data_4CQM
# 
_entry.id   4CQM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4CQM         
PDBE  EBI-59545    
WWPDB D_1290059545 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4CQL 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF HETEROTETRAMERIC HUMAN KETOACYL REDUCTASE COMPLEXED WITH NAD' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4CQM 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2014-02-19 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Venkatesan, R.'    1 
'SahTeli, S.K.'     2 
'Awoniyi, L.O.'     3 
'Jiang, G.'         4 
'Prus, P.'          5 
'Kastoniotis, A.J.' 6 
'Hiltunen, J.K.'    7 
'Wierenga, R.K.'    8 
'Chen, Z.'          9 
# 
_citation.id                        primary 
_citation.title                     
;Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
;
_citation.journal_abbrev            Nat.Commun. 
_citation.journal_volume            5 
_citation.page_first                4805 
_citation.page_last                 ? 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25203508 
_citation.pdbx_database_id_DOI      10.1038/NCOMMS5805 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Venkatesan, R.'    1 
primary 'Sah-Teli, S.K.'    2 
primary 'Awoniyi, L.O.'     3 
primary 'Jiang, G.'         4 
primary 'Prus, P.'          5 
primary 'Kastaniotis, A.J.' 6 
primary 'Hiltunen, J.K.'    7 
primary 'Wierenga, R.K.'    8 
primary 'Chen, Z.'          9 
# 
_cell.entry_id           4CQM 
_cell.length_a           87.501 
_cell.length_b           238.411 
_cell.length_c           87.688 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.18 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4CQM 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ESTRADIOL 17-BETA-DEHYDROGENASE 8'                26999.738 7   '1.1.1.62, 1.1.1.239, 1.1.1.100'          ? ? ? 
2 polymer     man 'CARBONYL REDUCTASE FAMILY MEMBER 4'               26298.506 8   1.1.1.100                                 ? ? ? 
3 polymer     man 'ESTRADIOL 17-BETA-DEHYDROGENASE 8'                27041.773 1   '1.1.1.62, 1.1.1.-, 1.1.1.239, 1.1.1.100' ? ? ? 
4 non-polymer syn 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 743.405   16  ?                                         ? ? ? 
5 non-polymer syn GLYCEROL                                           92.094    4   ?                                         ? ? ? 
6 non-polymer syn 1,2-ETHANEDIOL                                     62.068    8   ?                                         ? ? ? 
7 non-polymer syn 'ACETATE ION'                                      59.044    3   ?                                         ? ? ? 
8 water       nat water                                              18.015    806 ?                                         ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;17-BETA-HYDROXYSTEROID DEHYDROGENASE 8,17-BETA-HSD 8,3-OXOACYL-ACYL-CARRIER-PROTEIN REDUCTASE, PROTEIN KE6,KE-6,REALLY INTERESTING NEW GENE 2 PROTEIN, TESTOSTERONE 17-BETA-DEHYDROGENASE 8,3-KETOACYL REDUCTASE ALPHA SUBUNIT
;
2 '3-OXOACYL-ACYL-CARRIER-PROTEIN REDUCTASE, QUINONE REDUCTASE CBR4,3-KETOACYL REDUCTASE BETA SUBUNIT' 
3 
;17-BETA-HYDROXYSTEROID DEHYDROGENASE 8,17-BETA-HSD 8,3-OXOACYL-ACYL-CARRIER-PROTEIN REDUCTASE, PROTEIN KE6,KE-6,REALLY INTERESTING NEW GENE 2 PROTEIN, TESTOSTERONE 17-BETA-DEHYDROGENASE 8,3-KETOACYL REDUCTASE ALPHA SUBUNIT
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEAR
AARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGK
VGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFL
ASEDSGYITGTSVEVTGGLFM
;
;MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEAR
AARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGK
VGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFL
ASEDSGYITGTSVEVTGGLFM
;
A,E,H,I,L,M,P   ? 
2 'polypeptide(L)' no no  
;MHHHHHHMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKH
LGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKG
GLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGL
QLIL
;
;MHHHHHHMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKH
LGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKG
GLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGL
QLIL
;
B,C,F,G,J,K,N,O ? 
3 'polypeptide(L)' no yes 
;MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEAR
AARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINIS(OAS)
IVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADV
VAFLASEDSGYITGTSVEVTGGLFM
;
;MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEAR
AARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGK
VGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFL
ASEDSGYITGTSVEVTGGLFM
;
D               ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   GLN n 
1 5   LEU n 
1 6   GLN n 
1 7   ASN n 
1 8   ARG n 
1 9   LEU n 
1 10  ARG n 
1 11  SER n 
1 12  ALA n 
1 13  LEU n 
1 14  ALA n 
1 15  LEU n 
1 16  VAL n 
1 17  THR n 
1 18  GLY n 
1 19  ALA n 
1 20  GLY n 
1 21  SER n 
1 22  GLY n 
1 23  ILE n 
1 24  GLY n 
1 25  ARG n 
1 26  ALA n 
1 27  VAL n 
1 28  SER n 
1 29  VAL n 
1 30  ARG n 
1 31  LEU n 
1 32  ALA n 
1 33  GLY n 
1 34  GLU n 
1 35  GLY n 
1 36  ALA n 
1 37  THR n 
1 38  VAL n 
1 39  ALA n 
1 40  ALA n 
1 41  CYS n 
1 42  ASP n 
1 43  LEU n 
1 44  ASP n 
1 45  ARG n 
1 46  ALA n 
1 47  ALA n 
1 48  ALA n 
1 49  GLN n 
1 50  GLU n 
1 51  THR n 
1 52  VAL n 
1 53  ARG n 
1 54  LEU n 
1 55  LEU n 
1 56  GLY n 
1 57  GLY n 
1 58  PRO n 
1 59  GLY n 
1 60  SER n 
1 61  LYS n 
1 62  GLU n 
1 63  GLY n 
1 64  PRO n 
1 65  PRO n 
1 66  ARG n 
1 67  GLY n 
1 68  ASN n 
1 69  HIS n 
1 70  ALA n 
1 71  ALA n 
1 72  PHE n 
1 73  GLN n 
1 74  ALA n 
1 75  ASP n 
1 76  VAL n 
1 77  SER n 
1 78  GLU n 
1 79  ALA n 
1 80  ARG n 
1 81  ALA n 
1 82  ALA n 
1 83  ARG n 
1 84  CYS n 
1 85  LEU n 
1 86  LEU n 
1 87  GLU n 
1 88  GLN n 
1 89  VAL n 
1 90  GLN n 
1 91  ALA n 
1 92  CYS n 
1 93  PHE n 
1 94  SER n 
1 95  ARG n 
1 96  PRO n 
1 97  PRO n 
1 98  SER n 
1 99  VAL n 
1 100 VAL n 
1 101 VAL n 
1 102 SER n 
1 103 CYS n 
1 104 ALA n 
1 105 GLY n 
1 106 ILE n 
1 107 THR n 
1 108 GLN n 
1 109 ASP n 
1 110 GLU n 
1 111 PHE n 
1 112 LEU n 
1 113 LEU n 
1 114 HIS n 
1 115 MET n 
1 116 SER n 
1 117 GLU n 
1 118 ASP n 
1 119 ASP n 
1 120 TRP n 
1 121 ASP n 
1 122 LYS n 
1 123 VAL n 
1 124 ILE n 
1 125 ALA n 
1 126 VAL n 
1 127 ASN n 
1 128 LEU n 
1 129 LYS n 
1 130 GLY n 
1 131 THR n 
1 132 PHE n 
1 133 LEU n 
1 134 VAL n 
1 135 THR n 
1 136 GLN n 
1 137 ALA n 
1 138 ALA n 
1 139 ALA n 
1 140 GLN n 
1 141 ALA n 
1 142 LEU n 
1 143 VAL n 
1 144 SER n 
1 145 ASN n 
1 146 GLY n 
1 147 CYS n 
1 148 ARG n 
1 149 GLY n 
1 150 SER n 
1 151 ILE n 
1 152 ILE n 
1 153 ASN n 
1 154 ILE n 
1 155 SER n 
1 156 SER n 
1 157 ILE n 
1 158 VAL n 
1 159 GLY n 
1 160 LYS n 
1 161 VAL n 
1 162 GLY n 
1 163 ASN n 
1 164 VAL n 
1 165 GLY n 
1 166 GLN n 
1 167 THR n 
1 168 ASN n 
1 169 TYR n 
1 170 ALA n 
1 171 ALA n 
1 172 SER n 
1 173 LYS n 
1 174 ALA n 
1 175 GLY n 
1 176 VAL n 
1 177 ILE n 
1 178 GLY n 
1 179 LEU n 
1 180 THR n 
1 181 GLN n 
1 182 THR n 
1 183 ALA n 
1 184 ALA n 
1 185 ARG n 
1 186 GLU n 
1 187 LEU n 
1 188 GLY n 
1 189 ARG n 
1 190 HIS n 
1 191 GLY n 
1 192 ILE n 
1 193 ARG n 
1 194 CYS n 
1 195 ASN n 
1 196 SER n 
1 197 VAL n 
1 198 LEU n 
1 199 PRO n 
1 200 GLY n 
1 201 PHE n 
1 202 ILE n 
1 203 ALA n 
1 204 THR n 
1 205 PRO n 
1 206 MET n 
1 207 THR n 
1 208 GLN n 
1 209 LYS n 
1 210 VAL n 
1 211 PRO n 
1 212 GLN n 
1 213 LYS n 
1 214 VAL n 
1 215 VAL n 
1 216 ASP n 
1 217 LYS n 
1 218 ILE n 
1 219 THR n 
1 220 GLU n 
1 221 MET n 
1 222 ILE n 
1 223 PRO n 
1 224 MET n 
1 225 GLY n 
1 226 HIS n 
1 227 LEU n 
1 228 GLY n 
1 229 ASP n 
1 230 PRO n 
1 231 GLU n 
1 232 ASP n 
1 233 VAL n 
1 234 ALA n 
1 235 ASP n 
1 236 VAL n 
1 237 VAL n 
1 238 ALA n 
1 239 PHE n 
1 240 LEU n 
1 241 ALA n 
1 242 SER n 
1 243 GLU n 
1 244 ASP n 
1 245 SER n 
1 246 GLY n 
1 247 TYR n 
1 248 ILE n 
1 249 THR n 
1 250 GLY n 
1 251 THR n 
1 252 SER n 
1 253 VAL n 
1 254 GLU n 
1 255 VAL n 
1 256 THR n 
1 257 GLY n 
1 258 GLY n 
1 259 LEU n 
1 260 PHE n 
1 261 MET n 
2 1   MET n 
2 2   HIS n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   MET n 
2 9   ASP n 
2 10  LYS n 
2 11  VAL n 
2 12  CYS n 
2 13  ALA n 
2 14  VAL n 
2 15  PHE n 
2 16  GLY n 
2 17  GLY n 
2 18  SER n 
2 19  ARG n 
2 20  GLY n 
2 21  ILE n 
2 22  GLY n 
2 23  ARG n 
2 24  ALA n 
2 25  VAL n 
2 26  ALA n 
2 27  GLN n 
2 28  LEU n 
2 29  MET n 
2 30  ALA n 
2 31  ARG n 
2 32  LYS n 
2 33  GLY n 
2 34  TYR n 
2 35  ARG n 
2 36  LEU n 
2 37  ALA n 
2 38  VAL n 
2 39  ILE n 
2 40  ALA n 
2 41  ARG n 
2 42  ASN n 
2 43  LEU n 
2 44  GLU n 
2 45  GLY n 
2 46  ALA n 
2 47  LYS n 
2 48  ALA n 
2 49  ALA n 
2 50  ALA n 
2 51  GLY n 
2 52  ASP n 
2 53  LEU n 
2 54  GLY n 
2 55  GLY n 
2 56  ASP n 
2 57  HIS n 
2 58  LEU n 
2 59  ALA n 
2 60  PHE n 
2 61  SER n 
2 62  CYS n 
2 63  ASP n 
2 64  VAL n 
2 65  ALA n 
2 66  LYS n 
2 67  GLU n 
2 68  HIS n 
2 69  ASP n 
2 70  VAL n 
2 71  GLN n 
2 72  ASN n 
2 73  THR n 
2 74  PHE n 
2 75  GLU n 
2 76  GLU n 
2 77  LEU n 
2 78  GLU n 
2 79  LYS n 
2 80  HIS n 
2 81  LEU n 
2 82  GLY n 
2 83  ARG n 
2 84  VAL n 
2 85  ASN n 
2 86  PHE n 
2 87  LEU n 
2 88  VAL n 
2 89  ASN n 
2 90  ALA n 
2 91  ALA n 
2 92  GLY n 
2 93  ILE n 
2 94  ASN n 
2 95  ARG n 
2 96  ASP n 
2 97  GLY n 
2 98  LEU n 
2 99  LEU n 
2 100 VAL n 
2 101 ARG n 
2 102 THR n 
2 103 LYS n 
2 104 THR n 
2 105 GLU n 
2 106 ASP n 
2 107 MET n 
2 108 VAL n 
2 109 SER n 
2 110 GLN n 
2 111 LEU n 
2 112 HIS n 
2 113 THR n 
2 114 ASN n 
2 115 LEU n 
2 116 LEU n 
2 117 GLY n 
2 118 SER n 
2 119 MET n 
2 120 LEU n 
2 121 THR n 
2 122 CYS n 
2 123 LYS n 
2 124 ALA n 
2 125 ALA n 
2 126 MET n 
2 127 ARG n 
2 128 THR n 
2 129 MET n 
2 130 ILE n 
2 131 GLN n 
2 132 GLN n 
2 133 GLN n 
2 134 GLY n 
2 135 GLY n 
2 136 SER n 
2 137 ILE n 
2 138 VAL n 
2 139 ASN n 
2 140 VAL n 
2 141 GLY n 
2 142 SER n 
2 143 ILE n 
2 144 VAL n 
2 145 GLY n 
2 146 LEU n 
2 147 LYS n 
2 148 GLY n 
2 149 ASN n 
2 150 SER n 
2 151 GLY n 
2 152 GLN n 
2 153 SER n 
2 154 VAL n 
2 155 TYR n 
2 156 SER n 
2 157 ALA n 
2 158 SER n 
2 159 LYS n 
2 160 GLY n 
2 161 GLY n 
2 162 LEU n 
2 163 VAL n 
2 164 GLY n 
2 165 PHE n 
2 166 SER n 
2 167 ARG n 
2 168 ALA n 
2 169 LEU n 
2 170 ALA n 
2 171 LYS n 
2 172 GLU n 
2 173 VAL n 
2 174 ALA n 
2 175 ARG n 
2 176 LYS n 
2 177 LYS n 
2 178 ILE n 
2 179 ARG n 
2 180 VAL n 
2 181 ASN n 
2 182 VAL n 
2 183 VAL n 
2 184 ALA n 
2 185 PRO n 
2 186 GLY n 
2 187 PHE n 
2 188 VAL n 
2 189 HIS n 
2 190 THR n 
2 191 ASP n 
2 192 MET n 
2 193 THR n 
2 194 LYS n 
2 195 ASP n 
2 196 LEU n 
2 197 LYS n 
2 198 GLU n 
2 199 GLU n 
2 200 HIS n 
2 201 LEU n 
2 202 LYS n 
2 203 LYS n 
2 204 ASN n 
2 205 ILE n 
2 206 PRO n 
2 207 LEU n 
2 208 GLY n 
2 209 ARG n 
2 210 PHE n 
2 211 GLY n 
2 212 GLU n 
2 213 THR n 
2 214 ILE n 
2 215 GLU n 
2 216 VAL n 
2 217 ALA n 
2 218 HIS n 
2 219 ALA n 
2 220 VAL n 
2 221 VAL n 
2 222 PHE n 
2 223 LEU n 
2 224 LEU n 
2 225 GLU n 
2 226 SER n 
2 227 PRO n 
2 228 TYR n 
2 229 ILE n 
2 230 THR n 
2 231 GLY n 
2 232 HIS n 
2 233 VAL n 
2 234 LEU n 
2 235 VAL n 
2 236 VAL n 
2 237 ASP n 
2 238 GLY n 
2 239 GLY n 
2 240 LEU n 
2 241 GLN n 
2 242 LEU n 
2 243 ILE n 
2 244 LEU n 
3 1   MET n 
3 2   ALA n 
3 3   SER n 
3 4   GLN n 
3 5   LEU n 
3 6   GLN n 
3 7   ASN n 
3 8   ARG n 
3 9   LEU n 
3 10  ARG n 
3 11  SER n 
3 12  ALA n 
3 13  LEU n 
3 14  ALA n 
3 15  LEU n 
3 16  VAL n 
3 17  THR n 
3 18  GLY n 
3 19  ALA n 
3 20  GLY n 
3 21  SER n 
3 22  GLY n 
3 23  ILE n 
3 24  GLY n 
3 25  ARG n 
3 26  ALA n 
3 27  VAL n 
3 28  SER n 
3 29  VAL n 
3 30  ARG n 
3 31  LEU n 
3 32  ALA n 
3 33  GLY n 
3 34  GLU n 
3 35  GLY n 
3 36  ALA n 
3 37  THR n 
3 38  VAL n 
3 39  ALA n 
3 40  ALA n 
3 41  CYS n 
3 42  ASP n 
3 43  LEU n 
3 44  ASP n 
3 45  ARG n 
3 46  ALA n 
3 47  ALA n 
3 48  ALA n 
3 49  GLN n 
3 50  GLU n 
3 51  THR n 
3 52  VAL n 
3 53  ARG n 
3 54  LEU n 
3 55  LEU n 
3 56  GLY n 
3 57  GLY n 
3 58  PRO n 
3 59  GLY n 
3 60  SER n 
3 61  LYS n 
3 62  GLU n 
3 63  GLY n 
3 64  PRO n 
3 65  PRO n 
3 66  ARG n 
3 67  GLY n 
3 68  ASN n 
3 69  HIS n 
3 70  ALA n 
3 71  ALA n 
3 72  PHE n 
3 73  GLN n 
3 74  ALA n 
3 75  ASP n 
3 76  VAL n 
3 77  SER n 
3 78  GLU n 
3 79  ALA n 
3 80  ARG n 
3 81  ALA n 
3 82  ALA n 
3 83  ARG n 
3 84  CYS n 
3 85  LEU n 
3 86  LEU n 
3 87  GLU n 
3 88  GLN n 
3 89  VAL n 
3 90  GLN n 
3 91  ALA n 
3 92  CYS n 
3 93  PHE n 
3 94  SER n 
3 95  ARG n 
3 96  PRO n 
3 97  PRO n 
3 98  SER n 
3 99  VAL n 
3 100 VAL n 
3 101 VAL n 
3 102 SER n 
3 103 CYS n 
3 104 ALA n 
3 105 GLY n 
3 106 ILE n 
3 107 THR n 
3 108 GLN n 
3 109 ASP n 
3 110 GLU n 
3 111 PHE n 
3 112 LEU n 
3 113 LEU n 
3 114 HIS n 
3 115 MET n 
3 116 SER n 
3 117 GLU n 
3 118 ASP n 
3 119 ASP n 
3 120 TRP n 
3 121 ASP n 
3 122 LYS n 
3 123 VAL n 
3 124 ILE n 
3 125 ALA n 
3 126 VAL n 
3 127 ASN n 
3 128 LEU n 
3 129 LYS n 
3 130 GLY n 
3 131 THR n 
3 132 PHE n 
3 133 LEU n 
3 134 VAL n 
3 135 THR n 
3 136 GLN n 
3 137 ALA n 
3 138 ALA n 
3 139 ALA n 
3 140 GLN n 
3 141 ALA n 
3 142 LEU n 
3 143 VAL n 
3 144 SER n 
3 145 ASN n 
3 146 GLY n 
3 147 CYS n 
3 148 ARG n 
3 149 GLY n 
3 150 SER n 
3 151 ILE n 
3 152 ILE n 
3 153 ASN n 
3 154 ILE n 
3 155 SER n 
3 156 OAS n 
3 157 ILE n 
3 158 VAL n 
3 159 GLY n 
3 160 LYS n 
3 161 VAL n 
3 162 GLY n 
3 163 ASN n 
3 164 VAL n 
3 165 GLY n 
3 166 GLN n 
3 167 THR n 
3 168 ASN n 
3 169 TYR n 
3 170 ALA n 
3 171 ALA n 
3 172 SER n 
3 173 LYS n 
3 174 ALA n 
3 175 GLY n 
3 176 VAL n 
3 177 ILE n 
3 178 GLY n 
3 179 LEU n 
3 180 THR n 
3 181 GLN n 
3 182 THR n 
3 183 ALA n 
3 184 ALA n 
3 185 ARG n 
3 186 GLU n 
3 187 LEU n 
3 188 GLY n 
3 189 ARG n 
3 190 HIS n 
3 191 GLY n 
3 192 ILE n 
3 193 ARG n 
3 194 CYS n 
3 195 ASN n 
3 196 SER n 
3 197 VAL n 
3 198 LEU n 
3 199 PRO n 
3 200 GLY n 
3 201 PHE n 
3 202 ILE n 
3 203 ALA n 
3 204 THR n 
3 205 PRO n 
3 206 MET n 
3 207 THR n 
3 208 GLN n 
3 209 LYS n 
3 210 VAL n 
3 211 PRO n 
3 212 GLN n 
3 213 LYS n 
3 214 VAL n 
3 215 VAL n 
3 216 ASP n 
3 217 LYS n 
3 218 ILE n 
3 219 THR n 
3 220 GLU n 
3 221 MET n 
3 222 ILE n 
3 223 PRO n 
3 224 MET n 
3 225 GLY n 
3 226 HIS n 
3 227 LEU n 
3 228 GLY n 
3 229 ASP n 
3 230 PRO n 
3 231 GLU n 
3 232 ASP n 
3 233 VAL n 
3 234 ALA n 
3 235 ASP n 
3 236 VAL n 
3 237 VAL n 
3 238 ALA n 
3 239 PHE n 
3 240 LEU n 
3 241 ALA n 
3 242 SER n 
3 243 GLU n 
3 244 ASP n 
3 245 SER n 
3 246 GLY n 
3 247 TYR n 
3 248 ILE n 
3 249 THR n 
3 250 GLY n 
3 251 THR n 
3 252 SER n 
3 253 VAL n 
3 254 GLU n 
3 255 VAL n 
3 256 THR n 
3 257 GLY n 
3 258 GLY n 
3 259 LEU n 
3 260 PHE n 
3 261 MET n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 511693 ? ? ? ? ? ? BL21 'PLYSS RARE' 
? ? ? ? ? ? PLASMID ? ? ? PLR631 ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 511693 ? ? ? ? ? ? BL21 'PLYSS RARE' 
? ? ? ? ? ? PLASMID ? ? ? PLR631 ? ? 
3 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 511693 ? ? ? ? ? ? BL21 'PLYSS RARE' 
? ? ? ? ? ? PLASMID ? ? ? PLR631 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP DHB8_HUMAN 1 ? ? Q92506 ? 
2 UNP CBR4_HUMAN 2 ? ? Q8N4T8 ? 
3 UNP DHB8_HUMAN 3 ? ? Q92506 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4CQM A 1 ? 261 ? Q92506 1 ? 261 ? 1 261 
2  2 4CQM B 8 ? 244 ? Q8N4T8 1 ? 237 ? 1 237 
3  2 4CQM C 8 ? 244 ? Q8N4T8 1 ? 237 ? 1 237 
4  3 4CQM D 1 ? 261 ? Q92506 1 ? 261 ? 1 261 
5  1 4CQM E 1 ? 261 ? Q92506 1 ? 261 ? 1 261 
6  2 4CQM F 8 ? 244 ? Q8N4T8 1 ? 237 ? 1 237 
7  2 4CQM G 8 ? 244 ? Q8N4T8 1 ? 237 ? 1 237 
8  1 4CQM H 1 ? 261 ? Q92506 1 ? 261 ? 1 261 
9  1 4CQM I 1 ? 261 ? Q92506 1 ? 261 ? 1 261 
10 2 4CQM J 8 ? 244 ? Q8N4T8 1 ? 237 ? 1 237 
11 2 4CQM K 8 ? 244 ? Q8N4T8 1 ? 237 ? 1 237 
12 1 4CQM L 1 ? 261 ? Q92506 1 ? 261 ? 1 261 
13 1 4CQM M 1 ? 261 ? Q92506 1 ? 261 ? 1 261 
14 2 4CQM N 8 ? 244 ? Q8N4T8 1 ? 237 ? 1 237 
15 2 4CQM O 8 ? 244 ? Q8N4T8 1 ? 237 ? 1 237 
16 1 4CQM P 1 ? 261 ? Q92506 1 ? 261 ? 1 261 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2  4CQM MET B 1 ? UNP Q8N4T8 ? ? 'expression tag' -6 1  
2  4CQM HIS B 2 ? UNP Q8N4T8 ? ? 'expression tag' -5 2  
2  4CQM HIS B 3 ? UNP Q8N4T8 ? ? 'expression tag' -4 3  
2  4CQM HIS B 4 ? UNP Q8N4T8 ? ? 'expression tag' -3 4  
2  4CQM HIS B 5 ? UNP Q8N4T8 ? ? 'expression tag' -2 5  
2  4CQM HIS B 6 ? UNP Q8N4T8 ? ? 'expression tag' -1 6  
2  4CQM HIS B 7 ? UNP Q8N4T8 ? ? 'expression tag' 0  7  
3  4CQM MET C 1 ? UNP Q8N4T8 ? ? 'expression tag' -6 8  
3  4CQM HIS C 2 ? UNP Q8N4T8 ? ? 'expression tag' -5 9  
3  4CQM HIS C 3 ? UNP Q8N4T8 ? ? 'expression tag' -4 10 
3  4CQM HIS C 4 ? UNP Q8N4T8 ? ? 'expression tag' -3 11 
3  4CQM HIS C 5 ? UNP Q8N4T8 ? ? 'expression tag' -2 12 
3  4CQM HIS C 6 ? UNP Q8N4T8 ? ? 'expression tag' -1 13 
3  4CQM HIS C 7 ? UNP Q8N4T8 ? ? 'expression tag' 0  14 
6  4CQM MET F 1 ? UNP Q8N4T8 ? ? 'expression tag' -6 15 
6  4CQM HIS F 2 ? UNP Q8N4T8 ? ? 'expression tag' -5 16 
6  4CQM HIS F 3 ? UNP Q8N4T8 ? ? 'expression tag' -4 17 
6  4CQM HIS F 4 ? UNP Q8N4T8 ? ? 'expression tag' -3 18 
6  4CQM HIS F 5 ? UNP Q8N4T8 ? ? 'expression tag' -2 19 
6  4CQM HIS F 6 ? UNP Q8N4T8 ? ? 'expression tag' -1 20 
6  4CQM HIS F 7 ? UNP Q8N4T8 ? ? 'expression tag' 0  21 
7  4CQM MET G 1 ? UNP Q8N4T8 ? ? 'expression tag' -6 22 
7  4CQM HIS G 2 ? UNP Q8N4T8 ? ? 'expression tag' -5 23 
7  4CQM HIS G 3 ? UNP Q8N4T8 ? ? 'expression tag' -4 24 
7  4CQM HIS G 4 ? UNP Q8N4T8 ? ? 'expression tag' -3 25 
7  4CQM HIS G 5 ? UNP Q8N4T8 ? ? 'expression tag' -2 26 
7  4CQM HIS G 6 ? UNP Q8N4T8 ? ? 'expression tag' -1 27 
7  4CQM HIS G 7 ? UNP Q8N4T8 ? ? 'expression tag' 0  28 
10 4CQM MET J 1 ? UNP Q8N4T8 ? ? 'expression tag' -6 29 
10 4CQM HIS J 2 ? UNP Q8N4T8 ? ? 'expression tag' -5 30 
10 4CQM HIS J 3 ? UNP Q8N4T8 ? ? 'expression tag' -4 31 
10 4CQM HIS J 4 ? UNP Q8N4T8 ? ? 'expression tag' -3 32 
10 4CQM HIS J 5 ? UNP Q8N4T8 ? ? 'expression tag' -2 33 
10 4CQM HIS J 6 ? UNP Q8N4T8 ? ? 'expression tag' -1 34 
10 4CQM HIS J 7 ? UNP Q8N4T8 ? ? 'expression tag' 0  35 
11 4CQM MET K 1 ? UNP Q8N4T8 ? ? 'expression tag' -6 36 
11 4CQM HIS K 2 ? UNP Q8N4T8 ? ? 'expression tag' -5 37 
11 4CQM HIS K 3 ? UNP Q8N4T8 ? ? 'expression tag' -4 38 
11 4CQM HIS K 4 ? UNP Q8N4T8 ? ? 'expression tag' -3 39 
11 4CQM HIS K 5 ? UNP Q8N4T8 ? ? 'expression tag' -2 40 
11 4CQM HIS K 6 ? UNP Q8N4T8 ? ? 'expression tag' -1 41 
11 4CQM HIS K 7 ? UNP Q8N4T8 ? ? 'expression tag' 0  42 
14 4CQM MET N 1 ? UNP Q8N4T8 ? ? 'expression tag' -6 43 
14 4CQM HIS N 2 ? UNP Q8N4T8 ? ? 'expression tag' -5 44 
14 4CQM HIS N 3 ? UNP Q8N4T8 ? ? 'expression tag' -4 45 
14 4CQM HIS N 4 ? UNP Q8N4T8 ? ? 'expression tag' -3 46 
14 4CQM HIS N 5 ? UNP Q8N4T8 ? ? 'expression tag' -2 47 
14 4CQM HIS N 6 ? UNP Q8N4T8 ? ? 'expression tag' -1 48 
14 4CQM HIS N 7 ? UNP Q8N4T8 ? ? 'expression tag' 0  49 
15 4CQM MET O 1 ? UNP Q8N4T8 ? ? 'expression tag' -6 50 
15 4CQM HIS O 2 ? UNP Q8N4T8 ? ? 'expression tag' -5 51 
15 4CQM HIS O 3 ? UNP Q8N4T8 ? ? 'expression tag' -4 52 
15 4CQM HIS O 4 ? UNP Q8N4T8 ? ? 'expression tag' -3 53 
15 4CQM HIS O 5 ? UNP Q8N4T8 ? ? 'expression tag' -2 54 
15 4CQM HIS O 6 ? UNP Q8N4T8 ? ? 'expression tag' -1 55 
15 4CQM HIS O 7 ? UNP Q8N4T8 ? ? 'expression tag' 0  56 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'                                      ?                                            
'C2 H3 O2 -1'       59.044  
ALA 'L-peptide linking' y ALANINE                                            ?                                            
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                           ?                                            
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                         ?                                            
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                    ?                                            
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                           ?                                            
'C3 H7 N O2 S'      121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                     'ETHYLENE GLYCOL'                            
'C2 H6 O2'          62.068  
GLN 'L-peptide linking' y GLUTAMINE                                          ?                                            
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                    ?                                            
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                            ?                                            
'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                                           'GLYCERIN; PROPANE-1,2,3-TRIOL'              
'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                                          ?                                            
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                              ?                                            'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                         ?                                            
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                            ?                                            
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                             ?                                            
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                         ?                                            
'C5 H11 N O2 S'     149.211 
NAP non-polymer         . 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 
;2'-MONOPHOSPHOADENOSINE 5'-DIPHOSPHORIBOSE
;
'C21 H28 N7 O17 P3' 743.405 
OAS 'L-peptide linking' n O-ACETYLSERINE                                     ?                                            
'C5 H9 N O4'        147.129 
PHE 'L-peptide linking' y PHENYLALANINE                                      ?                                            
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                            ?                                            
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                             ?                                            
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                          ?                                            
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                         ?                                            
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                           ?                                            
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                             ?                                            
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4CQM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2 
_exptl_crystal.density_percent_sol   40 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '18% PEG3350, 0.4 M AMMONIUM ACETATE, 0.1 M SODIUM ACETATE PH 5.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS' 
_diffrn_detector.pdbx_collection_date   2013-09-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97950 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_wavelength             0.97950 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4CQM 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             49.25 
_reflns.d_resolution_high            2.34 
_reflns.number_obs                   283379 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.9 
_reflns.pdbx_Rmerge_I_obs            0.10 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        5.50 
_reflns.B_iso_Wilson_estimate        48.8 
_reflns.pdbx_redundancy              6.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.34 
_reflns_shell.d_res_low              2.48 
_reflns_shell.percent_possible_all   91.1 
_reflns_shell.Rmerge_I_obs           0.66 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.00 
_reflns_shell.pdbx_redundancy        1.8 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4CQM 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     148285 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.252 
_refine.ls_d_res_high                            2.339 
_refine.ls_percent_reflns_obs                    98.58 
_refine.ls_R_factor_obs                          0.2049 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2034 
_refine.ls_R_factor_R_free                       0.2355 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  7464 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      NONE 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       TWIN_LSQ_F 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 30.15 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        27716 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         758 
_refine_hist.number_atoms_solvent             806 
_refine_hist.number_atoms_total               29280 
_refine_hist.d_res_high                       2.339 
_refine_hist.d_res_low                        49.252 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.002  ? ? 28934 'X-RAY DIFFRACTION' ? 
f_angle_d          0.645  ? ? 39298 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.025 ? ? 10249 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.023  ? ? 4721  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.002  ? ? 5022  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.3389 2.3792  5915 0.3170 80.00 0.3486 . . 327 . . 
'X-RAY DIFFRACTION' . 2.3792 2.4225  7125 0.2856 95.00 0.3153 . . 373 . . 
'X-RAY DIFFRACTION' . 2.4225 2.4691  7061 0.2907 95.00 0.3169 . . 400 . . 
'X-RAY DIFFRACTION' . 2.4691 2.5195  7192 0.2773 95.00 0.3244 . . 345 . . 
'X-RAY DIFFRACTION' . 2.5195 2.5742  7137 0.2720 95.00 0.3001 . . 399 . . 
'X-RAY DIFFRACTION' . 2.5742 2.6341  7017 0.2736 95.00 0.3065 . . 389 . . 
'X-RAY DIFFRACTION' . 2.6341 2.7000  7118 0.2541 95.00 0.3031 . . 351 . . 
'X-RAY DIFFRACTION' . 2.7000 2.7729  7121 0.2494 95.00 0.2944 . . 397 . . 
'X-RAY DIFFRACTION' . 2.7729 2.8545  7138 0.2494 95.00 0.2959 . . 363 . . 
'X-RAY DIFFRACTION' . 2.8545 2.9466  7118 0.2326 95.00 0.2660 . . 392 . . 
'X-RAY DIFFRACTION' . 2.9466 3.0519  7188 0.2306 95.00 0.2763 . . 337 . . 
'X-RAY DIFFRACTION' . 3.0519 3.1740  7110 0.2208 95.00 0.2585 . . 379 . . 
'X-RAY DIFFRACTION' . 3.1740 3.3184  7141 0.2128 95.00 0.2656 . . 361 . . 
'X-RAY DIFFRACTION' . 3.3184 3.4932  7134 0.1978 95.00 0.2320 . . 337 . . 
'X-RAY DIFFRACTION' . 3.4932 3.7119  7085 0.1850 94.00 0.2051 . . 377 . . 
'X-RAY DIFFRACTION' . 3.7119 3.9982  7054 0.1767 94.00 0.2217 . . 380 . . 
'X-RAY DIFFRACTION' . 3.9982 4.4001  7021 0.1654 93.00 0.1886 . . 375 . . 
'X-RAY DIFFRACTION' . 4.4001 5.0356  7055 0.1587 94.00 0.1844 . . 373 . . 
'X-RAY DIFFRACTION' . 5.0356 6.3396  7092 0.1953 94.00 0.2323 . . 372 . . 
'X-RAY DIFFRACTION' . 6.3396 38.3159 7046 0.1624 93.00 0.1782 . . 375 . . 
# 
_struct.entry_id                  4CQM 
_struct.title                     'Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP' 
_struct.pdbx_descriptor           
'ESTRADIOL 17-BETA-DEHYDROGENASE 8 (E.C.1.1.1.62, 1.1.1.239, 1.1.1.100), CARBONYL REDUCTASE FAMILY MEMBER 4 (E.C.1.1.1.100)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4CQM 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;OXIDOREDUCTASE, KAR, KETOACYL REDUCTASE, 3-KETOACYL-ACP REDUCTASE, KE6, HSD8, 17-BETA HYDROXYSTEROID DEHYDROGENASE, HSD17B8, 3R-HYDROXYACYL-COA DEHYDROGENASE, CBR4, CARBOBYL REDUCTASE TYPE4, NAD, NADH, NADP, NADPH, HETERO TETRAMER
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 2 ? 
D  N N 3 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 2 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 1 ? 
Q  N N 4 ? 
R  N N 5 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 6 ? 
