATM 7810 O  O   . HOH V 8 .   ? 15.352  22.425  -34.303 1.00 29.07  ? 2049 HOH A O   1 
HETATM 7811 O  O   . HOH V 8 .   ? 17.191  27.897  -35.795 1.00 53.33  ? 2050 HOH A O   1 
HETATM 7812 O  O   . HOH V 8 .   ? -6.831  -5.882  -44.947 1.00 47.22  ? 2051 HOH A O   1 
HETATM 7813 O  O   . HOH V 8 .   ? -2.067  -5.503  -44.529 1.00 41.37  ? 2052 HOH A O   1 
HETATM 7814 O  O   . HOH V 8 .   ? -2.605  -3.414  -48.659 1.00 50.54  ? 2053 HOH A O   1 
HETATM 7815 O  O   . HOH V 8 .   ? -7.161  -2.935  -48.439 1.00 35.41  ? 2054 HOH A O   1 
HETATM 7816 O  O   . HOH V 8 .   ? 17.048  24.166  -33.252 1.00 34.31  ? 2055 HOH A O   1 
HETATM 7817 O  O   . HOH V 8 .   ? 18.998  22.578  -31.944 1.00 42.20  ? 2056 HOH A O   1 
HETATM 7818 O  O   . HOH V 8 .   ? 14.856  -0.575  -30.887 1.00 38.62  ? 2057 HOH A O   1 
HETATM 7819 O  O   . HOH V 8 .   ? 17.158  2.725   -31.899 1.00 28.32  ? 2058 HOH A O   1 
HETATM 7820 O  O   . HOH V 8 .   ? 14.327  0.984   -33.645 1.00 46.66  ? 2059 HOH A O   1 
HETATM 7821 O  O   . HOH V 8 .   ? 15.441  -0.745  -26.411 1.00 25.77  ? 2060 HOH A O   1 
HETATM 7822 O  O   . HOH V 8 .   ? 18.772  -0.602  -24.654 1.00 29.90  ? 2061 HOH A O   1 
HETATM 7823 O  O   . HOH V 8 .   ? 21.383  1.189   -25.993 1.00 30.89  ? 2062 HOH A O   1 
HETATM 7824 O  O   . HOH V 8 .   ? 13.474  -1.060  -28.759 1.00 30.65  ? 2063 HOH A O   1 
HETATM 7825 O  O   . HOH V 8 .   ? 12.652  1.594   -35.444 1.00 34.97  ? 2064 HOH A O   1 
HETATM 7826 O  O   . HOH V 8 .   ? 15.498  5.226   -34.751 1.00 22.05  ? 2065 HOH A O   1 
HETATM 7827 O  O   . HOH V 8 .   ? 12.586  3.032   -39.154 1.00 35.20  ? 2066 HOH A O   1 
HETATM 7828 O  O   . HOH V 8 .   ? 15.043  6.361   -42.672 1.00 40.88  ? 2067 HOH A O   1 
HETATM 7829 O  O   . HOH V 8 .   ? 9.539   11.329  -40.378 1.00 29.44  ? 2068 HOH A O   1 
HETATM 7830 O  O   . HOH V 8 .   ? 13.367  5.502   -44.387 1.00 34.81  ? 2069 HOH A O   1 
HETATM 7831 O  O   . HOH V 8 .   ? 4.560   8.145   -32.897 1.00 29.71  ? 2070 HOH A O   1 
HETATM 7832 O  O   . HOH V 8 .   ? 18.541  14.163  -41.672 1.00 35.23  ? 2071 HOH A O   1 
HETATM 7833 O  O   . HOH V 8 .   ? 17.784  8.762   -44.119 1.00 37.05  ? 2072 HOH A O   1 
HETATM 7834 O  O   . HOH V 8 .   ? 18.566  7.207   -39.919 1.00 49.46  ? 2073 HOH A O   1 
HETATM 7835 O  O   . HOH V 8 .   ? 14.648  8.749   -43.073 1.00 50.75  ? 2074 HOH A O   1 
HETATM 7836 O  O   . HOH V 8 .   ? 20.490  18.246  -36.304 1.00 45.73  ? 2075 HOH A O   1 
HETATM 7837 O  O   . HOH V 8 .   ? 17.922  20.235  -43.336 1.00 30.45  ? 2076 HOH A O   1 
HETATM 7838 O  O   . HOH V 8 .   ? 17.424  24.207  -37.878 1.00 29.62  ? 2077 HOH A O   1 
HETATM 7839 O  O   . HOH V 8 .   ? 22.251  14.726  -31.633 1.00 34.21  ? 2078 HOH A O   1 
HETATM 7840 O  O   . HOH V 8 .   ? 10.983  -24.658 -71.301 1.00 54.20  ? 2079 HOH A O   1 
HETATM 7841 O  O   . HOH V 8 .   ? 21.561  8.355   -26.609 1.00 27.24  ? 2080 HOH A O   1 
HETATM 7842 O  O   . HOH V 8 .   ? 12.711  4.951   -22.884 1.00 28.47  ? 2081 HOH A O   1 
HETATM 7843 O  O   . HOH V 8 .   ? 14.546  -4.492  -23.099 1.00 47.60  ? 2082 HOH A O   1 
HETATM 7844 O  O   . HOH V 8 .   ? 7.874   -0.007  -9.657  1.00 42.25  ? 2083 HOH A O   1 
HETATM 7845 O  O   . HOH V 8 .   ? 3.460   0.346   -14.930 1.00 30.83  ? 2084 HOH A O   1 
HETATM 7846 O  O   . HOH V 8 .   ? 3.596   -1.538  -16.952 1.00 44.72  ? 2085 HOH A O   1 
HETATM 7847 O  O   . HOH V 8 .   ? 20.022  4.025   -14.786 1.00 41.05  ? 2086 HOH A O   1 
HETATM 7848 O  O   . HOH V 8 .   ? 8.657   14.773  -18.062 1.00 50.45  ? 2087 HOH A O   1 
HETATM 7849 O  O   . HOH V 8 .   ? 22.644  2.739   -64.698 1.00 47.47  ? 2088 HOH A O   1 
HETATM 7850 O  O   . HOH V 8 .   ? 11.965  23.264  -17.234 1.00 35.07  ? 2089 HOH A O   1 
HETATM 7851 O  O   . HOH V 8 .   ? 6.849   19.698  -15.506 1.00 52.18  ? 2090 HOH A O   1 
HETATM 7852 O  O   . HOH V 8 .   ? 1.081   21.507  -14.965 1.00 40.64  ? 2091 HOH A O   1 
HETATM 7853 O  O   . HOH V 8 .   ? 1.853   26.459  -20.427 1.00 41.57  ? 2092 HOH A O   1 
HETATM 7854 O  O   . HOH V 8 .   ? 0.334   23.640  -16.721 1.00 33.90  ? 2093 HOH A O   1 
HETATM 7855 O  O   . HOH V 8 .   ? -1.586  16.041  -27.645 1.00 25.04  ? 2094 HOH A O   1 
HETATM 7856 O  O   . HOH V 8 .   ? -17.389 24.549  -23.248 1.00 43.41  ? 2095 HOH A O   1 
HETATM 7857 O  O   . HOH V 8 .   ? -13.591 25.534  -19.176 1.00 38.36  ? 2096 HOH A O   1 
HETATM 7858 O  O   . HOH V 8 .   ? -12.076 26.897  -25.262 1.00 38.51  ? 2097 HOH A O   1 
HETATM 7859 O  O   . HOH V 8 .   ? -7.498  26.196  -35.137 1.00 42.73  ? 2098 HOH A O   1 
HETATM 7860 O  O   . HOH V 8 .   ? -21.309 19.791  -41.440 1.00 43.27  ? 2099 HOH A O   1 
HETATM 7861 O  O   . HOH V 8 .   ? -24.609 13.336  -29.186 1.00 46.53  ? 2100 HOH A O   1 
HETATM 7862 O  O   . HOH V 8 .   ? -25.261 13.191  -35.208 1.00 51.85  ? 2101 HOH A O   1 
HETATM 7863 O  O   . HOH V 8 .   ? -27.510 12.549  -32.284 1.00 46.86  ? 2102 HOH A O   1 
HETATM 7864 O  O   . HOH V 8 .   ? -25.558 10.821  -29.325 1.00 44.25  ? 2103 HOH A O   1 
HETATM 7865 O  O   . HOH V 8 .   ? -6.187  8.733   -32.409 1.00 23.14  ? 2104 HOH A O   1 
HETATM 7866 O  O   . HOH V 8 .   ? -5.826  10.749  -30.633 1.00 27.48  ? 2105 HOH A O   1 
HETATM 7867 O  O   . HOH V 8 .   ? -5.525  11.278  -26.529 1.00 24.33  ? 2106 HOH A O   1 
HETATM 7868 O  O   . HOH V 8 .   ? -3.733  12.478  -30.834 1.00 26.32  ? 2107 HOH A O   1 
HETATM 7869 O  O   . HOH V 8 .   ? -19.665 14.188  -24.621 1.00 48.40  ? 2108 HOH A O   1 
HETATM 7870 O  O   . HOH V 8 .   ? -18.835 1.386   -28.035 1.00 44.68  ? 2109 HOH A O   1 
HETATM 7871 O  O   . HOH V 8 .   ? -0.241  -3.524  -28.451 1.00 28.27  ? 2110 HOH A O   1 
HETATM 7872 O  O   . HOH V 8 .   ? -2.422  -4.126  -21.741 1.00 29.77  ? 2111 HOH A O   1 
HETATM 7873 O  O   . HOH V 8 .   ? 3.001   -0.452  -19.371 1.00 42.08  ? 2112 HOH A O   1 
HETATM 7874 O  O   . HOH V 8 .   ? -6.899  1.166   -15.063 1.00 36.77  ? 2113 HOH A O   1 
HETATM 7875 O  O   . HOH V 8 .   ? -13.757 0.583   -20.677 1.00 33.69  ? 2114 HOH A O   1 
HETATM 7876 O  O   . HOH V 8 .   ? -11.785 5.857   -17.903 1.00 29.99  ? 2115 HOH A O   1 
HETATM 7877 O  O   . HOH V 8 .   ? -11.775 7.490   -14.193 1.00 40.24  ? 2116 HOH A O   1 
HETATM 7878 O  O   . HOH V 8 .   ? -8.312  1.956   -13.042 1.00 41.69  ? 2117 HOH A O   1 
HETATM 7879 O  O   . HOH V 8 .   ? -4.198  -6.329  -22.271 1.00 47.36  ? 2118 HOH A O   1 
HETATM 7880 O  O   . HOH V 8 .   ? 8.974   -2.375  -28.912 1.00 45.82  ? 2119 HOH A O   1 
HETATM 7881 O  O   . HOH V 8 .   ? 5.668   1.790   -35.838 1.00 23.35  ? 2120 HOH A O   1 
HETATM 7882 O  O   . HOH V 8 .   ? 8.173   -0.097  -33.653 1.00 27.05  ? 2121 HOH A O   1 
HETATM 7883 O  O   . HOH V 8 .   ? 10.755  -2.508  -34.618 1.00 41.94  ? 2122 HOH A O   1 
HETATM 7884 O  O   . HOH V 8 .   ? 3.082   3.107   -35.496 1.00 27.83  ? 2123 HOH A O   1 
HETATM 7885 O  O   . HOH V 8 .   ? 1.852   5.655   -35.076 1.00 23.39  ? 2124 HOH A O   1 
HETATM 7886 O  O   . HOH V 8 .   ? 3.482   6.306   -26.305 1.00 34.89  ? 2125 HOH A O   1 
HETATM 7887 O  O   . HOH V 8 .   ? 2.656   3.498   -13.094 1.00 35.81  ? 2126 HOH A O   1 
HETATM 7888 O  O   . HOH V 8 .   ? -12.202 15.364  -13.841 1.00 50.52  ? 2127 HOH A O   1 
HETATM 7889 O  O   . HOH V 8 .   ? -18.978 -1.032  -27.314 1.00 50.18  ? 2128 HOH A O   1 
HETATM 7890 O  O   . HOH V 8 .   ? -13.258 -2.725  -24.174 1.00 41.43  ? 2129 HOH A O   1 
HETATM 7891 O  O   . HOH V 8 .   ? -14.612 -2.103  -21.686 1.00 47.49  ? 2130 HOH A O   1 
HETATM 7892 O  O   . HOH V 8 .   ? -10.822 -3.954  -25.200 1.00 37.15  ? 2131 HOH A O   1 
HETATM 7893 O  O   . HOH V 8 .   ? -7.629  -6.011  -29.778 1.00 49.97  ? 2132 HOH A O   1 
HETATM 7894 O  O   . HOH V 8 .   ? -2.598  -0.865  -31.560 1.00 28.89  ? 2133 HOH A O   1 
HETATM 7895 O  O   . HOH V 8 .   ? -0.748  -8.017  -32.791 1.00 35.28  ? 2134 HOH A O   1 
HETATM 7896 O  O   . HOH V 8 .   ? 0.382   -5.901  -30.056 1.00 28.95  ? 2135 HOH A O   1 
HETATM 7897 O  O   . HOH V 8 .   ? -0.334  -1.798  -30.444 1.00 27.04  ? 2136 HOH A O   1 
HETATM 7898 O  O   . HOH V 8 .   ? -9.514  -5.720  -35.662 1.00 37.63  ? 2137 HOH A O   1 
HETATM 7899 O  O   . HOH V 8 .   ? -4.674  -4.124  -44.740 1.00 39.08  ? 2138 HOH A O   1 
HETATM 7900 O  O   . HOH V 8 .   ? -1.814  0.001   -48.215 1.00 28.03  ? 2139 HOH A O   1 
HETATM 7901 O  O   . HOH V 8 .   ? -4.658  -3.074  -47.142 1.00 40.43  ? 2140 HOH A O   1 
HETATM 7902 O  O   . HOH V 8 .   ? -5.852  0.583   -53.543 1.00 33.86  ? 2141 HOH A O   1 
HETATM 7903 O  O   . HOH V 8 .   ? -10.867 9.371   -49.324 1.00 32.07  ? 2142 HOH A O   1 
HETATM 7904 O  O   . HOH V 8 .   ? -3.699  11.277  -47.780 1.00 27.68  ? 2143 HOH A O   1 
HETATM 7905 O  O   . HOH V 8 .   ? 0.714   11.922  -45.325 1.00 30.64  ? 2144 HOH A O   1 
HETATM 7906 O  O   . HOH V 8 .   ? -1.208  7.795   -36.740 1.00 25.75  ? 2145 HOH A O   1 
HETATM 7907 O  O   . HOH V 8 .   ? -11.533 -4.059  -35.997 1.00 36.01  ? 2146 HOH A O   1 
HETATM 7908 O  O   . HOH V 8 .   ? -25.760 6.926   -29.371 1.00 51.29  ? 2147 HOH A O   1 
HETATM 7909 O  O   . HOH V 8 .   ? 9.501   0.350   -47.295 1.00 42.62  ? 2148 HOH A O   1 
HETATM 7910 O  O   . HOH V 8 .   ? 12.955  -0.435  -40.268 1.00 54.82  ? 2149 HOH A O   1 
HETATM 7911 O  O   . HOH V 8 .   ? 5.258   0.544   -38.160 1.00 28.28  ? 2150 HOH A O   1 
HETATM 7912 O  O   . HOH V 8 .   ? 4.456   -0.398  -49.733 1.00 33.73  ? 2151 HOH A O   1 
HETATM 7913 O  O   . HOH V 8 .   ? 11.718  -2.197  -36.577 1.00 43.20  ? 2152 HOH A O   1 
HETATM 7914 O  O   . HOH V 8 .   ? 0.444   -19.944 -58.332 1.00 42.27  ? 2153 HOH A O   1 
HETATM 7915 O  O   . HOH V 8 .   ? 12.198  -21.848 -69.864 1.00 44.06  ? 2154 HOH A O   1 
HETATM 7916 O  O   . HOH V 8 .   ? 8.409   -24.925 -62.335 1.00 50.86  ? 2155 HOH A O   1 
HETATM 7917 O  O   . HOH V 8 .   ? 5.001   -20.841 -72.048 1.00 58.94  ? 2156 HOH A O   1 
HETATM 7918 O  O   . HOH V 8 .   ? 21.167  -17.328 -79.412 1.00 54.13  ? 2157 HOH A O   1 
HETATM 7919 O  O   . HOH V 8 .   ? 19.506  -11.291 -76.850 1.00 36.73  ? 2158 HOH A O   1 
HETATM 7920 O  O   . HOH V 8 .   ? 25.427  -15.206 -78.263 1.00 44.02  ? 2159 HOH A O   1 
HETATM 7921 O  O   . HOH V 8 .   ? 29.301  -12.325 -75.226 1.00 51.41  ? 2160 HOH A O   1 
HETATM 7922 O  O   . HOH V 8 .   ? 30.327  -9.578  -79.750 1.00 41.78  ? 2161 HOH A O   1 
HETATM 7923 O  O   . HOH V 8 .   ? 31.426  -1.542  -76.955 1.00 50.40  ? 2162 HOH A O   1 
HETATM 7924 O  O   . HOH V 8 .   ? 32.281  -4.789  -83.401 1.00 41.49  ? 2163 HOH A O   1 
HETATM 7925 O  O   . HOH V 8 .   ? 31.776  -0.679  -86.591 1.00 47.68  ? 2164 HOH A O   1 
HETATM 7926 O  O   . HOH V 8 .   ? 25.375  -2.505  -92.528 1.00 40.04  ? 2165 HOH A O   1 
HETATM 7927 O  O   . HOH V 8 .   ? 15.902  -7.225  -84.907 1.00 52.11  ? 2166 HOH A O   1 
HETATM 7928 O  O   . HOH V 8 .   ? 14.830  -2.180  -78.946 1.00 36.82  ? 2167 HOH A O   1 
HETATM 7929 O  O   . HOH V 8 .   ? 26.337  -3.143  -64.330 1.00 47.09  ? 2168 HOH A O   1 
HETATM 7930 O  O   . HOH V 8 .   ? 20.944  0.391   -74.613 1.00 41.18  ? 2169 HOH A O   1 
HETATM 7931 O  O   . HOH V 8 .   ? 20.859  1.144   -66.784 1.00 36.63  ? 2170 HOH A O   1 
HETATM 7932 O  O   . HOH V 8 .   ? 18.721  -0.375  -66.899 1.00 33.58  ? 2171 HOH A O   1 
HETATM 7933 O  O   . HOH V 8 .   ? 17.131  -3.006  -65.490 1.00 31.30  ? 2172 HOH A O   1 
HETATM 7934 O  O   . HOH V 8 .   ? 15.620  1.289   -59.625 1.00 34.35  ? 2173 HOH A O   1 
HETATM 7935 O  O   . HOH V 8 .   ? 19.585  -3.646  -59.863 1.00 45.19  ? 2174 HOH A O   1 
HETATM 7936 O  O   . HOH V 8 .   ? 21.312  -8.955  -59.504 1.00 40.58  ? 2175 HOH A O   1 
HETATM 7937 O  O   . HOH V 8 .   ? 18.802  -20.516 -62.584 1.00 55.17  ? 2176 HOH A O   1 
HETATM 7938 O  O   . HOH V 8 .   ? 11.421  -17.217 -55.778 1.00 36.86  ? 2177 HOH A O   1 
HETATM 7939 O  O   . HOH V 8 .   ? 7.578   -13.360 -53.651 1.00 53.85  ? 2178 HOH A O   1 
HETATM 7940 O  O   . HOH V 8 .   ? 5.835   -5.326  -61.846 1.00 45.04  ? 2179 HOH A O   1 
HETATM 7941 O  O   . HOH V 8 .   ? 4.516   -7.356  -57.431 1.00 42.44  ? 2180 HOH A O   1 
HETATM 7942 O  O   . HOH V 8 .   ? 14.820  -5.556  -58.920 1.00 38.64  ? 2181 HOH A O   1 
HETATM 7943 O  O   . HOH V 8 .   ? 9.900   -3.242  -64.626 1.00 25.68  ? 2182 HOH A O   1 
HETATM 7944 O  O   . HOH V 8 .   ? 4.445   -5.141  -54.408 1.00 46.22  ? 2183 HOH A O   1 
HETATM 7945 O  O   . HOH V 8 .   ? 3.557   -4.356  -59.897 1.00 36.43  ? 2184 HOH A O   1 
HETATM 7946 O  O   . HOH V 8 .   ? 13.063  2.834   -56.701 1.00 26.31  ? 2185 HOH A O   1 
HETATM 7947 O  O   . HOH V 8 .   ? 17.479  -2.659  -58.114 1.00 48.10  ? 2186 HOH A O   1 
HETATM 7948 O  O   . HOH V 8 .   ? 10.201  -4.310  -67.245 1.00 27.85  ? 2187 HOH A O   1 
HETATM 7949 O  O   . HOH V 8 .   ? 12.268  -3.821  -73.002 1.00 36.72  ? 2188 HOH A O   1 
HETATM 7950 O  O   . HOH V 8 .   ? 3.810   -7.485  -66.251 1.00 41.14  ? 2189 HOH A O   1 
HETATM 7951 O  O   . HOH V 8 .   ? 25.236  14.265  -24.999 1.00 42.14  ? 2190 HOH A O   1 
HETATM 7952 O  O   . HOH V 8 .   ? 23.742  -0.388  -61.954 1.00 53.67  ? 2191 HOH A O   1 
HETATM 7953 O  O   . HOH W 8 .   ? 2.873   10.658  -75.396 1.00 50.60  ? 2001 HOH B O   1 
HETATM 7954 O  O   . HOH W 8 .   ? -4.168  21.093  -50.412 1.00 49.38  ? 2002 HOH B O   1 
HETATM 7955 O  O   . HOH W 8 .   ? -9.521  23.282  -52.522 1.00 55.74  ? 2003 HOH B O   1 
HETATM 7956 O  O   . HOH W 8 .   ? 9.155   30.113  -44.410 1.00 33.69  ? 2004 HOH B O   1 
HETATM 7957 O  O   . HOH W 8 .   ? 10.706  37.392  -47.817 1.00 41.80  ? 2005 HOH B O   1 
HETATM 7958 O  O   . HOH W 8 .   ? 14.280  35.660  -46.690 1.00 42.94  ? 2006 HOH B O   1 
HETATM 7959 O  O   . HOH W 8 .   ? 10.796  38.072  -43.010 1.00 52.46  ? 2007 HOH B O   1 
HETATM 7960 O  O   . HOH W 8 .   ? 10.468  30.984  -41.487 1.00 37.98  ? 2008 HOH B O   1 
HETATM 7961 O  O   . HOH W 8 .   ? 14.212  2.258   -47.836 1.00 52.26  ? 2009 HOH B O   1 
HETATM 7962 O  O   . HOH W 8 .   ? 0.298   15.746  -47.632 1.00 45.48  ? 2010 HOH B O   1 
HETATM 7963 O  O   . HOH W 8 .   ? 5.153   11.985  -52.627 1.00 51.54  ? 2011 HOH B O   1 
HETATM 7964 O  O   . HOH W 8 .   ? 3.689   12.772  -54.094 1.00 31.61  ? 2012 HOH B O   1 
HETATM 7965 O  O   . HOH W 8 .   ? 5.822   14.318  -52.012 1.00 35.71  ? 2013 HOH B O   1 
HETATM 7966 O  O   . HOH W 8 .   ? 1.483   13.402  -55.826 1.00 32.36  ? 2014 HOH B O   1 
HETATM 7967 O  O   . HOH W 8 .   ? -5.346  12.931  -57.428 1.00 53.80  ? 2015 HOH B O   1 
HETATM 7968 O  O   . HOH W 8 .   ? -8.246  14.108  -69.548 1.00 42.50  ? 2016 HOH B O   1 
HETATM 7969 O  O   . HOH W 8 .   ? -2.741  7.881   -67.498 1.00 39.72  ? 2017 HOH B O   1 
HETATM 7970 O  O   . HOH W 8 .   ? 8.971   14.618  -64.518 1.00 48.89  ? 2018 HOH B O   1 
HETATM 7971 O  O   . HOH W 8 .   ? 7.839   13.451  -59.980 1.00 32.12  ? 2019 HOH B O   1 
HETATM 7972 O  O   . HOH W 8 .   ? 9.955   13.626  -58.368 1.00 34.09  ? 2020 HOH B O   1 
HETATM 7973 O  O   . HOH W 8 .   ? -4.148  2.752   -57.033 1.00 26.89  ? 2021 HOH B O   1 
HETATM 7974 O  O   . HOH W 8 .   ? -10.024 0.932   -55.299 1.00 48.60  ? 2022 HOH B O   1 
HETATM 7975 O  O   . HOH W 8 .   ? 24.041  25.269  -46.492 1.00 46.48  ? 2023 HOH B O   1 
HETATM 7976 O  O   . HOH W 8 .   ? 20.981  25.673  -43.055 1.00 40.03  ? 2024 HOH B O   1 
HETATM 7977 O  O   . HOH W 8 .   ? -5.992  1.143   -58.115 1.00 38.76  ? 2025 HOH B O   1 
HETATM 7978 O  O   . HOH W 8 .   ? -4.395  -0.754  -59.184 1.00 47.20  ? 2026 HOH B O   1 
HETATM 7979 O  O   . HOH W 8 .   ? 18.849  2.996   -65.069 1.00 26.40  ? 2027 HOH B O   1 
HETATM 7980 O  O   . HOH W 8 .   ? 19.261  5.105   -62.759 1.00 38.72  ? 2028 HOH B O   1 
HETATM 7981 O  O   . HOH W 8 .   ? 16.790  5.954   -55.879 1.00 34.72  ? 2029 HOH B O   1 
HETATM 7982 O  O   . HOH W 8 .   ? 18.085  12.162  -65.094 1.00 46.54  ? 2030 HOH B O   1 
HETATM 7983 O  O   . HOH W 8 .   ? 15.243  5.748   -52.328 1.00 38.64  ? 2031 HOH B O   1 
HETATM 7984 O  O   . HOH W 8 .   ? 11.988  3.197   -48.781 1.00 35.79  ? 2032 HOH B O   1 
HETATM 7985 O  O   . HOH W 8 .   ? 6.911   8.743   -50.944 1.00 30.14  ? 2033 HOH B O   1 
HETATM 7986 O  O   . HOH W 8 .   ? 12.700  4.943   -47.068 1.00 31.39  ? 2034 HOH B O   1 
HETATM 7987 O  O   . HOH W 8 .   ? 11.668  0.057   -51.028 1.00 52.95  ? 2035 HOH B O   1 
HETATM 7988 O  O   . HOH W 8 .   ? -2.722  -2.342  -51.690 1.00 50.40  ? 2036 HOH B O   1 
HETATM 7989 O  O   . HOH W 8 .   ? 13.096  5.601   -68.660 1.00 33.77  ? 2037 HOH B O   1 
HETATM 7990 O  O   . HOH W 8 .   ? 17.885  10.430  -70.558 1.00 60.09  ? 2038 HOH B O   1 
HETATM 7991 O  O   . HOH W 8 .   ? 20.157  -5.166  0.253   1.00 45.00  ? 2039 HOH B O   1 
HETATM 7992 O  O   . HOH W 8 .   ? 12.994  8.134   -70.706 1.00 55.81  ? 2040 HOH B O   1 
HETATM 7993 O  O   . HOH W 8 .   ? 14.027  -1.989  -76.580 1.00 41.21  ? 2041 HOH B O   1 
HETATM 7994 O  O   . HOH W 8 .   ? -4.969  6.243   -74.318 1.00 49.60  ? 2042 HOH B O   1 
HETATM 7995 O  O   . HOH W 8 .   ? -1.691  11.061  -75.698 1.00 52.08  ? 2043 HOH B O   1 
HETATM 7996 O  O   . HOH W 8 .   ? 1.948   19.861  -63.691 1.00 33.07  ? 2044 HOH B O   1 
HETATM 7997 O  O   . HOH W 8 .   ? 7.245   23.984  -60.606 1.00 37.97  ? 2045 HOH B O   1 
HETATM 7998 O  O   . HOH W 8 .   ? 9.146   24.493  -59.003 1.00 33.92  ? 2046 HOH B O   1 
HETATM 7999 O  O   . HOH W 8 .   ? 6.678   23.828  -64.850 1.00 31.05  ? 2047 HOH B O   1 
HETATM 8000 O  O   . HOH W 8 .   ? 5.517   22.006  -60.475 1.00 34.41  ? 2048 HOH B O   1 
HETATM 8001 O  O   . HOH W 8 .   ? 21.568  18.940  -62.942 1.00 31.63  ? 2049 HOH B O   1 
HETATM 8002 O  O   . HOH W 8 .   ? 22.151  21.020  -69.723 1.00 42.92  ? 2050 HOH B O   1 
HETATM 8003 O  O   . HOH W 8 .   ? 17.047  32.349  -70.811 1.00 41.58  ? 2051 HOH B O   1 
HETATM 8004 O  O   . HOH W 8 .   ? 12.046  30.213  -73.409 1.00 47.64  ? 2052 HOH B O   1 
HETATM 8005 O  O   . HOH W 8 .   ? 19.515  10.759  -64.938 1.00 71.16  ? 2053 HOH B O   1 
HETATM 8006 O  O   . HOH W 8 .   ? 18.284  10.319  -57.854 1.00 30.60  ? 2054 HOH B O   1 
HETATM 8007 O  O   . HOH W 8 .   ? 16.347  12.763  -55.691 1.00 29.64  ? 2055 HOH B O   1 
HETATM 8008 O  O   . HOH W 8 .   ? 15.013  15.277  -55.887 1.00 31.32  ? 2056 HOH B O   1 
HETATM 8009 O  O   . HOH W 8 .   ? 12.419  16.605  -56.329 1.00 32.45  ? 2057 HOH B O   1 
HETATM 8010 O  O   . HOH W 8 .   ? 11.915  14.732  -65.067 1.00 40.79  ? 2058 HOH B O   1 
HETATM 8011 O  O   . HOH W 8 .   ? 12.691  10.733  -71.072 1.00 39.07  ? 2059 HOH B O   1 
HETATM 8012 O  O   . HOH W 8 .   ? 20.607  31.801  -66.984 1.00 48.45  ? 2060 HOH B O   1 
HETATM 8013 O  O   . HOH W 8 .   ? 18.888  21.069  -59.907 1.00 32.46  ? 2061 HOH B O   1 
HETATM 8014 O  O   . HOH W 8 .   ? 26.102  19.220  -58.624 1.00 36.72  ? 2062 HOH B O   1 
HETATM 8015 O  O   . HOH W 8 .   ? 23.798  18.328  -61.517 1.00 34.65  ? 2063 HOH B O   1 
HETATM 8016 O  O   . HOH W 8 .   ? 19.817  18.776  -60.888 1.00 32.52  ? 2064 HOH B O   1 
HETATM 8017 O  O   . HOH W 8 .   ? 23.688  28.055  -55.644 1.00 45.00  ? 2065 HOH B O   1 
HETATM 8018 O  O   . HOH W 8 .   ? 22.179  23.082  -46.679 1.00 34.49  ? 2066 HOH B O   1 
HETATM 8019 O  O   . HOH W 8 .   ? 20.901  23.234  -44.236 1.00 37.24  ? 2067 HOH B O   1 
HETATM 8020 O  O   . HOH W 8 .   ? 20.051  18.387  -43.565 1.00 42.64  ? 2068 HOH B O   1 
HETATM 8021 O  O   . HOH W 8 .   ? 23.450  20.655  -46.920 1.00 38.50  ? 2069 HOH B O   1 
HETATM 8022 O  O   . HOH W 8 .   ? 24.209  19.920  -44.560 1.00 49.42  ? 2070 HOH B O   1 
HETATM 8023 O  O   . HOH W 8 .   ? 6.087   17.455  -46.163 1.00 30.25  ? 2071 HOH B O   1 
HETATM 8024 O  O   . HOH W 8 .   ? 10.173  19.524  -54.681 1.00 29.24  ? 2072 HOH B O   1 
HETATM 8025 O  O   . HOH W 8 .   ? 22.026  30.070  -55.427 1.00 42.65  ? 2073 HOH B O   1 
HETATM 8026 O  O   . HOH W 8 .   ? 17.726  13.172  -53.279 1.00 29.55  ? 2074 HOH B O   1 
HETATM 8027 O  O   . HOH W 8 .   ? 29.445  -1.425  -14.331 1.00 42.38  ? 2075 HOH B O   1 
HETATM 8028 O  O   . HOH W 8 .   ? 27.912  -12.147 -11.777 1.00 44.25  ? 2076 HOH B O   1 
HETATM 8029 O  O   . HOH W 8 .   ? 23.135  -14.690 -8.475  1.00 45.45  ? 2077 HOH B O   1 
HETATM 8030 O  O   . HOH W 8 .   ? 20.296  2.765   -3.649  1.00 31.54  ? 2078 HOH B O   1 
HETATM 8031 O  O   . HOH W 8 .   ? 21.433  -3.656  -1.304  1.00 49.94  ? 2079 HOH B O   1 
HETATM 8032 O  O   . HOH W 8 .   ? 20.125  2.857   -12.271 1.00 37.75  ? 2080 HOH B O   1 
HETATM 8033 O  O   . HOH W 8 .   ? 22.001  -8.120  -27.173 1.00 45.59  ? 2081 HOH B O   1 
HETATM 8034 O  O   . HOH W 8 .   ? 17.516  -3.039  -17.230 1.00 42.57  ? 2082 HOH B O   1 
HETATM 8035 O  O   . HOH W 8 .   ? 10.756  -4.193  -16.386 1.00 40.18  ? 2083 HOH B O   1 
HETATM 8036 O  O   . HOH W 8 .   ? 16.055  -5.753  -24.529 1.00 40.48  ? 2084 HOH B O   1 
HETATM 8037 O  O   . HOH W 8 .   ? 17.273  -2.732  -24.784 1.00 40.05  ? 2085 HOH B O   1 
HETATM 8038 O  O   . HOH W 8 .   ? 22.013  -4.334  -29.799 1.00 48.64  ? 2086 HOH B O   1 
HETATM 8039 O  O   . HOH W 8 .   ? 22.018  -1.077  -31.609 1.00 37.63  ? 2087 HOH B O   1 
HETATM 8040 O  O   . HOH W 8 .   ? 27.800  -2.763  -31.939 1.00 40.74  ? 2088 HOH B O   1 
HETATM 8041 O  O   . HOH W 8 .   ? 33.471  -2.139  -32.489 1.00 56.43  ? 2089 HOH B O   1 
HETATM 8042 O  O   . HOH W 8 .   ? 40.125  -0.436  -35.211 1.00 63.50  ? 2090 HOH B O   1 
HETATM 8043 O  O   . HOH W 8 .   ? 35.585  7.594   -35.083 1.00 38.39  ? 2091 HOH B O   1 
HETATM 8044 O  O   . HOH W 8 .   ? 29.114  8.337   -37.728 1.00 48.63  ? 2092 HOH B O   1 
HETATM 8045 O  O   . HOH W 8 .   ? 25.316  14.011  -33.752 1.00 38.36  ? 2093 HOH B O   1 
HETATM 8046 O  O   . HOH W 8 .   ? 23.674  6.736   -35.680 1.00 52.54  ? 2094 HOH B O   1 
HETATM 8047 O  O   . HOH W 8 .   ? 24.148  3.716   -32.506 1.00 34.46  ? 2095 HOH B O   1 
HETATM 8048 O  O   . HOH W 8 .   ? 23.410  13.892  -36.910 1.00 50.37  ? 2096 HOH B O   1 
HETATM 8049 O  O   . HOH W 8 .   ? 21.218  0.855   -33.421 1.00 43.28  ? 2097 HOH B O   1 
HETATM 8050 O  O   . HOH W 8 .   ? 22.508  8.082   -24.117 1.00 26.40  ? 2098 HOH B O   1 
HETATM 8051 O  O   . HOH W 8 .   ? 21.823  5.889   -18.320 1.00 35.99  ? 2099 HOH B O   1 
HETATM 8052 O  O   . HOH W 8 .   ? 37.555  -4.438  -25.924 1.00 57.26  ? 2100 HOH B O   1 
HETATM 8053 O  O   . HOH W 8 .   ? 22.073  9.816   -21.084 1.00 57.32  ? 2101 HOH B O   1 
HETATM 8054 O  O   . HOH W 8 .   ? -5.703  18.976  -79.039 1.00 61.41  ? 2102 HOH B O   1 
HETATM 8055 O  O   . HOH W 8 .   ? 12.026  11.582  -65.729 1.00 49.62  ? 2103 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
23   N N   . ARG A 67  ? 0.7518 0.8301 0.5742 0.2032  -0.0532 -0.0998 45  ARG A N   
24   C CA  A ARG A 67  ? 0.7061 0.7580 0.5243 0.2040  -0.0212 -0.0749 45  ARG A CA  
25   C CA  B ARG A 67  ? 0.7053 0.7579 0.5252 0.2034  -0.0214 -0.0753 45  ARG A CA  
26   C C   . ARG A 67  ? 0.6281 0.6573 0.4563 0.1749  0.0033  -0.0752 45  ARG A C   
27   O O   . ARG A 67  ? 0.6268 0.6467 0.4370 0.1664  0.0033  -0.0830 45  ARG A O   
28   C CB  A ARG A 67  ? 0.7509 0.7789 0.5105 0.2340  -0.0106 -0.0534 45  ARG A CB  
29   C CB  B ARG A 67  ? 0.7499 0.7797 0.5141 0.2339  -0.0106 -0.0529 45  ARG A CB  
30   C CG  A ARG A 67  ? 0.7911 0.8393 0.5375 0.2682  -0.0306 -0.0449 45  ARG A CG  
31   C CG  B ARG A 67  ? 0.7753 0.7793 0.4859 0.2394  -0.0038 -0.0521 45  ARG A CG  
32   C CD  A ARG A 67  ? 0.8428 0.8644 0.5187 0.3015  -0.0220 -0.0253 45  ARG A CD  
33   C CD  B ARG A 67  ? 0.8328 0.8184 0.4871 0.2767  0.0027  -0.0306 45  ARG A CD  
34   N NE  A ARG A 67  ? 0.8323 0.8123 0.4963 0.3000  0.0218  -0.0016 45  ARG A NE  
35   N NE  B ARG A 67  ? 0.8752 0.8291 0.4743 0.2858  0.0161  -0.0259 45  ARG A NE  
36   C CZ  A ARG A 67  ? 0.8258 0.7946 0.4987 0.3139  0.0435  0.0206  45  ARG A CZ  
37   C CZ  B ARG A 67  ? 0.8816 0.7967 0.4619 0.2877  0.0540  -0.0061 45  ARG A CZ  
38   N NH1 A ARG A 67  ? 0.8382 0.8355 0.5308 0.3328  0.0248  0.0251  45  ARG A NH1 
39   N NH1 B ARG A 67  ? 0.8526 0.7566 0.4640 0.2789  0.0803  0.0082  45  ARG A NH1 
40   N NH2 A ARG A 67  ? 0.8188 0.7485 0.4846 0.3090  0.0847  0.0376  45  ARG A NH2 
41   N NH2 B ARG A 67  ? 0.9216 0.8078 0.4545 0.2975  0.0673  -0.0021 45  ARG A NH2 
42   N N   . PRO A 68  ? 0.5634 0.5836 0.4194 0.1606  0.0242  -0.0669 46  PRO A N   
43   C CA  . PRO A 68  ? 0.5099 0.5136 0.3744 0.1339  0.0423  -0.0688 46  PRO A CA  
44   C C   . PRO A 68  ? 0.5164 0.4910 0.3483 0.1352  0.0647  -0.0551 46  PRO A C   
45   O O   . PRO A 68  ? 0.4815 0.4462 0.3220 0.1147  0.0774  -0.0562 46  PRO A O   
46   C CB  . PRO A 68  ? 0.4883 0.4916 0.3871 0.1211  0.0555  -0.0662 46  PRO A CB  
47   C CG  . PRO A 68  ? 0.5157 0.5188 0.4112 0.1438  0.0594  -0.0527 46  PRO A CG  
48   C CD  . PRO A 68  ? 0.5468 0.5711 0.4267 0.1681  0.0324  -0.0563 46  PRO A CD  
49   N N   . ASP A 69  ? 0.5496 0.5116 0.3465 0.1603  0.0695  -0.0422 47  ASP A N   
50   C CA  . ASP A 69  ? 0.5774 0.5093 0.3467 0.1645  0.0947  -0.0286 47  ASP A CA  
51   C C   . ASP A 69  ? 0.6230 0.5455 0.3497 0.1822  0.0895  -0.0276 47  ASP A C   
52   O O   . ASP A 69  ? 0.6582 0.5529 0.3580 0.1934  0.1128  -0.0133 47  ASP A O   
53   C CB  . ASP A 69  ? 0.6034 0.5155 0.3660 0.1799  0.1188  -0.0096 47  ASP A CB  
54   C CG  . ASP A 69  ? 0.6529 0.5692 0.3866 0.2157  0.1081  0.0016  47  ASP A CG  
55   O OD1 . ASP A 69  ? 0.6674 0.6100 0.3960 0.2251  0.0764  -0.0097 47  ASP A OD1 
56   O OD2 . ASP A 69  ? 0.6813 0.5759 0.3995 0.2353  0.1312  0.0214  47  ASP A OD2 
57   N N   . ALA A 70  ? 0.6303 0.5721 0.3508 0.1840  0.0624  -0.0438 48  ALA A N   
58   C CA  . ALA A 70  ? 0.6736 0.6020 0.3477 0.2001  0.0590  -0.0452 48  ALA A CA  
59   C C   . ALA A 70  ? 0.6726 0.5782 0.3471 0.1853  0.0835  -0.0408 48  ALA A C   
60   O O   . ALA A 70  ? 0.6410 0.5547 0.3552 0.1591  0.0877  -0.0461 48  ALA A O   
61   C CB  . ALA A 70  ? 0.6780 0.6311 0.3514 0.1992  0.0266  -0.0687 48  ALA A CB  
62   N N   . PRO A 71  ? 0.7021 0.5789 0.3327 0.2037  0.1005  -0.0300 49  PRO A N   
63   C CA  . PRO A 71  ? 0.6943 0.5511 0.3326 0.1910  0.1254  -0.0249 49  PRO A CA  
64   C C   . PRO A 71  ? 0.6576 0.5300 0.3190 0.1700  0.1120  -0.0420 49  PRO A C   
65   O O   . PRO A 71  ? 0.6616 0.5436 0.3058 0.1749  0.0908  -0.0574 49  PRO A O   
66   C CB  . PRO A 71  ? 0.7641 0.5865 0.3443 0.2192  0.1434  -0.0127 49  PRO A CB  
67   C CG  . PRO A 71  ? 0.8105 0.6305 0.3543 0.2481  0.1360  -0.0033 49  PRO A CG  
68   C CD  . PRO A 71  ? 0.7690 0.6287 0.3430 0.2390  0.1017  -0.0182 49  PRO A CD  
69   N N   . SER A 72  ? 0.6268 0.5014 0.3269 0.1478  0.1253  -0.0397 50  SER A N   
70   C CA  . SER A 72  ? 0.6111 0.4983 0.3351 0.1302  0.1173  -0.0512 50  SER A CA  
71   C C   . SER A 72  ? 0.6586 0.5266 0.3500 0.1418  0.1238  -0.0539 50  SER A C   
72   O O   . SER A 72  ? 0.7080 0.5490 0.3728 0.1559  0.1461  -0.0413 50  SER A O   
73   C CB  . SER A 72  ? 0.5803 0.4732 0.3474 0.1092  0.1309  -0.0443 50  SER A CB  
74   O OG  . SER A 72  ? 0.5492 0.4534 0.3372 0.0964  0.1247  -0.0516 50  SER A OG  
75   N N   . ARG A 73  ? 0.6726 0.5508 0.3656 0.1360  0.1078  -0.0709 51  ARG A N   
76   C CA  . ARG A 73  ? 0.7181 0.5755 0.3830 0.1434  0.1167  -0.0762 51  ARG A CA  
77   C C   . ARG A 73  ? 0.6807 0.5384 0.3843 0.1265  0.1323  -0.0720 51  ARG A C   
78   O O   . ARG A 73  ? 0.6704 0.5109 0.3598 0.1297  0.1428  -0.0765 51  ARG A O   
79   C CB  . ARG A 73  ? 0.7692 0.6341 0.4107 0.1480  0.0922  -0.1002 51  ARG A CB  
80   C CG  . ARG A 73  ? 0.8200 0.6870 0.4179 0.1697  0.0733  -0.1047 51  ARG A CG  
81   C CD  . ARG A 73  ? 0.8347 0.7267 0.4367 0.1661  0.0405  -0.1327 51  ARG A CD  
82   N NE  . ARG A 73  ? 0.7934 0.7166 0.4566 0.1454  0.0289  -0.1383 51  ARG A NE  
83   C CZ  . ARG A 73  ? 0.8036 0.7532 0.4915 0.1378  0.0040  -0.1613 51  ARG A CZ  
84   N NH1 . ARG A 73  ? 0.8533 0.8071 0.5120 0.1477  -0.0171 -0.1842 51  ARG A NH1 
85   N NH2 . ARG A 73  ? 0.7582 0.7296 0.5008 0.1202  0.0006  -0.1626 51  ARG A NH2 
86   N N   . CYS A 74  ? 0.6210 0.4974 0.3712 0.1100  0.1340  -0.0633 52  CYS A N   
87   C CA  . CYS A 74  ? 0.5922 0.4736 0.3808 0.0970  0.1466  -0.0559 52  CYS A CA  
88   C C   . CYS A 74  ? 0.6149 0.4728 0.3982 0.1057  0.1745  -0.0416 52  CYS A C   
89   O O   . CYS A 74  ? 0.6289 0.4744 0.4020 0.1135  0.1876  -0.0312 52  CYS A O   
90   C CB  . CYS A 74  ? 0.5473 0.4541 0.3786 0.0803  0.1400  -0.0498 52  CYS A CB  
91   S SG  . CYS A 74  ? 0.5224 0.4434 0.4013 0.0674  0.1491  -0.0391 52  CYS A SG  
92   N N   . THR A 75  ? 0.6217 0.4714 0.4149 0.1049  0.1871  -0.0405 53  THR A N   
93   C CA  . THR A 75  ? 0.6460 0.4724 0.4409 0.1132  0.2173  -0.0264 53  THR A CA  
94   C C   . THR A 75  ? 0.6014 0.4493 0.4590 0.1000  0.2258  -0.0130 53  THR A C   
95   O O   . THR A 75  ? 0.6013 0.4359 0.4757 0.1045  0.2507  -0.0017 53  THR A O   
96   C CB  . THR A 75  ? 0.6977 0.4949 0.4590 0.1241  0.2308  -0.0334 53  THR A CB  
97   O OG1 . THR A 75  ? 0.6802 0.4926 0.4677 0.1126  0.2216  -0.0422 53  THR A OG1 
98   C CG2 . THR A 75  ? 0.7440 0.5197 0.4367 0.1402  0.2210  -0.0475 53  THR A CG2 
99   N N   . TRP A 76  ? 0.5473 0.4287 0.4394 0.0847  0.2054  -0.0140 54  TRP A N   
100  C CA  . TRP A 76  ? 0.5167 0.4225 0.4640 0.0739  0.2087  -0.0020 54  TRP A CA  
101  C C   . TRP A 76  ? 0.5386 0.4342 0.5004 0.0766  0.2300  0.0076  54  TRP A C   
102  O O   . TRP A 76  ? 0.5563 0.4364 0.4914 0.0815  0.2342  0.0054  54  TRP A O   
103  C CB  . TRP A 76  ? 0.4758 0.4138 0.4434 0.0592  0.1836  -0.0058 54  TRP A CB  
104  C CG  . TRP A 76  ? 0.4484 0.4163 0.4692 0.0483  0.1811  0.0040  54  TRP A CG  
105  C CD1 . TRP A 76  ? 0.4357 0.4260 0.4891 0.0454  0.1752  0.0118  54  TRP A CD1 
106  C CD2 . TRP A 76  ? 0.4407 0.4206 0.4882 0.0395  0.1830  0.0056  54  TRP A CD2 
107  N NE1 . TRP A 76  ? 0.4245 0.4444 0.5219 0.0361  0.1688  0.0179  54  TRP A NE1 
108  C CE2 . TRP A 76  ? 0.4186 0.4326 0.5153 0.0305  0.1735  0.0120  54  TRP A CE2 
109  C CE3 . TRP A 76  ? 0.4463 0.4111 0.4822 0.0388  0.1926  0.0017  54  TRP A CE3 
110  C CZ2 . TRP A 76  ? 0.4062 0.4426 0.5431 0.0183  0.1706  0.0108  54  TRP A CZ2 
111  C CZ3 . TRP A 76  ? 0.4422 0.4241 0.5190 0.0262  0.1949  0.0014  54  TRP A CZ3 
112  C CH2 . TRP A 76  ? 0.4219 0.4406 0.5500 0.0148  0.1826  0.0040  54  TRP A CH2 
113  N N   . GLN A 77  ? 0.5304 0.4364 0.5404 0.0735  0.2444  0.0189  55  GLN A N   
114  C CA  . GLN A 77  ? 0.5706 0.4737 0.6124 0.0718  0.2647  0.0265  55  GLN A CA  
115  C C   . GLN A 77  ? 0.5267 0.4701 0.6398 0.0588  0.2575  0.0331  55  GLN A C   
116  O O   . GLN A 77  ? 0.5136 0.4714 0.6445 0.0603  0.2520  0.0386  55  GLN A O   
117  C CB  . GLN A 77  ? 0.6536 0.5143 0.6734 0.0895  0.3008  0.0348  55  GLN A CB  
118  C CG  . GLN A 77  ? 0.7333 0.5706 0.7596 0.0946  0.3304  0.0415  55  GLN A CG  
119  C CD  . GLN A 77  ? 0.8144 0.6069 0.8184 0.1139  0.3697  0.0520  55  GLN A CD  
120  O OE1 . GLN A 77  ? 0.8549 0.6477 0.9112 0.1132  0.3952  0.0629  55  GLN A OE1 
121  N NE2 . GLN A 77  ? 0.8585 0.6133 0.7846 0.1318  0.3738  0.0480  55  GLN A NE2 
122  N N   . LEU A 78  ? 0.5181 0.4803 0.6739 0.0470  0.2582  0.0321  56  LEU A N   
123  C CA  . LEU A 78  ? 0.4981 0.5054 0.7235 0.0346  0.2456  0.0358  56  LEU A CA  
124  C C   . LEU A 78  ? 0.5060 0.5095 0.7711 0.0442  0.2706  0.0504  56  LEU A C   
125  O O   . LEU A 78  ? 0.5297 0.5026 0.7995 0.0518  0.3045  0.0556  56  LEU A O   
126  C CB  . LEU A 78  ? 0.4888 0.5161 0.7568 0.0181  0.2432  0.0274  56  LEU A CB  
127  C CG  . LEU A 78  ? 0.4780 0.5590 0.8199 0.0049  0.2239  0.0280  56  LEU A CG  
128  C CD1 . LEU A 78  ? 0.4602 0.5747 0.7875 0.0012  0.1849  0.0262  56  LEU A CD1 
129  C CD2 . LEU A 78  ? 0.4844 0.5822 0.8725 -0.0134 0.2250  0.0148  56  LEU A CD2 
130  N N   . GLY A 79  ? 0.4859 0.5175 0.7786 0.0457  0.2570  0.0587  57  GLY A N   
131  C CA  . GLY A 79  ? 0.5065 0.5347 0.8386 0.0565  0.2818  0.0745  57  GLY A CA  
132  C C   . GLY A 79  ? 0.5213 0.5237 0.8109 0.0703  0.2890  0.0797  57  GLY A C   
133  O O   . GLY A 79  ? 0.5067 0.5143 0.8313 0.0785  0.3028  0.0937  57  GLY A O   
134  N N   . ARG A 80  ? 0.5331 0.5082 0.7519 0.0726  0.2810  0.0677  58  ARG A N   
135  C CA  . ARG A 80  ? 0.5556 0.5096 0.7379 0.0820  0.2846  0.0673  58  ARG A CA  
136  C C   . ARG A 80  ? 0.5261 0.5168 0.7364 0.0786  0.2619  0.0738  58  ARG A C   
137  O O   . ARG A 80  ? 0.4838 0.5030 0.6933 0.0688  0.2323  0.0683  58  ARG A O   
138  C CB  . ARG A 80  ? 0.5873 0.5118 0.6960 0.0836  0.2761  0.0500  58  ARG A CB  
139  C CG  . ARG A 80  ? 0.6623 0.5429 0.7271 0.0938  0.3005  0.0457  58  ARG A CG  
140  C CD  . ARG A 80  ? 0.7108 0.5664 0.7044 0.0987  0.2892  0.0287  58  ARG A CD  
141  N NE  . ARG A 80  ? 0.7586 0.5930 0.7304 0.1054  0.2985  0.0238  58  ARG A NE  
142  C CZ  . ARG A 80  ? 0.8008 0.6048 0.7113 0.1128  0.2978  0.0075  58  ARG A CZ  
143  N NH1 . ARG A 80  ? 0.8021 0.5949 0.6653 0.1173  0.2869  -0.0024 58  ARG A NH1 
144  N NH2 . ARG A 80  ? 0.8447 0.6294 0.7420 0.1162  0.3084  0.0005  58  ARG A NH2 
145  N N   . PRO A 81  ? 0.5337 0.5195 0.7646 0.0884  0.2787  0.0865  59  PRO A N   
146  C CA  . PRO A 81  ? 0.5047 0.5217 0.7606 0.0895  0.2616  0.0969  59  PRO A CA  
147  C C   . PRO A 81  ? 0.4846 0.4959 0.6930 0.0849  0.2416  0.0837  59  PRO A C   
148  O O   . PRO A 81  ? 0.4804 0.4572 0.6386 0.0844  0.2476  0.0672  59  PRO A O   
149  C CB  . PRO A 81  ? 0.5321 0.5302 0.8095 0.1032  0.2929  0.1118  59  PRO A CB  
150  C CG  . PRO A 81  ? 0.5598 0.5167 0.8223 0.1083  0.3259  0.1080  59  PRO A CG  
151  C CD  . PRO A 81  ? 0.5551 0.5061 0.7916 0.1002  0.3174  0.0944  59  PRO A CD  
152  N N   . ALA A 82  ? 0.4706 0.5161 0.6958 0.0826  0.2183  0.0911  60  ALA A N   
153  C CA  . ALA A 82  ? 0.4862 0.5266 0.6742 0.0792  0.2033  0.0816  60  ALA A CA  
154  C C   . ALA A 82  ? 0.4953 0.5000 0.6625 0.0862  0.2256  0.0777  60  ALA A C   
155  O O   . ALA A 82  ? 0.4926 0.4800 0.6236 0.0811  0.2201  0.0610  60  ALA A O   
156  C CB  . ALA A 82  ? 0.4824 0.5618 0.6917 0.0801  0.1805  0.0951  60  ALA A CB  
157  N N   . SER A 83  ? 0.5069 0.5002 0.7005 0.0969  0.2520  0.0914  61  SER A N   
158  C CA  . SER A 83  ? 0.5417 0.4964 0.7177 0.1022  0.2781  0.0851  61  SER A CA  
159  C C   . SER A 83  ? 0.5625 0.4785 0.6871 0.0969  0.2846  0.0579  61  SER A C   
160  O O   . SER A 83  ? 0.5931 0.4806 0.6959 0.0967  0.2972  0.0438  61  SER A O   
161  C CB  . SER A 83  ? 0.5632 0.5100 0.7783 0.1152  0.3090  0.1055  61  SER A CB  
162  O OG  . SER A 83  ? 0.5764 0.5204 0.8060 0.1171  0.3205  0.1094  61  SER A OG  
163  N N   . GLU A 84  ? 0.5482 0.4640 0.6532 0.0930  0.2753  0.0496  62  GLU A N   
164  C CA  . GLU A 84  ? 0.5593 0.4415 0.6107 0.0918  0.2781  0.0263  62  GLU A CA  
165  C C   . GLU A 84  ? 0.5477 0.4375 0.5682 0.0827  0.2506  0.0073  62  GLU A C   
166  O O   . GLU A 84  ? 0.5709 0.4379 0.5479 0.0829  0.2482  -0.0130 62  GLU A O   