W  N N 4 ? 
X  N N 5 ? 
Y  N N 6 ? 
Z  N N 4 ? 
AA N N 6 ? 
BA N N 4 ? 
CA N N 4 ? 
DA N N 7 ? 
EA N N 4 ? 
FA N N 5 ? 
GA N N 6 ? 
HA N N 6 ? 
IA N N 4 ? 
JA N N 4 ? 
KA N N 4 ? 
LA N N 6 ? 
MA N N 4 ? 
NA N N 5 ? 
OA N N 6 ? 
PA N N 7 ? 
QA N N 4 ? 
RA N N 4 ? 
SA N N 4 ? 
TA N N 6 ? 
UA N N 7 ? 
VA N N 8 ? 
WA N N 8 ? 
XA N N 8 ? 
YA N N 8 ? 
ZA N N 8 ? 
AB N N 8 ? 
BB N N 8 ? 
CB N N 8 ? 
DB N N 8 ? 
EB N N 8 ? 
FB N N 8 ? 
GB N N 8 ? 
HB N N 8 ? 
IB N N 8 ? 
JB N N 8 ? 
KB N N 8 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 21  ? GLY A 33  ? SER A 21  GLY A 33  1 ? 13 
HELX_P HELX_P2   2   ASP A 44  ? ARG A 53  ? ASP A 44  ARG A 53  1 ? 10 
HELX_P HELX_P3   3   GLU A 78  ? SER A 94  ? GLU A 78  SER A 94  1 ? 17 
HELX_P HELX_P4   4   PHE A 111 ? MET A 115 ? PHE A 111 MET A 115 5 ? 5  
HELX_P HELX_P5   5   SER A 116 ? LEU A 128 ? SER A 116 LEU A 128 1 ? 13 
HELX_P HELX_P6   6   LEU A 128 ? SER A 144 ? LEU A 128 SER A 144 1 ? 17 
HELX_P HELX_P7   7   ILE A 157 ? GLY A 162 ? ILE A 157 GLY A 162 1 ? 6  
HELX_P HELX_P8   8   GLN A 166 ? GLY A 188 ? GLN A 166 GLY A 188 1 ? 23 
HELX_P HELX_P9   9   MET A 206 ? VAL A 210 ? MET A 206 VAL A 210 5 ? 5  
HELX_P HELX_P10  10  PRO A 211 ? ILE A 222 ? PRO A 211 ILE A 222 1 ? 12 
HELX_P HELX_P11  11  ASP A 229 ? SER A 242 ? ASP A 229 SER A 242 1 ? 14 
HELX_P HELX_P12  12  GLU A 243 ? GLY A 246 ? GLU A 243 GLY A 246 5 ? 4  
HELX_P HELX_P13  13  GLY B 20  ? ARG B 31  ? GLY B 13  ARG B 24  1 ? 12 
HELX_P HELX_P14  14  ASN B 42  ? LEU B 53  ? ASN B 35  LEU B 46  1 ? 12 
HELX_P HELX_P15  15  LYS B 66  ? LEU B 77  ? LYS B 59  LEU B 70  1 ? 12 
HELX_P HELX_P16  16  LYS B 103 ? LEU B 115 ? LYS B 96  LEU B 108 1 ? 13 
HELX_P HELX_P17  17  LEU B 115 ? GLN B 132 ? LEU B 108 GLN B 125 1 ? 18 
HELX_P HELX_P18  18  SER B 142 ? LEU B 146 ? SER B 135 LEU B 139 5 ? 5  
HELX_P HELX_P19  19  GLN B 152 ? VAL B 173 ? GLN B 145 VAL B 166 1 ? 22 
HELX_P HELX_P20  20  ALA B 174 ? LYS B 176 ? ALA B 167 LYS B 169 5 ? 3  
HELX_P HELX_P21  21  GLU B 212 ? SER B 226 ? GLU B 205 SER B 219 1 ? 15 
HELX_P HELX_P22  22  GLY B 239 ? ILE B 243 ? GLY B 232 ILE B 236 5 ? 5  
HELX_P HELX_P23  23  ARG C 19  ? GLY C 33  ? ARG C 12  GLY C 26  1 ? 15 
HELX_P HELX_P24  24  ASN C 42  ? ASP C 52  ? ASN C 35  ASP C 45  1 ? 11 
HELX_P HELX_P25  25  LYS C 66  ? LEU C 81  ? LYS C 59  LEU C 74  1 ? 16 
HELX_P HELX_P26  26  LEU C 98  ? THR C 102 ? LEU C 91  THR C 95  5 ? 5  
HELX_P HELX_P27  27  LYS C 103 ? ASN C 114 ? LYS C 96  ASN C 107 1 ? 12 
HELX_P HELX_P28  28  LEU C 115 ? ALA C 125 ? LEU C 108 ALA C 118 1 ? 11 
HELX_P HELX_P29  29  MET C 126 ? GLN C 131 ? MET C 119 GLN C 124 1 ? 6  
HELX_P HELX_P30  30  ILE C 143 ? GLY C 148 ? ILE C 136 GLY C 141 1 ? 6  
HELX_P HELX_P31  31  GLN C 152 ? ALA C 174 ? GLN C 145 ALA C 167 1 ? 23 
HELX_P HELX_P32  32  LYS C 197 ? LYS C 203 ? LYS C 190 LYS C 196 1 ? 7  
HELX_P HELX_P33  33  GLU C 212 ? SER C 226 ? GLU C 205 SER C 219 1 ? 15 
HELX_P HELX_P34  34  GLY C 239 ? ILE C 243 ? GLY C 232 ILE C 236 5 ? 5  
HELX_P HELX_P35  35  SER D 21  ? GLY D 33  ? SER D 21  GLY D 33  1 ? 13 
HELX_P HELX_P36  36  ASP D 44  ? LEU D 54  ? ASP D 44  LEU D 54  1 ? 11 
HELX_P HELX_P37  37  GLU D 78  ? PHE D 93  ? GLU D 78  PHE D 93  1 ? 16 
HELX_P HELX_P38  38  PHE D 111 ? MET D 115 ? PHE D 111 MET D 115 5 ? 5  
HELX_P HELX_P39  39  SER D 116 ? LEU D 128 ? SER D 116 LEU D 128 1 ? 13 
HELX_P HELX_P40  40  LEU D 128 ? GLY D 146 ? LEU D 128 GLY D 146 1 ? 19 
HELX_P HELX_P41  41  ILE D 157 ? GLY D 162 ? ILE D 157 GLY D 162 1 ? 6  
HELX_P HELX_P42  42  GLN D 166 ? LEU D 187 ? GLN D 166 LEU D 187 1 ? 22 
HELX_P HELX_P43  43  PRO D 211 ? ILE D 222 ? PRO D 211 ILE D 222 1 ? 12 
HELX_P HELX_P44  44  ASP D 229 ? SER D 242 ? ASP D 229 SER D 242 1 ? 14 
HELX_P HELX_P45  45  GLU D 243 ? GLY D 246 ? GLU D 243 GLY D 246 5 ? 4  
HELX_P HELX_P46  46  SER E 21  ? GLY E 33  ? SER E 21  GLY E 33  1 ? 13 
HELX_P HELX_P47  47  ASP E 44  ? LEU E 55  ? ASP E 44  LEU E 55  1 ? 12 
HELX_P HELX_P48  48  GLU E 78  ? SER E 94  ? GLU E 78  SER E 94  1 ? 17 
HELX_P HELX_P49  49  SER E 116 ? LEU E 128 ? SER E 116 LEU E 128 1 ? 13 
HELX_P HELX_P50  50  LEU E 128 ? GLY E 146 ? LEU E 128 GLY E 146 1 ? 19 
HELX_P HELX_P51  51  ILE E 157 ? GLY E 162 ? ILE E 157 GLY E 162 1 ? 6  
HELX_P HELX_P52  52  GLN E 166 ? GLY E 188 ? GLN E 166 GLY E 188 1 ? 23 
HELX_P HELX_P53  53  MET E 206 ? VAL E 210 ? MET E 206 VAL E 210 5 ? 5  
HELX_P HELX_P54  54  PRO E 211 ? ILE E 222 ? PRO E 211 ILE E 222 1 ? 12 
HELX_P HELX_P55  55  ASP E 229 ? SER E 242 ? ASP E 229 SER E 242 1 ? 14 
HELX_P HELX_P56  56  GLU E 243 ? GLY E 246 ? GLU E 243 GLY E 246 5 ? 4  
HELX_P HELX_P57  57  ARG F 19  ? LYS F 32  ? ARG F 12  LYS F 25  1 ? 14 
HELX_P HELX_P58  58  ASN F 42  ? GLY F 54  ? ASN F 35  GLY F 47  1 ? 13 
HELX_P HELX_P59  59  LYS F 66  ? LEU F 81  ? LYS F 59  LEU F 74  1 ? 16 
HELX_P HELX_P60  60  LEU F 98  ? THR F 102 ? LEU F 91  THR F 95  5 ? 5  
HELX_P HELX_P61  61  LYS F 103 ? LEU F 115 ? LYS F 96  LEU F 108 1 ? 13 
HELX_P HELX_P62  62  LEU F 115 ? GLN F 133 ? LEU F 108 GLN F 126 1 ? 19 
HELX_P HELX_P63  63  SER F 142 ? LYS F 147 ? SER F 135 LYS F 140 1 ? 6  
HELX_P HELX_P64  64  GLN F 152 ? ALA F 174 ? GLN F 145 ALA F 167 1 ? 23 
HELX_P HELX_P65  65  ASP F 191 ? ASP F 195 ? ASP F 184 ASP F 188 5 ? 5  
HELX_P HELX_P66  66  LYS F 197 ? LYS F 202 ? LYS F 190 LYS F 195 1 ? 6  
HELX_P HELX_P67  67  GLU F 212 ? SER F 226 ? GLU F 205 SER F 219 1 ? 15 
HELX_P HELX_P68  68  GLY F 239 ? ILE F 243 ? GLY F 232 ILE F 236 5 ? 5  
HELX_P HELX_P69  69  GLY G 20  ? LYS G 32  ? GLY G 13  LYS G 25  1 ? 13 
HELX_P HELX_P70  70  ASN G 42  ? ALA G 48  ? ASN G 35  ALA G 41  1 ? 7  
HELX_P HELX_P71  71  ALA G 49  ? ASP G 52  ? ALA G 42  ASP G 45  5 ? 4  
HELX_P HELX_P72  72  LYS G 66  ? LEU G 81  ? LYS G 59  LEU G 74  1 ? 16 
HELX_P HELX_P73  73  LYS G 103 ? ASN G 114 ? LYS G 96  ASN G 107 1 ? 12 
HELX_P HELX_P74  74  LEU G 115 ? MET G 126 ? LEU G 108 MET G 119 1 ? 12 
HELX_P HELX_P75  75  ARG G 127 ? GLN G 132 ? ARG G 120 GLN G 125 1 ? 6  
HELX_P HELX_P76  76  SER G 142 ? LEU G 146 ? SER G 135 LEU G 139 5 ? 5  
HELX_P HELX_P77  77  GLN G 152 ? ALA G 174 ? GLN G 145 ALA G 167 1 ? 23 
HELX_P HELX_P78  78  HIS G 200 ? ILE G 205 ? HIS G 193 ILE G 198 1 ? 6  
HELX_P HELX_P79  79  GLU G 212 ? SER G 226 ? GLU G 205 SER G 219 1 ? 15 
HELX_P HELX_P80  80  GLY G 239 ? ILE G 243 ? GLY G 232 ILE G 236 5 ? 5  
HELX_P HELX_P81  81  SER H 21  ? GLY H 33  ? SER H 21  GLY H 33  1 ? 13 
HELX_P HELX_P82  82  ASP H 44  ? LEU H 55  ? ASP H 44  LEU H 55  1 ? 12 
HELX_P HELX_P83  83  GLU H 78  ? SER H 94  ? GLU H 78  SER H 94  1 ? 17 
HELX_P HELX_P84  84  SER H 116 ? LEU H 128 ? SER H 116 LEU H 128 1 ? 13 
HELX_P HELX_P85  85  LEU H 128 ? ASN H 145 ? LEU H 128 ASN H 145 1 ? 18 
HELX_P HELX_P86  86  ILE H 157 ? GLY H 162 ? ILE H 157 GLY H 162 1 ? 6  
HELX_P HELX_P87  87  GLN H 166 ? LEU H 187 ? GLN H 166 LEU H 187 1 ? 22 
HELX_P HELX_P88  88  GLY H 188 ? HIS H 190 ? GLY H 188 HIS H 190 5 ? 3  
HELX_P HELX_P89  89  THR H 204 ? LYS H 209 ? THR H 204 LYS H 209 1 ? 6  
HELX_P HELX_P90  90  PRO H 211 ? ILE H 222 ? PRO H 211 ILE H 222 1 ? 12 
HELX_P HELX_P91  91  ASP H 229 ? SER H 242 ? ASP H 229 SER H 242 1 ? 14 
HELX_P HELX_P92  92  SER I 21  ? GLU I 34  ? SER I 21  GLU I 34  1 ? 14 
HELX_P HELX_P93  93  ASP I 44  ? LEU I 54  ? ASP I 44  LEU I 54  1 ? 11 
HELX_P HELX_P94  94  GLU I 78  ? SER I 94  ? GLU I 78  SER I 94  1 ? 17 
HELX_P HELX_P95  95  PHE I 111 ? MET I 115 ? PHE I 111 MET I 115 5 ? 5  
HELX_P HELX_P96  96  SER I 116 ? LEU I 128 ? SER I 116 LEU I 128 1 ? 13 
HELX_P HELX_P97  97  LEU I 128 ? SER I 144 ? LEU I 128 SER I 144 1 ? 17 
HELX_P HELX_P98  98  ILE I 157 ? GLY I 162 ? ILE I 157 GLY I 162 1 ? 6  
HELX_P HELX_P99  99  GLN I 166 ? LEU I 187 ? GLN I 166 LEU I 187 1 ? 22 
HELX_P HELX_P100 100 GLY I 188 ? HIS I 190 ? GLY I 188 HIS I 190 5 ? 3  
HELX_P HELX_P101 101 MET I 206 ? VAL I 210 ? MET I 206 VAL I 210 5 ? 5  
HELX_P HELX_P102 102 PRO I 211 ? GLU I 220 ? PRO I 211 GLU I 220 1 ? 10 
HELX_P HELX_P103 103 ASP I 229 ? SER I 242 ? ASP I 229 SER I 242 1 ? 14 
HELX_P HELX_P104 104 GLU I 243 ? GLY I 246 ? GLU I 243 GLY I 246 5 ? 4  
HELX_P HELX_P105 105 GLY J 20  ? LYS J 32  ? GLY J 13  LYS J 25  1 ? 13 
HELX_P HELX_P106 106 ASN J 42  ? ASP J 52  ? ASN J 35  ASP J 45  1 ? 11 
HELX_P HELX_P107 107 LYS J 66  ? GLY J 82  ? LYS J 59  GLY J 75  1 ? 17 
HELX_P HELX_P108 108 LEU J 98  ? THR J 102 ? LEU J 91  THR J 95  5 ? 5  
HELX_P HELX_P109 109 LYS J 103 ? LEU J 115 ? LYS J 96  LEU J 108 1 ? 13 
HELX_P HELX_P110 110 LEU J 115 ? GLN J 131 ? LEU J 108 GLN J 124 1 ? 17 
HELX_P HELX_P111 111 ILE J 143 ? GLY J 148 ? ILE J 136 GLY J 141 1 ? 6  
HELX_P HELX_P112 112 GLN J 152 ? ALA J 174 ? GLN J 145 ALA J 167 1 ? 23 
HELX_P HELX_P113 113 LYS J 197 ? LYS J 203 ? LYS J 190 LYS J 196 1 ? 7  
HELX_P HELX_P114 114 GLU J 212 ? GLU J 225 ? GLU J 205 GLU J 218 1 ? 14 
HELX_P HELX_P115 115 GLY J 239 ? ILE J 243 ? GLY J 232 ILE J 236 5 ? 5  
HELX_P HELX_P116 116 ARG K 19  ? GLY K 33  ? ARG K 12  GLY K 26  1 ? 15 
HELX_P HELX_P117 117 ASN K 42  ? ASP K 52  ? ASN K 35  ASP K 45  1 ? 11 
HELX_P HELX_P118 118 LYS K 66  ? LEU K 81  ? LYS K 59  LEU K 74  1 ? 16 
HELX_P HELX_P119 119 LYS K 103 ? LEU K 115 ? LYS K 96  LEU K 108 1 ? 13 
HELX_P HELX_P120 120 LEU K 115 ? ALA K 125 ? LEU K 108 ALA K 118 1 ? 11 
HELX_P HELX_P121 121 ALA K 125 ? GLN K 132 ? ALA K 118 GLN K 125 1 ? 8  
HELX_P HELX_P122 122 ILE K 143 ? GLY K 148 ? ILE K 136 GLY K 141 1 ? 6  
HELX_P HELX_P123 123 GLN K 152 ? ALA K 174 ? GLN K 145 ALA K 167 1 ? 23 
HELX_P HELX_P124 124 GLU K 198 ? LYS K 203 ? GLU K 191 LYS K 196 1 ? 6  
HELX_P HELX_P125 125 GLU K 212 ? SER K 226 ? GLU K 205 SER K 219 1 ? 15 
HELX_P HELX_P126 126 GLY K 239 ? ILE K 243 ? GLY K 232 ILE K 236 5 ? 5  
HELX_P HELX_P127 127 SER L 21  ? GLY L 33  ? SER L 21  GLY L 33  1 ? 13 
HELX_P HELX_P128 128 ASP L 44  ? LEU L 55  ? ASP L 44  LEU L 55  1 ? 12 
HELX_P HELX_P129 129 GLU L 78  ? PHE L 93  ? GLU L 78  PHE L 93  1 ? 16 
HELX_P HELX_P130 130 PHE L 111 ? MET L 115 ? PHE L 111 MET L 115 5 ? 5  
HELX_P HELX_P131 131 SER L 116 ? LEU L 128 ? SER L 116 LEU L 128 1 ? 13 
HELX_P HELX_P132 132 LEU L 128 ? ASN L 145 ? LEU L 128 ASN L 145 1 ? 18 
HELX_P HELX_P133 133 ILE L 157 ? GLY L 162 ? ILE L 157 GLY L 162 1 ? 6  
HELX_P HELX_P134 134 GLN L 166 ? LEU L 187 ? GLN L 166 LEU L 187 1 ? 22 
HELX_P HELX_P135 135 GLY L 188 ? HIS L 190 ? GLY L 188 HIS L 190 5 ? 3  
HELX_P HELX_P136 136 PRO L 211 ? ILE L 222 ? PRO L 211 ILE L 222 1 ? 12 
HELX_P HELX_P137 137 ASP L 229 ? SER L 242 ? ASP L 229 SER L 242 1 ? 14 
HELX_P HELX_P138 138 GLU L 243 ? GLY L 246 ? GLU L 243 GLY L 246 5 ? 4  
HELX_P HELX_P139 139 SER M 21  ? GLU M 34  ? SER M 21  GLU M 34  1 ? 14 
HELX_P HELX_P140 140 ASP M 44  ? LEU M 55  ? ASP M 44  LEU M 55  1 ? 12 
HELX_P HELX_P141 141 GLU M 78  ? SER M 94  ? GLU M 78  SER M 94  1 ? 17 
HELX_P HELX_P142 142 PHE M 111 ? MET M 115 ? PHE M 111 MET M 115 5 ? 5  
HELX_P HELX_P143 143 SER M 116 ? LEU M 128 ? SER M 116 LEU M 128 1 ? 13 
HELX_P HELX_P144 144 LEU M 128 ? GLY M 146 ? LEU M 128 GLY M 146 1 ? 19 
HELX_P HELX_P145 145 ILE M 157 ? GLY M 162 ? ILE M 157 GLY M 162 1 ? 6  
HELX_P HELX_P146 146 GLN M 166 ? GLY M 188 ? GLN M 166 GLY M 188 1 ? 23 
HELX_P HELX_P147 147 MET M 206 ? VAL M 210 ? MET M 206 VAL M 210 5 ? 5  
HELX_P HELX_P148 148 PRO M 211 ? ILE M 222 ? PRO M 211 ILE M 222 1 ? 12 
HELX_P HELX_P149 149 ASP M 229 ? SER M 242 ? ASP M 229 SER M 242 1 ? 14 
HELX_P HELX_P150 150 GLU M 243 ? GLY M 246 ? GLU M 243 GLY M 246 5 ? 4  
HELX_P HELX_P151 151 ARG N 19  ? LYS N 32  ? ARG N 12  LYS N 25  1 ? 14 
HELX_P HELX_P152 152 ASN N 42  ? ASP N 52  ? ASN N 35  ASP N 45  1 ? 11 
HELX_P HELX_P153 153 LYS N 66  ? GLU N 78  ? LYS N 59  GLU N 71  1 ? 13 
HELX_P HELX_P154 154 LYS N 103 ? LEU N 115 ? LYS N 96  LEU N 108 1 ? 13 
HELX_P HELX_P155 155 LEU N 115 ? GLN N 133 ? LEU N 108 GLN N 126 1 ? 19 
HELX_P HELX_P156 156 ILE N 143 ? GLY N 148 ? ILE N 136 GLY N 141 1 ? 6  
HELX_P HELX_P157 157 GLN N 152 ? ALA N 174 ? GLN N 145 ALA N 167 1 ? 23 
HELX_P HELX_P158 158 HIS N 200 ? ILE N 205 ? HIS N 193 ILE N 198 5 ? 6  
HELX_P HELX_P159 159 GLU N 212 ? SER N 226 ? GLU N 205 SER N 219 1 ? 15 
HELX_P HELX_P160 160 GLY N 239 ? ILE N 243 ? GLY N 232 ILE N 236 5 ? 5  
HELX_P HELX_P161 161 ARG O 19  ? ARG O 31  ? ARG O 12  ARG O 24  1 ? 13 
HELX_P HELX_P162 162 ASN O 42  ? GLY O 51  ? ASN O 35  GLY O 44  1 ? 10 
HELX_P HELX_P163 163 LYS O 66  ? LEU O 81  ? LYS O 59  LEU O 74  1 ? 16 
HELX_P HELX_P164 164 LEU O 98  ? THR O 102 ? LEU O 91  THR O 95  5 ? 5  
HELX_P HELX_P165 165 LYS O 103 ? ASN O 114 ? LYS O 96  ASN O 107 1 ? 12 
HELX_P HELX_P166 166 LEU O 115 ? GLN O 133 ? LEU O 108 GLN O 126 1 ? 19 
HELX_P HELX_P167 167 ILE O 143 ? GLY O 148 ? ILE O 136 GLY O 141 1 ? 6  
HELX_P HELX_P168 168 GLN O 152 ? ALA O 174 ? GLN O 145 ALA O 167 1 ? 23 
HELX_P HELX_P169 169 LYS O 197 ? LYS O 203 ? LYS O 190 LYS O 196 1 ? 7  
HELX_P HELX_P170 170 GLU O 212 ? GLU O 225 ? GLU O 205 GLU O 218 1 ? 14 
HELX_P HELX_P171 171 GLY O 239 ? ILE O 243 ? GLY O 232 ILE O 236 5 ? 5  
HELX_P HELX_P172 172 SER P 21  ? GLU P 34  ? SER P 21  GLU P 34  1 ? 14 
HELX_P HELX_P173 173 ASP P 44  ? LEU P 54  ? ASP P 44  LEU P 54  1 ? 11 
HELX_P HELX_P174 174 GLU P 78  ? SER P 94  ? GLU P 78  SER P 94  1 ? 17 
HELX_P HELX_P175 175 PHE P 111 ? MET P 115 ? PHE P 111 MET P 115 5 ? 5  
HELX_P HELX_P176 176 SER P 116 ? GLY P 146 ? SER P 116 GLY P 146 1 ? 31 
HELX_P HELX_P177 177 ILE P 157 ? GLY P 162 ? ILE P 157 GLY P 162 1 ? 6  
HELX_P HELX_P178 178 GLN P 166 ? LEU P 187 ? GLN P 166 LEU P 187 1 ? 22 
HELX_P HELX_P179 179 GLY P 188 ? HIS P 190 ? GLY P 188 HIS P 190 5 ? 3  
HELX_P HELX_P180 180 MET P 206 ? VAL P 210 ? MET P 206 VAL P 210 5 ? 5  
HELX_P HELX_P181 181 PRO P 211 ? ILE P 222 ? PRO P 211 ILE P 222 1 ? 12 
HELX_P HELX_P182 182 ASP P 229 ? SER P 242 ? ASP P 229 SER P 242 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? D SER 155 C ? ? ? 1_555 D OAS 156 N ? ? D SER 155 D OAS 156 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale2 covale ? ? D OAS 156 C ? ? ? 1_555 D ILE 157 N ? ? D OAS 156 D ILE 157 1_555 ? ? ? ? ? ? ? 1.331 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 7 ? 
BA ? 7 ? 
CA ? 7 ? 
DA ? 7 ? 
EA ? 7 ? 
FA ? 7 ? 
GA ? 7 ? 
HA ? 7 ? 
IA ? 7 ? 
JA ? 7 ? 
KA ? 7 ? 
LA ? 7 ? 
MA ? 7 ? 
NA ? 7 ? 
OA ? 7 ? 
PA ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel 
AA 2 3 ? parallel 
AA 3 4 ? parallel 
AA 4 5 ? parallel 
AA 5 6 ? parallel 
AA 6 7 ? parallel 
BA 1 2 ? parallel 
BA 2 3 ? parallel 
BA 3 4 ? parallel 
BA 4 5 ? parallel 
BA 5 6 ? parallel 
BA 6 7 ? parallel 
CA 1 2 ? parallel 
CA 2 3 ? parallel 
CA 3 4 ? parallel 
CA 4 5 ? parallel 
CA 5 6 ? parallel 
CA 6 7 ? parallel 
DA 1 2 ? parallel 
DA 2 3 ? parallel 
DA 3 4 ? parallel 
DA 4 5 ? parallel 
DA 5 6 ? parallel 
DA 6 7 ? parallel 
EA 1 2 ? parallel 
EA 2 3 ? parallel 
EA 3 4 ? parallel 
EA 4 5 ? parallel 
EA 5 6 ? parallel 
EA 6 7 ? parallel 
FA 1 2 ? parallel 
FA 2 3 ? parallel 
FA 3 4 ? parallel 
FA 4 5 ? parallel 
FA 5 6 ? parallel 
FA 6 7 ? parallel 
GA 1 2 ? parallel 
GA 2 3 ? parallel 
GA 3 4 ? parallel 
GA 4 5 ? parallel 
GA 5 6 ? parallel 
GA 6 7 ? parallel 
HA 1 2 ? parallel 
HA 2 3 ? parallel 
HA 3 4 ? parallel 
HA 4 5 ? parallel 
HA 5 6 ? parallel 
HA 6 7 ? parallel 
IA 1 2 ? parallel 
IA 2 3 ? parallel 
IA 3 4 ? parallel 
IA 4 5 ? parallel 
IA 5 6 ? parallel 
IA 6 7 ? parallel 
JA 1 2 ? parallel 
JA 2 3 ? parallel 
JA 3 4 ? parallel 
JA 4 5 ? parallel 
JA 5 6 ? parallel 
JA 6 7 ? parallel 
KA 1 2 ? parallel 
KA 2 3 ? parallel 
KA 3 4 ? parallel 
KA 4 5 ? parallel 
KA 5 6 ? parallel 
KA 6 7 ? parallel 
LA 1 2 ? parallel 
LA 2 3 ? parallel 
LA 3 4 ? parallel 
LA 4 5 ? parallel 
LA 5 6 ? parallel 
LA 6 7 ? parallel 
MA 1 2 ? parallel 
MA 2 3 ? parallel 
MA 3 4 ? parallel 
MA 4 5 ? parallel 
MA 5 6 ? parallel 
MA 6 7 ? parallel 
NA 1 2 ? parallel 
NA 2 3 ? parallel 
NA 3 4 ? parallel 
NA 4 5 ? parallel 
NA 5 6 ? parallel 
NA 6 7 ? parallel 
OA 1 2 ? parallel 
OA 2 3 ? parallel 
OA 3 4 ? parallel 
OA 4 5 ? parallel 
OA 5 6 ? parallel 
OA 6 7 ? parallel 
PA 1 2 ? parallel 
PA 2 3 ? parallel 
PA 3 4 ? parallel 
PA 4 5 ? parallel 
PA 5 6 ? parallel 
PA 6 7 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ALA A 70  ? GLN A 73  ? ALA A 70  GLN A 73  
AA 2 THR A 37  ? ASP A 42  ? THR A 37  ASP A 42  
AA 3 LEU A 13  ? THR A 17  ? LEU A 13  THR A 17  
AA 4 VAL A 99  ? SER A 102 ? VAL A 99  SER A 102 
AA 5 GLY A 149 ? ILE A 154 ? GLY A 149 ILE A 154 
AA 6 ILE A 192 ? PRO A 199 ? ILE A 192 PRO A 199 
AA 7 SER A 252 ? VAL A 255 ? SER A 252 VAL A 255 
BA 1 LEU B 58  ? SER B 61  ? LEU B 51  SER B 54  
BA 2 ARG B 35  ? ALA B 40  ? ARG B 28  ALA B 33  
BA 3 VAL B 11  ? PHE B 15  ? VAL B 4   PHE B 8   
BA 4 VAL B 84  ? ASN B 89  ? VAL B 77  ASN B 82  
BA 5 GLY B 135 ? VAL B 140 ? GLY B 128 VAL B 133 
BA 6 ILE B 178 ? PRO B 185 ? ILE B 171 PRO B 178 
BA 7 VAL B 233 ? VAL B 236 ? VAL B 226 VAL B 229 
CA 1 LEU C 58  ? SER C 61  ? LEU C 51  SER C 54  
CA 2 ARG C 35  ? ALA C 40  ? ARG C 28  ALA C 33  
CA 3 VAL C 11  ? PHE C 15  ? VAL C 4   PHE C 8   
CA 4 VAL C 84  ? ASN C 89  ? VAL C 77  ASN C 82  
CA 5 GLY C 135 ? VAL C 140 ? GLY C 128 VAL C 133 
CA 6 ILE C 178 ? PRO C 185 ? ILE C 171 PRO C 178 
CA 7 VAL C 233 ? VAL C 236 ? VAL C 226 VAL C 229 
DA 1 ALA D 70  ? GLN D 73  ? ALA D 70  GLN D 73  
DA 2 ALA D 36  ? ASP D 42  ? ALA D 36  ASP D 42  
DA 3 ALA D 12  ? THR D 17  ? ALA D 12  THR D 17  
DA 4 VAL D 99  ? SER D 102 ? VAL D 99  SER D 102 
DA 5 GLY D 149 ? ILE D 154 ? GLY D 149 ILE D 154 
DA 6 ILE D 192 ? PRO D 199 ? ILE D 192 PRO D 199 
DA 7 SER D 252 ? VAL D 255 ? SER D 252 VAL D 255 
EA 1 ALA E 70  ? GLN E 73  ? ALA E 70  GLN E 73  
EA 2 THR E 37  ? ASP E 42  ? THR E 37  ASP E 42  
EA 3 LEU E 13  ? THR E 17  ? LEU E 13  THR E 17  
EA 4 VAL E 99  ? SER E 102 ? VAL E 99  SER E 102 
EA 5 GLY E 149 ? ILE E 154 ? GLY E 149 ILE E 154 
EA 6 ILE E 192 ? PRO E 199 ? ILE E 192 PRO E 199 
EA 7 SER E 252 ? VAL E 255 ? SER E 252 VAL E 255 
FA 1 LEU F 58  ? SER F 61  ? LEU F 51  SER F 54  
FA 2 ARG F 35  ? ALA F 40  ? ARG F 28  ALA F 33  
FA 3 VAL F 11  ? PHE F 15  ? VAL F 4   PHE F 8   
FA 4 PHE F 86  ? ASN F 89  ? PHE F 79  ASN F 82  
FA 5 GLY F 135 ? VAL F 140 ? GLY F 128 VAL F 133 
FA 6 ILE F 178 ? PRO F 185 ? ILE F 171 PRO F 178 
FA 7 VAL F 233 ? VAL F 236 ? VAL F 226 VAL F 229 
GA 1 LEU G 58  ? SER G 61  ? LEU G 51  SER G 54  
GA 2 ALA G 37  ? ALA G 40  ? ALA G 30  ALA G 33  
GA 3 ALA G 13  ? PHE G 15  ? ALA G 6   PHE G 8   
GA 4 PHE G 86  ? ASN G 89  ? PHE G 79  ASN G 82  
GA 5 GLY G 135 ? VAL G 140 ? GLY G 128 VAL G 133 
GA 6 ILE G 178 ? PRO G 185 ? ILE G 171 PRO G 178 
GA 7 VAL G 233 ? VAL G 236 ? VAL G 226 VAL G 229 
HA 1 ALA H 70  ? GLN H 73  ? ALA H 70  GLN H 73  
HA 2 THR H 37  ? ASP H 42  ? THR H 37  ASP H 42  
HA 3 LEU H 13  ? THR H 17  ? LEU H 13  THR H 17  
HA 4 VAL H 99  ? SER H 102 ? VAL H 99  SER H 102 
HA 5 GLY H 149 ? ILE H 154 ? GLY H 149 ILE H 154 
HA 6 ILE H 192 ? PRO H 199 ? ILE H 192 PRO H 199 
HA 7 SER H 252 ? VAL H 255 ? SER H 252 VAL H 255 
IA 1 ALA I 70  ? GLN I 73  ? ALA I 70  GLN I 73  
IA 2 THR I 37  ? ASP I 42  ? THR I 37  ASP I 42  
IA 3 LEU I 13  ? THR I 17  ? LEU I 13  THR I 17  
IA 4 VAL I 99  ? SER I 102 ? VAL I 99  SER I 102 
IA 5 GLY I 149 ? ILE I 154 ? GLY I 149 ILE I 154 
IA 6 ILE I 192 ? PRO I 199 ? ILE I 192 PRO I 199 
IA 7 THR I 251 ? VAL I 255 ? THR I 251 VAL I 255 
JA 1 LEU J 58  ? SER J 61  ? LEU J 51  SER J 54  
JA 2 ARG J 35  ? ALA J 40  ? ARG J 28  ALA J 33  
JA 3 VAL J 11  ? PHE J 15  ? VAL J 4   PHE J 8   
JA 4 PHE J 86  ? ASN J 89  ? PHE J 79  ASN J 82  
JA 5 GLY J 135 ? VAL J 140 ? GLY J 128 VAL J 133 
JA 6 ILE J 178 ? PRO J 185 ? ILE J 171 PRO J 178 
JA 7 VAL J 233 ? VAL J 236 ? VAL J 226 VAL J 229 
KA 1 LEU K 58  ? SER K 61  ? LEU K 51  SER K 54  
KA 2 ARG K 35  ? ALA K 40  ? ARG K 28  ALA K 33  
KA 3 VAL K 11  ? PHE K 15  ? VAL K 4   PHE K 8   
KA 4 PHE K 86  ? ASN K 89  ? PHE K 79  ASN K 82  
KA 5 GLY K 135 ? VAL K 140 ? GLY K 128 VAL K 133 
KA 6 ILE K 178 ? PRO K 185 ? ILE K 171 PRO K 178 
KA 7 VAL K 233 ? VAL K 236 ? VAL K 226 VAL K 229 
LA 1 ALA L 70  ? GLN L 73  ? ALA L 70  GLN L 73  
LA 2 THR L 37  ? ASP L 42  ? THR L 37  ASP L 42  
LA 3 LEU L 13  ? THR L 17  ? LEU L 13  THR L 17  
LA 4 VAL L 99  ? SER L 102 ? VAL L 99  SER L 102 
LA 5 GLY L 149 ? ILE L 154 ? GLY L 149 ILE L 154 
LA 6 ILE L 192 ? PRO L 199 ? ILE L 192 PRO L 199 
LA 7 SER L 252 ? VAL L 255 ? SER L 252 VAL L 255 
MA 1 ALA M 70  ? GLN M 73  ? ALA M 70  GLN M 73  
MA 2 THR M 37  ? ASP M 42  ? THR M 37  ASP M 42  
MA 3 LEU M 13  ? THR M 17  ? LEU M 13  THR M 17  
MA 4 VAL M 99  ? SER M 102 ? VAL M 99  SER M 102 
MA 5 GLY M 149 ? ILE M 154 ? GLY M 149 ILE M 154 
MA 6 ILE M 192 ? PRO M 199 ? ILE M 192 PRO M 199 
MA 7 SER M 252 ? VAL M 255 ? SER M 252 VAL M 255 
NA 1 LEU N 58  ? SER N 61  ? LEU N 51  SER N 54  
NA 2 ARG N 35  ? ALA N 40  ? ARG N 28  ALA N 33  
NA 3 VAL N 11  ? PHE N 15  ? VAL N 4   PHE N 8   
NA 4 PHE N 86  ? ASN N 89  ? PHE N 79  ASN N 82  
NA 5 GLY N 135 ? VAL N 140 ? GLY N 128 VAL N 133 
NA 6 ILE N 178 ? PRO N 185 ? ILE N 171 PRO N 178 
NA 7 VAL N 233 ? VAL N 236 ? VAL N 226 VAL N 229 
OA 1 LEU O 58  ? SER O 61  ? LEU O 51  SER O 54  
OA 2 ARG O 35  ? ALA O 40  ? ARG O 28  ALA O 33  
OA 3 VAL O 11  ? PHE O 15  ? VAL O 4   PHE O 8   
OA 4 PHE O 86  ? ASN O 89  ? PHE O 79  ASN O 82  
OA 5 GLY O 135 ? VAL O 140 ? GLY O 128 VAL O 133 
OA 6 ILE O 178 ? PRO O 185 ? ILE O 171 PRO O 178 
OA 7 VAL O 233 ? VAL O 236 ? VAL O 226 VAL O 229 
PA 1 ALA P 70  ? GLN P 73  ? ALA P 70  GLN P 73  
PA 2 THR P 37  ? ASP P 42  ? THR P 37  ASP P 42  
PA 3 LEU P 13  ? THR P 17  ? LEU P 13  THR P 17  
PA 4 VAL P 99  ? SER P 102 ? VAL P 99  SER P 102 
PA 5 GLY P 149 ? ILE P 154 ? GLY P 149 ILE P 154 
PA 6 ILE P 192 ? PRO P 199 ? ILE P 192 PRO P 199 
PA 7 SER P 252 ? VAL P 255 ? SER P 252 VAL P 255 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ALA A 70  ? N ALA A 70  O VAL A 38  ? O VAL A 38  
AA 2 3 N ALA A 39  ? N ALA A 39  O ALA A 14  ? O ALA A 14  
AA 3 4 N LEU A 15  ? N LEU A 15  O VAL A 99  ? O VAL A 99  
AA 4 5 N VAL A 100 ? N VAL A 100 O SER A 150 ? O SER A 150 
AA 5 6 N ILE A 151 ? N ILE A 151 O ARG A 193 ? O ARG A 193 
AA 6 7 N LEU A 198 ? N LEU A 198 O VAL A 253 ? O VAL A 253 
BA 1 2 N LEU B 58  ? N LEU B 51  O LEU B 36  ? O LEU B 29  
BA 2 3 N ALA B 37  ? N ALA B 30  O CYS B 12  ? O CYS B 5   
BA 3 4 O VAL B 11  ? O VAL B 4   N ASN B 85  ? N ASN B 78  
BA 4 5 N LEU B 87  ? N LEU B 80  O SER B 136 ? O SER B 129 
BA 5 6 N ILE B 137 ? N ILE B 130 O ARG B 179 ? O ARG B 172 
BA 6 7 N ALA B 184 ? N ALA B 177 O LEU B 234 ? O LEU B 227 
CA 1 2 N LEU C 58  ? N LEU C 51  O LEU C 36  ? O LEU C 29  
CA 2 3 N ALA C 37  ? N ALA C 30  O CYS C 12  ? O CYS C 5   
CA 3 4 O VAL C 11  ? O VAL C 4   N ASN C 85  ? N ASN C 78  
CA 4 5 N LEU C 87  ? N LEU C 80  O SER C 136 ? O SER C 129 
CA 5 6 N ILE C 137 ? N ILE C 130 O ARG C 179 ? O ARG C 172 
CA 6 7 N ALA C 184 ? N ALA C 177 O LEU C 234 ? O LEU C 227 
DA 1 2 N ALA D 70  ? N ALA D 70  O VAL D 38  ? O VAL D 38  
DA 2 3 N THR D 37  ? N THR D 37  O ALA D 12  ? O ALA D 12  
DA 3 4 N LEU D 15  ? N LEU D 15  O VAL D 99  ? O VAL D 99  
DA 4 5 N VAL D 100 ? N VAL D 100 O SER D 150 ? O SER D 150 
DA 5 6 N ILE D 151 ? N ILE D 151 O ARG D 193 ? O ARG D 193 
DA 6 7 N LEU D 198 ? N LEU D 198 O VAL D 253 ? O VAL D 253 
EA 1 2 N ALA E 70  ? N ALA E 70  O VAL E 38  ? O VAL E 38  
EA 2 3 N ALA E 39  ? N ALA E 39  O ALA E 14  ? O ALA E 14  
EA 3 4 N LEU E 15  ? N LEU E 15  O VAL E 99  ? O VAL E 99  
EA 4 5 N VAL E 100 ? N VAL E 100 O SER E 150 ? O SER E 150 
EA 5 6 N ILE E 151 ? N ILE E 151 O ARG E 193 ? O ARG E 193 
EA 6 7 N LEU E 198 ? N LEU E 198 O VAL E 253 ? O VAL E 253 
FA 1 2 N LEU F 58  ? N LEU F 51  O LEU F 36  ? O LEU F 29  
FA 2 3 N ALA F 37  ? N ALA F 30  O CYS F 12  ? O CYS F 5   
FA 3 4 N ALA F 13  ? N ALA F 6   O PHE F 86  ? O PHE F 79  
FA 4 5 N LEU F 87  ? N LEU F 80  O SER F 136 ? O SER F 129 
FA 5 6 N ILE F 137 ? N ILE F 130 O ARG F 179 ? O ARG F 172 
FA 6 7 N ALA F 184 ? N ALA F 177 O LEU F 234 ? O LEU F 227 
GA 1 2 N PHE G 60  ? N PHE G 53  O VAL G 38  ? O VAL G 31  
GA 2 3 N ILE G 39  ? N ILE G 32  O VAL G 14  ? O VAL G 7   
GA 3 4 N ALA G 13  ? N ALA G 6   O PHE G 86  ? O PHE G 79  
GA 4 5 N LEU G 87  ? N LEU G 80  O SER G 136 ? O SER G 129 
GA 5 6 N ILE G 137 ? N ILE G 130 O ARG G 179 ? O ARG G 172 
GA 6 7 N ALA G 184 ? N ALA G 177 O LEU G 234 ? O LEU G 227 
HA 1 2 N ALA H 70  ? N ALA H 70  O VAL H 38  ? O VAL H 38  
HA 2 3 N ALA H 39  ? N ALA H 39  O ALA H 14  ? O ALA H 14  
HA 3 4 N LEU H 15  ? N LEU H 15  O VAL H 99  ? O VAL H 99  
HA 4 5 N VAL H 100 ? N VAL H 100 O SER H 150 ? O SER H 150 
HA 5 6 N ILE H 151 ? N ILE H 151 O ARG H 193 ? O ARG H 193 
HA 6 7 N LEU H 198 ? N LEU H 198 O VAL H 253 ? O VAL H 253 
IA 1 2 N ALA I 70  ? N ALA I 70  O VAL I 38  ? O VAL I 38  
IA 2 3 N ALA I 39  ? N ALA I 39  O ALA I 14  ? O ALA I 14  
IA 3 4 N LEU I 15  ? N LEU I 15  O VAL I 99  ? O VAL I 99  
IA 4 5 N VAL I 100 ? N VAL I 100 O SER I 150 ? O SER I 150 
IA 5 6 N ILE I 151 ? N ILE I 151 O ARG I 193 ? O ARG I 193 
IA 6 7 N SER I 196 ? N SER I 196 O THR I 251 ? O THR I 251 
JA 1 2 N LEU J 58  ? N LEU J 51  O LEU J 36  ? O LEU J 29  
JA 2 3 N ALA J 37  ? N ALA J 30  O CYS J 12  ? O CYS J 5   
JA 3 4 N ALA J 13  ? N ALA J 6   O PHE J 86  ? O PHE J 79  
JA 4 5 N LEU J 87  ? N LEU J 80  O SER J 136 ? O SER J 129 
JA 5 6 N ILE J 137 ? N ILE J 130 O ARG J 179 ? O ARG J 172 
JA 6 7 N ALA J 184 ? N ALA J 177 O LEU J 234 ? O LEU J 227 
KA 1 2 N LEU K 58  ? N LEU K 51  O LEU K 36  ? O LEU K 29  
KA 2 3 N ALA K 37  ? N ALA K 30  O CYS K 12  ? O CYS K 5   
KA 3 4 N ALA K 13  ? N ALA K 6   O PHE K 86  ? O PHE K 79  
KA 4 5 N LEU K 87  ? N LEU K 80  O SER K 136 ? O SER K 129 
KA 5 6 N ILE K 137 ? N ILE K 130 O ARG K 179 ? O ARG K 172 
KA 6 7 N ALA K 184 ? N ALA K 177 O LEU K 234 ? O LEU K 227 
LA 1 2 N ALA L 70  ? N ALA L 70  O VAL L 38  ? O VAL L 38  
LA 2 3 N ALA L 39  ? N ALA L 39  O ALA L 14  ? O ALA L 14  
LA 3 4 N LEU L 15  ? N LEU L 15  O VAL L 99  ? O VAL L 99  
LA 4 5 N VAL L 100 ? N VAL L 100 O SER L 150 ? O SER L 150 
LA 5 6 N ILE L 151 ? N ILE L 151 O ARG L 193 ? O ARG L 193 
LA 6 7 N LEU L 198 ? N LEU L 198 O VAL L 253 ? O VAL L 253 
MA 1 2 N ALA M 70  ? N ALA M 70  O VAL M 38  ? O VAL M 38  
MA 2 3 N ALA M 39  ? N ALA M 39  O ALA M 14  ? O ALA M 14  
MA 3 4 N LEU M 15  ? N LEU M 15  O VAL M 99  ? O VAL M 99  
MA 4 5 N VAL M 100 ? N VAL M 100 O SER M 150 ? O SER M 150 
MA 5 6 N ILE M 151 ? N ILE M 151 O ARG M 193 ? O ARG M 193 
MA 6 7 N LEU M 198 ? N LEU M 198 O VAL M 253 ? O VAL M 253 
NA 1 2 N LEU N 58  ? N LEU N 51  O LEU N 36  ? O LEU N 29  
NA 2 3 N ALA N 37  ? N ALA N 30  O CYS N 12  ? O CYS N 5   
NA 3 4 N ALA N 13  ? N ALA N 6   O PHE N 86  ? O PHE N 79  
NA 4 5 N LEU N 87  ? N LEU N 80  O SER N 136 ? O SER N 129 
NA 5 6 N ILE N 137 ? N ILE N 130 O ARG N 179 ? O ARG N 172 
NA 6 7 N ALA N 184 ? N ALA N 177 O LEU N 234 ? O LEU N 227 
OA 1 2 N LEU O 58  ? N LEU O 51  O LEU O 36  ? O LEU O 29  
OA 2 3 N ALA O 37  ? N ALA O 30  O CYS O 12  ? O CYS O 5   
OA 3 4 N ALA O 13  ? N ALA O 6   O PHE O 86  ? O PHE O 79  
OA 4 5 N LEU O 87  ? N LEU O 80  O SER O 136 ? O SER O 129 
OA 5 6 N ILE O 137 ? N ILE O 130 O ARG O 179 ? O ARG O 172 
OA 6 7 N ALA O 184 ? N ALA O 177 O LEU O 234 ? O LEU O 227 
PA 1 2 N ALA P 70  ? N ALA P 70  O VAL P 38  ? O VAL P 38  
PA 2 3 N ALA P 39  ? N ALA P 39  O ALA P 14  ? O ALA P 14  
PA 3 4 N LEU P 15  ? N LEU P 15  O VAL P 99  ? O VAL P 99  
PA 4 5 N VAL P 100 ? N VAL P 100 O SER P 150 ? O SER P 150 
PA 5 6 N ILE P 151 ? N ILE P 151 O ARG P 193 ? O ARG P 193 
PA 6 7 N LEU P 198 ? N LEU P 198 O VAL P 253 ? O VAL P 253 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE NAP A 301' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A 401' 
AC3 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE NAP B 301' 
AC4 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE NAP C 301' 
AC5 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE NAP D 301' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO D 401' 
AC7 Software ? ? ? ? 30 'BINDING SITE FOR RESIDUE NAP E 301' 
AC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL E 401' 
AC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO E 402' 
BC1 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE NAP F 301' 
BC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO F 401' 
BC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE NAP G 301' 
BC4 Software ? ? ? ? 32 'BINDING SITE FOR RESIDUE NAP H 301' 
BC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT H 501' 
BC6 Software ? ? ? ? 32 'BINDING SITE FOR RESIDUE NAP I 301' 
BC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL I 401' 
BC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO I 402' 
BC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO I 403' 
CC1 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE NAP J 301' 
CC2 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE NAP K 301' 
CC3 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE NAP L 301' 
CC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO L 401' 
CC5 Software ? ? ? ? 32 'BINDING SITE FOR RESIDUE NAP M 301' 
CC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL M 401' 
CC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE EDO M 402' 
CC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE ACT M 501' 
CC9 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE NAP N 301' 
DC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE NAP O 301' 
DC2 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE NAP P 301' 
DC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO P 401' 
DC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT P 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 29 GLY A  18  ? GLY A 18   . ? 1_555 ? 
2   AC1 29 SER A  21  ? SER A 21   . ? 1_555 ? 
3   AC1 29 GLY A  22  ? GLY A 22   . ? 1_555 ? 
4   AC1 29 ILE A  23  ? ILE A 23   . ? 1_555 ? 
5   AC1 29 ASP A  42  ? ASP A 42   . ? 1_555 ? 
6   AC1 29 LEU A  43  ? LEU A 43   . ? 1_555 ? 
7   AC1 29 ALA A  74  ? ALA A 74   . ? 1_555 ? 
8   AC1 29 ASP A  75  ? ASP A 75   . ? 1_555 ? 
9   AC1 29 VAL A  76  ? VAL A 76   . ? 1_555 ? 
10  AC1 29 CYS A  103 ? CYS A 103  . ? 1_555 ? 
11  AC1 29 ALA A  104 ? ALA A 104  . ? 1_555 ? 
12  AC1 29 GLY A  105 ? GLY A 105  . ? 1_555 ? 
13  AC1 29 ILE A  106 ? ILE A 106  . ? 1_555 ? 
14  AC1 29 VAL A  126 ? VAL A 126  . ? 1_555 ? 
15  AC1 29 ILE A  154 ? ILE A 154  . ? 1_555 ? 
16  AC1 29 SER A  155 ? SER A 155  . ? 1_555 ? 
17  AC1 29 SER A  156 ? SER A 156  . ? 1_555 ? 
18  AC1 29 TYR A  169 ? TYR A 169  . ? 1_555 ? 
19  AC1 29 LYS A  173 ? LYS A 173  . ? 1_555 ? 
20  AC1 29 PRO A  199 ? PRO A 199  . ? 1_555 ? 
21  AC1 29 GLY A  200 ? GLY A 200  . ? 1_555 ? 
22  AC1 29 PHE A  201 ? PHE A 201  . ? 1_555 ? 
23  AC1 29 ILE A  202 ? ILE A 202  . ? 1_555 ? 
24  AC1 29 THR A  204 ? THR A 204  . ? 1_555 ? 
25  AC1 29 PRO A  205 ? PRO A 205  . ? 1_555 ? 
26  AC1 29 MET A  206 ? MET A 206  . ? 1_555 ? 
27  AC1 29 THR A  207 ? THR A 207  . ? 1_555 ? 
28  AC1 29 HOH VA .   ? HOH A 2002 . ? 1_555 ? 
29  AC1 29 HOH VA .   ? HOH A 2015 . ? 1_555 ? 
30  AC2 7  GLY A  159 ? GLY A 159  . ? 1_555 ? 
31  AC2 7  ILE A  177 ? ILE A 177  . ? 1_555 ? 
32  AC2 7  GLN A  181 ? GLN A 181  . ? 1_555 ? 
33  AC2 7  HOH VA .   ? HOH A 2033 . ? 1_555 ? 
34  AC2 7  GLY D  159 ? GLY D 159  . ? 1_555 ? 
35  AC2 7  LYS D  160 ? LYS D 160  . ? 1_555 ? 
36  AC2 7  ILE D  177 ? ILE D 177  . ? 1_555 ? 
37  AC3 25 GLY B  16  ? GLY B 9    . ? 1_555 ? 
38  AC3 25 SER B  18  ? SER B 11   . ? 1_555 ? 
39  AC3 25 ARG B  19  ? ARG B 12   . ? 1_555 ? 
40  AC3 25 GLY B  20  ? GLY B 13   . ? 1_555 ? 
41  AC3 25 ILE B  21  ? ILE B 14   . ? 1_555 ? 
42  AC3 25 ALA B  40  ? ALA B 33   . ? 1_555 ? 
43  AC3 25 ARG B  41  ? ARG B 34   . ? 1_555 ? 
44  AC3 25 ASN B  42  ? ASN B 35   . ? 1_555 ? 
45  AC3 25 CYS B  62  ? CYS B 55   . ? 1_555 ? 
46  AC3 25 ASP B  63  ? ASP B 56   . ? 1_555 ? 
47  AC3 25 VAL B  64  ? VAL B 57   . ? 1_555 ? 
48  AC3 25 ALA B  90  ? ALA B 83   . ? 1_555 ? 
49  AC3 25 ALA B  91  ? ALA B 84   . ? 1_555 ? 
50  AC3 25 GLY B  92  ? GLY B 85   . ? 1_555 ? 
51  AC3 25 ILE B  93  ? ILE B 86   . ? 1_555 ? 
52  AC3 25 THR B  113 ? THR B 106  . ? 1_555 ? 
53  AC3 25 VAL B  140 ? VAL B 133  . ? 1_555 ? 
54  AC3 25 GLY B  141 ? GLY B 134  . ? 1_555 ? 
55  AC3 25 TYR B  155 ? TYR B 148  . ? 1_555 ? 
56  AC3 25 LYS B  159 ? LYS B 152  . ? 1_555 ? 
57  AC3 25 PRO B  185 ? PRO B 178  . ? 1_555 ? 
58  AC3 25 HOH WA .   ? HOH B 2004 . ? 1_555 ? 
59  AC3 25 HOH WA .   ? HOH B 2005 . ? 1_555 ? 
60  AC3 25 HOH WA .   ? HOH B 2016 . ? 1_555 ? 
61  AC3 25 HOH WA .   ? HOH B 2032 . ? 1_555 ? 
62  AC4 16 GLY C  16  ? GLY C 9    . ? 1_555 ? 
63  AC4 16 SER C  18  ? SER C 11   . ? 1_555 ? 
64  AC4 16 ARG C  19  ? ARG C 12   . ? 1_555 ? 
65  AC4 16 GLY C  20  ? GLY C 13   . ? 1_555 ? 
66  AC4 16 ILE C  21  ? ILE C 14   . ? 1_555 ? 
67  AC4 16 ALA C  40  ? ALA C 33   . ? 1_555 ? 
68  AC4 16 ARG C  41  ? ARG C 34   . ? 1_555 ? 
69  AC4 16 ASN C  42  ? ASN C 35   . ? 1_555 ? 
70  AC4 16 CYS C  62  ? CYS C 55   . ? 1_555 ? 
71  AC4 16 ASP C  63  ? ASP C 56   . ? 1_555 ? 
72  AC4 16 VAL C  64  ? VAL C 57   . ? 1_555 ? 
73  AC4 16 ALA C  90  ? ALA C 83   . ? 1_555 ? 
74  AC4 16 ALA C  91  ? ALA C 84   . ? 1_555 ? 
75  AC4 16 GLY C  92  ? GLY C 85   . ? 1_555 ? 
76  AC4 16 ILE C  93  ? ILE C 86   . ? 1_555 ? 
77  AC4 16 THR C  113 ? THR C 106  . ? 1_555 ? 
78  AC5 27 GLY D  18  ? GLY D 18   . ? 1_555 ? 
79  AC5 27 SER D  21  ? SER D 21   . ? 1_555 ? 
80  AC5 27 GLY D  22  ? GLY D 22   . ? 1_555 ? 
81  AC5 27 ILE D  23  ? ILE D 23   . ? 1_555 ? 
82  AC5 27 ASP D  42  ? ASP D 42   . ? 1_555 ? 
83  AC5 27 LEU D  43  ? LEU D 43   . ? 1_555 ? 
84  AC5 27 ALA D  74  ? ALA D 74   . ? 1_555 ? 
85  AC5 27 ASP D  75  ? ASP D 75   . ? 1_555 ? 
86  AC5 27 VAL D  76  ? VAL D 76   . ? 1_555 ? 
87  AC5 27 CYS D  103 ? CYS D 103  . ? 1_555 ? 
88  AC5 27 ALA D  104 ? ALA D 104  . ? 1_555 ? 
89  AC5 27 GLY D  105 ? GLY D 105  . ? 1_555 ? 
90  AC5 27 ILE D  106 ? ILE D 106  . ? 1_555 ? 
91  AC5 27 VAL D  126 ? VAL D 126  . ? 1_555 ? 
92  AC5 27 ILE D  154 ? ILE D 154  . ? 1_555 ? 
93  AC5 27 SER D  155 ? SER D 155  . ? 1_555 ? 
94  AC5 27 OAS D  156 ? OAS D 156  . ? 1_555 ? 
95  AC5 27 TYR D  169 ? TYR D 169  . ? 1_555 ? 
96  AC5 27 LYS D  173 ? LYS D 173  . ? 1_555 ? 
97  AC5 27 PRO D  199 ? PRO D 199  . ? 1_555 ? 
98  AC5 27 GLY D  200 ? GLY D 200  . ? 1_555 ? 
99  AC5 27 ILE D  202 ? ILE D 202  . ? 1_555 ? 
100 AC5 27 THR D  204 ? THR D 204  . ? 1_555 ? 
101 AC5 27 PRO D  205 ? PRO D 205  . ? 1_555 ? 
102 AC5 27 MET D  206 ? MET D 206  . ? 1_555 ? 
103 AC5 27 THR D  207 ? THR D 207  . ? 1_555 ? 
104 AC5 27 HOH YA .   ? HOH D 2004 . ? 1_555 ? 
105 AC6 4  THR D  207 ? THR D 207  . ? 1_555 ? 
106 AC6 4  GLN D  208 ? GLN D 208  . ? 1_555 ? 
107 AC6 4  VAL D  210 ? VAL D 210  . ? 1_555 ? 
108 AC6 4  VAL D  215 ? VAL D 215  . ? 1_555 ? 
109 AC7 30 ARG B  83  ? ARG B 76   . ? 1_555 ? 
110 AC7 30 HOH WA .   ? HOH B 2013 . ? 1_555 ? 
111 AC7 30 GLY E  18  ? GLY E 18   . ? 1_555 ? 
112 AC7 30 SER E  21  ? SER E 21   . ? 1_555 ? 
113 AC7 30 GLY E  22  ? GLY E 22   . ? 1_555 ? 
114 AC7 30 ILE E  23  ? ILE E 23   . ? 1_555 ? 
115 AC7 30 ASP E  42  ? ASP E 42   . ? 1_555 ? 
116 AC7 30 LEU E  43  ? LEU E 43   . ? 1_555 ? 
117 AC7 30 ALA E  74  ? ALA E 74   . ? 1_555 ? 
118 AC7 30 ASP E  75  ? ASP E 75   . ? 1_555 ? 
119 AC7 30 VAL E  76  ? VAL E 76   . ? 1_555 ? 
120 AC7 30 CYS E  103 ? CYS E 103  . ? 1_555 ? 
121 AC7 30 ALA E  104 ? ALA E 104  . ? 1_555 ? 
122 AC7 30 GLY E  105 ? GLY E 105  . ? 1_555 ? 
123 AC7 30 ILE E  106 ? ILE E 106  . ? 1_555 ? 
124 AC7 30 VAL E  126 ? VAL E 126  . ? 1_555 ? 
125 AC7 30 ILE E  154 ? ILE E 154  . ? 1_555 ? 
126 AC7 30 SER E  155 ? SER E 155  . ? 1_555 ? 
127 AC7 30 SER E  156 ? SER E 156  . ? 1_555 ? 
128 AC7 30 TYR E  169 ? TYR E 169  . ? 1_555 ? 
129 AC7 30 LYS E  173 ? LYS E 173  . ? 1_555 ? 
130 AC7 30 PRO E  199 ? PRO E 199  . ? 1_555 ? 
131 AC7 30 GLY E  200 ? GLY E 200  . ? 1_555 ? 
132 AC7 30 ILE E  202 ? ILE E 202  . ? 1_555 ? 
133 AC7 30 THR E  204 ? THR E 204  . ? 1_555 ? 
134 AC7 30 PRO E  205 ? PRO E 205  . ? 1_555 ? 
135 AC7 30 MET E  206 ? MET E 206  . ? 1_555 ? 
136 AC7 30 THR E  207 ? THR E 207  . ? 1_555 ? 
137 AC7 30 HOH ZA .   ? HOH E 2005 . ? 1_555 ? 
138 AC7 30 HOH ZA .   ? HOH E 2021 . ? 1_555 ? 
139 AC8 8  GLY E  159 ? GLY E 159  . ? 1_555 ? 
140 AC8 8  LYS E  160 ? LYS E 160  . ? 1_555 ? 
141 AC8 8  ILE E  177 ? ILE E 177  . ? 1_555 ? 
142 AC8 8  HOH ZA .   ? HOH E 2043 . ? 1_555 ? 
143 AC8 8  GLY H  159 ? GLY H 159  . ? 1_555 ? 
144 AC8 8  ALA H  174 ? ALA H 174  . ? 1_555 ? 
145 AC8 8  ILE H  177 ? ILE H 177  . ? 1_555 ? 
146 AC8 8  GLN H  181 ? GLN H 181  . ? 1_555 ? 
147 AC9 5  ARG B  35  ? ARG B 28   . ? 1_555 ? 
148 AC9 5  THR E  207 ? THR E 207  . ? 1_555 ? 
149 AC9 5  GLN E  208 ? GLN E 208  . ? 1_555 ? 
150 AC9 5  VAL E  210 ? VAL E 210  . ? 1_555 ? 
151 AC9 5  GLN E  212 ? GLN E 212  . ? 1_555 ? 
152 BC1 29 GLY F  16  ? GLY F 9    . ? 1_555 ? 
153 BC1 29 SER F  18  ? SER F 11   . ? 1_555 ? 
154 BC1 29 ARG F  19  ? ARG F 12   . ? 1_555 ? 
155 BC1 29 GLY F  20  ? GLY F 13   . ? 1_555 ? 
156 BC1 29 ILE F  21  ? ILE F 14   . ? 1_555 ? 
157 BC1 29 ALA F  40  ? ALA F 33   . ? 1_555 ? 
158 BC1 29 ARG F  41  ? ARG F 34   . ? 1_555 ? 
159 BC1 29 ASN F  42  ? ASN F 35   . ? 1_555 ? 
160 BC1 29 CYS F  62  ? CYS F 55   . ? 1_555 ? 
161 BC1 29 ASP F  63  ? ASP F 56   . ? 1_555 ? 
162 BC1 29 VAL F  64  ? VAL F 57   . ? 1_555 ? 
163 BC1 29 ALA F  90  ? ALA F 83   . ? 1_555 ? 
164 BC1 29 ALA F  91  ? ALA F 84   . ? 1_555 ? 
165 BC1 29 GLY F  92  ? GLY F 85   . ? 1_555 ? 
166 BC1 29 VAL F  140 ? VAL F 133  . ? 1_555 ? 
167 BC1 29 GLY F  141 ? GLY F 134  . ? 1_555 ? 
168 BC1 29 SER F  142 ? SER F 135  . ? 1_555 ? 
169 BC1 29 TYR F  155 ? TYR F 148  . ? 1_555 ? 
170 BC1 29 LYS F  159 ? LYS F 152  . ? 1_555 ? 
171 BC1 29 GLY F  186 ? GLY F 179  . ? 1_555 ? 
172 BC1 29 VAL F  188 ? VAL F 181  . ? 1_555 ? 
173 BC1 29 THR F  190 ? THR F 183  . ? 1_555 ? 
174 BC1 29 ASP F  191 ? ASP F 184  . ? 1_555 ? 
175 BC1 29 MET F  192 ? MET F 185  . ? 1_555 ? 
176 BC1 29 THR F  193 ? THR F 186  . ? 1_555 ? 
177 BC1 29 HOH AB .   ? HOH F 2008 . ? 1_555 ? 
178 BC1 29 HOH AB .   ? HOH F 2016 . ? 1_555 ? 
179 BC1 29 HOH AB .   ? HOH F 2018 . ? 1_555 ? 
180 BC1 29 HOH AB .   ? HOH F 2030 . ? 1_555 ? 
181 BC2 6  ARG E  8   ? ARG E 8    . ? 1_555 ? 
182 BC2 6  PHE E  239 ? PHE E 239  . ? 1_555 ? 
183 BC2 6  HOH ZA .   ? HOH E 2002 . ? 1_555 ? 
184 BC2 6  HIS F  218 ? HIS F 211  . ? 1_555 ? 
185 BC2 6  VAL F  221 ? VAL F 214  . ? 1_555 ? 
186 BC2 6  GLU F  225 ? GLU F 218  . ? 1_555 ? 
187 BC3 12 GLY G  16  ? GLY G 9    . ? 1_555 ? 
188 BC3 12 SER G  18  ? SER G 11   . ? 1_555 ? 
189 BC3 12 ARG G  19  ? ARG G 12   . ? 1_555 ? 
190 BC3 12 ALA G  40  ? ALA G 33   . ? 1_555 ? 
191 BC3 12 ARG G  41  ? ARG G 34   . ? 1_555 ? 
192 BC3 12 ASN G  42  ? ASN G 35   . ? 1_555 ? 
193 BC3 12 CYS G  62  ? CYS G 55   . ? 1_555 ? 
194 BC3 12 ASP G  63  ? ASP G 56   . ? 1_555 ? 
195 BC3 12 VAL G  64  ? VAL G 57   . ? 1_555 ? 
196 BC3 12 ALA G  91  ? ALA G 84   . ? 1_555 ? 
197 BC3 12 GLY G  92  ? GLY G 85   . ? 1_555 ? 
198 BC3 12 THR G  113 ? THR G 106  . ? 1_555 ? 
199 BC4 32 GLY H  18  ? GLY H 18   . ? 1_555 ? 
200 BC4 32 SER H  21  ? SER H 21   . ? 1_555 ? 
201 BC4 32 GLY H  22  ? GLY H 22   . ? 1_555 ? 
202 BC4 32 ILE H  23  ? ILE H 23   . ? 1_555 ? 
203 BC4 32 ASP H  42  ? ASP H 42   . ? 1_555 ? 
204 BC4 32 LEU H  43  ? LEU H 43   . ? 1_555 ? 
205 BC4 32 ALA H  74  ? ALA H 74   . ? 1_555 ? 
206 BC4 32 ASP H  75  ? ASP H 75   . ? 1_555 ? 
207 BC4 32 VAL H  76  ? VAL H 76   . ? 1_555 ? 
208 BC4 32 CYS H  103 ? CYS H 103  . ? 1_555 ? 
209 BC4 32 ALA H  104 ? ALA H 104  . ? 1_555 ? 
210 BC4 32 GLY H  105 ? GLY H 105  . ? 1_555 ? 
211 BC4 32 VAL H  126 ? VAL H 126  . ? 1_555 ? 
212 BC4 32 ILE H  154 ? ILE H 154  . ? 1_555 ? 
213 BC4 32 SER H  155 ? SER H 155  . ? 1_555 ? 
214 BC4 32 SER H  156 ? SER H 156  . ? 1_555 ? 
215 BC4 32 TYR H  169 ? TYR H 169  . ? 1_555 ? 
216 BC4 32 LYS H  173 ? LYS H 173  . ? 1_555 ? 
217 BC4 32 PRO H  199 ? PRO H 199  . ? 1_555 ? 
218 BC4 32 GLY H  200 ? GLY H 200  . ? 1_555 ? 
219 BC4 32 PHE H  201 ? PHE H 201  . ? 1_555 ? 
220 BC4 32 ILE H  202 ? ILE H 202  . ? 1_555 ? 
221 BC4 32 THR H  204 ? THR H 204  . ? 1_555 ? 
222 BC4 32 PRO H  205 ? PRO H 205  . ? 1_555 ? 
223 BC4 32 MET H  206 ? MET H 206  . ? 1_555 ? 
224 BC4 32 THR H  207 ? THR H 207  . ? 1_555 ? 
225 BC4 32 ACT DA .   ? ACT H 501  . ? 1_555 ? 
226 BC4 32 HOH CB .   ? HOH H 2003 . ? 1_555 ? 
227 BC4 32 HOH CB .   ? HOH H 2015 . ? 1_555 ? 
228 BC4 32 HOH CB .   ? HOH H 2030 . ? 1_555 ? 
229 BC4 32 HOH CB .   ? HOH H 2035 . ? 1_555 ? 
230 BC4 32 HOH CB .   ? HOH H 2036 . ? 1_555 ? 
231 BC5 5  SER H  156 ? SER H 156  . ? 1_555 ? 
232 BC5 5  VAL H  158 ? VAL H 158  . ? 1_555 ? 
233 BC5 5  TYR H  169 ? TYR H 169  . ? 1_555 ? 
234 BC5 5  PHE H  201 ? PHE H 201  . ? 1_555 ? 
235 BC5 5  NAP CA .   ? NAP H 301  . ? 1_555 ? 
236 BC6 32 GLY I  18  ? GLY I 18   . ? 1_555 ? 
237 BC6 32 SER I  21  ? SER I 21   . ? 1_555 ? 
238 BC6 32 GLY I  22  ? GLY I 22   . ? 1_555 ? 
239 BC6 32 ILE I  23  ? ILE I 23   . ? 1_555 ? 
240 BC6 32 ASP I  42  ? ASP I 42   . ? 1_555 ? 
241 BC6 32 LEU I  43  ? LEU I 43   . ? 1_555 ? 
242 BC6 32 ALA I  74  ? ALA I 74   . ? 1_555 ? 
243 BC6 32 ASP I  75  ? ASP I 75   . ? 1_555 ? 
244 BC6 32 VAL I  76  ? VAL I 76   . ? 1_555 ? 
245 BC6 32 CYS I  103 ? CYS I 103  . ? 1_555 ? 
246 BC6 32 ALA I  104 ? ALA I 104  . ? 1_555 ? 
247 BC6 32 GLY I  105 ? GLY I 105  . ? 1_555 ? 
248 BC6 32 ILE I  106 ? ILE I 106  . ? 1_555 ? 
249 BC6 32 VAL I  126 ? VAL I 126  . ? 1_555 ? 
250 BC6 32 ILE I  154 ? ILE I 154  . ? 1_555 ? 
251 BC6 32 SER I  155 ? SER I 155  . ? 1_555 ? 
252 BC6 32 SER I  156 ? SER I 156  . ? 1_555 ? 
253 BC6 32 TYR I  169 ? TYR I 169  . ? 1_555 ? 
254 BC6 32 LYS I  173 ? LYS I 173  . ? 1_555 ? 
255 BC6 32 PRO I  199 ? PRO I 199  . ? 1_555 ? 
256 BC6 32 GLY I  200 ? GLY I 200  . ? 1_555 ? 
257 BC6 32 ILE I  202 ? ILE I 202  . ? 1_555 ? 
258 BC6 32 THR I  204 ? THR I 204  . ? 1_555 ? 
259 BC6 32 PRO I  205 ? PRO I 205  . ? 1_555 ? 
260 BC6 32 MET I  206 ? MET I 206  . ? 1_555 ? 
261 BC6 32 THR I  207 ? THR I 207  . ? 1_555 ? 
262 BC6 32 HOH DB .   ? HOH I 2006 . ? 1_555 ? 
263 BC6 32 HOH DB .   ? HOH I 2057 . ? 1_555 ? 
264 BC6 32 HOH DB .   ? HOH I 2058 . ? 1_555 ? 
265 BC6 32 ARG N  83  ? ARG N 76   . ? 1_554 ? 
266 BC6 32 HOH IB .   ? HOH N 2001 . ? 1_554 ? 
267 BC6 32 HOH IB .   ? HOH N 2023 . ? 1_554 ? 
268 BC7 6  GLY I  159 ? GLY I 159  . ? 1_555 ? 
269 BC7 6  ILE I  177 ? ILE I 177  . ? 1_555 ? 
270 BC7 6  GLN I  181 ? GLN I 181  . ? 1_555 ? 
271 BC7 6  HOH DB .   ? HOH I 2032 . ? 1_555 ? 
272 BC7 6  GLY L  159 ? GLY L 159  . ? 1_555 ? 
273 BC7 6  LYS L  160 ? LYS L 160  . ? 1_555 ? 
274 BC8 5  THR I  207 ? THR I 207  . ? 1_555 ? 
275 BC8 5  GLN I  208 ? GLN I 208  . ? 1_555 ? 
276 BC8 5  VAL I  210 ? VAL I 210  . ? 1_555 ? 
277 BC8 5  GLN I  212 ? GLN I 212  . ? 1_555 ? 
278 BC8 5  ARG N  35  ? ARG N 28   . ? 1_554 ? 
279 BC9 3  SER I  77  ? SER I 77   . ? 1_555 ? 
280 BC9 3  LYS I  129 ? LYS I 129  . ? 1_555 ? 
281 BC9 3  HOH DB .   ? HOH I 2060 . ? 1_555 ? 
282 CC1 27 HOH WA .   ? HOH B 2008 . ? 1_555 ? 
283 CC1 27 GLY J  16  ? GLY J 9    . ? 1_555 ? 
284 CC1 27 SER J  18  ? SER J 11   . ? 1_555 ? 
285 CC1 27 ARG J  19  ? ARG J 12   . ? 1_555 ? 
286 CC1 27 GLY J  20  ? GLY J 13   . ? 1_555 ? 
287 CC1 27 ILE J  21  ? ILE J 14   . ? 1_555 ? 
288 CC1 27 ALA J  40  ? ALA J 33   . ? 1_555 ? 
289 CC1 27 ARG J  41  ? ARG J 34   . ? 1_555 ? 
290 CC1 27 ASN J  42  ? ASN J 35   . ? 1_555 ? 
291 CC1 27 CYS J  62  ? CYS J 55   . ? 1_555 ? 
292 CC1 27 ASP J  63  ? ASP J 56   . ? 1_555 ? 
293 CC1 27 VAL J  64  ? VAL J 57   . ? 1_555 ? 
294 CC1 27 ALA J  90  ? ALA J 83   . ? 1_555 ? 
295 CC1 27 ALA J  91  ? ALA J 84   . ? 1_555 ? 
296 CC1 27 GLY J  92  ? GLY J 85   . ? 1_555 ? 
297 CC1 27 ILE J  93  ? ILE J 86   . ? 1_555 ? 
298 CC1 27 THR J  113 ? THR J 106  . ? 1_555 ? 
299 CC1 27 VAL J  140 ? VAL J 133  . ? 1_555 ? 
300 CC1 27 GLY J  141 ? GLY J 134  . ? 1_555 ? 
301 CC1 27 SER J  142 ? SER J 135  . ? 1_555 ? 
302 CC1 27 TYR J  155 ? TYR J 148  . ? 1_555 ? 
303 CC1 27 LYS J  159 ? LYS J 152  . ? 1_555 ? 
304 CC1 27 GLY J  186 ? GLY J 179  . ? 1_555 ? 
305 CC1 27 VAL J  188 ? VAL J 181  . ? 1_555 ? 
306 CC1 27 THR J  190 ? THR J 183  . ? 1_555 ? 
307 CC1 27 MET J  192 ? MET J 185  . ? 1_555 ? 
308 CC1 27 THR J  193 ? THR J 186  . ? 1_555 ? 
309 CC2 20 GLY K  16  ? GLY K 9    . ? 1_555 ? 
310 CC2 20 SER K  18  ? SER K 11   . ? 1_555 ? 
311 CC2 20 ARG K  19  ? ARG K 12   . ? 1_555 ? 
312 CC2 20 GLY K  20  ? GLY K 13   . ? 1_555 ? 
313 CC2 20 ILE K  21  ? ILE K 14   . ? 1_555 ? 
314 CC2 20 ALA K  40  ? ALA K 33   . ? 1_555 ? 
315 CC2 20 ARG K  41  ? ARG K 34   . ? 1_555 ? 
316 CC2 20 ASN K  42  ? ASN K 35   . ? 1_555 ? 
317 CC2 20 CYS K  62  ? CYS K 55   . ? 1_555 ? 
318 CC2 20 ASP K  63  ? ASP K 56   . ? 1_555 ? 
319 CC2 20 VAL K  64  ? VAL K 57   . ? 1_555 ? 
320 CC2 20 ALA K  90  ? ALA K 83   . ? 1_555 ? 
321 CC2 20 ALA K  91  ? ALA K 84   . ? 1_555 ? 
322 CC2 20 GLY K  92  ? GLY K 85   . ? 1_555 ? 
323 CC2 20 THR K  113 ? THR K 106  . ? 1_555 ? 
324 CC2 20 VAL K  140 ? VAL K 133  . ? 1_555 ? 
325 CC2 20 TYR K  155 ? TYR K 148  . ? 1_555 ? 
326 CC2 20 LYS K  159 ? LYS K 152  . ? 1_555 ? 
327 CC2 20 HOH FB .   ? HOH K 2002 . ? 1_555 ? 
328 CC2 20 HOH FB .   ? HOH K 2007 . ? 1_555 ? 
329 CC3 28 GLY L  18  ? GLY L 18   . ? 1_555 ? 
330 CC3 28 SER L  21  ? SER L 21   . ? 1_555 ? 
331 CC3 28 GLY L  22  ? GLY L 22   . ? 1_555 ? 
332 CC3 28 ILE L  23  ? ILE L 23   . ? 1_555 ? 
333 CC3 28 ASP L  42  ? ASP L 42   . ? 1_555 ? 
334 CC3 28 LEU L  43  ? LEU L 43   . ? 1_555 ? 
335 CC3 28 ALA L  74  ? ALA L 74   . ? 1_555 ? 
336 CC3 28 ASP L  75  ? ASP L 75   . ? 1_555 ? 
337 CC3 28 VAL L  76  ? VAL L 76   . ? 1_555 ? 
338 CC3 28 CYS L  103 ? CYS L 103  . ? 1_555 ? 
339 CC3 28 GLY L  105 ? GLY L 105  . ? 1_555 ? 
340 CC3 28 ILE L  106 ? ILE L 106  . ? 1_555 ? 
341 CC3 28 VAL L  126 ? VAL L 126  . ? 1_555 ? 
342 CC3 28 ILE L  154 ? ILE L 154  . ? 1_555 ? 
343 CC3 28 SER L  155 ? SER L 155  . ? 1_555 ? 
344 CC3 28 SER L  156 ? SER L 156  . ? 1_555 ? 
345 CC3 28 TYR L  169 ? TYR L 169  . ? 1_555 ? 
346 CC3 28 LYS L  173 ? LYS L 173  . ? 1_555 ? 
347 CC3 28 PRO L  199 ? PRO L 199  . ? 1_555 ? 
348 CC3 28 GLY L  200 ? GLY L 200  . ? 1_555 ? 
349 CC3 28 ILE L  202 ? ILE L 202  . ? 1_555 ? 
350 CC3 28 THR L  204 ? THR L 204  . ? 1_555 ? 
351 CC3 28 PRO L  205 ? PRO L 205  . ? 1_555 ? 
352 CC3 28 MET L  206 ? MET L 206  . ? 1_555 ? 
353 CC3 28 THR L  207 ? THR L 207  . ? 1_555 ? 
354 CC3 28 HOH GB .   ? HOH L 2007 . ? 1_555 ? 
355 CC3 28 HOH GB .   ? HOH L 2027 . ? 1_555 ? 
356 CC3 28 HOH GB .   ? HOH L 2055 . ? 1_555 ? 
357 CC4 3  HIS C  68  ? HIS C 61   . ? 1_554 ? 
358 CC4 3  HIS L  114 ? HIS L 114  . ? 1_555 ? 
359 CC4 3  HOH GB .   ? HOH L 2056 . ? 1_555 ? 
360 CC5 32 ARG J  83  ? ARG J 76   . ? 1_555 ? 
361 CC5 32 HOH EB .   ? HOH J 2020 . ? 1_555 ? 
362 CC5 32 HOH EB .   ? HOH J 2022 . ? 1_555 ? 
363 CC5 32 HOH EB .   ? HOH J 2032 . ? 1_555 ? 
364 CC5 32 GLY M  18  ? GLY M 18   . ? 1_555 ? 
365 CC5 32 SER M  21  ? SER M 21   . ? 1_555 ? 
366 CC5 32 GLY M  22  ? GLY M 22   . ? 1_555 ? 
367 CC5 32 ILE M  23  ? ILE M 23   . ? 1_555 ? 
368 CC5 32 ASP M  42  ? ASP M 42   . ? 1_555 ? 
369 CC5 32 LEU M  43  ? LEU M 43   . ? 1_555 ? 
370 CC5 32 ALA M  74  ? ALA M 74   . ? 1_555 ? 
371 CC5 32 ASP M  75  ? ASP M 75   . ? 1_555 ? 
372 CC5 32 VAL M  76  ? VAL M 76   . ? 1_555 ? 
373 CC5 32 CYS M  103 ? CYS M 103  . ? 1_555 ? 
374 CC5 32 GLY M  105 ? GLY M 105  . ? 1_555 ? 
375 CC5 32 ILE M  106 ? ILE M 106  . ? 1_555 ? 
376 CC5 32 VAL M  126 ? VAL M 126  . ? 1_555 ? 
377 CC5 32 ILE M  154 ? ILE M 154  . ? 1_555 ? 
378 CC5 32 SER M  155 ? SER M 155  . ? 1_555 ? 
379 CC5 32 SER M  156 ? SER M 156  . ? 1_555 ? 
380 CC5 32 TYR M  169 ? TYR M 169  . ? 1_555 ? 
381 CC5 32 LYS M  173 ? LYS M 173  . ? 1_555 ? 
382 CC5 32 PRO M  199 ? PRO M 199  . ? 1_555 ? 
383 CC5 32 GLY M  200 ? GLY M 200  . ? 1_555 ? 
384 CC5 32 ILE M  202 ? ILE M 202  . ? 1_555 ? 
385 CC5 32 THR M  204 ? THR M 204  . ? 1_555 ? 
386 CC5 32 PRO M  205 ? PRO M 205  . ? 1_555 ? 
387 CC5 32 MET M  206 ? MET M 206  . ? 1_555 ? 
388 CC5 32 THR M  207 ? THR M 207  . ? 1_555 ? 
389 CC5 32 ACT PA .   ? ACT M 501  . ? 1_555 ? 
390 CC5 32 HOH HB .   ? HOH M 2006 . ? 1_555 ? 
391 CC5 32 HOH HB .   ? HOH M 2040 . ? 1_555 ? 
392 CC6 6  GLY M  159 ? GLY M 159  . ? 1_555 ? 
393 CC6 6  ILE M  177 ? ILE M 177  . ? 1_555 ? 
394 CC6 6  HOH HB .   ? HOH M 2064 . ? 1_555 ? 
395 CC6 6  GLY P  159 ? GLY P 159  . ? 1_555 ? 
396 CC6 6  ALA P  174 ? ALA P 174  . ? 1_555 ? 
397 CC6 6  ILE P  177 ? ILE P 177  . ? 1_555 ? 
398 CC7 7  ARG J  35  ? ARG J 28   . ? 1_555 ? 
399 CC7 7  THR M  207 ? THR M 207  . ? 1_555 ? 
400 CC7 7  GLN M  208 ? GLN M 208  . ? 1_555 ? 
401 CC7 7  VAL M  210 ? VAL M 210  . ? 1_555 ? 
402 CC7 7  GLN M  212 ? GLN M 212  . ? 1_555 ? 
403 CC7 7  VAL M  215 ? VAL M 215  . ? 1_555 ? 
404 CC7 7  HOH HB .   ? HOH M 2093 . ? 1_555 ? 
405 CC8 8  HOH EB .   ? HOH J 2003 . ? 1_555 ? 
406 CC8 8  SER M  156 ? SER M 156  . ? 1_555 ? 
407 CC8 8  VAL M  158 ? VAL M 158  . ? 1_555 ? 
408 CC8 8  TYR M  169 ? TYR M 169  . ? 1_555 ? 
409 CC8 8  GLY M  200 ? GLY M 200  . ? 1_555 ? 
410 CC8 8  PHE M  201 ? PHE M 201  . ? 1_555 ? 
411 CC8 8  NAP MA .   ? NAP M 301  . ? 1_555 ? 
412 CC8 8  HOH HB .   ? HOH M 2063 . ? 1_555 ? 
413 CC9 23 GLY N  16  ? GLY N 9    . ? 1_555 ? 
414 CC9 23 SER N  18  ? SER N 11   . ? 1_555 ? 
415 CC9 23 ARG N  19  ? ARG N 12   . ? 1_555 ? 
416 CC9 23 ILE N  21  ? ILE N 14   . ? 1_555 ? 
417 CC9 23 ALA N  40  ? ALA N 33   . ? 1_555 ? 
418 CC9 23 ARG N  41  ? ARG N 34   . ? 1_555 ? 
419 CC9 23 ASN N  42  ? ASN N 35   . ? 1_555 ? 
420 CC9 23 CYS N  62  ? CYS N 55   . ? 1_555 ? 
421 CC9 23 ASP N  63  ? ASP N 56   . ? 1_555 ? 
422 CC9 23 VAL N  64  ? VAL N 57   . ? 1_555 ? 
423 CC9 23 ALA N  90  ? ALA N 83   . ? 1_555 ? 
424 CC9 23 ALA N  91  ? ALA N 84   . ? 1_555 ? 
425 CC9 23 GLY N  92  ? GLY N 85   . ? 1_555 ? 
426 CC9 23 VAL N  140 ? VAL N 133  . ? 1_555 ? 
427 CC9 23 GLY N  141 ? GLY N 134  . ? 1_555 ? 
428 CC9 23 SER N  142 ? SER N 135  . ? 1_555 ? 
429 CC9 23 TYR N  155 ? TYR N 148  . ? 1_555 ? 
430 CC9 23 LYS N  159 ? LYS N 152  . ? 1_555 ? 
431 CC9 23 VAL N  188 ? VAL N 181  . ? 1_555 ? 
432 CC9 23 HOH IB .   ? HOH N 2007 . ? 1_555 ? 
433 CC9 23 HOH IB .   ? HOH N 2016 . ? 1_555 ? 
434 CC9 23 HOH IB .   ? HOH N 2029 . ? 1_555 ? 
435 CC9 23 HOH IB .   ? HOH N 2051 . ? 1_555 ? 
436 DC1 22 SER O  18  ? SER O 11   . ? 1_555 ? 
437 DC1 22 ARG O  19  ? ARG O 12   . ? 1_555 ? 
438 DC1 22 GLY O  20  ? GLY O 13   . ? 1_555 ? 
439 DC1 22 ILE O  21  ? ILE O 14   . ? 1_555 ? 
440 DC1 22 ALA O  40  ? ALA O 33   . ? 1_555 ? 
441 DC1 22 ARG O  41  ? ARG O 34   . ? 1_555 ? 
442 DC1 22 ASN O  42  ? ASN O 35   . ? 1_555 ? 
443 DC1 22 CYS O  62  ? CYS O 55   . ? 1_555 ? 
444 DC1 22 ASP O  63  ? ASP O 56   . ? 1_555 ? 
445 DC1 22 VAL O  64  ? VAL O 57   . ? 1_555 ? 
446 DC1 22 ALA O  90  ? ALA O 83   . ? 1_555 ? 
447 DC1 22 ALA O  91  ? ALA O 84   . ? 1_555 ? 
448 DC1 22 GLY O  92  ? GLY O 85   . ? 1_555 ? 
449 DC1 22 ILE O  93  ? ILE O 86   . ? 1_555 ? 
450 DC1 22 THR O  113 ? THR O 106  . ? 1_555 ? 
451 DC1 22 GLY O  141 ? GLY O 134  . ? 1_555 ? 
452 DC1 22 SER O  142 ? SER O 135  . ? 1_555 ? 