167  C CB  . GLU A 84  ? 0.5841 0.4536 0.6267 0.0969  0.2903  0.0301  62  GLU A CB  
168  C CG  . GLU A 84  ? 0.6084 0.4602 0.6783 0.1072  0.3249  0.0459  62  GLU A CG  
169  C CD  . GLU A 84  ? 0.6266 0.4580 0.6888 0.1139  0.3454  0.0507  62  GLU A CD  
170  O OE1 . GLU A 84  ? 0.6415 0.4722 0.6786 0.1117  0.3345  0.0438  62  GLU A OE1 
171  O OE2 . GLU A 84  ? 0.6556 0.4692 0.7398 0.1227  0.3768  0.0633  62  GLU A OE2 
172  N N   . SER A 85  ? 0.5072 0.4282 0.5480 0.0760  0.2299  0.0132  63  SER A N   
173  C CA  . SER A 85  ? 0.4931 0.4197 0.5087 0.0678  0.2073  -0.0036 63  SER A CA  
174  C C   . SER A 85  ? 0.5084 0.4148 0.5073 0.0659  0.2117  -0.0228 63  SER A C   
175  O O   . SER A 85  ? 0.5055 0.4056 0.5248 0.0678  0.2268  -0.0175 63  SER A O   
176  C CB  . SER A 85  ? 0.4619 0.4210 0.4989 0.0617  0.1880  0.0068  63  SER A CB  
177  O OG  . SER A 85  ? 0.4506 0.4104 0.4654 0.0544  0.1714  -0.0094 63  SER A OG  
178  N N   . PRO A 86  ? 0.5231 0.4210 0.4889 0.0624  0.1983  -0.0454 64  PRO A N   
179  C CA  . PRO A 86  ? 0.5377 0.4225 0.4961 0.0579  0.1987  -0.0678 64  PRO A CA  
180  C C   . PRO A 86  ? 0.5104 0.4145 0.4854 0.0492  0.1834  -0.0713 64  PRO A C   
181  O O   . PRO A 86  ? 0.5173 0.4149 0.4943 0.0435  0.1820  -0.0915 64  PRO A O   
182  C CB  . PRO A 86  ? 0.5693 0.4395 0.4835 0.0610  0.1888  -0.0898 64  PRO A CB  
183  C CG  . PRO A 86  ? 0.5481 0.4336 0.4515 0.0635  0.1744  -0.0786 64  PRO A CG  
184  C CD  . PRO A 86  ? 0.5286 0.4257 0.4632 0.0645  0.1856  -0.0518 64  PRO A CD  
185  N N   . HIS A 87  ? 0.4826 0.4091 0.4704 0.0479  0.1733  -0.0534 65  HIS A N   
186  C CA  . HIS A 87  ? 0.4678 0.4081 0.4640 0.0407  0.1608  -0.0564 65  HIS A CA  
187  C C   . HIS A 87  ? 0.4627 0.4042 0.4854 0.0413  0.1739  -0.0431 65  HIS A C   
188  O O   . HIS A 87  ? 0.4576 0.3959 0.4953 0.0482  0.1895  -0.0265 65  HIS A O   
189  C CB  . HIS A 87  ? 0.4457 0.4052 0.4342 0.0385  0.1435  -0.0475 65  HIS A CB  
190  C CG  . HIS A 87  ? 0.4511 0.4069 0.4139 0.0400  0.1341  -0.0576 65  HIS A CG  
191  N ND1 . HIS A 87  ? 0.4547 0.4065 0.4005 0.0388  0.1231  -0.0775 65  HIS A ND1 
192  C CD2 . HIS A 87  ? 0.4470 0.4021 0.4001 0.0445  0.1358  -0.0493 65  HIS A CD2 
193  C CE1 . HIS A 87  ? 0.4692 0.4168 0.3902 0.0446  0.1182  -0.0789 65  HIS A CE1 
194  N NE2 . HIS A 87  ? 0.4696 0.4167 0.3944 0.0477  0.1279  -0.0621 65  HIS A NE2 
195  N N   . HIS A 88  ? 0.4525 0.3968 0.4812 0.0358  0.1700  -0.0493 66  HIS A N   
196  C CA  . HIS A 88  ? 0.4704 0.4167 0.5154 0.0389  0.1806  -0.0316 66  HIS A CA  
197  C C   . HIS A 88  ? 0.4570 0.4250 0.4934 0.0417  0.1658  -0.0110 66  HIS A C   
198  O O   . HIS A 88  ? 0.4225 0.4008 0.4434 0.0359  0.1480  -0.0178 66  HIS A O   
199  C CB  . HIS A 88  ? 0.4764 0.4154 0.5295 0.0321  0.1839  -0.0452 66  HIS A CB  
200  C CG  . HIS A 88  ? 0.4997 0.4334 0.5645 0.0380  0.2004  -0.0258 66  HIS A CG  
201  N ND1 . HIS A 88  ? 0.5177 0.4377 0.6000 0.0467  0.2253  -0.0121 66  HIS A ND1 
202  C CD2 . HIS A 88  ? 0.5024 0.4395 0.5598 0.0389  0.1982  -0.0159 66  HIS A CD2 
203  C CE1 . HIS A 88  ? 0.5370 0.4525 0.6214 0.0540  0.2373  0.0067  66  HIS A CE1 
204  N NE2 . HIS A 88  ? 0.5114 0.4365 0.5785 0.0493  0.2209  0.0042  66  HIS A NE2 
205  N N   . HIS A 89  ? 0.4664 0.4414 0.5133 0.0513  0.1732  0.0132  67  HIS A N   
206  C CA  . HIS A 89  ? 0.4702 0.4692 0.5101 0.0544  0.1566  0.0308  67  HIS A CA  
207  C C   . HIS A 89  ? 0.4973 0.4956 0.5354 0.0635  0.1639  0.0493  67  HIS A C   
208  O O   . HIS A 89  ? 0.5196 0.5060 0.5730 0.0740  0.1852  0.0622  67  HIS A O   
209  C CB  . HIS A 89  ? 0.4668 0.4828 0.5221 0.0603  0.1534  0.0448  67  HIS A CB  
210  C CG  . HIS A 89  ? 0.4609 0.4759 0.5123 0.0532  0.1475  0.0301  67  HIS A CG  
211  N ND1 . HIS A 89  ? 0.4383 0.4659 0.4769 0.0447  0.1291  0.0223  67  HIS A ND1 
212  C CD2 . HIS A 89  ? 0.4569 0.4554 0.5113 0.0545  0.1607  0.0219  67  HIS A CD2 
213  C CE1 . HIS A 89  ? 0.4395 0.4583 0.4745 0.0427  0.1323  0.0122  67  HIS A CE1 
214  N NE2 . HIS A 89  ? 0.4611 0.4620 0.5023 0.0490  0.1503  0.0116  67  HIS A NE2 
215  N N   . THR A 90  ? 0.5228 0.5297 0.5391 0.0606  0.1493  0.0505  68  THR A N   
216  C CA  . THR A 90  ? 0.5402 0.5464 0.5428 0.0722  0.1537  0.0706  68  THR A CA  
217  C C   . THR A 90  ? 0.5407 0.5791 0.5367 0.0795  0.1313  0.0886  68  THR A C   
218  O O   . THR A 90  ? 0.4929 0.5526 0.5023 0.0739  0.1159  0.0844  68  THR A O   
219  C CB  . THR A 90  ? 0.5638 0.5571 0.5410 0.0653  0.1524  0.0605  68  THR A CB  
220  O OG1 . THR A 90  ? 0.5374 0.5476 0.4964 0.0543  0.1273  0.0495  68  THR A OG1 
221  C CG2 . THR A 90  ? 0.5739 0.5424 0.5660 0.0562  0.1702  0.0395  68  THR A CG2 
222  N N   . ALA A 91  ? 0.5885 0.6302 0.5638 0.0927  0.1298  0.1079  69  ALA A N   
223  C CA  . ALA A 91  ? 0.6053 0.6812 0.5690 0.0987  0.1023  0.1204  69  ALA A CA  
224  C C   . ALA A 91  ? 0.6404 0.7086 0.5584 0.1059  0.0977  0.1280  69  ALA A C   
225  O O   . ALA A 91  ? 0.6621 0.6973 0.5656 0.1112  0.1226  0.1311  69  ALA A O   
226  C CB  . ALA A 91  ? 0.6090 0.7056 0.6013 0.1167  0.1042  0.1459  69  ALA A CB  
227  N N   . PRO A 92  ? 0.6594 0.7564 0.5546 0.1055  0.0672  0.1290  70  PRO A N   
228  C CA  . PRO A 92  ? 0.7073 0.7965 0.5503 0.1166  0.0621  0.1389  70  PRO A CA  
229  C C   . PRO A 92  ? 0.7565 0.8322 0.5910 0.1448  0.0835  0.1711  70  PRO A C   
230  O O   . PRO A 92  ? 0.7509 0.8472 0.6151 0.1593  0.0827  0.1908  70  PRO A O   
231  C CB  . PRO A 92  ? 0.7183 0.8509 0.5505 0.1137  0.0219  0.1356  70  PRO A CB  
232  C CG  . PRO A 92  ? 0.6685 0.8177 0.5406 0.0905  0.0114  0.1120  70  PRO A CG  
233  C CD  . PRO A 92  ? 0.6359 0.7704 0.5511 0.0926  0.0377  0.1168  70  PRO A CD  
234  N N   . ALA A 93  ? 0.8103 0.8488 0.6071 0.1532  0.1063  0.1772  71  ALA A N   
235  C CA  . ALA A 93  ? 0.8686 0.8867 0.6527 0.1816  0.1326  0.2092  71  ALA A CA  
236  C C   . ALA A 93  ? 0.9355 0.9446 0.6502 0.1988  0.1254  0.2236  71  ALA A C   
237  O O   . ALA A 93  ? 0.9396 0.9384 0.6163 0.1852  0.1157  0.2044  71  ALA A O   
238  C CB  . ALA A 93  ? 0.8681 0.8410 0.6771 0.1783  0.1779  0.2052  71  ALA A CB  
239  N N   . LYS A 94  ? 0.9798 0.9927 0.6761 0.2305  0.1305  0.2584  72  LYS A N   
240  C CA  . LYS A 94  ? 1.0680 1.0635 0.6920 0.2551  0.1322  0.2794  72  LYS A CA  
241  C C   . LYS A 94  ? 1.0682 1.0017 0.6723 0.2537  0.1791  0.2765  72  LYS A C   
242  O O   . LYS A 94  ? 1.0634 0.9694 0.7147 0.2489  0.2170  0.2753  72  LYS A O   
243  C CB  . LYS A 94  ? 1.1225 1.1315 0.7434 0.2931  0.1362  0.3219  72  LYS A CB  
244  C CG  . LYS A 94  ? 1.2317 1.2101 0.7784 0.3280  0.1529  0.3534  72  LYS A CG  
245  C CD  . LYS A 94  ? 1.2965 1.3131 0.7787 0.3414  0.1026  0.3582  72  LYS A CD  
246  C CE  . LYS A 94  ? 1.3858 1.3826 0.8026 0.3880  0.1172  0.4022  72  LYS A CE  
247  N NZ  . LYS A 94  ? 1.4556 1.4934 0.8053 0.4031  0.0633  0.4056  72  LYS A NZ  
248  N N   . SER A 95  ? 1.0899 1.0010 0.6275 0.2563  0.1777  0.2729  73  SER A N   
249  C CA  . SER A 95  ? 1.0893 0.9419 0.6144 0.2535  0.2240  0.2688  73  SER A CA  
250  C C   . SER A 95  ? 1.1442 0.9568 0.6173 0.2911  0.2588  0.3068  73  SER A C   
251  O O   . SER A 95  ? 1.1771 1.0078 0.5988 0.3188  0.2374  0.3325  73  SER A O   
252  C CB  . SER A 95  ? 1.0878 0.9309 0.5820 0.2286  0.2111  0.2371  73  SER A CB  
253  O OG  . SER A 95  ? 1.1568 1.0100 0.5732 0.2397  0.1812  0.2414  73  SER A OG  
254  N N   . PRO A 96  ? 1.1486 0.9069 0.6374 0.2932  0.3139  0.3109  74  PRO A N   
255  C CA  . PRO A 96  ? 1.2285 0.9416 0.6713 0.3301  0.3555  0.3487  74  PRO A CA  
256  C C   . PRO A 96  ? 1.3113 0.9999 0.6570 0.3437  0.3504  0.3543  74  PRO A C   
257  O O   . PRO A 96  ? 1.2908 0.9875 0.6160 0.3193  0.3253  0.3241  74  PRO A O   
258  C CB  . PRO A 96  ? 1.2079 0.8720 0.7094 0.3204  0.4157  0.3424  74  PRO A CB  
259  C CG  . PRO A 96  ? 1.1387 0.8129 0.6796 0.2796  0.4014  0.2982  74  PRO A CG  
260  C CD  . PRO A 96  ? 1.0905 0.8267 0.6388 0.2625  0.3399  0.2801  74  PRO A CD  
261  N N   . LYS A 97  ? 0.7312 0.4584 0.6227 0.1628  0.0858  0.2020  75  LYS A N   
262  C CA  . LYS A 97  ? 0.7623 0.5059 0.6344 0.1672  0.0794  0.2133  75  LYS A CA  
263  C C   . LYS A 97  ? 0.7473 0.4933 0.6100 0.1491  0.0847  0.2088  75  LYS A C   
264  O O   . LYS A 97  ? 0.7273 0.4996 0.5818 0.1467  0.0764  0.2049  75  LYS A O   
265  C CB  . LYS A 97  ? 0.8188 0.5415 0.6763 0.1825  0.0836  0.2363  75  LYS A CB  
266  C CG  . LYS A 97  ? 0.8522 0.5820 0.7167 0.2040  0.0744  0.2431  75  LYS A CG  
267  C CD  . LYS A 97  ? 0.9206 0.6425 0.7642 0.2210  0.0728  0.2670  75  LYS A CD  
268  C CE  . LYS A 97  ? 0.9570 0.7020 0.8059 0.2424  0.0573  0.2718  75  LYS A CE  
269  N NZ  . LYS A 97  ? 0.9863 0.7130 0.8553 0.2539  0.0617  0.2733  75  LYS A NZ  
270  N N   . ILE A 98  ? 0.7464 0.4643 0.6115 0.1369  0.0987  0.2090  76  ILE A N   
271  C CA  . ILE A 98  ? 0.7387 0.4571 0.6010 0.1184  0.1053  0.2030  76  ILE A CA  
272  C C   . ILE A 98  ? 0.7218 0.4408 0.6032 0.1038  0.1062  0.1824  76  ILE A C   
273  O O   . ILE A 98  ? 0.7504 0.4470 0.6427 0.1027  0.1122  0.1785  76  ILE A O   
274  C CB  . ILE A 98  ? 0.7717 0.4588 0.6250 0.1142  0.1205  0.2185  76  ILE A CB  
275  C CG1 . ILE A 98  ? 0.8015 0.4882 0.6322 0.1300  0.1196  0.2405  76  ILE A CG1 
276  C CG2 . ILE A 98  ? 0.7661 0.4542 0.6218 0.0938  0.1284  0.2111  76  ILE A CG2 
277  C CD1 . ILE A 98  ? 0.8364 0.4875 0.6578 0.1302  0.1354  0.2599  76  ILE A CD1 
278  N N   . LEU A 99  ? 0.6672 0.4115 0.5516 0.0936  0.1000  0.1690  77  LEU A N   
279  C CA  . LEU A 99  ? 0.6387 0.3846 0.5382 0.0799  0.1003  0.1507  77  LEU A CA  
280  C C   . LEU A 99  ? 0.6532 0.3782 0.5557 0.0642  0.1122  0.1497  77  LEU A C   
281  O O   . LEU A 99  ? 0.6664 0.3917 0.5607 0.0586  0.1175  0.1576  77  LEU A O   
282  C CB  . LEU A 99  ? 0.5998 0.3782 0.5017 0.0746  0.0901  0.1380  77  LEU A CB  
283  C CG  . LEU A 99  ? 0.5953 0.3989 0.4959 0.0877  0.0774  0.1375  77  LEU A CG  
284  C CD1 . LEU A 99  ? 0.5588 0.3885 0.4663 0.0797  0.0692  0.1221  77  LEU A CD1 
285  C CD2 . LEU A 99  ? 0.6222 0.4183 0.5318 0.0999  0.0756  0.1384  77  LEU A CD2 
286  N N   . PRO A 100 ? 0.6708 0.3776 0.5854 0.0567  0.1168  0.1395  78  PRO A N   
287  C CA  . PRO A 100 ? 0.6864 0.3739 0.6065 0.0404  0.1272  0.1369  78  PRO A CA  
288  C C   . PRO A 100 ? 0.6217 0.3308 0.5464 0.0251  0.1243  0.1259  78  PRO A C   
289  O O   . PRO A 100 ? 0.6106 0.3127 0.5382 0.0130  0.1322  0.1281  78  PRO A O   
290  C CB  . PRO A 100 ? 0.7104 0.3745 0.6410 0.0381  0.1306  0.1264  78  PRO A CB  
291  C CG  . PRO A 100 ? 0.7059 0.3857 0.6382 0.0499  0.1210  0.1192  78  PRO A CG  
292  C CD  . PRO A 100 ? 0.6950 0.3926 0.6174 0.0648  0.1148  0.1328  78  PRO A CD  
293  N N   . ASP A 101 ? 0.5815 0.3167 0.5082 0.0262  0.1135  0.1148  79  ASP A N   
294  C CA  . ASP A 101 ? 0.5618 0.3208 0.4913 0.0160  0.1092  0.1066  79  ASP A CA  
295  C C   . ASP A 101 ? 0.5436 0.3292 0.4709 0.0241  0.0972  0.1007  79  ASP A C   
296  O O   . ASP A 101 ? 0.5350 0.3205 0.4610 0.0361  0.0927  0.1020  79  ASP A O   
297  C CB  . ASP A 101 ? 0.5630 0.3175 0.5055 0.0000  0.1108  0.0922  79  ASP A CB  
298  C CG  . ASP A 101 ? 0.5612 0.3099 0.5089 0.0013  0.1062  0.0796  79  ASP A CG  
299  O OD1 . ASP A 101 ? 0.5586 0.3252 0.5053 0.0076  0.0977  0.0739  79  ASP A OD1 
300  O OD2 . ASP A 101 ? 0.6208 0.3462 0.5736 -0.0041 0.1119  0.0752  79  ASP A OD2 
301  N N   . ILE A 102 ? 0.5217 0.3297 0.4508 0.0173  0.0925  0.0936  80  ILE A N   
302  C CA  . ILE A 102 ? 0.5030 0.3361 0.4302 0.0237  0.0819  0.0886  80  ILE A CA  
303  C C   . ILE A 102 ? 0.4963 0.3333 0.4321 0.0243  0.0758  0.0766  80  ILE A C   
304  O O   . ILE A 102 ? 0.4711 0.3248 0.4070 0.0316  0.0679  0.0739  80  ILE A O   
305  C CB  . ILE A 102 ? 0.4798 0.3334 0.4065 0.0167  0.0798  0.0847  80  ILE A CB  
306  C CG1 . ILE A 102 ? 0.4656 0.3427 0.3873 0.0247  0.0701  0.0824  80  ILE A CG1 
307  C CG2 . ILE A 102 ? 0.4677 0.3254 0.4068 0.0038  0.0789  0.0717  80  ILE A CG2 
308  C CD1 . ILE A 102 ? 0.4940 0.3726 0.4026 0.0381  0.0680  0.0940  80  ILE A CD1 
309  N N   . LEU A 103 ? 0.5309 0.3527 0.4736 0.0166  0.0795  0.0691  81  LEU A N   
310  C CA  . LEU A 103 ? 0.5357 0.3597 0.4838 0.0177  0.0752  0.0582  81  LEU A CA  
311  C C   . LEU A 103 ? 0.5500 0.3693 0.4974 0.0316  0.0745  0.0626  81  LEU A C   
312  O O   . LEU A 103 ? 0.5536 0.3808 0.5055 0.0348  0.0707  0.0552  81  LEU A O   
313  C CB  . LEU A 103 ? 0.5568 0.3650 0.5096 0.0069  0.0790  0.0485  81  LEU A CB  
314  C CG  . LEU A 103 ? 0.5620 0.3763 0.5191 -0.0071 0.0789  0.0430  81  LEU A CG  
315  C CD1 . LEU A 103 ? 0.5615 0.3600 0.5231 -0.0172 0.0811  0.0324  81  LEU A CD1 
316  C CD2 . LEU A 103 ? 0.5472 0.3875 0.5056 -0.0081 0.0707  0.0377  81  LEU A CD2 
317  N N   . LYS A 104 ? 0.5876 0.3956 0.5301 0.0404  0.0783  0.0752  82  LYS A N   
318  C CA  . LYS A 104 ? 0.6191 0.4278 0.5624 0.0555  0.0760  0.0808  82  LYS A CA  
319  C C   . LYS A 104 ? 0.5888 0.4258 0.5318 0.0630  0.0659  0.0821  82  LYS A C   
320  O O   . LYS A 104 ? 0.5446 0.3889 0.4927 0.0740  0.0620  0.0833  82  LYS A O   
321  C CB  . LYS A 104 ? 0.7086 0.4957 0.6461 0.0637  0.0825  0.0952  82  LYS A CB  
322  C CG  . LYS A 104 ? 0.8200 0.5774 0.7617 0.0625  0.0916  0.0930  82  LYS A CG  
323  C CD  . LYS A 104 ? 0.8869 0.6451 0.8366 0.0713  0.0900  0.0860  82  LYS A CD  
324  C CE  . LYS A 104 ? 1.0059 0.7322 0.9582 0.0743  0.0997  0.0860  82  LYS A CE  
325  N NZ  . LYS A 104 ? 1.0479 0.7540 0.9990 0.0586  0.1063  0.0787  82  LYS A NZ  
326  N N   . LYS A 105 ? 0.5230 0.3762 0.4615 0.0567  0.0619  0.0809  83  LYS A N   
327  C CA  . LYS A 105 ? 0.5109 0.3898 0.4490 0.0621  0.0523  0.0799  83  LYS A CA  
328  C C   . LYS A 105 ? 0.4700 0.3640 0.4183 0.0564  0.0474  0.0664  83  LYS A C   
329  O O   . LYS A 105 ? 0.4447 0.3547 0.3930 0.0508  0.0427  0.0609  83  LYS A O   
330  C CB  . LYS A 105 ? 0.5430 0.4301 0.4695 0.0596  0.0514  0.0852  83  LYS A CB  
331  C CG  . LYS A 105 ? 0.6000 0.5027 0.5189 0.0713  0.0435  0.0919  83  LYS A CG  
332  C CD  . LYS A 105 ? 0.6190 0.5442 0.5481 0.0727  0.0337  0.0815  83  LYS A CD  
333  C CE  . LYS A 105 ? 0.6683 0.6124 0.5918 0.0830  0.0237  0.0851  83  LYS A CE  
334  N NZ  . LYS A 105 ? 0.6591 0.6242 0.5947 0.0797  0.0155  0.0725  83  LYS A NZ  
335  N N   . ILE A 106 ? 0.4444 0.3319 0.4012 0.0582  0.0495  0.0615  84  ILE A N   
336  C CA  . ILE A 106 ? 0.4469 0.3449 0.4119 0.0534  0.0469  0.0505  84  ILE A CA  
337  C C   . ILE A 106 ? 0.4637 0.3649 0.4382 0.0637  0.0465  0.0507  84  ILE A C   
338  O O   . ILE A 106 ? 0.4609 0.3462 0.4356 0.0702  0.0518  0.0551  84  ILE A O   
339  C CB  . ILE A 106 ? 0.4551 0.3395 0.4191 0.0423  0.0522  0.0428  84  ILE A CB  
340  C CG1 . ILE A 106 ? 0.4690 0.3533 0.4273 0.0324  0.0525  0.0429  84  ILE A CG1 
341  C CG2 . ILE A 106 ? 0.4383 0.3330 0.4083 0.0386  0.0499  0.0328  84  ILE A CG2 
342  C CD1 . ILE A 106 ? 0.4841 0.3569 0.4427 0.0212  0.0561  0.0351  84  ILE A CD1 
343  N N   . GLY A 107 ? 0.4625 0.3846 0.4462 0.0656  0.0404  0.0462  85  GLY A N   
344  C CA  . GLY A 107 ? 0.4519 0.3818 0.4480 0.0754  0.0397  0.0464  85  GLY A CA  
345  C C   . GLY A 107 ? 0.4719 0.4143 0.4707 0.0869  0.0327  0.0547  85  GLY A C   
346  O O   . GLY A 107 ? 0.4450 0.3889 0.4327 0.0877  0.0286  0.0608  85  GLY A O   
347  N N   . ASP A 108 ? 0.4624 0.4146 0.4758 0.0962  0.0315  0.0548  86  ASP A N   
348  C CA  . ASP A 108 ? 0.4947 0.4644 0.5148 0.1079  0.0226  0.0611  86  ASP A CA  
349  C C   . ASP A 108 ? 0.4626 0.4528 0.4792 0.1039  0.0119  0.0588  86  ASP A C   
350  O O   . ASP A 108 ? 0.4524 0.4472 0.4588 0.1095  0.0054  0.0656  86  ASP A O   
351  C CB  . ASP A 108 ? 0.5748 0.5287 0.5856 0.1188  0.0244  0.0735  86  ASP A CB  
352  C CG  . ASP A 108 ? 0.6882 0.6248 0.7071 0.1262  0.0338  0.0752  86  ASP A CG  
353  O OD1 . ASP A 108 ? 0.7144 0.6614 0.7510 0.1298  0.0353  0.0696  86  ASP A OD1 
354  O OD2 . ASP A 108 ? 0.7909 0.7026 0.7987 0.1288  0.0404  0.0824  86  ASP A OD2 
355  N N   . THR A 109 ? 0.4260 0.4273 0.4500 0.0942  0.0107  0.0488  87  THR A N   
356  C CA  . THR A 109 ? 0.4098 0.4281 0.4316 0.0891  0.0018  0.0443  87  THR A CA  
357  C C   . THR A 109 ? 0.4063 0.4499 0.4442 0.0959  -0.0086 0.0423  87  THR A C   
358  O O   . THR A 109 ? 0.3914 0.4423 0.4475 0.1020  -0.0075 0.0423  87  THR A O   
359  C CB  . THR A 109 ? 0.3929 0.4111 0.4173 0.0763  0.0050  0.0348  87  THR A CB  
360  O OG1 . THR A 109 ? 0.3617 0.3826 0.4026 0.0755  0.0098  0.0302  87  THR A OG1 
361  C CG2 . THR A 109 ? 0.4020 0.3995 0.4105 0.0691  0.0124  0.0359  87  THR A CG2 
362  N N   . PRO A 110 ? 0.4024 0.4606 0.4346 0.0948  -0.0186 0.0399  88  PRO A N   
363  C CA  . PRO A 110 ? 0.3928 0.4768 0.4401 0.1009  -0.0306 0.0370  88  PRO A CA  
364  C C   . PRO A 110 ? 0.3591 0.4586 0.4315 0.0941  -0.0313 0.0266  88  PRO A C   
365  O O   . PRO A 110 ? 0.3301 0.4231 0.4037 0.0830  -0.0252 0.0200  88  PRO A O   
366  C CB  . PRO A 110 ? 0.4150 0.5076 0.4457 0.0999  -0.0403 0.0352  88  PRO A CB  
367  C CG  . PRO A 110 ? 0.4093 0.4818 0.4182 0.0933  -0.0323 0.0376  88  PRO A CG  
368  C CD  . PRO A 110 ? 0.4046 0.4559 0.4152 0.0897  -0.0193 0.0405  88  PRO A CD  
369  N N   . MET A 111 ? 0.3385 0.4587 0.4313 0.1013  -0.0386 0.0258  89  MET A N   
370  C CA  . MET A 111 ? 0.3283 0.4676 0.4479 0.0956  -0.0408 0.0164  89  MET A CA  
371  C C   . MET A 111 ? 0.3194 0.4822 0.4430 0.0973  -0.0569 0.0114  89  MET A C   
372  O O   . MET A 111 ? 0.3398 0.5144 0.4639 0.1087  -0.0662 0.0165  89  MET A O   
373  C CB  . MET A 111 ? 0.3408 0.4871 0.4845 0.1027  -0.0356 0.0191  89  MET A CB  
374  C CG  . MET A 111 ? 0.3334 0.4997 0.5075 0.0959  -0.0357 0.0101  89  MET A CG  
375  S SD  . MET A 111 ? 0.3377 0.4865 0.5099 0.0813  -0.0209 0.0048  89  MET A SD  
376  C CE  . MET A 111 ? 0.3459 0.4800 0.5212 0.0888  -0.0058 0.0116  89  MET A CE  
377  N N   . VAL A 112 ? 0.3138 0.4825 0.4394 0.0863  -0.0605 0.0011  90  VAL A N   
378  C CA  . VAL A 112 ? 0.3200 0.5075 0.4439 0.0866  -0.0757 -0.0058 90  VAL A CA  
379  C C   . VAL A 112 ? 0.3042 0.5118 0.4579 0.0781  -0.0806 -0.0180 90  VAL A C   
380  O O   . VAL A 112 ? 0.2944 0.4941 0.4573 0.0672  -0.0715 -0.0230 90  VAL A O   
381  C CB  . VAL A 112 ? 0.3345 0.5082 0.4293 0.0811  -0.0758 -0.0081 90  VAL A CB  
382  C CG1 . VAL A 112 ? 0.3508 0.5422 0.4377 0.0837  -0.0916 -0.0147 90  VAL A CG1 
383  C CG2 . VAL A 112 ? 0.3525 0.5036 0.4210 0.0867  -0.0674 0.0042  90  VAL A CG2 
384  N N   . ARG A 113 ? 0.3241 0.5577 0.4930 0.0830  -0.0952 -0.0224 91  ARG A N   
385  C CA  . ARG A 113 ? 0.3421 0.5970 0.5421 0.0741  -0.1013 -0.0352 91  ARG A CA  
386  C C   . ARG A 113 ? 0.3406 0.5915 0.5302 0.0627  -0.1054 -0.0471 91  ARG A C   
387  O O   . ARG A 113 ? 0.3246 0.5724 0.4872 0.0656  -0.1132 -0.0485 91  ARG A O   
388  C CB  . ARG A 113 ? 0.3725 0.6584 0.5928 0.0827  -0.1174 -0.0374 91  ARG A CB  
389  C CG  . ARG A 113 ? 0.4166 0.7262 0.6708 0.0722  -0.1251 -0.0521 91  ARG A CG  
390  C CD  . ARG A 113 ? 0.4455 0.7880 0.7334 0.0792  -0.1365 -0.0536 91  ARG A CD  
391  N NE  . ARG A 113 ? 0.5486 0.8985 0.8199 0.0961  -0.1477 -0.0442 91  ARG A NE  
392  C CZ  . ARG A 113 ? 0.5986 0.9488 0.8751 0.1095  -0.1430 -0.0313 91  ARG A CZ  
393  N NH1 . ARG A 113 ? 0.6091 0.9540 0.9077 0.1083  -0.1273 -0.0270 91  ARG A NH1 
394  N NH2 . ARG A 113 ? 0.6441 0.9994 0.9027 0.1251  -0.1541 -0.0224 91  ARG A NH2 
395  N N   . ILE A 114 ? 0.3299 0.5789 0.5398 0.0501  -0.0984 -0.0549 92  ILE A N   
396  C CA  . ILE A 114 ? 0.3272 0.5724 0.5341 0.0388  -0.1012 -0.0672 92  ILE A CA  
397  C C   . ILE A 114 ? 0.3472 0.6200 0.5784 0.0354  -0.1169 -0.0805 92  ILE A C   
398  O O   . ILE A 114 ? 0.3284 0.6177 0.5948 0.0314  -0.1167 -0.0837 92  ILE A O   
399  C CB  . ILE A 114 ? 0.3352 0.5648 0.5546 0.0270  -0.0862 -0.0685 92  ILE A CB  
400  C CG1 . ILE A 114 ? 0.3531 0.5565 0.5501 0.0293  -0.0714 -0.0568 92  ILE A CG1 
401  C CG2 . ILE A 114 ? 0.3394 0.5653 0.5599 0.0158  -0.0894 -0.0815 92  ILE A CG2 
402  C CD1 . ILE A 114 ? 0.3828 0.5701 0.5457 0.0312  -0.0722 -0.0553 92  ILE A CD1 
403  N N   . ASN A 115 ? 0.3388 0.6174 0.5521 0.0366  -0.1304 -0.0889 93  ASN A N   
404  C CA  . ASN A 115 ? 0.3469 0.6532 0.5793 0.0352  -0.1481 -0.1018 93  ASN A CA  
405  C C   . ASN A 115 ? 0.3528 0.6616 0.6009 0.0209  -0.1518 -0.1195 93  ASN A C   
406  O O   . ASN A 115 ? 0.3512 0.6842 0.6283 0.0163  -0.1635 -0.1308 93  ASN A O   
407  C CB  . ASN A 115 ? 0.3601 0.6756 0.5634 0.0476  -0.1632 -0.1004 93  ASN A CB  
408  C CG  . ASN A 115 ? 0.3673 0.6829 0.5611 0.0623  -0.1610 -0.0830 93  ASN A CG  
409  O OD1 . ASN A 115 ? 0.3539 0.6865 0.5759 0.0665  -0.1628 -0.0790 93  ASN A OD1 
410  N ND2 . ASN A 115 ? 0.3541 0.6501 0.5108 0.0699  -0.1558 -0.0723 93  ASN A ND2 
411  N N   . LYS A 116 ? 0.3572 0.6422 0.5878 0.0139  -0.1428 -0.1227 94  LYS A N   
412  C CA  . LYS A 116 ? 0.3855 0.6704 0.6283 0.0012  -0.1469 -0.1401 94  LYS A CA  
413  C C   . LYS A 116 ? 0.3543 0.6227 0.6183 -0.0108 -0.1310 -0.1398 94  LYS A C   
414  O O   . LYS A 116 ? 0.3513 0.6278 0.6458 -0.0219 -0.1330 -0.1512 94  LYS A O   
415  C CB  . LYS A 116 ? 0.4273 0.6992 0.6342 0.0028  -0.1511 -0.1472 94  LYS A CB  
416  C CG  . LYS A 116 ? 0.4911 0.7807 0.6766 0.0129  -0.1689 -0.1514 94  LYS A CG  
417  C CD  . LYS A 116 ? 0.5592 0.8339 0.7089 0.0137  -0.1697 -0.1586 94  LYS A CD  
418  C CE  . LYS A 116 ? 0.6169 0.9024 0.7332 0.0267  -0.1824 -0.1565 94  LYS A CE  
419  N NZ  . LYS A 116 ? 0.6025 0.8655 0.6813 0.0331  -0.1705 -0.1451 94  LYS A NZ  
420  N N   . ILE A 117 ? 0.3375 0.5830 0.5855 -0.0087 -0.1153 -0.1267 95  ILE A N   
421  C CA  . ILE A 117 ? 0.3355 0.5621 0.5961 -0.0188 -0.1001 -0.1252 95  ILE A CA  
422  C C   . ILE A 117 ? 0.3417 0.5799 0.6423 -0.0258 -0.0943 -0.1242 95  ILE A C   
423  O O   . ILE A 117 ? 0.3124 0.5468 0.6357 -0.0377 -0.0899 -0.1317 95  ILE A O   
424  C CB  . ILE A 117 ? 0.3308 0.5328 0.5645 -0.0140 -0.0864 -0.1114 95  ILE A CB  
425  C CG1 . ILE A 117 ? 0.3429 0.5330 0.5428 -0.0103 -0.0903 -0.1150 95  ILE A CG1 
426  C CG2 . ILE A 117 ? 0.3275 0.5109 0.5730 -0.0230 -0.0711 -0.1080 95  ILE A CG2 
427  C CD1 . ILE A 117 ? 0.3397 0.5088 0.5142 -0.0055 -0.0785 -0.1020 95  ILE A CD1 
428  N N   . GLY A 118 ? 0.3373 0.5901 0.6477 -0.0183 -0.0939 -0.1150 96  GLY A N   
429  C CA  . GLY A 118 ? 0.3508 0.6168 0.6994 -0.0238 -0.0871 -0.1134 96  GLY A CA  
430  C C   . GLY A 118 ? 0.3746 0.6614 0.7572 -0.0340 -0.0977 -0.1291 96  GLY A C   
431  O O   . GLY A 118 ? 0.3788 0.6621 0.7882 -0.0462 -0.0887 -0.1327 96  GLY A O   
432  N N   . LYS A 119 ? 0.3993 0.7074 0.7799 -0.0292 -0.1170 -0.1384 97  LYS A N   
433  C CA  . LYS A 119 ? 0.4306 0.7616 0.8422 -0.0385 -0.1309 -0.1556 97  LYS A CA  
434  C C   . LYS A 119 ? 0.4251 0.7390 0.8408 -0.0528 -0.1279 -0.1684 97  LYS A C   
435  O O   . LYS A 119 ? 0.4063 0.7297 0.8585 -0.0654 -0.1278 -0.1782 97  LYS A O   
436  C CB  . LYS A 119 ? 0.4920 0.8438 0.8887 -0.0297 -0.1534 -0.1640 97  LYS A CB  
437  C CG  . LYS A 119 ? 0.5330 0.9057 0.9293 -0.0147 -0.1603 -0.1532 97  LYS A CG  
438  C CD  . LYS A 119 ? 0.6005 1.0009 0.9948 -0.0091 -0.1852 -0.1647 97  LYS A CD  
439  C CE  . LYS A 119 ? 0.6339 1.0531 1.0228 0.0082  -0.1932 -0.1524 97  LYS A CE  
440  N NZ  . LYS A 119 ? 0.6251 1.0192 0.9708 0.0207  -0.1836 -0.1355 97  LYS A NZ  
441  N N   . LYS A 120 ? 0.4107 0.6998 0.7899 -0.0506 -0.1254 -0.1684 98  LYS A N   
442  C CA  . LYS A 120 ? 0.4294 0.6990 0.8085 -0.0620 -0.1221 -0.1799 98  LYS A CA  
443  C C   . LYS A 120 ? 0.4034 0.6572 0.8077 -0.0731 -0.1035 -0.1742 98  LYS A C   
444  O O   . LYS A 120 ? 0.4022 0.6488 0.8260 -0.0857 -0.1021 -0.1854 98  LYS A O   
445  C CB  . LYS A 120 ? 0.4622 0.7084 0.7966 -0.0547 -0.1201 -0.1771 98  LYS A CB  
446  C CG  . LYS A 120 ? 0.5053 0.7284 0.8328 -0.0631 -0.1161 -0.1877 98  LYS A CG  
447  C CD  . LYS A 120 ? 0.5401 0.7462 0.8238 -0.0532 -0.1149 -0.1834 98  LYS A CD  
448  C CE  . LYS A 120 ? 0.5778 0.7538 0.8521 -0.0576 -0.1018 -0.1826 98  LYS A CE  
449  N NZ  . LYS A 120 ? 0.6372 0.8073 0.9098 -0.0634 -0.1091 -0.2021 98  LYS A NZ  
450  N N   . PHE A 121 ? 0.3745 0.6217 0.7774 -0.0685 -0.0890 -0.1567 99  PHE A N   
451  C CA  . PHE A 121 ? 0.3720 0.6047 0.7957 -0.0779 -0.0708 -0.1497 99  PHE A CA  
452  C C   . PHE A 121 ? 0.3664 0.6218 0.8322 -0.0832 -0.0666 -0.1477 99  PHE A C   
453  O O   . PHE A 121 ? 0.3873 0.6324 0.8671 -0.0885 -0.0494 -0.1384 99  PHE A O   
454  C CB  . PHE A 121 ? 0.3769 0.5840 0.7705 -0.0710 -0.0558 -0.1330 99  PHE A CB  
455  C CG  . PHE A 121 ? 0.4015 0.5839 0.7648 -0.0702 -0.0557 -0.1356 99  PHE A CG  
456  C CD1 . PHE A 121 ? 0.4172 0.5779 0.7871 -0.0796 -0.0464 -0.1379 99  PHE A CD1 
457  C CD2 . PHE A 121 ? 0.3961 0.5779 0.7262 -0.0599 -0.0651 -0.1364 99  PHE A CD2 
458  C CE1 . PHE A 121 ? 0.4445 0.5836 0.7888 -0.0779 -0.0464 -0.1407 99  PHE A CE1 
459  C CE2 . PHE A 121 ? 0.4219 0.5828 0.7265 -0.0590 -0.0643 -0.1395 99  PHE A CE2 
460  C CZ  . PHE A 121 ? 0.4293 0.5694 0.7415 -0.0676 -0.0553 -0.1420 99  PHE A CZ  
461  N N   . GLY A 122 ? 0.3365 0.6234 0.8221 -0.0812 -0.0820 -0.1563 100 GLY A N   
462  C CA  . GLY A 122 ? 0.3546 0.6677 0.8864 -0.0873 -0.0801 -0.1575 100 GLY A CA  
463  C C   . GLY A 122 ? 0.3471 0.6727 0.8848 -0.0770 -0.0716 -0.1424 100 GLY A C   
464  O O   . GLY A 122 ? 0.3463 0.6927 0.9236 -0.0819 -0.0669 -0.1422 100 GLY A O   
465  N N   . LEU A 123 ? 0.3360 0.6492 0.8363 -0.0631 -0.0689 -0.1302 101 LEU A N   
466  C CA  . LEU A 123 ? 0.3232 0.6449 0.8264 -0.0524 -0.0603 -0.1165 101 LEU A CA  
467  C C   . LEU A 123 ? 0.3280 0.6867 0.8579 -0.0463 -0.0750 -0.1213 101 LEU A C   
468  O O   . LEU A 123 ? 0.3636 0.7369 0.8894 -0.0441 -0.0949 -0.1319 101 LEU A O   
469  C CB  . LEU A 123 ? 0.3138 0.6153 0.7711 -0.0390 -0.0578 -0.1049 101 LEU A CB  
470  C CG  . LEU A 123 ? 0.3244 0.5915 0.7544 -0.0413 -0.0414 -0.0960 101 LEU A CG  
471  C CD1 . LEU A 123 ? 0.3238 0.5774 0.7141 -0.0276 -0.0415 -0.0859 101 LEU A CD1 
472  C CD2 . LEU A 123 ? 0.3179 0.5792 0.7680 -0.0471 -0.0211 -0.0877 101 LEU A CD2 
473  N N   . LYS A 124 ? 0.3216 0.6962 0.8785 -0.0429 -0.0654 -0.1137 102 LYS A N   
474  C CA  . LYS A 124 ? 0.3323 0.7439 0.9167 -0.0348 -0.0790 -0.1165 102 LYS A CA  
475  C C   . LYS A 124 ? 0.3038 0.7138 0.8648 -0.0160 -0.0777 -0.1031 102 LYS A C   
476  O O   . LYS A 124 ? 0.3079 0.7422 0.8754 -0.0049 -0.0930 -0.1040 102 LYS A O   
477  C CB  . LYS A 124 ? 0.3654 0.8013 1.0042 -0.0434 -0.0697 -0.1184 102 LYS A CB  
478  C CG  . LYS A 124 ? 0.3976 0.8268 1.0617 -0.0635 -0.0615 -0.1271 102 LYS A CG  
479  C CD  . LYS A 124 ? 0.4439 0.9058 1.1502 -0.0736 -0.0790 -0.1443 102 LYS A CD  
480  C CE  . LYS A 124 ? 0.4772 0.9380 1.1577 -0.0726 -0.1025 -0.1573 102 LYS A CE  
481  N NZ  . LYS A 124 ? 0.4994 0.9935 1.2210 -0.0825 -0.1211 -0.1757 102 LYS A NZ  
482  N N   . CYS A 125 ? 0.2857 0.6675 0.8215 -0.0126 -0.0592 -0.0908 103 CYS A N   
483  C CA  . CYS A 125 ? 0.2903 0.6650 0.8027 0.0039  -0.0554 -0.0783 103 CYS A CA  
484  C C   . CYS A 125 ? 0.2993 0.6626 0.7699 0.0133  -0.0698 -0.0773 103 CYS A C   
485  O O   . CYS A 125 ? 0.2875 0.6447 0.7427 0.0071  -0.0803 -0.0858 103 CYS A O   
486  C CB  . CYS A 125 ? 0.2894 0.6348 0.7840 0.0030  -0.0319 -0.0673 103 CYS A CB  
487  S SG  . CYS A 125 ? 0.3024 0.6096 0.7590 -0.0072 -0.0254 -0.0676 103 CYS A SG  
488  N N   . GLU A 126 ? 0.2965 0.6562 0.7496 0.0286  -0.0687 -0.0667 104 GLU A N   
489  C CA  . GLU A 126 ? 0.3051 0.6477 0.7154 0.0378  -0.0764 -0.0619 104 GLU A CA  
490  C C   . GLU A 126 ? 0.3002 0.6069 0.6786 0.0329  -0.0611 -0.0564 104 GLU A C   
491  O O   . GLU A 126 ? 0.2752 0.5698 0.6589 0.0303  -0.0435 -0.0508 104 GLU A O   
492  C CB  . GLU A 126 ? 0.3294 0.6797 0.7359 0.0555  -0.0794 -0.0518 104 GLU A CB  
493  C CG  . GLU A 126 ? 0.3555 0.6911 0.7205 0.0660  -0.0883 -0.0459 104 GLU A CG  
494  C CD  . GLU A 126 ? 0.3737 0.7174 0.7384 0.0839  -0.0918 -0.0355 104 GLU A CD  
495  O OE1 . GLU A 126 ? 0.3805 0.7177 0.7543 0.0893  -0.0775 -0.0278 104 GLU A OE1 
496  O OE2 . GLU A 126 ? 0.4094 0.7653 0.7637 0.0933  -0.1086 -0.0347 104 GLU A OE2 
497  N N   . LEU A 127 ? 0.2762 0.5669 0.6216 0.0319  -0.0680 -0.0585 105 LEU A N   
498  C CA  . LEU A 127 ? 0.2737 0.5326 0.5883 0.0281  -0.0564 -0.0538 105 LEU A CA  
499  C C   . LEU A 127 ? 0.2884 0.5348 0.5671 0.0396  -0.0611 -0.0463 105 LEU A C   
500  O O   . LEU A 127 ? 0.2990 0.5545 0.5662 0.0441  -0.0758 -0.0497 105 LEU A O   
501  C CB  . LEU A 127 ? 0.2798 0.5310 0.5914 0.0150  -0.0588 -0.0639 105 LEU A CB  
502  C CG  . LEU A 127 ? 0.3022 0.5230 0.5858 0.0102  -0.0481 -0.0604 105 LEU A CG  
503  C CD1 . LEU A 127 ? 0.3063 0.5132 0.5944 0.0077  -0.0298 -0.0524 105 LEU A CD1 
504  C CD2 . LEU A 127 ? 0.3120 0.5274 0.5959 -0.0009 -0.0519 -0.0710 105 LEU A CD2 
505  N N   . LEU A 128 ? 0.2781 0.5042 0.5399 0.0443  -0.0483 -0.0362 106 LEU A N   
506  C CA  . LEU A 128 ? 0.2781 0.4903 0.5095 0.0545  -0.0498 -0.0278 106 LEU A CA  
507  C C   . LEU A 128 ? 0.2725 0.4563 0.4773 0.0491  -0.0391 -0.0248 106 LEU A C   
508  O O   . LEU A 128 ? 0.2599 0.4329 0.4702 0.0421  -0.0268 -0.0247 106 LEU A O   
509  C CB  . LEU A 128 ? 0.2884 0.5030 0.5273 0.0663  -0.0445 -0.0188 106 LEU A CB  
510  C CG  . LEU A 128 ? 0.3017 0.5465 0.5715 0.0733  -0.0539 -0.0206 106 LEU A CG  
511  C CD1 . LEU A 128 ? 0.3252 0.5667 0.5982 0.0863  -0.0464 -0.0105 106 LEU A CD1 
512  C CD2 . LEU A 128 ? 0.3187 0.5816 0.5839 0.0782  -0.0738 -0.0242 106 LEU A CD2 
513  N N   . ALA A 129 ? 0.2718 0.4442 0.4479 0.0525  -0.0437 -0.0220 107 ALA A N   
514  C CA  . ALA A 129 ? 0.2704 0.4178 0.4218 0.0483  -0.0348 -0.0189 107 ALA A CA  
515  C C   . ALA A 129 ? 0.2757 0.4072 0.4071 0.0569  -0.0294 -0.0085 107 ALA A C   
516  O O   . ALA A 129 ? 0.3008 0.4356 0.4216 0.0658  -0.0363 -0.0037 107 ALA A O   
517  C CB  . ALA A 129 ? 0.2743 0.4196 0.4103 0.0433  -0.0419 -0.0249 107 ALA A CB  
518  N N   . LYS A 130 ? 0.2735 0.3871 0.3993 0.0540  -0.0169 -0.0051 108 LYS A N   
519  C CA  . LYS A 130 ? 0.2909 0.3857 0.3975 0.0593  -0.0106 0.0028  108 LYS A CA  
520  C C   . LYS A 130 ? 0.3020 0.3821 0.3853 0.0536  -0.0103 0.0026  108 LYS A C   
521  O O   . LYS A 130 ? 0.3045 0.3762 0.3853 0.0452  -0.0051 -0.0009 108 LYS A O   
522  C CB  . LYS A 130 ? 0.3006 0.3846 0.4133 0.0587  0.0021  0.0047  108 LYS A CB  
523  C CG  . LYS A 130 ? 0.3110 0.3743 0.4065 0.0636  0.0093  0.0112  108 LYS A CG  
524  C CD  . LYS A 130 ? 0.3300 0.3965 0.4274 0.0759  0.0061  0.0177  108 LYS A CD  
525  C CE  . LYS A 130 ? 0.3363 0.3800 0.4214 0.0800  0.0160  0.0230  108 LYS A CE  
526  N NZ  . LYS A 130 ? 0.3525 0.3953 0.4341 0.0918  0.0117  0.0309  108 LYS A NZ  
527  N N   . CYS A 131 ? 0.3177 0.3959 0.3848 0.0587  -0.0157 0.0067  109 CYS A N   
528  C CA  . CYS A 131 ? 0.3134 0.3838 0.3617 0.0539  -0.0168 0.0055  109 CYS A CA  
529  C C   . CYS A 131 ? 0.3278 0.3770 0.3594 0.0533  -0.0081 0.0119  109 CYS A C   
530  O O   . CYS A 131 ? 0.3441 0.3869 0.3629 0.0593  -0.0082 0.0191  109 CYS A O   
531  C CB  . CYS A 131 ? 0.3417 0.4234 0.3808 0.0594  -0.0271 0.0060  109 CYS A CB  
532  S SG  . CYS A 131 ? 0.3438 0.4517 0.4023 0.0590  -0.0396 -0.0039 109 CYS A SG  
533  N N   . GLU A 132 ? 0.3195 0.3579 0.3514 0.0459  -0.0009 0.0093  110 GLU A N   
534  C CA  . GLU A 132 ? 0.3465 0.3659 0.3654 0.0439  0.0068  0.0134  110 GLU A CA  
535  C C   . GLU A 132 ? 0.3558 0.3697 0.3596 0.0400  0.0063  0.0142  110 GLU A C   
536  O O   . GLU A 132 ? 0.3652 0.3646 0.3594 0.0378  0.0119  0.0177  110 GLU A O   
537  C CB  . GLU A 132 ? 0.3454 0.3571 0.3691 0.0378  0.0135  0.0097  110 GLU A CB  
538  C CG  . GLU A 132 ? 0.3338 0.3472 0.3700 0.0422  0.0175  0.0102  110 GLU A CG  
539  C CD  . GLU A 132 ? 0.3711 0.3733 0.4023 0.0495  0.0217  0.0161  110 GLU A CD  
540  O OE1 . GLU A 132 ? 0.3791 0.3644 0.3971 0.0470  0.0262  0.0179  110 GLU A OE1 
541  O OE2 . GLU A 132 ? 0.3728 0.3826 0.4146 0.0578  0.0206  0.0188  110 GLU A OE2 
542  N N   . PHE A 133 ? 0.3506 0.3762 0.3531 0.0391  -0.0001 0.0104  111 PHE A N   
543  C CA  . PHE A 133 ? 0.3533 0.3759 0.3425 0.0362  0.0004  0.0108  111 PHE A CA  
544  C C   . PHE A 133 ? 0.3718 0.3898 0.3467 0.0421  0.0011  0.0192  111 PHE A C   
545  O O   . PHE A 133 ? 0.3926 0.4071 0.3561 0.0399  0.0036  0.0209  111 PHE A O   
546  C CB  . PHE A 133 ? 0.3537 0.3883 0.3452 0.0332  -0.0053 0.0029  111 PHE A CB  
547  C CG  . PHE A 133 ? 0.3543 0.4044 0.3512 0.0380  -0.0141 -0.0006 111 PHE A CG  
548  C CD1 . PHE A 133 ? 0.3675 0.4241 0.3516 0.0436  -0.0193 0.0013  111 PHE A CD1 
549  C CD2 . PHE A 133 ? 0.3494 0.4083 0.3644 0.0363  -0.0173 -0.0062 111 PHE A CD2 
550  C CE1 . PHE A 133 ? 0.3869 0.4595 0.3755 0.0478  -0.0292 -0.0033 111 PHE A CE1 
551  C CE2 . PHE A 133 ? 0.3632 0.4383 0.3860 0.0397  -0.0264 -0.0107 111 PHE A CE2 
552  C CZ  . PHE A 133 ? 0.3781 0.4605 0.3874 0.0456  -0.0332 -0.0097 111 PHE A CZ  
553  N N   . PHE A 134 ? 0.3788 0.3972 0.3549 0.0502  -0.0006 0.0250  112 PHE A N   
554  C CA  . PHE A 134 ? 0.4040 0.4143 0.3661 0.0565  0.0015  0.0352  112 PHE A CA  
555  C C   . PHE A 134 ? 0.3926 0.3820 0.3510 0.0544  0.0113  0.0413  112 PHE A C   
556  O O   . PHE A 134 ? 0.4531 0.4324 0.4006 0.0587  0.0148  0.0506  112 PHE A O   
557  C CB  . PHE A 134 ? 0.4434 0.4629 0.4080 0.0676  -0.0054 0.0398  112 PHE A CB  
558  C CG  . PHE A 134 ? 0.4601 0.4995 0.4232 0.0705  -0.0161 0.0349  112 PHE A CG  
559  C CD1 . PHE A 134 ? 0.5157 0.5574 0.4596 0.0745  -0.0189 0.0392  112 PHE A CD1 
560  C CD2 . PHE A 134 ? 0.4493 0.5045 0.4297 0.0687  -0.0229 0.0255  112 PHE A CD2 
561  C CE1 . PHE A 134 ? 0.5357 0.5956 0.4762 0.0773  -0.0295 0.0331  112 PHE A CE1 
562  C CE2 . PHE A 134 ? 0.4827 0.5558 0.4627 0.0704  -0.0335 0.0192  112 PHE A CE2 
563  C CZ  . PHE A 134 ? 0.5045 0.5801 0.4636 0.0749  -0.0374 0.0224  112 PHE A CZ  
564  N N   . ASN A 135 ? 0.3701 0.3522 0.3370 0.0480  0.0158  0.0364  113 ASN A N   
565  C CA  . ASN A 135 ? 0.3722 0.3348 0.3352 0.0443  0.0242  0.0398  113 ASN A CA  
566  C C   . ASN A 135 ? 0.3975 0.3546 0.3507 0.0379  0.0281  0.0418  113 ASN A C   
567  O O   . ASN A 135 ? 0.4081 0.3767 0.3592 0.0346  0.0251  0.0380  113 ASN A O   
568  C CB  . ASN A 135 ? 0.3548 0.3122 0.3264 0.0386  0.0271  0.0327  113 ASN A CB  
569  C CG  . ASN A 135 ? 0.3660 0.3244 0.3472 0.0452  0.0272  0.0322  113 ASN A CG  
570  O OD1 . ASN A 135 ? 0.4054 0.3591 0.3866 0.0537  0.0282  0.0386  113 ASN A OD1 
571  N ND2 . ASN A 135 ? 0.3490 0.3134 0.3388 0.0418  0.0269  0.0253  113 ASN A ND2 
572  N N   . ALA A 136 ? 0.3992 0.3386 0.3479 0.0359  0.0354  0.0473  114 ALA A N   
573  C CA  . ALA A 136 ? 0.4155 0.3488 0.3574 0.0298  0.0409  0.0508  114 ALA A CA  