453 DC1 22 TYR O  155 ? TYR O 148  . ? 1_555 ? 
454 DC1 22 VAL O  188 ? VAL O 181  . ? 1_555 ? 
455 DC1 22 THR O  190 ? THR O 183  . ? 1_555 ? 
456 DC1 22 HOH JB .   ? HOH O 2001 . ? 1_555 ? 
457 DC1 22 HOH JB .   ? HOH O 2002 . ? 1_555 ? 
458 DC2 27 GLY P  18  ? GLY P 18   . ? 1_555 ? 
459 DC2 27 SER P  21  ? SER P 21   . ? 1_555 ? 
460 DC2 27 ILE P  23  ? ILE P 23   . ? 1_555 ? 
461 DC2 27 ASP P  42  ? ASP P 42   . ? 1_555 ? 
462 DC2 27 LEU P  43  ? LEU P 43   . ? 1_555 ? 
463 DC2 27 ALA P  74  ? ALA P 74   . ? 1_555 ? 
464 DC2 27 ASP P  75  ? ASP P 75   . ? 1_555 ? 
465 DC2 27 VAL P  76  ? VAL P 76   . ? 1_555 ? 
466 DC2 27 CYS P  103 ? CYS P 103  . ? 1_555 ? 
467 DC2 27 GLY P  105 ? GLY P 105  . ? 1_555 ? 
468 DC2 27 ILE P  106 ? ILE P 106  . ? 1_555 ? 
469 DC2 27 VAL P  126 ? VAL P 126  . ? 1_555 ? 
470 DC2 27 ILE P  154 ? ILE P 154  . ? 1_555 ? 
471 DC2 27 SER P  155 ? SER P 155  . ? 1_555 ? 
472 DC2 27 SER P  156 ? SER P 156  . ? 1_555 ? 
473 DC2 27 TYR P  169 ? TYR P 169  . ? 1_555 ? 
474 DC2 27 LYS P  173 ? LYS P 173  . ? 1_555 ? 
475 DC2 27 PRO P  199 ? PRO P 199  . ? 1_555 ? 
476 DC2 27 GLY P  200 ? GLY P 200  . ? 1_555 ? 
477 DC2 27 ILE P  202 ? ILE P 202  . ? 1_555 ? 
478 DC2 27 THR P  204 ? THR P 204  . ? 1_555 ? 
479 DC2 27 PRO P  205 ? PRO P 205  . ? 1_555 ? 
480 DC2 27 MET P  206 ? MET P 206  . ? 1_555 ? 
481 DC2 27 THR P  207 ? THR P 207  . ? 1_555 ? 
482 DC2 27 ACT UA .   ? ACT P 501  . ? 1_555 ? 
483 DC2 27 HOH KB .   ? HOH P 2003 . ? 1_555 ? 
484 DC2 27 HOH KB .   ? HOH P 2052 . ? 1_555 ? 
485 DC3 3  GLN P  208 ? GLN P 208  . ? 1_555 ? 
486 DC3 3  VAL P  210 ? VAL P 210  . ? 1_555 ? 
487 DC3 3  PRO P  211 ? PRO P 211  . ? 1_555 ? 
488 DC4 5  SER P  156 ? SER P 156  . ? 1_555 ? 
489 DC4 5  VAL P  158 ? VAL P 158  . ? 1_555 ? 
490 DC4 5  TYR P  169 ? TYR P 169  . ? 1_555 ? 
491 DC4 5  PHE P  201 ? PHE P 201  . ? 1_555 ? 
492 DC4 5  NAP SA .   ? NAP P 301  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4CQM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4CQM 
_atom_sites.fract_transf_matrix[1][1]   0.011428 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000835 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004194 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011434 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . GLN A  1 6   ? 17.460  -42.592  7.504   1.00 56.54  ? 6    GLN A N   1 
ATOM   2     C CA  . GLN A  1 6   ? 17.369  -43.681  8.468   1.00 57.44  ? 6    GLN A CA  1 
ATOM   3     C C   . GLN A  1 6   ? 16.724  -44.911  7.833   1.00 56.14  ? 6    GLN A C   1 
ATOM   4     O O   . GLN A  1 6   ? 16.019  -44.803  6.829   1.00 52.56  ? 6    GLN A O   1 
ATOM   5     C CB  . GLN A  1 6   ? 16.571  -43.241  9.699   1.00 58.52  ? 6    GLN A CB  1 
ATOM   6     C CG  . GLN A  1 6   ? 16.847  -44.054  10.956  1.00 60.18  ? 6    GLN A CG  1 
ATOM   7     C CD  . GLN A  1 6   ? 18.036  -43.531  11.740  1.00 66.39  ? 6    GLN A CD  1 
ATOM   8     O OE1 . GLN A  1 6   ? 18.270  -42.324  11.802  1.00 69.24  ? 6    GLN A OE1 1 
ATOM   9     N NE2 . GLN A  1 6   ? 18.794  -44.440  12.342  1.00 69.68  ? 6    GLN A NE2 1 
ATOM   10    N N   . ASN A  1 7   ? 16.972  -46.078  8.418   1.00 56.60  ? 7    ASN A N   1 
ATOM   11    C CA  . ASN A  1 7   ? 16.361  -47.317  7.954   1.00 59.68  ? 7    ASN A CA  1 
ATOM   12    C C   . ASN A  1 7   ? 15.669  -48.049  9.097   1.00 56.18  ? 7    ASN A C   1 
ATOM   13    O O   . ASN A  1 7   ? 15.438  -49.256  9.023   1.00 55.80  ? 7    ASN A O   1 
ATOM   14    C CB  . ASN A  1 7   ? 17.409  -48.226  7.310   1.00 66.48  ? 7    ASN A CB  1 
ATOM   15    C CG  . ASN A  1 7   ? 17.093  -48.545  5.863   1.00 68.55  ? 7    ASN A CG  1 
ATOM   16    O OD1 . ASN A  1 7   ? 16.497  -49.578  5.558   1.00 71.36  ? 7    ASN A OD1 1 
ATOM   17    N ND2 . ASN A  1 7   ? 17.490  -47.655  4.962   1.00 69.11  ? 7    ASN A ND2 1 
ATOM   18    N N   . ARG A  1 8   ? 15.341  -47.310  10.154  1.00 57.49  ? 8    ARG A N   1 
ATOM   19    C CA  . ARG A  1 8   ? 14.724  -47.897  11.342  1.00 60.38  ? 8    ARG A CA  1 
ATOM   20    C C   . ARG A  1 8   ? 13.287  -48.331  11.077  1.00 56.00  ? 8    ARG A C   1 
ATOM   21    O O   . ARG A  1 8   ? 12.823  -49.330  11.626  1.00 51.92  ? 8    ARG A O   1 
ATOM   22    C CB  . ARG A  1 8   ? 14.763  -46.911  12.516  1.00 59.92  ? 8    ARG A CB  1 
ATOM   23    C CG  . ARG A  1 8   ? 14.205  -47.473  13.822  1.00 56.76  ? 8    ARG A CG  1 
ATOM   24    C CD  . ARG A  1 8   ? 14.567  -46.601  15.022  1.00 55.91  ? 8    ARG A CD  1 
ATOM   25    N NE  . ARG A  1 8   ? 13.583  -45.555  15.296  1.00 53.50  ? 8    ARG A NE  1 
ATOM   26    C CZ  . ARG A  1 8   ? 13.872  -44.264  15.432  1.00 58.88  ? 8    ARG A CZ  1 
ATOM   27    N NH1 . ARG A  1 8   ? 15.125  -43.841  15.314  1.00 65.04  ? 8    ARG A NH1 1 
ATOM   28    N NH2 . ARG A  1 8   ? 12.906  -43.392  15.688  1.00 56.83  ? 8    ARG A NH2 1 
ATOM   29    N N   . LEU A  1 9   ? 12.587  -47.580  10.233  1.00 57.16  ? 9    LEU A N   1 
ATOM   30    C CA  . LEU A  1 9   ? 11.192  -47.880  9.932   1.00 55.52  ? 9    LEU A CA  1 
ATOM   31    C C   . LEU A  1 9   ? 10.979  -48.351  8.500   1.00 59.13  ? 9    LEU A C   1 
ATOM   32    O O   . LEU A  1 9   ? 9.877   -48.242  7.966   1.00 60.63  ? 9    LEU A O   1 
ATOM   33    C CB  . LEU A  1 9   ? 10.316  -46.659  10.202  1.00 53.54  ? 9    LEU A CB  1 
ATOM   34    C CG  . LEU A  1 9   ? 10.173  -46.315  11.684  1.00 54.12  ? 9    LEU A CG  1 
ATOM   35    C CD1 . LEU A  1 9   ? 9.307   -45.085  11.858  1.00 52.83  ? 9    LEU A CD1 1 
ATOM   36    C CD2 . LEU A  1 9   ? 9.610   -47.495  12.472  1.00 55.35  ? 9    LEU A CD2 1 
ATOM   37    N N   . ARG A  1 10  ? 12.029  -48.878  7.880   1.00 62.55  ? 10   ARG A N   1 
ATOM   38    C CA  . ARG A  1 10  ? 11.900  -49.461  6.550   1.00 64.16  ? 10   ARG A CA  1 
ATOM   39    C C   . ARG A  1 10  ? 10.997  -50.690  6.608   1.00 67.55  ? 10   ARG A C   1 
ATOM   40    O O   . ARG A  1 10  ? 10.746  -51.232  7.686   1.00 68.30  ? 10   ARG A O   1 
ATOM   41    C CB  . ARG A  1 10  ? 13.271  -49.827  5.980   1.00 63.82  ? 10   ARG A CB  1 
ATOM   42    N N   . SER A  1 11  ? 10.509  -51.113  5.444   1.00 67.26  ? 11   SER A N   1 
ATOM   43    C CA  . SER A  1 11  ? 9.597   -52.253  5.317   1.00 69.75  ? 11   SER A CA  1 
ATOM   44    C C   . SER A  1 11  ? 8.306   -52.057  6.111   1.00 65.76  ? 11   SER A C   1 
ATOM   45    O O   . SER A  1 11  ? 7.619   -53.024  6.439   1.00 68.92  ? 11   SER A O   1 
ATOM   46    C CB  . SER A  1 11  ? 10.283  -53.553  5.757   1.00 71.61  ? 11   SER A CB  1 
ATOM   47    O OG  . SER A  1 11  ? 10.446  -53.601  7.166   1.00 68.32  ? 11   SER A OG  1 
ATOM   48    N N   . ALA A  1 12  ? 7.972   -50.805  6.408   1.00 59.60  ? 12   ALA A N   1 
ATOM   49    C CA  . ALA A  1 12  ? 6.783   -50.511  7.197   1.00 56.67  ? 12   ALA A CA  1 
ATOM   50    C C   . ALA A  1 12  ? 5.837   -49.559  6.476   1.00 55.90  ? 12   ALA A C   1 
ATOM   51    O O   . ALA A  1 12  ? 6.266   -48.617  5.808   1.00 54.80  ? 12   ALA A O   1 
ATOM   52    C CB  . ALA A  1 12  ? 7.175   -49.936  8.550   1.00 49.62  ? 12   ALA A CB  1 
ATOM   53    N N   . LEU A  1 13  ? 4.543   -49.824  6.619   1.00 52.53  ? 13   LEU A N   1 
ATOM   54    C CA  . LEU A  1 13  ? 3.507   -48.951  6.090   1.00 49.49  ? 13   LEU A CA  1 
ATOM   55    C C   . LEU A  1 13  ? 2.865   -48.174  7.232   1.00 46.46  ? 13   LEU A C   1 
ATOM   56    O O   . LEU A  1 13  ? 2.417   -48.760  8.218   1.00 44.54  ? 13   LEU A O   1 
ATOM   57    C CB  . LEU A  1 13  ? 2.456   -49.760  5.331   1.00 51.50  ? 13   LEU A CB  1 
ATOM   58    C CG  . LEU A  1 13  ? 1.240   -48.983  4.826   1.00 51.91  ? 13   LEU A CG  1 
ATOM   59    C CD1 . LEU A  1 13  ? 1.669   -47.865  3.892   1.00 55.44  ? 13   LEU A CD1 1 
ATOM   60    C CD2 . LEU A  1 13  ? 0.266   -49.920  4.134   1.00 50.23  ? 13   LEU A CD2 1 
ATOM   61    N N   . ALA A  1 14  ? 2.825   -46.853  7.098   1.00 43.06  ? 14   ALA A N   1 
ATOM   62    C CA  . ALA A  1 14  ? 2.339   -45.997  8.173   1.00 39.50  ? 14   ALA A CA  1 
ATOM   63    C C   . ALA A  1 14  ? 0.996   -45.357  7.838   1.00 48.54  ? 14   ALA A C   1 
ATOM   64    O O   . ALA A  1 14  ? 0.804   -44.831  6.743   1.00 58.97  ? 14   ALA A O   1 
ATOM   65    C CB  . ALA A  1 14  ? 3.367   -44.924  8.487   1.00 34.79  ? 14   ALA A CB  1 
ATOM   66    N N   . LEU A  1 15  ? 0.072   -45.406  8.792   1.00 48.06  ? 15   LEU A N   1 
ATOM   67    C CA  . LEU A  1 15  ? -1.225  -44.755  8.642   1.00 46.83  ? 15   LEU A CA  1 
ATOM   68    C C   . LEU A  1 15  ? -1.363  -43.607  9.633   1.00 46.97  ? 15   LEU A C   1 
ATOM   69    O O   . LEU A  1 15  ? -1.477  -43.826  10.839  1.00 48.50  ? 15   LEU A O   1 
ATOM   70    C CB  . LEU A  1 15  ? -2.362  -45.759  8.837   1.00 46.56  ? 15   LEU A CB  1 
ATOM   71    C CG  . LEU A  1 15  ? -3.782  -45.190  8.817   1.00 45.88  ? 15   LEU A CG  1 
ATOM   72    C CD1 . LEU A  1 15  ? -4.053  -44.470  7.505   1.00 48.94  ? 15   LEU A CD1 1 
ATOM   73    C CD2 . LEU A  1 15  ? -4.804  -46.291  9.050   1.00 45.41  ? 15   LEU A CD2 1 
ATOM   74    N N   . VAL A  1 16  ? -1.351  -42.381  9.120   1.00 44.63  ? 16   VAL A N   1 
ATOM   75    C CA  . VAL A  1 16  ? -1.445  -41.200  9.968   1.00 40.82  ? 16   VAL A CA  1 
ATOM   76    C C   . VAL A  1 16  ? -2.677  -40.368  9.629   1.00 39.36  ? 16   VAL A C   1 
ATOM   77    O O   . VAL A  1 16  ? -2.768  -39.789  8.547   1.00 42.68  ? 16   VAL A O   1 
ATOM   78    C CB  . VAL A  1 16  ? -0.188  -40.317  9.843   1.00 38.56  ? 16   VAL A CB  1 
ATOM   79    C CG1 . VAL A  1 16  ? -0.335  -39.060  10.686  1.00 34.84  ? 16   VAL A CG1 1 
ATOM   80    C CG2 . VAL A  1 16  ? 1.050   -41.100  10.253  1.00 34.30  ? 16   VAL A CG2 1 
ATOM   81    N N   . THR A  1 17  ? -3.625  -40.318  10.559  1.00 38.90  ? 17   THR A N   1 
ATOM   82    C CA  . THR A  1 17  ? -4.819  -39.500  10.388  1.00 38.99  ? 17   THR A CA  1 
ATOM   83    C C   . THR A  1 17  ? -4.537  -38.072  10.837  1.00 42.22  ? 17   THR A C   1 
ATOM   84    O O   . THR A  1 17  ? -3.786  -37.851  11.786  1.00 46.08  ? 17   THR A O   1 
ATOM   85    C CB  . THR A  1 17  ? -6.015  -40.061  11.177  1.00 38.32  ? 17   THR A CB  1 
ATOM   86    O OG1 . THR A  1 17  ? -5.781  -39.908  12.583  1.00 36.97  ? 17   THR A OG1 1 
ATOM   87    C CG2 . THR A  1 17  ? -6.222  -41.534  10.856  1.00 39.82  ? 17   THR A CG2 1 
ATOM   88    N N   . GLY A  1 18  ? -5.140  -37.104  10.155  1.00 36.47  ? 18   GLY A N   1 
ATOM   89    C CA  . GLY A  1 18  ? -4.880  -35.706  10.439  1.00 32.98  ? 18   GLY A CA  1 
ATOM   90    C C   . GLY A  1 18  ? -3.482  -35.321  10.001  1.00 37.82  ? 18   GLY A C   1 
ATOM   91    O O   . GLY A  1 18  ? -2.861  -34.423  10.571  1.00 42.86  ? 18   GLY A O   1 
ATOM   92    N N   . ALA A  1 19  ? -2.989  -36.007  8.974   1.00 37.70  ? 19   ALA A N   1 
ATOM   93    C CA  . ALA A  1 19  ? -1.631  -35.803  8.485   1.00 37.59  ? 19   ALA A CA  1 
ATOM   94    C C   . ALA A  1 19  ? -1.514  -34.554  7.619   1.00 34.53  ? 19   ALA A C   1 
ATOM   95    O O   . ALA A  1 19  ? -0.436  -34.231  7.126   1.00 34.78  ? 19   ALA A O   1 
ATOM   96    C CB  . ALA A  1 19  ? -1.166  -37.025  7.707   1.00 38.14  ? 19   ALA A CB  1 
ATOM   97    N N   . GLY A  1 20  ? -2.626  -33.852  7.438   1.00 36.10  ? 20   GLY A N   1 
ATOM   98    C CA  . GLY A  1 20  ? -2.645  -32.676  6.590   1.00 41.50  ? 20   GLY A CA  1 
ATOM   99    C C   . GLY A  1 20  ? -2.080  -31.431  7.245   1.00 39.87  ? 20   GLY A C   1 
ATOM   100   O O   . GLY A  1 20  ? -1.833  -30.432  6.570   1.00 43.78  ? 20   GLY A O   1 
ATOM   101   N N   . SER A  1 21  ? -1.866  -31.485  8.557   1.00 43.88  ? 21   SER A N   1 
ATOM   102   C CA  . SER A  1 21  ? -1.421  -30.305  9.291   1.00 45.61  ? 21   SER A CA  1 
ATOM   103   C C   . SER A  1 21  ? -0.801  -30.624  10.650  1.00 49.14  ? 21   SER A C   1 
ATOM   104   O O   . SER A  1 21  ? -1.029  -31.693  11.216  1.00 52.76  ? 21   SER A O   1 
ATOM   105   C CB  . SER A  1 21  ? -2.594  -29.341  9.484   1.00 47.88  ? 21   SER A CB  1 
ATOM   106   O OG  . SER A  1 21  ? -2.225  -28.243  10.297  1.00 48.09  ? 21   SER A OG  1 
ATOM   107   N N   . GLY A  1 22  ? -0.013  -29.679  11.156  1.00 47.85  ? 22   GLY A N   1 
ATOM   108   C CA  . GLY A  1 22  ? 0.528   -29.735  12.503  1.00 41.04  ? 22   GLY A CA  1 
ATOM   109   C C   . GLY A  1 22  ? 1.349   -30.964  12.840  1.00 34.10  ? 22   GLY A C   1 
ATOM   110   O O   . GLY A  1 22  ? 2.346   -31.261  12.182  1.00 32.12  ? 22   GLY A O   1 
ATOM   111   N N   . ILE A  1 23  ? 0.924   -31.674  13.881  1.00 31.97  ? 23   ILE A N   1 
ATOM   112   C CA  . ILE A  1 23  ? 1.629   -32.861  14.351  1.00 33.55  ? 23   ILE A CA  1 
ATOM   113   C C   . ILE A  1 23  ? 1.574   -33.985  13.323  1.00 35.91  ? 23   ILE A C   1 
ATOM   114   O O   . ILE A  1 23  ? 2.587   -34.624  13.039  1.00 38.62  ? 23   ILE A O   1 
ATOM   115   C CB  . ILE A  1 23  ? 1.048   -33.363  15.689  1.00 33.73  ? 23   ILE A CB  1 
ATOM   116   C CG1 . ILE A  1 23  ? 1.233   -32.304  16.778  1.00 26.11  ? 23   ILE A CG1 1 
ATOM   117   C CG2 . ILE A  1 23  ? 1.702   -34.670  16.104  1.00 29.39  ? 23   ILE A CG2 1 
ATOM   118   C CD1 . ILE A  1 23  ? 0.725   -32.728  18.138  1.00 29.59  ? 23   ILE A CD1 1 
ATOM   119   N N   . GLY A  1 24  ? 0.390   -34.211  12.762  1.00 37.25  ? 24   GLY A N   1 
ATOM   120   C CA  . GLY A  1 24  ? 0.190   -35.263  11.780  1.00 37.28  ? 24   GLY A CA  1 
ATOM   121   C C   . GLY A  1 24  ? 1.097   -35.152  10.570  1.00 40.44  ? 24   GLY A C   1 
ATOM   122   O O   . GLY A  1 24  ? 1.561   -36.162  10.041  1.00 43.41  ? 24   GLY A O   1 
ATOM   123   N N   . ARG A  1 25  ? 1.352   -33.924  10.130  1.00 39.74  ? 25   ARG A N   1 
ATOM   124   C CA  . ARG A  1 25  ? 2.230   -33.693  8.988   1.00 38.18  ? 25   ARG A CA  1 
ATOM   125   C C   . ARG A  1 25  ? 3.685   -33.962  9.353   1.00 38.71  ? 25   ARG A C   1 
ATOM   126   O O   . ARG A  1 25  ? 4.416   -34.598  8.594   1.00 40.91  ? 25   ARG A O   1 
ATOM   127   C CB  . ARG A  1 25  ? 2.074   -32.263  8.465   1.00 36.58  ? 25   ARG A CB  1 
ATOM   128   C CG  . ARG A  1 25  ? 3.094   -31.880  7.401   1.00 37.37  ? 25   ARG A CG  1 
ATOM   129   C CD  . ARG A  1 25  ? 2.734   -30.567  6.722   1.00 40.52  ? 25   ARG A CD  1 
ATOM   130   N NE  . ARG A  1 25  ? 1.571   -30.703  5.849   1.00 45.69  ? 25   ARG A NE  1 
ATOM   131   C CZ  . ARG A  1 25  ? 1.048   -29.708  5.140   1.00 46.18  ? 25   ARG A CZ  1 
ATOM   132   N NH1 . ARG A  1 25  ? 1.582   -28.496  5.200   1.00 49.51  ? 25   ARG A NH1 1 
ATOM   133   N NH2 . ARG A  1 25  ? -0.011  -29.924  4.371   1.00 40.05  ? 25   ARG A NH2 1 
ATOM   134   N N   . ALA A  1 26  ? 4.098   -33.478  10.520  1.00 35.01  ? 26   ALA A N   1 
ATOM   135   C CA  . ALA A  1 26  ? 5.463   -33.680  10.992  1.00 35.36  ? 26   ALA A CA  1 
ATOM   136   C C   . ALA A  1 26  ? 5.747   -35.158  11.224  1.00 39.70  ? 26   ALA A C   1 
ATOM   137   O O   . ALA A  1 26  ? 6.855   -35.632  10.973  1.00 42.96  ? 26   ALA A O   1 
ATOM   138   C CB  . ALA A  1 26  ? 5.705   -32.893  12.261  1.00 30.86  ? 26   ALA A CB  1 
ATOM   139   N N   . VAL A  1 27  ? 4.741   -35.877  11.710  1.00 37.00  ? 27   VAL A N   1 
ATOM   140   C CA  . VAL A  1 27  ? 4.852   -37.318  11.897  1.00 36.33  ? 27   VAL A CA  1 
ATOM   141   C C   . VAL A  1 27  ? 5.111   -37.995  10.557  1.00 39.85  ? 27   VAL A C   1 
ATOM   142   O O   . VAL A  1 27  ? 6.023   -38.810  10.431  1.00 43.17  ? 27   VAL A O   1 
ATOM   143   C CB  . VAL A  1 27  ? 3.582   -37.907  12.547  1.00 30.77  ? 27   VAL A CB  1 
ATOM   144   C CG1 . VAL A  1 27  ? 3.553   -39.418  12.396  1.00 31.67  ? 27   VAL A CG1 1 
ATOM   145   C CG2 . VAL A  1 27  ? 3.505   -37.515  14.015  1.00 24.92  ? 27   VAL A CG2 1 
ATOM   146   N N   . SER A  1 28  ? 4.314   -37.633  9.555   1.00 35.35  ? 28   SER A N   1 
ATOM   147   C CA  . SER A  1 28  ? 4.464   -38.175  8.208   1.00 32.75  ? 28   SER A CA  1 
ATOM   148   C C   . SER A  1 28  ? 5.858   -37.912  7.648   1.00 38.37  ? 28   SER A C   1 
ATOM   149   O O   . SER A  1 28  ? 6.438   -38.768  6.983   1.00 44.71  ? 28   SER A O   1 
ATOM   150   C CB  . SER A  1 28  ? 3.407   -37.584  7.274   1.00 35.63  ? 28   SER A CB  1 
ATOM   151   O OG  . SER A  1 28  ? 2.099   -37.889  7.724   1.00 36.55  ? 28   SER A OG  1 
ATOM   152   N N   . VAL A  1 29  ? 6.392   -36.726  7.924   1.00 37.16  ? 29   VAL A N   1 
ATOM   153   C CA  . VAL A  1 29  ? 7.731   -36.364  7.474   1.00 35.59  ? 29   VAL A CA  1 
ATOM   154   C C   . VAL A  1 29  ? 8.790   -37.223  8.160   1.00 39.24  ? 29   VAL A C   1 
ATOM   155   O O   . VAL A  1 29  ? 9.688   -37.758  7.507   1.00 43.61  ? 29   VAL A O   1 
ATOM   156   C CB  . VAL A  1 29  ? 8.031   -34.873  7.741   1.00 30.62  ? 29   VAL A CB  1 
ATOM   157   C CG1 . VAL A  1 29  ? 9.486   -34.556  7.431   1.00 30.22  ? 29   VAL A CG1 1 
ATOM   158   C CG2 . VAL A  1 29  ? 7.105   -33.991  6.921   1.00 30.58  ? 29   VAL A CG2 1 
ATOM   159   N N   . ARG A  1 30  ? 8.672   -37.357  9.477   1.00 37.63  ? 30   ARG A N   1 
ATOM   160   C CA  . ARG A  1 30  ? 9.629   -38.128  10.263  1.00 37.19  ? 30   ARG A CA  1 
ATOM   161   C C   . ARG A  1 30  ? 9.575   -39.616  9.925   1.00 39.56  ? 30   ARG A C   1 
ATOM   162   O O   . ARG A  1 30  ? 10.613  -40.258  9.765   1.00 43.88  ? 30   ARG A O   1 
ATOM   163   C CB  . ARG A  1 30  ? 9.378   -37.923  11.759  1.00 36.55  ? 30   ARG A CB  1 
ATOM   164   C CG  . ARG A  1 30  ? 10.303  -38.728  12.662  1.00 34.63  ? 30   ARG A CG  1 
ATOM   165   C CD  . ARG A  1 30  ? 11.756  -38.322  12.473  1.00 38.17  ? 30   ARG A CD  1 
ATOM   166   N NE  . ARG A  1 30  ? 12.666  -39.195  13.209  1.00 44.95  ? 30   ARG A NE  1 
ATOM   167   C CZ  . ARG A  1 30  ? 13.082  -38.969  14.450  1.00 45.56  ? 30   ARG A CZ  1 
ATOM   168   N NH1 . ARG A  1 30  ? 12.672  -37.890  15.103  1.00 46.70  ? 30   ARG A NH1 1 
ATOM   169   N NH2 . ARG A  1 30  ? 13.910  -39.821  15.039  1.00 45.20  ? 30   ARG A NH2 1 
ATOM   170   N N   . LEU A  1 31  ? 8.365   -40.159  9.819   1.00 40.26  ? 31   LEU A N   1 
ATOM   171   C CA  . LEU A  1 31  ? 8.191   -41.575  9.504   1.00 38.40  ? 31   LEU A CA  1 
ATOM   172   C C   . LEU A  1 31  ? 8.739   -41.899  8.118   1.00 44.39  ? 31   LEU A C   1 
ATOM   173   O O   . LEU A  1 31  ? 9.461   -42.880  7.944   1.00 51.79  ? 31   LEU A O   1 
ATOM   174   C CB  . LEU A  1 31  ? 6.716   -41.980  9.594   1.00 32.60  ? 31   LEU A CB  1 
ATOM   175   C CG  . LEU A  1 31  ? 6.028   -41.881  10.960  1.00 31.97  ? 31   LEU A CG  1 
ATOM   176   C CD1 . LEU A  1 31  ? 4.668   -42.564  10.934  1.00 33.71  ? 31   LEU A CD1 1 
ATOM   177   C CD2 . LEU A  1 31  ? 6.896   -42.446  12.073  1.00 33.41  ? 31   LEU A CD2 1 
ATOM   178   N N   . ALA A  1 32  ? 8.395   -41.071  7.135   1.00 41.63  ? 32   ALA A N   1 
ATOM   179   C CA  . ALA A  1 32  ? 8.897   -41.249  5.776   1.00 43.97  ? 32   ALA A CA  1 
ATOM   180   C C   . ALA A  1 32  ? 10.406  -41.046  5.732   1.00 46.55  ? 32   ALA A C   1 
ATOM   181   O O   . ALA A  1 32  ? 11.105  -41.672  4.935   1.00 48.28  ? 32   ALA A O   1 
ATOM   182   C CB  . ALA A  1 32  ? 8.205   -40.293  4.819   1.00 40.79  ? 32   ALA A CB  1 
ATOM   183   N N   . GLY A  1 33  ? 10.901  -40.171  6.601   1.00 48.04  ? 33   GLY A N   1 
ATOM   184   C CA  . GLY A  1 33  ? 12.325  -39.916  6.701   1.00 49.20  ? 33   GLY A CA  1 
ATOM   185   C C   . GLY A  1 33  ? 13.080  -41.077  7.319   1.00 53.16  ? 33   GLY A C   1 
ATOM   186   O O   . GLY A  1 33  ? 14.310  -41.101  7.307   1.00 57.61  ? 33   GLY A O   1 
ATOM   187   N N   . GLU A  1 34  ? 12.344  -42.042  7.864   1.00 54.26  ? 34   GLU A N   1 
ATOM   188   C CA  . GLU A  1 34  ? 12.958  -43.224  8.460   1.00 58.75  ? 34   GLU A CA  1 
ATOM   189   C C   . GLU A  1 34  ? 12.684  -44.479  7.633   1.00 55.69  ? 34   GLU A C   1 
ATOM   190   O O   . GLU A  1 34  ? 12.776  -45.598  8.137   1.00 53.92  ? 34   GLU A O   1 
ATOM   191   C CB  . GLU A  1 34  ? 12.470  -43.419  9.898   1.00 62.60  ? 34   GLU A CB  1 
ATOM   192   C CG  . GLU A  1 34  ? 12.932  -42.328  10.853  1.00 68.81  ? 34   GLU A CG  1 
ATOM   193   C CD  . GLU A  1 34  ? 12.690  -42.675  12.310  1.00 75.29  ? 34   GLU A CD  1 
ATOM   194   O OE1 . GLU A  1 34  ? 12.229  -43.802  12.589  1.00 77.24  ? 34   GLU A OE1 1 
ATOM   195   O OE2 . GLU A  1 34  ? 12.964  -41.819  13.177  1.00 77.65  ? 34   GLU A OE2 1 
ATOM   196   N N   . GLY A  1 35  ? 12.346  -44.284  6.361   1.00 54.71  ? 35   GLY A N   1 
ATOM   197   C CA  . GLY A  1 35  ? 12.187  -45.389  5.431   1.00 54.33  ? 35   GLY A CA  1 
ATOM   198   C C   . GLY A  1 35  ? 10.774  -45.927  5.310   1.00 50.81  ? 35   GLY A C   1 
ATOM   199   O O   . GLY A  1 35  ? 10.482  -46.727  4.421   1.00 50.00  ? 35   GLY A O   1 
ATOM   200   N N   . ALA A  1 36  ? 9.893   -45.490  6.202   1.00 45.27  ? 36   ALA A N   1 
ATOM   201   C CA  . ALA A  1 36  ? 8.516   -45.970  6.206   1.00 44.48  ? 36   ALA A CA  1 
ATOM   202   C C   . ALA A  1 36  ? 7.702   -45.366  5.068   1.00 46.53  ? 36   ALA A C   1 
ATOM   203   O O   . ALA A  1 36  ? 7.911   -44.217  4.683   1.00 51.84  ? 36   ALA A O   1 
ATOM   204   C CB  . ALA A  1 36  ? 7.857   -45.667  7.543   1.00 34.52  ? 36   ALA A CB  1 
ATOM   205   N N   . THR A  1 37  ? 6.777   -46.154  4.530   1.00 45.86  ? 37   THR A N   1 
ATOM   206   C CA  . THR A  1 37  ? 5.831   -45.656  3.540   1.00 46.18  ? 37   THR A CA  1 
ATOM   207   C C   . THR A  1 37  ? 4.609   -45.096  4.257   1.00 45.09  ? 37   THR A C   1 
ATOM   208   O O   . THR A  1 37  ? 3.974   -45.789  5.051   1.00 45.32  ? 37   THR A O   1 
ATOM   209   C CB  . THR A  1 37  ? 5.399   -46.755  2.553   1.00 51.56  ? 37   THR A CB  1 
ATOM   210   O OG1 . THR A  1 37  ? 6.551   -47.272  1.876   1.00 56.91  ? 37   THR A OG1 1 
ATOM   211   C CG2 . THR A  1 37  ? 4.424   -46.198  1.528   1.00 54.63  ? 37   THR A CG2 1 
ATOM   212   N N   . VAL A  1 38  ? 4.285   -43.838  3.978   1.00 44.77  ? 38   VAL A N   1 
ATOM   213   C CA  . VAL A  1 38  ? 3.237   -43.143  4.714   1.00 43.38  ? 38   VAL A CA  1 
ATOM   214   C C   . VAL A  1 38  ? 1.921   -43.063  3.946   1.00 48.84  ? 38   VAL A C   1 
ATOM   215   O O   . VAL A  1 38  ? 1.884   -42.635  2.792   1.00 52.27  ? 38   VAL A O   1 
ATOM   216   C CB  . VAL A  1 38  ? 3.680   -41.714  5.085   1.00 39.37  ? 38   VAL A CB  1 
ATOM   217   C CG1 . VAL A  1 38  ? 2.578   -40.992  5.845   1.00 38.49  ? 38   VAL A CG1 1 
ATOM   218   C CG2 . VAL A  1 38  ? 4.960   -41.754  5.903   1.00 40.81  ? 38   VAL A CG2 1 
ATOM   219   N N   . ALA A  1 39  ? 0.843   -43.488  4.597   1.00 44.81  ? 39   ALA A N   1 
ATOM   220   C CA  . ALA A  1 39  ? -0.501  -43.305  4.067   1.00 42.06  ? 39   ALA A CA  1 
ATOM   221   C C   . ALA A  1 39  ? -1.161  -42.125  4.773   1.00 43.33  ? 39   ALA A C   1 
ATOM   222   O O   . ALA A  1 39  ? -1.844  -42.295  5.783   1.00 45.20  ? 39   ALA A O   1 
ATOM   223   C CB  . ALA A  1 39  ? -1.327  -44.569  4.239   1.00 39.59  ? 39   ALA A CB  1 
ATOM   224   N N   . ALA A  1 40  ? -0.944  -40.928  4.237   1.00 43.02  ? 40   ALA A N   1 
ATOM   225   C CA  . ALA A  1 40  ? -1.419  -39.701  4.869   1.00 40.37  ? 40   ALA A CA  1 
ATOM   226   C C   . ALA A  1 40  ? -2.927  -39.525  4.722   1.00 44.07  ? 40   ALA A C   1 
ATOM   227   O O   . ALA A  1 40  ? -3.429  -39.266  3.628   1.00 48.10  ? 40   ALA A O   1 
ATOM   228   C CB  . ALA A  1 40  ? -0.689  -38.498  4.288   1.00 38.25  ? 40   ALA A CB  1 
ATOM   229   N N   . CYS A  1 41  ? -3.644  -39.663  5.833   1.00 45.12  ? 41   CYS A N   1 
ATOM   230   C CA  . CYS A  1 41  ? -5.090  -39.470  5.840   1.00 46.12  ? 41   CYS A CA  1 
ATOM   231   C C   . CYS A  1 41  ? -5.473  -38.168  6.534   1.00 41.85  ? 41   CYS A C   1 
ATOM   232   O O   . CYS A  1 41  ? -4.832  -37.756  7.501   1.00 39.48  ? 41   CYS A O   1 
ATOM   233   C CB  . CYS A  1 41  ? -5.789  -40.646  6.522   1.00 46.97  ? 41   CYS A CB  1 
ATOM   234   S SG  . CYS A  1 41  ? -7.557  -40.382  6.795   1.00 68.48  ? 41   CYS A SG  1 
ATOM   235   N N   . ASP A  1 42  ? -6.526  -37.528  6.035   1.00 38.01  ? 42   ASP A N   1 
ATOM   236   C CA  . ASP A  1 42  ? -6.995  -36.266  6.592   1.00 37.55  ? 42   ASP A CA  1 
ATOM   237   C C   . ASP A  1 42  ? -8.409  -35.966  6.111   1.00 45.07  ? 42   ASP A C   1 
ATOM   238   O O   . ASP A  1 42  ? -8.815  -36.421  5.041   1.00 50.29  ? 42   ASP A O   1 
ATOM   239   C CB  . ASP A  1 42  ? -6.051  -35.125  6.204   1.00 39.18  ? 42   ASP A CB  1 
ATOM   240   C CG  . ASP A  1 42  ? -6.300  -33.864  7.006   1.00 39.27  ? 42   ASP A CG  1 
ATOM   241   O OD1 . ASP A  1 42  ? -7.246  -33.120  6.673   1.00 33.81  ? 42   ASP A OD1 1 
ATOM   242   O OD2 . ASP A  1 42  ? -5.545  -33.612  7.968   1.00 42.22  ? 42   ASP A OD2 1 
ATOM   243   N N   . LEU A  1 43  ? -9.156  -35.204  6.904   1.00 47.85  ? 43   LEU A N   1 
ATOM   244   C CA  . LEU A  1 43  ? -10.493 -34.777  6.508   1.00 50.01  ? 43   LEU A CA  1 
ATOM   245   C C   . LEU A  1 43  ? -10.401 -33.864  5.291   1.00 52.75  ? 43   LEU A C   1 
ATOM   246   O O   . LEU A  1 43  ? -11.210 -33.954  4.367   1.00 54.29  ? 43   LEU A O   1 
ATOM   247   C CB  . LEU A  1 43  ? -11.201 -34.063  7.660   1.00 45.05  ? 43   LEU A CB  1 
ATOM   248   C CG  . LEU A  1 43  ? -12.632 -33.595  7.389   1.00 49.41  ? 43   LEU A CG  1 
ATOM   249   C CD1 . LEU A  1 43  ? -13.545 -34.782  7.123   1.00 53.94  ? 43   LEU A CD1 1 
ATOM   250   C CD2 . LEU A  1 43  ? -13.152 -32.762  8.549   1.00 54.26  ? 43   LEU A CD2 1 
ATOM   251   N N   . ASP A  1 44  ? -9.404  -32.986  5.300   1.00 53.68  ? 44   ASP A N   1 
ATOM   252   C CA  . ASP A  1 44  ? -9.116  -32.138  4.152   1.00 57.05  ? 44   ASP A CA  1 
ATOM   253   C C   . ASP A  1 44  ? -8.154  -32.865  3.223   1.00 57.99  ? 44   ASP A C   1 
ATOM   254   O O   . ASP A  1 44  ? -6.949  -32.910  3.477   1.00 56.89  ? 44   ASP A O   1 
ATOM   255   C CB  . ASP A  1 44  ? -8.526  -30.798  4.597   1.00 57.83  ? 44   ASP A CB  1 
ATOM   256   C CG  . ASP A  1 44  ? -8.461  -29.785  3.469   1.00 62.82  ? 44   ASP A CG  1 
ATOM   257   O OD1 . ASP A  1 44  ? -7.520  -29.861  2.652   1.00 67.05  ? 44   ASP A OD1 1 
ATOM   258   O OD2 . ASP A  1 44  ? -9.349  -28.910  3.404   1.00 64.27  ? 44   ASP A OD2 1 
ATOM   259   N N   . ARG A  1 45  ? -8.696  -33.445  2.156   1.00 61.46  ? 45   ARG A N   1 
ATOM   260   C CA  . ARG A  1 45  ? -7.905  -34.219  1.204   1.00 65.54  ? 45   ARG A CA  1 
ATOM   261   C C   . ARG A  1 45  ? -6.774  -33.395  0.598   1.00 64.49  ? 45   ARG A C   1 
ATOM   262   O O   . ARG A  1 45  ? -5.659  -33.888  0.424   1.00 63.05  ? 45   ARG A O   1 
ATOM   263   C CB  . ARG A  1 45  ? -8.805  -34.766  0.095   1.00 72.12  ? 45   ARG A CB  1 
ATOM   264   C CG  . ARG A  1 45  ? -8.057  -35.401  -1.063  1.00 79.03  ? 45   ARG A CG  1 
ATOM   265   C CD  . ARG A  1 45  ? -8.961  -35.518  -2.275  1.00 88.12  ? 45   ARG A CD  1 
ATOM   266   N NE  . ARG A  1 45  ? -9.696  -34.277  -2.502  1.00 93.48  ? 45   ARG A NE  1 
ATOM   267   C CZ  . ARG A  1 45  ? -10.451 -34.036  -3.568  1.00 99.85  ? 45   ARG A CZ  1 
ATOM   268   N NH1 . ARG A  1 45  ? -10.573 -34.952  -4.520  1.00 102.66 ? 45   ARG A NH1 1 
ATOM   269   N NH2 . ARG A  1 45  ? -11.083 -32.876  -3.685  1.00 101.82 ? 45   ARG A NH2 1 
ATOM   270   N N   . ALA A  1 46  ? -7.068  -32.136  0.287   1.00 63.02  ? 46   ALA A N   1 
ATOM   271   C CA  . ALA A  1 46  ? -6.076  -31.231  -0.282  1.00 60.80  ? 46   ALA A CA  1 
ATOM   272   C C   . ALA A  1 46  ? -4.906  -31.023  0.675   1.00 54.84  ? 46   ALA A C   1 
ATOM   273   O O   . ALA A  1 46  ? -3.766  -30.845  0.246   1.00 54.17  ? 46   ALA A O   1 
ATOM   274   C CB  . ALA A  1 46  ? -6.718  -29.899  -0.635  1.00 64.01  ? 46   ALA A CB  1 
ATOM   275   N N   . ALA A  1 47  ? -5.195  -31.047  1.973   1.00 49.06  ? 47   ALA A N   1 
ATOM   276   C CA  . ALA A  1 47  ? -4.159  -30.917  2.989   1.00 42.40  ? 47   ALA A CA  1 
ATOM   277   C C   . ALA A  1 47  ? -3.355  -32.208  3.101   1.00 44.06  ? 47   ALA A C   1 
ATOM   278   O O   . ALA A  1 47  ? -2.149  -32.181  3.350   1.00 45.38  ? 47   ALA A O   1 
ATOM   279   C CB  . ALA A  1 47  ? -4.771  -30.552  4.330   1.00 37.93  ? 47   ALA A CB  1 
ATOM   280   N N   . ALA A  1 48  ? -4.032  -33.337  2.914   1.00 44.92  ? 48   ALA A N   1 
ATOM   281   C CA  . ALA A  1 48  ? -3.376  -34.639  2.942   1.00 44.06  ? 48   ALA A CA  1 
ATOM   282   C C   . ALA A  1 48  ? -2.465  -34.807  1.730   1.00 52.17  ? 48   ALA A C   1 
ATOM   283   O O   . ALA A  1 48  ? -1.350  -35.315  1.845   1.00 56.18  ? 48   ALA A O   1 
ATOM   284   C CB  . ALA A  1 48  ? -4.407  -35.755  2.992   1.00 38.48  ? 48   ALA A CB  1 
ATOM   285   N N   . GLN A  1 49  ? -2.950  -34.376  0.570   1.00 53.19  ? 49   GLN A N   1 
ATOM   286   C CA  . GLN A  1 49  ? -2.172  -34.442  -0.662  1.00 55.07  ? 49   GLN A CA  1 
ATOM   287   C C   . GLN A  1 49  ? -0.977  -33.497  -0.610  1.00 57.12  ? 49   GLN A C   1 
ATOM   288   O O   . GLN A  1 49  ? 0.074   -33.779  -1.185  1.00 61.29  ? 49   GLN A O   1 
ATOM   289   C CB  . GLN A  1 49  ? -3.051  -34.111  -1.870  1.00 54.17  ? 49   GLN A CB  1 
ATOM   290   C CG  . GLN A  1 49  ? -4.094  -35.169  -2.189  1.00 57.09  ? 49   GLN A CG  1 
ATOM   291   C CD  . GLN A  1 49  ? -5.068  -34.723  -3.260  1.00 61.76  ? 49   GLN A CD  1 
ATOM   292   O OE1 . GLN A  1 49  ? -5.493  -33.567  -3.286  1.00 60.73  ? 49   GLN A OE1 1 
ATOM   293   N NE2 . GLN A  1 49  ? -5.425  -35.637  -4.155  1.00 65.49  ? 49   GLN A NE2 1 
ATOM   294   N N   . GLU A  1 50  ? -1.146  -32.376  0.084   1.00 53.49  ? 50   GLU A N   1 
ATOM   295   C CA  . GLU A  1 50  ? -0.075  -31.399  0.239   1.00 53.40  ? 50   GLU A CA  1 
ATOM   296   C C   . GLU A  1 50  ? 1.049   -31.974  1.093   1.00 52.67  ? 50   GLU A C   1 
ATOM   297   O O   . GLU A  1 50  ? 2.219   -31.635  0.913   1.00 52.37  ? 50   GLU A O   1 
ATOM   298   C CB  . GLU A  1 50  ? -0.611  -30.108  0.860   1.00 54.79  ? 50   GLU A CB  1 
ATOM   299   C CG  . GLU A  1 50  ? 0.398   -28.972  0.910   1.00 59.71  ? 50   GLU A CG  1 
ATOM   300   C CD  . GLU A  1 50  ? -0.185  -27.701  1.493   1.00 68.47  ? 50   GLU A CD  1 
ATOM   301   O OE1 . GLU A  1 50  ? -0.952  -27.792  2.476   1.00 72.35  ? 50   GLU A OE1 1 
ATOM   302   O OE2 . GLU A  1 50  ? 0.119   -26.610  0.966   1.00 70.67  ? 50   GLU A OE2 1 
ATOM   303   N N   . THR A  1 51  ? 0.682   -32.852  2.021   1.00 50.28  ? 51   THR A N   1 
ATOM   304   C CA  . THR A  1 51  ? 1.649   -33.514  2.887   1.00 46.36  ? 51   THR A CA  1 
ATOM   305   C C   . THR A  1 51  ? 2.437   -34.569  2.116   1.00 53.83  ? 51   THR A C   1 
ATOM   306   O O   . THR A  1 51  ? 3.636   -34.748  2.335   1.00 61.44  ? 51   THR A O   1 
ATOM   307   C CB  . THR A  1 51  ? 0.957   -34.175  4.096   1.00 38.36  ? 51   THR A CB  1 
ATOM   308   O OG1 . THR A  1 51  ? 0.198   -33.193  4.811   1.00 34.96  ? 51   THR A OG1 1 
ATOM   309   C CG2 . THR A  1 51  ? 1.984   -34.798  5.032   1.00 35.09  ? 51   THR A CG2 1 
ATOM   310   N N   . VAL A  1 52  ? 1.755   -35.260  1.207   1.00 54.41  ? 52   VAL A N   1 
ATOM   311   C CA  . VAL A  1 52  ? 2.367   -36.333  0.431   1.00 57.01  ? 52   VAL A CA  1 
ATOM   312   C C   . VAL A  1 52  ? 3.462   -35.814  -0.501  1.00 64.07  ? 52   VAL A C   1 
ATOM   313   O O   . VAL A  1 52  ? 4.513   -36.441  -0.644  1.00 70.50  ? 52   VAL A O   1 
ATOM   314   C CB  . VAL A  1 52  ? 1.306   -37.094  -0.393  1.00 58.99  ? 52   VAL A CB  1 
ATOM   315   C CG1 . VAL A  1 52  ? 1.963   -38.085  -1.343  1.00 62.94  ? 52   VAL A CG1 1 
ATOM   316   C CG2 . VAL A  1 52  ? 0.340   -37.808  0.535   1.00 57.19  ? 52   VAL A CG2 1 
ATOM   317   N N   . ARG A  1 53  ? 3.226   -34.661  -1.121  1.00 62.08  ? 53   ARG A N   1 
ATOM   318   C CA  . ARG A  1 53  ? 4.209   -34.088  -2.036  1.00 63.09  ? 53   ARG A CA  1 
ATOM   319   C C   . ARG A  1 53  ? 5.421   -33.555  -1.275  1.00 61.19  ? 53   ARG A C   1 
ATOM   320   O O   . ARG A  1 53  ? 6.473   -33.306  -1.865  1.00 65.63  ? 53   ARG A O   1 
ATOM   321   C CB  . ARG A  1 53  ? 3.584   -32.977  -2.884  1.00 65.06  ? 53   ARG A CB  1 
ATOM   322   C CG  . ARG A  1 53  ? 3.397   -31.653  -2.164  1.00 63.89  ? 53   ARG A CG  1 
ATOM   323   C CD  . ARG A  1 53  ? 2.925   -30.579  -3.131  1.00 66.38  ? 53   ARG A CD  1 
ATOM   324   N NE  . ARG A  1 53  ? 1.602   -30.875  -3.673  1.00 69.29  ? 53   ARG A NE  1 
ATOM   325   C CZ  . ARG A  1 53  ? 0.486   -30.259  -3.297  1.00 70.60  ? 53   ARG A CZ  1 
ATOM   326   N NH1 . ARG A  1 53  ? 0.532   -29.301  -2.382  1.00 68.50  ? 53   ARG A NH1 1 
ATOM   327   N NH2 . ARG A  1 53  ? -0.675  -30.594  -3.842  1.00 73.84  ? 53   ARG A NH2 1 
ATOM   328   N N   . LEU A  1 54  ? 5.268   -33.381  0.034   1.00 52.67  ? 54   LEU A N   1 
ATOM   329   C CA  . LEU A  1 54  ? 6.381   -32.989  0.892   1.00 46.77  ? 54   LEU A CA  1 
ATOM   330   C C   . LEU A  1 54  ? 7.286   -34.182  1.178   1.00 50.38  ? 54   LEU A C   1 
ATOM   331   O O   . LEU A  1 54  ? 8.472   -34.021  1.466   1.00 54.09  ? 54   LEU A O   1 
ATOM   332   C CB  . LEU A  1 54  ? 5.871   -32.392  2.207   1.00 38.69  ? 54   LEU A CB  1 
ATOM   333   C CG  . LEU A  1 54  ? 5.364   -30.950  2.172   1.00 38.24  ? 54   LEU A CG  1 
ATOM   334   C CD1 . LEU A  1 54  ? 4.752   -30.568  3.509   1.00 39.68  ? 54   LEU A CD1 1 
ATOM   335   C CD2 . LEU A  1 54  ? 6.494   -30.002  1.814   1.00 35.69  ? 54   LEU A CD2 1 
ATOM   336   N N   . LEU A  1 55  ? 6.715   -35.379  1.095   1.00 47.57  ? 55   LEU A N   1 
ATOM   337   C CA  . LEU A  1 55  ? 7.452   -36.606  1.372   1.00 43.43  ? 55   LEU A CA  1 
ATOM   338   C C   . LEU A  1 55  ? 8.331   -37.011  0.192   1.00 43.82  ? 55   LEU A C   1 
ATOM   339   O O   . LEU A  1 55  ? 8.182   -36.492  -0.915  1.00 46.41  ? 55   LEU A O   1 
ATOM   340   C CB  . LEU A  1 55  ? 6.486   -37.739  1.721   1.00 38.29  ? 55   LEU A CB  1 
ATOM   341   C CG  . LEU A  1 55  ? 5.509   -37.466  2.866   1.00 34.25  ? 55   LEU A CG  1 
ATOM   342   C CD1 . LEU A  1 55  ? 4.636   -38.683  3.125   1.00 36.60  ? 55   LEU A CD1 1 
ATOM   343   C CD2 . LEU A  1 55  ? 6.252   -37.054  4.128   1.00 33.45  ? 55   LEU A CD2 1 
ATOM   344   N N   . PRO A  1 64  ? 15.856  -40.027  -4.613  1.00 92.81  ? 64   PRO A N   1 
ATOM   345   C CA  . PRO A  1 64  ? 15.419  -39.910  -3.218  1.00 94.76  ? 64   PRO A CA  1 
ATOM   346   C C   . PRO A  1 64  ? 15.272  -41.262  -2.546  1.00 99.70  ? 64   PRO A C   1 
ATOM   347   O O   . PRO A  1 64  ? 15.914  -42.229  -2.962  1.00 102.26 ? 64   PRO A O   1 
ATOM   348   C CB  . PRO A  1 64  ? 14.060  -39.218  -3.331  1.00 94.23  ? 64   PRO A CB  1 
ATOM   349   N N   . PRO A  1 65  ? 14.415  -41.336  -1.518  1.00 100.22 ? 65   PRO A N   1 
ATOM   350   C CA  . PRO A  1 65  ? 14.205  -42.575  -0.763  1.00 102.05 ? 65   PRO A CA  1 
ATOM   351   C C   . PRO A  1 65  ? 13.011  -43.403  -1.267  1.00 101.37 ? 65   PRO A C   1 
ATOM   352   O O   . PRO A  1 65  ? 12.458  -43.139  -2.341  1.00 98.45  ? 65   PRO A O   1 
ATOM   353   C CB  . PRO A  1 65  ? 13.962  -42.069  0.662   1.00 100.96 ? 65   PRO A CB  1 
ATOM   354   N N   . ARG A  1 66  ? 12.635  -44.420  -0.497  1.00 107.73 ? 66   ARG A N   1 
ATOM   355   C CA  . ARG A  1 66  ? 11.488  -45.260  -0.843  1.00 112.79 ? 66   ARG A CA  1 
ATOM   356   C C   . ARG A  1 66  ? 10.179  -44.469  -0.755  1.00 116.02 ? 66   ARG A C   1 
ATOM   357   O O   . ARG A  1 66  ? 9.727   -44.123  0.336   1.00 117.87 ? 66   ARG A O   1 
ATOM   358   C CB  . ARG A  1 66  ? 11.423  -46.489  0.071   1.00 110.47 ? 66   ARG A CB  1 
ATOM   359   C CG  . ARG A  1 66  ? 10.340  -47.493  -0.311  1.00 108.25 ? 66   ARG A CG  1 
ATOM   360   C CD  . ARG A  1 66  ? 10.932  -48.801  -0.816  1.00 105.15 ? 66   ARG A CD  1 
ATOM   361   N NE  . ARG A  1 66  ? 12.392  -48.824  -0.767  1.00 100.89 ? 66   ARG A NE  1 
ATOM   362   C CZ  . ARG A  1 66  ? 13.175  -48.696  -1.834  1.00 97.79  ? 66   ARG A CZ  1 
ATOM   363   N NH1 . ARG A  1 66  ? 12.636  -48.533  -3.033  1.00 98.16  ? 66   ARG A NH1 1 
ATOM   364   N NH2 . ARG A  1 66  ? 14.495  -48.734  -1.704  1.00 94.73  ? 66   ARG A NH2 1 
ATOM   365   N N   . GLY A  1 67  ? 9.569   -44.189  -1.904  1.00 121.62 ? 67   GLY A N   1 
ATOM   366   C CA  . GLY A  1 67  ? 8.365   -43.376  -1.949  1.00 122.83 ? 67   GLY A CA  1 
ATOM   367   C C   . GLY A  1 67  ? 7.074   -44.173  -1.896  1.00 124.54 ? 67   GLY A C   1 
ATOM   368   O O   . GLY A  1 67  ? 6.782   -44.821  -0.890  1.00 125.93 ? 67   GLY A O   1 
ATOM   369   N N   . ASN A  1 68  ? 6.312   -44.123  -2.988  1.00 113.85 ? 68   ASN A N   1 
ATOM   370   C CA  . ASN A  1 68  ? 4.995   -44.759  -3.090  1.00 95.53  ? 68   ASN A CA  1 
ATOM   371   C C   . ASN A  1 68  ? 4.028   -44.308  -1.996  1.00 78.31  ? 68   ASN A C   1 
ATOM   372   O O   . ASN A  1 68  ? 3.193   -45.086  -1.537  1.00 77.01  ? 68   ASN A O   1 
ATOM   373   C CB  . ASN A  1 68  ? 5.127   -46.285  -3.066  1.00 90.57  ? 68   ASN A CB  1 
ATOM   374   N N   . HIS A  1 69  ? 4.143   -43.048  -1.586  1.00 64.71  ? 69   HIS A N   1 
ATOM   375   C CA  . HIS A  1 69  ? 3.244   -42.480  -0.587  1.00 57.96  ? 69   HIS A CA  1 
ATOM   376   C C   . HIS A  1 69  ? 1.885   -42.164  -1.202  1.00 59.07  ? 69   HIS A C   1 
ATOM   377   O O   . HIS A  1 69  ? 1.790   -41.870  -2.394  1.00 65.63  ? 69   HIS A O   1 
ATOM   378   C CB  . HIS A  1 69  ? 3.851   -41.217  0.027   1.00 56.01  ? 69   HIS A CB  1 
ATOM   379   C CG  . HIS A  1 69  ? 5.214   -41.423  0.610   1.00 49.90  ? 69   HIS A CG  1 
ATOM   380   N ND1 . HIS A  1 69  ? 5.437   -42.209  1.720   1.00 45.87  ? 69   HIS A ND1 1 
ATOM   381   C CD2 . HIS A  1 69  ? 6.425   -40.943  0.240   1.00 47.06  ? 69   HIS A CD2 1 
ATOM   382   C CE1 . HIS A  1 69  ? 6.726   -42.207  2.007   1.00 44.47  ? 69   HIS A CE1 1 
ATOM   383   N NE2 . HIS A  1 69  ? 7.348   -41.446  1.124   1.00 45.25  ? 69   HIS A NE2 1 
ATOM   384   N N   . ALA A  1 70  ? 0.836   -42.221  -0.388  1.00 54.53  ? 70   ALA A N   1 
ATOM   385   C CA  . ALA A  1 70  ? -0.516  -41.979  -0.877  1.00 53.78  ? 70   ALA A CA  1 
ATOM   386   C C   . ALA A  1 70  ? -1.326  -41.131  0.097   1.00 50.04  ? 70   ALA A C   1 
ATOM   387   O O   . ALA A  1 70  ? -1.123  -41.194  1.309   1.00 48.71  ? 70   ALA A O   1 
ATOM   388   C CB  . ALA A  1 70  ? -1.224  -43.298  -1.141  1.00 55.10  ? 70   ALA A CB  1 
ATOM   389   N N   . ALA A  1 71  ? -2.246  -40.338  -0.444  1.00 51.81  ? 71   ALA A N   1 
ATOM   390   C CA  . ALA A  1 71  ? -3.118  -39.499  0.369   1.00 48.16  ? 71   ALA A CA  1 
ATOM   391   C C   . ALA A  1 71  ? -4.523  -40.083  0.437   1.00 49.99  ? 71   ALA A C   1 
ATOM   392   O O   . ALA A  1 71  ? -5.063  -40.545  -0.568  1.00 55.45  ? 71   ALA A O   1 
ATOM   393   C CB  . ALA A  1 71  ? -3.161  -38.085  -0.181  1.00 39.61  ? 71   ALA A CB  1 
ATOM   394   N N   . PHE A  1 72  ? -5.114  -40.056  1.627   1.00 50.70  ? 72   PHE A N   1 
ATOM   395   C CA  . PHE A  1 72  ? -6.460  -40.579  1.820   1.00 53.89  ? 72   PHE A CA  1 
ATOM   396   C C   . PHE A  1 72  ? -7.368  -39.537  2.463   1.00 58.90  ? 72   PHE A C   1 
ATOM   397   O O   . PHE A  1 72  ? -6.905  -38.664  3.196   1.00 63.81  ? 72   PHE A O   1 
ATOM   398   C CB  . PHE A  1 72  ? -6.425  -41.846  2.678   1.00 52.22  ? 72   PHE A CB  1 
ATOM   399   C CG  . PHE A  1 72  ? -5.722  -43.004  2.026   1.00 48.26  ? 72   PHE A CG  1 
ATOM   400   C CD1 . PHE A  1 72  ? -4.351  -43.158  2.149   1.00 41.27  ? 72   PHE A CD1 1 
ATOM   401   C CD2 . PHE A  1 72  ? -6.433  -43.939  1.292   1.00 50.57  ? 72   PHE A CD2 1 
ATOM   402   C CE1 . PHE A  1 72  ? -3.702  -44.222  1.550   1.00 43.24  ? 72   PHE A CE1 1 
ATOM   403   C CE2 . PHE A  1 72  ? -5.789  -45.005  0.691   1.00 49.90  ? 72   PHE A CE2 1 
ATOM   404   C CZ  . PHE A  1 72  ? -4.423  -45.147  0.821   1.00 48.02  ? 72   PHE A CZ  1 
ATOM   405   N N   . GLN A  1 73  ? -8.662  -39.633  2.179   1.00 61.33  ? 73   GLN A N   1 
ATOM   406   C CA  . GLN A  1 73  ? -9.642  -38.726  2.763   1.00 64.07  ? 73   GLN A CA  1 
ATOM   407   C C   . GLN A  1 73  ? -10.652 -39.516  3.585   1.00 63.42  ? 73   GLN A C   1 
ATOM   408   O O   . GLN A  1 73  ? -11.204 -40.511  3.113   1.00 66.39  ? 73   GLN A O   1 
ATOM   409   C CB  . GLN A  1 73  ? -10.350 -37.917  1.671   1.00 73.31  ? 73   GLN A CB  1 
ATOM   410   C CG  . GLN A  1 73  ? -11.154 -36.724  2.182   1.00 79.43  ? 73   GLN A CG  1 
ATOM   411   C CD  . GLN A  1 73  ? -12.517 -37.110  2.729   1.00 82.14  ? 73   GLN A CD  1 
ATOM   412   O OE1 . GLN A  1 73  ? -13.080 -38.140  2.358   1.00 84.94  ? 73   GLN A OE1 1 
ATOM   413   N NE2 . GLN A  1 73  ? -13.052 -36.283  3.620   1.00 80.33  ? 73   GLN A NE2 1 
ATOM   414   N N   . ALA A  1 74  ? -10.895 -39.065  4.812   1.00 57.87  ? 74   ALA A N   1 
ATOM   415   C CA  . ALA A  1 74  ? -11.822 -39.752  5.702   1.00 55.92  ? 74   ALA A CA  1 
ATOM   416   C C   . ALA A  1 74  ? -12.248 -38.881  6.877   1.00 52.69  ? 74   ALA A C   1 
ATOM   417   O O   . ALA A  1 74  ? -11.468 -38.077  7.387   1.00 48.73  ? 74   ALA A O   1 
ATOM   418   C CB  . ALA A  1 74  ? -11.200 -41.046  6.213   1.00 54.22  ? 74   ALA A CB  1 
ATOM   419   N N   . ASP A  1 75  ? -13.499 -39.047  7.295   1.00 55.10  ? 75   ASP A N   1 
ATOM   420   C CA  . ASP A  1 75  ? -13.981 -38.468  8.541   1.00 49.33  ? 75   ASP A CA  1 
ATOM   421   C C   . ASP A  1 75  ? -13.928 -39.559  9.603   1.00 43.62  ? 75   ASP A C   1 
ATOM   422   O O   . ASP A  1 75  ? -14.774 -40.452  9.626   1.00 40.63  ? 75   ASP A O   1 
ATOM   423   C CB  . ASP A  1 75  ? -15.402 -37.919  8.381   1.00 54.61  ? 75   ASP A CB  1 
ATOM   424   C CG  . ASP A  1 75  ? -15.814 -37.007  9.527   1.00 57.42  ? 75   ASP A CG  1 
ATOM   425   O OD1 . ASP A  1 75  ? -15.343 -37.213  10.665  1.00 57.55  ? 75   ASP A OD1 1 
ATOM   426   O OD2 . ASP A  1 75  ? -16.617 -36.081  9.285   1.00 58.90  ? 75   ASP A OD2 1 
ATOM   427   N N   . VAL A  1 76  ? -12.925 -39.485  10.474  1.00 43.15  ? 76   VAL A N   1 
ATOM   428   C CA  . VAL A  1 76  ? -12.659 -40.551  11.436  1.00 43.49  ? 76   VAL A CA  1 
ATOM   429   C C   . VAL A  1 76  ? -13.789 -40.736  12.446  1.00 47.47  ? 76   VAL A C   1 
ATOM   430   O O   . VAL A  1 76  ? -13.901 -41.791  13.069  1.00 49.89  ? 76   VAL A O   1 
ATOM   431   C CB  . VAL A  1 76  ? -11.344 -40.299  12.203  1.00 33.71  ? 76   VAL A CB  1 
ATOM   432   C CG1 . VAL A  1 76  ? -10.162 -40.320  11.247  1.00 31.92  ? 76   VAL A CG1 1 
ATOM   433   C CG2 . VAL A  1 76  ? -11.408 -38.979  12.954  1.00 38.84  ? 76   VAL A CG2 1 
ATOM   434   N N   . SER A  1 77  ? -14.626 -39.715  12.601  1.00 47.09  ? 77   SER A N   1 
ATOM   435   C CA  . SER A  1 77  ? -15.759 -39.790  13.515  1.00 41.78  ? 77   SER A CA  1 
ATOM   436   C C   . SER A  1 77  ? -16.845 -40.716  12.973  1.00 43.11  ? 77   SER A C   1 
ATOM   437   O O   . SER A  1 77  ? -17.674 -41.223  13.728  1.00 45.95  ? 77   SER A O   1 
ATOM   438   C CB  . SER A  1 77  ? -16.336 -38.396  13.774  1.00 35.58  ? 77   SER A CB  1 
ATOM   439   O OG  . SER A  1 77  ? -16.772 -37.790  12.570  1.00 37.68  ? 77   SER A OG  1 
ATOM   440   N N   . GLU A  1 78  ? -16.832 -40.933  11.661  1.00 41.43  ? 78   GLU A N   1 
ATOM   441   C CA  . GLU A  1 78  ? -17.809 -41.804  11.015  1.00 45.88  ? 78   GLU A CA  1 