574  C C   . ALA A 136 ? 0.3956 0.3391 0.3411 0.0209  0.0398  0.0430  114 ALA A C   
575  O O   . ALA A 136 ? 0.4104 0.3591 0.3503 0.0193  0.0418  0.0454  114 ALA A O   
576  C CB  . ALA A 136 ? 0.4296 0.3414 0.3719 0.0257  0.0490  0.0542  114 ALA A CB  
577  N N   . GLY A 137 ? 0.3708 0.3165 0.3251 0.0159  0.0376  0.0345  115 GLY A N   
578  C CA  . GLY A 137 ? 0.3703 0.3249 0.3293 0.0087  0.0359  0.0275  115 GLY A CA  
579  C C   . GLY A 137 ? 0.3610 0.3318 0.3230 0.0113  0.0293  0.0222  115 GLY A C   
580  O O   . GLY A 137 ? 0.3645 0.3429 0.3304 0.0070  0.0278  0.0170  115 GLY A O   
581  N N   . GLY A 138 ? 0.3676 0.3436 0.3287 0.0187  0.0252  0.0235  116 GLY A N   
582  C CA  . GLY A 138 ? 0.3482 0.3388 0.3135 0.0208  0.0186  0.0179  116 GLY A CA  
583  C C   . GLY A 138 ? 0.3321 0.3251 0.3081 0.0197  0.0160  0.0124  116 GLY A C   
584  O O   . GLY A 138 ? 0.3226 0.3260 0.3043 0.0194  0.0116  0.0071  116 GLY A O   
585  N N   . SER A 139 ? 0.3378 0.3207 0.3165 0.0189  0.0195  0.0134  117 SER A N   
586  C CA  . SER A 139 ? 0.3311 0.3163 0.3186 0.0183  0.0186  0.0090  117 SER A CA  
587  C C   . SER A 139 ? 0.3391 0.3147 0.3281 0.0212  0.0228  0.0110  117 SER A C   
588  O O   . SER A 139 ? 0.3401 0.3037 0.3233 0.0225  0.0268  0.0150  117 SER A O   
589  C CB  . SER A 139 ? 0.3226 0.3068 0.3117 0.0114  0.0189  0.0042  117 SER A CB  
590  O OG  . SER A 139 ? 0.3111 0.2830 0.2957 0.0078  0.0230  0.0045  117 SER A OG  
591  N N   . VAL A 140 ? 0.3329 0.3133 0.3304 0.0217  0.0227  0.0078  118 VAL A N   
592  C CA  . VAL A 140 ? 0.3433 0.3164 0.3436 0.0242  0.0279  0.0079  118 VAL A CA  
593  C C   . VAL A 140 ? 0.3551 0.3121 0.3460 0.0200  0.0330  0.0067  118 VAL A C   
594  O O   . VAL A 140 ? 0.3466 0.2931 0.3355 0.0231  0.0379  0.0075  118 VAL A O   
595  C CB  . VAL A 140 ? 0.3332 0.3151 0.3442 0.0234  0.0283  0.0044  118 VAL A CB  
596  C CG1 . VAL A 140 ? 0.3307 0.3116 0.3389 0.0164  0.0280  0.0010  118 VAL A CG1 
597  C CG2 . VAL A 140 ? 0.3570 0.3334 0.3716 0.0271  0.0351  0.0046  118 VAL A CG2 
598  N N   . LYS A 141 ? 0.3483 0.3038 0.3340 0.0132  0.0314  0.0042  119 LYS A N   
599  C CA  . LYS A 141 ? 0.3458 0.2882 0.3232 0.0083  0.0343  0.0017  119 LYS A CA  
600  C C   . LYS A 141 ? 0.3532 0.2832 0.3255 0.0078  0.0372  0.0039  119 LYS A C   
601  O O   . LYS A 141 ? 0.3597 0.2769 0.3263 0.0043  0.0402  0.0007  119 LYS A O   
602  C CB  . LYS A 141 ? 0.3499 0.2966 0.3255 0.0018  0.0306  -0.0012 119 LYS A CB  
603  C CG  . LYS A 141 ? 0.3556 0.3104 0.3349 0.0016  0.0287  -0.0031 119 LYS A CG  
604  C CD  . LYS A 141 ? 0.3751 0.3231 0.3511 0.0032  0.0334  -0.0044 119 LYS A CD  
605  C CE  . LYS A 141 ? 0.3914 0.3412 0.3647 0.0004  0.0324  -0.0060 119 LYS A CE  
606  N NZ  . LYS A 141 ? 0.3898 0.3513 0.3734 0.0008  0.0290  -0.0047 119 LYS A NZ  
607  N N   . ASP A 142 ? 0.3595 0.2921 0.3329 0.0109  0.0365  0.0093  120 ASP A N   
608  C CA  . ASP A 142 ? 0.3734 0.2921 0.3425 0.0114  0.0407  0.0133  120 ASP A CA  
609  C C   . ASP A 142 ? 0.4010 0.3055 0.3692 0.0159  0.0460  0.0127  120 ASP A C   
610  O O   . ASP A 142 ? 0.3868 0.2747 0.3509 0.0135  0.0504  0.0125  120 ASP A O   
611  C CB  . ASP A 142 ? 0.4048 0.3288 0.3733 0.0165  0.0396  0.0208  120 ASP A CB  
612  C CG  . ASP A 142 ? 0.4201 0.3566 0.3879 0.0123  0.0359  0.0205  120 ASP A CG  
613  O OD1 . ASP A 142 ? 0.4259 0.3625 0.3945 0.0046  0.0358  0.0160  120 ASP A OD1 
614  O OD2 . ASP A 142 ? 0.4261 0.3733 0.3929 0.0171  0.0328  0.0240  120 ASP A OD2 
615  N N   . ARG A 143 ? 0.3730 0.2841 0.3465 0.0224  0.0460  0.0122  121 ARG A N   
616  C CA  . ARG A 143 ? 0.3806 0.2797 0.3544 0.0277  0.0521  0.0110  121 ARG A CA  
617  C C   . ARG A 143 ? 0.3727 0.2591 0.3387 0.0213  0.0556  0.0033  121 ARG A C   
618  O O   . ARG A 143 ? 0.3922 0.2612 0.3539 0.0219  0.0608  0.0015  121 ARG A O   
619  C CB  . ARG A 143 ? 0.3605 0.2727 0.3441 0.0348  0.0521  0.0111  121 ARG A CB  
620  C CG  . ARG A 143 ? 0.3739 0.2995 0.3661 0.0425  0.0476  0.0175  121 ARG A CG  
621  C CD  . ARG A 143 ? 0.3634 0.3038 0.3690 0.0478  0.0475  0.0161  121 ARG A CD  
622  N NE  . ARG A 143 ? 0.3659 0.3230 0.3813 0.0544  0.0410  0.0205  121 ARG A NE  
623  C CZ  . ARG A 143 ? 0.3699 0.3292 0.3925 0.0648  0.0410  0.0255  121 ARG A CZ  
624  N NH1 . ARG A 143 ? 0.4096 0.3534 0.4312 0.0704  0.0483  0.0272  121 ARG A NH1 
625  N NH2 . ARG A 143 ? 0.3567 0.3336 0.3875 0.0703  0.0331  0.0287  121 ARG A NH2 
626  N N   . ILE A 144 ? 0.3643 0.2589 0.3280 0.0154  0.0524  -0.0015 122 ILE A N   
627  C CA  . ILE A 144 ? 0.3842 0.2685 0.3383 0.0105  0.0547  -0.0089 122 ILE A CA  
628  C C   . ILE A 144 ? 0.4085 0.2840 0.3568 0.0019  0.0523  -0.0123 122 ILE A C   
629  O O   . ILE A 144 ? 0.3985 0.2602 0.3388 -0.0015 0.0547  -0.0186 122 ILE A O   
630  C CB  . ILE A 144 ? 0.4005 0.2954 0.3529 0.0090  0.0530  -0.0116 122 ILE A CB  
631  C CG1 . ILE A 144 ? 0.3925 0.2982 0.3453 0.0027  0.0456  -0.0114 122 ILE A CG1 
632  C CG2 . ILE A 144 ? 0.3882 0.2943 0.3507 0.0162  0.0556  -0.0081 122 ILE A CG2 
633  C CD1 . ILE A 144 ? 0.3835 0.2941 0.3312 0.0008  0.0444  -0.0140 122 ILE A CD1 
634  N N   . SER A 145 ? 0.4066 0.2900 0.3596 -0.0017 0.0480  -0.0084 123 SER A N   
635  C CA  . SER A 145 ? 0.4119 0.2885 0.3637 -0.0100 0.0468  -0.0105 123 SER A CA  
636  C C   . SER A 145 ? 0.4101 0.2667 0.3602 -0.0098 0.0529  -0.0103 123 SER A C   
637  O O   . SER A 145 ? 0.4450 0.2889 0.3911 -0.0162 0.0539  -0.0171 123 SER A O   
638  C CB  . SER A 145 ? 0.4217 0.3113 0.3801 -0.0121 0.0434  -0.0050 123 SER A CB  
639  O OG  . SER A 145 ? 0.4782 0.3834 0.4381 -0.0130 0.0379  -0.0069 123 SER A OG  
640  N N   . LEU A 146 ? 0.4086 0.2619 0.3620 -0.0022 0.0566  -0.0026 124 LEU A N   
641  C CA  . LEU A 146 ? 0.4206 0.2530 0.3730 -0.0002 0.0632  -0.0007 124 LEU A CA  
642  C C   . LEU A 146 ? 0.4431 0.2604 0.3900 0.0020  0.0678  -0.0088 124 LEU A C   
643  O O   . LEU A 146 ? 0.4381 0.2361 0.3816 -0.0026 0.0715  -0.0141 124 LEU A O   
644  C CB  . LEU A 146 ? 0.4365 0.2704 0.3925 0.0100  0.0653  0.0101  124 LEU A CB  
645  C CG  . LEU A 146 ? 0.4832 0.2949 0.4387 0.0151  0.0726  0.0149  124 LEU A CG  
646  C CD1 . LEU A 146 ? 0.5188 0.3152 0.4733 0.0052  0.0757  0.0148  124 LEU A CD1 
647  C CD2 . LEU A 146 ? 0.4969 0.3139 0.4552 0.0267  0.0726  0.0268  124 LEU A CD2 
648  N N   . ARG A 147 ? 0.4507 0.2762 0.3973 0.0092  0.0682  -0.0098 125 ARG A N   
649  C CA  . ARG A 147 ? 0.4969 0.3089 0.4374 0.0124  0.0740  -0.0174 125 ARG A CA  
650  C C   . ARG A 147 ? 0.4856 0.2903 0.4153 0.0027  0.0722  -0.0289 125 ARG A C   
651  O O   . ARG A 147 ? 0.4946 0.2798 0.4176 0.0016  0.0770  -0.0364 125 ARG A O   
652  C CB  . ARG A 147 ? 0.5238 0.3488 0.4677 0.0212  0.0758  -0.0160 125 ARG A CB  
653  C CG  . ARG A 147 ? 0.5633 0.3773 0.4988 0.0238  0.0826  -0.0248 125 ARG A CG  
654  C CD  . ARG A 147 ? 0.6567 0.4490 0.5922 0.0302  0.0910  -0.0264 125 ARG A CD  
655  N NE  . ARG A 147 ? 0.7148 0.5172 0.6614 0.0421  0.0949  -0.0203 125 ARG A NE  
656  C CZ  . ARG A 147 ? 0.6060 0.4078 0.5536 0.0497  0.1025  -0.0238 125 ARG A CZ  
657  N NH1 . ARG A 147 ? 0.6631 0.4501 0.5982 0.0487  0.1092  -0.0341 125 ARG A NH1 
658  N NH2 . ARG A 147 ? 0.5932 0.4099 0.5556 0.0593  0.1036  -0.0166 125 ARG A NH2 
659  N N   . MET A 148 ? 0.4675 0.2876 0.3951 -0.0037 0.0649  -0.0306 126 MET A N   
660  C CA  . MET A 148 ? 0.4714 0.2876 0.3883 -0.0121 0.0611  -0.0410 126 MET A CA  
661  C C   . MET A 148 ? 0.4703 0.2719 0.3884 -0.0209 0.0605  -0.0457 126 MET A C   
662  O O   . MET A 148 ? 0.4830 0.2707 0.3921 -0.0256 0.0610  -0.0564 126 MET A O   
663  C CB  . MET A 148 ? 0.4506 0.2865 0.3669 -0.0162 0.0528  -0.0403 126 MET A CB  
664  C CG  . MET A 148 ? 0.4643 0.3108 0.3762 -0.0100 0.0538  -0.0387 126 MET A CG  
665  S SD  . MET A 148 ? 0.4579 0.3221 0.3661 -0.0146 0.0446  -0.0385 126 MET A SD  
666  C CE  . MET A 148 ? 0.4480 0.3266 0.3729 -0.0168 0.0395  -0.0307 126 MET A CE  
667  N N   . ILE A 149 ? 0.4511 0.2557 0.3803 -0.0235 0.0599  -0.0382 127 ILE A N   
668  C CA  . ILE A 149 ? 0.4776 0.2680 0.4108 -0.0326 0.0610  -0.0415 127 ILE A CA  
669  C C   . ILE A 149 ? 0.4984 0.2623 0.4291 -0.0294 0.0697  -0.0439 127 ILE A C   
670  O O   . ILE A 149 ? 0.5150 0.2621 0.4424 -0.0370 0.0706  -0.0542 127 ILE A O   
671  C CB  . ILE A 149 ? 0.4693 0.2687 0.4143 -0.0360 0.0602  -0.0316 127 ILE A CB  
672  C CG1 . ILE A 149 ? 0.4560 0.2786 0.4042 -0.0413 0.0515  -0.0326 127 ILE A CG1 
673  C CG2 . ILE A 149 ? 0.4849 0.2660 0.4361 -0.0443 0.0648  -0.0325 127 ILE A CG2 
674  C CD1 . ILE A 149 ? 0.4573 0.2924 0.4158 -0.0426 0.0513  -0.0232 127 ILE A CD1 
675  N N   . GLU A 150 ? 0.5109 0.2709 0.4441 -0.0181 0.0757  -0.0351 128 GLU A N   
676  C CA  . GLU A 150 ? 0.5590 0.2927 0.4911 -0.0129 0.0848  -0.0362 128 GLU A CA  
677  C C   . GLU A 150 ? 0.5414 0.2616 0.4622 -0.0128 0.0874  -0.0503 128 GLU A C   
678  O O   . GLU A 150 ? 0.5476 0.2442 0.4658 -0.0168 0.0919  -0.0582 128 GLU A O   
679  C CB  . GLU A 150 ? 0.5985 0.3339 0.5361 0.0011  0.0895  -0.0236 128 GLU A CB  
680  C CG  . GLU A 150 ? 0.6876 0.4304 0.6329 0.0000  0.0877  -0.0107 128 GLU A CG  
681  C CD  . GLU A 150 ? 0.7500 0.4855 0.6995 0.0122  0.0929  0.0024  128 GLU A CD  
682  O OE1 . GLU A 150 ? 0.7685 0.5104 0.7193 0.0242  0.0938  0.0049  128 GLU A OE1 
683  O OE2 . GLU A 150 ? 0.7701 0.4957 0.7222 0.0095  0.0957  0.0108  128 GLU A OE2 
684  N N   . ASP A 151 ? 0.5298 0.2645 0.4431 -0.0089 0.0849  -0.0538 129 ASP A N   
685  C CA  . ASP A 151 ? 0.5541 0.2776 0.4534 -0.0080 0.0881  -0.0669 129 ASP A CA  
686  C C   . ASP A 151 ? 0.5624 0.2789 0.4531 -0.0213 0.0821  -0.0801 129 ASP A C   
687  O O   . ASP A 151 ? 0.5916 0.2870 0.4736 -0.0234 0.0860  -0.0920 129 ASP A O   
688  C CB  . ASP A 151 ? 0.5380 0.2802 0.4314 -0.0011 0.0876  -0.0656 129 ASP A CB  
689  C CG  . ASP A 151 ? 0.5333 0.2804 0.4364 0.0124  0.0946  -0.0557 129 ASP A CG  
690  O OD1 . ASP A 151 ? 0.5482 0.2817 0.4595 0.0184  0.1004  -0.0511 129 ASP A OD1 
691  O OD2 . ASP A 151 ? 0.5308 0.2960 0.4346 0.0172  0.0942  -0.0522 129 ASP A OD2 
692  N N   . ALA A 152 ? 0.5463 0.2805 0.4406 -0.0301 0.0724  -0.0786 130 ALA A N   
693  C CA  . ALA A 152 ? 0.5558 0.2879 0.4449 -0.0428 0.0647  -0.0909 130 ALA A CA  
694  C C   . ALA A 152 ? 0.5837 0.2951 0.4819 -0.0515 0.0676  -0.0951 130 ALA A C   
695  O O   . ALA A 152 ? 0.5958 0.2952 0.4878 -0.0606 0.0645  -0.1095 130 ALA A O   
696  C CB  . ALA A 152 ? 0.5364 0.2944 0.4306 -0.0487 0.0539  -0.0869 130 ALA A CB  
697  N N   . GLU A 153 ? 0.5790 0.2855 0.4912 -0.0491 0.0733  -0.0829 131 GLU A N   
698  C CA  . GLU A 153 ? 0.6165 0.2994 0.5374 -0.0564 0.0787  -0.0851 131 GLU A CA  
699  C C   . GLU A 153 ? 0.6597 0.3131 0.5718 -0.0514 0.0874  -0.0942 131 GLU A C   
700  O O   . GLU A 153 ? 0.6563 0.2890 0.5682 -0.0607 0.0886  -0.1061 131 GLU A O   
701  C CB  . GLU A 153 ? 0.6272 0.3103 0.5623 -0.0538 0.0838  -0.0682 131 GLU A CB  
702  C CG  . GLU A 153 ? 0.6173 0.3246 0.5630 -0.0614 0.0770  -0.0612 131 GLU A CG  
703  C CD  . GLU A 153 ? 0.6307 0.3406 0.5856 -0.0562 0.0825  -0.0436 131 GLU A CD  
704  O OE1 . GLU A 153 ? 0.6449 0.3426 0.5976 -0.0448 0.0896  -0.0352 131 GLU A OE1 
705  O OE2 . GLU A 153 ? 0.6353 0.3607 0.5993 -0.0627 0.0796  -0.0378 131 GLU A OE2 
706  N N   . ARG A 154 ? 0.6745 0.3262 0.5807 -0.0368 0.0937  -0.0893 132 ARG A N   
707  C CA  . ARG A 154 ? 0.7120 0.3361 0.6116 -0.0298 0.1035  -0.0969 132 ARG A CA  
708  C C   . ARG A 154 ? 0.7414 0.3586 0.6236 -0.0351 0.1007  -0.1169 132 ARG A C   
709  O O   . ARG A 154 ? 0.7715 0.3618 0.6491 -0.0380 0.1058  -0.1291 132 ARG A O   
710  C CB  . ARG A 154 ? 0.7192 0.3480 0.6194 -0.0124 0.1105  -0.0865 132 ARG A CB  
711  C CG  . ARG A 154 ? 0.7737 0.3732 0.6736 -0.0026 0.1225  -0.0895 132 ARG A CG  
712  C CD  . ARG A 154 ? 0.7733 0.3807 0.6814 0.0145  0.1283  -0.0749 132 ARG A CD  
713  N NE  . ARG A 154 ? 0.7788 0.4125 0.6815 0.0196  0.1250  -0.0749 132 ARG A NE  
714  C CZ  . ARG A 154 ? 0.7536 0.4151 0.6634 0.0228  0.1194  -0.0627 132 ARG A CZ  
715  N NH1 . ARG A 154 ? 0.7800 0.4485 0.7017 0.0234  0.1164  -0.0488 132 ARG A NH1 
716  N NH2 . ARG A 154 ? 0.7425 0.4241 0.6468 0.0258  0.1175  -0.0648 132 ARG A NH2 
717  N N   . ASP A 155 ? 0.7362 0.3771 0.6079 -0.0360 0.0926  -0.1196 133 ASP A N   
718  C CA  . ASP A 155 ? 0.7706 0.4112 0.6232 -0.0421 0.0867  -0.1369 133 ASP A CA  
719  C C   . ASP A 155 ? 0.7828 0.4131 0.6360 -0.0578 0.0795  -0.1507 133 ASP A C   
720  O O   . ASP A 155 ? 0.8003 0.4233 0.6366 -0.0618 0.0761  -0.1671 133 ASP A O   
721  C CB  . ASP A 155 ? 0.7822 0.4537 0.6284 -0.0427 0.0766  -0.1328 133 ASP A CB  
722  C CG  . ASP A 155 ? 0.8148 0.4960 0.6519 -0.0294 0.0823  -0.1268 133 ASP A CG  
723  O OD1 . ASP A 155 ? 0.8858 0.5506 0.7217 -0.0199 0.0938  -0.1275 133 ASP A OD1 
724  O OD2 . ASP A 155 ? 0.7793 0.4838 0.6123 -0.0284 0.0760  -0.1213 133 ASP A OD2 
725  N N   . GLY A 156 ? 0.7897 0.4235 0.6620 -0.0672 0.0760  -0.1442 134 GLY A N   
726  C CA  . GLY A 156 ? 0.8145 0.4460 0.6912 -0.0839 0.0672  -0.1571 134 GLY A CA  
727  C C   . GLY A 156 ? 0.7894 0.4514 0.6640 -0.0905 0.0526  -0.1586 134 GLY A C   
728  O O   . GLY A 156 ? 0.8477 0.5126 0.7277 -0.1041 0.0435  -0.1693 134 GLY A O   
729  N N   . THR A 157 ? 0.7534 0.4379 0.6217 -0.0808 0.0503  -0.1480 135 THR A N   
730  C CA  . THR A 157 ? 0.7618 0.4750 0.6293 -0.0848 0.0373  -0.1465 135 THR A CA  
731  C C   . THR A 157 ? 0.7476 0.4753 0.6398 -0.0937 0.0329  -0.1380 135 THR A C   
732  O O   . THR A 157 ? 0.7657 0.5068 0.6643 -0.1044 0.0219  -0.1447 135 THR A O   
733  C CB  . THR A 157 ? 0.7563 0.4872 0.6156 -0.0720 0.0386  -0.1344 135 THR A CB  
734  O OG1 . THR A 157 ? 0.8028 0.5213 0.6413 -0.0629 0.0453  -0.1404 135 THR A OG1 
735  C CG2 . THR A 157 ? 0.7815 0.5396 0.6384 -0.0748 0.0255  -0.1328 135 THR A CG2 
736  N N   . LEU A 158 ? 0.7055 0.4313 0.6115 -0.0887 0.0417  -0.1230 136 LEU A N   
737  C CA  . LEU A 158 ? 0.6847 0.4252 0.6119 -0.0948 0.0400  -0.1126 136 LEU A CA  
738  C C   . LEU A 158 ? 0.6890 0.4088 0.6313 -0.1040 0.0470  -0.1137 136 LEU A C   
739  O O   . LEU A 158 ? 0.6991 0.3971 0.6407 -0.0978 0.0581  -0.1083 136 LEU A O   
740  C CB  . LEU A 158 ? 0.6604 0.4128 0.5907 -0.0828 0.0450  -0.0950 136 LEU A CB  
741  C CG  . LEU A 158 ? 0.6494 0.4246 0.5955 -0.0855 0.0416  -0.0838 136 LEU A CG  
742  C CD1 . LEU A 158 ? 0.6339 0.4320 0.5817 -0.0922 0.0288  -0.0904 136 LEU A CD1 
743  C CD2 . LEU A 158 ? 0.6168 0.4019 0.5612 -0.0726 0.0457  -0.0695 136 LEU A CD2 
744  N N   . LYS A 159 ? 0.6970 0.4240 0.6539 -0.1184 0.0407  -0.1200 137 LYS A N   
745  C CA  . LYS A 159 ? 0.7445 0.4526 0.7185 -0.1302 0.0472  -0.1220 137 LYS A CA  
746  C C   . LYS A 159 ? 0.7175 0.4398 0.7126 -0.1343 0.0507  -0.1074 137 LYS A C   
747  O O   . LYS A 159 ? 0.6453 0.3956 0.6440 -0.1316 0.0445  -0.1005 137 LYS A O   
748  C CB  . LYS A 159 ? 0.7982 0.5048 0.7777 -0.1462 0.0380  -0.1414 137 LYS A CB  
749  C CG  . LYS A 159 ? 0.8548 0.5548 0.8115 -0.1444 0.0305  -0.1589 137 LYS A CG  
750  C CD  . LYS A 159 ? 0.9173 0.5832 0.8605 -0.1378 0.0418  -0.1634 137 LYS A CD  
751  C CE  . LYS A 159 ? 0.9843 0.6391 0.9080 -0.1412 0.0350  -0.1853 137 LYS A CE  
752  N NZ  . LYS A 159 ? 1.0343 0.6542 0.9461 -0.1346 0.0473  -0.1910 137 LYS A NZ  
753  N N   . PRO A 160 ? 0.7352 0.4374 0.7444 -0.1415 0.0610  -0.1032 138 PRO A N   
754  C CA  . PRO A 160 ? 0.7207 0.4354 0.7487 -0.1455 0.0663  -0.0887 138 PRO A CA  
755  C C   . PRO A 160 ? 0.6918 0.4384 0.7346 -0.1554 0.0555  -0.0931 138 PRO A C   
756  O O   . PRO A 160 ? 0.6869 0.4368 0.7362 -0.1672 0.0467  -0.1090 138 PRO A O   
757  C CB  . PRO A 160 ? 0.7463 0.4315 0.7870 -0.1556 0.0778  -0.0884 138 PRO A CB  
758  C CG  . PRO A 160 ? 0.7683 0.4225 0.7924 -0.1481 0.0824  -0.0948 138 PRO A CG  
759  C CD  . PRO A 160 ? 0.7603 0.4259 0.7675 -0.1443 0.0702  -0.1095 138 PRO A CD  
760  N N   . GLY A 161 ? 0.6816 0.4520 0.7290 -0.1495 0.0556  -0.0800 139 GLY A N   
761  C CA  . GLY A 161 ? 0.6725 0.4748 0.7356 -0.1565 0.0465  -0.0823 139 GLY A CA  
762  C C   . GLY A 161 ? 0.6686 0.4914 0.7227 -0.1541 0.0306  -0.0934 139 GLY A C   
763  O O   . GLY A 161 ? 0.6770 0.5245 0.7461 -0.1610 0.0217  -0.0978 139 GLY A O   
764  N N   . ASP A 162 ? 0.6304 0.4439 0.6608 -0.1438 0.0274  -0.0973 140 ASP A N   
765  C CA  . ASP A 162 ? 0.6088 0.4407 0.6272 -0.1397 0.0136  -0.1051 140 ASP A CA  
766  C C   . ASP A 162 ? 0.5290 0.3861 0.5492 -0.1307 0.0111  -0.0932 140 ASP A C   
767  O O   . ASP A 162 ? 0.5402 0.3993 0.5673 -0.1264 0.0200  -0.0800 140 ASP A O   
768  C CB  . ASP A 162 ? 0.6238 0.4382 0.6151 -0.1304 0.0134  -0.1108 140 ASP A CB  
769  C CG  . ASP A 162 ? 0.6601 0.4552 0.6450 -0.1392 0.0104  -0.1284 140 ASP A CG  
770  O OD1 . ASP A 162 ? 0.6942 0.4906 0.6962 -0.1534 0.0066  -0.1372 140 ASP A OD1 
771  O OD2 . ASP A 162 ? 0.6506 0.4294 0.6135 -0.1321 0.0120  -0.1342 140 ASP A OD2 
772  N N   . THR A 163 ? 0.5041 0.3794 0.5166 -0.1272 -0.0010 -0.0979 141 THR A N   
773  C CA  . THR A 163 ? 0.4789 0.3761 0.4915 -0.1179 -0.0040 -0.0880 141 THR A CA  
774  C C   . THR A 163 ? 0.4805 0.3729 0.4697 -0.1045 -0.0038 -0.0842 141 THR A C   
775  O O   . THR A 163 ? 0.5147 0.3996 0.4862 -0.1027 -0.0088 -0.0926 141 THR A O   
776  C CB  . THR A 163 ? 0.4620 0.3853 0.4862 -0.1226 -0.0175 -0.0935 141 THR A CB  
777  O OG1 . THR A 163 ? 0.4643 0.3952 0.5145 -0.1348 -0.0161 -0.0956 141 THR A OG1 
778  C CG2 . THR A 163 ? 0.4419 0.3855 0.4668 -0.1126 -0.0202 -0.0837 141 THR A CG2 
779  N N   . ILE A 164 ? 0.4561 0.3538 0.4459 -0.0956 0.0022  -0.0719 142 ILE A N   
780  C CA  . ILE A 164 ? 0.4771 0.3743 0.4503 -0.0834 0.0031  -0.0666 142 ILE A CA  
781  C C   . ILE A 164 ? 0.4306 0.3512 0.4076 -0.0792 -0.0047 -0.0626 142 ILE A C   
782  O O   . ILE A 164 ? 0.4161 0.3509 0.4090 -0.0805 -0.0041 -0.0570 142 ILE A O   
783  C CB  . ILE A 164 ? 0.4926 0.3797 0.4654 -0.0764 0.0146  -0.0561 142 ILE A CB  
784  C CG1 . ILE A 164 ? 0.5467 0.4088 0.5152 -0.0787 0.0225  -0.0593 142 ILE A CG1 
785  C CG2 . ILE A 164 ? 0.5207 0.4111 0.4814 -0.0647 0.0153  -0.0505 142 ILE A CG2 
786  C CD1 . ILE A 164 ? 0.5834 0.4363 0.5546 -0.0726 0.0330  -0.0480 142 ILE A CD1 
787  N N   . ILE A 165 ? 0.4115 0.3350 0.3734 -0.0740 -0.0111 -0.0652 143 ILE A N   
788  C CA  . ILE A 165 ? 0.3911 0.3330 0.3544 -0.0686 -0.0179 -0.0605 143 ILE A CA  
789  C C   . ILE A 165 ? 0.4035 0.3393 0.3511 -0.0585 -0.0136 -0.0550 143 ILE A C   
790  O O   . ILE A 165 ? 0.4615 0.3842 0.3915 -0.0565 -0.0122 -0.0592 143 ILE A O   
791  C CB  . ILE A 165 ? 0.3994 0.3512 0.3587 -0.0718 -0.0307 -0.0683 143 ILE A CB  
792  C CG1 . ILE A 165 ? 0.4131 0.3702 0.3893 -0.0836 -0.0353 -0.0763 143 ILE A CG1 
793  C CG2 . ILE A 165 ? 0.3851 0.3542 0.3460 -0.0647 -0.0372 -0.0619 143 ILE A CG2 
794  C CD1 . ILE A 165 ? 0.4349 0.4031 0.4084 -0.0875 -0.0496 -0.0854 143 ILE A CD1 
795  N N   . GLU A 166 ? 0.3721 0.3168 0.3262 -0.0524 -0.0110 -0.0463 144 GLU A N   
796  C CA  . GLU A 166 ? 0.3862 0.3259 0.3288 -0.0440 -0.0066 -0.0412 144 GLU A CA  
797  C C   . GLU A 166 ? 0.3713 0.3244 0.3180 -0.0386 -0.0102 -0.0351 144 GLU A C   
798  O O   . GLU A 166 ? 0.3489 0.3131 0.3104 -0.0387 -0.0106 -0.0316 144 GLU A O   
799  C CB  . GLU A 166 ? 0.3963 0.3271 0.3416 -0.0409 0.0033  -0.0367 144 GLU A CB  
800  C CG  . GLU A 166 ? 0.4049 0.3312 0.3412 -0.0331 0.0083  -0.0327 144 GLU A CG  
801  C CD  . GLU A 166 ? 0.4646 0.3769 0.3842 -0.0318 0.0114  -0.0377 144 GLU A CD  
802  O OE1 . GLU A 166 ? 0.4619 0.3651 0.3751 -0.0368 0.0099  -0.0453 144 GLU A OE1 
803  O OE2 . GLU A 166 ? 0.4844 0.3948 0.3978 -0.0257 0.0160  -0.0343 144 GLU A OE2 
804  N N   . PRO A 167 ? 0.3744 0.3252 0.3074 -0.0336 -0.0116 -0.0336 145 PRO A N   
805  C CA  . PRO A 167 ? 0.3618 0.3203 0.2977 -0.0277 -0.0124 -0.0269 145 PRO A CA  
806  C C   . PRO A 167 ? 0.3679 0.3234 0.3089 -0.0238 -0.0039 -0.0219 145 PRO A C   
807  O O   . PRO A 167 ? 0.3826 0.3280 0.3158 -0.0223 0.0025  -0.0222 145 PRO A O   
808  C CB  . PRO A 167 ? 0.3845 0.3385 0.3018 -0.0245 -0.0154 -0.0267 145 PRO A CB  
809  C CG  . PRO A 167 ? 0.3922 0.3328 0.2950 -0.0267 -0.0114 -0.0327 145 PRO A CG  
810  C CD  . PRO A 167 ? 0.3940 0.3326 0.3072 -0.0331 -0.0107 -0.0381 145 PRO A CD  
811  N N   . THR A 168 ? 0.3280 0.2928 0.2823 -0.0219 -0.0040 -0.0181 146 THR A N   
812  C CA  . THR A 168 ? 0.3362 0.3001 0.2966 -0.0192 0.0024  -0.0149 146 THR A CA  
813  C C   . THR A 168 ? 0.3293 0.3024 0.2997 -0.0159 0.0010  -0.0116 146 THR A C   
814  O O   . THR A 168 ? 0.3265 0.3075 0.3028 -0.0161 -0.0041 -0.0116 146 THR A O   
815  C CB  . THR A 168 ? 0.3468 0.3095 0.3131 -0.0222 0.0055  -0.0162 146 THR A CB  
816  O OG1 . THR A 168 ? 0.3171 0.2813 0.2890 -0.0187 0.0100  -0.0130 146 THR A OG1 
817  C CG2 . THR A 168 ? 0.3626 0.3347 0.3389 -0.0263 0.0016  -0.0177 146 THR A CG2 
818  N N   . SER A 169 ? 0.3215 0.2934 0.2948 -0.0128 0.0054  -0.0092 147 SER A N   
819  C CA  . SER A 169 ? 0.3329 0.3115 0.3162 -0.0103 0.0050  -0.0078 147 SER A CA  
820  C C   . SER A 169 ? 0.3422 0.3268 0.3331 -0.0109 0.0060  -0.0091 147 SER A C   
821  O O   . SER A 169 ? 0.3482 0.3389 0.3466 -0.0090 0.0055  -0.0095 147 SER A O   
822  C CB  . SER A 169 ? 0.3398 0.3150 0.3240 -0.0077 0.0089  -0.0057 147 SER A CB  
823  O OG  . SER A 169 ? 0.3482 0.3200 0.3306 -0.0074 0.0134  -0.0060 147 SER A OG  
824  N N   . GLY A 170 ? 0.3109 0.2926 0.2987 -0.0134 0.0078  -0.0098 148 GLY A N   
825  C CA  . GLY A 170 ? 0.3183 0.3051 0.3112 -0.0145 0.0092  -0.0098 148 GLY A CA  
826  C C   . GLY A 170 ? 0.3121 0.2927 0.3010 -0.0140 0.0136  -0.0081 148 GLY A C   
827  O O   . GLY A 170 ? 0.2978 0.2767 0.2867 -0.0168 0.0156  -0.0074 148 GLY A O   
828  N N   . ASN A 171 ? 0.3040 0.2815 0.2909 -0.0103 0.0153  -0.0069 149 ASN A N   
829  C CA  . ASN A 171 ? 0.3235 0.2961 0.3077 -0.0081 0.0189  -0.0045 149 ASN A CA  
830  C C   . ASN A 171 ? 0.3099 0.2703 0.2881 -0.0102 0.0220  -0.0045 149 ASN A C   
831  O O   . ASN A 171 ? 0.3311 0.2867 0.3080 -0.0101 0.0249  -0.0020 149 ASN A O   
832  C CB  . ASN A 171 ? 0.3032 0.2789 0.2901 -0.0031 0.0191  -0.0035 149 ASN A CB  
833  C CG  . ASN A 171 ? 0.3298 0.3162 0.3218 -0.0011 0.0162  -0.0043 149 ASN A CG  
834  O OD1 . ASN A 171 ? 0.3402 0.3304 0.3308 -0.0014 0.0160  -0.0036 149 ASN A OD1 
835  N ND2 . ASN A 171 ? 0.3154 0.3067 0.3134 0.0006  0.0146  -0.0060 149 ASN A ND2 
836  N N   . THR A 172 ? 0.3040 0.2586 0.2777 -0.0120 0.0216  -0.0073 150 THR A N   
837  C CA  . THR A 172 ? 0.3295 0.2718 0.2967 -0.0145 0.0242  -0.0094 150 THR A CA  
838  C C   . THR A 172 ? 0.3411 0.2833 0.3105 -0.0210 0.0225  -0.0110 150 THR A C   
839  O O   . THR A 172 ? 0.3592 0.2916 0.3274 -0.0235 0.0259  -0.0111 150 THR A O   
840  C CB  . THR A 172 ? 0.3430 0.2798 0.3022 -0.0147 0.0240  -0.0129 150 THR A CB  
841  O OG1 . THR A 172 ? 0.3330 0.2702 0.2926 -0.0092 0.0274  -0.0109 150 THR A OG1 
842  C CG2 . THR A 172 ? 0.3494 0.2728 0.3009 -0.0177 0.0262  -0.0170 150 THR A CG2 
843  N N   . GLY A 173 ? 0.3443 0.2975 0.3189 -0.0235 0.0179  -0.0121 151 GLY A N   
844  C CA  . GLY A 173 ? 0.3552 0.3123 0.3362 -0.0296 0.0167  -0.0134 151 GLY A CA  
845  C C   . GLY A 173 ? 0.3345 0.2909 0.3195 -0.0296 0.0220  -0.0090 151 GLY A C   
846  O O   . GLY A 173 ? 0.3160 0.2663 0.3032 -0.0350 0.0250  -0.0091 151 GLY A O   
847  N N   . ILE A 174 ? 0.3189 0.2811 0.3040 -0.0239 0.0233  -0.0050 152 ILE A N   
848  C CA  . ILE A 174 ? 0.3343 0.2961 0.3195 -0.0226 0.0281  0.0002  152 ILE A CA  
849  C C   . ILE A 174 ? 0.3549 0.3012 0.3346 -0.0219 0.0329  0.0032  152 ILE A C   
850  O O   . ILE A 174 ? 0.3446 0.2843 0.3249 -0.0250 0.0378  0.0066  152 ILE A O   
851  C CB  . ILE A 174 ? 0.3217 0.2933 0.3062 -0.0161 0.0272  0.0025  152 ILE A CB  
852  C CG1 . ILE A 174 ? 0.3447 0.3299 0.3360 -0.0174 0.0245  -0.0004 152 ILE A CG1 
853  C CG2 . ILE A 174 ? 0.3369 0.3059 0.3163 -0.0126 0.0317  0.0087  152 ILE A CG2 
854  C CD1 . ILE A 174 ? 0.3280 0.3216 0.3188 -0.0116 0.0223  -0.0012 152 ILE A CD1 
855  N N   . GLY A 175 ? 0.3531 0.2926 0.3281 -0.0176 0.0323  0.0021  153 GLY A N   
856  C CA  . GLY A 175 ? 0.3482 0.2721 0.3187 -0.0153 0.0371  0.0045  153 GLY A CA  
857  C C   . GLY A 175 ? 0.3524 0.2631 0.3228 -0.0228 0.0398  0.0014  153 GLY A C   
858  O O   . GLY A 175 ? 0.3615 0.2600 0.3312 -0.0236 0.0452  0.0052  153 GLY A O   
859  N N   . LEU A 176 ? 0.3506 0.2635 0.3215 -0.0282 0.0357  -0.0058 154 LEU A N   
860  C CA  . LEU A 176 ? 0.3516 0.2540 0.3233 -0.0364 0.0364  -0.0112 154 LEU A CA  
861  C C   . LEU A 176 ? 0.3644 0.2707 0.3454 -0.0435 0.0383  -0.0090 154 LEU A C   
862  O O   . LEU A 176 ? 0.3630 0.2565 0.3465 -0.0494 0.0426  -0.0098 154 LEU A O   
863  C CB  . LEU A 176 ? 0.3587 0.2656 0.3273 -0.0398 0.0298  -0.0194 154 LEU A CB  
864  C CG  . LEU A 176 ? 0.3633 0.2623 0.3208 -0.0347 0.0300  -0.0227 154 LEU A CG  
865  C CD1 . LEU A 176 ? 0.3701 0.2769 0.3228 -0.0368 0.0230  -0.0284 154 LEU A CD1 
866  C CD2 . LEU A 176 ? 0.3903 0.2690 0.3419 -0.0354 0.0354  -0.0263 154 LEU A CD2 
867  N N   . ALA A 177 ? 0.3443 0.2680 0.3315 -0.0433 0.0359  -0.0067 155 ALA A N   
868  C CA  . ALA A 177 ? 0.3400 0.2695 0.3374 -0.0496 0.0393  -0.0041 155 ALA A CA  
869  C C   . ALA A 177 ? 0.3527 0.2714 0.3471 -0.0475 0.0481  0.0046  155 ALA A C   
870  O O   . ALA A 177 ? 0.3578 0.2706 0.3586 -0.0544 0.0539  0.0069  155 ALA A O   
871  C CB  . ALA A 177 ? 0.3261 0.2760 0.3302 -0.0482 0.0360  -0.0037 155 ALA A CB  
872  N N   . LEU A 178 ? 0.3687 0.2854 0.3541 -0.0378 0.0490  0.0101  156 LEU A N   
873  C CA  . LEU A 178 ? 0.4008 0.3069 0.3809 -0.0338 0.0564  0.0197  156 LEU A CA  
874  C C   . LEU A 178 ? 0.4097 0.2933 0.3890 -0.0371 0.0617  0.0201  156 LEU A C   
875  O O   . LEU A 178 ? 0.4306 0.3035 0.4125 -0.0417 0.0693  0.0257  156 LEU A O   
876  C CB  . LEU A 178 ? 0.4214 0.3315 0.3929 -0.0223 0.0542  0.0242  156 LEU A CB  
877  C CG  . LEU A 178 ? 0.4703 0.3784 0.4354 -0.0172 0.0596  0.0349  156 LEU A CG  
878  C CD1 . LEU A 178 ? 0.4903 0.4139 0.4499 -0.0087 0.0547  0.0366  156 LEU A CD1 
879  C CD2 . LEU A 178 ? 0.4981 0.3859 0.4579 -0.0130 0.0647  0.0415  156 LEU A CD2 
880  N N   . ALA A 179 ? 0.4208 0.2958 0.3967 -0.0351 0.0587  0.0140  157 ALA A N   
881  C CA  . ALA A 179 ? 0.4412 0.2933 0.4160 -0.0380 0.0635  0.0120  157 ALA A CA  
882  C C   . ALA A 179 ? 0.4352 0.2824 0.4191 -0.0514 0.0648  0.0060  157 ALA A C   
883  O O   . ALA A 179 ? 0.4548 0.2833 0.4412 -0.0560 0.0717  0.0078  157 ALA A O   
884  C CB  . ALA A 179 ? 0.4542 0.3005 0.4229 -0.0332 0.0603  0.0050  157 ALA A CB  
885  N N   . ALA A 180 ? 0.4124 0.2767 0.4027 -0.0577 0.0581  -0.0011 158 ALA A N   
886  C CA  . ALA A 180 ? 0.4289 0.2936 0.4311 -0.0708 0.0575  -0.0079 158 ALA A CA  
887  C C   . ALA A 180 ? 0.4421 0.3076 0.4546 -0.0765 0.0656  0.0000  158 ALA A C   
888  O O   . ALA A 180 ? 0.4231 0.2781 0.4455 -0.0871 0.0701  -0.0024 158 ALA A O   
889  C CB  . ALA A 180 ? 0.4206 0.3060 0.4277 -0.0740 0.0475  -0.0160 158 ALA A CB  
890  N N   . ALA A 181 ? 0.4285 0.3062 0.4384 -0.0697 0.0681  0.0093  159 ALA A N   
891  C CA  . ALA A 181 ? 0.4379 0.3173 0.4544 -0.0735 0.0773  0.0182  159 ALA A CA  
892  C C   . ALA A 181 ? 0.4672 0.3207 0.4786 -0.0730 0.0872  0.0266  159 ALA A C   
893  O O   . ALA A 181 ? 0.4685 0.3125 0.4893 -0.0822 0.0955  0.0297  159 ALA A O   
894  C CB  . ALA A 181 ? 0.4237 0.3201 0.4342 -0.0647 0.0774  0.0253  159 ALA A CB  
895  N N   . VAL A 182 ? 0.4767 0.3185 0.4743 -0.0620 0.0866  0.0304  160 VAL A N   
896  C CA  . VAL A 182 ? 0.4935 0.3102 0.4851 -0.0585 0.0953  0.0395  160 VAL A CA  
897  C C   . VAL A 182 ? 0.5235 0.3178 0.5228 -0.0685 0.0984  0.0317  160 VAL A C   
898  O O   . VAL A 182 ? 0.5307 0.3073 0.5350 -0.0744 0.1080  0.0375  160 VAL A O   
899  C CB  . VAL A 182 ? 0.4887 0.3016 0.4664 -0.0433 0.0924  0.0442  160 VAL A CB  
900  C CG1 . VAL A 182 ? 0.5164 0.3021 0.4887 -0.0382 0.1007  0.0534  160 VAL A CG1 
901  C CG2 . VAL A 182 ? 0.4758 0.3088 0.4461 -0.0343 0.0897  0.0517  160 VAL A CG2 
902  N N   . ARG A 183 ? 0.5226 0.3178 0.5222 -0.0706 0.0903  0.0182  161 ARG A N   
903  C CA  A ARG A 183 ? 0.5446 0.3171 0.5475 -0.0780 0.0922  0.0090  161 ARG A CA  
904  C CA  B ARG A 183 ? 0.5529 0.3262 0.5556 -0.0780 0.0916  0.0083  161 ARG A CA  
905  C C   . ARG A 183 ? 0.5557 0.3337 0.5740 -0.0946 0.0897  -0.0017 161 ARG A C   
906  O O   . ARG A 183 ? 0.6010 0.3597 0.6245 -0.1033 0.0921  -0.0096 161 ARG A O   
907  C CB  A ARG A 183 ? 0.5386 0.3068 0.5308 -0.0706 0.0859  0.0000  161 ARG A CB  
908  C CB  B ARG A 183 ? 0.5538 0.3267 0.5466 -0.0716 0.0838  -0.0021 161 ARG A CB  
909  C CG  A ARG A 183 ? 0.5299 0.2955 0.5105 -0.0544 0.0876  0.0096  161 ARG A CG  
910  C CG  B ARG A 183 ? 0.5819 0.3316 0.5650 -0.0616 0.0888  0.0002  161 ARG A CG  
911  C CD  A ARG A 183 ? 0.5496 0.2989 0.5227 -0.0483 0.0875  0.0023  161 ARG A CD  
912  C CD  B ARG A 183 ? 0.5969 0.3342 0.5776 -0.0534 0.0978  0.0164  161 ARG A CD  
913  N NE  A ARG A 183 ? 0.5543 0.2983 0.5206 -0.0332 0.0909  0.0125  161 ARG A NE  
914  N NE  B ARG A 183 ? 0.5980 0.3283 0.5691 -0.0383 0.0982  0.0202  161 ARG A NE  
915  C CZ  A ARG A 183 ? 0.5535 0.2872 0.5143 -0.0245 0.0918  0.0085  161 ARG A CZ  
916  C CZ  B ARG A 183 ? 0.6011 0.3267 0.5676 -0.0269 0.1026  0.0345  161 ARG A CZ  
917  N NH1 A ARG A 183 ? 0.5439 0.2699 0.5023 -0.0296 0.0901  -0.0056 161 ARG A NH1 
918  N NH1 B ARG A 183 ? 0.5993 0.3245 0.5672 -0.0290 0.1078  0.0464  161 ARG A NH1 
919  N NH2 A ARG A 183 ? 0.5514 0.2835 0.5091 -0.0105 0.0942  0.0185  161 ARG A NH2 
920  N NH2 B ARG A 183 ? 0.6052 0.3277 0.5660 -0.0131 0.1020  0.0371  161 ARG A NH2 
921  N N   . GLY A 184 ? 0.5385 0.3426 0.5656 -0.0989 0.0850  -0.0025 162 GLY A N   
922  C CA  . GLY A 184 ? 0.5462 0.3587 0.5918 -0.1146 0.0826  -0.0118 162 GLY A CA  
923  C C   . GLY A 184 ? 0.5307 0.3547 0.5771 -0.1187 0.0693  -0.0278 162 GLY A C   
924  O O   . GLY A 184 ? 0.5620 0.3819 0.6190 -0.1308 0.0664  -0.0388 162 GLY A O   
925  N N   . TYR A 185 ? 0.5117 0.3507 0.5469 -0.1089 0.0610  -0.0291 163 TYR A N   
926  C CA  . TYR A 185 ? 0.4967 0.3485 0.5309 -0.1118 0.0483  -0.0422 163 TYR A CA  
927  C C   . TYR A 185 ? 0.4670 0.3490 0.5117 -0.1121 0.0419  -0.0407 163 TYR A C   
928  O O   . TYR A 185 ? 0.4488 0.3408 0.4920 -0.1044 0.0454  -0.0307 163 TYR A O   
929  C CB  . TYR A 185 ? 0.4883 0.3348 0.5020 -0.1001 0.0442  -0.0443 163 TYR A CB  
930  C CG  . TYR A 185 ? 0.5130 0.3310 0.5154 -0.0976 0.0498  -0.0473 163 TYR A CG  
931  C CD1 . TYR A 185 ? 0.5497 0.3529 0.5523 -0.1068 0.0477  -0.0605 163 TYR A CD1 
932  C CD2 . TYR A 185 ? 0.5148 0.3215 0.5069 -0.0856 0.0568  -0.0378 163 TYR A CD2 
933  C CE1 . TYR A 185 ? 0.5764 0.3522 0.5689 -0.1040 0.0538  -0.0641 163 TYR A CE1 
934  C CE2 . TYR A 185 ? 0.5409 0.3219 0.5245 -0.0822 0.0626  -0.0404 163 TYR A CE2 
935  C CZ  . TYR A 185 ? 0.5683 0.3331 0.5520 -0.0913 0.0616  -0.0537 163 TYR A CZ  
936  O OH  . TYR A 185 ? 0.5940 0.3325 0.5693 -0.0875 0.0678  -0.0574 163 TYR A OH  
937  N N   . ARG A 186 ? 0.4522 0.3486 0.5069 -0.1201 0.0320  -0.0512 164 ARG A N   
938  C CA  . ARG A 186 ? 0.4385 0.3629 0.5002 -0.1175 0.0236  -0.0513 164 ARG A CA  
939  C C   . ARG A 186 ? 0.4328 0.3601 0.4751 -0.1046 0.0178  -0.0499 164 ARG A C   
940  O O   . ARG A 186 ? 0.4427 0.3563 0.4690 -0.1020 0.0147  -0.0556 164 ARG A O   
941  C CB  . ARG A 186 ? 0.4428 0.3807 0.5189 -0.1283 0.0127  -0.0635 164 ARG A CB  
942  C CG  . ARG A 186 ? 0.4206 0.3882 0.5078 -0.1258 0.0036  -0.0635 164 ARG A CG  
943  C CD  . ARG A 186 ? 0.4365 0.4189 0.5395 -0.1363 -0.0085 -0.0758 164 ARG A CD  
944  N NE  . ARG A 186 ? 0.4229 0.4332 0.5347 -0.1310 -0.0178 -0.0746 164 ARG A NE  
945  C CZ  . ARG A 186 ? 0.4293 0.4571 0.5487 -0.1341 -0.0323 -0.0835 164 ARG A CZ  
946  N NH1 . ARG A 186 ? 0.4442 0.4660 0.5628 -0.1433 -0.0403 -0.0956 164 ARG A NH1 
947  N NH2 . ARG A 186 ? 0.4291 0.4802 0.5562 -0.1271 -0.0393 -0.0803 164 ARG A NH2 
948  N N   . CYS A 187 ? 0.3941 0.3383 0.4380 -0.0970 0.0171  -0.0429 165 CYS A N   
949  C CA  . CYS A 187 ? 0.3969 0.3426 0.4249 -0.0854 0.0140  -0.0400 165 CYS A CA  
950  C C   . CYS A 187 ? 0.3977 0.3666 0.4329 -0.0824 0.0058  -0.0402 165 CYS A C   
951  O O   . CYS A 187 ? 0.3840 0.3680 0.4343 -0.0835 0.0082  -0.0364 165 CYS A O   
952  C CB  . CYS A 187 ? 0.4019 0.3396 0.4225 -0.0772 0.0233  -0.0298 165 CYS A CB  
953  S SG  . CYS A 187 ? 0.4224 0.3621 0.4271 -0.0642 0.0201  -0.0268 165 CYS A SG  
954  N N   . ILE A 188 ? 0.3700 0.3412 0.3946 -0.0788 -0.0034 -0.0450 166 ILE A N   
955  C CA  . ILE A 188 ? 0.3563 0.3462 0.3846 -0.0742 -0.0118 -0.0446 166 ILE A CA  
956  C C   . ILE A 188 ? 0.3772 0.3621 0.3887 -0.0638 -0.0119 -0.0404 166 ILE A C   
957  O O   . ILE A 188 ? 0.3785 0.3500 0.3734 -0.0619 -0.0125 -0.0430 166 ILE A O   
958  C CB  . ILE A 188 ? 0.3781 0.3761 0.4082 -0.0792 -0.0239 -0.0534 166 ILE A CB  
959  C CG1 . ILE A 188 ? 0.3909 0.3945 0.4406 -0.0914 -0.0245 -0.0593 166 ILE A CG1 
960  C CG2 . ILE A 188 ? 0.3675 0.3842 0.4014 -0.0725 -0.0325 -0.0511 166 ILE A CG2 
961  C CD1 . ILE A 188 ? 0.4075 0.4163 0.4581 -0.0982 -0.0368 -0.0702 166 ILE A CD1 
962  N N   . ILE A 189 ? 0.3304 0.3262 0.3470 -0.0573 -0.0110 -0.0345 167 ILE A N   
963  C CA  . ILE A 189 ? 0.3608 0.3526 0.3657 -0.0483 -0.0098 -0.0300 167 ILE A CA  
964  C C   . ILE A 189 ? 0.3467 0.3507 0.3534 -0.0441 -0.0182 -0.0299 167 ILE A C   
965  O O   . ILE A 189 ? 0.3342 0.3532 0.3558 -0.0453 -0.0218 -0.0302 167 ILE A O   
966  C CB  . ILE A 189 ? 0.3899 0.3835 0.4000 -0.0446 -0.0019 -0.0241 167 ILE A CB  
967  C CG1 . ILE A 189 ? 0.4281 0.4069 0.4323 -0.0459 0.0063  -0.0221 167 ILE A CG1 
968  C CG2 . ILE A 189 ? 0.4524 0.4507 0.4601 -0.0365 -0.0028 -0.0205 167 ILE A CG2 
969  C CD1 . ILE A 189 ? 0.4678 0.4304 0.4594 -0.0469 0.0070  -0.0252 167 ILE A CD1 
970  N N   . VAL A 190 ? 0.3292 0.3267 0.3213 -0.0389 -0.0205 -0.0287 168 VAL A N   
971  C CA  . VAL A 190 ? 0.3364 0.3425 0.3278 -0.0337 -0.0277 -0.0266 168 VAL A CA  
972  C C   . VAL A 190 ? 0.3401 0.3411 0.3265 -0.0265 -0.0228 -0.0208 168 VAL A C   
973  O O   . VAL A 190 ? 0.3499 0.3388 0.3233 -0.0248 -0.0183 -0.0197 168 VAL A O   
974  C CB  . VAL A 190 ? 0.3429 0.3455 0.3196 -0.0343 -0.0356 -0.0301 168 VAL A CB  
975  C CG1 . VAL A 190 ? 0.3510 0.3625 0.3270 -0.0278 -0.0433 -0.0262 168 VAL A CG1 
976  C CG2 . VAL A 190 ? 0.3592 0.3653 0.3408 -0.0428 -0.0408 -0.0379 168 VAL A CG2 
977  N N   . MET A 191 ? 0.3167 0.3273 0.3152 -0.0226 -0.0229 -0.0178 169 MET A N   
978  C CA  . MET A 191 ? 0.3062 0.3131 0.3050 -0.0176 -0.0174 -0.0139 169 MET A CA  
979  C C   . MET A 191 ? 0.2970 0.3089 0.3008 -0.0115 -0.0211 -0.0107 169 MET A C   
980  O O   . MET A 191 ? 0.2931 0.3167 0.3088 -0.0104 -0.0255 -0.0113 169 MET A O   
981  C CB  . MET A 191 ? 0.3052 0.3162 0.3141 -0.0191 -0.0115 -0.0146 169 MET A CB  