ATOM   442   C C   . GLU A  1 78  ? -17.315 -43.246  10.975  1.00 47.85  ? 78   GLU A C   1 
ATOM   443   O O   . GLU A  1 78  ? -16.193 -43.513  10.545  1.00 47.73  ? 78   GLU A O   1 
ATOM   444   C CB  . GLU A  1 78  ? -18.109 -41.317  9.595   1.00 51.37  ? 78   GLU A CB  1 
ATOM   445   C CG  . GLU A  1 78  ? -18.344 -39.817  9.475   1.00 58.36  ? 78   GLU A CG  1 
ATOM   446   C CD  . GLU A  1 78  ? -19.666 -39.371  10.071  1.00 63.63  ? 78   GLU A CD  1 
ATOM   447   O OE1 . GLU A  1 78  ? -20.494 -40.239  10.421  1.00 63.96  ? 78   GLU A OE1 1 
ATOM   448   O OE2 . GLU A  1 78  ? -19.881 -38.145  10.182  1.00 65.99  ? 78   GLU A OE2 1 
ATOM   449   N N   . ALA A  1 79  ? -18.159 -44.172  11.421  1.00 48.35  ? 79   ALA A N   1 
ATOM   450   C CA  . ALA A  1 79  ? -17.805 -45.588  11.451  1.00 47.55  ? 79   ALA A CA  1 
ATOM   451   C C   . ALA A  1 79  ? -17.610 -46.145  10.046  1.00 52.55  ? 79   ALA A C   1 
ATOM   452   O O   . ALA A  1 79  ? -16.724 -46.967  9.811   1.00 56.66  ? 79   ALA A O   1 
ATOM   453   C CB  . ALA A  1 79  ? -18.870 -46.382  12.189  1.00 46.56  ? 79   ALA A CB  1 
ATOM   454   N N   . ARG A  1 80  ? -18.444 -45.691  9.116   1.00 57.94  ? 80   ARG A N   1 
ATOM   455   C CA  . ARG A  1 80  ? -18.366 -46.136  7.731   1.00 64.87  ? 80   ARG A CA  1 
ATOM   456   C C   . ARG A  1 80  ? -17.109 -45.604  7.050   1.00 68.16  ? 80   ARG A C   1 
ATOM   457   O O   . ARG A  1 80  ? -16.440 -46.324  6.309   1.00 69.36  ? 80   ARG A O   1 
ATOM   458   C CB  . ARG A  1 80  ? -19.610 -45.693  6.957   1.00 71.75  ? 80   ARG A CB  1 
ATOM   459   C CG  . ARG A  1 80  ? -19.654 -46.175  5.516   1.00 81.60  ? 80   ARG A CG  1 
ATOM   460   C CD  . ARG A  1 80  ? -19.817 -47.684  5.442   1.00 88.53  ? 80   ARG A CD  1 
ATOM   461   N NE  . ARG A  1 80  ? -21.083 -48.125  6.021   1.00 92.08  ? 80   ARG A NE  1 
ATOM   462   N N   . ALA A  1 81  ? -16.793 -44.339  7.310   1.00 67.43  ? 81   ALA A N   1 
ATOM   463   C CA  . ALA A  1 81  ? -15.637 -43.694  6.699   1.00 64.44  ? 81   ALA A CA  1 
ATOM   464   C C   . ALA A  1 81  ? -14.329 -44.211  7.290   1.00 62.99  ? 81   ALA A C   1 
ATOM   465   O O   . ALA A  1 81  ? -13.302 -44.242  6.612   1.00 64.85  ? 81   ALA A O   1 
ATOM   466   C CB  . ALA A  1 81  ? -15.728 -42.184  6.862   1.00 60.29  ? 81   ALA A CB  1 
ATOM   467   N N   . ALA A  1 82  ? -14.373 -44.617  8.554   1.00 62.19  ? 82   ALA A N   1 
ATOM   468   C CA  . ALA A  1 82  ? -13.183 -45.102  9.245   1.00 61.71  ? 82   ALA A CA  1 
ATOM   469   C C   . ALA A  1 82  ? -12.773 -46.487  8.756   1.00 67.21  ? 82   ALA A C   1 
ATOM   470   O O   . ALA A  1 82  ? -11.593 -46.745  8.514   1.00 70.06  ? 82   ALA A O   1 
ATOM   471   C CB  . ALA A  1 82  ? -13.417 -45.123  10.745  1.00 58.71  ? 82   ALA A CB  1 
ATOM   472   N N   . ARG A  1 83  ? -13.754 -47.374  8.615   1.00 66.36  ? 83   ARG A N   1 
ATOM   473   C CA  . ARG A  1 83  ? -13.500 -48.750  8.201   1.00 65.69  ? 83   ARG A CA  1 
ATOM   474   C C   . ARG A  1 83  ? -13.026 -48.815  6.755   1.00 66.17  ? 83   ARG A C   1 
ATOM   475   O O   . ARG A  1 83  ? -12.117 -49.578  6.421   1.00 68.65  ? 83   ARG A O   1 
ATOM   476   C CB  . ARG A  1 83  ? -14.759 -49.603  8.370   1.00 72.32  ? 83   ARG A CB  1 
ATOM   477   C CG  . ARG A  1 83  ? -14.517 -51.100  8.252   1.00 82.27  ? 83   ARG A CG  1 
ATOM   478   C CD  . ARG A  1 83  ? -15.580 -51.770  7.399   1.00 94.52  ? 83   ARG A CD  1 
ATOM   479   N NE  . ARG A  1 83  ? -15.353 -51.543  5.974   1.00 103.26 ? 83   ARG A NE  1 
ATOM   480   C CZ  . ARG A  1 83  ? -16.322 -51.445  5.071   1.00 105.91 ? 83   ARG A CZ  1 
ATOM   481   N NH1 . ARG A  1 83  ? -17.591 -51.543  5.447   1.00 108.84 ? 83   ARG A NH1 1 
ATOM   482   N NH2 . ARG A  1 83  ? -16.025 -51.240  3.795   1.00 103.64 ? 83   ARG A NH2 1 
ATOM   483   N N   . CYS A  1 84  ? -13.651 -48.012  5.902   1.00 61.16  ? 84   CYS A N   1 
ATOM   484   C CA  . CYS A  1 84  ? -13.333 -48.007  4.481   1.00 57.81  ? 84   CYS A CA  1 
ATOM   485   C C   . CYS A  1 84  ? -11.952 -47.408  4.238   1.00 50.97  ? 84   CYS A C   1 
ATOM   486   O O   . CYS A  1 84  ? -11.291 -47.733  3.253   1.00 53.41  ? 84   CYS A O   1 
ATOM   487   C CB  . CYS A  1 84  ? -14.396 -47.236  3.696   1.00 60.26  ? 84   CYS A CB  1 
ATOM   488   S SG  . CYS A  1 84  ? -14.453 -47.622  1.929   1.00 105.29 ? 84   CYS A SG  1 
ATOM   489   N N   . LEU A  1 85  ? -11.526 -46.532  5.143   1.00 49.29  ? 85   LEU A N   1 
ATOM   490   C CA  . LEU A  1 85  ? -10.190 -45.950  5.085   1.00 49.06  ? 85   LEU A CA  1 
ATOM   491   C C   . LEU A  1 85  ? -9.127  -47.040  5.132   1.00 49.19  ? 85   LEU A C   1 
ATOM   492   O O   . LEU A  1 85  ? -8.171  -47.022  4.358   1.00 49.07  ? 85   LEU A O   1 
ATOM   493   C CB  . LEU A  1 85  ? -9.980  -44.964  6.235   1.00 48.97  ? 85   LEU A CB  1 
ATOM   494   C CG  . LEU A  1 85  ? -8.537  -44.529  6.504   1.00 43.86  ? 85   LEU A CG  1 
ATOM   495   C CD1 . LEU A  1 85  ? -7.976  -43.735  5.334   1.00 39.47  ? 85   LEU A CD1 1 
ATOM   496   C CD2 . LEU A  1 85  ? -8.446  -43.731  7.794   1.00 35.57  ? 85   LEU A CD2 1 
ATOM   497   N N   . LEU A  1 86  ? -9.305  -47.989  6.045   1.00 50.90  ? 86   LEU A N   1 
ATOM   498   C CA  . LEU A  1 86  ? -8.395  -49.121  6.164   1.00 52.12  ? 86   LEU A CA  1 
ATOM   499   C C   . LEU A  1 86  ? -8.481  -50.012  4.931   1.00 48.77  ? 86   LEU A C   1 
ATOM   500   O O   . LEU A  1 86  ? -7.488  -50.607  4.515   1.00 45.22  ? 86   LEU A O   1 
ATOM   501   C CB  . LEU A  1 86  ? -8.702  -49.932  7.426   1.00 55.26  ? 86   LEU A CB  1 
ATOM   502   C CG  . LEU A  1 86  ? -7.983  -49.536  8.720   1.00 53.87  ? 86   LEU A CG  1 
ATOM   503   C CD1 . LEU A  1 86  ? -6.485  -49.768  8.592   1.00 56.76  ? 86   LEU A CD1 1 
ATOM   504   C CD2 . LEU A  1 86  ? -8.272  -48.091  9.105   1.00 49.74  ? 86   LEU A CD2 1 
ATOM   505   N N   . GLU A  1 87  ? -9.673  -50.098  4.349   1.00 50.25  ? 87   GLU A N   1 
ATOM   506   C CA  . GLU A  1 87  ? -9.878  -50.890  3.143   1.00 55.82  ? 87   GLU A CA  1 
ATOM   507   C C   . GLU A  1 87  ? -9.187  -50.246  1.947   1.00 55.64  ? 87   GLU A C   1 
ATOM   508   O O   . GLU A  1 87  ? -8.654  -50.939  1.081   1.00 58.63  ? 87   GLU A O   1 
ATOM   509   C CB  . GLU A  1 87  ? -11.372 -51.065  2.863   1.00 62.20  ? 87   GLU A CB  1 
ATOM   510   C CG  . GLU A  1 87  ? -12.116 -51.830  3.944   1.00 67.79  ? 87   GLU A CG  1 
ATOM   511   C CD  . GLU A  1 87  ? -11.599 -53.245  4.117   1.00 73.28  ? 87   GLU A CD  1 
ATOM   512   O OE1 . GLU A  1 87  ? -11.202 -53.865  3.108   1.00 74.74  ? 87   GLU A OE1 1 
ATOM   513   O OE2 . GLU A  1 87  ? -11.586 -53.737  5.265   1.00 74.92  ? 87   GLU A OE2 1 
ATOM   514   N N   . GLN A  1 88  ? -9.200  -48.917  1.905   1.00 52.82  ? 88   GLN A N   1 
ATOM   515   C CA  . GLN A  1 88  ? -8.526  -48.179  0.844   1.00 49.53  ? 88   GLN A CA  1 
ATOM   516   C C   . GLN A  1 88  ? -7.016  -48.360  0.932   1.00 49.97  ? 88   GLN A C   1 
ATOM   517   O O   . GLN A  1 88  ? -6.339  -48.505  -0.085  1.00 54.71  ? 88   GLN A O   1 
ATOM   518   C CB  . GLN A  1 88  ? -8.880  -46.692  0.909   1.00 47.72  ? 88   GLN A CB  1 
ATOM   519   C CG  . GLN A  1 88  ? -10.315 -46.374  0.532   1.00 52.98  ? 88   GLN A CG  1 
ATOM   520   C CD  . GLN A  1 88  ? -10.633 -44.898  0.665   1.00 60.94  ? 88   GLN A CD  1 
ATOM   521   O OE1 . GLN A  1 88  ? -9.762  -44.090  0.990   1.00 60.21  ? 88   GLN A OE1 1 
ATOM   522   N NE2 . GLN A  1 88  ? -11.888 -44.539  0.417   1.00 64.96  ? 88   GLN A NE2 1 
ATOM   523   N N   . VAL A  1 89  ? -6.496  -48.351  2.154   1.00 45.48  ? 89   VAL A N   1 
ATOM   524   C CA  . VAL A  1 89  ? -5.070  -48.543  2.381   1.00 46.82  ? 89   VAL A CA  1 
ATOM   525   C C   . VAL A  1 89  ? -4.650  -49.965  2.019   1.00 51.88  ? 89   VAL A C   1 
ATOM   526   O O   . VAL A  1 89  ? -3.652  -50.168  1.326   1.00 57.72  ? 89   VAL A O   1 
ATOM   527   C CB  . VAL A  1 89  ? -4.689  -48.251  3.846   1.00 47.06  ? 89   VAL A CB  1 
ATOM   528   C CG1 . VAL A  1 89  ? -3.234  -48.616  4.105   1.00 45.87  ? 89   VAL A CG1 1 
ATOM   529   C CG2 . VAL A  1 89  ? -4.943  -46.788  4.176   1.00 47.22  ? 89   VAL A CG2 1 
ATOM   530   N N   . GLN A  1 90  ? -5.421  -50.943  2.487   1.00 51.18  ? 90   GLN A N   1 
ATOM   531   C CA  . GLN A  1 90  ? -5.136  -52.348  2.210   1.00 52.57  ? 90   GLN A CA  1 
ATOM   532   C C   . GLN A  1 90  ? -5.166  -52.647  0.717   1.00 60.37  ? 90   GLN A C   1 
ATOM   533   O O   . GLN A  1 90  ? -4.367  -53.436  0.221   1.00 63.65  ? 90   GLN A O   1 
ATOM   534   C CB  . GLN A  1 90  ? -6.132  -53.254  2.936   1.00 54.67  ? 90   GLN A CB  1 
ATOM   535   C CG  . GLN A  1 90  ? -5.934  -53.330  4.439   1.00 56.12  ? 90   GLN A CG  1 
ATOM   536   C CD  . GLN A  1 90  ? -6.982  -54.189  5.118   1.00 57.96  ? 90   GLN A CD  1 
ATOM   537   O OE1 . GLN A  1 90  ? -7.088  -55.387  4.850   1.00 58.73  ? 90   GLN A OE1 1 
ATOM   538   N NE2 . GLN A  1 90  ? -7.770  -53.579  5.995   1.00 57.94  ? 90   GLN A NE2 1 
ATOM   539   N N   . ALA A  1 91  ? -6.092  -52.017  0.003   1.00 63.97  ? 91   ALA A N   1 
ATOM   540   C CA  . ALA A  1 91  ? -6.223  -52.235  -1.432  1.00 54.23  ? 91   ALA A CA  1 
ATOM   541   C C   . ALA A  1 91  ? -5.108  -51.533  -2.201  1.00 54.59  ? 91   ALA A C   1 
ATOM   542   O O   . ALA A  1 91  ? -4.633  -52.032  -3.220  1.00 60.41  ? 91   ALA A O   1 
ATOM   543   C CB  . ALA A  1 91  ? -7.581  -51.758  -1.918  1.00 57.92  ? 91   ALA A CB  1 
ATOM   544   N N   . CYS A  1 92  ? -4.694  -50.375  -1.700  1.00 54.36  ? 92   CYS A N   1 
ATOM   545   C CA  . CYS A  1 92  ? -3.686  -49.564  -2.371  1.00 56.31  ? 92   CYS A CA  1 
ATOM   546   C C   . CYS A  1 92  ? -2.287  -50.165  -2.261  1.00 62.53  ? 92   CYS A C   1 
ATOM   547   O O   . CYS A  1 92  ? -1.484  -50.056  -3.188  1.00 68.57  ? 92   CYS A O   1 
ATOM   548   C CB  . CYS A  1 92  ? -3.686  -48.144  -1.799  1.00 53.35  ? 92   CYS A CB  1 
ATOM   549   S SG  . CYS A  1 92  ? -2.470  -47.030  -2.538  1.00 69.50  ? 92   CYS A SG  1 
ATOM   550   N N   . PHE A  1 93  ? -2.001  -50.805  -1.131  1.00 62.01  ? 93   PHE A N   1 
ATOM   551   C CA  . PHE A  1 93  ? -0.652  -51.292  -0.858  1.00 60.29  ? 93   PHE A CA  1 
ATOM   552   C C   . PHE A  1 93  ? -0.561  -52.810  -0.729  1.00 62.60  ? 93   PHE A C   1 
ATOM   553   O O   . PHE A  1 93  ? 0.530   -53.348  -0.530  1.00 62.32  ? 93   PHE A O   1 
ATOM   554   C CB  . PHE A  1 93  ? -0.111  -50.647  0.420   1.00 54.93  ? 93   PHE A CB  1 
ATOM   555   C CG  . PHE A  1 93  ? -0.013  -49.151  0.351   1.00 52.80  ? 93   PHE A CG  1 
ATOM   556   C CD1 . PHE A  1 93  ? 1.083   -48.543  -0.238  1.00 50.60  ? 93   PHE A CD1 1 
ATOM   557   C CD2 . PHE A  1 93  ? -1.012  -48.352  0.881   1.00 51.34  ? 93   PHE A CD2 1 
ATOM   558   C CE1 . PHE A  1 93  ? 1.178   -47.166  -0.301  1.00 45.75  ? 93   PHE A CE1 1 
ATOM   559   C CE2 . PHE A  1 93  ? -0.923  -46.974  0.821   1.00 46.77  ? 93   PHE A CE2 1 
ATOM   560   C CZ  . PHE A  1 93  ? 0.174   -46.380  0.229   1.00 43.93  ? 93   PHE A CZ  1 
ATOM   561   N N   . SER A  1 94  ? -1.701  -53.490  -0.838  1.00 73.72  ? 94   SER A N   1 
ATOM   562   C CA  . SER A  1 94  ? -1.777  -54.941  -0.651  1.00 72.74  ? 94   SER A CA  1 
ATOM   563   C C   . SER A  1 94  ? -1.232  -55.345  0.719   1.00 71.29  ? 94   SER A C   1 
ATOM   564   O O   . SER A  1 94  ? -0.674  -56.430  0.882   1.00 73.30  ? 94   SER A O   1 
ATOM   565   C CB  . SER A  1 94  ? -1.020  -55.676  -1.762  1.00 75.59  ? 94   SER A CB  1 
ATOM   566   O OG  . SER A  1 94  ? -1.500  -55.304  -3.043  1.00 78.58  ? 94   SER A OG  1 
ATOM   567   N N   . ARG A  1 95  ? -1.408  -54.464  1.699   1.00 67.71  ? 95   ARG A N   1 
ATOM   568   C CA  . ARG A  1 95  ? -0.843  -54.658  3.030   1.00 67.65  ? 95   ARG A CA  1 
ATOM   569   C C   . ARG A  1 95  ? -1.468  -53.697  4.035   1.00 69.79  ? 95   ARG A C   1 
ATOM   570   O O   . ARG A  1 95  ? -1.650  -52.517  3.738   1.00 70.74  ? 95   ARG A O   1 
ATOM   571   C CB  . ARG A  1 95  ? 0.676   -54.463  2.994   1.00 68.86  ? 95   ARG A CB  1 
ATOM   572   C CG  . ARG A  1 95  ? 1.355   -54.506  4.354   1.00 69.75  ? 95   ARG A CG  1 
ATOM   573   C CD  . ARG A  1 95  ? 2.839   -54.195  4.234   1.00 75.32  ? 95   ARG A CD  1 
ATOM   574   N NE  . ARG A  1 95  ? 3.078   -52.837  3.751   1.00 79.61  ? 95   ARG A NE  1 
ATOM   575   C CZ  . ARG A  1 95  ? 4.270   -52.371  3.394   1.00 83.32  ? 95   ARG A CZ  1 
ATOM   576   N NH1 . ARG A  1 95  ? 5.338   -53.155  3.460   1.00 84.88  ? 95   ARG A NH1 1 
ATOM   577   N NH2 . ARG A  1 95  ? 4.396   -51.122  2.966   1.00 84.48  ? 95   ARG A NH2 1 
ATOM   578   N N   . PRO A  1 96  ? -1.812  -54.205  5.228   1.00 76.76  ? 96   PRO A N   1 
ATOM   579   C CA  . PRO A  1 96  ? -2.319  -53.354  6.309   1.00 74.29  ? 96   PRO A CA  1 
ATOM   580   C C   . PRO A  1 96  ? -1.220  -52.471  6.887   1.00 71.50  ? 96   PRO A C   1 
ATOM   581   O O   . PRO A  1 96  ? -0.048  -52.841  6.821   1.00 77.80  ? 96   PRO A O   1 
ATOM   582   C CB  . PRO A  1 96  ? -2.813  -54.361  7.357   1.00 72.68  ? 96   PRO A CB  1 
ATOM   583   C CG  . PRO A  1 96  ? -2.920  -55.661  6.638   1.00 77.33  ? 96   PRO A CG  1 
ATOM   584   C CD  . PRO A  1 96  ? -1.861  -55.630  5.587   1.00 80.21  ? 96   PRO A CD  1 
ATOM   585   N N   . PRO A  1 97  ? -1.592  -51.312  7.447   1.00 58.37  ? 97   PRO A N   1 
ATOM   586   C CA  . PRO A  1 97  ? -0.600  -50.439  8.081   1.00 55.07  ? 97   PRO A CA  1 
ATOM   587   C C   . PRO A  1 97  ? -0.067  -51.030  9.383   1.00 52.79  ? 97   PRO A C   1 
ATOM   588   O O   . PRO A  1 97  ? -0.831  -51.231  10.327  1.00 60.08  ? 97   PRO A O   1 
ATOM   589   C CB  . PRO A  1 97  ? -1.383  -49.150  8.341   1.00 54.65  ? 97   PRO A CB  1 
ATOM   590   C CG  . PRO A  1 97  ? -2.803  -49.587  8.442   1.00 56.80  ? 97   PRO A CG  1 
ATOM   591   C CD  . PRO A  1 97  ? -2.946  -50.732  7.480   1.00 60.16  ? 97   PRO A CD  1 
ATOM   592   N N   . SER A  1 98  ? 1.231   -51.309  9.426   1.00 47.28  ? 98   SER A N   1 
ATOM   593   C CA  . SER A  1 98  ? 1.855   -51.841  10.632  1.00 47.18  ? 98   SER A CA  1 
ATOM   594   C C   . SER A  1 98  ? 2.030   -50.737  11.668  1.00 46.28  ? 98   SER A C   1 
ATOM   595   O O   . SER A  1 98  ? 2.191   -51.006  12.858  1.00 46.24  ? 98   SER A O   1 
ATOM   596   C CB  . SER A  1 98  ? 3.203   -52.487  10.305  1.00 50.11  ? 98   SER A CB  1 
ATOM   597   O OG  . SER A  1 98  ? 4.075   -51.560  9.682   1.00 54.17  ? 98   SER A OG  1 
ATOM   598   N N   . VAL A  1 99  ? 1.998   -49.493  11.201  1.00 45.23  ? 99   VAL A N   1 
ATOM   599   C CA  . VAL A  1 99  ? 2.097   -48.334  12.080  1.00 44.06  ? 99   VAL A CA  1 
ATOM   600   C C   . VAL A  1 99  ? 0.892   -47.420  11.894  1.00 46.26  ? 99   VAL A C   1 
ATOM   601   O O   . VAL A  1 99  ? 0.660   -46.900  10.803  1.00 49.01  ? 99   VAL A O   1 
ATOM   602   C CB  . VAL A  1 99  ? 3.387   -47.533  11.821  1.00 43.25  ? 99   VAL A CB  1 
ATOM   603   C CG1 . VAL A  1 99  ? 3.389   -46.251  12.641  1.00 39.91  ? 99   VAL A CG1 1 
ATOM   604   C CG2 . VAL A  1 99  ? 4.613   -48.379  12.133  1.00 40.41  ? 99   VAL A CG2 1 
ATOM   605   N N   . VAL A  1 100 ? 0.124   -47.230  12.961  1.00 47.18  ? 100  VAL A N   1 
ATOM   606   C CA  . VAL A  1 100 ? -1.061  -46.382  12.902  1.00 46.62  ? 100  VAL A CA  1 
ATOM   607   C C   . VAL A  1 100 ? -1.007  -45.284  13.957  1.00 46.17  ? 100  VAL A C   1 
ATOM   608   O O   . VAL A  1 100 ? -0.948  -45.561  15.155  1.00 42.92  ? 100  VAL A O   1 
ATOM   609   C CB  . VAL A  1 100 ? -2.350  -47.203  13.085  1.00 41.51  ? 100  VAL A CB  1 
ATOM   610   C CG1 . VAL A  1 100 ? -3.560  -46.284  13.159  1.00 42.15  ? 100  VAL A CG1 1 
ATOM   611   C CG2 . VAL A  1 100 ? -2.502  -48.202  11.950  1.00 35.40  ? 100  VAL A CG2 1 
ATOM   612   N N   . VAL A  1 101 ? -1.021  -44.035  13.500  1.00 46.81  ? 101  VAL A N   1 
ATOM   613   C CA  . VAL A  1 101 ? -0.953  -42.887  14.397  1.00 41.24  ? 101  VAL A CA  1 
ATOM   614   C C   . VAL A  1 101 ? -2.142  -41.953  14.192  1.00 36.61  ? 101  VAL A C   1 
ATOM   615   O O   . VAL A  1 101 ? -2.305  -41.368  13.122  1.00 34.45  ? 101  VAL A O   1 
ATOM   616   C CB  . VAL A  1 101 ? 0.349   -42.091  14.196  1.00 44.46  ? 101  VAL A CB  1 
ATOM   617   C CG1 . VAL A  1 101 ? 0.484   -41.023  15.268  1.00 41.84  ? 101  VAL A CG1 1 
ATOM   618   C CG2 . VAL A  1 101 ? 1.548   -43.024  14.216  1.00 47.99  ? 101  VAL A CG2 1 
ATOM   619   N N   . SER A  1 102 ? -2.968  -41.816  15.224  1.00 38.02  ? 102  SER A N   1 
ATOM   620   C CA  . SER A  1 102 ? -4.147  -40.962  15.151  1.00 41.76  ? 102  SER A CA  1 
ATOM   621   C C   . SER A  1 102 ? -3.849  -39.545  15.631  1.00 42.32  ? 102  SER A C   1 
ATOM   622   O O   . SER A  1 102 ? -3.856  -39.274  16.831  1.00 41.89  ? 102  SER A O   1 
ATOM   623   C CB  . SER A  1 102 ? -5.291  -41.561  15.972  1.00 49.11  ? 102  SER A CB  1 
ATOM   624   O OG  . SER A  1 102 ? -5.692  -42.816  15.451  1.00 54.80  ? 102  SER A OG  1 
ATOM   625   N N   . CYS A  1 103 ? -3.588  -38.645  14.686  1.00 42.09  ? 103  CYS A N   1 
ATOM   626   C CA  . CYS A  1 103 ? -3.325  -37.246  15.011  1.00 39.39  ? 103  CYS A CA  1 
ATOM   627   C C   . CYS A  1 103 ? -4.533  -36.374  14.688  1.00 40.90  ? 103  CYS A C   1 
ATOM   628   O O   . CYS A  1 103 ? -4.482  -35.152  14.827  1.00 44.97  ? 103  CYS A O   1 
ATOM   629   C CB  . CYS A  1 103 ? -2.099  -36.734  14.254  1.00 35.05  ? 103  CYS A CB  1 
ATOM   630   S SG  . CYS A  1 103 ? -0.590  -37.683  14.524  1.00 51.70  ? 103  CYS A SG  1 
ATOM   631   N N   . ALA A  1 104 ? -5.616  -37.008  14.250  1.00 40.94  ? 104  ALA A N   1 
ATOM   632   C CA  . ALA A  1 104 ? -6.836  -36.290  13.898  1.00 38.49  ? 104  ALA A CA  1 
ATOM   633   C C   . ALA A  1 104 ? -7.626  -35.897  15.142  1.00 38.18  ? 104  ALA A C   1 
ATOM   634   O O   . ALA A  1 104 ? -8.077  -36.755  15.903  1.00 36.35  ? 104  ALA A O   1 
ATOM   635   C CB  . ALA A  1 104 ? -7.695  -37.131  12.969  1.00 36.24  ? 104  ALA A CB  1 
ATOM   636   N N   . GLY A  1 105 ? -7.791  -34.594  15.341  1.00 36.72  ? 105  GLY A N   1 
ATOM   637   C CA  . GLY A  1 105 ? -8.526  -34.082  16.482  1.00 37.70  ? 105  GLY A CA  1 
ATOM   638   C C   . GLY A  1 105 ? -8.847  -32.609  16.329  1.00 40.31  ? 105  GLY A C   1 
ATOM   639   O O   . GLY A  1 105 ? -8.188  -31.899  15.568  1.00 40.22  ? 105  GLY A O   1 
ATOM   640   N N   . ILE A  1 106 ? -9.868  -32.149  17.046  1.00 36.61  ? 106  ILE A N   1 
ATOM   641   C CA  . ILE A  1 106 ? -10.274 -30.750  16.986  1.00 37.28  ? 106  ILE A CA  1 
ATOM   642   C C   . ILE A  1 106 ? -10.515 -30.169  18.373  1.00 33.26  ? 106  ILE A C   1 
ATOM   643   O O   . ILE A  1 106 ? -10.596 -30.897  19.363  1.00 24.90  ? 106  ILE A O   1 
ATOM   644   C CB  . ILE A  1 106 ? -11.561 -30.557  16.155  1.00 42.73  ? 106  ILE A CB  1 
ATOM   645   C CG1 . ILE A  1 106 ? -12.729 -31.309  16.797  1.00 39.01  ? 106  ILE A CG1 1 
ATOM   646   C CG2 . ILE A  1 106 ? -11.350 -31.000  14.714  1.00 47.65  ? 106  ILE A CG2 1 
ATOM   647   C CD1 . ILE A  1 106 ? -14.052 -31.095  16.093  1.00 38.95  ? 106  ILE A CD1 1 
ATOM   648   N N   . THR A  1 107 ? -10.629 -28.846  18.429  1.00 29.17  ? 107  THR A N   1 
ATOM   649   C CA  . THR A  1 107 ? -10.992 -28.156  19.657  1.00 30.46  ? 107  THR A CA  1 
ATOM   650   C C   . THR A  1 107 ? -12.212 -27.277  19.418  1.00 38.57  ? 107  THR A C   1 
ATOM   651   O O   . THR A  1 107 ? -12.300 -26.584  18.405  1.00 47.47  ? 107  THR A O   1 
ATOM   652   C CB  . THR A  1 107 ? -9.842  -27.283  20.193  1.00 27.13  ? 107  THR A CB  1 
ATOM   653   O OG1 . THR A  1 107 ? -9.560  -26.232  19.260  1.00 28.68  ? 107  THR A OG1 1 
ATOM   654   C CG2 . THR A  1 107 ? -8.590  -28.117  20.413  1.00 26.84  ? 107  THR A CG2 1 
ATOM   655   N N   . GLN A  1 108 ? -13.157 -27.324  20.349  1.00 37.83  ? 108  GLN A N   1 
ATOM   656   C CA  . GLN A  1 108 ? -14.309 -26.434  20.324  1.00 39.84  ? 108  GLN A CA  1 
ATOM   657   C C   . GLN A  1 108 ? -14.500 -25.873  21.727  1.00 42.48  ? 108  GLN A C   1 
ATOM   658   O O   . GLN A  1 108 ? -15.462 -26.204  22.420  1.00 46.53  ? 108  GLN A O   1 
ATOM   659   C CB  . GLN A  1 108 ? -15.564 -27.168  19.847  1.00 41.75  ? 108  GLN A CB  1 
ATOM   660   C CG  . GLN A  1 108 ? -16.701 -26.247  19.439  1.00 45.54  ? 108  GLN A CG  1 
ATOM   661   C CD  . GLN A  1 108 ? -16.363 -25.406  18.223  1.00 43.93  ? 108  GLN A CD  1 
ATOM   662   O OE1 . GLN A  1 108 ? -16.331 -25.905  17.098  1.00 50.45  ? 108  GLN A OE1 1 
ATOM   663   N NE2 . GLN A  1 108 ? -16.105 -24.121  18.443  1.00 37.00  ? 108  GLN A NE2 1 
ATOM   664   N N   . ASP A  1 109 ? -13.563 -25.024  22.135  1.00 39.75  ? 109  ASP A N   1 
ATOM   665   C CA  . ASP A  1 109 ? -13.467 -24.571  23.518  1.00 38.46  ? 109  ASP A CA  1 
ATOM   666   C C   . ASP A  1 109 ? -14.626 -23.686  23.962  1.00 38.93  ? 109  ASP A C   1 
ATOM   667   O O   . ASP A  1 109 ? -15.115 -22.848  23.204  1.00 42.65  ? 109  ASP A O   1 
ATOM   668   C CB  . ASP A  1 109 ? -12.150 -23.826  23.728  1.00 40.52  ? 109  ASP A CB  1 
ATOM   669   C CG  . ASP A  1 109 ? -10.950 -24.751  23.709  1.00 44.31  ? 109  ASP A CG  1 
ATOM   670   O OD1 . ASP A  1 109 ? -11.114 -25.932  23.338  1.00 48.11  ? 109  ASP A OD1 1 
ATOM   671   O OD2 . ASP A  1 109 ? -9.840  -24.296  24.060  1.00 43.58  ? 109  ASP A OD2 1 
ATOM   672   N N   . GLU A  1 110 ? -15.047 -23.891  25.207  1.00 40.22  ? 110  GLU A N   1 
ATOM   673   C CA  . GLU A  1 110 ? -16.096 -23.102  25.842  1.00 43.91  ? 110  GLU A CA  1 
ATOM   674   C C   . GLU A  1 110 ? -16.142 -23.452  27.324  1.00 43.49  ? 110  GLU A C   1 