982  C CG  . MET A 191 ? 0.3078 0.3152 0.3162 -0.0150 -0.0064 -0.0126 169 MET A CG  
983  S SD  . MET A 191 ? 0.3342 0.3432 0.3463 -0.0162 0.0003  -0.0129 169 MET A SD  
984  C CE  . MET A 191 ? 0.3388 0.3624 0.3653 -0.0171 0.0001  -0.0144 169 MET A CE  
985  N N   . PRO A 192 ? 0.3025 0.3057 0.2988 -0.0074 -0.0187 -0.0069 170 PRO A N   
986  C CA  . PRO A 192 ? 0.3031 0.3078 0.3043 -0.0015 -0.0212 -0.0031 170 PRO A CA  
987  C C   . PRO A 192 ? 0.2887 0.3022 0.3067 0.0007  -0.0198 -0.0048 170 PRO A C   
988  O O   . PRO A 192 ? 0.2614 0.2767 0.2838 -0.0017 -0.0148 -0.0078 170 PRO A O   
989  C CB  . PRO A 192 ? 0.3124 0.3047 0.3050 0.0005  -0.0159 0.0007  170 PRO A CB  
990  C CG  . PRO A 192 ? 0.3221 0.3076 0.3006 -0.0031 -0.0138 -0.0004 170 PRO A CG  
991  C CD  . PRO A 192 ? 0.3273 0.3185 0.3112 -0.0079 -0.0135 -0.0057 170 PRO A CD  
992  N N   . GLU A 193 ? 0.2884 0.3067 0.3142 0.0060  -0.0239 -0.0026 171 GLU A N   
993  C CA  . GLU A 193 ? 0.2883 0.3155 0.3305 0.0092  -0.0224 -0.0050 171 GLU A CA  
994  C C   . GLU A 193 ? 0.2866 0.3075 0.3312 0.0102  -0.0156 -0.0069 171 GLU A C   
995  O O   . GLU A 193 ? 0.2781 0.3060 0.3321 0.0109  -0.0125 -0.0111 171 GLU A O   
996  C CB  . GLU A 193 ? 0.3151 0.3469 0.3653 0.0162  -0.0282 -0.0016 171 GLU A CB  
997  C CG  . GLU A 193 ? 0.3169 0.3625 0.3725 0.0156  -0.0361 -0.0021 171 GLU A CG  
998  C CD  . GLU A 193 ? 0.3514 0.4016 0.4130 0.0238  -0.0435 0.0025  171 GLU A CD  
999  O OE1 . GLU A 193 ? 0.3448 0.3833 0.4018 0.0298  -0.0425 0.0078  171 GLU A OE1 
1000 O OE2 . GLU A 193 ? 0.3425 0.4084 0.4146 0.0242  -0.0505 0.0011  171 GLU A OE2 
1001 N N   . LYS A 194 ? 0.2801 0.2887 0.3163 0.0101  -0.0130 -0.0046 172 LYS A N   
1002 C CA  . LYS A 194 ? 0.3134 0.3174 0.3537 0.0104  -0.0079 -0.0076 172 LYS A CA  
1003 C C   . LYS A 194 ? 0.2899 0.2980 0.3285 0.0063  -0.0044 -0.0122 172 LYS A C   
1004 O O   . LYS A 194 ? 0.2836 0.2919 0.3262 0.0070  -0.0016 -0.0164 172 LYS A O   
1005 C CB  . LYS A 194 ? 0.3510 0.3422 0.3863 0.0105  -0.0056 -0.0039 172 LYS A CB  
1006 C CG  . LYS A 194 ? 0.3852 0.3722 0.4100 0.0060  -0.0031 -0.0029 172 LYS A CG  
1007 C CD  . LYS A 194 ? 0.4151 0.3912 0.4380 0.0057  0.0009  0.0007  172 LYS A CD  
1008 C CE  . LYS A 194 ? 0.4123 0.3887 0.4367 0.0021  0.0049  -0.0026 172 LYS A CE  
1009 N NZ  . LYS A 194 ? 0.3957 0.3635 0.4208 0.0008  0.0097  0.0008  172 LYS A NZ  
1010 N N   . MET A 195 ? 0.2805 0.2907 0.3121 0.0024  -0.0047 -0.0116 173 MET A N   
1011 C CA  . MET A 195 ? 0.2752 0.2868 0.3035 -0.0005 -0.0011 -0.0140 173 MET A CA  
1012 C C   . MET A 195 ? 0.2693 0.2902 0.3042 0.0004  0.0009  -0.0177 173 MET A C   
1013 O O   . MET A 195 ? 0.2658 0.2940 0.3082 0.0017  -0.0002 -0.0183 173 MET A O   
1014 C CB  . MET A 195 ? 0.2810 0.2898 0.3006 -0.0045 -0.0011 -0.0122 173 MET A CB  
1015 C CG  . MET A 195 ? 0.2942 0.2939 0.3051 -0.0048 -0.0022 -0.0090 173 MET A CG  
1016 S SD  . MET A 195 ? 0.3146 0.3072 0.3255 -0.0031 0.0015  -0.0080 173 MET A SD  
1017 C CE  . MET A 195 ? 0.3489 0.3321 0.3481 -0.0032 0.0014  -0.0033 173 MET A CE  
1018 N N   . SER A 196 ? 0.2681 0.2896 0.3000 0.0003  0.0040  -0.0201 174 SER A N   
1019 C CA  . SER A 196 ? 0.2788 0.3078 0.3136 0.0023  0.0067  -0.0239 174 SER A CA  
1020 C C   . SER A 196 ? 0.2720 0.3090 0.3090 0.0003  0.0093  -0.0227 174 SER A C   
1021 O O   . SER A 196 ? 0.2752 0.3107 0.3091 -0.0038 0.0094  -0.0194 174 SER A O   
1022 C CB  . SER A 196 ? 0.3068 0.3349 0.3345 0.0027  0.0083  -0.0261 174 SER A CB  
1023 O OG  . SER A 196 ? 0.3260 0.3527 0.3461 0.0001  0.0098  -0.0221 174 SER A OG  
1024 N N   . SER A 197 ? 0.2680 0.3131 0.3107 0.0029  0.0124  -0.0259 175 SER A N   
1025 C CA  . SER A 197 ? 0.2853 0.3394 0.3323 0.0008  0.0165  -0.0248 175 SER A CA  
1026 C C   . SER A 197 ? 0.2724 0.3247 0.3082 -0.0018 0.0214  -0.0223 175 SER A C   
1027 O O   . SER A 197 ? 0.2886 0.3444 0.3263 -0.0056 0.0253  -0.0193 175 SER A O   
1028 C CB  . SER A 197 ? 0.2938 0.3576 0.3512 0.0053  0.0196  -0.0290 175 SER A CB  
1029 O OG  . SER A 197 ? 0.3695 0.4323 0.4190 0.0086  0.0231  -0.0332 175 SER A OG  
1030 N N   . GLU A 198 ? 0.2689 0.3155 0.2940 0.0004  0.0208  -0.0232 176 GLU A N   
1031 C CA  . GLU A 198 ? 0.2853 0.3292 0.2985 -0.0005 0.0240  -0.0196 176 GLU A CA  
1032 C C   . GLU A 198 ? 0.2896 0.3262 0.3011 -0.0051 0.0236  -0.0141 176 GLU A C   
1033 O O   . GLU A 198 ? 0.3002 0.3350 0.3070 -0.0075 0.0284  -0.0096 176 GLU A O   
1034 C CB  . GLU A 198 ? 0.2951 0.3361 0.2992 0.0033  0.0210  -0.0222 176 GLU A CB  
1035 C CG  . GLU A 198 ? 0.3054 0.3527 0.3061 0.0077  0.0224  -0.0285 176 GLU A CG  
1036 C CD  . GLU A 198 ? 0.3201 0.3682 0.3310 0.0096  0.0197  -0.0355 176 GLU A CD  
1037 O OE1 . GLU A 198 ? 0.3420 0.3860 0.3622 0.0080  0.0165  -0.0344 176 GLU A OE1 
1038 O OE2 . GLU A 198 ? 0.3324 0.3842 0.3412 0.0132  0.0210  -0.0421 176 GLU A OE2 
1039 N N   . LYS A 199 ? 0.2799 0.3112 0.2946 -0.0064 0.0186  -0.0145 177 LYS A N   
1040 C CA  . LYS A 199 ? 0.2810 0.3048 0.2938 -0.0106 0.0180  -0.0112 177 LYS A CA  
1041 C C   . LYS A 199 ? 0.2816 0.3097 0.3020 -0.0156 0.0200  -0.0105 177 LYS A C   
1042 O O   . LYS A 199 ? 0.2940 0.3169 0.3121 -0.0199 0.0231  -0.0077 177 LYS A O   
1043 C CB  . LYS A 199 ? 0.2677 0.2859 0.2809 -0.0104 0.0129  -0.0123 177 LYS A CB  
1044 C CG  . LYS A 199 ? 0.2776 0.2906 0.2852 -0.0073 0.0120  -0.0121 177 LYS A CG  
1045 C CD  . LYS A 199 ? 0.3139 0.3231 0.3236 -0.0068 0.0086  -0.0130 177 LYS A CD  
1046 C CE  . LYS A 199 ? 0.2992 0.3038 0.3060 -0.0049 0.0088  -0.0125 177 LYS A CE  
1047 N NZ  . LYS A 199 ? 0.3000 0.3006 0.3091 -0.0047 0.0073  -0.0125 177 LYS A NZ  
1048 N N   . VAL A 200 ? 0.2760 0.3136 0.3072 -0.0152 0.0181  -0.0133 178 VAL A N   
1049 C CA  . VAL A 200 ? 0.2880 0.3338 0.3308 -0.0200 0.0195  -0.0134 178 VAL A CA  
1050 C C   . VAL A 200 ? 0.2828 0.3314 0.3254 -0.0225 0.0281  -0.0107 178 VAL A C   
1051 O O   . VAL A 200 ? 0.2850 0.3331 0.3325 -0.0289 0.0310  -0.0089 178 VAL A O   
1052 C CB  . VAL A 200 ? 0.2900 0.3481 0.3463 -0.0169 0.0164  -0.0166 178 VAL A CB  
1053 C CG1 . VAL A 200 ? 0.3173 0.3877 0.3891 -0.0216 0.0182  -0.0170 178 VAL A CG1 
1054 C CG2 . VAL A 200 ? 0.2988 0.3527 0.3542 -0.0147 0.0081  -0.0174 178 VAL A CG2 
1055 N N   . ASP A 201 ? 0.3064 0.3575 0.3429 -0.0176 0.0326  -0.0105 179 ASP A N   
1056 C CA  . ASP A 201 ? 0.3403 0.3946 0.3746 -0.0191 0.0421  -0.0068 179 ASP A CA  
1057 C C   . ASP A 201 ? 0.3240 0.3657 0.3477 -0.0224 0.0455  -0.0007 179 ASP A C   
1058 O O   . ASP A 201 ? 0.3021 0.3435 0.3295 -0.0277 0.0526  0.0033  179 ASP A O   
1059 C CB  . ASP A 201 ? 0.3973 0.4570 0.4243 -0.0124 0.0456  -0.0088 179 ASP A CB  
1060 C CG  . ASP A 201 ? 0.4348 0.5072 0.4755 -0.0095 0.0455  -0.0146 179 ASP A CG  
1061 O OD1 . ASP A 201 ? 0.5335 0.6143 0.5905 -0.0131 0.0459  -0.0149 179 ASP A OD1 
1062 O OD2 . ASP A 201 ? 0.4980 0.5718 0.5343 -0.0034 0.0443  -0.0192 179 ASP A OD2 
1063 N N   . VAL A 202 ? 0.2950 0.3263 0.3078 -0.0196 0.0407  0.0000  180 VAL A N   
1064 C CA  . VAL A 202 ? 0.3142 0.3324 0.3182 -0.0214 0.0433  0.0056  180 VAL A CA  
1065 C C   . VAL A 202 ? 0.3180 0.3299 0.3303 -0.0291 0.0426  0.0051  180 VAL A C   
1066 O O   . VAL A 202 ? 0.3235 0.3280 0.3359 -0.0338 0.0486  0.0094  180 VAL A O   
1067 C CB  . VAL A 202 ? 0.3217 0.3325 0.3145 -0.0156 0.0385  0.0060  180 VAL A CB  
1068 C CG1 . VAL A 202 ? 0.3487 0.3453 0.3347 -0.0165 0.0410  0.0116  180 VAL A CG1 
1069 C CG2 . VAL A 202 ? 0.3513 0.3683 0.3348 -0.0087 0.0389  0.0061  180 VAL A CG2 
1070 N N   . LEU A 203 ? 0.3179 0.3323 0.3368 -0.0304 0.0353  -0.0003 181 LEU A N   
1071 C CA  . LEU A 203 ? 0.3143 0.3243 0.3400 -0.0377 0.0332  -0.0026 181 LEU A CA  
1072 C C   . LEU A 203 ? 0.3244 0.3417 0.3637 -0.0451 0.0382  -0.0022 181 LEU A C   
1073 O O   . LEU A 203 ? 0.3313 0.3401 0.3735 -0.0522 0.0411  -0.0015 181 LEU A O   
1074 C CB  . LEU A 203 ? 0.3123 0.3261 0.3412 -0.0370 0.0241  -0.0080 181 LEU A CB  
1075 C CG  . LEU A 203 ? 0.3147 0.3191 0.3318 -0.0322 0.0201  -0.0084 181 LEU A CG  
1076 C CD1 . LEU A 203 ? 0.3113 0.3220 0.3314 -0.0298 0.0128  -0.0118 181 LEU A CD1 
1077 C CD2 . LEU A 203 ? 0.3378 0.3272 0.3475 -0.0353 0.0209  -0.0084 181 LEU A CD2 
1078 N N   . ARG A 204 ? 0.3357 0.3688 0.3851 -0.0437 0.0395  -0.0034 182 ARG A N   
1079 C CA  . ARG A 204 ? 0.3552 0.3982 0.4202 -0.0503 0.0456  -0.0028 182 ARG A CA  
1080 C C   . ARG A 204 ? 0.3544 0.3883 0.4139 -0.0535 0.0567  0.0042  182 ARG A C   
1081 O O   . ARG A 204 ? 0.3501 0.3818 0.4203 -0.0624 0.0611  0.0051  182 ARG A O   
1082 C CB  . ARG A 204 ? 0.3965 0.4577 0.4716 -0.0460 0.0474  -0.0045 182 ARG A CB  
1083 C CG  . ARG A 204 ? 0.4488 0.5220 0.5369 -0.0447 0.0378  -0.0104 182 ARG A CG  
1084 C CD  . ARG A 204 ? 0.5066 0.5998 0.6131 -0.0433 0.0417  -0.0121 182 ARG A CD  
1085 N NE  . ARG A 204 ? 0.5451 0.6418 0.6455 -0.0335 0.0424  -0.0133 182 ARG A NE  
1086 C CZ  . ARG A 204 ? 0.5513 0.6568 0.6600 -0.0275 0.0362  -0.0172 182 ARG A CZ  
1087 N NH1 . ARG A 204 ? 0.5463 0.6599 0.6692 -0.0291 0.0276  -0.0196 182 ARG A NH1 
1088 N NH2 . ARG A 204 ? 0.6118 0.7175 0.7139 -0.0193 0.0383  -0.0188 182 ARG A NH2 
1089 N N   . ALA A 205 ? 0.3373 0.3662 0.3809 -0.0463 0.0613  0.0093  183 ALA A N   
1090 C CA  . ALA A 205 ? 0.3485 0.3681 0.3839 -0.0477 0.0721  0.0178  183 ALA A CA  
1091 C C   . ALA A 205 ? 0.3559 0.3558 0.3869 -0.0523 0.0726  0.0209  183 ALA A C   
1092 O O   . ALA A 205 ? 0.3486 0.3400 0.3805 -0.0572 0.0819  0.0273  183 ALA A O   
1093 C CB  . ALA A 205 ? 0.3461 0.3650 0.3627 -0.0378 0.0743  0.0219  183 ALA A CB  
1094 N N   . LEU A 206 ? 0.3494 0.3412 0.3755 -0.0504 0.0635  0.0165  184 LEU A N   
1095 C CA  . LEU A 206 ? 0.3643 0.3368 0.3865 -0.0541 0.0638  0.0176  184 LEU A CA  
1096 C C   . LEU A 206 ? 0.3863 0.3578 0.4243 -0.0656 0.0626  0.0117  184 LEU A C   
1097 O O   . LEU A 206 ? 0.3985 0.3529 0.4347 -0.0701 0.0640  0.0113  184 LEU A O   
1098 C CB  . LEU A 206 ? 0.3431 0.3078 0.3540 -0.0475 0.0560  0.0148  184 LEU A CB  
1099 C CG  . LEU A 206 ? 0.3438 0.3064 0.3400 -0.0370 0.0568  0.0206  184 LEU A CG  
1100 C CD1 . LEU A 206 ? 0.3309 0.2914 0.3210 -0.0311 0.0489  0.0166  184 LEU A CD1 
1101 C CD2 . LEU A 206 ? 0.3669 0.3137 0.3544 -0.0356 0.0649  0.0300  184 LEU A CD2 
1102 N N   . GLY A 207 ? 0.3695 0.3593 0.4234 -0.0700 0.0600  0.0068  185 GLY A N   
1103 C CA  . GLY A 207 ? 0.3733 0.3662 0.4448 -0.0813 0.0576  0.0004  185 GLY A CA  
1104 C C   . GLY A 207 ? 0.3402 0.3350 0.4115 -0.0815 0.0446  -0.0089 185 GLY A C   
1105 O O   . GLY A 207 ? 0.3417 0.3374 0.4242 -0.0904 0.0405  -0.0154 185 GLY A O   
1106 N N   . ALA A 208 ? 0.3277 0.3236 0.3864 -0.0722 0.0382  -0.0097 186 ALA A N   
1107 C CA  . ALA A 208 ? 0.3475 0.3453 0.4038 -0.0716 0.0268  -0.0171 186 ALA A CA  
1108 C C   . ALA A 208 ? 0.3578 0.3770 0.4296 -0.0729 0.0197  -0.0216 186 ALA A C   
1109 O O   . ALA A 208 ? 0.3770 0.4102 0.4574 -0.0696 0.0228  -0.0186 186 ALA A O   
1110 C CB  . ALA A 208 ? 0.3380 0.3296 0.3773 -0.0616 0.0238  -0.0155 186 ALA A CB  
1111 N N   . GLU A 209 ? 0.3580 0.3800 0.4331 -0.0771 0.0099  -0.0288 187 GLU A N   
1112 C CA  . GLU A 209 ? 0.3557 0.3977 0.4429 -0.0759 0.0006  -0.0324 187 GLU A CA  
1113 C C   . GLU A 209 ? 0.3413 0.3814 0.4133 -0.0655 -0.0054 -0.0312 187 GLU A C   
1114 O O   . GLU A 209 ? 0.3617 0.3857 0.4153 -0.0626 -0.0054 -0.0309 187 GLU A O   
1115 C CB  . GLU A 209 ? 0.3827 0.4303 0.4803 -0.0850 -0.0082 -0.0407 187 GLU A CB  
1116 C CG  . GLU A 209 ? 0.4075 0.4552 0.5222 -0.0970 -0.0017 -0.0425 187 GLU A CG  
1117 C CD  . GLU A 209 ? 0.4478 0.4945 0.5688 -0.1074 -0.0102 -0.0524 187 GLU A CD  
1118 O OE1 . GLU A 209 ? 0.4496 0.5089 0.5727 -0.1064 -0.0233 -0.0584 187 GLU A OE1 
1119 O OE2 . GLU A 209 ? 0.5008 0.5336 0.6247 -0.1168 -0.0038 -0.0544 187 GLU A OE2 
1120 N N   . ILE A 210 ? 0.3210 0.3770 0.4017 -0.0596 -0.0092 -0.0301 188 ILE A N   
1121 C CA  . ILE A 210 ? 0.3233 0.3770 0.3923 -0.0497 -0.0126 -0.0275 188 ILE A CA  
1122 C C   . ILE A 210 ? 0.3190 0.3855 0.3941 -0.0463 -0.0237 -0.0296 188 ILE A C   
1123 O O   . ILE A 210 ? 0.2960 0.3805 0.3905 -0.0467 -0.0263 -0.0307 188 ILE A O   
1124 C CB  . ILE A 210 ? 0.3376 0.3944 0.4086 -0.0435 -0.0049 -0.0230 188 ILE A CB  
1125 C CG1 . ILE A 210 ? 0.3535 0.3986 0.4166 -0.0455 0.0052  -0.0199 188 ILE A CG1 
1126 C CG2 . ILE A 210 ? 0.3510 0.4033 0.4113 -0.0346 -0.0079 -0.0211 188 ILE A CG2 
1127 C CD1 . ILE A 210 ? 0.3573 0.4104 0.4268 -0.0427 0.0134  -0.0169 188 ILE A CD1 
1128 N N   . VAL A 211 ? 0.2980 0.3552 0.3565 -0.0423 -0.0297 -0.0295 189 VAL A N   
1129 C CA  . VAL A 211 ? 0.3018 0.3675 0.3605 -0.0372 -0.0402 -0.0294 189 VAL A CA  
1130 C C   . VAL A 211 ? 0.2905 0.3466 0.3359 -0.0282 -0.0382 -0.0240 189 VAL A C   
1131 O O   . VAL A 211 ? 0.2863 0.3277 0.3180 -0.0279 -0.0320 -0.0225 189 VAL A O   
1132 C CB  . VAL A 211 ? 0.3317 0.3937 0.3794 -0.0417 -0.0492 -0.0343 189 VAL A CB  
1133 C CG1 . VAL A 211 ? 0.3447 0.4132 0.3870 -0.0347 -0.0604 -0.0326 189 VAL A CG1 
1134 C CG2 . VAL A 211 ? 0.3575 0.4291 0.4209 -0.0519 -0.0518 -0.0409 189 VAL A CG2 
1135 N N   . ARG A 212 ? 0.2704 0.3347 0.3213 -0.0209 -0.0435 -0.0211 190 ARG A N   
1136 C CA  . ARG A 212 ? 0.2793 0.3341 0.3208 -0.0130 -0.0410 -0.0159 190 ARG A CA  
1137 C C   . ARG A 212 ? 0.2838 0.3367 0.3150 -0.0074 -0.0498 -0.0125 190 ARG A C   
1138 O O   . ARG A 212 ? 0.2917 0.3559 0.3279 -0.0071 -0.0594 -0.0138 190 ARG A O   
1139 C CB  . ARG A 212 ? 0.2748 0.3370 0.3315 -0.0076 -0.0367 -0.0143 190 ARG A CB  
1140 C CG  . ARG A 212 ? 0.2703 0.3371 0.3370 -0.0117 -0.0282 -0.0170 190 ARG A CG  
1141 C CD  . ARG A 212 ? 0.2621 0.3150 0.3156 -0.0150 -0.0206 -0.0169 190 ARG A CD  
1142 N NE  . ARG A 212 ? 0.2622 0.3053 0.3080 -0.0097 -0.0170 -0.0145 190 ARG A NE  
1143 C CZ  . ARG A 212 ? 0.2640 0.3088 0.3151 -0.0065 -0.0116 -0.0151 190 ARG A CZ  
1144 N NH1 . ARG A 212 ? 0.2792 0.3351 0.3422 -0.0068 -0.0082 -0.0171 190 ARG A NH1 
1145 N NH2 . ARG A 212 ? 0.2747 0.3104 0.3196 -0.0030 -0.0095 -0.0141 190 ARG A NH2 
1146 N N   . THR A 213 ? 0.2884 0.3276 0.3060 -0.0028 -0.0462 -0.0078 191 THR A N   
1147 C CA  . THR A 213 ? 0.3000 0.3333 0.3037 0.0030  -0.0520 -0.0025 191 THR A CA  
1148 C C   . THR A 213 ? 0.2989 0.3243 0.3041 0.0104  -0.0473 0.0041  191 THR A C   
1149 O O   . THR A 213 ? 0.2901 0.3107 0.3010 0.0095  -0.0389 0.0032  191 THR A O   
1150 C CB  . THR A 213 ? 0.3049 0.3250 0.2856 -0.0004 -0.0507 -0.0032 191 THR A CB  
1151 O OG1 . THR A 213 ? 0.3151 0.3242 0.2926 -0.0029 -0.0400 -0.0035 191 THR A OG1 
1152 C CG2 . THR A 213 ? 0.3221 0.3481 0.3007 -0.0073 -0.0564 -0.0104 191 THR A CG2 
1153 N N   . PRO A 214 ? 0.3013 0.3254 0.3020 0.0178  -0.0531 0.0105  192 PRO A N   
1154 C CA  . PRO A 214 ? 0.3122 0.3275 0.3165 0.0244  -0.0485 0.0167  192 PRO A CA  
1155 C C   . PRO A 214 ? 0.3281 0.3270 0.3204 0.0218  -0.0391 0.0187  192 PRO A C   
1156 O O   . PRO A 214 ? 0.3416 0.3333 0.3160 0.0190  -0.0382 0.0196  192 PRO A O   
1157 C CB  . PRO A 214 ? 0.3240 0.3392 0.3212 0.0326  -0.0571 0.0245  192 PRO A CB  
1158 C CG  . PRO A 214 ? 0.3282 0.3599 0.3273 0.0308  -0.0682 0.0202  192 PRO A CG  
1159 C CD  . PRO A 214 ? 0.3233 0.3536 0.3151 0.0205  -0.0645 0.0125  192 PRO A CD  
1160 N N   . THR A 215 ? 0.3241 0.3181 0.3272 0.0226  -0.0320 0.0183  193 THR A N   
1161 C CA  . THR A 215 ? 0.3406 0.3222 0.3377 0.0195  -0.0232 0.0190  193 THR A CA  
1162 C C   . THR A 215 ? 0.3440 0.3123 0.3256 0.0221  -0.0212 0.0274  193 THR A C   
1163 O O   . THR A 215 ? 0.3562 0.3174 0.3274 0.0184  -0.0154 0.0278  193 THR A O   
1164 C CB  . THR A 215 ? 0.3539 0.3336 0.3667 0.0203  -0.0177 0.0164  193 THR A CB  
1165 O OG1 . THR A 215 ? 0.3425 0.3341 0.3656 0.0174  -0.0180 0.0087  193 THR A OG1 
1166 C CG2 . THR A 215 ? 0.3848 0.3528 0.3946 0.0170  -0.0095 0.0171  193 THR A CG2 
1167 N N   A ASN A 216 ? 0.3559 0.3211 0.3359 0.0290  -0.0253 0.0348  194 ASN A N   
1168 N N   B ASN A 216 ? 0.3564 0.3213 0.3369 0.0291  -0.0250 0.0348  194 ASN A N   
1169 C CA  A ASN A 216 ? 0.3862 0.3373 0.3500 0.0322  -0.0222 0.0446  194 ASN A CA  
1170 C CA  B ASN A 216 ? 0.3873 0.3381 0.3514 0.0324  -0.0221 0.0449  194 ASN A CA  
1171 C C   A ASN A 216 ? 0.3970 0.3503 0.3398 0.0350  -0.0300 0.0487  194 ASN A C   
1172 C C   B ASN A 216 ? 0.3946 0.3465 0.3358 0.0339  -0.0285 0.0483  194 ASN A C   
1173 O O   A ASN A 216 ? 0.4180 0.3624 0.3470 0.0409  -0.0310 0.0587  194 ASN A O   
1174 O O   B ASN A 216 ? 0.4075 0.3483 0.3323 0.0377  -0.0262 0.0576  194 ASN A O   
1175 C CB  A ASN A 216 ? 0.3995 0.3412 0.3739 0.0382  -0.0196 0.0514  194 ASN A CB  
1176 C CB  B ASN A 216 ? 0.4082 0.3509 0.3800 0.0400  -0.0221 0.0530  194 ASN A CB  
1177 C CG  A ASN A 216 ? 0.3974 0.3374 0.3912 0.0344  -0.0126 0.0447  194 ASN A CG  
1178 C CG  B ASN A 216 ? 0.4324 0.3871 0.4143 0.0467  -0.0323 0.0527  194 ASN A CG  
1179 O OD1 A ASN A 216 ? 0.3961 0.3344 0.3896 0.0278  -0.0062 0.0403  194 ASN A OD1 
1180 O OD1 B ASN A 216 ? 0.4432 0.4130 0.4375 0.0441  -0.0363 0.0438  194 ASN A OD1 
1181 N ND2 A ASN A 216 ? 0.3973 0.3393 0.4077 0.0389  -0.0144 0.0429  194 ASN A ND2 
1182 N ND2 B ASN A 216 ? 0.4586 0.4069 0.4362 0.0558  -0.0362 0.0631  194 ASN A ND2 
1183 N N   . ALA A 217 ? 0.3753 0.3399 0.3148 0.0306  -0.0358 0.0407  195 ALA A N   
1184 C CA  . ALA A 217 ? 0.4008 0.3674 0.3188 0.0315  -0.0433 0.0416  195 ALA A CA  
1185 C C   . ALA A 217 ? 0.4199 0.3730 0.3171 0.0284  -0.0340 0.0434  195 ALA A C   
1186 O O   . ALA A 217 ? 0.4078 0.3589 0.3103 0.0225  -0.0261 0.0378  195 ALA A O   
1187 C CB  . ALA A 217 ? 0.3797 0.3614 0.3033 0.0264  -0.0514 0.0312  195 ALA A CB  
1188 N N   . ARG A 218 ? 0.4421 0.3864 0.3165 0.0332  -0.0343 0.0518  196 ARG A N   
1189 C CA  . ARG A 218 ? 0.4681 0.4012 0.3219 0.0306  -0.0248 0.0528  196 ARG A CA  
1190 C C   . ARG A 218 ? 0.4517 0.3906 0.2971 0.0246  -0.0279 0.0411  196 ARG A C   
1191 O O   . ARG A 218 ? 0.4365 0.3860 0.2803 0.0242  -0.0401 0.0354  196 ARG A O   
1192 C CB  . ARG A 218 ? 0.5347 0.4577 0.3621 0.0375  -0.0248 0.0644  196 ARG A CB  
1193 C CG  . ARG A 218 ? 0.5819 0.4943 0.4156 0.0430  -0.0188 0.0775  196 ARG A CG  
1194 C CD  . ARG A 218 ? 0.6581 0.5548 0.4660 0.0463  -0.0090 0.0891  196 ARG A CD  
1195 N NE  . ARG A 218 ? 0.7335 0.6224 0.5516 0.0402  0.0067  0.0883  196 ARG A NE  
1196 C CZ  . ARG A 218 ? 0.7386 0.6217 0.5422 0.0368  0.0176  0.0874  196 ARG A CZ  
1197 N NH1 . ARG A 218 ? 0.7846 0.6658 0.5577 0.0390  0.0162  0.0874  196 ARG A NH1 
1198 N NH2 . ARG A 218 ? 0.7642 0.6441 0.5855 0.0314  0.0302  0.0860  196 ARG A NH2 
1199 N N   . PHE A 219 ? 0.4356 0.3675 0.2767 0.0201  -0.0168 0.0376  197 PHE A N   
1200 C CA  . PHE A 219 ? 0.4346 0.3691 0.2712 0.0144  -0.0176 0.0261  197 PHE A CA  
1201 C C   . PHE A 219 ? 0.4542 0.3902 0.2669 0.0152  -0.0274 0.0219  197 PHE A C   
1202 O O   . PHE A 219 ? 0.4401 0.3819 0.2552 0.0102  -0.0333 0.0113  197 PHE A O   
1203 C CB  . PHE A 219 ? 0.4533 0.3786 0.2867 0.0117  -0.0034 0.0247  197 PHE A CB  
1204 C CG  . PHE A 219 ? 0.4735 0.3876 0.2795 0.0150  0.0041  0.0301  197 PHE A CG  
1205 C CD1 . PHE A 219 ? 0.4831 0.3901 0.2841 0.0195  0.0105  0.0422  197 PHE A CD1 
1206 C CD2 . PHE A 219 ? 0.4994 0.4091 0.2845 0.0137  0.0055  0.0228  197 PHE A CD2 
1207 C CE1 . PHE A 219 ? 0.5161 0.4127 0.2906 0.0226  0.0188  0.0480  197 PHE A CE1 
1208 C CE2 . PHE A 219 ? 0.5100 0.4096 0.2676 0.0172  0.0131  0.0272  197 PHE A CE2 
1209 C CZ  . PHE A 219 ? 0.5255 0.4190 0.2774 0.0218  0.0200  0.0403  197 PHE A CZ  
1210 N N   . ASP A 220 ? 0.4700 0.4004 0.2596 0.0213  -0.0291 0.0301  198 ASP A N   
1211 C CA  . ASP A 220 ? 0.5100 0.4414 0.2727 0.0228  -0.0388 0.0259  198 ASP A CA  
1212 C C   . ASP A 220 ? 0.5013 0.4456 0.2669 0.0265  -0.0562 0.0272  198 ASP A C   
1213 O O   . ASP A 220 ? 0.5324 0.4793 0.2755 0.0287  -0.0665 0.0247  198 ASP A O   
1214 C CB  . ASP A 220 ? 0.5515 0.4692 0.2814 0.0276  -0.0303 0.0332  198 ASP A CB  
1215 C CG  . ASP A 220 ? 0.5905 0.5023 0.3169 0.0351  -0.0268 0.0497  198 ASP A CG  
1216 O OD1 . ASP A 220 ? 0.5693 0.4846 0.3213 0.0361  -0.0270 0.0551  198 ASP A OD1 
1217 O OD2 . ASP A 220 ? 0.6430 0.5455 0.3396 0.0404  -0.0234 0.0573  198 ASP A OD2 
1218 N N   . SER A 221 ? 0.4776 0.4310 0.2713 0.0276  -0.0598 0.0304  199 SER A N   
1219 C CA  . SER A 221 ? 0.4814 0.4502 0.2840 0.0314  -0.0761 0.0309  199 SER A CA  
1220 C C   . SER A 221 ? 0.4514 0.4341 0.2707 0.0231  -0.0839 0.0167  199 SER A C   
1221 O O   . SER A 221 ? 0.4432 0.4228 0.2735 0.0158  -0.0753 0.0096  199 SER A O   
1222 C CB  . SER A 221 ? 0.4637 0.4357 0.2906 0.0369  -0.0752 0.0402  199 SER A CB  
1223 O OG  . SER A 221 ? 0.4428 0.4185 0.2978 0.0309  -0.0684 0.0343  199 SER A OG  
1224 N N   . PRO A 222 ? 0.4677 0.4662 0.2904 0.0242  -0.1002 0.0129  200 PRO A N   
1225 C CA  . PRO A 222 ? 0.4628 0.4743 0.3031 0.0149  -0.1067 -0.0009 200 PRO A CA  
1226 C C   . PRO A 222 ? 0.4475 0.4657 0.3222 0.0105  -0.1001 -0.0028 200 PRO A C   
1227 O O   . PRO A 222 ? 0.4465 0.4695 0.3344 0.0014  -0.0993 -0.0130 200 PRO A O   
1228 C CB  . PRO A 222 ? 0.4772 0.5066 0.3167 0.0182  -0.1262 -0.0028 200 PRO A CB  
1229 C CG  . PRO A 222 ? 0.4993 0.5202 0.3072 0.0283  -0.1297 0.0075  200 PRO A CG  
1230 C CD  . PRO A 222 ? 0.4904 0.4943 0.2962 0.0333  -0.1134 0.0200  200 PRO A CD  
1231 N N   . GLU A 223 ? 0.4357 0.4524 0.3233 0.0165  -0.0942 0.0068  201 GLU A N   
1232 C CA  . GLU A 223 ? 0.4352 0.4601 0.3535 0.0136  -0.0894 0.0047  201 GLU A CA  
1233 C C   . GLU A 223 ? 0.4070 0.4185 0.3280 0.0105  -0.0739 0.0054  201 GLU A C   
1234 O O   . GLU A 223 ? 0.3884 0.4046 0.3308 0.0089  -0.0689 0.0044  201 GLU A O   
1235 C CB  . GLU A 223 ? 0.4601 0.4961 0.3964 0.0222  -0.0951 0.0120  201 GLU A CB  
1236 C CG  . GLU A 223 ? 0.4752 0.4978 0.4019 0.0314  -0.0899 0.0243  201 GLU A CG  
1237 C CD  . GLU A 223 ? 0.5142 0.5337 0.4166 0.0391  -0.0990 0.0319  201 GLU A CD  
1238 O OE1 . GLU A 223 ? 0.5342 0.5623 0.4248 0.0373  -0.1103 0.0265  201 GLU A OE1 
1239 O OE2 . GLU A 223 ? 0.5436 0.5516 0.4385 0.0470  -0.0947 0.0433  201 GLU A OE2 
1240 N N   . SER A 224 ? 0.4088 0.4046 0.3083 0.0096  -0.0662 0.0067  202 SER A N   
1241 C CA  . SER A 224 ? 0.3829 0.3687 0.2871 0.0060  -0.0527 0.0059  202 SER A CA  
1242 C C   . SER A 224 ? 0.3712 0.3612 0.2861 -0.0024 -0.0511 -0.0041 202 SER A C   
1243 O O   . SER A 224 ? 0.3994 0.3965 0.3136 -0.0067 -0.0592 -0.0111 202 SER A O   
1244 C CB  . SER A 224 ? 0.4053 0.3752 0.2862 0.0071  -0.0442 0.0091  202 SER A CB  
1245 O OG  . SER A 224 ? 0.4133 0.3800 0.2761 0.0033  -0.0468 0.0017  202 SER A OG  
1246 N N   . HIS A 225 ? 0.3635 0.3489 0.2883 -0.0048 -0.0410 -0.0046 203 HIS A N   
1247 C CA  . HIS A 225 ? 0.3756 0.3617 0.3083 -0.0118 -0.0377 -0.0119 203 HIS A CA  
1248 C C   . HIS A 225 ? 0.4131 0.3904 0.3281 -0.0160 -0.0378 -0.0182 203 HIS A C   
1249 O O   . HIS A 225 ? 0.3957 0.3767 0.3158 -0.0222 -0.0416 -0.0256 203 HIS A O   
1250 C CB  . HIS A 225 ? 0.3789 0.3616 0.3229 -0.0120 -0.0276 -0.0102 203 HIS A CB  
1251 C CG  . HIS A 225 ? 0.3968 0.3671 0.3297 -0.0101 -0.0187 -0.0073 203 HIS A CG  
1252 N ND1 . HIS A 225 ? 0.4523 0.4162 0.3735 -0.0054 -0.0170 -0.0013 203 HIS A ND1 
1253 C CD2 . HIS A 225 ? 0.4155 0.3796 0.3497 -0.0118 -0.0106 -0.0088 203 HIS A CD2 
1254 C CE1 . HIS A 225 ? 0.4455 0.4007 0.3623 -0.0052 -0.0076 -0.0001 203 HIS A CE1 
1255 N NE2 . HIS A 225 ? 0.4351 0.3910 0.3601 -0.0086 -0.0042 -0.0048 203 HIS A NE2 
1256 N N   . VAL A 226 ? 0.4115 0.3773 0.3061 -0.0127 -0.0335 -0.0157 204 VAL A N   
1257 C CA  . VAL A 226 ? 0.4538 0.4102 0.3286 -0.0155 -0.0333 -0.0225 204 VAL A CA  
1258 C C   . VAL A 226 ? 0.4389 0.4019 0.3035 -0.0169 -0.0465 -0.0276 204 VAL A C   
1259 O O   . VAL A 226 ? 0.4417 0.4035 0.3038 -0.0230 -0.0500 -0.0373 204 VAL A O   
1260 C CB  . VAL A 226 ? 0.4978 0.4408 0.3534 -0.0112 -0.0233 -0.0185 204 VAL A CB  
1261 C CG1 . VAL A 226 ? 0.4860 0.4256 0.3558 -0.0105 -0.0118 -0.0147 204 VAL A CG1 
1262 C CG2 . VAL A 226 ? 0.5367 0.4796 0.3788 -0.0048 -0.0259 -0.0101 204 VAL A CG2 
1263 N N   . GLY A 227 ? 0.4282 0.3986 0.2887 -0.0112 -0.0545 -0.0213 205 GLY A N   
1264 C CA  . GLY A 227 ? 0.4287 0.4082 0.2805 -0.0117 -0.0691 -0.0259 205 GLY A CA  
1265 C C   . GLY A 227 ? 0.4166 0.4108 0.2918 -0.0189 -0.0775 -0.0340 205 GLY A C   
1266 O O   . GLY A 227 ? 0.4188 0.4172 0.2887 -0.0240 -0.0869 -0.0436 205 GLY A O   
1267 N N   . VAL A 228 ? 0.3884 0.3909 0.2899 -0.0194 -0.0739 -0.0306 206 VAL A N   
1268 C CA  . VAL A 228 ? 0.3874 0.4054 0.3137 -0.0258 -0.0799 -0.0365 206 VAL A CA  
1269 C C   . VAL A 228 ? 0.3730 0.3830 0.3019 -0.0356 -0.0743 -0.0457 206 VAL A C   
1270 O O   . VAL A 228 ? 0.3755 0.3931 0.3127 -0.0430 -0.0816 -0.0543 206 VAL A O   
1271 C CB  . VAL A 228 ? 0.3706 0.3991 0.3221 -0.0226 -0.0762 -0.0300 206 VAL A CB  
1272 C CG1 . VAL A 228 ? 0.3672 0.4095 0.3447 -0.0303 -0.0775 -0.0359 206 VAL A CG1 
1273 C CG2 . VAL A 228 ? 0.3867 0.4249 0.3392 -0.0134 -0.0845 -0.0225 206 VAL A CG2 
1274 N N   . ALA A 229 ? 0.3763 0.3705 0.2978 -0.0354 -0.0618 -0.0440 207 ALA A N   
1275 C CA  . ALA A 229 ? 0.3959 0.3793 0.3177 -0.0432 -0.0558 -0.0518 207 ALA A CA  
1276 C C   . ALA A 229 ? 0.4311 0.4089 0.3362 -0.0481 -0.0631 -0.0624 207 ALA A C   
1277 O O   . ALA A 229 ? 0.4295 0.4089 0.3450 -0.0571 -0.0662 -0.0713 207 ALA A O   
1278 C CB  . ALA A 229 ? 0.3941 0.3620 0.3093 -0.0403 -0.0421 -0.0476 207 ALA A CB  
1279 N N   . TRP A 230 ? 0.4640 0.4361 0.3436 -0.0424 -0.0663 -0.0618 208 TRP A N   
1280 C CA  A TRP A 230 ? 0.4961 0.4628 0.3557 -0.0461 -0.0740 -0.0729 208 TRP A CA  
1281 C CA  B TRP A 230 ? 0.5024 0.4694 0.3610 -0.0457 -0.0743 -0.0726 208 TRP A CA  
1282 C C   . TRP A 230 ? 0.5091 0.4942 0.3797 -0.0512 -0.0904 -0.0796 208 TRP A C   
1283 O O   . TRP A 230 ? 0.4948 0.4783 0.3659 -0.0600 -0.0958 -0.0921 208 TRP A O   
1284 C CB  A TRP A 230 ? 0.5255 0.4817 0.3526 -0.0381 -0.0722 -0.0698 208 TRP A CB  
1285 C CB  B TRP A 230 ? 0.5399 0.4992 0.3671 -0.0369 -0.0742 -0.0682 208 TRP A CB  
1286 C CG  A TRP A 230 ? 0.5352 0.4727 0.3528 -0.0359 -0.0558 -0.0680 208 TRP A CG  
1287 C CG  B TRP A 230 ? 0.5989 0.5558 0.4003 -0.0384 -0.0847 -0.0786 208 TRP A CG  
1288 C CD1 A TRP A 230 ? 0.5203 0.4544 0.3421 -0.0298 -0.0446 -0.0569 208 TRP A CD1 
1289 C CD1 B TRP A 230 ? 0.6193 0.5888 0.4095 -0.0350 -0.0999 -0.0784 208 TRP A CD1 
1290 C CD2 A TRP A 230 ? 0.5522 0.4730 0.3573 -0.0397 -0.0492 -0.0782 208 TRP A CD2 
1291 C CD2 B TRP A 230 ? 0.6545 0.5951 0.4364 -0.0427 -0.0812 -0.0910 208 TRP A CD2 
1292 N NE1 A TRP A 230 ? 0.5310 0.4494 0.3446 -0.0292 -0.0320 -0.0591 208 TRP A NE1 
1293 N NE1 B TRP A 230 ? 0.6656 0.6286 0.4297 -0.0374 -0.1066 -0.0903 208 TRP A NE1 
1294 C CE2 A TRP A 230 ? 0.5427 0.4520 0.3457 -0.0347 -0.0340 -0.0718 208 TRP A CE2 
1295 C CE2 B TRP A 230 ? 0.6743 0.6190 0.4329 -0.0424 -0.0950 -0.0988 208 TRP A CE2 
1296 C CE3 A TRP A 230 ? 0.5749 0.4891 0.3714 -0.0469 -0.0546 -0.0928 208 TRP A CE3 
1297 C CE3 B TRP A 230 ? 0.6668 0.5896 0.4486 -0.0462 -0.0678 -0.0964 208 TRP A CE3 
1298 C CZ2 A TRP A 230 ? 0.5546 0.4466 0.3478 -0.0354 -0.0238 -0.0786 208 TRP A CZ2 
1299 C CZ2 B TRP A 230 ? 0.7461 0.6770 0.4805 -0.0462 -0.0957 -0.1132 208 TRP A CZ2 
1300 C CZ3 A TRP A 230 ? 0.5886 0.4830 0.3737 -0.0480 -0.0439 -0.1002 208 TRP A CZ3 
1301 C CZ3 B TRP A 230 ? 0.7172 0.6255 0.4765 -0.0494 -0.0677 -0.1101 208 TRP A CZ3 
1302 C CH2 A TRP A 230 ? 0.5755 0.4593 0.3593 -0.0417 -0.0285 -0.0926 208 TRP A CH2 
1303 C CH2 B TRP A 230 ? 0.7505 0.6627 0.4860 -0.0498 -0.0814 -0.1190 208 TRP A CH2 
1304 N N   . ARG A 231 ? 0.5018 0.5047 0.3840 -0.0460 -0.0983 -0.0719 209 ARG A N   
1305 C CA  . ARG A 231 ? 0.5215 0.5452 0.4184 -0.0500 -0.1144 -0.0777 209 ARG A CA  
1306 C C   . ARG A 231 ? 0.4880 0.5195 0.4162 -0.0613 -0.1127 -0.0846 209 ARG A C   
1307 O O   . ARG A 231 ? 0.4986 0.5406 0.4358 -0.0693 -0.1236 -0.0950 209 ARG A O   
1308 C CB  . ARG A 231 ? 0.5505 0.5912 0.4552 -0.0404 -0.1221 -0.0669 209 ARG A CB  
1309 C CG  . ARG A 231 ? 0.6289 0.6643 0.5020 -0.0300 -0.1275 -0.0607 209 ARG A CG  
1310 C CD  . ARG A 231 ? 0.6633 0.7041 0.5416 -0.0186 -0.1264 -0.0456 209 ARG A CD  
1311 N NE  . ARG A 231 ? 0.7382 0.8026 0.6355 -0.0154 -0.1412 -0.0440 209 ARG A NE  
1312 C CZ  . ARG A 231 ? 0.7506 0.8258 0.6699 -0.0087 -0.1404 -0.0346 209 ARG A CZ  
1313 N NH1 . ARG A 231 ? 0.6859 0.7505 0.6112 -0.0052 -0.1259 -0.0262 209 ARG A NH1 
1314 N NH2 . ARG A 231 ? 0.7437 0.8412 0.6804 -0.0055 -0.1546 -0.0343 209 ARG A NH2 
1315 N N   . LEU A 232 ? 0.4618 0.4883 0.4063 -0.0624 -0.0990 -0.0788 210 LEU A N   
1316 C CA  . LEU A 232 ? 0.4534 0.4850 0.4249 -0.0731 -0.0955 -0.0840 210 LEU A CA  
1317 C C   . LEU A 232 ? 0.4690 0.4843 0.4320 -0.0831 -0.0934 -0.0961 210 LEU A C   
1318 O O   . LEU A 232 ? 0.4608 0.4833 0.4396 -0.0937 -0.0994 -0.1058 210 LEU A O   
1319 C CB  . LEU A 232 ? 0.4321 0.4598 0.4174 -0.0710 -0.0808 -0.0748 210 LEU A CB  
1320 C CG  . LEU A 232 ? 0.4373 0.4814 0.4365 -0.0628 -0.0818 -0.0649 210 LEU A CG  
1321 C CD1 . LEU A 232 ? 0.4131 0.4505 0.4199 -0.0603 -0.0673 -0.0570 210 LEU A CD1 
1322 C CD2 . LEU A 232 ? 0.4560 0.5248 0.4820 -0.0671 -0.0916 -0.0682 210 LEU A CD2 
1323 N N   . LYS A 233 ? 0.4894 0.4824 0.4289 -0.0795 -0.0841 -0.0955 211 LYS A N   
1324 C CA  . LYS A 233 ? 0.5304 0.5039 0.4594 -0.0868 -0.0799 -0.1063 211 LYS A CA  
1325 C C   . LYS A 233 ? 0.5592 0.5370 0.4798 -0.0934 -0.0945 -0.1205 211 LYS A C   
1326 O O   . LYS A 233 ? 0.5252 0.4973 0.4552 -0.1046 -0.0953 -0.1319 211 LYS A O   
1327 C CB  . LYS A 233 ? 0.5735 0.5254 0.4761 -0.0790 -0.0692 -0.1030 211 LYS A CB  
1328 C CG  . LYS A 233 ? 0.6616 0.5910 0.5536 -0.0851 -0.0629 -0.1140 211 LYS A CG  
1329 C CD  . LYS A 233 ? 0.7141 0.6246 0.5826 -0.0764 -0.0516 -0.1106 211 LYS A CD  
1330 C CE  . LYS A 233 ? 0.7880 0.7003 0.6285 -0.0694 -0.0583 -0.1117 211 LYS A CE  
1331 N NZ  . LYS A 233 ? 0.8827 0.7919 0.7089 -0.0761 -0.0691 -0.1276 211 LYS A NZ  
1332 N N   . ASN A 234 ? 0.5785 0.5668 0.4821 -0.0865 -0.1064 -0.1198 212 ASN A N   
1333 C CA  . ASN A 234 ? 0.6365 0.6313 0.5296 -0.0918 -0.1226 -0.1335 212 ASN A CA  
1334 C C   . ASN A 234 ? 0.6250 0.6406 0.5498 -0.1030 -0.1339 -0.1415 212 ASN A C   
1335 O O   . ASN A 234 ? 0.6410 0.6585 0.5618 -0.1112 -0.1455 -0.1565 212 ASN A O   
1336 C CB  . ASN A 234 ? 0.6817 0.6845 0.5488 -0.0807 -0.1336 -0.1290 212 ASN A CB  
1337 C CG  . ASN A 234 ? 0.7432 0.7238 0.5746 -0.0721 -0.1233 -0.1255 212 ASN A CG  
1338 O OD1 . ASN A 234 ? 0.8168 0.7764 0.6370 -0.0759 -0.1133 -0.1330 212 ASN A OD1 
1339 N ND2 . ASN A 234 ? 0.7716 0.7564 0.5862 -0.0604 -0.1249 -0.1139 212 ASN A ND2 
1340 N N   . GLU A 235 ? 0.5892 0.6204 0.5457 -0.1037 -0.1302 -0.1326 213 GLU A N   
1341 C CA  . GLU A 235 ? 0.6095 0.6623 0.6004 -0.1148 -0.1389 -0.1395 213 GLU A CA  
1342 C C   . GLU A 235 ? 0.5834 0.6266 0.5983 -0.1272 -0.1261 -0.1429 213 GLU A C   
1343 O O   . GLU A 235 ? 0.5793 0.6388 0.6244 -0.1380 -0.1311 -0.1489 213 GLU A O   
1344 C CB  . GLU A 235 ? 0.6191 0.6989 0.6325 -0.1077 -0.1437 -0.1283 213 GLU A CB  
1345 C CG  . GLU A 235 ? 0.6504 0.7403 0.6432 -0.0944 -0.1562 -0.1225 213 GLU A CG  
1346 C CD  . GLU A 235 ? 0.7055 0.8032 0.6828 -0.0971 -0.1755 -0.1352 213 GLU A CD  
1347 O OE1 . GLU A 235 ? 0.7312 0.8391 0.7266 -0.1098 -0.1844 -0.1488 213 GLU A OE1 
1348 O OE2 . GLU A 235 ? 0.7835 0.8770 0.7295 -0.0866 -0.1821 -0.1316 213 GLU A OE2 
1349 N N   . ILE A 236 ? 0.5568 0.5742 0.5596 -0.1255 -0.1096 -0.1384 214 ILE A N   
1350 C CA  . ILE A 236 ? 0.5393 0.5457 0.5629 -0.1352 -0.0960 -0.1382 214 ILE A CA  
1351 C C   . ILE A 236 ? 0.5622 0.5394 0.5691 -0.1416 -0.0902 -0.1489 214 ILE A C   
1352 O O   . ILE A 236 ? 0.5485 0.5052 0.5303 -0.1332 -0.0816 -0.1452 214 ILE A O   
1353 C CB  . ILE A 236 ? 0.4964 0.4984 0.5244 -0.1269 -0.0804 -0.1218 214 ILE A CB  
1354 C CG1 . ILE A 236 ? 0.4709 0.5005 0.5177 -0.1212 -0.0849 -0.1126 214 ILE A CG1 
1355 C CG2 . ILE A 236 ? 0.4877 0.4760 0.5327 -0.1356 -0.0658 -0.1203 214 ILE A CG2 
1356 C CD1 . ILE A 236 ? 0.4431 0.4696 0.4909 -0.1120 -0.0715 -0.0980 214 ILE A CD1 
1357 N N   . PRO A 237 ? 0.5977 0.5728 0.6206 -0.1564 -0.0939 -0.1624 215 PRO A N   
1358 C CA  . PRO A 237 ? 0.6238 0.5690 0.6319 -0.1626 -0.0880 -0.1737 215 PRO A CA  
1359 C C   . PRO A 237 ? 0.6144 0.5356 0.6225 -0.1597 -0.0679 -0.1634 215 PRO A C   
1360 O O   . PRO A 237 ? 0.6099 0.5386 0.6380 -0.1590 -0.0590 -0.1506 215 PRO A O   
1361 C CB  . PRO A 237 ? 0.6475 0.5985 0.6811 -0.1806 -0.0955 -0.1887 215 PRO A CB  
1362 C CG  . PRO A 237 ? 0.6391 0.6265 0.6950 -0.1822 -0.1097 -0.1875 215 PRO A CG  
1363 C CD  . PRO A 237 ? 0.5975 0.5973 0.6544 -0.1685 -0.1033 -0.1684 215 PRO A CD  
1364 N N   . ASN A 238 ? 0.6320 0.5251 0.6164 -0.1570 -0.0612 -0.1689 216 ASN A N   
1365 C CA  . ASN A 238 ? 0.6350 0.5036 0.6161 -0.1522 -0.0431 -0.1596 216 ASN A CA  
1366 C C   . ASN A 238 ? 0.5934 0.4693 0.5717 -0.1386 -0.0351 -0.1409 216 ASN A C   
1367 O O   . ASN A 238 ? 0.5709 0.4371 0.5591 -0.1371 -0.0219 -0.1303 216 ASN A O   
1368 C CB  . ASN A 238 ? 0.6533 0.5110 0.6607 -0.1650 -0.0341 -0.1603 216 ASN A CB  
1369 C CG  . ASN A 238 ? 0.7118 0.5584 0.7236 -0.1796 -0.0406 -0.1799 216 ASN A CG  
1370 O OD1 . ASN A 238 ? 0.7345 0.5955 0.7725 -0.1929 -0.0466 -0.1856 216 ASN A OD1 
1371 N ND2 . ASN A 238 ? 0.7496 0.5716 0.7366 -0.1774 -0.0394 -0.1912 216 ASN A ND2 
1372 N N   . SER A 239 ? 0.5628 0.4553 0.5276 -0.1289 -0.0432 -0.1368 217 SER A N   
1373 C CA  . SER A 239 ? 0.5414 0.4396 0.5017 -0.1163 -0.0365 -0.1211 217 SER A CA  
1374 C C   . SER A 239 ? 0.5409 0.4243 0.4721 -0.1055 -0.0327 -0.1208 217 SER A C   
1375 O O   . SER A 239 ? 0.5357 0.4119 0.4475 -0.1063 -0.0388 -0.1322 217 SER A O   
1376 C CB  . SER A 239 ? 0.5205 0.4476 0.4901 -0.1127 -0.0465 -0.1149 217 SER A CB  
1377 O OG  . SER A 239 ? 0.5295 0.4651 0.4827 -0.1107 -0.0602 -0.1226 217 SER A OG  
1378 N N   . HIS A 240 ? 0.5254 0.4056 0.4538 -0.0955 -0.0227 -0.1081 218 HIS A N   
1379 C CA  . HIS A 240 ? 0.5448 0.4123 0.4496 -0.0850 -0.0167 -0.1063 218 HIS A CA  
1380 C C   . HIS A 240 ? 0.4986 0.3786 0.4047 -0.0749 -0.0138 -0.0923 218 HIS A C   
1381 O O   . HIS A 240 ? 0.4779 0.3665 0.4020 -0.0748 -0.0105 -0.0832 218 HIS A O   
1382 C CB  . HIS A 240 ? 0.5652 0.4076 0.4672 -0.0838 -0.0036 -0.1072 218 HIS A CB  
1383 C CG  . HIS A 240 ? 0.6046 0.4315 0.5120 -0.0948 -0.0035 -0.1193 218 HIS A CG  
1384 N ND1 . HIS A 240 ? 0.6636 0.4757 0.5533 -0.0977 -0.0062 -0.1342 218 HIS A ND1 
1385 C CD2 . HIS A 240 ? 0.6241 0.4475 0.5529 -0.1044 -0.0008 -0.1191 218 HIS A CD2 
1386 C CE1 . HIS A 240 ? 0.6671 0.4665 0.5681 -0.1090 -0.0057 -0.1435 218 HIS A CE1 
1387 N NE2 . HIS A 240 ? 0.6523 0.4580 0.5777 -0.1134 -0.0020 -0.1340 218 HIS A NE2 
1388 N N   . ILE A 241 ? 0.4801 0.3606 0.3669 -0.0668 -0.0146 -0.0908 219 ILE A N   