ATOM   675   O O   . GLU A  1 110 ? -15.820 -24.577  27.708  1.00 41.18  ? 110  GLU A O   1 
ATOM   676   C CB  . GLU A  1 110 ? -17.457 -23.358  25.186  1.00 45.13  ? 110  GLU A CB  1 
ATOM   677   C CG  . GLU A  1 110 ? -18.596 -22.510  25.737  1.00 50.08  ? 110  GLU A CG  1 
ATOM   678   C CD  . GLU A  1 110 ? -18.335 -21.020  25.611  1.00 59.03  ? 110  GLU A CD  1 
ATOM   679   O OE1 . GLU A  1 110 ? -18.642 -20.450  24.542  1.00 65.47  ? 110  GLU A OE1 1 
ATOM   680   O OE2 . GLU A  1 110 ? -17.825 -20.419  26.581  1.00 56.50  ? 110  GLU A OE2 1 
ATOM   681   N N   . PHE A  1 111 ? -16.525 -22.490  28.157  1.00 49.80  ? 111  PHE A N   1 
ATOM   682   C CA  . PHE A  1 111 ? -16.661 -22.742  29.585  1.00 50.96  ? 111  PHE A CA  1 
ATOM   683   C C   . PHE A  1 111 ? -17.784 -23.739  29.842  1.00 48.39  ? 111  PHE A C   1 
ATOM   684   O O   . PHE A  1 111 ? -18.739 -23.822  29.068  1.00 47.22  ? 111  PHE A O   1 
ATOM   685   C CB  . PHE A  1 111 ? -16.914 -21.440  30.345  1.00 61.18  ? 111  PHE A CB  1 
ATOM   686   C CG  . PHE A  1 111 ? -15.798 -20.445  30.223  1.00 69.95  ? 111  PHE A CG  1 
ATOM   687   C CD1 . PHE A  1 111 ? -14.559 -20.705  30.786  1.00 73.41  ? 111  PHE A CD1 1 
ATOM   688   C CD2 . PHE A  1 111 ? -15.985 -19.251  29.548  1.00 74.95  ? 111  PHE A CD2 1 
ATOM   689   C CE1 . PHE A  1 111 ? -13.528 -19.795  30.675  1.00 79.11  ? 111  PHE A CE1 1 
ATOM   690   C CE2 . PHE A  1 111 ? -14.958 -18.335  29.435  1.00 80.14  ? 111  PHE A CE2 1 
ATOM   691   C CZ  . PHE A  1 111 ? -13.727 -18.608  30.000  1.00 82.44  ? 111  PHE A CZ  1 
ATOM   692   N N   . LEU A  1 112 ? -17.655 -24.495  30.929  1.00 45.21  ? 112  LEU A N   1 
ATOM   693   C CA  . LEU A  1 112 ? -18.607 -25.549  31.266  1.00 44.99  ? 112  LEU A CA  1 
ATOM   694   C C   . LEU A  1 112 ? -20.043 -25.039  31.342  1.00 44.90  ? 112  LEU A C   1 
ATOM   695   O O   . LEU A  1 112 ? -20.966 -25.693  30.859  1.00 44.10  ? 112  LEU A O   1 
ATOM   696   C CB  . LEU A  1 112 ? -18.222 -26.201  32.595  1.00 45.12  ? 112  LEU A CB  1 
ATOM   697   C CG  . LEU A  1 112 ? -19.173 -27.282  33.111  1.00 46.69  ? 112  LEU A CG  1 
ATOM   698   C CD1 . LEU A  1 112 ? -19.202 -28.467  32.159  1.00 46.14  ? 112  LEU A CD1 1 
ATOM   699   C CD2 . LEU A  1 112 ? -18.784 -27.721  34.512  1.00 45.99  ? 112  LEU A CD2 1 
ATOM   700   N N   . LEU A  1 113 ? -20.222 -23.864  31.936  1.00 44.03  ? 113  LEU A N   1 
ATOM   701   C CA  . LEU A  1 113 ? -21.553 -23.296  32.128  1.00 42.17  ? 113  LEU A CA  1 
ATOM   702   C C   . LEU A  1 113 ? -22.198 -22.849  30.820  1.00 40.36  ? 113  LEU A C   1 
ATOM   703   O O   . LEU A  1 113 ? -23.399 -22.580  30.779  1.00 43.36  ? 113  LEU A O   1 
ATOM   704   C CB  . LEU A  1 113 ? -21.490 -22.112  33.094  1.00 41.72  ? 113  LEU A CB  1 
ATOM   705   C CG  . LEU A  1 113 ? -21.022 -22.405  34.520  1.00 37.66  ? 113  LEU A CG  1 
ATOM   706   C CD1 . LEU A  1 113 ? -21.095 -21.149  35.375  1.00 35.30  ? 113  LEU A CD1 1 
ATOM   707   C CD2 . LEU A  1 113 ? -21.847 -23.523  35.132  1.00 32.27  ? 113  LEU A CD2 1 
ATOM   708   N N   . HIS A  1 114 ? -21.406 -22.772  29.756  1.00 42.72  ? 114  HIS A N   1 
ATOM   709   C CA  . HIS A  1 114 ? -21.897 -22.239  28.489  1.00 46.40  ? 114  HIS A CA  1 
ATOM   710   C C   . HIS A  1 114 ? -21.679 -23.186  27.312  1.00 46.73  ? 114  HIS A C   1 
ATOM   711   O O   . HIS A  1 114 ? -22.028 -22.859  26.177  1.00 47.79  ? 114  HIS A O   1 
ATOM   712   C CB  . HIS A  1 114 ? -21.230 -20.893  28.198  1.00 45.86  ? 114  HIS A CB  1 
ATOM   713   C CG  . HIS A  1 114 ? -21.509 -19.847  29.231  1.00 48.38  ? 114  HIS A CG  1 
ATOM   714   N ND1 . HIS A  1 114 ? -20.577 -18.903  29.605  1.00 49.19  ? 114  HIS A ND1 1 
ATOM   715   C CD2 . HIS A  1 114 ? -22.617 -19.593  29.968  1.00 50.09  ? 114  HIS A CD2 1 
ATOM   716   C CE1 . HIS A  1 114 ? -21.098 -18.115  30.529  1.00 51.84  ? 114  HIS A CE1 1 
ATOM   717   N NE2 . HIS A  1 114 ? -22.335 -18.512  30.767  1.00 49.69  ? 114  HIS A NE2 1 
ATOM   718   N N   . MET A  1 115 ? -21.106 -24.355  27.576  1.00 45.15  ? 115  MET A N   1 
ATOM   719   C CA  . MET A  1 115 ? -20.835 -25.314  26.510  1.00 45.69  ? 115  MET A CA  1 
ATOM   720   C C   . MET A  1 115 ? -22.114 -25.983  26.019  1.00 48.29  ? 115  MET A C   1 
ATOM   721   O O   . MET A  1 115 ? -22.805 -26.660  26.781  1.00 47.99  ? 115  MET A O   1 
ATOM   722   C CB  . MET A  1 115 ? -19.840 -26.377  26.975  1.00 43.96  ? 115  MET A CB  1 
ATOM   723   C CG  . MET A  1 115 ? -19.540 -27.429  25.919  1.00 40.52  ? 115  MET A CG  1 
ATOM   724   S SD  . MET A  1 115 ? -18.279 -28.603  26.440  1.00 47.46  ? 115  MET A SD  1 
ATOM   725   C CE  . MET A  1 115 ? -16.890 -27.505  26.705  1.00 41.78  ? 115  MET A CE  1 
ATOM   726   N N   . SER A  1 116 ? -22.421 -25.792  24.740  1.00 46.12  ? 116  SER A N   1 
ATOM   727   C CA  . SER A  1 116 ? -23.610 -26.385  24.142  1.00 44.16  ? 116  SER A CA  1 
ATOM   728   C C   . SER A  1 116 ? -23.424 -27.884  23.938  1.00 45.16  ? 116  SER A C   1 
ATOM   729   O O   . SER A  1 116 ? -22.310 -28.399  24.030  1.00 47.30  ? 116  SER A O   1 
ATOM   730   C CB  . SER A  1 116 ? -23.939 -25.710  22.809  1.00 43.85  ? 116  SER A CB  1 
ATOM   731   O OG  . SER A  1 116 ? -22.936 -25.973  21.843  1.00 40.17  ? 116  SER A OG  1 
ATOM   732   N N   . GLU A  1 117 ? -24.524 -28.575  23.658  1.00 48.44  ? 117  GLU A N   1 
ATOM   733   C CA  . GLU A  1 117 ? -24.499 -30.019  23.457  1.00 45.63  ? 117  GLU A CA  1 
ATOM   734   C C   . GLU A  1 117 ? -23.648 -30.401  22.250  1.00 42.76  ? 117  GLU A C   1 
ATOM   735   O O   . GLU A  1 117 ? -22.921 -31.393  22.281  1.00 42.11  ? 117  GLU A O   1 
ATOM   736   C CB  . GLU A  1 117 ? -25.921 -30.557  23.287  1.00 47.59  ? 117  GLU A CB  1 
ATOM   737   C CG  . GLU A  1 117 ? -26.001 -32.063  23.106  1.00 47.64  ? 117  GLU A CG  1 
ATOM   738   C CD  . GLU A  1 117 ? -27.418 -32.546  22.869  1.00 55.05  ? 117  GLU A CD  1 
ATOM   739   O OE1 . GLU A  1 117 ? -28.343 -31.707  22.870  1.00 58.10  ? 117  GLU A OE1 1 
ATOM   740   O OE2 . GLU A  1 117 ? -27.606 -33.766  22.681  1.00 59.97  ? 117  GLU A OE2 1 
ATOM   741   N N   . ASP A  1 118 ? -23.737 -29.604  21.191  1.00 46.20  ? 118  ASP A N   1 
ATOM   742   C CA  . ASP A  1 118 ? -22.999 -29.887  19.965  1.00 50.49  ? 118  ASP A CA  1 
ATOM   743   C C   . ASP A  1 118 ? -21.507 -29.606  20.114  1.00 46.02  ? 118  ASP A C   1 
ATOM   744   O O   . ASP A  1 118 ? -20.686 -30.296  19.513  1.00 48.02  ? 118  ASP A O   1 
ATOM   745   C CB  . ASP A  1 118 ? -23.574 -29.086  18.796  1.00 58.49  ? 118  ASP A CB  1 
ATOM   746   C CG  . ASP A  1 118 ? -24.753 -29.780  18.141  1.00 68.40  ? 118  ASP A CG  1 
ATOM   747   O OD1 . ASP A  1 118 ? -24.790 -31.030  18.158  1.00 70.89  ? 118  ASP A OD1 1 
ATOM   748   O OD2 . ASP A  1 118 ? -25.641 -29.081  17.607  1.00 71.21  ? 118  ASP A OD2 1 
ATOM   749   N N   . ASP A  1 119 ? -21.159 -28.595  20.907  1.00 40.38  ? 119  ASP A N   1 
ATOM   750   C CA  . ASP A  1 119 ? -19.756 -28.309  21.202  1.00 37.02  ? 119  ASP A CA  1 
ATOM   751   C C   . ASP A  1 119 ? -19.104 -29.524  21.844  1.00 35.65  ? 119  ASP A C   1 
ATOM   752   O O   . ASP A  1 119 ? -17.965 -29.874  21.535  1.00 39.80  ? 119  ASP A O   1 
ATOM   753   C CB  . ASP A  1 119 ? -19.621 -27.095  22.124  1.00 36.80  ? 119  ASP A CB  1 
ATOM   754   C CG  . ASP A  1 119 ? -19.917 -25.788  21.418  1.00 46.96  ? 119  ASP A CG  1 
ATOM   755   O OD1 . ASP A  1 119 ? -19.834 -25.750  20.173  1.00 47.79  ? 119  ASP A OD1 1 
ATOM   756   O OD2 . ASP A  1 119 ? -20.227 -24.796  22.111  1.00 52.02  ? 119  ASP A OD2 1 
ATOM   757   N N   . TRP A  1 120 ? -19.846 -30.165  22.740  1.00 32.82  ? 120  TRP A N   1 
ATOM   758   C CA  . TRP A  1 120 ? -19.390 -31.374  23.409  1.00 35.03  ? 120  TRP A CA  1 
ATOM   759   C C   . TRP A  1 120 ? -19.313 -32.551  22.441  1.00 35.05  ? 120  TRP A C   1 
ATOM   760   O O   . TRP A  1 120 ? -18.287 -33.223  22.347  1.00 33.87  ? 120  TRP A O   1 
ATOM   761   C CB  . TRP A  1 120 ? -20.320 -31.708  24.579  1.00 33.30  ? 120  TRP A CB  1 
ATOM   762   C CG  . TRP A  1 120 ? -20.168 -33.102  25.107  1.00 32.39  ? 120  TRP A CG  1 
ATOM   763   C CD1 . TRP A  1 120 ? -20.872 -34.206  24.720  1.00 33.61  ? 120  TRP A CD1 1 
ATOM   764   C CD2 . TRP A  1 120 ? -19.260 -33.542  26.123  1.00 29.93  ? 120  TRP A CD2 1 
ATOM   765   N NE1 . TRP A  1 120 ? -20.456 -35.306  25.429  1.00 33.53  ? 120  TRP A NE1 1 
ATOM   766   C CE2 . TRP A  1 120 ? -19.467 -34.925  26.299  1.00 32.48  ? 120  TRP A CE2 1 
ATOM   767   C CE3 . TRP A  1 120 ? -18.292 -32.901  26.902  1.00 24.39  ? 120  TRP A CE3 1 
ATOM   768   C CZ2 . TRP A  1 120 ? -18.742 -35.678  27.219  1.00 32.12  ? 120  TRP A CZ2 1 
ATOM   769   C CZ3 . TRP A  1 120 ? -17.572 -33.651  27.815  1.00 29.35  ? 120  TRP A CZ3 1 
ATOM   770   C CH2 . TRP A  1 120 ? -17.802 -35.024  27.966  1.00 31.39  ? 120  TRP A CH2 1 
ATOM   771   N N   . ASP A  1 121 ? -20.405 -32.784  21.718  1.00 43.31  ? 121  ASP A N   1 
ATOM   772   C CA  . ASP A  1 121 ? -20.534 -33.951  20.849  1.00 42.29  ? 121  ASP A CA  1 
ATOM   773   C C   . ASP A  1 121 ? -19.497 -34.000  19.729  1.00 43.09  ? 121  ASP A C   1 
ATOM   774   O O   . ASP A  1 121 ? -18.937 -35.059  19.447  1.00 45.01  ? 121  ASP A O   1 
ATOM   775   C CB  . ASP A  1 121 ? -21.938 -33.999  20.240  1.00 42.08  ? 121  ASP A CB  1 
ATOM   776   C CG  . ASP A  1 121 ? -23.010 -34.305  21.268  1.00 44.38  ? 121  ASP A CG  1 
ATOM   777   O OD1 . ASP A  1 121 ? -22.713 -35.025  22.245  1.00 41.00  ? 121  ASP A OD1 1 
ATOM   778   O OD2 . ASP A  1 121 ? -24.151 -33.827  21.098  1.00 49.99  ? 121  ASP A OD2 1 
ATOM   779   N N   . LYS A  1 122 ? -19.245 -32.860  19.092  1.00 44.04  ? 122  LYS A N   1 
ATOM   780   C CA  . LYS A  1 122 ? -18.347 -32.817  17.941  1.00 42.86  ? 122  LYS A CA  1 
ATOM   781   C C   . LYS A  1 122 ? -16.902 -33.125  18.332  1.00 40.72  ? 122  LYS A C   1 
ATOM   782   O O   . LYS A  1 122 ? -16.153 -33.706  17.548  1.00 40.82  ? 122  LYS A O   1 
ATOM   783   C CB  . LYS A  1 122 ? -18.428 -31.453  17.244  1.00 45.39  ? 122  LYS A CB  1 
ATOM   784   C CG  . LYS A  1 122 ? -17.885 -30.285  18.053  1.00 49.64  ? 122  LYS A CG  1 
ATOM   785   C CD  . LYS A  1 122 ? -18.003 -28.976  17.287  1.00 54.30  ? 122  LYS A CD  1 
ATOM   786   C CE  . LYS A  1 122 ? -19.455 -28.636  16.989  1.00 58.55  ? 122  LYS A CE  1 
ATOM   787   N NZ  . LYS A  1 122 ? -19.588 -27.337  16.272  1.00 60.84  ? 122  LYS A NZ  1 
ATOM   788   N N   . VAL A  1 123 ? -16.517 -32.746  19.547  1.00 37.39  ? 123  VAL A N   1 
ATOM   789   C CA  . VAL A  1 123 ? -15.163 -32.996  20.026  1.00 31.75  ? 123  VAL A CA  1 
ATOM   790   C C   . VAL A  1 123 ? -15.003 -34.460  20.420  1.00 29.08  ? 123  VAL A C   1 
ATOM   791   O O   . VAL A  1 123 ? -13.988 -35.088  20.118  1.00 29.98  ? 123  VAL A O   1 
ATOM   792   C CB  . VAL A  1 123 ? -14.810 -32.090  21.222  1.00 31.10  ? 123  VAL A CB  1 
ATOM   793   C CG1 . VAL A  1 123 ? -13.439 -32.443  21.778  1.00 27.93  ? 123  VAL A CG1 1 
ATOM   794   C CG2 . VAL A  1 123 ? -14.858 -30.629  20.806  1.00 32.54  ? 123  VAL A CG2 1 
ATOM   795   N N   . ILE A  1 124 ? -16.019 -35.002  21.084  1.00 29.61  ? 124  ILE A N   1 
ATOM   796   C CA  . ILE A  1 124 ? -16.015 -36.404  21.485  1.00 34.07  ? 124  ILE A CA  1 
ATOM   797   C C   . ILE A  1 124 ? -16.014 -37.326  20.268  1.00 35.53  ? 124  ILE A C   1 
ATOM   798   O O   . ILE A  1 124 ? -15.297 -38.326  20.234  1.00 34.42  ? 124  ILE A O   1 
ATOM   799   C CB  . ILE A  1 124 ? -17.230 -36.735  22.376  1.00 37.63  ? 124  ILE A CB  1 
ATOM   800   C CG1 . ILE A  1 124 ? -17.163 -35.939  23.679  1.00 34.54  ? 124  ILE A CG1 1 
ATOM   801   C CG2 . ILE A  1 124 ? -17.293 -38.226  22.673  1.00 41.14  ? 124  ILE A CG2 1 
ATOM   802   C CD1 . ILE A  1 124 ? -15.906 -36.188  24.482  1.00 29.88  ? 124  ILE A CD1 1 
ATOM   803   N N   . ALA A  1 125 ? -16.812 -36.974  19.265  1.00 35.64  ? 125  ALA A N   1 
ATOM   804   C CA  . ALA A  1 125 ? -16.927 -37.782  18.057  1.00 33.11  ? 125  ALA A CA  1 
ATOM   805   C C   . ALA A  1 125 ? -15.604 -37.858  17.300  1.00 34.31  ? 125  ALA A C   1 
ATOM   806   O O   . ALA A  1 125 ? -15.200 -38.928  16.845  1.00 37.49  ? 125  ALA A O   1 
ATOM   807   C CB  . ALA A  1 125 ? -18.019 -37.228  17.155  1.00 29.88  ? 125  ALA A CB  1 
ATOM   808   N N   . VAL A  1 126 ? -14.931 -36.719  17.172  1.00 36.26  ? 126  VAL A N   1 
ATOM   809   C CA  . VAL A  1 126 ? -13.688 -36.648  16.413  1.00 34.89  ? 126  VAL A CA  1 
ATOM   810   C C   . VAL A  1 126 ? -12.492 -37.161  17.210  1.00 39.52  ? 126  VAL A C   1 
ATOM   811   O O   . VAL A  1 126 ? -11.768 -38.047  16.756  1.00 45.15  ? 126  VAL A O   1 
ATOM   812   C CB  . VAL A  1 126 ? -13.395 -35.206  15.952  1.00 34.06  ? 126  VAL A CB  1 
ATOM   813   C CG1 . VAL A  1 126 ? -12.015 -35.119  15.317  1.00 33.10  ? 126  VAL A CG1 1 
ATOM   814   C CG2 . VAL A  1 126 ? -14.466 -34.734  14.981  1.00 36.09  ? 126  VAL A CG2 1 
ATOM   815   N N   . ASN A  1 127 ? -12.291 -36.604  18.400  1.00 35.04  ? 127  ASN A N   1 
ATOM   816   C CA  . ASN A  1 127 ? -11.116 -36.925  19.201  1.00 32.09  ? 127  ASN A CA  1 
ATOM   817   C C   . ASN A  1 127 ? -11.185 -38.303  19.853  1.00 33.45  ? 127  ASN A C   1 
ATOM   818   O O   . ASN A  1 127 ? -10.205 -39.047  19.848  1.00 35.80  ? 127  ASN A O   1 
ATOM   819   C CB  . ASN A  1 127 ? -10.906 -35.858  20.277  1.00 33.10  ? 127  ASN A CB  1 
ATOM   820   C CG  . ASN A  1 127 ? -10.734 -34.468  19.694  1.00 40.13  ? 127  ASN A CG  1 
ATOM   821   O OD1 . ASN A  1 127 ? -11.082 -34.218  18.541  1.00 44.36  ? 127  ASN A OD1 1 
ATOM   822   N ND2 . ASN A  1 127 ? -10.195 -33.554  20.493  1.00 41.80  ? 127  ASN A ND2 1 
ATOM   823   N N   . LEU A  1 128 ? -12.341 -38.641  20.415  1.00 31.65  ? 128  LEU A N   1 
ATOM   824   C CA  . LEU A  1 128 ? -12.483 -39.891  21.157  1.00 34.98  ? 128  LEU A CA  1 
ATOM   825   C C   . LEU A  1 128 ? -13.045 -41.018  20.295  1.00 34.00  ? 128  LEU A C   1 
ATOM   826   O O   . LEU A  1 128 ? -12.384 -42.036  20.086  1.00 33.77  ? 128  LEU A O   1 
ATOM   827   C CB  . LEU A  1 128 ? -13.370 -39.681  22.386  1.00 35.02  ? 128  LEU A CB  1 
ATOM   828   C CG  . LEU A  1 128 ? -13.592 -40.906  23.273  1.00 35.14  ? 128  LEU A CG  1 
ATOM   829   C CD1 . LEU A  1 128 ? -12.263 -41.516  23.686  1.00 32.41  ? 128  LEU A CD1 1 
ATOM   830   C CD2 . LEU A  1 128 ? -14.414 -40.534  24.497  1.00 38.81  ? 128  LEU A CD2 1 
ATOM   831   N N   . LYS A  1 129 ? -14.268 -40.837  19.805  1.00 35.46  ? 129  LYS A N   1 
ATOM   832   C CA  . LYS A  1 129 ? -14.910 -41.842  18.966  1.00 41.34  ? 129  LYS A CA  1 
ATOM   833   C C   . LYS A  1 129 ? -14.117 -42.055  17.682  1.00 42.13  ? 129  LYS A C   1 
ATOM   834   O O   . LYS A  1 129 ? -14.014 -43.175  17.182  1.00 41.90  ? 129  LYS A O   1 
ATOM   835   C CB  . LYS A  1 129 ? -16.349 -41.437  18.642  1.00 45.85  ? 129  LYS A CB  1 
ATOM   836   C CG  . LYS A  1 129 ? -17.114 -42.462  17.817  1.00 46.42  ? 129  LYS A CG  1 
ATOM   837   C CD  . LYS A  1 129 ? -18.541 -42.010  17.555  1.00 47.56  ? 129  LYS A CD  1 
ATOM   838   C CE  . LYS A  1 129 ? -19.310 -43.050  16.756  1.00 51.43  ? 129  LYS A CE  1 
ATOM   839   N NZ  . LYS A  1 129 ? -20.712 -42.624  16.491  1.00 52.97  ? 129  LYS A NZ  1 
ATOM   840   N N   . GLY A  1 130 ? -13.552 -40.970  17.159  1.00 38.36  ? 130  GLY A N   1 
ATOM   841   C CA  . GLY A  1 130 ? -12.724 -41.037  15.969  1.00 37.69  ? 130  GLY A CA  1 
ATOM   842   C C   . GLY A  1 130 ? -11.490 -41.889  16.186  1.00 40.23  ? 130  GLY A C   1 
ATOM   843   O O   . GLY A  1 130 ? -11.117 -42.686  15.326  1.00 45.83  ? 130  GLY A O   1 
ATOM   844   N N   . THR A  1 131 ? -10.856 -41.720  17.342  1.00 39.68  ? 131  THR A N   1 
ATOM   845   C CA  . THR A  1 131 ? -9.680  -42.507  17.692  1.00 43.34  ? 131  THR A CA  1 
ATOM   846   C C   . THR A  1 131 ? -10.038 -43.982  17.839  1.00 45.69  ? 131  THR A C   1 
ATOM   847   O O   . THR A  1 131 ? -9.320  -44.854  17.350  1.00 45.61  ? 131  THR A O   1 
ATOM   848   C CB  . THR A  1 131 ? -9.035  -42.005  18.997  1.00 40.93  ? 131  THR A CB  1 
ATOM   849   O OG1 . THR A  1 131 ? -8.599  -40.651  18.827  1.00 41.61  ? 131  THR A OG1 1 
ATOM   850   C CG2 . THR A  1 131 ? -7.843  -42.871  19.373  1.00 38.70  ? 131  THR A CG2 1 
ATOM   851   N N   . PHE A  1 132 ? -11.156 -44.249  18.509  1.00 46.45  ? 132  PHE A N   1 
ATOM   852   C CA  . PHE A  1 132 ? -11.635 -45.613  18.710  1.00 46.44  ? 132  PHE A CA  1 
ATOM   853   C C   . PHE A  1 132 ? -11.870 -46.341  17.392  1.00 46.67  ? 132  PHE A C   1 
ATOM   854   O O   . PHE A  1 132 ? -11.438 -47.481  17.217  1.00 48.68  ? 132  PHE A O   1 
ATOM   855   C CB  . PHE A  1 132 ? -12.926 -45.610  19.530  1.00 44.43  ? 132  PHE A CB  1 
ATOM   856   C CG  . PHE A  1 132 ? -13.686 -46.903  19.464  1.00 43.96  ? 132  PHE A CG  1 
ATOM   857   C CD1 . PHE A  1 132 ? -13.224 -48.028  20.128  1.00 42.99  ? 132  PHE A CD1 1 
ATOM   858   C CD2 . PHE A  1 132 ? -14.862 -46.994  18.739  1.00 45.78  ? 132  PHE A CD2 1 
ATOM   859   C CE1 . PHE A  1 132 ? -13.921 -49.219  20.067  1.00 46.92  ? 132  PHE A CE1 1 
ATOM   860   C CE2 . PHE A  1 132 ? -15.564 -48.183  18.675  1.00 48.51  ? 132  PHE A CE2 1 
ATOM   861   C CZ  . PHE A  1 132 ? -15.092 -49.297  19.340  1.00 49.48  ? 132  PHE A CZ  1 
ATOM   862   N N   . LEU A  1 133 ? -12.563 -45.676  16.475  1.00 44.07  ? 133  LEU A N   1 
ATOM   863   C CA  . LEU A  1 133 ? -12.889 -46.261  15.180  1.00 49.25  ? 133  LEU A CA  1 
ATOM   864   C C   . LEU A  1 133 ? -11.631 -46.593  14.385  1.00 49.99  ? 133  LEU A C   1 
ATOM   865   O O   . LEU A  1 133 ? -11.543 -47.651  13.761  1.00 49.66  ? 133  LEU A O   1 
ATOM   866   C CB  . LEU A  1 133 ? -13.788 -45.315  14.381  1.00 51.40  ? 133  LEU A CB  1 
ATOM   867   C CG  . LEU A  1 133 ? -15.223 -45.173  14.893  1.00 52.27  ? 133  LEU A CG  1 
ATOM   868   C CD1 . LEU A  1 133 ? -15.941 -44.038  14.184  1.00 49.92  ? 133  LEU A CD1 1 
ATOM   869   C CD2 . LEU A  1 133 ? -15.982 -46.480  14.719  1.00 54.86  ? 133  LEU A CD2 1 
ATOM   870   N N   . VAL A  1 134 ? -10.659 -45.687  14.413  1.00 48.51  ? 134  VAL A N   1 
ATOM   871   C CA  . VAL A  1 134 ? -9.385  -45.916  13.743  1.00 45.32  ? 134  VAL A CA  1 
ATOM   872   C C   . VAL A  1 134 ? -8.613  -47.028  14.445  1.00 42.36  ? 134  VAL A C   1 
ATOM   873   O O   . VAL A  1 134 ? -8.047  -47.906  13.796  1.00 39.55  ? 134  VAL A O   1 
ATOM   874   C CB  . VAL A  1 134 ? -8.528  -44.635  13.698  1.00 41.59  ? 134  VAL A CB  1 
ATOM   875   C CG1 . VAL A  1 134 ? -7.140  -44.935  13.149  1.00 39.53  ? 134  VAL A CG1 1 
ATOM   876   C CG2 . VAL A  1 134 ? -9.215  -43.569  12.859  1.00 38.90  ? 134  VAL A CG2 1 
ATOM   877   N N   . THR A  1 135 ? -8.606  -46.988  15.775  1.00 42.13  ? 135  THR A N   1 
ATOM   878   C CA  . THR A  1 135 ? -7.926  -47.998  16.579  1.00 42.29  ? 135  THR A CA  1 
ATOM   879   C C   . THR A  1 135 ? -8.494  -49.390  16.322  1.00 45.00  ? 135  THR A C   1 
ATOM   880   O O   . THR A  1 135 ? -7.748  -50.356  16.154  1.00 45.63  ? 135  THR A O   1 
ATOM   881   C CB  . THR A  1 135 ? -8.033  -47.686  18.085  1.00 39.81  ? 135  THR A CB  1 
ATOM   882   O OG1 . THR A  1 135 ? -7.494  -46.383  18.345  1.00 39.29  ? 135  THR A OG1 1 
ATOM   883   C CG2 . THR A  1 135 ? -7.273  -48.719  18.904  1.00 36.59  ? 135  THR A CG2 1 
ATOM   884   N N   . GLN A  1 136 ? -9.819  -49.483  16.287  1.00 45.76  ? 136  GLN A N   1 
ATOM   885   C CA  . GLN A  1 136 ? -10.490 -50.756  16.062  1.00 47.04  ? 136  GLN A CA  1 
ATOM   886   C C   . GLN A  1 136 ? -10.223 -51.291  14.659  1.00 52.84  ? 136  GLN A C   1 
ATOM   887   O O   . GLN A  1 136 ? -9.860  -52.454  14.491  1.00 58.05  ? 136  GLN A O   1 
ATOM   888   C CB  . GLN A  1 136 ? -11.996 -50.612  16.286  1.00 48.69  ? 136  GLN A CB  1 
ATOM   889   C CG  . GLN A  1 136 ? -12.771 -51.900  16.078  1.00 51.51  ? 136  GLN A CG  1 
ATOM   890   C CD  . GLN A  1 136 ? -14.261 -51.724  16.287  1.00 50.68  ? 136  GLN A CD  1 
ATOM   891   O OE1 . GLN A  1 136 ? -14.820 -50.666  15.997  1.00 47.27  ? 136  GLN A OE1 1 
ATOM   892   N NE2 . GLN A  1 136 ? -14.914 -52.763  16.796  1.00 54.35  ? 136  GLN A NE2 1 
ATOM   893   N N   . ALA A  1 137 ? -10.399 -50.436  13.657  1.00 47.72  ? 137  ALA A N   1 
ATOM   894   C CA  . ALA A  1 137 ? -10.236 -50.838  12.264  1.00 48.11  ? 137  ALA A CA  1 
ATOM   895   C C   . ALA A  1 137 ? -8.790  -51.201  11.939  1.00 46.66  ? 137  ALA A C   1 
ATOM   896   O O   . ALA A  1 137 ? -8.533  -52.068  11.103  1.00 42.06  ? 137  ALA A O   1 
ATOM   897   C CB  . ALA A  1 137 ? -10.723 -49.735  11.338  1.00 47.92  ? 137  ALA A CB  1 
ATOM   898   N N   . ALA A  1 138 ? -7.849  -50.534  12.600  1.00 47.95  ? 138  ALA A N   1 
ATOM   899   C CA  . ALA A  1 138 ? -6.432  -50.814  12.399  1.00 45.59  ? 138  ALA A CA  1 
ATOM   900   C C   . ALA A  1 138 ? -6.061  -52.160  13.006  1.00 44.32  ? 138  ALA A C   1 
ATOM   901   O O   . ALA A  1 138 ? -5.315  -52.938  12.411  1.00 44.65  ? 138  ALA A O   1 
ATOM   902   C CB  . ALA A  1 138 ? -5.581  -49.712  12.999  1.00 34.97  ? 138  ALA A CB  1 
ATOM   903   N N   . ALA A  1 139 ? -6.590  -52.424  14.196  1.00 36.74  ? 139  ALA A N   1 
ATOM   904   C CA  . ALA A  1 139 ? -6.351  -53.685  14.884  1.00 40.30  ? 139  ALA A CA  1 
ATOM   905   C C   . ALA A  1 139 ? -6.968  -54.845  14.115  1.00 40.44  ? 139  ALA A C   1 
ATOM   906   O O   . ALA A  1 139 ? -6.352  -55.900  13.964  1.00 41.41  ? 139  ALA A O   1 