1389 C CA  . ILE A 241 ? 0.4599 0.3474 0.3468 -0.0573 -0.0097 -0.0784 219 ILE A CA  
1390 C C   . ILE A 241 ? 0.4930 0.3629 0.3696 -0.0512 0.0025  -0.0775 219 ILE A C   
1391 O O   . ILE A 241 ? 0.4741 0.3334 0.3307 -0.0485 0.0043  -0.0838 219 ILE A O   
1392 C CB  . ILE A 241 ? 0.4658 0.3657 0.3403 -0.0524 -0.0175 -0.0759 219 ILE A CB  
1393 C CG1 . ILE A 241 ? 0.4670 0.3853 0.3535 -0.0573 -0.0302 -0.0770 219 ILE A CG1 
1394 C CG2 . ILE A 241 ? 0.4463 0.3512 0.3223 -0.0436 -0.0114 -0.0639 219 ILE A CG2 
1395 C CD1 . ILE A 241 ? 0.4986 0.4260 0.3689 -0.0531 -0.0402 -0.0769 219 ILE A CD1 
1396 N N   . LEU A 242 ? 0.4752 0.3424 0.3651 -0.0485 0.0107  -0.0700 220 LEU A N   
1397 C CA  . LEU A 242 ? 0.5084 0.3624 0.3925 -0.0413 0.0216  -0.0677 220 LEU A CA  
1398 C C   . LEU A 242 ? 0.5211 0.3809 0.3939 -0.0329 0.0240  -0.0629 220 LEU A C   
1399 O O   . LEU A 242 ? 0.5119 0.3606 0.3726 -0.0279 0.0315  -0.0655 220 LEU A O   
1400 C CB  . LEU A 242 ? 0.4940 0.3471 0.3952 -0.0394 0.0279  -0.0592 220 LEU A CB  
1401 C CG  . LEU A 242 ? 0.5081 0.3505 0.4181 -0.0474 0.0286  -0.0634 220 LEU A CG  
1402 C CD1 . LEU A 242 ? 0.5185 0.3622 0.4434 -0.0452 0.0340  -0.0531 220 LEU A CD1 
1403 C CD2 . LEU A 242 ? 0.5530 0.3727 0.4525 -0.0484 0.0339  -0.0729 220 LEU A CD2 
1404 N N   . ASP A 243 ? 0.4843 0.3605 0.3617 -0.0317 0.0184  -0.0563 221 ASP A N   
1405 C CA  . ASP A 243 ? 0.4838 0.3657 0.3505 -0.0256 0.0194  -0.0516 221 ASP A CA  
1406 C C   . ASP A 243 ? 0.4678 0.3478 0.3388 -0.0184 0.0300  -0.0452 221 ASP A C   
1407 O O   . ASP A 243 ? 0.4637 0.3342 0.3234 -0.0142 0.0378  -0.0475 221 ASP A O   
1408 C CB  . ASP A 243 ? 0.5334 0.4086 0.3762 -0.0258 0.0168  -0.0590 221 ASP A CB  
1409 C CG  . ASP A 243 ? 0.5737 0.4566 0.4055 -0.0207 0.0157  -0.0525 221 ASP A CG  
1410 O OD1 . ASP A 243 ? 0.5616 0.4526 0.4053 -0.0170 0.0189  -0.0429 221 ASP A OD1 
1411 O OD2 . ASP A 243 ? 0.6168 0.4968 0.4272 -0.0205 0.0116  -0.0569 221 ASP A OD2 
1412 N N   . GLN A 244 ? 0.4311 0.3214 0.3192 -0.0169 0.0300  -0.0376 222 GLN A N   
1413 C CA  . GLN A 244 ? 0.4323 0.3252 0.3285 -0.0107 0.0376  -0.0314 222 GLN A CA  
1414 C C   . GLN A 244 ? 0.4452 0.3399 0.3328 -0.0064 0.0423  -0.0285 222 GLN A C   
1415 O O   . GLN A 244 ? 0.4293 0.3248 0.3234 -0.0017 0.0503  -0.0252 222 GLN A O   
1416 C CB  . GLN A 244 ? 0.4255 0.3308 0.3395 -0.0107 0.0345  -0.0251 222 GLN A CB  
1417 C CG  . GLN A 244 ? 0.4268 0.3435 0.3430 -0.0121 0.0278  -0.0219 222 GLN A CG  
1418 C CD  . GLN A 244 ? 0.4340 0.3618 0.3670 -0.0119 0.0254  -0.0174 222 GLN A CD  
1419 O OE1 . GLN A 244 ? 0.4155 0.3447 0.3574 -0.0090 0.0294  -0.0148 222 GLN A OE1 
1420 N NE2 . GLN A 244 ? 0.4313 0.3676 0.3682 -0.0143 0.0186  -0.0165 222 GLN A NE2 
1421 N N   . TYR A 245 ? 0.4504 0.3468 0.3249 -0.0079 0.0374  -0.0288 223 TYR A N   
1422 C CA  . TYR A 245 ? 0.4609 0.3575 0.3250 -0.0041 0.0426  -0.0246 223 TYR A CA  
1423 C C   . TYR A 245 ? 0.4620 0.3466 0.3076 -0.0013 0.0514  -0.0295 223 TYR A C   
1424 O O   . TYR A 245 ? 0.4571 0.3416 0.2978 0.0026  0.0598  -0.0252 223 TYR A O   
1425 C CB  . TYR A 245 ? 0.4589 0.3608 0.3140 -0.0053 0.0343  -0.0215 223 TYR A CB  
1426 C CG  . TYR A 245 ? 0.4513 0.3649 0.3254 -0.0070 0.0272  -0.0168 223 TYR A CG  
1427 C CD1 . TYR A 245 ? 0.4276 0.3473 0.3172 -0.0049 0.0314  -0.0103 223 TYR A CD1 
1428 C CD2 . TYR A 245 ? 0.4786 0.3973 0.3568 -0.0111 0.0170  -0.0201 223 TYR A CD2 
1429 C CE1 . TYR A 245 ? 0.4120 0.3412 0.3177 -0.0061 0.0256  -0.0077 223 TYR A CE1 
1430 C CE2 . TYR A 245 ? 0.4504 0.3797 0.3460 -0.0120 0.0120  -0.0166 223 TYR A CE2 
1431 C CZ  . TYR A 245 ? 0.4428 0.3766 0.3508 -0.0092 0.0163  -0.0106 223 TYR A CZ  
1432 O OH  . TYR A 245 ? 0.4374 0.3807 0.3609 -0.0098 0.0118  -0.0085 223 TYR A OH  
1433 N N   . ARG A 246 ? 0.4787 0.3531 0.3146 -0.0035 0.0499  -0.0386 224 ARG A N   
1434 C CA  . ARG A 246 ? 0.5384 0.3995 0.3545 -0.0009 0.0577  -0.0458 224 ARG A CA  
1435 C C   . ARG A 246 ? 0.5311 0.3814 0.3539 0.0002  0.0639  -0.0520 224 ARG A C   
1436 O O   . ARG A 246 ? 0.5508 0.3905 0.3619 0.0042  0.0734  -0.0569 224 ARG A O   
1437 C CB  . ARG A 246 ? 0.5725 0.4281 0.3652 -0.0047 0.0491  -0.0539 224 ARG A CB  
1438 C CG  . ARG A 246 ? 0.6137 0.4782 0.3959 -0.0046 0.0420  -0.0479 224 ARG A CG  
1439 C CD  . ARG A 246 ? 0.6615 0.5214 0.4178 -0.0070 0.0330  -0.0564 224 ARG A CD  
1440 N NE  . ARG A 246 ? 0.7709 0.6157 0.5061 -0.0059 0.0395  -0.0673 224 ARG A NE  
1441 C CZ  . ARG A 246 ? 0.8260 0.6632 0.5415 0.0000  0.0513  -0.0670 224 ARG A CZ  
1442 N NH1 . ARG A 246 ? 0.8457 0.6886 0.5607 0.0049  0.0588  -0.0553 224 ARG A NH1 
1443 N NH2 . ARG A 246 ? 0.8679 0.6909 0.5647 0.0007  0.0566  -0.0789 224 ARG A NH2 
1444 N N   . ASN A 247 ? 0.4920 0.3437 0.3323 -0.0030 0.0592  -0.0515 225 ASN A N   
1445 C CA  . ASN A 247 ? 0.4953 0.3342 0.3411 -0.0021 0.0642  -0.0566 225 ASN A CA  
1446 C C   . ASN A 247 ? 0.4746 0.3144 0.3335 0.0060  0.0751  -0.0512 225 ASN A C   
1447 O O   . ASN A 247 ? 0.4416 0.2942 0.3185 0.0078  0.0740  -0.0427 225 ASN A O   
1448 C CB  . ASN A 247 ? 0.4917 0.3327 0.3519 -0.0081 0.0563  -0.0557 225 ASN A CB  
1449 C CG  . ASN A 247 ? 0.5203 0.3445 0.3824 -0.0095 0.0598  -0.0619 225 ASN A CG  
1450 O OD1 . ASN A 247 ? 0.5212 0.3346 0.3831 -0.0032 0.0693  -0.0632 225 ASN A OD1 
1451 N ND2 . ASN A 247 ? 0.5193 0.3411 0.3852 -0.0177 0.0524  -0.0656 225 ASN A ND2 
1452 N N   . ALA A 248 ? 0.4843 0.3112 0.3350 0.0110  0.0850  -0.0569 226 ALA A N   
1453 C CA  . ALA A 248 ? 0.4781 0.3067 0.3429 0.0197  0.0958  -0.0524 226 ALA A CA  
1454 C C   . ALA A 248 ? 0.4807 0.3124 0.3673 0.0216  0.0934  -0.0465 226 ALA A C   
1455 O O   . ALA A 248 ? 0.4554 0.2974 0.3587 0.0280  0.0975  -0.0397 226 ALA A O   
1456 C CB  . ALA A 248 ? 0.5113 0.3233 0.3633 0.0252  0.1071  -0.0610 226 ALA A CB  
1457 N N   . SER A 249 ? 0.4865 0.3100 0.3729 0.0159  0.0866  -0.0489 227 SER A N   
1458 C CA  . SER A 249 ? 0.4789 0.3045 0.3824 0.0168  0.0837  -0.0423 227 SER A CA  
1459 C C   . SER A 249 ? 0.4498 0.2963 0.3683 0.0180  0.0789  -0.0325 227 SER A C   
1460 O O   . SER A 249 ? 0.4497 0.3003 0.3820 0.0227  0.0791  -0.0262 227 SER A O   
1461 C CB  . SER A 249 ? 0.4851 0.3006 0.3852 0.0081  0.0772  -0.0461 227 SER A CB  
1462 O OG  . SER A 249 ? 0.4945 0.2880 0.3859 0.0079  0.0826  -0.0547 227 SER A OG  
1463 N N   . ASN A 250 ? 0.4354 0.2943 0.3504 0.0143  0.0746  -0.0315 228 ASN A N   
1464 C CA  . ASN A 250 ? 0.4045 0.2821 0.3334 0.0153  0.0708  -0.0239 228 ASN A CA  
1465 C C   . ASN A 250 ? 0.4085 0.2944 0.3498 0.0233  0.0780  -0.0201 228 ASN A C   
1466 O O   . ASN A 250 ? 0.4040 0.2966 0.3602 0.0279  0.0772  -0.0154 228 ASN A O   
1467 C CB  . ASN A 250 ? 0.3922 0.2773 0.3133 0.0094  0.0649  -0.0243 228 ASN A CB  
1468 C CG  . ASN A 250 ? 0.3683 0.2701 0.3020 0.0098  0.0620  -0.0180 228 ASN A CG  
1469 O OD1 . ASN A 250 ? 0.3773 0.2880 0.3265 0.0137  0.0628  -0.0138 228 ASN A OD1 
1470 N ND2 . ASN A 250 ? 0.3489 0.2550 0.2760 0.0058  0.0577  -0.0177 228 ASN A ND2 
1471 N N   . PRO A 251 ? 0.4070 0.2938 0.3429 0.0252  0.0851  -0.0218 229 PRO A N   
1472 C CA  . PRO A 251 ? 0.3972 0.2946 0.3495 0.0321  0.0921  -0.0181 229 PRO A CA  
1473 C C   . PRO A 251 ? 0.4048 0.2956 0.3652 0.0402  0.0977  -0.0186 229 PRO A C   
1474 O O   . PRO A 251 ? 0.4039 0.3073 0.3835 0.0461  0.0990  -0.0141 229 PRO A O   
1475 C CB  . PRO A 251 ? 0.4146 0.3117 0.3572 0.0321  0.1007  -0.0198 229 PRO A CB  
1476 C CG  . PRO A 251 ? 0.4444 0.3254 0.3618 0.0281  0.0997  -0.0264 229 PRO A CG  
1477 C CD  . PRO A 251 ? 0.4278 0.3082 0.3441 0.0218  0.0873  -0.0263 229 PRO A CD  
1478 N N   . LEU A 252 ? 0.4300 0.3016 0.3771 0.0406  0.1004  -0.0241 230 LEU A N   
1479 C CA  . LEU A 252 ? 0.4482 0.3103 0.4027 0.0492  0.1063  -0.0243 230 LEU A CA  
1480 C C   . LEU A 252 ? 0.4256 0.2932 0.3944 0.0518  0.0993  -0.0171 230 LEU A C   
1481 O O   . LEU A 252 ? 0.4176 0.2877 0.4001 0.0612  0.1027  -0.0133 230 LEU A O   
1482 C CB  . LEU A 252 ? 0.4815 0.3187 0.4182 0.0484  0.1112  -0.0329 230 LEU A CB  
1483 C CG  . LEU A 252 ? 0.5019 0.3306 0.4225 0.0495  0.1209  -0.0412 230 LEU A CG  
1484 C CD1 . LEU A 252 ? 0.5383 0.3427 0.4396 0.0458  0.1217  -0.0514 230 LEU A CD1 
1485 C CD2 . LEU A 252 ? 0.5062 0.3386 0.4379 0.0605  0.1335  -0.0406 230 LEU A CD2 
1486 N N   . ALA A 253 ? 0.4171 0.2870 0.3825 0.0444  0.0897  -0.0149 231 ALA A N   
1487 C CA  . ALA A 253 ? 0.4051 0.2799 0.3809 0.0472  0.0838  -0.0076 231 ALA A CA  
1488 C C   . ALA A 253 ? 0.3887 0.2854 0.3829 0.0537  0.0820  -0.0021 231 ALA A C   
1489 O O   . ALA A 253 ? 0.3933 0.2940 0.3986 0.0618  0.0808  0.0034  231 ALA A O   
1490 C CB  . ALA A 253 ? 0.4085 0.2852 0.3782 0.0380  0.0751  -0.0066 231 ALA A CB  
1491 N N   . HIS A 254 ? 0.3582 0.2689 0.3561 0.0501  0.0818  -0.0036 232 HIS A N   
1492 C CA  . HIS A 254 ? 0.3547 0.2871 0.3721 0.0540  0.0797  0.0001  232 HIS A CA  
1493 C C   . HIS A 254 ? 0.3568 0.2933 0.3875 0.0632  0.0888  0.0000  232 HIS A C   
1494 O O   . HIS A 254 ? 0.3536 0.3051 0.4029 0.0699  0.0863  0.0039  232 HIS A O   
1495 C CB  . HIS A 254 ? 0.3475 0.2914 0.3655 0.0462  0.0770  -0.0012 232 HIS A CB  
1496 C CG  . HIS A 254 ? 0.3479 0.2907 0.3566 0.0386  0.0681  -0.0009 232 HIS A CG  
1497 N ND1 . HIS A 254 ? 0.3594 0.3097 0.3735 0.0394  0.0598  0.0026  232 HIS A ND1 
1498 C CD2 . HIS A 254 ? 0.3527 0.2888 0.3474 0.0309  0.0663  -0.0036 232 HIS A CD2 
1499 C CE1 . HIS A 254 ? 0.3560 0.3039 0.3606 0.0322  0.0544  0.0018  232 HIS A CE1 
1500 N NE2 . HIS A 254 ? 0.3698 0.3099 0.3639 0.0271  0.0577  -0.0019 232 HIS A NE2 
1501 N N   . TYR A 255 ? 0.3627 0.2869 0.3838 0.0638  0.0992  -0.0049 233 TYR A N   
1502 C CA  . TYR A 255 ? 0.3750 0.3011 0.4081 0.0736  0.1098  -0.0056 233 TYR A CA  
1503 C C   . TYR A 255 ? 0.3851 0.3041 0.4253 0.0839  0.1094  -0.0025 233 TYR A C   
1504 O O   . TYR A 255 ? 0.3954 0.3281 0.4566 0.0934  0.1114  0.0009  233 TYR A O   
1505 C CB  . TYR A 255 ? 0.3923 0.3024 0.4076 0.0721  0.1212  -0.0125 233 TYR A CB  
1506 C CG  . TYR A 255 ? 0.3948 0.3039 0.4181 0.0816  0.1349  -0.0150 233 TYR A CG  
1507 C CD1 . TYR A 255 ? 0.3942 0.3203 0.4314 0.0828  0.1428  -0.0142 233 TYR A CD1 
1508 C CD2 . TYR A 255 ? 0.4209 0.3102 0.4367 0.0886  0.1415  -0.0190 233 TYR A CD2 
1509 C CE1 . TYR A 255 ? 0.4019 0.3282 0.4471 0.0917  0.1570  -0.0167 233 TYR A CE1 
1510 C CE2 . TYR A 255 ? 0.4413 0.3288 0.4637 0.0981  0.1556  -0.0223 233 TYR A CE2 
1511 C CZ  . TYR A 255 ? 0.4308 0.3378 0.4679 0.0998  0.1636  -0.0210 233 TYR A CZ  
1512 O OH  . TYR A 255 ? 0.4584 0.3652 0.5035 0.1095  0.1792  -0.0243 233 TYR A OH  
1513 N N   . ASP A 256 ? 0.4010 0.2995 0.4254 0.0820  0.1067  -0.0031 234 ASP A N   
1514 C CA  . ASP A 256 ? 0.4462 0.3319 0.4740 0.0916  0.1080  0.0005  234 ASP A CA  
1515 C C   . ASP A 256 ? 0.4277 0.3266 0.4672 0.0958  0.0974  0.0098  234 ASP A C   
1516 O O   . ASP A 256 ? 0.4188 0.3186 0.4700 0.1076  0.0981  0.0152  234 ASP A O   
1517 C CB  . ASP A 256 ? 0.4607 0.3179 0.4677 0.0864  0.1096  -0.0035 234 ASP A CB  
1518 C CG  . ASP A 256 ? 0.4922 0.3322 0.4857 0.0848  0.1202  -0.0137 234 ASP A CG  
1519 O OD1 . ASP A 256 ? 0.4774 0.3252 0.4781 0.0907  0.1287  -0.0163 234 ASP A OD1 
1520 O OD2 . ASP A 256 ? 0.4770 0.2964 0.4528 0.0775  0.1201  -0.0194 234 ASP A OD2 
1521 N N   . THR A 257 ? 0.4090 0.3169 0.4437 0.0871  0.0877  0.0116  235 THR A N   
1522 C CA  . THR A 257 ? 0.4172 0.3339 0.4567 0.0906  0.0778  0.0198  235 THR A CA  
1523 C C   . THR A 257 ? 0.3844 0.3294 0.4382 0.0896  0.0694  0.0212  235 THR A C   
1524 O O   . THR A 257 ? 0.3974 0.3580 0.4677 0.0990  0.0658  0.0255  235 THR A O   
1525 C CB  . THR A 257 ? 0.4320 0.3331 0.4537 0.0830  0.0737  0.0218  235 THR A CB  
1526 O OG1 . THR A 257 ? 0.4442 0.3500 0.4577 0.0707  0.0704  0.0167  235 THR A OG1 
1527 C CG2 . THR A 257 ? 0.4544 0.3273 0.4652 0.0837  0.0818  0.0198  235 THR A CG2 
1528 N N   . THR A 258 ? 0.3597 0.3113 0.4082 0.0786  0.0659  0.0173  236 THR A N   
1529 C CA  . THR A 258 ? 0.3590 0.3346 0.4202 0.0760  0.0579  0.0174  236 THR A CA  
1530 C C   . THR A 258 ? 0.3680 0.3626 0.4529 0.0827  0.0604  0.0168  236 THR A C   
1531 O O   . THR A 258 ? 0.3627 0.3765 0.4632 0.0880  0.0526  0.0196  236 THR A O   
1532 C CB  . THR A 258 ? 0.3460 0.3227 0.3993 0.0637  0.0569  0.0124  236 THR A CB  
1533 O OG1 . THR A 258 ? 0.3564 0.3155 0.3898 0.0576  0.0564  0.0118  236 THR A OG1 
1534 C CG2 . THR A 258 ? 0.3301 0.3273 0.3937 0.0604  0.0473  0.0122  236 THR A CG2 
1535 N N   . ALA A 259 ? 0.3734 0.3635 0.4611 0.0822  0.0714  0.0129  237 ALA A N   
1536 C CA  . ALA A 259 ? 0.3654 0.3733 0.4772 0.0879  0.0766  0.0122  237 ALA A CA  
1537 C C   . ALA A 259 ? 0.3779 0.3930 0.5056 0.1019  0.0752  0.0168  237 ALA A C   
1538 O O   . ALA A 259 ? 0.3647 0.4042 0.5171 0.1066  0.0709  0.0180  237 ALA A O   
1539 C CB  . ALA A 259 ? 0.3783 0.3760 0.4854 0.0860  0.0910  0.0076  237 ALA A CB  
1540 N N   . ASP A 260 ? 0.4001 0.3942 0.5151 0.1087  0.0787  0.0195  238 ASP A N   
1541 C CA  . ASP A 260 ? 0.4292 0.4270 0.5576 0.1234  0.0777  0.0252  238 ASP A CA  
1542 C C   . ASP A 260 ? 0.3989 0.4127 0.5325 0.1268  0.0625  0.0315  238 ASP A C   
1543 O O   . ASP A 260 ? 0.3612 0.3928 0.5147 0.1378  0.0578  0.0354  238 ASP A O   
1544 C CB  . ASP A 260 ? 0.4976 0.4654 0.6104 0.1297  0.0855  0.0269  238 ASP A CB  
1545 C CG  . ASP A 260 ? 0.5657 0.5214 0.6794 0.1324  0.1013  0.0204  238 ASP A CG  
1546 O OD1 . ASP A 260 ? 0.5736 0.5457 0.7017 0.1312  0.1070  0.0164  238 ASP A OD1 
1547 O OD2 . ASP A 260 ? 0.6451 0.5738 0.7445 0.1357  0.1086  0.0192  238 ASP A OD2 
1548 N N   . GLU A 261 ? 0.3742 0.3823 0.4896 0.1181  0.0547  0.0323  239 GLU A N   
1549 C CA  . GLU A 261 ? 0.3652 0.3884 0.4818 0.1211  0.0405  0.0375  239 GLU A CA  
1550 C C   . GLU A 261 ? 0.3436 0.3984 0.4838 0.1197  0.0331  0.0336  239 GLU A C   
1551 O O   . GLU A 261 ? 0.3329 0.4070 0.4874 0.1287  0.0236  0.0372  239 GLU A O   
1552 C CB  . GLU A 261 ? 0.3710 0.3833 0.4643 0.1110  0.0356  0.0376  239 GLU A CB  
1553 C CG  . GLU A 261 ? 0.3968 0.3809 0.4686 0.1119  0.0403  0.0427  239 GLU A CG  
1554 C CD  . GLU A 261 ? 0.4110 0.3867 0.4634 0.0999  0.0375  0.0412  239 GLU A CD  
1555 O OE1 . GLU A 261 ? 0.3885 0.3812 0.4421 0.0942  0.0292  0.0386  239 GLU A OE1 
1556 O OE2 . GLU A 261 ? 0.4076 0.3600 0.4449 0.0960  0.0438  0.0419  239 GLU A OE2 
1557 N N   . ILE A 262 ? 0.3380 0.3978 0.4828 0.1084  0.0373  0.0263  240 ILE A N   
1558 C CA  . ILE A 262 ? 0.3311 0.4185 0.4996 0.1044  0.0317  0.0216  240 ILE A CA  
1559 C C   . ILE A 262 ? 0.3520 0.4589 0.5497 0.1152  0.0335  0.0228  240 ILE A C   
1560 O O   . ILE A 262 ? 0.3384 0.4711 0.5564 0.1188  0.0224  0.0226  240 ILE A O   
1561 C CB  . ILE A 262 ? 0.3316 0.4156 0.4989 0.0912  0.0395  0.0152  240 ILE A CB  
1562 C CG1 . ILE A 262 ? 0.3256 0.3978 0.4698 0.0812  0.0343  0.0138  240 ILE A CG1 
1563 C CG2 . ILE A 262 ? 0.3276 0.4379 0.5242 0.0872  0.0379  0.0107  240 ILE A CG2 
1564 C CD1 . ILE A 262 ? 0.3297 0.3939 0.4679 0.0695  0.0418  0.0091  240 ILE A CD1 
1565 N N   . LEU A 263 ? 0.3693 0.4646 0.5698 0.1208  0.0470  0.0235  241 LEU A N   
1566 C CA  . LEU A 263 ? 0.3788 0.4917 0.6082 0.1329  0.0504  0.0251  241 LEU A CA  
1567 C C   . LEU A 263 ? 0.3935 0.5137 0.6281 0.1478  0.0395  0.0326  241 LEU A C   
1568 O O   . LEU A 263 ? 0.3867 0.5348 0.6489 0.1551  0.0321  0.0332  241 LEU A O   
1569 C CB  . LEU A 263 ? 0.3929 0.4883 0.6204 0.1368  0.0685  0.0238  241 LEU A CB  
1570 C CG  . LEU A 263 ? 0.4012 0.4965 0.6308 0.1254  0.0807  0.0174  241 LEU A CG  
1571 C CD1 . LEU A 263 ? 0.4269 0.4977 0.6420 0.1283  0.0977  0.0155  241 LEU A CD1 
1572 C CD2 . LEU A 263 ? 0.3975 0.5245 0.6635 0.1249  0.0820  0.0149  241 LEU A CD2 
1573 N N   . GLN A 264 ? 0.4222 0.5176 0.6312 0.1528  0.0388  0.0386  242 GLN A N   
1574 C CA  . GLN A 264 ? 0.4543 0.5540 0.6639 0.1671  0.0282  0.0477  242 GLN A CA  
1575 C C   . GLN A 264 ? 0.4056 0.5317 0.6212 0.1649  0.0103  0.0475  242 GLN A C   
1576 O O   . GLN A 264 ? 0.3895 0.5388 0.6241 0.1760  0.0000  0.0509  242 GLN A O   
1577 C CB  . GLN A 264 ? 0.5291 0.5968 0.7070 0.1690  0.0296  0.0546  242 GLN A CB  
1578 C CG  . GLN A 264 ? 0.6342 0.6710 0.8021 0.1729  0.0451  0.0556  242 GLN A CG  
1579 C CD  . GLN A 264 ? 0.7417 0.7483 0.8798 0.1720  0.0451  0.0621  242 GLN A CD  
1580 O OE1 . GLN A 264 ? 0.8098 0.8157 0.9430 0.1820  0.0372  0.0721  242 GLN A OE1 
1581 N NE2 . GLN A 264 ? 0.7601 0.7430 0.8787 0.1599  0.0538  0.0568  242 GLN A NE2 
1582 N N   . GLN A 265 ? 0.3764 0.4988 0.5750 0.1508  0.0062  0.0429  243 GLN A N   
1583 C CA  . GLN A 265 ? 0.3725 0.5170 0.5727 0.1479  -0.0105 0.0411  243 GLN A CA  
1584 C C   . GLN A 265 ? 0.3738 0.5529 0.6089 0.1465  -0.0170 0.0341  243 GLN A C   
1585 O O   . GLN A 265 ? 0.3845 0.5869 0.6289 0.1518  -0.0327 0.0344  243 GLN A O   
1586 C CB  . GLN A 265 ? 0.3676 0.4995 0.5429 0.1338  -0.0122 0.0371  243 GLN A CB  
1587 C CG  . GLN A 265 ? 0.3775 0.4824 0.5209 0.1364  -0.0104 0.0450  243 GLN A CG  
1588 C CD  . GLN A 265 ? 0.3710 0.4620 0.4925 0.1223  -0.0086 0.0407  243 GLN A CD  
1589 O OE1 . GLN A 265 ? 0.3588 0.4447 0.4827 0.1112  -0.0009 0.0337  243 GLN A OE1 
1590 N NE2 . GLN A 265 ? 0.3938 0.4785 0.4933 0.1232  -0.0153 0.0455  243 GLN A NE2 
1591 N N   . CYS A 266 ? 0.3501 0.5331 0.6048 0.1401  -0.0051 0.0282  244 CYS A N   
1592 C CA  . CYS A 266 ? 0.3517 0.5673 0.6432 0.1372  -0.0088 0.0215  244 CYS A CA  
1593 C C   . CYS A 266 ? 0.3645 0.5984 0.6870 0.1512  -0.0062 0.0248  244 CYS A C   
1594 O O   . CYS A 266 ? 0.3277 0.5882 0.6846 0.1486  -0.0056 0.0194  244 CYS A O   
1595 C CB  . CYS A 266 ? 0.3468 0.5579 0.6441 0.1220  0.0038  0.0142  244 CYS A CB  
1596 S SG  . CYS A 266 ? 0.3646 0.5615 0.6344 0.1054  -0.0011 0.0090  244 CYS A SG  
1597 N N   . ASP A 267 ? 0.3918 0.6108 0.7038 0.1659  -0.0031 0.0335  245 ASP A N   
1598 C CA  . ASP A 267 ? 0.4179 0.6511 0.7586 0.1810  0.0013  0.0371  245 ASP A CA  
1599 C C   . ASP A 267 ? 0.4117 0.6476 0.7740 0.1755  0.0198  0.0312  245 ASP A C   
1600 O O   . ASP A 267 ? 0.4036 0.6660 0.8026 0.1819  0.0217  0.0298  245 ASP A O   
1601 C CB  . ASP A 267 ? 0.4422 0.7139 0.8120 0.1891  -0.0170 0.0373  245 ASP A CB  
1602 C CG  . ASP A 267 ? 0.4742 0.7429 0.8228 0.2006  -0.0335 0.0460  245 ASP A CG  
1603 O OD1 . ASP A 267 ? 0.4894 0.7258 0.8059 0.2050  -0.0281 0.0536  245 ASP A OD1 
1604 O OD2 . ASP A 267 ? 0.5264 0.8252 0.8902 0.2051  -0.0518 0.0452  245 ASP A OD2 
1605 N N   . GLY A 268 ? 0.4091 0.6183 0.7482 0.1640  0.0333  0.0280  246 GLY A N   
1606 C CA  . GLY A 268 ? 0.4179 0.6253 0.7696 0.1582  0.0519  0.0231  246 GLY A CA  
1607 C C   . GLY A 268 ? 0.4201 0.6542 0.7996 0.1458  0.0519  0.0162  246 GLY A C   
1608 O O   . GLY A 268 ? 0.4388 0.6758 0.8332 0.1421  0.0679  0.0132  246 GLY A O   
1609 N N   . LYS A 269 ? 0.4034 0.6560 0.7894 0.1390  0.0348  0.0134  247 LYS A N   
1610 C CA  . LYS A 269 ? 0.4092 0.6885 0.8261 0.1274  0.0334  0.0064  247 LYS A CA  
1611 C C   . LYS A 269 ? 0.3847 0.6544 0.7825 0.1107  0.0280  0.0015  247 LYS A C   
1612 O O   . LYS A 269 ? 0.3703 0.6429 0.7558 0.1096  0.0111  0.0005  247 LYS A O   
1613 C CB  . LYS A 269 ? 0.4490 0.7659 0.9008 0.1347  0.0168  0.0052  247 LYS A CB  
1614 C CG  . LYS A 269 ? 0.5053 0.8371 0.9831 0.1523  0.0212  0.0100  247 LYS A CG  
1615 C CD  . LYS A 269 ? 0.5657 0.9402 1.0842 0.1581  0.0044  0.0076  247 LYS A CD  
1616 C CE  . LYS A 269 ? 0.6112 0.9918 1.1132 0.1631  -0.0201 0.0093  247 LYS A CE  
1617 N NZ  . LYS A 269 ? 0.6553 1.0249 1.1407 0.1831  -0.0250 0.0199  247 LYS A NZ  
1618 N N   . LEU A 270 ? 0.3717 0.6290 0.7654 0.0987  0.0428  -0.0012 248 LEU A N   
1619 C CA  . LEU A 270 ? 0.3561 0.6083 0.7403 0.0825  0.0389  -0.0062 248 LEU A CA  
1620 C C   . LEU A 270 ? 0.3310 0.5846 0.7315 0.0712  0.0552  -0.0087 248 LEU A C   
1621 O O   . LEU A 270 ? 0.3408 0.5897 0.7462 0.0754  0.0722  -0.0059 248 LEU A O   
1622 C CB  . LEU A 270 ? 0.3813 0.6020 0.7210 0.0794  0.0365  -0.0042 248 LEU A CB  
1623 C CG  . LEU A 270 ? 0.3959 0.5857 0.7070 0.0792  0.0523  -0.0006 248 LEU A CG  
1624 C CD1 . LEU A 270 ? 0.3905 0.5591 0.6711 0.0689  0.0497  -0.0019 248 LEU A CD1 
1625 C CD2 . LEU A 270 ? 0.4342 0.6112 0.7304 0.0934  0.0534  0.0049  248 LEU A CD2 
1626 N N   . ASP A 271 ? 0.2803 0.5397 0.6890 0.0574  0.0507  -0.0140 249 ASP A N   
1627 C CA  . ASP A 271 ? 0.2600 0.5225 0.6879 0.0458  0.0656  -0.0156 249 ASP A CA  
1628 C C   . ASP A 271 ? 0.2520 0.4862 0.6499 0.0349  0.0729  -0.0147 249 ASP A C   
1629 O O   . ASP A 271 ? 0.2364 0.4646 0.6392 0.0281  0.0892  -0.0128 249 ASP A O   
1630 C CB  . ASP A 271 ? 0.2536 0.5479 0.7244 0.0379  0.0574  -0.0224 249 ASP A CB  
1631 C CG  . ASP A 271 ? 0.2587 0.5845 0.7625 0.0493  0.0493  -0.0233 249 ASP A CG  
1632 O OD1 . ASP A 271 ? 0.2526 0.5874 0.7512 0.0564  0.0300  -0.0250 249 ASP A OD1 
1633 O OD2 . ASP A 271 ? 0.2376 0.5793 0.7717 0.0522  0.0626  -0.0218 249 ASP A OD2 
1634 N N   . MET A 272 ? 0.2449 0.4619 0.6115 0.0336  0.0615  -0.0153 250 MET A N   
1635 C CA  . MET A 272 ? 0.2441 0.4367 0.5848 0.0242  0.0669  -0.0144 250 MET A CA  
1636 C C   . MET A 272 ? 0.2633 0.4358 0.5667 0.0286  0.0581  -0.0129 250 MET A C   
1637 O O   . MET A 272 ? 0.2444 0.4246 0.5451 0.0345  0.0437  -0.0145 250 MET A O   
1638 C CB  . MET A 272 ? 0.2578 0.4591 0.6162 0.0114  0.0608  -0.0203 250 MET A CB  
1639 C CG  . MET A 272 ? 0.2548 0.4317 0.5897 0.0020  0.0657  -0.0191 250 MET A CG  
1640 S SD  . MET A 272 ? 0.2796 0.4664 0.6421 -0.0128 0.0616  -0.0261 250 MET A SD  
1641 C CE  . MET A 272 ? 0.2736 0.4739 0.6718 -0.0175 0.0807  -0.0229 250 MET A CE  
1642 N N   . LEU A 273 ? 0.2726 0.4199 0.5474 0.0260  0.0671  -0.0095 251 LEU A N   
1643 C CA  . LEU A 273 ? 0.2852 0.4129 0.5261 0.0281  0.0604  -0.0082 251 LEU A CA  
1644 C C   . LEU A 273 ? 0.2825 0.3948 0.5082 0.0180  0.0625  -0.0087 251 LEU A C   
1645 O O   . LEU A 273 ? 0.2978 0.4011 0.5212 0.0138  0.0754  -0.0060 251 LEU A O   
1646 C CB  . LEU A 273 ? 0.3044 0.4155 0.5240 0.0364  0.0687  -0.0039 251 LEU A CB  
1647 C CG  . LEU A 273 ? 0.3415 0.4347 0.5301 0.0364  0.0603  -0.0033 251 LEU A CG  
1648 C CD1 . LEU A 273 ? 0.3414 0.4365 0.5248 0.0462  0.0514  -0.0017 251 LEU A CD1 
1649 C CD2 . LEU A 273 ? 0.3668 0.4363 0.5288 0.0337  0.0699  -0.0012 251 LEU A CD2 
1650 N N   . VAL A 274 ? 0.2561 0.3651 0.4709 0.0149  0.0504  -0.0116 252 VAL A N   
1651 C CA  . VAL A 274 ? 0.2616 0.3565 0.4636 0.0065  0.0513  -0.0122 252 VAL A CA  
1652 C C   . VAL A 274 ? 0.2719 0.3494 0.4421 0.0093  0.0467  -0.0104 252 VAL A C   
1653 O O   . VAL A 274 ? 0.2609 0.3419 0.4244 0.0138  0.0367  -0.0118 252 VAL A O   
1654 C CB  . VAL A 274 ? 0.2542 0.3603 0.4736 -0.0007 0.0418  -0.0187 252 VAL A CB  
1655 C CG1 . VAL A 274 ? 0.2533 0.3436 0.4630 -0.0089 0.0453  -0.0184 252 VAL A CG1 
1656 C CG2 . VAL A 274 ? 0.2668 0.3945 0.5219 -0.0036 0.0432  -0.0219 252 VAL A CG2 
1657 N N   . ALA A 275 ? 0.2883 0.3478 0.4393 0.0068  0.0544  -0.0070 253 ALA A N   
1658 C CA  . ALA A 275 ? 0.2896 0.3338 0.4134 0.0085  0.0508  -0.0057 253 ALA A CA  
1659 C C   . ALA A 275 ? 0.2974 0.3282 0.4085 0.0026  0.0536  -0.0043 253 ALA A C   
1660 O O   . ALA A 275 ? 0.2884 0.3142 0.4010 -0.0002 0.0634  -0.0012 253 ALA A O   
1661 C CB  . ALA A 275 ? 0.2997 0.3351 0.4098 0.0150  0.0571  -0.0027 253 ALA A CB  
1662 N N   . SER A 276 ? 0.2816 0.3071 0.3806 0.0012  0.0455  -0.0059 254 SER A N   
1663 C CA  . SER A 276 ? 0.2878 0.3000 0.3724 -0.0025 0.0469  -0.0039 254 SER A CA  
1664 C C   . SER A 276 ? 0.2929 0.2920 0.3551 0.0001  0.0512  -0.0006 254 SER A C   
1665 O O   . SER A 276 ? 0.2902 0.2884 0.3459 0.0044  0.0513  -0.0009 254 SER A O   
1666 C CB  . SER A 276 ? 0.3070 0.3195 0.3886 -0.0042 0.0373  -0.0074 254 SER A CB  
1667 O OG  . SER A 276 ? 0.3187 0.3323 0.3899 -0.0003 0.0313  -0.0086 254 SER A OG  
1668 N N   . VAL A 277 ? 0.2991 0.2876 0.3497 -0.0024 0.0546  0.0025  255 VAL A N   
1669 C CA  . VAL A 277 ? 0.3153 0.2922 0.3452 -0.0005 0.0595  0.0050  255 VAL A CA  
1670 C C   . VAL A 277 ? 0.3075 0.2755 0.3201 -0.0018 0.0540  0.0059  255 VAL A C   
1671 O O   . VAL A 277 ? 0.3226 0.2884 0.3366 -0.0041 0.0525  0.0080  255 VAL A O   
1672 C CB  . VAL A 277 ? 0.3172 0.2904 0.3469 -0.0010 0.0712  0.0092  255 VAL A CB  
1673 C CG1 . VAL A 277 ? 0.3375 0.2998 0.3444 0.0019  0.0766  0.0100  255 VAL A CG1 
1674 C CG2 . VAL A 277 ? 0.3272 0.3125 0.3800 -0.0005 0.0768  0.0083  255 VAL A CG2 
1675 N N   . GLY A 278 ? 0.3108 0.2737 0.3088 -0.0001 0.0513  0.0041  256 GLY A N   
1676 C CA  . GLY A 278 ? 0.3310 0.2872 0.3133 -0.0012 0.0459  0.0040  256 GLY A CA  
1677 C C   . GLY A 278 ? 0.3420 0.2887 0.3055 0.0001  0.0500  0.0037  256 GLY A C   
1678 O O   . GLY A 278 ? 0.3652 0.3063 0.3187 0.0004  0.0551  0.0069  256 GLY A O   
1679 N N   . THR A 279 ? 0.3509 0.2946 0.3085 0.0008  0.0482  -0.0003 257 THR A N   
1680 C CA  . THR A 279 ? 0.3642 0.2978 0.3043 0.0020  0.0529  -0.0026 257 THR A CA  
1681 C C   . THR A 279 ? 0.3653 0.2977 0.3076 0.0052  0.0643  -0.0012 257 THR A C   
1682 O O   . THR A 279 ? 0.3744 0.2985 0.3006 0.0065  0.0703  -0.0020 257 THR A O   
1683 C CB  . THR A 279 ? 0.3787 0.3072 0.3145 0.0018  0.0503  -0.0076 257 THR A CB  
1684 O OG1 . THR A 279 ? 0.3627 0.2945 0.3119 0.0050  0.0539  -0.0075 257 THR A OG1 
1685 C CG2 . THR A 279 ? 0.3887 0.3198 0.3251 -0.0020 0.0404  -0.0090 257 THR A CG2 
1686 N N   . GLY A 280 ? 0.3422 0.2839 0.3047 0.0067  0.0670  0.0002  258 GLY A N   
1687 C CA  . GLY A 280 ? 0.3472 0.2909 0.3170 0.0101  0.0778  0.0010  258 GLY A CA  
1688 C C   . GLY A 280 ? 0.3563 0.2977 0.3282 0.0146  0.0805  -0.0025 258 GLY A C   
1689 O O   . GLY A 280 ? 0.3449 0.2897 0.3260 0.0187  0.0895  -0.0022 258 GLY A O   
1690 N N   . GLY A 281 ? 0.3559 0.2919 0.3214 0.0143  0.0735  -0.0055 259 GLY A N   
1691 C CA  . GLY A 281 ? 0.3595 0.2898 0.3257 0.0188  0.0762  -0.0082 259 GLY A CA  
1692 C C   . GLY A 281 ? 0.3597 0.3020 0.3481 0.0238  0.0772  -0.0057 259 GLY A C   
1693 O O   . GLY A 281 ? 0.3562 0.2968 0.3495 0.0297  0.0843  -0.0064 259 GLY A O   
1694 N N   . THR A 282 ? 0.3410 0.2958 0.3427 0.0219  0.0697  -0.0033 260 THR A N   
1695 C CA  . THR A 282 ? 0.3312 0.2996 0.3534 0.0263  0.0677  -0.0015 260 THR A CA  
1696 C C   . THR A 282 ? 0.3322 0.3103 0.3700 0.0288  0.0761  -0.0007 260 THR A C   
1697 O O   . THR A 282 ? 0.3325 0.3141 0.3804 0.0355  0.0809  -0.0005 260 THR A O   
1698 C CB  . THR A 282 ? 0.3409 0.3202 0.3711 0.0231  0.0575  -0.0006 260 THR A CB  
1699 O OG1 . THR A 282 ? 0.3201 0.2913 0.3370 0.0211  0.0514  -0.0010 260 THR A OG1 
1700 C CG2 . THR A 282 ? 0.3389 0.3332 0.3881 0.0280  0.0538  0.0004  260 THR A CG2 
1701 N N   . ILE A 283 ? 0.3125 0.2943 0.3529 0.0238  0.0789  0.0001  261 ILE A N   
1702 C CA  . ILE A 283 ? 0.3292 0.3213 0.3871 0.0247  0.0878  0.0014  261 ILE A CA  
1703 C C   . ILE A 283 ? 0.3415 0.3252 0.3914 0.0296  0.1004  0.0008  261 ILE A C   
1704 O O   . ILE A 283 ? 0.3396 0.3332 0.4073 0.0343  0.1075  0.0011  261 ILE A O   
1705 C CB  . ILE A 283 ? 0.3308 0.3259 0.3929 0.0177  0.0895  0.0034  261 ILE A CB  
1706 C CG1 . ILE A 283 ? 0.3427 0.3529 0.4313 0.0175  0.0970  0.0046  261 ILE A CG1 
1707 C CG2 . ILE A 283 ? 0.3483 0.3280 0.3864 0.0153  0.0957  0.0050  261 ILE A CG2 
1708 C CD1 . ILE A 283 ? 0.3555 0.3716 0.4567 0.0100  0.0953  0.0059  261 ILE A CD1 
1709 N N   . THR A 284 ? 0.3486 0.3149 0.3722 0.0289  0.1029  -0.0009 262 THR A N   
1710 C CA  . THR A 284 ? 0.3736 0.3302 0.3857 0.0332  0.1154  -0.0028 262 THR A CA  
1711 C C   . THR A 284 ? 0.3817 0.3367 0.4006 0.0413  0.1172  -0.0053 262 THR A C   
1712 O O   . THR A 284 ? 0.3550 0.3142 0.3847 0.0474  0.1279  -0.0057 262 THR A O   
1713 C CB  . THR A 284 ? 0.3870 0.3257 0.3677 0.0302  0.1155  -0.0053 262 THR A CB  
1714 O OG1 . THR A 284 ? 0.3952 0.3353 0.3699 0.0245  0.1146  -0.0016 262 THR A OG1 
1715 C CG2 . THR A 284 ? 0.4318 0.3593 0.3977 0.0351  0.1280  -0.0091 262 THR A CG2 
1716 N N   . GLY A 285 ? 0.3580 0.3067 0.3717 0.0417  0.1074  -0.0064 263 GLY A N   
1717 C CA  . GLY A 285 ? 0.3699 0.3143 0.3889 0.0497  0.1086  -0.0074 263 GLY A CA  
1718 C C   . GLY A 285 ? 0.3690 0.3326 0.4168 0.0561  0.1088  -0.0041 263 GLY A C   
1719 O O   . GLY A 285 ? 0.3630 0.3272 0.4204 0.0647  0.1169  -0.0046 263 GLY A O   
1720 N N   . ILE A 286 ? 0.3422 0.3221 0.4046 0.0523  0.0998  -0.0013 264 ILE A N   
1721 C CA  . ILE A 286 ? 0.3380 0.3390 0.4289 0.0577  0.0976  0.0010  264 ILE A CA  
1722 C C   . ILE A 286 ? 0.3412 0.3531 0.4492 0.0596  0.1099  0.0007  264 ILE A C   
1723 O O   . ILE A 286 ? 0.3271 0.3489 0.4539 0.0681  0.1142  0.0013  264 ILE A O   
1724 C CB  . ILE A 286 ? 0.3245 0.3406 0.4264 0.0524  0.0850  0.0022  264 ILE A CB  
1725 C CG1 . ILE A 286 ? 0.3406 0.3478 0.4275 0.0524  0.0740  0.0032  264 ILE A CG1 
1726 C CG2 . ILE A 286 ? 0.3263 0.3660 0.4584 0.0573  0.0822  0.0032  264 ILE A CG2 
1727 C CD1 . ILE A 286 ? 0.3293 0.3480 0.4210 0.0472  0.0622  0.0033  264 ILE A CD1 
1728 N N   . ALA A 287 ? 0.3429 0.3534 0.4452 0.0519  0.1158  0.0004  265 ALA A N   
1729 C CA  . ALA A 287 ? 0.3480 0.3690 0.4664 0.0518  0.1291  0.0011  265 ALA A CA  
1730 C C   . ALA A 287 ? 0.3867 0.3988 0.4986 0.0597  0.1437  -0.0006 265 ALA A C   
1731 O O   . ALA A 287 ? 0.3757 0.4022 0.5112 0.0647  0.1533  -0.0001 265 ALA A O   
1732 C CB  . ALA A 287 ? 0.3403 0.3581 0.4502 0.0421  0.1328  0.0028  265 ALA A CB  
1733 N N   . ARG A 288 ? 0.3911 0.3805 0.4730 0.0609  0.1457  -0.0035 266 ARG A N   
1734 C CA  . ARG A 288 ? 0.4084 0.3872 0.4825 0.0691  0.1595  -0.0069 266 ARG A CA  
1735 C C   . ARG A 288 ? 0.4101 0.3970 0.5065 0.0802  0.1594  -0.0068 266 ARG A C   
1736 O O   . ARG A 288 ? 0.4221 0.4150 0.5323 0.0879  0.1723  -0.0077 266 ARG A O   
1737 C CB  . ARG A 288 ? 0.4255 0.3779 0.4635 0.0676  0.1600  -0.0117 266 ARG A CB  
1738 C CG  . ARG A 288 ? 0.4291 0.3733 0.4433 0.0600  0.1647  -0.0121 266 ARG A CG  
1739 C CD  . ARG A 288 ? 0.4466 0.3667 0.4258 0.0591  0.1645  -0.0183 266 ARG A CD  
1740 N NE  . ARG A 288 ? 0.4579 0.3714 0.4132 0.0541  0.1703  -0.0183 266 ARG A NE  
1741 C CZ  . ARG A 288 ? 0.5031 0.3979 0.4261 0.0535  0.1726  -0.0244 266 ARG A CZ  
1742 N NH1 . ARG A 288 ? 0.5207 0.4003 0.4325 0.0563  0.1697  -0.0320 266 ARG A NH1 
1743 N NH2 . ARG A 288 ? 0.5084 0.3992 0.4096 0.0501  0.1778  -0.0230 266 ARG A NH2 
1744 N N   . LYS A 289 ? 0.3975 0.3851 0.4978 0.0819  0.1453  -0.0050 267 LYS A N   
1745 C CA  . LYS A 289 ? 0.4071 0.4030 0.5282 0.0934  0.1434  -0.0032 267 LYS A CA  
1746 C C   . LYS A 289 ? 0.3983 0.4244 0.5559 0.0961  0.1432  -0.0003 267 LYS A C   
1747 O O   . LYS A 289 ? 0.4042 0.4400 0.5823 0.1062  0.1514  -0.0001 267 LYS A O   
1748 C CB  . LYS A 289 ? 0.3979 0.3860 0.5112 0.0945  0.1288  -0.0007 267 LYS A CB  
1749 C CG  . LYS A 289 ? 0.4132 0.4068 0.5440 0.1076  0.1258  0.0029  267 LYS A CG  
1750 C CD  . LYS A 289 ? 0.4439 0.4232 0.5734 0.1185  0.1392  0.0004  267 LYS A CD  
1751 C CE  . LYS A 289 ? 0.4561 0.4029 0.5544 0.1164  0.1424  -0.0038 267 LYS A CE  
1752 N NZ  . LYS A 289 ? 0.4476 0.3819 0.5371 0.1175  0.1313  0.0002  267 LYS A NZ  
1753 N N   . LEU A 290 ? 0.3825 0.4240 0.5501 0.0872  0.1343  0.0013  268 LEU A N   
1754 C CA  . LEU A 290 ? 0.3994 0.4707 0.6037 0.0879  0.1327  0.0028  268 LEU A CA  
1755 C C   . LEU A 290 ? 0.4170 0.4980 0.6381 0.0886  0.1506  0.0019  268 LEU A C   
1756 O O   . LEU A 290 ? 0.4136 0.5150 0.6657 0.0962  0.1546  0.0024  268 LEU A O   
1757 C CB  . LEU A 290 ? 0.3946 0.4777 0.6047 0.0769  0.1200  0.0031  268 LEU A CB  
1758 C CG  . LEU A 290 ? 0.3947 0.4762 0.5960 0.0772  0.1020  0.0042  268 LEU A CG  
1759 C CD1 . LEU A 290 ? 0.3987 0.4946 0.6101 0.0672  0.0910  0.0029  268 LEU A CD1 
1760 C CD2 . LEU A 290 ? 0.4167 0.5087 0.6330 0.0897  0.0952  0.0065  268 LEU A CD2 
1761 N N   . LYS A 291 ? 0.4366 0.5034 0.6371 0.0815  0.1618  0.0009  269 LYS A N   
1762 C CA  . LYS A 291 ? 0.4496 0.5225 0.6607 0.0821  0.1811  0.0008  269 LYS A CA  
1763 C C   . LYS A 291 ? 0.4549 0.5265 0.6730 0.0959  0.1927  -0.0012 269 LYS A C   
1764 O O   . LYS A 291 ? 0.4272 0.5161 0.6717 0.1000  0.2057  -0.0009 269 LYS A O   
1765 C CB  . LYS A 291 ? 0.4845 0.5372 0.6633 0.0741  0.1906  0.0007  269 LYS A CB  
1766 C CG  . LYS A 291 ? 0.4947 0.5515 0.6735 0.0612  0.1838  0.0036  269 LYS A CG  
1767 C CD  . LYS A 291 ? 0.5249 0.6021 0.7343 0.0563  0.1946  0.0064  269 LYS A CD  
1768 C CE  . LYS A 291 ? 0.5483 0.6296 0.7626 0.0440  0.1852  0.0088  269 LYS A CE  
1769 N NZ  . LYS A 291 ? 0.5754 0.6622 0.8013 0.0370  0.2012  0.0127  269 LYS A NZ  
1770 N N   . GLU A 292 ? 0.4550 0.5062 0.6512 0.1029  0.1884  -0.0033 270 GLU A N   
1771 C CA  . GLU A 292 ? 0.4906 0.5375 0.6931 0.1171  0.1980  -0.0054 270 GLU A CA  
1772 C C   . GLU A 292 ? 0.4730 0.5437 0.7125 0.1272  0.1895  -0.0022 270 GLU A C   
1773 O O   . GLU A 292 ? 0.4670 0.5504 0.7305 0.1374  0.2003  -0.0025 270 GLU A O   
1774 C CB  . GLU A 292 ? 0.4947 0.5090 0.6614 0.1202  0.1965  -0.0091 270 GLU A CB  
1775 C CG  . GLU A 292 ? 0.5125 0.5049 0.6444 0.1137  0.2076  -0.0138 270 GLU A CG  
1776 C CD  . GLU A 292 ? 0.5251 0.4867 0.6213 0.1128  0.2025  -0.0185 270 GLU A CD  
1777 O OE1 . GLU A 292 ? 0.5112 0.4667 0.6071 0.1144  0.1891  -0.0169 270 GLU A OE1 
1778 O OE2 . GLU A 292 ? 0.5229 0.4664 0.5909 0.1100  0.2122  -0.0240 270 GLU A OE2 
1779 N N   . LYS A 293 ? 0.4816 0.5593 0.7255 0.1250  0.1703  0.0009  271 LYS A N   
1780 C CA  . LYS A 293 ? 0.5198 0.6170 0.7926 0.1364  0.1605  0.0043  271 LYS A CA  
1781 C C   . LYS A 293 ? 0.4975 0.6306 0.8075 0.1326  0.1520  0.0059  271 LYS A C   
1782 O O   . LYS A 293 ? 0.4584 0.6138 0.7992 0.1431  0.1476  0.0078  271 LYS A O   
1783 C CB  . LYS A 293 ? 0.5684 0.6486 0.8209 0.1400  0.1456  0.0071  271 LYS A CB  
1784 C CG  . LYS A 293 ? 0.6607 0.7064 0.8824 0.1446  0.1546  0.0047  271 LYS A CG  
1785 C CD  . LYS A 293 ? 0.7427 0.7771 0.9629 0.1576  0.1479  0.0087  271 LYS A CD  
1786 C CE  . LYS A 293 ? 0.7987 0.8344 1.0106 0.1532  0.1286  0.0138  271 LYS A CE  
1787 N NZ  . LYS A 293 ? 0.8851 0.8977 1.0807 0.1613  0.1238  0.0181  271 LYS A NZ  
1788 N N   . CYS A 294 ? 0.4911 0.6295 0.7991 0.1179  0.1498  0.0047  272 CYS A N   
1789 C CA  . CYS A 294 ? 0.4824 0.6517 0.8231 0.1117  0.1402  0.0047  272 CYS A CA  
1790 C C   . CYS A 294 ? 0.4531 0.6244 0.7964 0.0980  0.1521  0.0031  272 CYS A C   
1791 O O   . CYS A 294 ? 0.4436 0.6124 0.7781 0.0857  0.1441  0.0025  272 CYS A O   
1792 C CB  . CYS A 294 ? 0.4910 0.6601 0.8208 0.1076  0.1183  0.0054  272 CYS A CB  
1793 S SG  . CYS A 294 ? 0.5484 0.7561 0.9183 0.1027  0.1023  0.0036  272 CYS A SG  
1794 N N   . PRO A 295 ? 0.4778 0.7816 0.7856 0.1421  0.1853  -0.0065 273 PRO A N   
1795 C CA  . PRO A 295 ? 0.4814 0.7901 0.7798 0.1148  0.1928  -0.0126 273 PRO A CA  
1796 C C   . PRO A 295 ? 0.4644 0.8123 0.7785 0.0904  0.1835  -0.0091 273 PRO A C   
1797 O O   . PRO A 295 ? 0.4624 0.8003 0.7620 0.0645  0.1853  -0.0105 273 PRO A O   
1798 C CB  . PRO A 295 ? 0.4962 0.8294 0.8060 0.1275  0.2132  -0.0214 273 PRO A CB  
1799 C CG  . PRO A 295 ? 0.5001 0.8666 0.8398 0.1587  0.2129  -0.0181 273 PRO A CG  
1800 C CD  . PRO A 295 ? 0.4986 0.8255 0.8263 0.1716  0.1988  -0.0095 273 PRO A CD  
1801 N N   . GLY A 296 ? 0.4300 0.8210 0.7720 0.0981  0.1737  -0.0042 274 GLY A N   
1802 C CA  . GLY A 296 ? 0.4048 0.8269 0.7590 0.0732  0.1630  -0.0021 274 GLY A CA  
1803 C C   . GLY A 296 ? 0.3954 0.7756 0.7265 0.0546  0.1489  0.0011  274 GLY A C   
1804 O O   . GLY A 296 ? 0.3913 0.7807 0.7232 0.0286  0.1443  0.0005  274 GLY A O   
1805 N N   . CYS A 297 ? 0.3597 0.6935 0.6701 0.0673  0.1428  0.0040  275 CYS A N   
1806 C CA  . CYS A 297 ? 0.3646 0.6648 0.6565 0.0539  0.1289  0.0069  275 CYS A CA  
1807 C C   . CYS A 297 ? 0.3471 0.6153 0.6161 0.0293  0.1314  0.0047  275 CYS A C   
1808 O O   . CYS A 297 ? 0.3500 0.5898 0.5997 0.0297  0.1409  0.0028  275 CYS A O   
1809 C CB  . CYS A 297 ? 0.3756 0.6367 0.6506 0.0729  0.1238  0.0104  275 CYS A CB  
1810 S SG  . CYS A 297 ? 0.4160 0.6468 0.6730 0.0596  0.1063  0.0134  275 CYS A SG  
1811 N N   . ARG A 298 ? 0.3428 0.6161 0.6136 0.0082  0.1230  0.0052  276 ARG A N   
1812 C CA  . ARG A 298 ? 0.3599 0.6009 0.6096 -0.0134 0.1238  0.0056  276 ARG A CA  
1813 C C   . ARG A 298 ? 0.3352 0.5280 0.5592 -0.0096 0.1156  0.0076  276 ARG A C   
1814 O O   . ARG A 298 ? 0.3273 0.5153 0.5526 -0.0043 0.1038  0.0082  276 ARG A O   
1815 C CB  . ARG A 298 ? 0.3934 0.6527 0.6542 -0.0362 0.1183  0.0046  276 ARG A CB  
1816 C CG  . ARG A 298 ? 0.4573 0.7635 0.7401 -0.0478 0.1282  0.0023  276 ARG A CG  
1817 C CD  . ARG A 298 ? 0.5208 0.8088 0.7886 -0.0708 0.1376  0.0041  276 ARG A CD  
1818 N NE  . ARG A 298 ? 0.6113 0.8684 0.8666 -0.0898 0.1289  0.0055  276 ARG A NE  
1819 C CZ  . ARG A 298 ? 0.6590 0.8843 0.8950 -0.1083 0.1333  0.0099  276 ARG A CZ  
1820 N NH1 . ARG A 298 ? 0.6743 0.8965 0.8994 -0.1129 0.1460  0.0140  276 ARG A NH1 
1821 N NH2 . ARG A 298 ? 0.6525 0.8484 0.8792 -0.1219 0.1253  0.0104  276 ARG A NH2 
1822 N N   . ILE A 299 ? 0.3198 0.4811 0.5207 -0.0130 0.1216  0.0084  277 ILE A N   
1823 C CA  . ILE A 299 ? 0.3178 0.4395 0.4953 -0.0106 0.1144  0.0099  277 ILE A CA  
1824 C C   . ILE A 299 ? 0.3216 0.4236 0.4873 -0.0283 0.1089  0.0131  277 ILE A C   
1825 O O   . ILE A 299 ? 0.3340 0.4300 0.4903 -0.0402 0.1161  0.0161  277 ILE A O   
1826 C CB  . ILE A 299 ? 0.3318 0.4320 0.4890 -0.0032 0.1235  0.0084  277 ILE A CB  
1827 C CG1 . ILE A 299 ? 0.3334 0.4461 0.5004 0.0153  0.1318  0.0045  277 ILE A CG1 
1828 C CG2 . ILE A 299 ? 0.3289 0.3948 0.4636 -0.0022 0.1157  0.0093  277 ILE A CG2 
1829 C CD1 . ILE A 299 ? 0.3205 0.4327 0.4960 0.0310  0.1230  0.0057  277 ILE A CD1 
1830 N N   . ILE A 300 ? 0.2974 0.3880 0.4623 -0.0291 0.0969  0.0129  278 ILE A N   
1831 C CA  . ILE A 300 ? 0.3066 0.3763 0.4623 -0.0426 0.0915  0.0150  278 ILE A CA  
1832 C C   . ILE A 300 ? 0.3105 0.3498 0.4460 -0.0357 0.0848  0.0165  278 ILE A C   
1833 O O   . ILE A 300 ? 0.3091 0.3478 0.4452 -0.0254 0.0778  0.0136  278 ILE A O   
1834 C CB  . ILE A 300 ? 0.2997 0.3831 0.4715 -0.0500 0.0836  0.0108  278 ILE A CB  
1835 C CG1 . ILE A 300 ? 0.3002 0.4230 0.4949 -0.0568 0.0889  0.0084  278 ILE A CG1 
1836 C CG2 . ILE A 300 ? 0.3225 0.3785 0.4841 -0.0632 0.0800  0.0117  278 ILE A CG2 
1837 C CD1 . ILE A 300 ? 0.3199 0.4470 0.5140 -0.0714 0.1007  0.0114  278 ILE A CD1 
1838 N N   . GLY A 301 ? 0.3128 0.3302 0.4306 -0.0414 0.0869  0.0217  279 GLY A N   
1839 C CA  . GLY A 301 ? 0.3154 0.3101 0.4148 -0.0356 0.0809  0.0237  279 GLY A CA  
1840 C C   . GLY A 301 ? 0.3143 0.2907 0.4109 -0.0401 0.0733  0.0256  279 GLY A C   
1841 O O   . GLY A 301 ? 0.3356 0.3050 0.4344 -0.0510 0.0760  0.0290  279 GLY A O   
1842 N N   . VAL A 302 ? 0.2960 0.2638 0.3877 -0.0320 0.0647  0.0229  280 VAL A N   
1843 C CA  . VAL A 302 ? 0.3144 0.2649 0.4043 -0.0330 0.0580  0.0228  280 VAL A CA  
1844 C C   . VAL A 302 ? 0.3141 0.2498 0.3867 -0.0256 0.0544  0.0282  280 VAL A C   
1845 O O   . VAL A 302 ? 0.3017 0.2445 0.3682 -0.0185 0.0518  0.0260  280 VAL A O   
1846 C CB  . VAL A 302 ? 0.3094 0.2688 0.4109 -0.0299 0.0507  0.0134  280 VAL A CB  
1847 C CG1 . VAL A 302 ? 0.3141 0.2542 0.4127 -0.0296 0.0452  0.0109  280 VAL A CG1 
1848 C CG2 . VAL A 302 ? 0.3102 0.2909 0.4295 -0.0372 0.0529  0.0087  280 VAL A CG2 
1849 N N   . ASP A 303 ? 0.3520 0.2676 0.4168 -0.0276 0.0545  0.0356  281 ASP A N   
1850 C CA  . ASP A 303 ? 0.3660 0.2717 0.4145 -0.0198 0.0511  0.0437  281 ASP A CA  
1851 C C   . ASP A 303 ? 0.3871 0.2703 0.4355 -0.0148 0.0463  0.0457  281 ASP A C   
1852 O O   . ASP A 303 ? 0.4081 0.2725 0.4595 -0.0225 0.0499  0.0480  281 ASP A O   
1853 C CB  . ASP A 303 ? 0.3848 0.2875 0.4200 -0.0259 0.0580  0.0552  281 ASP A CB  
1854 C CG  . ASP A 303 ? 0.3914 0.2919 0.4082 -0.0182 0.0540  0.0647  281 ASP A CG  
1855 O OD1 . ASP A 303 ? 0.3769 0.2907 0.3912 -0.0109 0.0488  0.0596  281 ASP A OD1 
1856 O OD2 . ASP A 303 ? 0.4233 0.3113 0.4277 -0.0207 0.0565  0.0779  281 ASP A OD2 
1857 N N   . PRO A 304 ? 0.3790 0.2634 0.4236 -0.0023 0.0391  0.0445  282 PRO A N   
1858 C CA  . PRO A 304 ? 0.3908 0.2528 0.4360 0.0056  0.0356  0.0456  282 PRO A CA  
1859 C C   . PRO A 304 ? 0.4179 0.2545 0.4503 0.0081  0.0378  0.0617  282 PRO A C   
1860 O O   . PRO A 304 ? 0.4070 0.2511 0.4267 0.0080  0.0388  0.0731  282 PRO A O   
1861 C CB  . PRO A 304 ? 0.3766 0.2549 0.4214 0.0193  0.0281  0.0408  282 PRO A CB  
1862 C CG  . PRO A 304 ? 0.3671 0.2684 0.4030 0.0176  0.0281  0.0443  282 PRO A CG  
1863 C CD  . PRO A 304 ? 0.3515 0.2579 0.3916 0.0046  0.0347  0.0410  282 PRO A CD  
1864 N N   . GLU A 305 ? 0.4499 0.2552 0.4839 0.0097  0.0389  0.0627  283 GLU A N   
1865 C CA  . GLU A 305 ? 0.5169 0.2926 0.5375 0.0156  0.0402  0.0795  283 GLU A CA  
1866 C C   . GLU A 305 ? 0.5023 0.2917 0.5154 0.0355  0.0324  0.0875  283 GLU A C   
1867 O O   . GLU A 305 ? 0.4603 0.2644 0.4816 0.0469  0.0267  0.0772  283 GLU A O   
1868 C CB  . GLU A 305 ? 0.5990 0.3331 0.6225 0.0155  0.0434  0.0766  283 GLU A CB  
1869 C CG  . GLU A 305 ? 0.6631 0.3844 0.6916 -0.0078 0.0517  0.0712  283 GLU A CG  
1870 C CD  . GLU A 305 ? 0.7546 0.4327 0.7843 -0.0124 0.0561  0.0656  283 GLU A CD  
1871 O OE1 . GLU A 305 ? 0.8273 0.4765 0.8514 0.0045  0.0540  0.0695  283 GLU A OE1 
1872 O OE2 . GLU A 305 ? 0.8572 0.5306 0.8936 -0.0334 0.0621  0.0568  283 GLU A OE2 
1873 N N   . GLY A 306 ? 0.5121 0.3005 0.5092 0.0380  0.0324  0.1057  284 GLY A N   
1874 C CA  . GLY A 306 ? 0.5209 0.3325 0.5096 0.0538  0.0245  0.1146  284 GLY A CA  
1875 C C   . GLY A 306 ? 0.4870 0.3362 0.4683 0.0449  0.0240  0.1140  284 GLY A C   
1876 O O   . GLY A 306 ? 0.5080 0.3762 0.4773 0.0524  0.0189  0.1246  284 GLY A O   
1877 N N   . SER A 307 ? 0.4554 0.3154 0.4435 0.0293  0.0294  0.1014  285 SER A N   
1878 C CA  . SER A 307 ? 0.4398 0.3280 0.4201 0.0195  0.0318  0.0988  285 SER A CA  
1879 C C   . SER A 307 ? 0.4502 0.3308 0.4177 0.0070  0.0399  0.1099  285 SER A C   
1880 O O   . SER A 307 ? 0.4571 0.3111 0.4254 0.0016  0.0449  0.1169  285 SER A O   
1881 C CB  . SER A 307 ? 0.4039 0.3056 0.3977 0.0117  0.0345  0.0806  285 SER A CB  
1882 O OG  . SER A 307 ? 0.3917 0.3126 0.3779 0.0023  0.0392  0.0773  285 SER A OG  
1883 N N   . ILE A 308 ? 0.4514 0.3557 0.4062 0.0007  0.0419  0.1107  286 ILE A N   
1884 C CA  . ILE A 308 ? 0.4761 0.3787 0.4168 -0.0117 0.0504  0.1203  286 ILE A CA  
1885 C C   . ILE A 308 ? 0.4555 0.3723 0.4019 -0.0246 0.0599  0.1064  286 ILE A C   
1886 O O   . ILE A 308 ? 0.4727 0.3958 0.4075 -0.0349 0.0681  0.1107  286 ILE A O   
1887 C CB  . ILE A 308 ? 0.5010 0.4198 0.4184 -0.0092 0.0468  0.1339  286 ILE A CB  
1888 C CG1 . ILE A 308 ? 0.4888 0.4404 0.4015 -0.0108 0.0443  0.1213  286 ILE A CG1 
1889 C CG2 . ILE A 308 ? 0.5381 0.4440 0.4504 0.0069  0.0374  0.1505  286 ILE A CG2 
1890 C CD1 . ILE A 308 ? 0.5314 0.5046 0.4193 -0.0158 0.0441  0.1306  286 ILE A CD1 
1891 N N   . LEU A 309 ? 0.4330 0.3553 0.3966 -0.0232 0.0594  0.0904  287 LEU A N   
1892 C CA  . LEU A 309 ? 0.4233 0.3595 0.3920 -0.0313 0.0680  0.0779  287 LEU A CA  
1893 C C   . LEU A 309 ? 0.4406 0.3712 0.4173 -0.0416 0.0781  0.0795  287 LEU A C   
1894 O O   . LEU A 309 ? 0.4551 0.3985 0.4278 -0.0491 0.0879  0.0760  287 LEU A O   
1895 C CB  . LEU A 309 ? 0.3982 0.3402 0.3818 -0.0260 0.0645  0.0634  287 LEU A CB  
1896 C CG  . LEU A 309 ? 0.4049 0.3570 0.3814 -0.0189 0.0560  0.0598  287 LEU A CG  
1897 C CD1 . LEU A 309 ? 0.3877 0.3435 0.3777 -0.0159 0.0539  0.0466  287 LEU A CD1 
1898 C CD2 . LEU A 309 ? 0.4205 0.3876 0.3766 -0.0242 0.0588  0.0599  287 LEU A CD2 
1899 N N   . ALA A 310 ? 0.4295 0.3422 0.4164 -0.0429 0.0767  0.0840  288 ALA A N   
1900 C CA  . ALA A 310 ? 0.4418 0.3538 0.4405 -0.0548 0.0857  0.0826  288 ALA A CA  
1901 C C   . ALA A 310 ? 0.4586 0.3714 0.4422 -0.0664 0.0952  0.0940  288 ALA A C   
1902 O O   . ALA A 310 ? 0.4727 0.3765 0.4362 -0.0650 0.0929  0.1075  288 ALA A O   
1903 C CB  . ALA A 310 ? 0.4484 0.3395 0.4596 -0.0566 0.0823  0.0830  288 ALA A CB  
1904 N N   . GLU A 311 ? 0.4729 0.3996 0.4669 -0.0773 0.1056  0.0890  289 GLU A N   
1905 C CA  . GLU A 311 ? 0.5076 0.4362 0.4912 -0.0918 0.1164  0.0989  289 GLU A CA  
1906 C C   . GLU A 311 ? 0.5034 0.4284 0.5044 -0.1049 0.1217  0.0977  289 GLU A C   
1907 O O   . GLU A 311 ? 0.4748 0.4093 0.4980 -0.1027 0.1194  0.0853  289 GLU A O   
1908 C CB  . GLU A 311 ? 0.5324 0.4895 0.5126 -0.0947 0.1268  0.0915  289 GLU A CB  
1909 C CG  . GLU A 311 ? 0.5433 0.5075 0.5085 -0.0843 0.1228  0.0870  289 GLU A CG  
1910 C CD  . GLU A 311 ? 0.5654 0.5522 0.5212 -0.0898 0.1355  0.0805  289 GLU A CD  
1911 O OE1 . GLU A 311 ? 0.5718 0.5740 0.5438 -0.0869 0.1425  0.0664  289 GLU A OE1 
1912 O OE2 . GLU A 311 ? 0.5618 0.5512 0.4937 -0.0961 0.1387  0.0895  289 GLU A OE2 
1913 N N   . PRO A 312 ? 0.5410 0.4540 0.5308 -0.1201 0.1291  0.1107  290 PRO A N   
1914 C CA  . PRO A 312 ? 0.5778 0.4789 0.5386 -0.1233 0.1314  0.1286  290 PRO A CA  
1915 C C   . PRO A 312 ? 0.6020 0.4721 0.5478 -0.1099 0.1191  0.1409  290 PRO A C   
1916 O O   . PRO A 312 ? 0.5889 0.4411 0.5469 -0.1014 0.1108  0.1359  290 PRO A O   
1917 C CB  . PRO A 312 ? 0.6078 0.5010 0.5652 -0.1452 0.1428  0.1386  290 PRO A CB  
1918 C CG  . PRO A 312 ? 0.5974 0.4865 0.5802 -0.1525 0.1427  0.1278  290 PRO A CG  
1919 C CD  . PRO A 312 ? 0.5524 0.4634 0.5572 -0.1374 0.1356  0.1091  290 PRO A CD  
1920 N N   . GLU A 313 ? 0.6442 0.5116 0.5641 -0.1071 0.1178  0.1562  291 GLU A N   
1921 C CA  . GLU A 313 ? 0.6910 0.5360 0.5970 -0.0915 0.1058  0.1694  291 GLU A CA  
1922 C C   . GLU A 313 ? 0.7080 0.5096 0.6160 -0.0911 0.1033  0.1799  291 GLU A C   
1923 O O   . GLU A 313 ? 0.7045 0.4885 0.6141 -0.0745 0.0931  0.1818  291 GLU A O   
1924 C CB  . GLU A 313 ? 0.7393 0.5924 0.6154 -0.0905 0.1052  0.1871  291 GLU A CB  
1925 C CG  . GLU A 313 ? 0.8060 0.6516 0.6708 -0.0704 0.0909  0.1978  291 GLU A CG  
1926 C CD  . GLU A 313 ? 0.8238 0.6890 0.7043 -0.0562 0.0817  0.1790  291 GLU A CD  
1927 O OE1 . GLU A 313 ? 0.8443 0.7341 0.7352 -0.0615 0.0863  0.1603  291 GLU A OE1 
1928 O OE2 . GLU A 313 ? 0.8756 0.7315 0.7579 -0.0394 0.0704  0.1829  291 GLU A OE2 
1929 N N   . GLU A 314 ? 0.7207 0.5060 0.6293 -0.1100 0.1137  0.1848  292 GLU A N   
1930 C CA  . GLU A 314 ? 0.7609 0.5004 0.6709 -0.1140 0.1140  0.1918  292 GLU A CA  
1931 C C   . GLU A 314 ? 0.7232 0.4531 0.6558 -0.1030 0.1062  0.1742  292 GLU A C   
1932 O O   . GLU A 314 ? 0.7360 0.4259 0.6656 -0.0958 0.1023  0.1800  292 GLU A O   
1933 C CB  . GLU A 314 ? 0.8016 0.5339 0.7134 -0.1415 0.1278  0.1934  292 GLU A CB  
1934 C CG  . GLU A 314 ? 0.8774 0.6013 0.7612 -0.1543 0.1364  0.2168  292 GLU A CG  
1935 C CD  . GLU A 314 ? 0.8702 0.6416 0.7458 -0.1569 0.1408  0.2156  292 GLU A CD  
1936 O OE1 . GLU A 314 ? 0.7993 0.6083 0.6927 -0.1507 0.1393  0.1954  292 GLU A OE1 
1937 O OE2 . GLU A 314 ? 0.9250 0.6943 0.7747 -0.1658 0.1468  0.2350  292 GLU A OE2 
1938 N N   . LEU A 315 ? 0.6515 0.4167 0.6052 -0.1010 0.1042  0.1532  293 LEU A N   
1939 C CA  . LEU A 315 ? 0.6510 0.4118 0.6242 -0.0911 0.0966  0.1368  293 LEU A CA  
1940 C C   . LEU A 315 ? 0.6590 0.4089 0.6261 -0.0670 0.0848  0.1403  293 LEU A C   
1941 O O   . LEU A 315 ? 0.6595 0.3966 0.6387 -0.0584 0.0792  0.1298  293 LEU A O   
1942 C CB  . LEU A 315 ? 0.5894 0.3915 0.5840 -0.0918 0.0963  0.1165  293 LEU A CB  
1943 C CG  . LEU A 315 ? 0.5881 0.4103 0.5983 -0.1118 0.1061  0.1075  293 LEU A CG  
1944 C CD1 . LEU A 315 ? 0.5386 0.3999 0.5680 -0.1053 0.1038  0.0905  293 LEU A CD1 
1945 C CD2 . LEU A 315 ? 0.6080 0.4048 0.6271 -0.1261 0.1086  0.1036  293 LEU A CD2 
1946 N N   . ASN A 316 ? 0.6580 0.4188 0.6076 -0.0567 0.0810  0.1532  294 ASN A N   
1947 C CA  . ASN A 316 ? 0.6626 0.4275 0.6094 -0.0342 0.0694  0.1543  294 ASN A CA  
1948 C C   . ASN A 316 ? 0.7454 0.4725 0.6782 -0.0209 0.0652  0.1734  294 ASN A C   
1949 O O   . ASN A 316 ? 0.7798 0.5104 0.7120 -0.0003 0.0555  0.1754  294 ASN A O   
1950 C CB  . ASN A 316 ? 0.6082 0.4113 0.5453 -0.0302 0.0664  0.1549  294 ASN A CB  
1951 C CG  . ASN A 316 ? 0.5660 0.4009 0.5166 -0.0392 0.0709  0.1358  294 ASN A CG  
1952 O OD1 . ASN A 316 ? 0.5322 0.3695 0.5027 -0.0396 0.0702  0.1200  294 ASN A OD1 
1953 N ND2 . ASN A 316 ? 0.5461 0.4056 0.4849 -0.0455 0.0754  0.1372  294 ASN A ND2 
1954 N N   . GLN A 317 ? 0.8020 0.4928 0.7241 -0.0321 0.0728  0.1873  295 GLN A N   
1955 C CA  . GLN A 317 ? 0.8972 0.5428 0.8052 -0.0190 0.0705  0.2067  295 GLN A CA  
1956 C C   . GLN A 317 ? 0.9260 0.5497 0.8492 -0.0022 0.0648  0.1944  295 GLN A C   
1957 O O   . GLN A 317 ? 0.9593 0.5707 0.8980 -0.0132 0.0692  0.1768  295 GLN A O   
1958 C CB  . GLN A 317 ? 0.9410 0.5455 0.8364 -0.0391 0.0821  0.2203  295 GLN A CB  
1959 N N   . THR A 318 ? 0.9636 0.5876 0.8831 0.0242  0.0551  0.2024  296 THR A N   
1960 C CA  . THR A 318 ? 1.0048 0.6097 0.9381 0.0425  0.0506  0.1906  296 THR A CA  
1961 C C   . THR A 318 ? 1.0723 0.6728 0.9976 0.0734  0.0415  0.2069  296 THR A C   
1962 O O   . THR A 318 ? 1.0678 0.6985 0.9812 0.0815  0.0352  0.2222  296 THR A O   
1963 C CB  . THR A 318 ? 0.9453 0.5887 0.9012 0.0413  0.0467  0.1629  296 THR A CB  
1964 O OG1 . THR A 318 ? 0.9676 0.5921 0.9350 0.0579  0.0436  0.1514  296 THR A OG1 
1965 C CG2 . THR A 318 ? 0.8974 0.5949 0.8533 0.0490  0.0386  0.1618  296 THR A CG2 
1966 N N   . GLU A 319 ? 1.1811 0.7483 1.1141 0.0908  0.0407  0.2017  297 GLU A N   
1967 C CA  . GLU A 319 ? 1.2572 0.8228 1.1877 0.1241  0.0321  0.2144  297 GLU A CA  
1968 C C   . GLU A 319 ? 1.2638 0.8920 1.2078 0.1375  0.0214  0.2022  297 GLU A C   
1969 O O   . GLU A 319 ? 1.2978 0.9614 1.2333 0.1490  0.0133  0.2170  297 GLU A O   
1970 C CB  . GLU A 319 ? 1.2919 0.8023 1.2281 0.1392  0.0364  0.2089  297 GLU A CB  
1971 N N   . GLN A 320 ? 1.2122 0.8556 1.1761 0.1345  0.0215  0.1754  298 GLN A N   
1972 C CA  . GLN A 320 ? 1.1599 0.8604 1.1364 0.1448  0.0126  0.1628  298 GLN A CA  
1973 C C   . GLN A 320 ? 1.0303 0.7769 1.0060 0.1238  0.0114  0.1556  298 GLN A C   
1974 O O   . GLN A 320 ? 1.0302 0.7673 1.0017 0.1004  0.0185  0.1536  298 GLN A O   
1975 C CB  . GLN A 320 ? 1.1771 0.8769 1.1733 0.1525  0.0129  0.1382  298 GLN A CB  
1976 C CG  . GLN A 320 ? 1.2233 0.8927 1.2270 0.1317  0.0219  0.1193  298 GLN A CG  
1977 C CD  . GLN A 320 ? 1.1960 0.8964 1.2047 0.1050  0.0237  0.1062  298 GLN A CD  
1978 O OE1 . GLN A 320 ? 1.2423 0.9878 1.2514 0.1024  0.0186  0.1055  298 GLN A OE1 
1979 N NE2 . GLN A 320 ? 1.1559 0.8322 1.1688 0.0851  0.0312  0.0949  298 GLN A NE2 
1980 N N   . THR A 321 ? 0.9401 0.7368 0.9198 0.1323  0.0031  0.1516  299 THR A N   
1981 C CA  . THR A 321 ? 0.8882 0.7265 0.8691 0.1137  0.0027  0.1397  299 THR A CA  
1982 C C   . THR A 321 ? 0.8106 0.6816 0.8082 0.1168  -0.0012 0.1182  299 THR A C   
1983 O O   . THR A 321 ? 0.7483 0.6540 0.7456 0.1044  -0.0023 0.1093  299 THR A O   
1984 C CB  . THR A 321 ? 0.9079 0.7790 0.8717 0.1112  -0.0017 0.1547  299 THR A CB  
1985 O OG1 . THR A 321 ? 0.9270 0.8342 0.8926 0.1306  -0.0119 0.1586  299 THR A OG1 
1986 C CG2 . THR A 321 ? 0.9497 0.7903 0.8943 0.1092  0.0018  0.1787  299 THR A CG2 
1987 N N   . THR A 322 ? 0.7476 0.6055 0.7581 0.1324  -0.0022 0.1096  300 THR A N   
1988 C CA  . THR A 322 ? 0.6563 0.5411 0.6821 0.1328  -0.0041 0.0883  300 THR A CA  
1989 C C   . THR A 322 ? 0.5754 0.4329 0.6112 0.1230  0.0023  0.0716  300 THR A C   
1990 O O   . THR A 322 ? 0.5911 0.4051 0.6260 0.1241  0.0074  0.0742  300 THR A O   
1991 C CB  . THR A 322 ? 0.7117 0.6127 0.7467 0.1589  -0.0099 0.0870  300 THR A CB  
1992 O OG1 . THR A 322 ? 0.7903 0.6465 0.8244 0.1766  -0.0074 0.0963  300 THR A OG1 
1993 C CG2 . THR A 322 ? 0.7277 0.6730 0.7571 0.1676  -0.0180 0.0981  300 THR A CG2 
1994 N N   . TYR A 323 ? 0.4647 0.3492 0.5092 0.1133  0.0018  0.0545  301 TYR A N   
1995 C CA  . TYR A 323 ? 0.4522 0.3228 0.5059 0.1025  0.0063  0.0378  301 TYR A CA  
1996 C C   . TYR A 323 ? 0.4144 0.3232 0.4766 0.1017  0.0030  0.0220  301 TYR A C   
1997 O O   . TYR A 323 ? 0.3854 0.3291 0.4452 0.1035  -0.0014 0.0243  301 TYR A O   
1998 C CB  . TYR A 323 ? 0.4286 0.2860 0.4784 0.0804  0.0118  0.0392  301 TYR A CB  
1999 C CG  . TYR A 323 ? 0.4081 0.2931 0.4504 0.0703  0.0108  0.0451  301 TYR A CG  
2000 C CD1 . TYR A 323 ? 0.3765 0.2892 0.4229 0.0611  0.0100  0.0338  301 TYR A CD1 
2001 C CD2 . TYR A 323 ? 0.4240 0.3057 0.4533 0.0700  0.0111  0.0619  301 TYR A CD2 
2002 C CE1 . TYR A 323 ? 0.3654 0.2978 0.4037 0.0519  0.0106  0.0374  301 TYR A CE1 
2003 C CE2 . TYR A 323 ? 0.4100 0.3162 0.4310 0.0600  0.0113  0.0646  301 TYR A CE2 
2004 C CZ  . TYR A 323 ? 0.3801 0.3096 0.4059 0.0511  0.0115  0.0516  301 TYR A CZ  
2005 O OH  . TYR A 323 ? 0.3702 0.3182 0.3869 0.0412  0.0132  0.0525  301 TYR A OH  
2006 N N   . GLU A 324 ? 0.4076 0.3098 0.4785 0.0968  0.0056  0.0061  302 GLU A N   
2007 C CA  . GLU A 324 ? 0.3880 0.3216 0.4661 0.0971  0.0033  -0.0089 302 GLU A CA  
2008 C C   . GLU A 324 ? 0.3683 0.3210 0.4454 0.0784  0.0037  -0.0141 302 GLU A C   
2009 O O   . GLU A 324 ? 0.3629 0.3460 0.4413 0.0768  0.0013  -0.0211 302 GLU A O   
2010 C CB  . GLU A 324 ? 0.4069 0.3239 0.4931 0.1027  0.0062  -0.0240 302 GLU A CB  
2011 C CG  . GLU A 324 ? 0.4535 0.3479 0.5414 0.1247  0.0071  -0.0208 302 GLU A CG  
2012 C CD  . GLU A 324 ? 0.4639 0.3941 0.5574 0.1437  0.0028  -0.0228 302 GLU A CD  
2013 O OE1 . GLU A 324 ? 0.4280 0.4004 0.5232 0.1370  -0.0005 -0.0277 302 GLU A OE1 
2014 O OE2 . GLU A 324 ? 0.5095 0.4247 0.6058 0.1652  0.0032  -0.0191 302 GLU A OE2 
2015 N N   . VAL A 325 ? 0.3688 0.3040 0.4435 0.0645  0.0071  -0.0105 303 VAL A N   
2016 C CA  . VAL A 325 ? 0.3502 0.3017 0.4242 0.0500  0.0077  -0.0135 303 VAL A CA  
2017 C C   . VAL A 325 ? 0.3360 0.3104 0.4018 0.0488  0.0058  -0.0066 303 VAL A C   
2018 O O   . VAL A 325 ? 0.3313 0.3035 0.3900 0.0531  0.0053  0.0043  303 VAL A O   
2019 C CB  . VAL A 325 ? 0.3715 0.3046 0.4463 0.0374  0.0121  -0.0099 303 VAL A CB  
2020 C CG1 . VAL A 325 ? 0.3686 0.3193 0.4428 0.0267  0.0129  -0.0107 303 VAL A CG1 
2021 C CG2 . VAL A 325 ? 0.4095 0.3263 0.4922 0.0333  0.0139  -0.0199 303 VAL A CG2 
2022 N N   . GLU A 326 ? 0.2857 0.2808 0.3507 0.0416  0.0052  -0.0129 304 GLU A N   
2023 C CA  . GLU A 326 ? 0.2986 0.3138 0.3547 0.0376  0.0044  -0.0097 304 GLU A CA  
2024 C C   . GLU A 326 ? 0.3021 0.3124 0.3522 0.0252  0.0086  -0.0071 304 GLU A C   
2025 O O   . GLU A 326 ? 0.3228 0.3293 0.3770 0.0197  0.0102  -0.0112 304 GLU A O   
2026 C CB  . GLU A 326 ? 0.2839 0.3260 0.3411 0.0384  0.0016  -0.0183 304 GLU A CB  
2027 C CG  . GLU A 326 ? 0.3004 0.3524 0.3645 0.0531  -0.0017 -0.0215 304 GLU A CG  
2028 C CD  . GLU A 326 ? 0.3045 0.3860 0.3716 0.0528  -0.0032 -0.0320 304 GLU A CD  
2029 O OE1 . GLU A 326 ? 0.2877 0.3907 0.3477 0.0431  -0.0033 -0.0322 304 GLU A OE1 
2030 O OE2 . GLU A 326 ? 0.2982 0.3801 0.3738 0.0614  -0.0034 -0.0407 304 GLU A OE2 
2031 N N   . GLY A 327 ? 0.2996 0.3115 0.3395 0.0218  0.0103  -0.0005 305 GLY A N   
2032 C CA  . GLY A 327 ? 0.3125 0.3213 0.3444 0.0114  0.0154  0.0002  305 GLY A CA  
2033 C C   . GLY A 327 ? 0.3002 0.2924 0.3306 0.0087  0.0207  0.0065  305 GLY A C   
2034 O O   . GLY A 327 ? 0.3379 0.3270 0.3620 0.0019  0.0262  0.0063  305 GLY A O   
2035 N N   . ILE A 328 ? 0.3120 0.2925 0.3472 0.0137  0.0201  0.0120  306 ILE A N   
2036 C CA  . ILE A 328 ? 0.3196 0.2865 0.3532 0.0094  0.0258  0.0186  306 ILE A CA  
2037 C C   . ILE A 328 ? 0.3356 0.2962 0.3616 0.0138  0.0245  0.0290  306 ILE A C   
2038 O O   . ILE A 328 ? 0.3128 0.2740 0.3400 0.0233  0.0189  0.0312  306 ILE A O   
2039 C CB  . ILE A 328 ? 0.3366 0.2930 0.3838 0.0068  0.0282  0.0159  306 ILE A CB  
2040 C CG1 . ILE A 328 ? 0.3541 0.3014 0.4094 0.0123  0.0238  0.0136  306 ILE A CG1 
2041 C CG2 . ILE A 328 ? 0.3150 0.2806 0.3676 0.0038  0.0292  0.0089  306 ILE A CG2 
2042 C CD1 . ILE A 328 ? 0.3574 0.2959 0.4246 0.0067  0.0260  0.0095  306 ILE A CD1 
2043 N N   . GLY A 329 ? 0.3223 0.2783 0.3396 0.0078  0.0301  0.0358  307 GLY A N   
2044 C CA  . GLY A 329 ? 0.3450 0.2947 0.3522 0.0105  0.0295  0.0482  307 GLY A CA  
2045 C C   . GLY A 329 ? 0.3522 0.3210 0.3449 0.0128  0.0254  0.0524  307 GLY A C   
2046 O O   . GLY A 329 ? 0.3461 0.3327 0.3394 0.0154  0.0207  0.0456  307 GLY A O   
2047 N N   . TYR A 330 ? 0.3629 0.3313 0.3418 0.0101  0.0276  0.0634  308 TYR A N   
2048 C CA  . TYR A 330 ? 0.3675 0.3583 0.3309 0.0113  0.0230  0.0687  308 TYR A CA  
2049 C C   . TYR A 330 ? 0.3845 0.3689 0.3351 0.0138  0.0228  0.0860  308 TYR A C   
2050 O O   . TYR A 330 ? 0.3925 0.3538 0.3437 0.0104  0.0287  0.0930  308 TYR A O   
2051 C CB  . TYR A 330 ? 0.3840 0.3914 0.3363 -0.0019 0.0282  0.0586  308 TYR A CB  
2052 C CG  . TYR A 330 ? 0.3657 0.3850 0.3237 -0.0037 0.0259  0.0451  308 TYR A CG  
2053 C CD1 . TYR A 330 ? 0.3846 0.4276 0.3419 0.0015  0.0172  0.0443  308 TYR A CD1 
2054 C CD2 . TYR A 330 ? 0.3776 0.3860 0.3427 -0.0097 0.0323  0.0341  308 TYR A CD2 
2055 C CE1 . TYR A 330 ? 0.3691 0.4235 0.3312 -0.0023 0.0160  0.0322  308 TYR A CE1 
2056 C CE2 . TYR A 330 ? 0.3829 0.3991 0.3514 -0.0120 0.0306  0.0237  308 TYR A CE2 
2057 C CZ  . TYR A 330 ? 0.3804 0.4190 0.3466 -0.0097 0.0229  0.0225  308 TYR A CZ  
2058 O OH  . TYR A 330 ? 0.3888 0.4350 0.3575 -0.0144 0.0223  0.0124  308 TYR A OH  
2059 N N   . ASP A 331 ? 0.3918 0.3996 0.3299 0.0186  0.0159  0.0936  309 ASP A N   
2060 C CA  . ASP A 331 ? 0.4176 0.4262 0.3389 0.0213  0.0142  0.1123  309 ASP A CA  
2061 C C   . ASP A 331 ? 0.4235 0.4494 0.3245 0.0053  0.0201  0.1113  309 ASP A C   
2062 O O   . ASP A 331 ? 0.4249 0.4608 0.3081 0.0054  0.0179  0.1262  309 ASP A O   
2063 C CB  . ASP A 331 ? 0.4378 0.4654 0.3574 0.0386  0.0023  0.1236  309 ASP A CB  
2064 C CG  . ASP A 331 ? 0.4235 0.4936 0.3417 0.0364  -0.0040 0.1126  309 ASP A CG  
2065 O OD1 . ASP A 331 ? 0.4291 0.5058 0.3514 0.0237  0.0005  0.0943  309 ASP A OD1 
2066 O OD2 . ASP A 331 ? 0.4234 0.5205 0.3364 0.0474  -0.0134 0.1228  309 ASP A OD2 
2067 N N   . PHE A 332 ? 0.3998 0.4281 0.3028 -0.0078 0.0279  0.0939  310 PHE A N   
2068 C CA  . PHE A 332 ? 0.4120 0.4525 0.2967 -0.0231 0.0360  0.0889  310 PHE A CA  
2069 C C   . PHE A 332 ? 0.3991 0.4220 0.2937 -0.0313 0.0477  0.0747  310 PHE A C   
2070 O O   . PHE A 332 ? 0.3677 0.3777 0.2815 -0.0262 0.0471  0.0674  310 PHE A O   
2071 C CB  . PHE A 332 ? 0.4136 0.4873 0.2849 -0.0295 0.0313  0.0801  310 PHE A CB  
2072 C CG  . PHE A 332 ? 0.3934 0.4700 0.2766 -0.0317 0.0308  0.0624  310 PHE A CG  
2073 C CD1 . PHE A 332 ? 0.3827 0.4694 0.2792 -0.0204 0.0205  0.0631  310 PHE A CD1 
2074 C CD2 . PHE A 332 ? 0.3855 0.4536 0.2663 -0.0443 0.0412  0.0454  310 PHE A CD2 
2075 C CE1 . PHE A 332 ? 0.3718 0.4616 0.2777 -0.0239 0.0206  0.0483  310 PHE A CE1 
2076 C CE2 . PHE A 332 ? 0.3796 0.4464 0.2692 -0.0465 0.0410  0.0318  310 PHE A CE2 
2077 C CZ  . PHE A 332 ? 0.3725 0.4509 0.2742 -0.0374 0.0306  0.0334  310 PHE A CZ  
2078 N N   . ILE A 333 ? 0.4105 0.4351 0.2923 -0.0430 0.0585  0.0709  311 ILE A N   
2079 C CA  . ILE A 333 ? 0.4071 0.4195 0.2983 -0.0487 0.0704  0.0570  311 ILE A CA  
2080 C C   . ILE A 333 ? 0.4039 0.4244 0.2881 -0.0555 0.0739  0.0391  311 ILE A C   
2081 O O   . ILE A 333 ? 0.4171 0.4512 0.2805 -0.0656 0.0781  0.0341  311 ILE A O   
2082 C CB  . ILE A 333 ? 0.4323 0.4432 0.3142 -0.0573 0.0826  0.0600  311 ILE A CB  
2083 C CG1 . ILE A 333 ? 0.4557 0.4583 0.3376 -0.0547 0.0800  0.0796  311 ILE A CG1 
2084 C CG2 . ILE A 333 ? 0.4198 0.4207 0.3167 -0.0588 0.0944  0.0466  311 ILE A CG2 
2085 C CD1 . ILE A 333 ? 0.4412 0.4236 0.3459 -0.0459 0.0753  0.0844  311 ILE A CD1 
2086 N N   . PRO A 334 ? 0.3790 0.3903 0.2782 -0.0512 0.0724  0.0294  312 PRO A N   
2087 C CA  . PRO A 334 ? 0.3891 0.4028 0.2786 -0.0594 0.0767  0.0135  312 PRO A CA  
2088 C C   . PRO A 334 ? 0.4156 0.4211 0.2947 -0.0676 0.0921  0.0023  312 PRO A C   
2089 O O   . PRO A 334 ? 0.4000 0.3957 0.2893 -0.0637 0.1003  0.0041  312 PRO A O   
2090 C CB  . PRO A 334 ? 0.3698 0.3712 0.2780 -0.0523 0.0734  0.0085  312 PRO A CB  
2091 C CG  . PRO A 334 ? 0.3505 0.3517 0.2750 -0.0411 0.0637  0.0210  312 PRO A CG  
2092 C CD  . PRO A 334 ? 0.3618 0.3604 0.2840 -0.0409 0.0674  0.0318  312 PRO A CD  
2093 N N   . THR A 335 ? 0.4307 0.4427 0.2892 -0.0795 0.0964  -0.0096 313 THR A N   
2094 C CA  . THR A 335 ? 0.4584 0.4611 0.3041 -0.0875 0.1123  -0.0232 313 THR A CA  
2095 C C   . THR A 335 ? 0.4454 0.4228 0.3092 -0.0782 0.1216  -0.0298 313 THR A C   
2096 O O   . THR A 335 ? 0.4290 0.4003 0.2940 -0.0765 0.1341  -0.0343 313 THR A O   
2097 C CB  . THR A 335 ? 0.4788 0.4865 0.3003 -0.1031 0.1155  -0.0386 313 THR A CB  
2098 O OG1 . THR A 335 ? 0.4891 0.5277 0.2937 -0.1116 0.1062  -0.0320 313 THR A OG1 
2099 C CG2 . THR A 335 ? 0.5159 0.5084 0.3232 -0.1106 0.1341  -0.0555 313 THR A CG2 
2100 N N   . VAL A 336 ? 0.4324 0.3982 0.3101 -0.0716 0.1156  -0.0302 314 VAL A N   
2101 C CA  . VAL A 336 ? 0.4367 0.3812 0.3312 -0.0612 0.1228  -0.0343 314 VAL A CA  
2102 C C   . VAL A 336 ? 0.4288 0.3766 0.3474 -0.0491 0.1220  -0.0238 314 VAL A C   
2103 O O   . VAL A 336 ? 0.4279 0.3650 0.3608 -0.0399 0.1288  -0.0267 314 VAL A O   
2104 C CB  . VAL A 336 ? 0.4370 0.3690 0.3363 -0.0592 0.1169  -0.0368 314 VAL A CB  
2105 C CG1 . VAL A 336 ? 0.4505 0.3745 0.3260 -0.0737 0.1214  -0.0499 314 VAL A CG1 
2106 C CG2 . VAL A 336 ? 0.4293 0.3761 0.3412 -0.0550 0.1010  -0.0254 314 VAL A CG2 
2107 N N   . LEU A 337 ? 0.4154 0.3778 0.3385 -0.0492 0.1140  -0.0116 315 LEU A N   
2108 C CA  . LEU A 337 ? 0.4042 0.3691 0.3484 -0.0418 0.1138  -0.0030 315 LEU A CA  
2109 C C   . LEU A 337 ? 0.4223 0.3938 0.3638 -0.0450 0.1269  -0.0042 315 LEU A C   
2110 O O   . LEU A 337 ? 0.4213 0.4019 0.3458 -0.0536 0.1288  -0.0008 315 LEU A O   
2111 C CB  . LEU A 337 ? 0.4043 0.3760 0.3531 -0.0412 0.1013  0.0104  315 LEU A CB  
2112 C CG  . LEU A 337 ? 0.3980 0.3709 0.3644 -0.0384 0.1016  0.0193  315 LEU A CG  
2113 C CD1 . LEU A 337 ? 0.3957 0.3654 0.3852 -0.0308 0.1023  0.0150  315 LEU A CD1 
2114 C CD2 . LEU A 337 ? 0.3985 0.3703 0.3653 -0.0377 0.0903  0.0315  315 LEU A CD2 
2115 N N   . ASP A 338 ? 0.4085 0.3789 0.3676 -0.0376 0.1355  -0.0081 316 ASP A N   
2116 C CA  . ASP A 338 ? 0.4125 0.3945 0.3745 -0.0396 0.1481  -0.0090 316 ASP A CA  
2117 C C   . ASP A 338 ? 0.4109 0.4038 0.3940 -0.0387 0.1440  0.0020  316 ASP A C   
2118 O O   . ASP A 338 ? 0.3981 0.3943 0.4042 -0.0304 0.1432  0.0014  316 ASP A O   
2119 C CB  . ASP A 338 ? 0.4202 0.3975 0.3890 -0.0308 0.1617  -0.0218 316 ASP A CB  
2120 C CG  . ASP A 338 ? 0.4359 0.4295 0.4075 -0.0322 0.1769  -0.0254 316 ASP A CG  
2121 O OD1 . ASP A 338 ? 0.4344 0.4435 0.4059 -0.0410 0.1765  -0.0163 316 ASP A OD1 
2122 O OD2 . ASP A 338 ? 0.4500 0.4398 0.4237 -0.0242 0.1902  -0.0374 316 ASP A OD2 
2123 N N   . ARG A 339 ? 0.4285 0.4272 0.4029 -0.0482 0.1417  0.0125  317 ARG A N   
2124 C CA  . ARG A 339 ? 0.4397 0.4431 0.4309 -0.0504 0.1382  0.0226  317 ARG A CA  
2125 C C   . ARG A 339 ? 0.4294 0.4504 0.4340 -0.0530 0.1513  0.0200  317 ARG A C   
2126 O O   . ARG A 339 ? 0.4296 0.4579 0.4530 -0.0555 0.1497  0.0251  317 ARG A O   
2127 C CB  . ARG A 339 ? 0.4641 0.4623 0.4404 -0.0590 0.1317  0.0365  317 ARG A CB  
2128 C CG  . ARG A 339 ? 0.4750 0.4611 0.4416 -0.0547 0.1178  0.0405  317 ARG A CG  
2129 C CD  . ARG A 339 ? 0.5482 0.5353 0.4907 -0.0619 0.1163  0.0521  317 ARG A CD  
2130 N NE  . ARG A 339 ? 0.5506 0.5261 0.4947 -0.0612 0.1074  0.0666  317 ARG A NE  
2131 C CZ  . ARG A 339 ? 0.5456 0.5184 0.4714 -0.0655 0.1052  0.0816  317 ARG A CZ  
2132 N NH1 . ARG A 339 ? 0.5641 0.5495 0.4676 -0.0730 0.1113  0.0844  317 ARG A NH1 
2133 N NH2 . ARG A 339 ? 0.5385 0.4943 0.4677 -0.0617 0.0968  0.0941  317 ARG A NH2 
2134 N N   . THR A 340 ? 0.4435 0.4732 0.4393 -0.0531 0.1648  0.0108  318 THR A N   
2135 C CA  . THR A 340 ? 0.4444 0.4964 0.4549 -0.0542 0.1788  0.0071  318 THR A CA  
2136 C C   . THR A 340 ? 0.4271 0.4888 0.4682 -0.0413 0.1785  0.0019  318 THR A C   
2137 O O   . THR A 340 ? 0.4303 0.5159 0.4904 -0.0422 0.1861  0.0014  318 THR A O   
2138 C CB  . THR A 340 ? 0.4686 0.5287 0.4636 -0.0552 0.1951  -0.0042 318 THR A CB  
2139 O OG1 . THR A 340 ? 0.4656 0.5129 0.4605 -0.0420 0.1981  -0.0176 318 THR A OG1 
2140 C CG2 . THR A 340 ? 0.4921 0.5479 0.4541 -0.0690 0.1952  0.0008  318 THR A CG2 
2141 N N   . VAL A 341 ? 0.4212 0.4678 0.4672 -0.0295 0.1697  -0.0015 319 VAL A N   
2142 C CA  . VAL A 341 ? 0.4254 0.4833 0.4991 -0.0159 0.1683  -0.0044 319 VAL A CA  
2143 C C   . VAL A 341 ? 0.4043 0.4654 0.4941 -0.0187 0.1541  0.0037  319 VAL A C   
2144 O O   . VAL A 341 ? 0.3744 0.4473 0.4855 -0.0088 0.1504  0.0025  319 VAL A O   
2145 C CB  . VAL A 341 ? 0.4352 0.4755 0.5059 0.0000  0.1692  -0.0126 319 VAL A CB  
2146 C CG1 . VAL A 341 ? 0.4750 0.5123 0.5334 0.0039  0.1859  -0.0236 319 VAL A CG1 
2147 C CG2 . VAL A 341 ? 0.4430 0.4568 0.4959 -0.0027 0.1571  -0.0106 319 VAL A CG2 
2148 N N   . VAL A 342 ? 0.4138 0.4644 0.4926 -0.0317 0.1465  0.0119  320 VAL A N   
2149 C CA  . VAL A 342 ? 0.3876 0.4388 0.4799 -0.0366 0.1354  0.0178  320 VAL A CA  
2150 C C   . VAL A 342 ? 0.3779 0.4486 0.4813 -0.0499 0.1422  0.0216  320 VAL A C   
2151 O O   . VAL A 342 ? 0.3778 0.4464 0.4668 -0.0607 0.1493  0.0263  320 VAL A O   
2152 C CB  . VAL A 342 ? 0.3977 0.4228 0.4721 -0.0410 0.1240  0.0242  320 VAL A CB  
2153 C CG1 . VAL A 342 ? 0.3993 0.4209 0.4864 -0.0455 0.1140  0.0278  320 VAL A CG1 
2154 C CG2 . VAL A 342 ? 0.3865 0.3972 0.4497 -0.0305 0.1186  0.0195  320 VAL A CG2 
2155 N N   . ASP A 343 ? 0.3736 0.4655 0.5020 -0.0504 0.1399  0.0198  321 ASP A N   
2156 C CA  . ASP A 343 ? 0.3812 0.4973 0.5232 -0.0653 0.1472  0.0217  321 ASP A CA  
2157 C C   . ASP A 343 ? 0.3914 0.4876 0.5252 -0.0830 0.1417  0.0295  321 ASP A C   
2158 O O   . ASP A 343 ? 0.3777 0.4781 0.5076 -0.0992 0.1498  0.0346  321 ASP A O   
2159 C CB  . ASP A 343 ? 0.3830 0.5357 0.5562 -0.0599 0.1466  0.0159  321 ASP A CB  
2160 C CG  . ASP A 343 ? 0.3865 0.5605 0.5699 -0.0410 0.1548  0.0095  321 ASP A CG  
2161 O OD1 . ASP A 343 ? 0.3850 0.5645 0.5604 -0.0421 0.1679  0.0077  321 ASP A OD1 
2162 O OD2 . ASP A 343 ? 0.3778 0.5606 0.5752 -0.0244 0.1488  0.0065  321 ASP A OD2 
2163 N N   . LYS A 344 ? 0.3610 0.4344 0.4918 -0.0798 0.1288  0.0303  322 LYS A N   
2164 C CA  . LYS A 344 ? 0.3741 0.4241 0.4983 -0.0937 0.1238  0.0363  322 LYS A CA  
2165 C C   . LYS A 344 ? 0.3586 0.3800 0.4725 -0.0835 0.1112  0.0367  322 LYS A C   
2166 O O   . LYS A 344 ? 0.3255 0.3538 0.4471 -0.0702 0.1045  0.0301  322 LYS A O   
2167 C CB  . LYS A 344 ? 0.3900 0.4600 0.5364 -0.1071 0.1236  0.0318  322 LYS A CB  
2168 C CG  . LYS A 344 ? 0.4286 0.4689 0.5662 -0.1243 0.1215  0.0369  322 LYS A CG  
2169 C CD  . LYS A 344 ? 0.4561 0.5152 0.6139 -0.1411 0.1215  0.0300  322 LYS A CD  
2170 C CE  . LYS A 344 ? 0.5011 0.5229 0.6461 -0.1602 0.1226  0.0353  322 LYS A CE  
2171 N NZ  . LYS A 344 ? 0.5384 0.5772 0.7014 -0.1808 0.1234  0.0263  322 LYS A NZ  
2172 N N   . TRP A 345 ? 0.3686 0.3587 0.4643 -0.0888 0.1086  0.0452  323 TRP A N   
2173 C CA  . TRP A 345 ? 0.3856 0.3505 0.4723 -0.0790 0.0974  0.0459  323 TRP A CA  
2174 C C   . TRP A 345 ? 0.3905 0.3372 0.4830 -0.0879 0.0930  0.0449  323 TRP A C   
2175 O O   . TRP A 345 ? 0.4110 0.3527 0.5051 -0.1042 0.0994  0.0484  323 TRP A O   
2176 C CB  . TRP A 345 ? 0.4050 0.3489 0.4669 -0.0749 0.0969  0.0566  323 TRP A CB  
2177 C CG  . TRP A 345 ? 0.3916 0.3496 0.4440 -0.0671 0.1003  0.0551  323 TRP A CG  
2178 C CD1 . TRP A 345 ? 0.4068 0.3801 0.4539 -0.0728 0.1113  0.0564  323 TRP A CD1 
2179 C CD2 . TRP A 345 ? 0.3619 0.3193 0.4073 -0.0541 0.0938  0.0507  323 TRP A CD2 
2180 N NE1 . TRP A 345 ? 0.4050 0.3845 0.4414 -0.0637 0.1122  0.0520  323 TRP A NE1 
2181 C CE2 . TRP A 345 ? 0.3857 0.3553 0.4210 -0.0532 0.1014  0.0487  323 TRP A CE2 
2182 C CE3 . TRP A 345 ? 0.3494 0.2981 0.3957 -0.0446 0.0831  0.0474  323 TRP A CE3 
2183 C CZ2 . TRP A 345 ? 0.3773 0.3475 0.4023 -0.0448 0.0986  0.0435  323 TRP A CZ2 
2184 C CZ3 . TRP A 345 ? 0.3520 0.3050 0.3893 -0.0361 0.0801  0.0432  323 TRP A CZ3 
2185 C CH2 . TRP A 345 ? 0.3638 0.3260 0.3901 -0.0371 0.0878  0.0413  323 TRP A CH2 
2186 N N   . PHE A 346 ? 0.3824 0.3195 0.4775 -0.0786 0.0831  0.0390  324 PHE A N   
2187 C CA  . PHE A 346 ? 0.3972 0.3092 0.4929 -0.0845 0.0791  0.0369  324 PHE A CA  
2188 C C   . PHE A 346 ? 0.4080 0.2954 0.4899 -0.0697 0.0715  0.0403  324 PHE A C   
2189 O O   . PHE A 346 ? 0.3756 0.2755 0.4568 -0.0566 0.0661  0.0371  324 PHE A O   
2190 C CB  . PHE A 346 ? 0.3854 0.3163 0.5002 -0.0877 0.0745  0.0231  324 PHE A CB  
2191 C CG  . PHE A 346 ? 0.3876 0.3424 0.5183 -0.1052 0.0807  0.0188  324 PHE A CG  
2192 C CD1 . PHE A 346 ? 0.3695 0.3624 0.5126 -0.1034 0.0849  0.0179  324 PHE A CD1 
2193 C CD2 . PHE A 346 ? 0.4079 0.3482 0.5417 -0.1235 0.0829  0.0146  324 PHE A CD2 
2194 C CE1 . PHE A 346 ? 0.3693 0.3919 0.5296 -0.1189 0.0906  0.0138  324 PHE A CE1 
2195 C CE2 . PHE A 346 ? 0.4272 0.3956 0.5767 -0.1422 0.0886  0.0096  324 PHE A CE2 
2196 C CZ  . PHE A 346 ? 0.3952 0.4082 0.5591 -0.1393 0.0920  0.0095  324 PHE A CZ  
2197 N N   . LYS A 347 ? 0.4386 0.2915 0.5100 -0.0720 0.0717  0.0470  325 LYS A N   
2198 C CA  . LYS A 347 ? 0.4633 0.2934 0.5245 -0.0566 0.0647  0.0500  325 LYS A CA  
2199 C C   . LYS A 347 ? 0.4567 0.2840 0.5292 -0.0533 0.0588  0.0353  325 LYS A C   
2200 O O   . LYS A 347 ? 0.4545 0.2721 0.5345 -0.0664 0.0617  0.0279  325 LYS A O   
2201 C CB  . LYS A 347 ? 0.5087 0.2997 0.5545 -0.0590 0.0683  0.0641  325 LYS A CB  
2202 C CG  . LYS A 347 ? 0.5346 0.3295 0.5643 -0.0579 0.0717  0.0803  325 LYS A CG  
2203 C CD  . LYS A 347 ? 0.5497 0.3526 0.5715 -0.0378 0.0630  0.0833  325 LYS A CD  
2204 C CE  . LYS A 347 ? 0.5453 0.3713 0.5560 -0.0369 0.0646  0.0906  325 LYS A CE  
2205 N NZ  . LYS A 347 ? 0.5167 0.3451 0.5172 -0.0196 0.0560  0.0960  325 LYS A NZ  
2206 N N   . SER A 348 ? 0.4221 0.2590 0.4946 -0.0377 0.0513  0.0304  326 SER A N   
2207 C CA  . SER A 348 ? 0.4265 0.2614 0.5074 -0.0339 0.0462  0.0164  326 SER A CA  
2208 C C   . SER A 348 ? 0.4640 0.2737 0.5364 -0.0183 0.0424  0.0186  326 SER A C   
2209 O O   . SER A 348 ? 0.4780 0.2809 0.5391 -0.0075 0.0413  0.0314  326 SER A O   
2210 C CB  . SER A 348 ? 0.3894 0.2594 0.4790 -0.0295 0.0411  0.0072  326 SER A CB  
2211 O OG  . SER A 348 ? 0.3943 0.2748 0.4756 -0.0165 0.0376  0.0129  326 SER A OG  
2212 N N   . ASN A 349 ? 0.4623 0.2601 0.5401 -0.0168 0.0408  0.0057  327 ASN A N   
2213 C CA  . ASN A 349 ? 0.4903 0.2681 0.5629 0.0006  0.0378  0.0054  327 ASN A CA  
2214 C C   . ASN A 349 ? 0.4547 0.2552 0.5352 0.0089  0.0322  -0.0105 327 ASN A C   
2215 O O   . ASN A 349 ? 0.4204 0.2480 0.5089 -0.0001 0.0304  -0.0206 327 ASN A O   
2216 C CB  . ASN A 349 ? 0.5425 0.2723 0.6095 -0.0019 0.0435  0.0069  327 ASN A CB  
2217 C CG  . ASN A 349 ? 0.5791 0.2990 0.6541 -0.0183 0.0472  -0.0114 327 ASN A CG  
2218 O OD1 . ASN A 349 ? 0.5730 0.3107 0.6557 -0.0166 0.0437  -0.0280 327 ASN A OD1 
2219 N ND2 . ASN A 349 ? 0.6091 0.3013 0.6807 -0.0358 0.0545  -0.0085 327 ASN A ND2 
2220 N N   . ASP A 350 ? 0.4551 0.2464 0.5328 0.0268  0.0296  -0.0114 328 ASP A N   
2221 C CA  . ASP A 350 ? 0.4284 0.2440 0.5121 0.0354  0.0250  -0.0254 328 ASP A CA  
2222 C C   . ASP A 350 ? 0.4319 0.2422 0.5222 0.0248  0.0271  -0.0447 328 ASP A C   
2223 O O   . ASP A 350 ? 0.4060 0.2466 0.5017 0.0200  0.0239  -0.0558 328 ASP A O   
2224 C CB  . ASP A 350 ? 0.4427 0.2513 0.5237 0.0582  0.0227  -0.0228 328 ASP A CB  
2225 C CG  . ASP A 350 ? 0.4222 0.2550 0.4982 0.0686  0.0180  -0.0082 328 ASP A CG  
2226 O OD1 . ASP A 350 ? 0.4008 0.2600 0.4754 0.0591  0.0162  -0.0047 328 ASP A OD1 
2227 O OD2 . ASP A 350 ? 0.4333 0.2601 0.5067 0.0873  0.0160  -0.0014 328 ASP A OD2 
2228 N N   . GLU A 351 ? 0.4633 0.2346 0.5516 0.0205  0.0328  -0.0489 329 GLU A N   
2229 C CA  . GLU A 351 ? 0.5136 0.2787 0.6063 0.0100  0.0353  -0.0698 329 GLU A CA  
2230 C C   . GLU A 351 ? 0.4888 0.2853 0.5882 -0.0112 0.0336  -0.0766 329 GLU A C   
2231 O O   . GLU A 351 ? 0.4551 0.2763 0.5591 -0.0159 0.0307  -0.0919 329 GLU A O   
2232 C CB  . GLU A 351 ? 0.5975 0.3098 0.6847 0.0052  0.0431  -0.0730 329 GLU A CB  
2233 C CG  . GLU A 351 ? 0.6608 0.3665 0.7510 -0.0093 0.0465  -0.0971 329 GLU A CG  
2234 C CD  . GLU A 351 ? 0.7729 0.4197 0.8558 -0.0154 0.0559  -0.1022 329 GLU A CD  
2235 O OE1 . GLU A 351 ? 0.8547 0.4626 0.9300 0.0009  0.0591  -0.0886 329 GLU A OE1 
2236 O OE2 . GLU A 351 ? 0.8413 0.4805 0.9250 -0.0372 0.0601  -0.1198 329 GLU A OE2 
2237 N N   . GLU A 352 ? 0.4789 0.2772 0.5790 -0.0234 0.0354  -0.0647 330 GLU A N   
2238 C CA  . GLU A 352 ? 0.4697 0.3014 0.5784 -0.0408 0.0337  -0.0697 330 GLU A CA  
2239 C C   . GLU A 352 ? 0.4089 0.2822 0.5208 -0.0327 0.0270  -0.0666 330 GLU A C   
2240 O O   . GLU A 352 ? 0.4054 0.3086 0.5237 -0.0407 0.0235  -0.0754 330 GLU A O   
2241 C CB  . GLU A 352 ? 0.4975 0.3232 0.6079 -0.0567 0.0388  -0.0595 330 GLU A CB  
2242 C CG  . GLU A 352 ? 0.4882 0.3225 0.5954 -0.0490 0.0387  -0.0407 330 GLU A CG  
2243 C CD  . GLU A 352 ? 0.5331 0.3541 0.6392 -0.0638 0.0459  -0.0305 330 GLU A CD  
2244 O OE1 . GLU A 352 ? 0.5766 0.3946 0.6882 -0.0831 0.0499  -0.0383 330 GLU A OE1 
2245 O OE2 . GLU A 352 ? 0.5415 0.3572 0.6405 -0.0574 0.0477  -0.0149 330 GLU A OE2 
2246 N N   . ALA A 353 ? 0.3851 0.2608 0.4917 -0.0177 0.0251  -0.0543 331 ALA A N   
2247 C CA  . ALA A 353 ? 0.3569 0.2663 0.4642 -0.0114 0.0200  -0.0519 331 ALA A CA  
2248 C C   . ALA A 353 ? 0.3545 0.2814 0.4633 -0.0090 0.0159  -0.0666 331 ALA A C   
2249 O O   . ALA A 353 ? 0.3398 0.2953 0.4519 -0.0144 0.0125  -0.0697 331 ALA A O   
2250 C CB  . ALA A 353 ? 0.3568 0.2647 0.4565 0.0020  0.0190  -0.0394 331 ALA A CB  
2251 N N   . PHE A 354 ? 0.3571 0.2674 0.4632 -0.0001 0.0168  -0.0750 332 PHE A N   
2252 C CA  . PHE A 354 ? 0.3475 0.2764 0.4540 0.0031  0.0141  -0.0898 332 PHE A CA  
2253 C C   . PHE A 354 ? 0.3519 0.2866 0.4619 -0.0119 0.0145  -0.1059 332 PHE A C   
2254 O O   . PHE A 354 ? 0.3535 0.3179 0.4636 -0.0155 0.0107  -0.1140 332 PHE A O   
2255 C CB  . PHE A 354 ? 0.3515 0.2657 0.4552 0.0200  0.0156  -0.0943 332 PHE A CB  
2256 C CG  . PHE A 354 ? 0.3391 0.2586 0.4396 0.0337  0.0137  -0.0794 332 PHE A CG  
2257 C CD1 . PHE A 354 ? 0.3153 0.2638 0.4138 0.0316  0.0100  -0.0712 332 PHE A CD1 
2258 C CD2 . PHE A 354 ? 0.3652 0.2607 0.4637 0.0486  0.0156  -0.0734 332 PHE A CD2 
2259 C CE1 . PHE A 354 ? 0.3087 0.2638 0.4030 0.0411  0.0085  -0.0592 332 PHE A CE1 
2260 C CE2 . PHE A 354 ? 0.3550 0.2617 0.4503 0.0602  0.0129  -0.0598 332 PHE A CE2 
2261 C CZ  . PHE A 354 ? 0.3204 0.2579 0.4135 0.0550  0.0094  -0.0538 332 PHE A CZ  
2262 N N   . THR A 355 ? 0.3601 0.2679 0.4718 -0.0225 0.0191  -0.1099 333 THR A N   
2263 C CA  . THR A 355 ? 0.3774 0.2937 0.4925 -0.0409 0.0195  -0.1248 333 THR A CA  
2264 C C   . THR A 355 ? 0.3494 0.3086 0.4702 -0.0500 0.0137  -0.1193 333 THR A C   
2265 O O   . THR A 355 ? 0.3205 0.3080 0.4421 -0.0572 0.0097  -0.1304 333 THR A O   
2266 C CB  . THR A 355 ? 0.4147 0.2944 0.5302 -0.0538 0.0263  -0.1265 333 THR A CB  
2267 O OG1 . THR A 355 ? 0.4506 0.2867 0.5595 -0.0426 0.0318  -0.1306 333 THR A OG1 
2268 C CG2 . THR A 355 ? 0.4327 0.3244 0.5518 -0.0766 0.0268  -0.1436 333 THR A CG2 
2269 N N   . PHE A 356 ? 0.3443 0.3081 0.4684 -0.0487 0.0135  -0.1020 334 PHE A N   
2270 C CA  . PHE A 356 ? 0.3295 0.3303 0.4599 -0.0538 0.0090  -0.0953 334 PHE A CA  
2271 C C   . PHE A 356 ? 0.3101 0.3368 0.4364 -0.0429 0.0034  -0.0906 334 PHE A C   
2272 O O   . PHE A 356 ? 0.2934 0.3522 0.4226 -0.0471 -0.0015 -0.0906 334 PHE A O   
2273 C CB  . PHE A 356 ? 0.3341 0.3314 0.4698 -0.0561 0.0124  -0.0804 334 PHE A CB  
2274 C CG  . PHE A 356 ? 0.3524 0.3484 0.4960 -0.0742 0.0159  -0.0856 334 PHE A CG  
2275 C CD1 . PHE A 356 ? 0.3818 0.3396 0.5216 -0.0817 0.0224  -0.0898 334 PHE A CD1 
2276 C CD2 . PHE A 356 ? 0.3520 0.3864 0.5068 -0.0845 0.0128  -0.0863 334 PHE A CD2 
2277 C CE1 . PHE A 356 ? 0.4061 0.3616 0.5519 -0.1020 0.0268  -0.0950 334 PHE A CE1 
2278 C CE2 . PHE A 356 ? 0.3700 0.4090 0.5333 -0.1039 0.0163  -0.0924 334 PHE A CE2 
2279 C CZ  . PHE A 356 ? 0.3963 0.3951 0.5545 -0.1144 0.0236  -0.0974 334 PHE A CZ  
2280 N N   . ALA A 357 ? 0.3001 0.3146 0.4189 -0.0297 0.0041  -0.0863 335 ALA A N   
2281 C CA  . ALA A 357 ? 0.3054 0.3430 0.4185 -0.0228 -0.0002 -0.0834 335 ALA A CA  
2282 C C   . ALA A 357 ? 0.3182 0.3754 0.4291 -0.0279 -0.0034 -0.0988 335 ALA A C   
2283 O O   . ALA A 357 ? 0.3177 0.4032 0.4259 -0.0300 -0.0080 -0.0965 335 ALA A O   
2284 C CB  . ALA A 357 ? 0.2965 0.3221 0.4027 -0.0103 0.0013  -0.0775 335 ALA A CB  
2285 N N   . ARG A 358 ? 0.3301 0.3713 0.4406 -0.0300 -0.0005 -0.1144 336 ARG A N   
2286 C CA  . ARG A 358 ? 0.3448 0.4048 0.4519 -0.0360 -0.0024 -0.1315 336 ARG A CA  
2287 C C   . ARG A 358 ? 0.3380 0.4239 0.4492 -0.0516 -0.0065 -0.1353 336 ARG A C   
2288 O O   . ARG A 358 ? 0.3207 0.4379 0.4273 -0.0562 -0.0112 -0.1411 336 ARG A O   
2289 C CB  . ARG A 358 ? 0.3818 0.4150 0.4876 -0.0344 0.0032  -0.1489 336 ARG A CB  
2290 C CG  . ARG A 358 ? 0.4046 0.4238 0.5073 -0.0166 0.0061  -0.1469 336 ARG A CG  
2291 C CD  . ARG A 358 ? 0.4794 0.4678 0.5819 -0.0125 0.0125  -0.1642 336 ARG A CD  
2292 N NE  . ARG A 358 ? 0.5373 0.5343 0.6374 0.0031  0.0137  -0.1692 336 ARG A NE  
2293 C CZ  . ARG A 358 ? 0.5030 0.5053 0.6007 0.0058  0.0170  -0.1893 336 ARG A CZ  
2294 N NH1 . ARG A 358 ? 0.5336 0.5266 0.6293 -0.0063 0.0203  -0.2089 336 ARG A NH1 
2295 N NH2 . ARG A 358 ? 0.5293 0.5461 0.6266 0.0210  0.0179  -0.1905 336 ARG A NH2 
2296 N N   . MET A 359 ? 0.3232 0.3991 0.4426 -0.0600 -0.0048 -0.1318 337 MET A N   
2297 C CA  . MET A 359 ? 0.3573 0.4628 0.4835 -0.0749 -0.0089 -0.1345 337 MET A CA  
2298 C C   . MET A 359 ? 0.3151 0.4563 0.4431 -0.0694 -0.0157 -0.1178 337 MET A C   
2299 O O   . MET A 359 ? 0.3175 0.4953 0.4460 -0.0763 -0.0220 -0.1204 337 MET A O   
2300 C CB  . MET A 359 ? 0.3840 0.4701 0.5193 -0.0853 -0.0041 -0.1334 337 MET A CB  
2301 C CG  . MET A 359 ? 0.4455 0.5612 0.5894 -0.1045 -0.0068 -0.1411 337 MET A CG  
2302 S SD  . MET A 359 ? 0.5191 0.6123 0.6733 -0.1184 0.0006  -0.1381 337 MET A SD  
2303 C CE  . MET A 359 ? 0.5062 0.5367 0.6495 -0.1185 0.0100  -0.1499 337 MET A CE  
2304 N N   . LEU A 360 ? 0.3007 0.4304 0.4284 -0.0566 -0.0142 -0.1007 338 LEU A N   
2305 C CA  . LEU A 360 ? 0.3002 0.4539 0.4272 -0.0489 -0.0188 -0.0846 338 LEU A CA  
2306 C C   . LEU A 360 ? 0.2854 0.4602 0.4008 -0.0469 -0.0239 -0.0868 338 LEU A C   
2307 O O   . LEU A 360 ? 0.2812 0.4869 0.3961 -0.0477 -0.0299 -0.0802 338 LEU A O   
2308 C CB  . LEU A 360 ? 0.2952 0.4261 0.4204 -0.0369 -0.0145 -0.0694 338 LEU A CB  
2309 C CG  . LEU A 360 ? 0.3012 0.4221 0.4376 -0.0387 -0.0101 -0.0630 338 LEU A CG  
2310 C CD1 . LEU A 360 ? 0.2967 0.3893 0.4281 -0.0292 -0.0046 -0.0532 338 LEU A CD1 
2311 C CD2 . LEU A 360 ? 0.2940 0.4464 0.4403 -0.0383 -0.0135 -0.0539 338 LEU A CD2 
2312 N N   . ILE A 361 ? 0.2809 0.4416 0.3872 -0.0443 -0.0213 -0.0962 339 ILE A N   
2313 C CA  . ILE A 361 ? 0.2770 0.4595 0.3715 -0.0449 -0.0247 -0.1007 339 ILE A CA  
2314 C C   . ILE A 361 ? 0.3004 0.5119 0.3944 -0.0575 -0.0292 -0.1147 339 ILE A C   
2315 O O   . ILE A 361 ? 0.3030 0.5464 0.3910 -0.0598 -0.0354 -0.1088 339 ILE A O   
2316 C CB  . ILE A 361 ? 0.2986 0.4639 0.3861 -0.0391 -0.0198 -0.1098 339 ILE A CB  
2317 C CG1 . ILE A 361 ? 0.2861 0.4305 0.3723 -0.0282 -0.0166 -0.0954 339 ILE A CG1 
2318 C CG2 . ILE A 361 ? 0.3127 0.5041 0.3879 -0.0415 -0.0221 -0.1160 339 ILE A CG2 
2319 C CD1 . ILE A 361 ? 0.3048 0.4352 0.3879 -0.0212 -0.0121 -0.1032 339 ILE A CD1 
2320 N N   . ALA A 362 ? 0.3146 0.5142 0.4136 -0.0666 -0.0259 -0.1333 340 ALA A N   
2321 C CA  . ALA A 362 ? 0.3248 0.5489 0.4210 -0.0811 -0.0287 -0.1518 340 ALA A CA  
2322 C C   . ALA A 362 ? 0.3313 0.5909 0.4349 -0.0917 -0.0359 -0.1468 340 ALA A C   
2323 O O   . ALA A 362 ? 0.3062 0.6019 0.4042 -0.1018 -0.0417 -0.1551 340 ALA A O   
2324 C CB  . ALA A 362 ? 0.3543 0.5479 0.4522 -0.0882 -0.0213 -0.1743 340 ALA A CB  
2325 N N   . GLN A 363 ? 0.3252 0.5779 0.4417 -0.0896 -0.0355 -0.1341 341 GLN A N   
2326 C CA  . GLN A 363 ? 0.3558 0.6450 0.4830 -0.0990 -0.0416 -0.1304 341 GLN A CA  
2327 C C   . GLN A 363 ? 0.3262 0.6409 0.4566 -0.0858 -0.0478 -0.1059 341 GLN A C   
2328 O O   . GLN A 363 ? 0.3221 0.6799 0.4579 -0.0903 -0.0555 -0.1019 341 GLN A O   
2329 C CB  . GLN A 363 ? 0.4015 0.6720 0.5425 -0.1085 -0.0360 -0.1355 341 GLN A CB  
2330 C CG  . GLN A 363 ? 0.4706 0.7171 0.6079 -0.1243 -0.0300 -0.1604 341 GLN A CG  
2331 C CD  . GLN A 363 ? 0.5490 0.7906 0.6986 -0.1411 -0.0262 -0.1667 341 GLN A CD  
2332 O OE1 . GLN A 363 ? 0.6265 0.8247 0.7780 -0.1413 -0.0178 -0.1671 341 GLN A OE1 
2333 N NE2 . GLN A 363 ? 0.6033 0.8922 0.7612 -0.1559 -0.0326 -0.1703 341 GLN A NE2 
2334 N N   . GLU A 364 ? 0.2869 0.5754 0.4139 -0.0696 -0.0442 -0.0900 342 GLU A N   
2335 C CA  . GLU A 364 ? 0.2971 0.5995 0.4260 -0.0557 -0.0479 -0.0671 342 GLU A CA  
2336 C C   . GLU A 364 ? 0.2848 0.5829 0.3961 -0.0460 -0.0494 -0.0566 342 GLU A C   
2337 O O   . GLU A 364 ? 0.2677 0.5768 0.3764 -0.0353 -0.0529 -0.0378 342 GLU A O   
2338 C CB  . GLU A 364 ? 0.2873 0.5620 0.4267 -0.0464 -0.0411 -0.0561 342 GLU A CB  
2339 C CG  . GLU A 364 ? 0.2933 0.5680 0.4488 -0.0573 -0.0376 -0.0650 342 GLU A CG  
2340 C CD  . GLU A 364 ? 0.3129 0.6353 0.4833 -0.0633 -0.0440 -0.0630 342 GLU A CD  
2341 O OE1 . GLU A 364 ? 0.3425 0.6941 0.5146 -0.0519 -0.0502 -0.0479 342 GLU A OE1 
2342 O OE2 . GLU A 364 ? 0.2873 0.6188 0.4680 -0.0796 -0.0425 -0.0761 342 GLU A OE2 
2343 N N   . GLY A 365 ? 0.3055 0.5875 0.4044 -0.0495 -0.0462 -0.0684 343 GLY A N   
2344 C CA  . GLY A 365 ? 0.2904 0.5695 0.3722 -0.0431 -0.0464 -0.0594 343 GLY A CA  
2345 C C   . GLY A 365 ? 0.2937 0.5412 0.3736 -0.0310 -0.0410 -0.0436 343 GLY A C   
2346 O O   . GLY A 365 ? 0.3001 0.5454 0.3669 -0.0256 -0.0413 -0.0303 343 GLY A O   
2347 N N   . LEU A 366 ? 0.2957 0.5170 0.3865 -0.0283 -0.0353 -0.0457 344 LEU A N   
2348 C CA  . LEU A 366 ? 0.2823 0.4740 0.3707 -0.0188 -0.0295 -0.0337 344 LEU A CA  
2349 C C   . LEU A 366 ? 0.3053 0.4740 0.3864 -0.0195 -0.0242 -0.0427 344 LEU A C   
2350 O O   . LEU A 366 ? 0.2876 0.4440 0.3756 -0.0222 -0.0214 -0.0550 344 LEU A O   
2351 C CB  . LEU A 366 ? 0.2884 0.4705 0.3921 -0.0155 -0.0264 -0.0296 344 LEU A CB  
2352 C CG  . LEU A 366 ? 0.2838 0.4930 0.3981 -0.0123 -0.0310 -0.0199 344 LEU A CG  
2353 C CD1 . LEU A 366 ? 0.2931 0.4966 0.4239 -0.0117 -0.0266 -0.0197 344 LEU A CD1 
2354 C CD2 . LEU A 366 ? 0.3005 0.5098 0.4060 -0.0003 -0.0321 -0.0011 344 LEU A CD2 
2355 N N   . LEU A 367 ? 0.3033 0.4675 0.3703 -0.0172 -0.0228 -0.0362 345 LEU A N   
2356 C CA  . LEU A 367 ? 0.3018 0.4573 0.3622 -0.0185 -0.0192 -0.0456 345 LEU A CA  
2357 C C   . LEU A 367 ? 0.2974 0.4259 0.3592 -0.0133 -0.0137 -0.0405 345 LEU A C   
2358 O O   . LEU A 367 ? 0.2782 0.3992 0.3295 -0.0128 -0.0108 -0.0342 345 LEU A O   
2359 C CB  . LEU A 367 ? 0.3193 0.4898 0.3637 -0.0223 -0.0202 -0.0430 345 LEU A CB  
2360 C CG  . LEU A 367 ? 0.3429 0.5432 0.3838 -0.0288 -0.0252 -0.0520 345 LEU A CG  
2361 C CD1 . LEU A 367 ? 0.3756 0.5905 0.3983 -0.0331 -0.0259 -0.0440 345 LEU A CD1 
2362 C CD2 . LEU A 367 ? 0.3685 0.5717 0.4153 -0.0313 -0.0232 -0.0736 345 LEU A CD2 
2363 N N   . CYS A 368 ? 0.2882 0.4037 0.3621 -0.0113 -0.0120 -0.0441 346 CYS A N   
2364 C CA  . CYS A 368 ? 0.3022 0.3948 0.3779 -0.0069 -0.0072 -0.0381 346 CYS A CA  
2365 C C   . CYS A 368 ? 0.2908 0.3714 0.3684 -0.0047 -0.0049 -0.0469 346 CYS A C   
2366 O O   . CYS A 368 ? 0.2808 0.3680 0.3602 -0.0053 -0.0061 -0.0589 346 CYS A O   
2367 C CB  . CYS A 368 ? 0.3035 0.3910 0.3904 -0.0060 -0.0063 -0.0325 346 CYS A CB  
2368 S SG  . CYS A 368 ? 0.3479 0.4397 0.4486 -0.0121 -0.0078 -0.0446 346 CYS A SG  
2369 N N   . GLY A 369 ? 0.2852 0.3484 0.3623 -0.0012 -0.0012 -0.0408 347 GLY A N   
2370 C CA  . GLY A 369 ? 0.2889 0.3415 0.3666 0.0034  0.0005  -0.0448 347 GLY A CA  
2371 C C   . GLY A 369 ? 0.2966 0.3310 0.3826 0.0050  0.0023  -0.0456 347 GLY A C   
2372 O O   . GLY A 369 ? 0.2900 0.3228 0.3832 0.0002  0.0024  -0.0462 347 GLY A O   
2373 N N   . GLY A 370 ? 0.2884 0.3107 0.3731 0.0112  0.0038  -0.0448 348 GLY A N   
2374 C CA  . GLY A 370 ? 0.2913 0.2923 0.3810 0.0131  0.0059  -0.0447 348 GLY A CA  
2375 C C   . GLY A 370 ? 0.2876 0.2777 0.3791 0.0080  0.0091  -0.0352 348 GLY A C   
2376 O O   . GLY A 370 ? 0.3081 0.2870 0.4060 0.0028  0.0110  -0.0369 348 GLY A O   
2377 N N   . SER A 371 ? 0.2790 0.2719 0.3642 0.0084  0.0107  -0.0263 349 SER A N   
2378 C CA  . SER A 371 ? 0.2893 0.2737 0.3755 0.0046  0.0152  -0.0182 349 SER A CA  
2379 C C   . SER A 371 ? 0.2925 0.2871 0.3877 -0.0011 0.0157  -0.0193 349 SER A C   
2380 O O   . SER A 371 ? 0.2794 0.2704 0.3803 -0.0052 0.0197  -0.0155 349 SER A O   
2381 C CB  . SER A 371 ? 0.2973 0.2822 0.3733 0.0060  0.0179  -0.0109 349 SER A CB  
2382 O OG  . SER A 371 ? 0.2701 0.2660 0.3422 0.0049  0.0176  -0.0115 349 SER A OG  
2383 N N   . ALA A 372 ? 0.2724 0.2832 0.3691 -0.0013 0.0118  -0.0239 350 ALA A N   
2384 C CA  . ALA A 372 ? 0.2761 0.3027 0.3823 -0.0054 0.0104  -0.0247 350 ALA A CA  
2385 C C   . ALA A 372 ? 0.2867 0.3119 0.4026 -0.0127 0.0101  -0.0318 350 ALA A C   
2386 O O   . ALA A 372 ? 0.3010 0.3351 0.4270 -0.0184 0.0117  -0.0305 350 ALA A O   
2387 C CB  . ALA A 372 ? 0.2694 0.3138 0.3721 -0.0043 0.0053  -0.0271 350 ALA A CB  
2388 N N   . GLY A 373 ? 0.2959 0.3097 0.4092 -0.0129 0.0089  -0.0401 351 GLY A N   
2389 C CA  . GLY A 373 ? 0.2947 0.2978 0.4141 -0.0209 0.0103  -0.0483 351 GLY A CA  
2390 C C   . GLY A 373 ? 0.3100 0.2927 0.4311 -0.0248 0.0161  -0.0413 351 GLY A C   
2391 O O   . GLY A 373 ? 0.2921 0.2742 0.4210 -0.0363 0.0186  -0.0446 351 GLY A O   
2392 N N   . SER A 374 ? 0.3085 0.2764 0.4214 -0.0171 0.0185  -0.0320 352 SER A N   
2393 C CA  . SER A 374 ? 0.3299 0.2802 0.4414 -0.0209 0.0243  -0.0233 352 SER A CA  
2394 C C   . SER A 374 ? 0.3097 0.2779 0.4303 -0.0291 0.0276  -0.0199 352 SER A C   
2395 O O   . SER A 374 ? 0.3374 0.2995 0.4629 -0.0394 0.0323  -0.0188 352 SER A O   
2396 C CB  . SER A 374 ? 0.3336 0.2751 0.4336 -0.0115 0.0255  -0.0131 352 SER A CB  
2397 O OG  . SER A 374 ? 0.3558 0.2884 0.4493 -0.0017 0.0220  -0.0151 352 SER A OG  
2398 N N   . THR A 375 ? 0.2886 0.2783 0.4110 -0.0239 0.0258  -0.0179 353 THR A N   
2399 C CA  . THR A 375 ? 0.2914 0.3003 0.4228 -0.0262 0.0292  -0.0137 353 THR A CA  
2400 C C   . THR A 375 ? 0.2834 0.3128 0.4297 -0.0362 0.0276  -0.0201 353 THR A C   
2401 O O   . THR A 375 ? 0.2741 0.3128 0.4298 -0.0442 0.0325  -0.0183 353 THR A O   
2402 C CB  . THR A 375 ? 0.2849 0.3057 0.4127 -0.0159 0.0280  -0.0097 353 THR A CB  
2403 O OG1 . THR A 375 ? 0.3043 0.3077 0.4174 -0.0102 0.0298  -0.0056 353 THR A OG1 
2404 C CG2 . THR A 375 ? 0.3024 0.3396 0.4395 -0.0143 0.0332  -0.0046 353 THR A CG2 
2405 N N   . VAL A 376 ? 0.2732 0.3121 0.4212 -0.0377 0.0210  -0.0287 354 VAL A N   
2406 C CA  . VAL A 376 ? 0.2777 0.3404 0.4385 -0.0490 0.0185  -0.0364 354 VAL A CA  
2407 C C   . VAL A 376 ? 0.3071 0.3517 0.4697 -0.0645 0.0225  -0.0435 354 VAL A C   
2408 O O   . VAL A 376 ? 0.3005 0.3638 0.4749 -0.0782 0.0242  -0.0473 354 VAL A O   
2409 C CB  . VAL A 376 ? 0.2648 0.3476 0.4250 -0.0468 0.0102  -0.0433 354 VAL A CB  
2410 C CG1 . VAL A 376 ? 0.2876 0.3983 0.4598 -0.0608 0.0070  -0.0527 354 VAL A CG1 
2411 C CG2 . VAL A 376 ? 0.2662 0.3658 0.4248 -0.0335 0.0075  -0.0337 354 VAL A CG2 
2412 N N   . ALA A 377 ? 0.3227 0.3314 0.4737 -0.0626 0.0246  -0.0448 355 ALA A N   
2413 C CA  . ALA A 377 ? 0.3554 0.3369 0.5049 -0.0757 0.0299  -0.0492 355 ALA A CA  
2414 C C   . ALA A 377 ? 0.3558 0.3380 0.5100 -0.0851 0.0373  -0.0400 355 ALA A C   
2415 O O   . ALA A 377 ? 0.3770 0.3568 0.5367 -0.1030 0.0416  -0.0448 355 ALA A O   
2416 C CB  . ALA A 377 ? 0.3758 0.3178 0.5114 -0.0662 0.0310  -0.0477 355 ALA A CB  
2417 N N   . VAL A 378 ? 0.3355 0.3205 0.4864 -0.0744 0.0396  -0.0279 356 VAL A N   
2418 C CA  . VAL A 378 ? 0.3553 0.3466 0.5103 -0.0818 0.0473  -0.0198 356 VAL A CA  
2419 C C   . VAL A 378 ? 0.3374 0.3730 0.5109 -0.0876 0.0473  -0.0227 356 VAL A C   
2420 O O   . VAL A 378 ? 0.3628 0.4097 0.5453 -0.1031 0.0531  -0.0233 356 VAL A O   
2421 C CB  . VAL A 378 ? 0.3445 0.3255 0.4885 -0.0695 0.0507  -0.0077 356 VAL A CB  
2422 C CG1 . VAL A 378 ? 0.3469 0.3450 0.4971 -0.0760 0.0592  -0.0013 356 VAL A CG1 
2423 C CG2 . VAL A 378 ? 0.3636 0.3048 0.4909 -0.0670 0.0519  -0.0022 356 VAL A CG2 
2424 N N   . ALA A 379 ? 0.3144 0.3763 0.4937 -0.0756 0.0410  -0.0239 357 ALA A N   
2425 C CA  . ALA A 379 ? 0.3030 0.4100 0.5008 -0.0766 0.0402  -0.0243 357 ALA A CA  
2426 C C   . ALA A 379 ? 0.3240 0.4535 0.5352 -0.0969 0.0392  -0.0343 357 ALA A C   
2427 O O   . ALA A 379 ? 0.3173 0.4794 0.5442 -0.1052 0.0433  -0.0335 357 ALA A O   
2428 C CB  . ALA A 379 ? 0.2806 0.4068 0.4796 -0.0597 0.0328  -0.0226 357 ALA A CB  
2429 N N   . VAL A 380 ? 0.3218 0.4357 0.5269 -0.1064 0.0348  -0.0449 358 VAL A N   
2430 C CA  . VAL A 380 ? 0.3279 0.4626 0.5438 -0.1290 0.0342  -0.0568 358 VAL A CA  
2431 C C   . VAL A 380 ? 0.3506 0.4683 0.5673 -0.1494 0.0443  -0.0569 358 VAL A C   
2432 O O   . VAL A 380 ? 0.3679 0.5077 0.5952 -0.1711 0.0456  -0.0662 358 VAL A O   
2433 C CB  . VAL A 380 ? 0.3472 0.4703 0.5556 -0.1359 0.0280  -0.0714 358 VAL A CB  
2434 C CG1 . VAL A 380 ? 0.3232 0.4701 0.5309 -0.1191 0.0181  -0.0711 358 VAL A CG1 
2435 C CG2 . VAL A 380 ? 0.3701 0.4345 0.5607 -0.1365 0.0325  -0.0739 358 VAL A CG2 
2436 N N   . LYS A 381 ? 0.3650 0.4450 0.5693 -0.1442 0.0516  -0.0464 359 LYS A N   
2437 C CA  . LYS A 381 ? 0.3954 0.4628 0.5992 -0.1622 0.0622  -0.0422 359 LYS A CA  
2438 C C   . LYS A 381 ? 0.3602 0.4637 0.5760 -0.1567 0.0673  -0.0327 359 LYS A C   
2439 O O   . LYS A 381 ? 0.3434 0.4756 0.5725 -0.1740 0.0730  -0.0347 359 LYS A O   
2440 C CB  . LYS A 381 ? 0.4558 0.4643 0.6381 -0.1598 0.0676  -0.0340 359 LYS A CB  
2441 C CG  . LYS A 381 ? 0.5087 0.4752 0.6776 -0.1575 0.0635  -0.0416 359 LYS A CG  
2442 C CD  . LYS A 381 ? 0.5672 0.4802 0.7161 -0.1494 0.0680  -0.0300 359 LYS A CD  
2443 C CE  . LYS A 381 ? 0.5956 0.4924 0.7348 -0.1252 0.0607  -0.0290 359 LYS A CE  
2444 N NZ  . LYS A 381 ? 0.6488 0.4922 0.7712 -0.1201 0.0630  -0.0249 359 LYS A NZ  
2445 N N   . ALA A 382 ? 0.3303 0.4324 0.5409 -0.1336 0.0662  -0.0236 360 ALA A N   
2446 C CA  . ALA A 382 ? 0.3283 0.4553 0.5464 -0.1266 0.0735  -0.0153 360 ALA A CA  
2447 C C   . ALA A 382 ? 0.3177 0.5038 0.5613 -0.1282 0.0725  -0.0196 360 ALA A C   
2448 O O   . ALA A 382 ? 0.3155 0.5294 0.5712 -0.1359 0.0810  -0.0175 360 ALA A O   
2449 C CB  . ALA A 382 ? 0.3076 0.4208 0.5143 -0.1023 0.0721  -0.0078 360 ALA A CB  
2450 N N   . ALA A 383 ? 0.3185 0.5260 0.5699 -0.1209 0.0618  -0.0254 361 ALA A N   
2451 C CA  . ALA A 383 ? 0.3097 0.5765 0.5849 -0.1176 0.0580  -0.0278 361 ALA A CA  
2452 C C   . ALA A 383 ? 0.3232 0.6237 0.6137 -0.1442 0.0577  -0.0379 361 ALA A C   
2453 O O   . ALA A 383 ? 0.3097 0.6665 0.6215 -0.1432 0.0533  -0.0402 361 ALA A O   
2454 C CB  . ALA A 383 ? 0.2928 0.5682 0.5667 -0.0978 0.0463  -0.0273 361 ALA A CB  
2455 N N   . GLN A 384 ? 0.3512 0.6186 0.6311 -0.1686 0.0627  -0.0435 362 GLN A N   
2456 C CA  . GLN A 384 ? 0.3802 0.6765 0.6731 -0.1982 0.0650  -0.0536 362 GLN A CA  
2457 C C   . GLN A 384 ? 0.3967 0.7408 0.7099 -0.2032 0.0740  -0.0490 362 GLN A C   
2458 O O   . GLN A 384 ? 0.3690 0.7627 0.7015 -0.2222 0.0739  -0.0567 362 GLN A O   
2459 C CB  . GLN A 384 ? 0.4288 0.6706 0.7036 -0.2235 0.0714  -0.0590 362 GLN A CB  
2460 C CG  . GLN A 384 ? 0.4495 0.6479 0.7070 -0.2220 0.0642  -0.0673 362 GLN A CG  
2461 C CD  . GLN A 384 ? 0.4541 0.6877 0.7220 -0.2367 0.0558  -0.0836 362 GLN A CD  
2462 O OE1 . GLN A 384 ? 0.4615 0.7333 0.7440 -0.2608 0.0581  -0.0915 362 GLN A OE1 
2463 N NE2 . GLN A 384 ? 0.4611 0.6856 0.7210 -0.2232 0.0460  -0.0890 362 GLN A NE2 
2464 N N   . GLU A 385 ? 0.4181 0.7504 0.7269 -0.1871 0.0820  -0.0376 363 GLU A N   
2465 C CA  . GLU A 385 ? 0.4903 0.8687 0.8180 -0.1910 0.0923  -0.0343 363 GLU A CA  
2466 C C   . GLU A 385 ? 0.4371 0.8836 0.7922 -0.1710 0.0872  -0.0340 363 GLU A C   
2467 O O   . GLU A 385 ? 0.4591 0.9555 0.8351 -0.1747 0.0948  -0.0337 363 GLU A O   
2468 C CB  . GLU A 385 ? 0.5298 0.8744 0.8421 -0.1821 0.1040  -0.0237 363 GLU A CB  
2469 C CG  . GLU A 385 ? 0.5387 0.8699 0.8437 -0.1482 0.1016  -0.0164 363 GLU A CG  
2470 C CD  . GLU A 385 ? 0.6007 0.9072 0.8911 -0.1434 0.1140  -0.0084 363 GLU A CD  
2471 O OE1 . GLU A 385 ? 0.7123 1.0106 0.9971 -0.1659 0.1238  -0.0067 363 GLU A OE1 
2472 O OE2 . GLU A 385 ? 0.6284 0.9236 0.9117 -0.1187 0.1143  -0.0039 363 GLU A OE2 
2473 N N   . LEU A 386 ? 0.3851 0.8332 0.7393 -0.1495 0.0747  -0.0333 364 LEU A N   
2474 C CA  . LEU A 386 ? 0.3435 0.8499 0.7207 -0.1272 0.0680  -0.0305 364 LEU A CA  
2475 C C   . LEU A 386 ? 0.3311 0.8963 0.7286 -0.1440 0.0587  -0.0394 364 LEU A C   
2476 O O   . LEU A 386 ? 0.3214 0.8715 0.7100 -0.1687 0.0542  -0.0493 364 LEU A O   
2477 C CB  . LEU A 386 ? 0.3284 0.8059 0.6918 -0.0974 0.0593  -0.0237 364 LEU A CB  
2478 C CG  . LEU A 386 ? 0.3320 0.7549 0.6747 -0.0814 0.0677  -0.0162 364 LEU A CG  
2479 C CD1 . LEU A 386 ? 0.3122 0.7100 0.6419 -0.0557 0.0594  -0.0104 364 LEU A CD1 
2480 C CD2 . LEU A 386 ? 0.3418 0.7898 0.6980 -0.0718 0.0807  -0.0119 364 LEU A CD2 
2481 N N   . GLN A 387 ? 0.3136 0.9484 0.7390 -0.1304 0.0565  -0.0364 365 GLN A N   
2482 C CA  . GLN A 387 ? 0.2941 0.9974 0.7414 -0.1432 0.0463  -0.0435 365 GLN A CA  
2483 C C   . GLN A 387 ? 0.2872 1.0127 0.7374 -0.1158 0.0311  -0.0370 365 GLN A C   
2484 O O   . GLN A 387 ? 0.2642 0.9511 0.7004 -0.0869 0.0296  -0.0268 365 GLN A O   
2485 C CB  . GLN A 387 ? 0.3006 1.0774 0.7799 -0.1491 0.0539  -0.0444 365 GLN A CB  
2486 C CG  . GLN A 387 ? 0.2833 1.0954 0.7817 -0.1112 0.0572  -0.0326 365 GLN A CG  
2487 C CD  . GLN A 387 ? 0.2926 1.1863 0.8256 -0.1194 0.0645  -0.0356 365 GLN A CD  
2488 O OE1 . GLN A 387 ? 0.3086 1.2004 0.8429 -0.1436 0.0782  -0.0410 365 GLN A OE1 
2489 N NE2 . GLN A 387 ? 0.2807 1.2494 0.8418 -0.0998 0.0552  -0.0316 365 GLN A NE2 
2490 N N   . GLU A 388 ? 0.2983 1.0862 0.7650 -0.1272 0.0199  -0.0431 366 GLU A N   
2491 C CA  . GLU A 388 ? 0.3194 1.1400 0.7902 -0.1037 0.0044  -0.0357 366 GLU A CA  
2492 C C   . GLU A 388 ? 0.2984 1.1416 0.7847 -0.0632 0.0069  -0.0191 366 GLU A C   
2493 O O   . GLU A 388 ? 0.2808 1.1628 0.7902 -0.0596 0.0165  -0.0178 366 GLU A O   
2494 C CB  . GLU A 388 ? 0.3714 1.2728 0.8627 -0.1246 -0.0068 -0.0449 366 GLU A CB  
2495 C CG  . GLU A 388 ? 0.4069 1.3246 0.8896 -0.1141 -0.0244 -0.0420 366 GLU A CG  
2496 C CD  . GLU A 388 ? 0.4444 1.4588 0.9521 -0.1248 -0.0367 -0.0462 366 GLU A CD  
2497 O OE1 . GLU A 388 ? 0.4607 1.5249 0.9893 -0.1513 -0.0322 -0.0572 366 GLU A OE1 
2498 O OE2 . GLU A 388 ? 0.5003 1.5435 1.0060 -0.1073 -0.0514 -0.0381 366 GLU A OE2 
2499 N N   . GLY A 389 ? 0.2712 1.0907 0.7447 -0.0334 -0.0008 -0.0070 367 GLY A N   
2500 C CA  . GLY A 389 ? 0.2635 1.0912 0.7473 0.0067  0.0026  0.0088  367 GLY A CA  
2501 C C   . GLY A 389 ? 0.2637 1.0179 0.7285 0.0209  0.0166  0.0129  367 GLY A C   
2502 O O   . GLY A 389 ? 0.2835 1.0309 0.7513 0.0538  0.0206  0.0245  367 GLY A O   
2503 N N   . GLN A 390 ? 0.2508 0.9494 0.6953 -0.0030 0.0245  0.0035  368 GLN A N   
2504 C CA  . GLN A 390 ? 0.2480 0.8787 0.6715 0.0094  0.0358  0.0073  368 GLN A CA  
2505 C C   . GLN A 390 ? 0.2418 0.8139 0.6355 0.0134  0.0282  0.0099  368 GLN A C   
2506 O O   . GLN A 390 ? 0.2338 0.8166 0.6229 0.0040  0.0157  0.0072  368 GLN A O   
2507 C CB  . GLN A 390 ? 0.2657 0.8725 0.6841 -0.0158 0.0491  -0.0015 368 GLN A CB  
2508 C CG  . GLN A 390 ? 0.2810 0.9402 0.7266 -0.0158 0.0606  -0.0027 368 GLN A CG  
2509 C CD  . GLN A 390 ? 0.3082 0.9352 0.7428 -0.0404 0.0748  -0.0090 368 GLN A CD  
2510 O OE1 . GLN A 390 ? 0.3283 0.9554 0.7604 -0.0725 0.0745  -0.0171 368 GLN A OE1 
2511 N NE2 . GLN A 390 ? 0.3314 0.9292 0.7576 -0.0254 0.0876  -0.0052 368 GLN A NE2 
2512 N N   . ARG A 391 ? 0.2439 0.7570 0.6170 0.0259  0.0362  0.0140  369 ARG A N   
2513 C CA  . ARG A 391 ? 0.2418 0.7044 0.5885 0.0332  0.0301  0.0178  369 ARG A CA  
2514 C C   . ARG A 391 ? 0.2389 0.6380 0.5613 0.0243  0.0390  0.0138  369 ARG A C   
2515 O O   . ARG A 391 ? 0.2236 0.6079 0.5455 0.0294  0.0514  0.0145  369 ARG A O   
2516 C CB  . ARG A 391 ? 0.2626 0.7251 0.6097 0.0662  0.0288  0.0310  369 ARG A CB  
2517 C CG  . ARG A 391 ? 0.2673 0.6748 0.5860 0.0753  0.0255  0.0364  369 ARG A CG  
2518 C CD  . ARG A 391 ? 0.3031 0.7129 0.6238 0.1072  0.0251  0.0506  369 ARG A CD  
2519 N NE  . ARG A 391 ? 0.3148 0.7779 0.6508 0.1160  0.0120  0.0586  369 ARG A NE  
2520 C CZ  . ARG A 391 ? 0.3280 0.8123 0.6743 0.1451  0.0100  0.0729  369 ARG A CZ  
2521 N NH1 . ARG A 391 ? 0.3458 0.8009 0.6900 0.1690  0.0219  0.0793  369 ARG A NH1 
2522 N NH2 . ARG A 391 ? 0.3413 0.8774 0.6995 0.1506  -0.0037 0.0807  369 ARG A NH2 
2523 N N   . CYS A 392 ? 0.2266 0.5926 0.5295 0.0110  0.0324  0.0092  370 CYS A N   
2524 C CA  . CYS A 392 ? 0.2461 0.5550 0.5253 0.0043  0.0380  0.0067  370 CYS A CA  
2525 C C   . CYS A 392 ? 0.2422 0.5189 0.5013 0.0166  0.0318  0.0112  370 CYS A C   
2526 O O   . CYS A 392 ? 0.2461 0.5358 0.5038 0.0151  0.0210  0.0106  370 CYS A O   
2527 C CB  . CYS A 392 ? 0.2558 0.5527 0.5300 -0.0228 0.0370  -0.0034 370 CYS A CB  
2528 S SG  . CYS A 392 ? 0.3025 0.5337 0.5488 -0.0290 0.0426  -0.0046 370 CYS A SG  
2529 N N   . VAL A 393 ? 0.2470 0.4838 0.4895 0.0265  0.0389  0.0148  371 VAL A N   
2530 C CA  . VAL A 393 ? 0.2514 0.4553 0.4730 0.0345  0.0347  0.0182  371 VAL A CA  
2531 C C   . VAL A 393 ? 0.2554 0.4205 0.4580 0.0215  0.0365  0.0125  371 VAL A C   
2532 O O   . VAL A 393 ? 0.2548 0.4052 0.4545 0.0156  0.0450  0.0105  371 VAL A O   
2533 C CB  . VAL A 393 ? 0.2660 0.4538 0.4819 0.0555  0.0417  0.0264  371 VAL A CB  
2534 C CG1 . VAL A 393 ? 0.2693 0.4182 0.4608 0.0592  0.0397  0.0290  371 VAL A CG1 
2535 C CG2 . VAL A 393 ? 0.2807 0.5056 0.5149 0.0727  0.0385  0.0344  371 VAL A CG2 
2536 N N   . VAL A 394 ? 0.2500 0.4017 0.4399 0.0178  0.0286  0.0103  372 VAL A N   
2537 C CA  . VAL A 394 ? 0.2589 0.3766 0.4314 0.0096  0.0295  0.0059  372 VAL A CA  
2538 C C   . VAL A 394 ? 0.2599 0.3543 0.4141 0.0186  0.0287  0.0097  372 VAL A C   
2539 O O   . VAL A 394 ? 0.2667 0.3695 0.4191 0.0265  0.0238  0.0142  372 VAL A O   
2540 C CB  . VAL A 394 ? 0.2598 0.3798 0.4324 -0.0040 0.0226  -0.0026 372 VAL A CB  
2541 C CG1 . VAL A 394 ? 0.2841 0.4196 0.4713 -0.0173 0.0250  -0.0076 372 VAL A CG1 
2542 C CG2 . VAL A 394 ? 0.2622 0.4024 0.4356 -0.0019 0.0129  -0.0038 372 VAL A CG2 
2543 N N   . ILE A 395 ? 0.2706 0.3369 0.4103 0.0163  0.0336  0.0086  373 ILE A N   
2544 C CA  . ILE A 395 ? 0.2662 0.3120 0.3877 0.0204  0.0330  0.0103  373 ILE A CA  
2545 C C   . ILE A 395 ? 0.2658 0.3078 0.3800 0.0129  0.0259  0.0047  373 ILE A C   
2546 O O   . ILE A 395 ? 0.2713 0.3063 0.3855 0.0061  0.0261  0.0002  373 ILE A O   
2547 C CB  . ILE A 395 ? 0.2845 0.3069 0.3933 0.0209  0.0419  0.0109  373 ILE A CB  
2548 C CG1 . ILE A 395 ? 0.2918 0.3181 0.4085 0.0286  0.0509  0.0141  373 ILE A CG1 
2549 C CG2 . ILE A 395 ? 0.2864 0.2898 0.3761 0.0218  0.0417  0.0114  373 ILE A CG2 
2550 C CD1 . ILE A 395 ? 0.2910 0.3211 0.4106 0.0418  0.0515  0.0198  373 ILE A CD1 
2551 N N   . LEU A 396 ? 0.2660 0.3123 0.3736 0.0150  0.0203  0.0055  374 LEU A N   
2552 C CA  . LEU A 396 ? 0.2716 0.3171 0.3714 0.0095  0.0146  -0.0007 374 LEU A CA  
2553 C C   . LEU A 396 ? 0.2630 0.2919 0.3453 0.0101  0.0169  0.0011  374 LEU A C   
2554 O O   . LEU A 396 ? 0.2808 0.3082 0.3549 0.0127  0.0168  0.0061  374 LEU A O   
2555 C CB  . LEU A 396 ? 0.2629 0.3308 0.3669 0.0084  0.0069  -0.0024 374 LEU A CB  
2556 C CG  . LEU A 396 ? 0.2689 0.3604 0.3903 0.0058  0.0038  -0.0047 374 LEU A CG  
2557 C CD1 . LEU A 396 ? 0.2669 0.3817 0.3885 0.0018  -0.0046 -0.0093 374 LEU A CD1 
2558 C CD2 . LEU A 396 ? 0.2597 0.3444 0.3895 -0.0019 0.0068  -0.0117 374 LEU A CD2 
2559 N N   . PRO A 397 ? 0.2746 0.2913 0.3504 0.0069  0.0193  -0.0024 375 PRO A N   
2560 C CA  . PRO A 397 ? 0.2778 0.2815 0.3378 0.0055  0.0230  -0.0008 375 PRO A CA  
2561 C C   . PRO A 397 ? 0.2789 0.2877 0.3281 0.0018  0.0195  -0.0032 375 PRO A C   
2562 O O   . PRO A 397 ? 0.2949 0.2945 0.3312 -0.0007 0.0230  -0.0001 375 PRO A O   
2563 C CB  . PRO A 397 ? 0.2882 0.2846 0.3463 0.0035  0.0254  -0.0030 375 PRO A CB  
2564 C CG  . PRO A 397 ? 0.2779 0.2760 0.3497 0.0047  0.0264  -0.0022 375 PRO A CG  
2565 C CD  . PRO A 397 ? 0.2619 0.2744 0.3443 0.0047  0.0204  -0.0054 375 PRO A CD  
2566 N N   . ASP A 398 ? 0.2682 0.2903 0.3214 0.0005  0.0139  -0.0094 376 ASP A N   
2567 C CA  . ASP A 398 ? 0.2744 0.3059 0.3179 -0.0037 0.0117  -0.0126 376 ASP A CA  
2568 C C   . ASP A 398 ? 0.2904 0.3403 0.3392 -0.0039 0.0060  -0.0182 376 ASP A C   
2569 O O   . ASP A 398 ? 0.2630 0.3188 0.3224 -0.0020 0.0032  -0.0197 376 ASP A O   
2570 C CB  . ASP A 398 ? 0.2715 0.3037 0.3084 -0.0062 0.0128  -0.0165 376 ASP A CB  
2571 C CG  . ASP A 398 ? 0.2659 0.3055 0.3124 -0.0013 0.0094  -0.0229 376 ASP A CG  
2572 O OD1 . ASP A 398 ? 0.2808 0.3194 0.3381 0.0021  0.0074  -0.0255 376 ASP A OD1 
2573 O OD2 . ASP A 398 ? 0.2780 0.3241 0.3210 -0.0007 0.0091  -0.0253 376 ASP A OD2 
2574 N N   . SER A 399 ? 0.3003 0.3620 0.3409 -0.0080 0.0047  -0.0222 377 SER A N   
2575 C CA  . SER A 399 ? 0.3190 0.3996 0.3601 -0.0099 0.0006  -0.0272 377 SER A CA  
2576 C C   . SER A 399 ? 0.2975 0.3908 0.3446 -0.0081 -0.0011 -0.0400 377 SER A C   
2577 O O   . SER A 399 ? 0.2888 0.3789 0.3371 -0.0050 0.0005  -0.0427 377 SER A O   
2578 C CB  . SER A 399 ? 0.3360 0.4216 0.3616 -0.0166 0.0017  -0.0213 377 SER A CB  
2579 O OG  . SER A 399 ? 0.3773 0.4652 0.3952 -0.0215 0.0046  -0.0243 377 SER A OG  
2580 N N   . VAL A 400 ? 0.2808 0.3896 0.3310 -0.0092 -0.0043 -0.0477 378 VAL A N   
2581 C CA  . VAL A 400 ? 0.2889 0.4084 0.3445 -0.0064 -0.0048 -0.0620 378 VAL A CA  
2582 C C   . VAL A 400 ? 0.2767 0.4123 0.3259 -0.0069 -0.0030 -0.0661 378 VAL A C   
2583 O O   . VAL A 400 ? 0.2701 0.4124 0.3257 -0.0003 -0.0022 -0.0766 378 VAL A O   
2584 C CB  . VAL A 400 ? 0.3054 0.4399 0.3630 -0.0100 -0.0078 -0.0711 378 VAL A CB  
2585 C CG1 . VAL A 400 ? 0.3014 0.4588 0.3464 -0.0171 -0.0091 -0.0694 378 VAL A CG1 
2586 C CG2 . VAL A 400 ? 0.3274 0.4618 0.3930 -0.0055 -0.0067 -0.0877 378 VAL A CG2 
2587 N N   . ARG A 401 ? 0.2643 0.4054 0.3013 -0.0145 -0.0017 -0.0578 379 ARG A N   
2588 C CA  . ARG A 401 ? 0.2609 0.4213 0.2912 -0.0187 0.0007  -0.0612 379 ARG A CA  
2589 C C   . ARG A 401 ? 0.2494 0.4101 0.2875 -0.0109 0.0017  -0.0648 379 ARG A C   
2590 O O   . ARG A 401 ? 0.2172 0.4016 0.2585 -0.0081 0.0024  -0.0735 379 ARG A O   
2591 C CB  . ARG A 401 ? 0.2894 0.4453 0.3035 -0.0305 0.0032  -0.0496 379 ARG A CB  
2592 C CG  . ARG A 401 ? 0.3084 0.4865 0.3131 -0.0404 0.0064  -0.0525 379 ARG A CG  
2593 C CD  . ARG A 401 ? 0.3295 0.4909 0.3183 -0.0527 0.0105  -0.0413 379 ARG A CD  
2594 N NE  . ARG A 401 ? 0.3585 0.5031 0.3514 -0.0488 0.0116  -0.0395 379 ARG A NE  
2595 C CZ  . ARG A 401 ? 0.4041 0.5201 0.3888 -0.0523 0.0147  -0.0306 379 ARG A CZ  
2596 N NH1 . ARG A 401 ? 0.4146 0.5110 0.3865 -0.0583 0.0174  -0.0212 379 ARG A NH1 
2597 N NH2 . ARG A 401 ? 0.4204 0.5269 0.4095 -0.0483 0.0154  -0.0312 379 ARG A NH2 
2598 N N   . ASN A 402 ? 0.2284 0.3659 0.2696 -0.0067 0.0017  -0.0577 380 ASN A N   
2599 C CA  . ASN A 402 ? 0.2414 0.3800 0.2879 0.0008  0.0018  -0.0583 380 ASN A CA  
2600 C C   . ASN A 402 ? 0.2432 0.3843 0.3031 0.0155  0.0003  -0.0673 380 ASN A C   
2601 O O   . ASN A 402 ? 0.2392 0.3868 0.3035 0.0241  -0.0003 -0.0672 380 ASN A O   
2602 C CB  . ASN A 402 ? 0.2546 0.3683 0.2988 0.0007  0.0028  -0.0480 380 ASN A CB  
2603 C CG  . ASN A 402 ? 0.2710 0.3814 0.3013 -0.0114 0.0059  -0.0412 380 ASN A CG  
2604 O OD1 . ASN A 402 ? 0.2781 0.4067 0.3005 -0.0200 0.0071  -0.0434 380 ASN A OD1 
2605 N ND2 . ASN A 402 ? 0.2807 0.3672 0.3078 -0.0125 0.0081  -0.0336 380 ASN A ND2 
2606 N N   . TYR A 403 ? 0.2280 0.3638 0.2932 0.0179  -0.0001 -0.0750 381 TYR A N   
2607 C CA  . TYR A 403 ? 0.2552 0.3791 0.3311 0.0304  0.0000  -0.0831 381 TYR A CA  
2608 C C   . TYR A 403 ? 0.2550 0.3947 0.3339 0.0320  0.0010  -0.0988 381 TYR A C   
2609 O O   . TYR A 403 ? 0.2676 0.3919 0.3530 0.0385  0.0022  -0.1081 381 TYR A O   
2610 C CB  . TYR A 403 ? 0.2584 0.3511 0.3372 0.0289  -0.0001 -0.0777 381 TYR A CB  
2611 C CG  . TYR A 403 ? 0.2469 0.3276 0.3211 0.0256  0.0000  -0.0634 381 TYR A CG  
2612 C CD1 . TYR A 403 ? 0.2571 0.3341 0.3312 0.0332  0.0000  -0.0573 381 TYR A CD1 
2613 C CD2 . TYR A 403 ? 0.2576 0.3340 0.3265 0.0156  0.0002  -0.0561 381 TYR A CD2 
2614 C CE1 . TYR A 403 ? 0.2727 0.3414 0.3405 0.0286  0.0008  -0.0459 381 TYR A CE1 
2615 C CE2 . TYR A 403 ? 0.2474 0.3128 0.3113 0.0129  0.0019  -0.0452 381 TYR A CE2 
2616 C CZ  . TYR A 403 ? 0.2615 0.3232 0.3241 0.0182  0.0024  -0.0410 381 TYR A CZ  
2617 O OH  . TYR A 403 ? 0.2963 0.3489 0.3521 0.0141  0.0046  -0.0321 381 TYR A OH  
2618 N N   . MET A 404 ? 0.2474 0.4171 0.3201 0.0251  0.0015  -0.1026 382 MET A N   
2619 C CA  . MET A 404 ? 0.2572 0.4470 0.3296 0.0235  0.0031  -0.1177 382 MET A CA  
2620 C C   . MET A 404 ? 0.2636 0.4534 0.3470 0.0396  0.0059  -0.1324 382 MET A C   
2621 O O   . MET A 404 ? 0.2679 0.4557 0.3527 0.0401  0.0079  -0.1467 382 MET A O   
2622 C CB  . MET A 404 ? 0.2572 0.4823 0.3205 0.0135  0.0043  -0.1181 382 MET A CB  
2623 C CG  . MET A 404 ? 0.2652 0.4872 0.3148 -0.0023 0.0027  -0.1040 382 MET A CG  
2624 S SD  . MET A 404 ? 0.2983 0.5107 0.3425 -0.0101 -0.0002 -0.1031 382 MET A SD  
2625 C CE  . MET A 404 ? 0.3055 0.5548 0.3433 -0.0157 0.0018  -0.1186 382 MET A CE  
2626 N N   . THR A 405 ? 0.2582 0.4511 0.3486 0.0530  0.0063  -0.1290 383 THR A N   
2627 C CA  . THR A 405 ? 0.2786 0.4704 0.3801 0.0726  0.0093  -0.1409 383 THR A CA  
2628 C C   . THR A 405 ? 0.2949 0.4461 0.4017 0.0849  0.0085  -0.1331 383 THR A C   
2629 O O   . THR A 405 ? 0.2859 0.4291 0.4010 0.1039  0.0108  -0.1383 383 THR A O   
2630 C CB  . THR A 405 ? 0.2820 0.5129 0.3895 0.0830  0.0101  -0.1429 383 THR A CB  
2631 O OG1 . THR A 405 ? 0.2489 0.4845 0.3543 0.0805  0.0063  -0.1264 383 THR A OG1 
2632 C CG2 . THR A 405 ? 0.2814 0.5539 0.3841 0.0714  0.0128  -0.1534 383 THR A CG2 
2633 N N   . LYS A 406 ? 0.2782 0.4037 0.3798 0.0746  0.0060  -0.1202 384 LYS A N   
2634 C CA  . LYS A 406 ? 0.2983 0.3845 0.4028 0.0826  0.0062  -0.1128 384 LYS A CA  
2635 C C   . LYS A 406 ? 0.3085 0.3661 0.4120 0.0729  0.0083  -0.1205 384 LYS A C   
2636 O O   . LYS A 406 ? 0.3099 0.3638 0.4160 0.0761  0.0119  -0.1376 384 LYS A O   
2637 C CB  . LYS A 406 ? 0.2910 0.3737 0.3913 0.0797  0.0030  -0.0937 384 LYS A CB  
2638 C CG  . LYS A 406 ? 0.3028 0.4171 0.4049 0.0892  0.0010  -0.0894 384 LYS A CG  
2639 C CD  . LYS A 406 ? 0.3144 0.4285 0.4106 0.0853  -0.0020 -0.0727 384 LYS A CD  
2640 C CE  . LYS A 406 ? 0.3247 0.4173 0.4233 0.1008  -0.0032 -0.0622 384 LYS A CE  
2641 N NZ  . LYS A 406 ? 0.3049 0.4066 0.3962 0.0965  -0.0062 -0.0475 384 LYS A NZ  
2642 N N   . PHE A 407 ? 0.3051 0.3456 0.4051 0.0604  0.0068  -0.1104 385 PHE A N   
2643 C CA  . PHE A 407 ? 0.3326 0.3490 0.4335 0.0511  0.0087  -0.1178 385 PHE A CA  
2644 C C   . PHE A 407 ? 0.3457 0.3828 0.4446 0.0399  0.0086  -0.1335 385 PHE A C   
2645 O O   . PHE A 407 ? 0.3474 0.3696 0.4472 0.0329  0.0108  -0.1454 385 PHE A O   
2646 C CB  . PHE A 407 ? 0.3320 0.3315 0.4316 0.0405  0.0075  -0.1038 385 PHE A CB  
2647 C CG  . PHE A 407 ? 0.3085 0.3311 0.4049 0.0271  0.0042  -0.0980 385 PHE A CG  
2648 C CD1 . PHE A 407 ? 0.3175 0.3509 0.4141 0.0151  0.0030  -0.1068 385 PHE A CD1 
2649 C CD2 . PHE A 407 ? 0.3145 0.3461 0.4069 0.0269  0.0025  -0.0834 385 PHE A CD2 
2650 C CE1 . PHE A 407 ? 0.3127 0.3661 0.4063 0.0060  -0.0004 -0.0990 385 PHE A CE1 
2651 C CE2 . PHE A 407 ? 0.3038 0.3503 0.3925 0.0169  0.0005  -0.0773 385 PHE A CE2 
2652 C CZ  . PHE A 407 ? 0.2961 0.3535 0.3858 0.0078  -0.0012 -0.0840 385 PHE A CZ  
2653 N N   . LEU A 408 ? 0.3352 0.4071 0.4299 0.0365  0.0063  -0.1333 386 LEU A N   
2654 C CA  . LEU A 408 ? 0.3709 0.4662 0.4612 0.0258  0.0058  -0.1464 386 LEU A CA  
2655 C C   . LEU A 408 ? 0.4087 0.5059 0.5012 0.0336  0.0106  -0.1676 386 LEU A C   
2656 O O   . LEU A 408 ? 0.4242 0.5308 0.5131 0.0242  0.0115  -0.1827 386 LEU A O   
2657 C CB  . LEU A 408 ? 0.3604 0.4892 0.4429 0.0190  0.0027  -0.1382 386 LEU A CB  
2658 C CG  . LEU A 408 ? 0.3870 0.5399 0.4616 0.0053  0.0004  -0.1434 386 LEU A CG  
2659 C CD1 . LEU A 408 ? 0.3896 0.5307 0.4653 -0.0043 -0.0031 -0.1365 386 LEU A CD1 
2660 C CD2 . LEU A 408 ? 0.3788 0.5594 0.4436 -0.0001 -0.0012 -0.1339 386 LEU A CD2 
2661 N N   . SER A 409 ? 0.4045 0.4929 0.5029 0.0516  0.0138  -0.1689 387 SER A N   
2662 C CA  . SER A 409 ? 0.4284 0.5151 0.5306 0.0641  0.0198  -0.1888 387 SER A CA  
2663 C C   . SER A 409 ? 0.4896 0.5290 0.5952 0.0706  0.0247  -0.1974 387 SER A C   
2664 O O   . SER A 409 ? 0.4825 0.4905 0.5916 0.0805  0.0248  -0.1845 387 SER A O   
2665 C CB  . SER A 409 ? 0.4335 0.5406 0.5417 0.0830  0.0207  -0.1851 387 SER A CB  
2666 O OG  . SER A 409 ? 0.4574 0.5482 0.5728 0.1027  0.0268  -0.1988 387 SER A OG  
2667 N N   . ASP A 410 ? 0.5133 0.5469 0.6162 0.0643  0.0295  -0.2197 388 ASP A N   
2668 C CA  . ASP A 410 ? 0.5635 0.5489 0.6672 0.0670  0.0358  -0.2313 388 ASP A CA  
2669 C C   . ASP A 410 ? 0.5801 0.5407 0.6905 0.0946  0.0413  -0.2315 388 ASP A C   
2670 O O   . ASP A 410 ? 0.6149 0.5271 0.7258 0.1010  0.0447  -0.2271 388 ASP A O   
2671 C CB  . ASP A 410 ? 0.6158 0.6040 0.7137 0.0537  0.0408  -0.2591 388 ASP A CB  
2672 C CG  . ASP A 410 ? 0.6176 0.6288 0.7089 0.0265  0.0347  -0.2584 388 ASP A CG  
2673 O OD1 . ASP A 410 ? 0.5845 0.6049 0.6766 0.0184  0.0275  -0.2371 388 ASP A OD1 
2674 O OD2 . ASP A 410 ? 0.6549 0.6775 0.7401 0.0138  0.0373  -0.2799 388 ASP A OD2 
2675 N N   . ARG A 411 ? 0.5640 0.5587 0.6793 0.1110  0.0422  -0.2360 389 ARG A N   
2676 C CA  . ARG A 411 ? 0.5774 0.5581 0.7013 0.1408  0.0464  -0.2348 389 ARG A CA  
2677 C C   . ARG A 411 ? 0.5575 0.5230 0.6843 0.1503  0.0408  -0.2068 389 ARG A C   
2678 O O   . ARG A 411 ? 0.5948 0.5210 0.7242 0.1689  0.0439  -0.2010 389 ARG A O   
2679 C CB  . ARG A 411 ? 0.5648 0.5974 0.6953 0.1547  0.0479  -0.2443 389 ARG A CB  
2680 N N   . TRP A 412 ? 0.5141 0.5092 0.6386 0.1376  0.0328  -0.1894 390 TRP A N   
2681 C CA  . TRP A 412 ? 0.4817 0.4661 0.6067 0.1434  0.0276  -0.1642 390 TRP A CA  
2682 C C   . TRP A 412 ? 0.5156 0.4461 0.6355 0.1354  0.0292  -0.1566 390 TRP A C   
2683 O O   . TRP A 412 ? 0.5358 0.4364 0.6561 0.1495  0.0296  -0.1427 390 TRP A O   
2684 C CB  . TRP A 412 ? 0.4344 0.4571 0.5559 0.1274  0.0206  -0.1510 390 TRP A CB  
2685 C CG  . TRP A 412 ? 0.4085 0.4276 0.5290 0.1317  0.0157  -0.1279 390 TRP A CG  
2686 C CD1 . TRP A 412 ? 0.3983 0.4430 0.5233 0.1476  0.0126  -0.1181 390 TRP A CD1 
2687 C CD2 . TRP A 412 ? 0.3861 0.3786 0.5006 0.1194  0.0135  -0.1125 390 TRP A CD2 
2688 N NE1 . TRP A 412 ? 0.3885 0.4232 0.5088 0.1446  0.0083  -0.0979 390 TRP A NE1 
2689 C CE2 . TRP A 412 ? 0.3781 0.3799 0.4919 0.1280  0.0093  -0.0942 390 TRP A CE2 
2690 C CE3 . TRP A 412 ? 0.3827 0.3486 0.4927 0.1014  0.0148  -0.1130 390 TRP A CE3 
2691 C CZ2 . TRP A 412 ? 0.3835 0.3672 0.4909 0.1190  0.0072  -0.0770 390 TRP A CZ2 
2692 C CZ3 . TRP A 412 ? 0.3848 0.3340 0.4906 0.0934  0.0128  -0.0956 390 TRP A CZ3 
2693 C CH2 . TRP A 412 ? 0.3891 0.3459 0.4930 0.1023  0.0095  -0.0779 390 TRP A CH2 
2694 N N   . MET A 413 ? 0.4956 0.4180 0.6103 0.1119  0.0299  -0.1647 391 MET A N   
2695 C CA  . MET A 413 ? 0.5303 0.4078 0.6407 0.0997  0.0322  -0.1600 391 MET A CA  
2696 C C   . MET A 413 ? 0.6094 0.4345 0.7193 0.1137  0.0405  -0.1686 391 MET A C   
2697 O O   . MET A 413 ? 0.6240 0.4080 0.7308 0.1164  0.0422  -0.1545 391 MET A O   
2698 C CB  . MET A 413 ? 0.5144 0.4020 0.6213 0.0730  0.0317  -0.1719 391 MET A CB  
2699 C CG  . MET A 413 ? 0.4674 0.3938 0.5733 0.0586  0.0242  -0.1594 391 MET A CG  
2700 S SD  . MET A 413 ? 0.4542 0.3629 0.5591 0.0501  0.0213  -0.1345 391 MET A SD  
2701 C CE  . MET A 413 ? 0.4783 0.3574 0.5822 0.0291  0.0257  -0.1464 391 MET A CE  
2702 N N   . LEU A 414 ? 0.6568 0.4819 0.7686 0.1223  0.0464  -0.1917 392 LEU A N   
2703 C CA  . LEU A 414 ? 0.7512 0.5235 0.8620 0.1383  0.0559  -0.2027 392 LEU A CA  
2704 C C   . LEU A 414 ? 0.7725 0.5284 0.8873 0.1686  0.0554  -0.1837 392 LEU A C   
2705 O O   . LEU A 414 ? 0.8262 0.5300 0.9363 0.1744  0.0588  -0.1719 392 LEU A O   
2706 C CB  . LEU A 414 ? 0.7924 0.5765 0.9051 0.1446  0.0627  -0.2323 392 LEU A CB  
2707 C CG  . LEU A 414 ? 0.8333 0.6083 0.9384 0.1167  0.0670  -0.2558 392 LEU A CG  
2708 C CD1 . LEU A 414 ? 0.8506 0.6667 0.9565 0.1165  0.0697  -0.2816 392 LEU A CD1 
2709 C CD2 . LEU A 414 ? 0.9071 0.6107 1.0059 0.1158  0.0773  -0.2656 392 LEU A CD2 
2710 N N   . GLN A 415 ? 0.7614 0.5648 0.8846 0.1870  0.0509  -0.1798 393 GLN A N   
2711 C CA  . GLN A 415 ? 0.7783 0.5835 0.9068 0.2155  0.0476  -0.1593 393 GLN A CA  
2712 C C   . GLN A 415 ? 0.7646 0.5448 0.8861 0.2099  0.0426  -0.1311 393 GLN A C   
2713 O O   . GLN A 415 ? 0.7688 0.5173 0.8892 0.2313  0.0435  -0.1155 393 GLN A O   
2714 C CB  . GLN A 415 ? 0.7789 0.6543 0.9163 0.2233  0.0409  -0.1571 393 GLN A CB  
2715 C CG  . GLN A 415 ? 0.8481 0.7387 0.9940 0.2555  0.0377  -0.1416 393 GLN A CG  
2716 C CD  . GLN A 415 ? 0.8496 0.7992 0.9982 0.2507  0.0278  -0.1257 393 GLN A CD  
2717 O OE1 . GLN A 415 ? 0.8549 0.8158 0.9961 0.2250  0.0230  -0.1180 393 GLN A OE1 
2718 N NE2 . GLN A 415 ? 0.8875 0.8756 1.0470 0.2759  0.0251  -0.1215 393 GLN A NE2 
2719 N N   . LYS A 416 ? 0.7007 0.4963 0.8171 0.1824  0.0378  -0.1241 394 LYS A N   
2720 C CA  . LYS A 416 ? 0.7007 0.4774 0.8101 0.1751  0.0341  -0.0993 394 LYS A CA  
2721 C C   . LYS A 416 ? 0.7486 0.4633 0.8494 0.1621  0.0408  -0.0981 394 LYS A C   
2722 O O   . LYS A 416 ? 0.7620 0.4555 0.8558 0.1574  0.0395  -0.0774 394 LYS A O   
2723 C CB  . LYS A 416 ? 0.6492 0.4684 0.7573 0.1530  0.0272  -0.0923 394 LYS A CB  
2724 C CG  . LYS A 416 ? 0.6121 0.4892 0.7260 0.1616  0.0209  -0.0903 394 LYS A CG  
2725 C CD  . LYS A 416 ? 0.6170 0.5017 0.7302 0.1795  0.0160  -0.0684 394 LYS A CD  
2726 C CE  . LYS A 416 ? 0.6019 0.5407 0.7234 0.1944  0.0116  -0.0708 394 LYS A CE  
2727 N NZ  . LYS A 416 ? 0.5999 0.5580 0.7184 0.2017  0.0049  -0.0487 394 LYS A NZ  
2728 N N   . GLY A 417 ? 0.7736 0.4616 0.8736 0.1538  0.0484  -0.1210 395 GLY A N   
2729 C CA  . GLY A 417 ? 0.8200 0.4501 0.9113 0.1371  0.0559  -0.1235 395 GLY A CA  
2730 C C   . GLY A 417 ? 0.8221 0.4635 0.9107 0.1030  0.0540  -0.1235 395 GLY A C   
2731 O O   . GLY A 417 ? 0.8805 0.4802 0.9623 0.0864  0.0594  -0.1210 395 GLY A O   
2732 N N   . PHE A 418 ? 0.7673 0.4649 0.8612 0.0924  0.0468  -0.1257 396 PHE A N   
2733 C CA  . PHE A 418 ? 0.7381 0.4530 0.8315 0.0634  0.0443  -0.1249 396 PHE A CA  
2734 C C   . PHE A 418 ? 0.7808 0.4985 0.8748 0.0444  0.0477  -0.1508 396 PHE A C   
2735 O O   . PHE A 418 ? 0.7763 0.5107 0.8713 0.0202  0.0459  -0.1532 396 PHE A O   
2736 C CB  . PHE A 418 ? 0.6440 0.4141 0.7414 0.0617  0.0356  -0.1149 396 PHE A CB  
2737 C CG  . PHE A 418 ? 0.6258 0.4006 0.7216 0.0763  0.0317  -0.0914 396 PHE A CG  
2738 C CD1 . PHE A 418 ? 0.6344 0.3725 0.7240 0.0767  0.0344  -0.0740 396 PHE A CD1 
2739 C CD2 . PHE A 418 ? 0.5727 0.3901 0.6715 0.0878  0.0257  -0.0868 396 PHE A CD2 
2740 C CE1 . PHE A 418 ? 0.6295 0.3755 0.7157 0.0894  0.0304  -0.0527 396 PHE A CE1 
2741 C CE2 . PHE A 418 ? 0.5588 0.3841 0.6550 0.0990  0.0219  -0.0669 396 PHE A CE2 
2742 C CZ  . PHE A 418 ? 0.6005 0.3914 0.6902 0.1004  0.0239  -0.0499 396 PHE A CZ  
2743 N N   . LEU A 419 ? 0.8164 0.5238 0.9105 0.0564  0.0524  -0.1702 397 LEU A N   
2744 C CA  . LEU A 419 ? 0.9073 0.6147 0.9997 0.0400  0.0568  -0.1975 397 LEU A CA  
2745 C C   . LEU A 419 ? 1.0052 0.6544 1.0928 0.0526  0.0675  -0.2107 397 LEU A C   
2746 O O   . LEU A 419 ? 1.0208 0.6585 1.1104 0.0818  0.0693  -0.2059 397 LEU A O   
2747 C CB  . LEU A 419 ? 0.9157 0.6780 1.0120 0.0443  0.0521  -0.2102 397 LEU A CB  
2748 C CG  . LEU A 419 ? 0.9621 0.7483 1.0560 0.0216  0.0525  -0.2343 397 LEU A CG  
2749 C CD1 . LEU A 419 ? 0.9475 0.7433 1.0411 -0.0064 0.0485  -0.2281 397 LEU A CD1 
2750 C CD2 . LEU A 419 ? 0.9416 0.7847 1.0376 0.0279  0.0470  -0.2395 397 LEU A CD2 
2751 N N   . LYS A 420 ? 1.0806 0.6932 1.1617 0.0309  0.0750  -0.2270 398 LYS A N   
2752 C CA  . LYS A 420 ? 1.1803 0.7285 1.2542 0.0395  0.0872  -0.2417 398 LYS A CA  
2753 C C   . LYS A 420 ? 1.2175 0.7703 1.2881 0.0252  0.0932  -0.2775 398 LYS A C   
2754 O O   . LYS A 420 ? 1.1807 0.7637 1.2503 -0.0045 0.0901  -0.2892 398 LYS A O   
2755 C CB  . LYS A 420 ? 1.2252 0.7136 1.2907 0.0240  0.0935  -0.2304 398 LYS A CB  
2756 C CG  . LYS A 420 ? 1.2475 0.7016 1.3109 0.0485  0.0934  -0.2002 398 LYS A CG  
2757 C CD  . LYS A 420 ? 1.3023 0.6920 1.3543 0.0313  0.1016  -0.1905 398 LYS A CD  
2758 C CE  . LYS A 420 ? 1.2993 0.6799 1.3492 0.0444  0.0973  -0.1544 398 LYS A CE  
2759 N NZ  . LYS A 420 ? 1.3026 0.6779 1.3545 0.0856  0.0950  -0.1411 398 LYS A NZ  
2760 N N   . GLU A 421 ? 1.2736 0.7991 1.3422 0.0471  0.1019  -0.2951 399 GLU A N   
2761 C CA  . GLU A 421 ? 1.3365 0.8666 1.4005 0.0359  0.1090  -0.3316 399 GLU A CA  
2762 C C   . GLU A 421 ? 1.4040 0.9120 1.4584 -0.0038 0.1138  -0.3498 399 GLU A C   
2763 O O   . GLU A 421 ? 1.4350 0.9672 1.4852 -0.0224 0.1158  -0.3783 399 GLU A O   
2764 C CB  . GLU A 421 ? 1.3588 0.8424 1.4206 0.0657  0.1213  -0.3477 399 GLU A CB  
2765 N N   . GLU A 422 ? 1.4811 0.9464 1.5314 -0.0180 0.1158  -0.3335 400 GLU A N   
2766 C CA  . GLU A 422 ? 1.5513 0.9950 1.5931 -0.0577 0.1212  -0.3502 400 GLU A CA  
2767 C C   . GLU A 422 ? 1.5846 1.1025 1.6314 -0.0872 0.1104  -0.3564 400 GLU A C   
2768 O O   . GLU A 422 ? 1.6367 1.1698 1.6780 -0.1098 0.1133  -0.3859 400 GLU A O   
2769 C CB  . GLU A 422 ? 1.5422 0.9321 1.5794 -0.0674 0.1251  -0.3274 400 GLU A CB  
2770 C CG  . GLU A 422 ? 1.5516 0.9060 1.5785 -0.1082 0.1340  -0.3460 400 GLU A CG  
2771 C CD  . GLU A 422 ? 1.5219 0.8486 1.5467 -0.1253 0.1348  -0.3205 400 GLU A CD  
2772 O OE1 . GLU A 422 ? 1.4252 0.7544 1.4548 -0.1038 0.1291  -0.2880 400 GLU A OE1 
2773 O OE2 . GLU A 422 ? 1.5348 0.8391 1.5524 -0.1620 0.1417  -0.3340 400 GLU A OE2 
2823 N N   . TRP A 430 ? 0.6363 0.6076 0.6489 -0.0558 0.1231  0.0397  408 TRP A N   
2824 C CA  . TRP A 430 ? 0.6283 0.5732 0.6238 -0.0766 0.1238  0.0288  408 TRP A CA  
2825 C C   . TRP A 430 ? 0.6243 0.5308 0.5928 -0.0698 0.1174  0.0180  408 TRP A C   
2826 O O   . TRP A 430 ? 0.6313 0.4978 0.5777 -0.0742 0.1250  0.0123  408 TRP A O   
2827 C CB  . TRP A 430 ? 0.6272 0.6108 0.6410 -0.1056 0.1176  0.0270  408 TRP A CB  
2828 C CG  . TRP A 430 ? 0.6061 0.6216 0.6296 -0.1076 0.1008  0.0255  408 TRP A CG  
2829 C CD1 . TRP A 430 ? 0.5791 0.6480 0.6316 -0.1008 0.0930  0.0380  408 TRP A CD1 
2830 C CD2 . TRP A 430 ? 0.6123 0.6069 0.6152 -0.1148 0.0916  0.0123  408 TRP A CD2 
2831 N NE1 . TRP A 430 ? 0.5633 0.6463 0.6136 -0.1043 0.0783  0.0334  408 TRP A NE1 
2832 C CE2 . TRP A 430 ? 0.5825 0.6202 0.6021 -0.1138 0.0771  0.0168  408 TRP A CE2 
2833 C CE3 . TRP A 430 ? 0.6354 0.5782 0.6073 -0.1206 0.0963  -0.0013 408 TRP A CE3 
2834 C CZ2 . TRP A 430 ? 0.6020 0.6327 0.6068 -0.1206 0.0663  0.0065  408 TRP A CZ2 
2835 C CZ3 . TRP A 430 ? 0.6362 0.5713 0.5947 -0.1258 0.0873  -0.0113 408 TRP A CZ3 
2836 C CH2 . TRP A 430 ? 0.6305 0.6091 0.6045 -0.1269 0.0720  -0.0083 408 TRP A CH2 
2837 N N   . TRP A 431 ? 0.5719 0.4904 0.5428 -0.0577 0.1054  0.0169  409 TRP A N   
2838 C CA  . TRP A 431 ? 0.5647 0.4543 0.5143 -0.0518 0.0994  0.0079  409 TRP A CA  
2839 C C   . TRP A 431 ? 0.5624 0.4213 0.4931 -0.0304 0.1028  0.0101  409 TRP A C   
2840 O O   . TRP A 431 ? 0.5479 0.3857 0.4630 -0.0239 0.0992  0.0054  409 TRP A O   
2841 C CB  . TRP A 431 ? 0.5389 0.4545 0.4976 -0.0504 0.0852  0.0056  409 TRP A CB  
2842 C CG  . TRP A 431 ? 0.5091 0.4531 0.4848 -0.0353 0.0822  0.0154  409 TRP A CG  
2843 C CD1 . TRP A 431 ? 0.4900 0.4768 0.4922 -0.0388 0.0814  0.0253  409 TRP A CD1 
2844 C CD2 . TRP A 431 ? 0.4928 0.4236 0.4593 -0.0146 0.0819  0.0173  409 TRP A CD2 
2845 N NE1 . TRP A 431 ? 0.4818 0.4770 0.4908 -0.0184 0.0834  0.0338  409 TRP A NE1 
2846 C CE2 . TRP A 431 ? 0.4796 0.4387 0.4648 -0.0055 0.0837  0.0274  409 TRP A CE2 
2847 C CE3 . TRP A 431 ? 0.5017 0.4015 0.4456 -0.0038 0.0809  0.0124  409 TRP A CE3 
2848 C CZ2 . TRP A 431 ? 0.4744 0.4229 0.4517 0.0121  0.0866  0.0300  409 TRP A CZ2 
2849 C CZ3 . TRP A 431 ? 0.5017 0.3980 0.4391 0.0107  0.0806  0.0148  409 TRP A CZ3 
2850 C CH2 . TRP A 431 ? 0.4896 0.4060 0.4414 0.0177  0.0844  0.0223  409 TRP A CH2 
2851 N N   . TRP A 432 ? 0.5694 0.4281 0.5008 -0.0204 0.1103  0.0180  410 TRP A N   
2852 C CA  . TRP A 432 ? 0.5821 0.4209 0.4947 -0.0028 0.1110  0.0206  410 TRP A CA  
2853 C C   . TRP A 432 ? 0.6020 0.4088 0.4924 0.0014  0.1130  0.0198  410 TRP A C   
2854 O O   . TRP A 432 ? 0.5792 0.3796 0.4567 0.0132  0.1068  0.0204  410 TRP A O   
2855 C CB  . TRP A 432 ? 0.6011 0.4395 0.5127 0.0032  0.1224  0.0283  410 TRP A CB  
2856 C CG  . TRP A 432 ? 0.6174 0.4428 0.5089 0.0173  0.1222  0.0298  410 TRP A CG  
2857 C CD1 . TRP A 432 ? 0.6435 0.4457 0.5105 0.0229  0.1277  0.0333  410 TRP A CD1 
2858 C CD2 . TRP A 432 ? 0.6145 0.4487 0.5053 0.0249  0.1171  0.0279  410 TRP A CD2 
2859 N NE1 . TRP A 432 ? 0.6403 0.4387 0.4902 0.0306  0.1251  0.0324  410 TRP A NE1 
2860 C CE2 . TRP A 432 ? 0.6309 0.4453 0.4942 0.0318  0.1200  0.0284  410 TRP A CE2 
2861 C CE3 . TRP A 432 ? 0.5900 0.4459 0.4984 0.0257  0.1112  0.0266  410 TRP A CE3 
2862 C CZ2 . TRP A 432 ? 0.6428 0.4545 0.4939 0.0367  0.1184  0.0253  410 TRP A CZ2 
2863 C CZ3 . TRP A 432 ? 0.6081 0.4598 0.5063 0.0343  0.1108  0.0252  410 TRP A CZ3 
2864 C CH2 . TRP A 432 ? 0.6397 0.4673 0.5084 0.0384  0.1150  0.0234  410 TRP A CH2 
2865 N N   . HIS A 433 ? 0.6294 0.4174 0.5156 -0.0080 0.1229  0.0199  411 HIS A N   
2866 C CA  . HIS A 433 ? 0.6871 0.4416 0.5526 -0.0007 0.1294  0.0230  411 HIS A CA  
2867 C C   . HIS A 433 ? 0.6838 0.4220 0.5451 -0.0065 0.1300  0.0159  411 HIS A C   
2868 O O   . HIS A 433 ? 0.7102 0.4178 0.5556 0.0013  0.1393  0.0202  411 HIS A O   
2869 C CB  . HIS A 433 ? 0.7657 0.4983 0.6220 -0.0036 0.1452  0.0300  411 HIS A CB  
2870 C CG  . HIS A 433 ? 0.7850 0.5263 0.6384 0.0042  0.1475  0.0375  411 HIS A CG  
2871 N ND1 . HIS A 433 ? 0.8011 0.5367 0.6364 0.0198  0.1440  0.0443  411 HIS A ND1 
2872 C CD2 . HIS A 433 ? 0.8145 0.5711 0.6797 -0.0021 0.1537  0.0393  411 HIS A CD2 
2873 C CE1 . HIS A 433 ? 0.8128 0.5540 0.6443 0.0213  0.1489  0.0481  411 HIS A CE1 
2874 N NE2 . HIS A 433 ? 0.8171 0.5701 0.6678 0.0100  0.1560  0.0457  411 HIS A NE2 
2875 N N   . LEU A 434 ? 0.6452 0.4024 0.5189 -0.0189 0.1219  0.0065  412 LEU A N   
2876 C CA  . LEU A 434 ? 0.6482 0.3904 0.5142 -0.0229 0.1215  -0.0015 412 LEU A CA  
2877 C C   . LEU A 434 ? 0.6306 0.3712 0.4905 -0.0017 0.1147  0.0027  412 LEU A C   
2878 O O   . LEU A 434 ? 0.6030 0.3630 0.4668 0.0100  0.1055  0.0081  412 LEU A O   
2879 C CB  . LEU A 434 ? 0.6344 0.4032 0.5131 -0.0405 0.1116  -0.0114 412 LEU A CB  
2880 C CG  . LEU A 434 ? 0.6532 0.4361 0.5416 -0.0653 0.1153  -0.0145 412 LEU A CG  
2881 C CD1 . LEU A 434 ? 0.6458 0.4557 0.5423 -0.0835 0.1043  -0.0232 412 LEU A CD1 
2882 C CD2 . LEU A 434 ? 0.7030 0.4453 0.5736 -0.0781 0.1337  -0.0173 412 LEU A CD2 
2883 N N   . ARG A 435 ? 0.6523 0.3693 0.5013 0.0020  0.1209  0.0002  413 ARG A N   
2884 C CA  . ARG A 435 ? 0.6474 0.3687 0.4942 0.0213  0.1150  0.0056  413 ARG A CA  
2885 C C   . ARG A 435 ? 0.6047 0.3449 0.4589 0.0165  0.1037  -0.0040 413 ARG A C   
2886 O O   . ARG A 435 ? 0.5785 0.3192 0.4342 -0.0013 0.1036  -0.0148 413 ARG A O   
2887 C CB  . ARG A 435 ? 0.6996 0.3855 0.5322 0.0340  0.1315  0.0130  413 ARG A CB  
2888 C CG  . ARG A 435 ? 0.7533 0.4231 0.5775 0.0425  0.1418  0.0261  413 ARG A CG  
2889 C CD  . ARG A 435 ? 0.8244 0.4618 0.6358 0.0607  0.1588  0.0384  413 ARG A CD  
2890 N NE  . ARG A 435 ? 0.8860 0.5168 0.6900 0.0723  0.1649  0.0547  413 ARG A NE  
2891 C CZ  . ARG A 435 ? 0.9698 0.5774 0.7634 0.0925  0.1797  0.0718  413 ARG A CZ  
2892 N NH1 . ARG A 435 ? 1.0011 0.5869 0.7913 0.1046  0.1926  0.0748  413 ARG A NH1 
2893 N NH2 . ARG A 435 ? 1.0150 0.6206 0.8008 0.1018  0.1834  0.0874  413 ARG A NH2 
2894 N N   . VAL A 436 ? 0.5836 0.3409 0.4411 0.0310  0.0940  0.0008  414 VAL A N   
2895 C CA  . VAL A 436 ? 0.5754 0.3500 0.4389 0.0290  0.0839  -0.0065 414 VAL A CA  
2896 C C   . VAL A 436 ? 0.5858 0.3365 0.4409 0.0216  0.0943  -0.0153 414 VAL A C   
2897 O O   . VAL A 436 ? 0.5787 0.3387 0.4356 0.0083  0.0886  -0.0257 414 VAL A O   
2898 C CB  . VAL A 436 ? 0.5771 0.3693 0.4428 0.0455  0.0757  0.0018  414 VAL A CB  
2899 C CG1 . VAL A 436 ? 0.5890 0.3921 0.4588 0.0454  0.0699  -0.0044 414 VAL A CG1 
2900 C CG2 . VAL A 436 ? 0.5667 0.3807 0.4352 0.0458  0.0651  0.0054  414 VAL A CG2 
2901 N N   . GLN A 437 ? 0.6085 0.3262 0.4518 0.0303  0.1112  -0.0104 415 GLN A N   
2902 C CA  . GLN A 437 ? 0.6516 0.3352 0.4804 0.0235  0.1271  -0.0192 415 GLN A CA  
2903 C C   . GLN A 437 ? 0.6671 0.3418 0.4880 -0.0062 0.1287  -0.0351 415 GLN A C   
2904 O O   . GLN A 437 ? 0.6827 0.3431 0.4915 -0.0188 0.1339  -0.0470 415 GLN A O   
2905 C CB  . GLN A 437 ? 0.7019 0.3445 0.5173 0.0379  0.1498  -0.0091 415 GLN A CB  
2906 C CG  . GLN A 437 ? 0.7457 0.3439 0.5415 0.0342  0.1716  -0.0176 415 GLN A CG  
2907 C CD  . GLN A 437 ? 0.7959 0.3547 0.5808 0.0571  0.1964  -0.0027 415 GLN A CD  
2908 O OE1 . GLN A 437 ? 0.7992 0.3783 0.5965 0.0829  0.1925  0.0168  415 GLN A OE1 
2909 N NE2 . GLN A 437 ? 0.8348 0.3374 0.5950 0.0473  0.2228  -0.0106 415 GLN A NE2 
2910 N N   . GLU A 438 ? 0.6437 0.3292 0.4707 -0.0184 0.1248  -0.0345 416 GLU A N   
2911 C CA  . GLU A 438 ? 0.6594 0.3469 0.4827 -0.0482 0.1247  -0.0465 416 GLU A CA  
2912 C C   . GLU A 438 ? 0.6246 0.3541 0.4603 -0.0605 0.1054  -0.0528 416 GLU A C   
2913 O O   . GLU A 438 ? 0.6242 0.3623 0.4564 -0.0864 0.1033  -0.0619 416 GLU A O   
2914 C CB  . GLU A 438 ? 0.6642 0.3554 0.4939 -0.0559 0.1276  -0.0412 416 GLU A CB  
2915 C CG  . GLU A 438 ? 0.7057 0.3500 0.5187 -0.0481 0.1494  -0.0355 416 GLU A CG  
2916 C CD  . GLU A 438 ? 0.7138 0.3606 0.5318 -0.0575 0.1535  -0.0306 416 GLU A CD  
2917 O OE1 . GLU A 438 ? 0.7433 0.3855 0.5568 -0.0855 0.1590  -0.0397 416 GLU A OE1 
2918 O OE2 . GLU A 438 ? 0.6966 0.3504 0.5214 -0.0383 0.1519  -0.0176 416 GLU A OE2 
2919 N N   . LEU A 439 ? 0.5995 0.3560 0.4484 -0.0431 0.0918  -0.0471 417 LEU A N   
2920 C CA  . LEU A 439 ? 0.5983 0.3886 0.4560 -0.0515 0.0764  -0.0514 417 LEU A CA  
2921 C C   . LEU A 439 ? 0.6201 0.3938 0.4594 -0.0653 0.0808  -0.0639 417 LEU A C   
2922 O O   . LEU A 439 ? 0.6495 0.4480 0.4905 -0.0810 0.0702  -0.0690 417 LEU A O   
2923 C CB  . LEU A 439 ? 0.5600 0.3735 0.4305 -0.0307 0.0646  -0.0437 417 LEU A CB  
2924 C CG  . LEU A 439 ? 0.5498 0.3815 0.4345 -0.0201 0.0595  -0.0334 417 LEU A CG  
2925 C CD1 . LEU A 439 ? 0.5206 0.3644 0.4094 -0.0031 0.0515  -0.0283 417 LEU A CD1 
2926 C CD2 . LEU A 439 ? 0.5449 0.4056 0.4439 -0.0330 0.0532  -0.0317 417 LEU A CD2 
2927 N N   . GLY A 440 ? 0.6577 0.3897 0.4785 -0.0585 0.0976  -0.0675 418 GLY A N   
2928 C CA  . GLY A 440 ? 0.7090 0.4174 0.5075 -0.0713 0.1063  -0.0804 418 GLY A CA  
2929 C C   . GLY A 440 ? 0.7027 0.4316 0.5083 -0.0570 0.0962  -0.0785 418 GLY A C   
2930 O O   . GLY A 440 ? 0.7087 0.4570 0.5112 -0.0710 0.0862  -0.0853 418 GLY A O   
2931 N N   . LEU A 441 ? 0.7052 0.4312 0.5197 -0.0300 0.0994  -0.0681 419 LEU A N   
2932 C CA  . LEU A 441 ? 0.6975 0.4483 0.5234 -0.0152 0.0889  -0.0636 419 LEU A CA  
2933 C C   . LEU A 441 ? 0.7375 0.4715 0.5473 -0.0181 0.0977  -0.0725 419 LEU A C   
2934 O O   . LEU A 441 ? 0.7889 0.4828 0.5794 -0.0189 0.1181  -0.0778 419 LEU A O   
2935 C CB  . LEU A 441 ? 0.6892 0.4434 0.5274 0.0111  0.0911  -0.0491 419 LEU A CB  
2936 C CG  . LEU A 441 ? 0.6814 0.4499 0.5318 0.0161  0.0838  -0.0395 419 LEU A CG  
2937 C CD1 . LEU A 441 ? 0.6796 0.4474 0.5353 0.0392  0.0886  -0.0251 419 LEU A CD1 
2938 C CD2 . LEU A 441 ? 0.6495 0.4548 0.5136 0.0113  0.0647  -0.0389 419 LEU A CD2 
2939 N N   . SER A 442 ? 0.7642 0.5259 0.5804 -0.0189 0.0846  -0.0738 420 SER A N   
2940 C CA  . SER A 442 ? 0.8263 0.5750 0.6287 -0.0183 0.0931  -0.0804 420 SER A CA  
2941 C C   . SER A 442 ? 0.7555 0.5119 0.5721 0.0079  0.0967  -0.0691 420 SER A C   
2942 O O   . SER A 442 ? 0.7223 0.5108 0.5589 0.0177  0.0823  -0.0596 420 SER A O   
2943 C CB  . SER A 442 ? 0.8579 0.6338 0.6583 -0.0338 0.0774  -0.0865 420 SER A CB  
2944 O OG  . SER A 442 ? 0.9299 0.7006 0.7132 -0.0608 0.0760  -0.0971 420 SER A OG  
2945 N N   . ALA A 443 ? 0.7428 0.4701 0.5482 0.0183  0.1172  -0.0696 421 ALA A N   
2946 C CA  . ALA A 443 ? 0.7361 0.4774 0.5566 0.0421  0.1216  -0.0577 421 ALA A CA  
2947 C C   . ALA A 443 ? 0.6939 0.4713 0.5241 0.0379  0.1044  -0.0591 421 ALA A C   
2948 O O   . ALA A 443 ? 0.6861 0.4580 0.5009 0.0224  0.1036  -0.0709 421 ALA A O   
2949 C CB  . ALA A 443 ? 0.7835 0.4854 0.5875 0.0521  0.1499  -0.0594 421 ALA A CB  
2950 N N   . PRO A 444 ? 0.6376 0.4508 0.4904 0.0493  0.0910  -0.0472 422 PRO A N   
2951 C CA  . PRO A 444 ? 0.6210 0.4621 0.4800 0.0438  0.0775  -0.0489 422 PRO A CA  
2952 C C   . PRO A 444 ? 0.6212 0.4661 0.4828 0.0544  0.0885  -0.0461 422 PRO A C   
2953 O O   . PRO A 444 ? 0.6246 0.4662 0.4942 0.0724  0.1024  -0.0360 422 PRO A O   
2954 C CB  . PRO A 444 ? 0.5864 0.4580 0.4634 0.0481  0.0616  -0.0391 422 PRO A CB  
2955 C CG  . PRO A 444 ? 0.6033 0.4727 0.4887 0.0642  0.0699  -0.0272 422 PRO A CG  
2956 C CD  . PRO A 444 ? 0.6356 0.4651 0.5056 0.0643  0.0874  -0.0325 422 PRO A CD  
2957 N N   . LEU A 445 ? 0.6064 0.4590 0.4615 0.0444  0.0834  -0.0532 423 LEU A N   
2958 C CA  . LEU A 445 ? 0.6144 0.4812 0.4764 0.0528  0.0895  -0.0491 423 LEU A CA  
2959 C C   . LEU A 445 ? 0.5608 0.4664 0.4475 0.0606  0.0772  -0.0362 423 LEU A C   
2960 O O   . LEU A 445 ? 0.5476 0.4669 0.4374 0.0517  0.0609  -0.0365 423 LEU A O   
2961 C CB  . LEU A 445 ? 0.6172 0.4852 0.4650 0.0372  0.0836  -0.0593 423 LEU A CB  
2962 C CG  . LEU A 445 ? 0.6357 0.5226 0.4905 0.0417  0.0863  -0.0558 423 LEU A CG  
2963 C CD1 . LEU A 445 ? 0.6805 0.5463 0.5273 0.0521  0.1103  -0.0569 423 LEU A CD1 
2964 C CD2 . LEU A 445 ? 0.6501 0.5430 0.4926 0.0259  0.0751  -0.0627 423 LEU A CD2 
2965 N N   . THR A 446 ? 0.5314 0.4555 0.4345 0.0761  0.0858  -0.0242 424 THR A N   
2966 C CA  . THR A 446 ? 0.4964 0.4628 0.4202 0.0778  0.0730  -0.0129 424 THR A CA  
2967 C C   . THR A 446 ? 0.4991 0.4861 0.4305 0.0780  0.0773  -0.0109 424 THR A C   
2968 O O   . THR A 446 ? 0.5098 0.4792 0.4340 0.0837  0.0936  -0.0144 424 THR A O   
2969 C CB  . THR A 446 ? 0.4955 0.4818 0.4372 0.0941  0.0753  0.0042  424 THR A CB  
2970 O OG1 . THR A 446 ? 0.5392 0.5273 0.4909 0.1134  0.0948  0.0146  424 THR A OG1 
2971 C CG2 . THR A 446 ? 0.4988 0.4599 0.4314 0.0956  0.0751  0.0029  424 THR A CG2 
2972 N N   . VAL A 447 ? 0.4756 0.4969 0.4185 0.0697  0.0641  -0.0064 425 VAL A N   
2973 C CA  . VAL A 447 ? 0.4781 0.5232 0.4298 0.0672  0.0674  -0.0037 425 VAL A CA  
2974 C C   . VAL A 447 ? 0.4623 0.5570 0.4382 0.0688  0.0602  0.0117  425 VAL A C   
2975 O O   . VAL A 447 ? 0.4519 0.5595 0.4305 0.0641  0.0476  0.0158  425 VAL A O   
2976 C CB  . VAL A 447 ? 0.4786 0.5149 0.4147 0.0482  0.0584  -0.0157 425 VAL A CB  
2977 C CG1 . VAL A 447 ? 0.4903 0.4870 0.4027 0.0442  0.0624  -0.0287 425 VAL A CG1 
2978 C CG2 . VAL A 447 ? 0.4624 0.5089 0.3970 0.0344  0.0416  -0.0163 425 VAL A CG2 
2979 N N   . LEU A 448 ? 0.4578 0.5827 0.4505 0.0733  0.0679  0.0203  426 LEU A N   
2980 C CA  . LEU A 448 ? 0.4612 0.6431 0.4792 0.0718  0.0605  0.0366  426 LEU A CA  
2981 C C   . LEU A 448 ? 0.4530 0.6498 0.4635 0.0444  0.0444  0.0290  426 LEU A C   
2982 O O   . LEU A 448 ? 0.4366 0.6040 0.4278 0.0319  0.0441  0.0146  426 LEU A O   
2983 C CB  . LEU A 448 ? 0.4798 0.6924 0.5212 0.0869  0.0767  0.0502  426 LEU A CB  
2984 C CG  . LEU A 448 ? 0.5057 0.7053 0.5564 0.1172  0.0985  0.0617  426 LEU A CG  
2985 C CD1 . LEU A 448 ? 0.5195 0.7389 0.5881 0.1315  0.1191  0.0718  426 LEU A CD1 
2986 C CD2 . LEU A 448 ? 0.5133 0.7434 0.5828 0.1313  0.0935  0.0814  426 LEU A CD2 
2987 N N   . PRO A 449 ? 0.4618 0.7042 0.4854 0.0339  0.0320  0.0395  427 PRO A N   
2988 C CA  . PRO A 449 ? 0.4556 0.7038 0.4656 0.0046  0.0195  0.0303  427 PRO A CA  
2989 C C   . PRO A 449 ? 0.4581 0.7236 0.4733 -0.0077 0.0246  0.0287  427 PRO A C   
2990 O O   . PRO A 449 ? 0.4595 0.7164 0.4581 -0.0320 0.0190  0.0187  427 PRO A O   
2991 C CB  . PRO A 449 ? 0.4668 0.7601 0.4863 -0.0050 0.0058  0.0421  427 PRO A CB  
2992 C CG  . PRO A 449 ? 0.4685 0.7994 0.5175 0.0213  0.0118  0.0636  427 PRO A CG  
2993 C CD  . PRO A 449 ? 0.4644 0.7525 0.5121 0.0474  0.0295  0.0604  427 PRO A CD  
2994 N N   . THR A 450 ? 0.4560 0.7419 0.4923 0.0092  0.0378  0.0387  428 THR A N   
2995 C CA  . THR A 450 ? 0.4575 0.7565 0.4983 -0.0006 0.0452  0.0372  428 THR A CA  
2996 C C   . THR A 450 ? 0.4598 0.7034 0.4760 0.0010  0.0552  0.0213  428 THR A C   
2997 O O   . THR A 450 ? 0.4625 0.7099 0.4785 -0.0056 0.0631  0.0193  428 THR A O   
2998 C CB  . THR A 450 ? 0.4785 0.8262 0.5539 0.0182  0.0575  0.0565  428 THR A CB  
2999 O OG1 . THR A 450 ? 0.4992 0.8178 0.5757 0.0481  0.0725  0.0594  428 THR A OG1 
3000 C CG2 . THR A 450 ? 0.4758 0.8924 0.5787 0.0138  0.0455  0.0761  428 THR A CG2 
3001 N N   . ILE A 451 ? 0.4554 0.6515 0.4511 0.0091  0.0548  0.0113  429 ILE A N   
3002 C CA  . ILE A 451 ? 0.4716 0.6216 0.4430 0.0089  0.0620  -0.0019 429 ILE A CA  
3003 C C   . ILE A 451 ? 0.4696 0.6070 0.4228 -0.0134 0.0555  -0.0104 429 ILE A C   
3004 O O   . ILE A 451 ? 0.4531 0.5951 0.4019 -0.0281 0.0446  -0.0116 429 ILE A O   
3005 C CB  . ILE A 451 ? 0.4654 0.5744 0.4201 0.0188  0.0609  -0.0096 429 ILE A CB  
3006 C CG1 . ILE A 451 ? 0.4891 0.5607 0.4214 0.0201  0.0698  -0.0202 429 ILE A CG1 
3007 C CG2 . ILE A 451 ? 0.4543 0.5510 0.3976 0.0076  0.0458  -0.0144 429 ILE A CG2 
3008 C CD1 . ILE A 451 ? 0.4982 0.5349 0.4147 0.0265  0.0693  -0.0274 429 ILE A CD1 
3009 N N   . THR A 452 ? 0.4866 0.6055 0.4266 -0.0162 0.0640  -0.0159 430 THR A N   
3010 C CA  . THR A 452 ? 0.4938 0.5937 0.4137 -0.0343 0.0607  -0.0222 430 THR A CA  
3011 C C   . THR A 452 ? 0.4954 0.5547 0.3920 -0.0330 0.0549  -0.0295 430 THR A C   
3012 O O   . THR A 452 ? 0.4954 0.5395 0.3886 -0.0202 0.0546  -0.0318 430 THR A O   
3013 C CB  . THR A 452 ? 0.5231 0.6204 0.4365 -0.0382 0.0723  -0.0229 430 THR A CB  
3014 O OG1 . THR A 452 ? 0.5150 0.5838 0.4128 -0.0261 0.0790  -0.0278 430 THR A OG1 
3015 C CG2 . THR A 452 ? 0.5200 0.6626 0.4605 -0.0377 0.0805  -0.0137 430 THR A CG2 
3016 N N   . CYS A 453 ? 0.4974 0.5393 0.3778 -0.0467 0.0521  -0.0322 431 CYS A N   
3017 C CA  . CYS A 453 ? 0.5203 0.5278 0.3807 -0.0443 0.0486  -0.0354 431 CYS A CA  
3018 C C   . CYS A 453 ? 0.5351 0.5272 0.3837 -0.0353 0.0526  -0.0366 431 CYS A C   
3019 O O   . CYS A 453 ? 0.5342 0.5122 0.3758 -0.0279 0.0477  -0.0379 431 CYS A O   
3020 C CB  . CYS A 453 ? 0.5634 0.5523 0.4073 -0.0588 0.0510  -0.0357 431 CYS A CB  
3021 S SG  . CYS A 453 ? 0.6080 0.6047 0.4539 -0.0749 0.0463  -0.0375 431 CYS A SG  
3022 N N   . GLY A 454 ? 0.5237 0.5206 0.3691 -0.0381 0.0613  -0.0359 432 GLY A N   
3023 C CA  . GLY A 454 ? 0.5413 0.5255 0.3716 -0.0327 0.0660  -0.0377 432 GLY A CA  
3024 C C   . GLY A 454 ? 0.5422 0.5270 0.3759 -0.0220 0.0677  -0.0418 432 GLY A C   
3025 O O   . GLY A 454 ? 0.5504 0.5191 0.3679 -0.0199 0.0648  -0.0451 432 GLY A O   
3026 N N   A HIS A 455 ? 0.5191 0.5228 0.3728 -0.0159 0.0736  -0.0405 433 HIS A N   
3027 N N   B HIS A 455 ? 0.5415 0.5450 0.3951 -0.0157 0.0737  -0.0406 433 HIS A N   
3028 C CA  A HIS A 455 ? 0.5150 0.5137 0.3713 -0.0042 0.0797  -0.0434 433 HIS A CA  
3029 C CA  B HIS A 455 ? 0.5547 0.5517 0.4099 -0.0039 0.0796  -0.0439 433 HIS A CA  
3030 C C   A HIS A 455 ? 0.5173 0.5050 0.3733 -0.0007 0.0692  -0.0456 433 HIS A C   
3031 C C   B HIS A 455 ? 0.5385 0.5249 0.3933 -0.0010 0.0688  -0.0459 433 HIS A C   
3032 O O   A HIS A 455 ? 0.5256 0.4967 0.3723 0.0043  0.0732  -0.0507 433 HIS A O   
3033 O O   B HIS A 455 ? 0.5416 0.5108 0.3861 0.0033  0.0720  -0.0512 433 HIS A O   
3034 C CB  A HIS A 455 ? 0.5063 0.5311 0.3874 0.0050  0.0908  -0.0370 433 HIS A CB  
3035 C CB  B HIS A 455 ? 0.5763 0.5974 0.4557 0.0063  0.0909  -0.0378 433 HIS A CB  
3036 C CG  A HIS A 455 ? 0.5118 0.5465 0.3932 0.0034  0.1044  -0.0350 433 HIS A CG  
3037 C CG  B HIS A 455 ? 0.6205 0.6266 0.4972 0.0202  0.1039  -0.0403 433 HIS A CG  
3038 N ND1 A HIS A 455 ? 0.4997 0.5697 0.4080 0.0077  0.1125  -0.0255 433 HIS A ND1 
3039 N ND1 B HIS A 455 ? 0.6533 0.6261 0.5015 0.0183  0.1104  -0.0505 433 HIS A ND1 
3040 C CD2 A HIS A 455 ? 0.5235 0.5402 0.3819 -0.0023 0.1115  -0.0400 433 HIS A CD2 
3041 C CD2 B HIS A 455 ? 0.6349 0.6527 0.5315 0.0358  0.1138  -0.0333 433 HIS A CD2 
3042 C CE1 A HIS A 455 ? 0.5087 0.5803 0.4115 0.0051  0.1254  -0.0255 433 HIS A CE1 
3043 C CE1 B HIS A 455 ? 0.6700 0.6284 0.5177 0.0304  0.1251  -0.0519 433 HIS A CE1 
3044 N NE2 A HIS A 455 ? 0.5243 0.5617 0.3952 -0.0011 0.1251  -0.0347 433 HIS A NE2 
3045 N NE2 B HIS A 455 ? 0.6641 0.6487 0.5423 0.0434  0.1283  -0.0405 433 HIS A NE2 
3046 N N   . THR A 456 ? 0.5121 0.5062 0.3752 -0.0053 0.0577  -0.0425 434 THR A N   
3047 C CA  . THR A 456 ? 0.5179 0.5017 0.3801 -0.0029 0.0483  -0.0439 434 THR A CA  
3048 C C   . THR A 456 ? 0.5151 0.4793 0.3570 -0.0065 0.0439  -0.0477 434 THR A C   
3049 O O   . THR A 456 ? 0.4900 0.4441 0.3267 -0.0042 0.0425  -0.0515 434 THR A O   
3050 C CB  . THR A 456 ? 0.5274 0.5194 0.3975 -0.0081 0.0395  -0.0402 434 THR A CB  
3051 O OG1 . THR A 456 ? 0.5156 0.5330 0.4046 -0.0070 0.0407  -0.0354 434 THR A OG1 
3052 C CG2 . THR A 456 ? 0.5329 0.5121 0.4003 -0.0053 0.0314  -0.0412 434 THR A CG2 
3053 N N   . ILE A 457 ? 0.5142 0.4749 0.3444 -0.0128 0.0426  -0.0454 435 ILE A N   
3054 C CA  . ILE A 457 ? 0.5359 0.4867 0.3478 -0.0157 0.0382  -0.0452 435 ILE A CA  
3055 C C   . ILE A 457 ? 0.5595 0.5037 0.3579 -0.0172 0.0437  -0.0527 435 ILE A C   
3056 O O   . ILE A 457 ? 0.5565 0.4955 0.3459 -0.0202 0.0386  -0.0559 435 ILE A O   
3057 C CB  . ILE A 457 ? 0.5546 0.5031 0.3541 -0.0201 0.0396  -0.0392 435 ILE A CB  
3058 C CG1 . ILE A 457 ? 0.5547 0.5000 0.3606 -0.0208 0.0386  -0.0331 435 ILE A CG1 
3059 C CG2 . ILE A 457 ? 0.5731 0.5193 0.3546 -0.0221 0.0338  -0.0356 435 ILE A CG2 
3060 C CD1 . ILE A 457 ? 0.5499 0.4910 0.3603 -0.0165 0.0315  -0.0296 435 ILE A CD1 
3061 N N   . GLU A 458 ? 0.5540 0.4977 0.3494 -0.0166 0.0555  -0.0557 436 GLU A N   
3062 C CA  . GLU A 458 ? 0.6105 0.5406 0.3863 -0.0193 0.0651  -0.0639 436 GLU A CA  
3063 C C   . GLU A 458 ? 0.6192 0.5374 0.3964 -0.0159 0.0686  -0.0704 436 GLU A C   
3064 O O   . GLU A 458 ? 0.6172 0.5210 0.3727 -0.0246 0.0683  -0.0778 436 GLU A O   
3065 C CB  . GLU A 458 ? 0.6319 0.5628 0.4072 -0.0163 0.0812  -0.0649 436 GLU A CB  
3066 C CG  . GLU A 458 ? 0.6544 0.5921 0.4222 -0.0221 0.0808  -0.0596 436 GLU A CG  
3067 C CD  . GLU A 458 ? 0.7118 0.6545 0.4837 -0.0191 0.0975  -0.0594 436 GLU A CD  
3068 O OE