ATOM   907   C CB  . ALA A  1 139 ? -6.908  -53.629  16.295  1.00 36.82  ? 139  ALA A CB  1 
ATOM   908   N N   . GLN A  1 140 ? -8.189  -54.639  13.631  1.00 41.80  ? 140  GLN A N   1 
ATOM   909   C CA  . GLN A  1 140 ? -8.898  -55.655  12.862  1.00 43.03  ? 140  GLN A CA  1 
ATOM   910   C C   . GLN A  1 140 ? -8.134  -56.031  11.596  1.00 46.27  ? 140  GLN A C   1 
ATOM   911   O O   . GLN A  1 140 ? -8.150  -57.185  11.179  1.00 46.53  ? 140  GLN A O   1 
ATOM   912   C CB  . GLN A  1 140 ? -10.303 -55.168  12.502  1.00 45.68  ? 140  GLN A CB  1 
ATOM   913   C CG  . GLN A  1 140 ? -11.278 -55.162  13.669  1.00 54.20  ? 140  GLN A CG  1 
ATOM   914   C CD  . GLN A  1 140 ? -12.582 -54.464  13.335  1.00 62.43  ? 140  GLN A CD  1 
ATOM   915   O OE1 . GLN A  1 140 ? -12.651 -53.665  12.401  1.00 62.62  ? 140  GLN A OE1 1 
ATOM   916   N NE2 . GLN A  1 140 ? -13.627 -54.765  14.098  1.00 66.08  ? 140  GLN A NE2 1 
ATOM   917   N N   . ALA A  1 141 ? -7.462  -55.055  10.996  1.00 47.18  ? 141  ALA A N   1 
ATOM   918   C CA  . ALA A  1 141 ? -6.692  -55.294  9.780   1.00 49.79  ? 141  ALA A CA  1 
ATOM   919   C C   . ALA A  1 141 ? -5.402  -56.054  10.077  1.00 48.70  ? 141  ALA A C   1 
ATOM   920   O O   . ALA A  1 141 ? -5.003  -56.938  9.318   1.00 47.28  ? 141  ALA A O   1 
ATOM   921   C CB  . ALA A  1 141 ? -6.381  -53.978  9.084   1.00 51.37  ? 141  ALA A CB  1 
ATOM   922   N N   . LEU A  1 142 ? -4.753  -55.706  11.183  1.00 47.26  ? 142  LEU A N   1 
ATOM   923   C CA  . LEU A  1 142 ? -3.498  -56.344  11.568  1.00 48.29  ? 142  LEU A CA  1 
ATOM   924   C C   . LEU A  1 142 ? -3.708  -57.788  12.016  1.00 55.47  ? 142  LEU A C   1 
ATOM   925   O O   . LEU A  1 142 ? -2.996  -58.691  11.575  1.00 54.00  ? 142  LEU A O   1 
ATOM   926   C CB  . LEU A  1 142 ? -2.813  -55.545  12.678  1.00 44.41  ? 142  LEU A CB  1 
ATOM   927   C CG  . LEU A  1 142 ? -2.195  -54.209  12.263  1.00 44.95  ? 142  LEU A CG  1 
ATOM   928   C CD1 . LEU A  1 142 ? -1.632  -53.477  13.471  1.00 42.38  ? 142  LEU A CD1 1 
ATOM   929   C CD2 . LEU A  1 142 ? -1.114  -54.427  11.216  1.00 46.89  ? 142  LEU A CD2 1 
ATOM   930   N N   . VAL A  1 143 ? -4.685  -57.997  12.894  1.00 55.23  ? 143  VAL A N   1 
ATOM   931   C CA  . VAL A  1 143 ? -4.995  -59.329  13.406  1.00 46.91  ? 143  VAL A CA  1 
ATOM   932   C C   . VAL A  1 143 ? -5.433  -60.261  12.280  1.00 53.20  ? 143  VAL A C   1 
ATOM   933   O O   . VAL A  1 143 ? -5.079  -61.442  12.262  1.00 54.96  ? 143  VAL A O   1 
ATOM   934   C CB  . VAL A  1 143 ? -6.099  -59.270  14.484  1.00 46.31  ? 143  VAL A CB  1 
ATOM   935   C CG1 . VAL A  1 143 ? -6.537  -60.671  14.893  1.00 48.71  ? 143  VAL A CG1 1 
ATOM   936   C CG2 . VAL A  1 143 ? -5.616  -58.487  15.694  1.00 59.38  ? 143  VAL A CG2 1 
ATOM   937   N N   . SER A  1 144 ? -6.186  -59.716  11.330  1.00 55.59  ? 144  SER A N   1 
ATOM   938   C CA  . SER A  1 144 ? -6.722  -60.505  10.226  1.00 59.49  ? 144  SER A CA  1 
ATOM   939   C C   . SER A  1 144 ? -5.654  -60.935  9.227   1.00 60.11  ? 144  SER A C   1 
ATOM   940   O O   . SER A  1 144 ? -5.926  -61.734  8.336   1.00 56.42  ? 144  SER A O   1 
ATOM   941   C CB  . SER A  1 144 ? -7.813  -59.723  9.494   1.00 60.00  ? 144  SER A CB  1 
ATOM   942   O OG  . SER A  1 144 ? -8.935  -59.509  10.331  1.00 60.66  ? 144  SER A OG  1 
ATOM   943   N N   . ASN A  1 145 ? -4.448  -60.396  9.366   1.00 63.10  ? 145  ASN A N   1 
ATOM   944   C CA  . ASN A  1 145 ? -3.340  -60.798  8.507   1.00 66.78  ? 145  ASN A CA  1 
ATOM   945   C C   . ASN A  1 145 ? -2.123  -61.237  9.314   1.00 69.91  ? 145  ASN A C   1 
ATOM   946   O O   . ASN A  1 145 ? -1.044  -61.445  8.762   1.00 70.12  ? 145  ASN A O   1 
ATOM   947   C CB  . ASN A  1 145 ? -2.964  -59.664  7.551   1.00 65.81  ? 145  ASN A CB  1 
ATOM   948   C CG  . ASN A  1 145 ? -3.973  -59.489  6.433   1.00 72.01  ? 145  ASN A CG  1 
ATOM   949   O OD1 . ASN A  1 145 ? -4.043  -58.437  5.799   1.00 69.71  ? 145  ASN A OD1 1 
ATOM   950   N ND2 . ASN A  1 145 ? -4.771  -60.523  6.192   1.00 80.94  ? 145  ASN A ND2 1 
ATOM   951   N N   . GLY A  1 146 ? -2.311  -61.380  10.623  1.00 72.12  ? 146  GLY A N   1 
ATOM   952   C CA  . GLY A  1 146 ? -1.268  -61.866  11.509  1.00 74.32  ? 146  GLY A CA  1 
ATOM   953   C C   . GLY A  1 146 ? -0.017  -61.012  11.524  1.00 70.53  ? 146  GLY A C   1 
ATOM   954   O O   . GLY A  1 146 ? 1.092   -61.522  11.682  1.00 67.75  ? 146  GLY A O   1 
ATOM   955   N N   . CYS A  1 147 ? -0.195  -59.706  11.356  1.00 69.92  ? 147  CYS A N   1 
ATOM   956   C CA  . CYS A  1 147 ? 0.932   -58.782  11.340  1.00 65.21  ? 147  CYS A CA  1 
ATOM   957   C C   . CYS A  1 147 ? 1.092   -58.082  12.682  1.00 58.31  ? 147  CYS A C   1 
ATOM   958   O O   . CYS A  1 147 ? 0.123   -57.577  13.249  1.00 55.23  ? 147  CYS A O   1 
ATOM   959   C CB  . CYS A  1 147 ? 0.761   -57.742  10.230  1.00 64.55  ? 147  CYS A CB  1 
ATOM   960   S SG  . CYS A  1 147 ? 0.714   -58.426  8.557   1.00 81.05  ? 147  CYS A SG  1 
ATOM   961   N N   . ARG A  1 148 ? 2.320   -58.061  13.190  1.00 56.23  ? 148  ARG A N   1 
ATOM   962   C CA  . ARG A  1 148 ? 2.625   -57.296  14.390  1.00 54.04  ? 148  ARG A CA  1 
ATOM   963   C C   . ARG A  1 148 ? 2.452   -55.815  14.080  1.00 51.18  ? 148  ARG A C   1 
ATOM   964   O O   . ARG A  1 148 ? 2.616   -55.392  12.935  1.00 50.66  ? 148  ARG A O   1 
ATOM   965   C CB  . ARG A  1 148 ? 4.044   -57.585  14.883  1.00 58.68  ? 148  ARG A CB  1 
ATOM   966   C CG  . ARG A  1 148 ? 4.283   -59.025  15.306  1.00 66.26  ? 148  ARG A CG  1 
ATOM   967   C CD  . ARG A  1 148 ? 5.769   -59.308  15.451  1.00 74.25  ? 148  ARG A CD  1 
ATOM   968   N NE  . ARG A  1 148 ? 6.029   -60.713  15.749  1.00 83.43  ? 148  ARG A NE  1 
ATOM   969   C CZ  . ARG A  1 148 ? 6.096   -61.669  14.828  1.00 88.62  ? 148  ARG A CZ  1 
ATOM   970   N NH1 . ARG A  1 148 ? 5.919   -61.372  13.547  1.00 91.95  ? 148  ARG A NH1 1 
ATOM   971   N NH2 . ARG A  1 148 ? 6.337   -62.923  15.186  1.00 88.28  ? 148  ARG A NH2 1 
ATOM   972   N N   . GLY A  1 149 ? 2.112   -55.025  15.091  1.00 47.93  ? 149  GLY A N   1 
ATOM   973   C CA  . GLY A  1 149 ? 1.854   -53.617  14.866  1.00 47.90  ? 149  GLY A CA  1 
ATOM   974   C C   . GLY A  1 149 ? 2.083   -52.725  16.068  1.00 45.34  ? 149  GLY A C   1 
ATOM   975   O O   . GLY A  1 149 ? 2.265   -53.196  17.190  1.00 38.68  ? 149  GLY A O   1 
ATOM   976   N N   . SER A  1 150 ? 2.075   -51.422  15.816  1.00 44.34  ? 150  SER A N   1 
ATOM   977   C CA  . SER A  1 150 ? 2.225   -50.429  16.867  1.00 44.47  ? 150  SER A CA  1 
ATOM   978   C C   . SER A  1 150 ? 1.234   -49.294  16.648  1.00 45.80  ? 150  SER A C   1 
ATOM   979   O O   . SER A  1 150 ? 1.388   -48.494  15.727  1.00 47.75  ? 150  SER A O   1 
ATOM   980   C CB  . SER A  1 150 ? 3.655   -49.888  16.904  1.00 47.40  ? 150  SER A CB  1 
ATOM   981   O OG  . SER A  1 150 ? 3.788   -48.877  17.888  1.00 48.59  ? 150  SER A OG  1 
ATOM   982   N N   . ILE A  1 151 ? 0.209   -49.239  17.492  1.00 46.20  ? 151  ILE A N   1 
ATOM   983   C CA  . ILE A  1 151 ? -0.799  -48.192  17.398  1.00 40.40  ? 151  ILE A CA  1 
ATOM   984   C C   . ILE A  1 151 ? -0.454  -47.044  18.339  1.00 37.85  ? 151  ILE A C   1 
ATOM   985   O O   . ILE A  1 151 ? -0.263  -47.247  19.538  1.00 40.93  ? 151  ILE A O   1 
ATOM   986   C CB  . ILE A  1 151 ? -2.203  -48.729  17.726  1.00 38.98  ? 151  ILE A CB  1 
ATOM   987   C CG1 . ILE A  1 151 ? -2.505  -49.969  16.881  1.00 38.36  ? 151  ILE A CG1 1 
ATOM   988   C CG2 . ILE A  1 151 ? -3.252  -47.650  17.499  1.00 37.09  ? 151  ILE A CG2 1 
ATOM   989   C CD1 . ILE A  1 151 ? -3.855  -50.589  17.161  1.00 35.75  ? 151  ILE A CD1 1 
ATOM   990   N N   . ILE A  1 152 ? -0.371  -45.839  17.786  1.00 35.16  ? 152  ILE A N   1 
ATOM   991   C CA  . ILE A  1 152 ? 0.045   -44.673  18.556  1.00 35.23  ? 152  ILE A CA  1 
ATOM   992   C C   . ILE A  1 152 ? -1.032  -43.595  18.569  1.00 32.43  ? 152  ILE A C   1 
ATOM   993   O O   . ILE A  1 152 ? -1.194  -42.853  17.601  1.00 33.16  ? 152  ILE A O   1 
ATOM   994   C CB  . ILE A  1 152 ? 1.349   -44.079  17.997  1.00 37.40  ? 152  ILE A CB  1 
ATOM   995   C CG1 . ILE A  1 152 ? 2.416   -45.169  17.882  1.00 41.32  ? 152  ILE A CG1 1 
ATOM   996   C CG2 . ILE A  1 152 ? 1.833   -42.935  18.872  1.00 33.69  ? 152  ILE A CG2 1 
ATOM   997   C CD1 . ILE A  1 152 ? 3.663   -44.725  17.162  1.00 50.74  ? 152  ILE A CD1 1 
ATOM   998   N N   . ASN A  1 153 ? -1.766  -43.513  19.673  1.00 34.30  ? 153  ASN A N   1 
ATOM   999   C CA  . ASN A  1 153 ? -2.832  -42.528  19.811  1.00 36.46  ? 153  ASN A CA  1 
ATOM   1000  C C   . ASN A  1 153 ? -2.336  -41.233  20.439  1.00 37.88  ? 153  ASN A C   1 
ATOM   1001  O O   . ASN A  1 153 ? -1.829  -41.229  21.560  1.00 43.27  ? 153  ASN A O   1 
ATOM   1002  C CB  . ASN A  1 153 ? -3.980  -43.102  20.641  1.00 36.34  ? 153  ASN A CB  1 
ATOM   1003  C CG  . ASN A  1 153 ? -4.667  -44.264  19.956  1.00 40.05  ? 153  ASN A CG  1 
ATOM   1004  O OD1 . ASN A  1 153 ? -4.773  -44.302  18.731  1.00 38.42  ? 153  ASN A OD1 1 
ATOM   1005  N ND2 . ASN A  1 153 ? -5.138  -45.223  20.745  1.00 45.00  ? 153  ASN A ND2 1 
ATOM   1006  N N   . ILE A  1 154 ? -2.484  -40.133  19.709  1.00 38.43  ? 154  ILE A N   1 
ATOM   1007  C CA  . ILE A  1 154 ? -2.056  -38.831  20.203  1.00 37.58  ? 154  ILE A CA  1 
ATOM   1008  C C   . ILE A  1 154 ? -3.082  -38.244  21.166  1.00 39.42  ? 154  ILE A C   1 
ATOM   1009  O O   . ILE A  1 154 ? -4.107  -37.706  20.746  1.00 40.98  ? 154  ILE A O   1 
ATOM   1010  C CB  . ILE A  1 154 ? -1.819  -37.838  19.052  1.00 34.91  ? 154  ILE A CB  1 
ATOM   1011  C CG1 . ILE A  1 154 ? -0.820  -38.415  18.048  1.00 36.97  ? 154  ILE A CG1 1 
ATOM   1012  C CG2 . ILE A  1 154 ? -1.324  -36.507  19.594  1.00 31.63  ? 154  ILE A CG2 1 
ATOM   1013  C CD1 . ILE A  1 154 ? 0.554   -38.670  18.628  1.00 37.07  ? 154  ILE A CD1 1 
ATOM   1014  N N   . SER A  1 155 ? -2.802  -38.358  22.459  1.00 37.49  ? 155  SER A N   1 
ATOM   1015  C CA  . SER A  1 155 ? -3.656  -37.765  23.479  1.00 35.08  ? 155  SER A CA  1 
ATOM   1016  C C   . SER A  1 155 ? -3.196  -36.341  23.769  1.00 30.85  ? 155  SER A C   1 
ATOM   1017  O O   . SER A  1 155 ? -2.817  -35.607  22.856  1.00 29.32  ? 155  SER A O   1 
ATOM   1018  C CB  . SER A  1 155 ? -3.642  -38.607  24.756  1.00 36.91  ? 155  SER A CB  1 
ATOM   1019  O OG  . SER A  1 155 ? -4.498  -38.054  25.741  1.00 42.90  ? 155  SER A OG  1 
ATOM   1020  N N   . SER A  1 156 ? -3.226  -35.957  25.040  1.00 26.28  ? 156  SER A N   1 
ATOM   1021  C CA  . SER A  1 156 ? -2.776  -34.632  25.449  1.00 28.73  ? 156  SER A CA  1 
ATOM   1022  C C   . SER A  1 156 ? -2.477  -34.589  26.941  1.00 38.36  ? 156  SER A C   1 
ATOM   1023  O O   . SER A  1 156 ? -2.968  -35.419  27.705  1.00 48.25  ? 156  SER A O   1 
ATOM   1024  C CB  . SER A  1 156 ? -3.826  -33.575  25.098  1.00 27.96  ? 156  SER A CB  1 
ATOM   1025  O OG  . SER A  1 156 ? -3.425  -32.291  25.542  1.00 32.46  ? 156  SER A OG  1 
ATOM   1026  N N   . ILE A  1 157 ? -1.671  -33.616  27.352  1.00 38.90  ? 157  ILE A N   1 
ATOM   1027  C CA  . ILE A  1 157 ? -1.405  -33.395  28.767  1.00 40.65  ? 157  ILE A CA  1 
ATOM   1028  C C   . ILE A  1 157 ? -2.679  -32.887  29.441  1.00 43.36  ? 157  ILE A C   1 
ATOM   1029  O O   . ILE A  1 157 ? -2.842  -32.988  30.657  1.00 43.37  ? 157  ILE A O   1 
ATOM   1030  C CB  . ILE A  1 157 ? -0.246  -32.394  28.981  1.00 42.02  ? 157  ILE A CB  1 
ATOM   1031  C CG1 . ILE A  1 157 ? 0.225   -32.411  30.438  1.00 47.04  ? 157  ILE A CG1 1 
ATOM   1032  C CG2 . ILE A  1 157 ? -0.648  -30.990  28.543  1.00 37.89  ? 157  ILE A CG2 1 
ATOM   1033  C CD1 . ILE A  1 157 ? 0.742   -33.758  30.896  1.00 50.24  ? 157  ILE A CD1 1 
ATOM   1034  N N   . VAL A  1 158 ? -3.585  -32.352  28.627  1.00 49.99  ? 158  VAL A N   1 
ATOM   1035  C CA  . VAL A  1 158 ? -4.882  -31.883  29.093  1.00 46.07  ? 158  VAL A CA  1 
ATOM   1036  C C   . VAL A  1 158 ? -5.723  -33.049  29.611  1.00 37.00  ? 158  VAL A C   1 
ATOM   1037  O O   . VAL A  1 158 ? -6.457  -32.913  30.589  1.00 32.97  ? 158  VAL A O   1 
ATOM   1038  C CB  . VAL A  1 158 ? -5.643  -31.148  27.967  1.00 50.07  ? 158  VAL A CB  1 
ATOM   1039  C CG1 . VAL A  1 158 ? -7.020  -30.715  28.435  1.00 51.77  ? 158  VAL A CG1 1 
ATOM   1040  C CG2 . VAL A  1 158 ? -4.840  -29.948  27.484  1.00 50.36  ? 158  VAL A CG2 1 
ATOM   1041  N N   . GLY A  1 159 ? -5.591  -34.204  28.966  1.00 33.95  ? 159  GLY A N   1 
ATOM   1042  C CA  . GLY A  1 159 ? -6.344  -35.385  29.350  1.00 38.40  ? 159  GLY A CA  1 
ATOM   1043  C C   . GLY A  1 159 ? -5.839  -36.057  30.615  1.00 40.38  ? 159  GLY A C   1 
ATOM   1044  O O   . GLY A  1 159 ? -6.167  -37.211  30.889  1.00 44.97  ? 159  GLY A O   1 
ATOM   1045  N N   . LYS A  1 160 ? -5.043  -35.331  31.392  1.00 42.56  ? 160  LYS A N   1 
ATOM   1046  C CA  . LYS A  1 160 ? -4.490  -35.860  32.630  1.00 38.71  ? 160  LYS A CA  1 
ATOM   1047  C C   . LYS A  1 160 ? -4.790  -34.934  33.807  1.00 40.28  ? 160  LYS A C   1 
ATOM   1048  O O   . LYS A  1 160 ? -4.935  -35.385  34.943  1.00 44.29  ? 160  LYS A O   1 
ATOM   1049  C CB  . LYS A  1 160 ? -2.982  -36.070  32.486  1.00 37.97  ? 160  LYS A CB  1 
ATOM   1050  C CG  . LYS A  1 160 ? -2.292  -36.588  33.735  1.00 44.38  ? 160  LYS A CG  1 
ATOM   1051  C CD  . LYS A  1 160 ? -0.787  -36.531  33.571  1.00 44.65  ? 160  LYS A CD  1 
ATOM   1052  C CE  . LYS A  1 160 ? -0.107  -36.118  34.862  1.00 44.59  ? 160  LYS A CE  1 
ATOM   1053  N NZ  . LYS A  1 160 ? 1.320   -35.772  34.629  1.00 48.21  ? 160  LYS A NZ  1 
ATOM   1054  N N   . VAL A  1 161 ? -4.888  -33.637  33.526  1.00 38.12  ? 161  VAL A N   1 
ATOM   1055  C CA  . VAL A  1 161 ? -5.139  -32.647  34.569  1.00 38.58  ? 161  VAL A CA  1 
ATOM   1056  C C   . VAL A  1 161 ? -6.297  -31.714  34.225  1.00 36.00  ? 161  VAL A C   1 
ATOM   1057  O O   . VAL A  1 161 ? -6.690  -30.877  35.036  1.00 36.62  ? 161  VAL A O   1 
ATOM   1058  C CB  . VAL A  1 161 ? -3.887  -31.790  34.841  1.00 42.59  ? 161  VAL A CB  1 
ATOM   1059  C CG1 . VAL A  1 161 ? -2.787  -32.634  35.464  1.00 47.20  ? 161  VAL A CG1 1 
ATOM   1060  C CG2 . VAL A  1 161 ? -3.406  -31.131  33.556  1.00 39.80  ? 161  VAL A CG2 1 
ATOM   1061  N N   . GLY A  1 162 ? -6.840  -31.858  33.021  1.00 34.24  ? 162  GLY A N   1 
ATOM   1062  C CA  . GLY A  1 162 ? -7.906  -30.984  32.565  1.00 32.66  ? 162  GLY A CA  1 
ATOM   1063  C C   . GLY A  1 162 ? -7.375  -29.622  32.165  1.00 37.47  ? 162  GLY A C   1 
ATOM   1064  O O   . GLY A  1 162 ? -6.184  -29.344  32.311  1.00 41.99  ? 162  GLY A O   1 
ATOM   1065  N N   . ASN A  1 163 ? -8.259  -28.769  31.656  1.00 40.04  ? 163  ASN A N   1 
ATOM   1066  C CA  . ASN A  1 163 ? -7.879  -27.420  31.255  1.00 41.44  ? 163  ASN A CA  1 
ATOM   1067  C C   . ASN A  1 163 ? -9.096  -26.510  31.140  1.00 43.98  ? 163  ASN A C   1 
ATOM   1068  O O   . ASN A  1 163 ? -10.169 -26.949  30.728  1.00 47.48  ? 163  ASN A O   1 
ATOM   1069  C CB  . ASN A  1 163 ? -7.119  -27.449  29.927  1.00 42.57  ? 163  ASN A CB  1 
ATOM   1070  C CG  . ASN A  1 163 ? -6.479  -26.116  29.591  1.00 46.03  ? 163  ASN A CG  1 
ATOM   1071  O OD1 . ASN A  1 163 ? -6.157  -25.327  30.480  1.00 49.47  ? 163  ASN A OD1 1 
ATOM   1072  N ND2 . ASN A  1 163 ? -6.291  -25.858  28.302  1.00 43.53  ? 163  ASN A ND2 1 
ATOM   1073  N N   . VAL A  1 164 ? -8.921  -25.244  31.506  1.00 43.32  ? 164  VAL A N   1 
ATOM   1074  C CA  . VAL A  1 164 ? -10.006 -24.267  31.472  1.00 45.61  ? 164  VAL A CA  1 
ATOM   1075  C C   . VAL A  1 164 ? -10.574 -24.091  30.067  1.00 43.05  ? 164  VAL A C   1 
ATOM   1076  O O   . VAL A  1 164 ? -9.835  -23.861  29.110  1.00 44.53  ? 164  VAL A O   1 
ATOM   1077  C CB  . VAL A  1 164 ? -9.537  -22.896  32.002  1.00 49.27  ? 164  VAL A CB  1 
ATOM   1078  C CG1 . VAL A  1 164 ? -10.603 -21.835  31.770  1.00 50.60  ? 164  VAL A CG1 1 
ATOM   1079  C CG2 . VAL A  1 164 ? -9.189  -22.991  33.478  1.00 49.21  ? 164  VAL A CG2 1 
ATOM   1080  N N   . GLY A  1 165 ? -11.893 -24.211  29.951  1.00 44.36  ? 165  GLY A N   1 
ATOM   1081  C CA  . GLY A  1 165 ? -12.569 -24.028  28.681  1.00 45.92  ? 165  GLY A CA  1 
ATOM   1082  C C   . GLY A  1 165 ? -12.490 -25.248  27.786  1.00 47.39  ? 165  GLY A C   1 
ATOM   1083  O O   . GLY A  1 165 ? -12.893 -25.200  26.625  1.00 50.87  ? 165  GLY A O   1 
ATOM   1084  N N   . GLN A  1 166 ? -11.973 -26.347  28.326  1.00 43.93  ? 166  GLN A N   1 
ATOM   1085  C CA  . GLN A  1 166 ? -11.826 -27.573  27.551  1.00 37.66  ? 166  GLN A CA  1 
ATOM   1086  C C   . GLN A  1 166 ? -12.419 -28.781  28.265  1.00 38.48  ? 166  GLN A C   1 
ATOM   1087  O O   . GLN A  1 166 ? -11.747 -29.797  28.435  1.00 42.91  ? 166  GLN A O   1 
ATOM   1088  C CB  . GLN A  1 166 ? -10.352 -27.830  27.235  1.00 35.36  ? 166  GLN A CB  1 
ATOM   1089  C CG  . GLN A  1 166 ? -9.762  -26.863  26.224  1.00 39.98  ? 166  GLN A CG  1 
ATOM   1090  C CD  . GLN A  1 166 ? -8.429  -27.332  25.680  1.00 40.88  ? 166  GLN A CD  1 
ATOM   1091  O OE1 . GLN A  1 166 ? -7.518  -27.667  26.437  1.00 41.73  ? 166  GLN A OE1 1 
ATOM   1092  N NE2 . GLN A  1 166 ? -8.310  -27.366  24.357  1.00 38.66  ? 166  GLN A NE2 1 
ATOM   1093  N N   . THR A  1 167 ? -13.677 -28.668  28.679  1.00 35.28  ? 167  THR A N   1 
ATOM   1094  C CA  . THR A  1 167 ? -14.380 -29.787  29.294  1.00 36.97  ? 167  THR A CA  1 
ATOM   1095  C C   . THR A  1 167 ? -14.512 -30.933  28.299  1.00 39.45  ? 167  THR A C   1 
ATOM   1096  O O   . THR A  1 167 ? -14.256 -32.092  28.627  1.00 39.36  ? 167  THR A O   1 
ATOM   1097  C CB  . THR A  1 167 ? -15.779 -29.379  29.792  1.00 38.99  ? 167  THR A CB  1 
ATOM   1098  O OG1 . THR A  1 167 ? -15.657 -28.351  30.783  1.00 44.64  ? 167  THR A OG1 1 
ATOM   1099  C CG2 . THR A  1 167 ? -16.503 -30.574  30.395  1.00 36.32  ? 167  THR A CG2 1 
ATOM   1100  N N   . ASN A  1 168 ? -14.905 -30.592  27.076  1.00 38.60  ? 168  ASN A N   1 
ATOM   1101  C CA  . ASN A  1 168 ? -15.063 -31.570  26.008  1.00 35.50  ? 168  ASN A CA  1 
ATOM   1102  C C   . ASN A  1 168 ? -13.729 -32.141  25.538  1.00 34.11  ? 168  ASN A C   1 
ATOM   1103  O O   . ASN A  1 168 ? -13.618 -33.334  25.254  1.00 36.18  ? 168  ASN A O   1 
ATOM   1104  C CB  . ASN A  1 168 ? -15.803 -30.940  24.826  1.00 32.14  ? 168  ASN A CB  1 
ATOM   1105  C CG  . ASN A  1 168 ? -15.232 -29.589  24.432  1.00 31.79  ? 168  ASN A CG  1 
ATOM   1106  O OD1 . ASN A  1 168 ? -14.173 -29.184  24.913  1.00 27.49  ? 168  ASN A OD1 1 
ATOM   1107  N ND2 . ASN A  1 168 ? -15.933 -28.885  23.550  1.00 35.39  ? 168  ASN A ND2 1 
ATOM   1108  N N   . TYR A  1 169 ? -12.720 -31.280  25.460  1.00 33.18  ? 169  TYR A N   1 
ATOM   1109  C CA  . TYR A  1 169 ? -11.406 -31.672  24.965  1.00 29.93  ? 169  TYR A CA  1 
ATOM   1110  C C   . TYR A  1 169 ? -10.678 -32.581  25.950  1.00 32.66  ? 169  TYR A C   1 
ATOM   1111  O O   . TYR A  1 169 ? -10.070 -33.575  25.555  1.00 35.62  ? 169  TYR A O   1 
ATOM   1112  C CB  . TYR A  1 169 ? -10.563 -30.431  24.669  1.00 32.47  ? 169  TYR A CB  1 
ATOM   1113  C CG  . TYR A  1 169 ? -9.220  -30.726  24.041  1.00 35.90  ? 169  TYR A CG  1 
ATOM   1114  C CD1 . TYR A  1 169 ? -9.106  -30.957  22.677  1.00 39.32  ? 169  TYR A CD1 1 
ATOM   1115  C CD2 . TYR A  1 169 ? -8.064  -30.762  24.811  1.00 36.67  ? 169  TYR A CD2 1 
ATOM   1116  C CE1 . TYR A  1 169 ? -7.881  -31.223  22.097  1.00 45.37  ? 169  TYR A CE1 1 
ATOM   1117  C CE2 . TYR A  1 169 ? -6.835  -31.028  24.240  1.00 42.07  ? 169  TYR A CE2 1 
ATOM   1118  C CZ  . TYR A  1 169 ? -6.748  -31.256  22.883  1.00 46.59  ? 169  TYR A CZ  1 
ATOM   1119  O OH  . TYR A  1 169 ? -5.526  -31.520  22.309  1.00 48.60  ? 169  TYR A OH  1 
ATOM   1120  N N   . ALA A  1 170 ? -10.744 -32.237  27.233  1.00 30.82  ? 170  ALA A N   1 
ATOM   1121  C CA  . ALA A  1 170 ? -10.075 -33.019  28.267  1.00 26.94  ? 170  ALA A CA  1 
ATOM   1122  C C   . ALA A  1 170 ? -10.722 -34.388  28.432  1.00 31.78  ? 170  ALA A C   1 
ATOM   1123  O O   . ALA A  1 170 ? -10.032 -35.395  28.593  1.00 32.64  ? 170  ALA A O   1 
ATOM   1124  C CB  . ALA A  1 170 ? -10.086 -32.270  29.588  1.00 22.49  ? 170  ALA A CB  1 
ATOM   1125  N N   . ALA A  1 171 ? -12.051 -34.418  28.393  1.00 33.62  ? 171  ALA A N   1 
ATOM   1126  C CA  . ALA A  1 171 ? -12.796 -35.661  28.552  1.00 32.41  ? 171  ALA A CA  1 
ATOM   1127  C C   . ALA A  1 171 ? -12.516 -36.621  27.402  1.00 35.74  ? 171  ALA A C   1 
ATOM   1128  O O   . ALA A  1 171 ? -12.548 -37.838  27.576  1.00 42.44  ? 171  ALA A O   1 
ATOM   1129  C CB  . ALA A  1 171 ? -14.287 -35.376  28.654  1.00 27.06  ? 171  ALA A CB  1 
ATOM   1130  N N   . SER A  1 172 ? -12.239 -36.066  26.228  1.00 28.99  ? 172  SER A N   1 
ATOM   1131  C CA  . SER A  1 172 ? -11.943 -36.881  25.057  1.00 35.71  ? 172  SER A CA  1 
ATOM   1132  C C   . SER A  1 172 ? -10.518 -37.423  25.116  1.00 40.84  ? 172  SER A C   1 
ATOM   1133  O O   . SER A  1 172 ? -10.281 -38.599  24.839  1.00 45.62  ? 172  SER A O   1 
ATOM   1134  C CB  . SER A  1 172 ? -12.151 -36.075  23.775  1.00 31.97  ? 172  SER A CB  1 
ATOM   1135  O OG  . SER A  1 172 ? -11.307 -34.937  23.747  1.00 38.00  ? 172  SER A OG  1 
ATOM   1136  N N   . LYS A  1 173 ? -9.575  -36.562  25.484  1.00 34.16  ? 173  LYS A N   1 
ATOM   1137  C CA  . LYS A  1 173 ? -8.171  -36.949  25.558  1.00 29.60  ? 173  LYS A CA  1 
ATOM   1138  C C   . LYS A  1 173 ? -7.927  -37.967  26.663  1.00 32.94  ? 173  LYS A C   1 
ATOM   1139  O O   . LYS A  1 173 ? -7.142  -38.901  26.493  1.00 34.19  ? 173  LYS A O   1 
ATOM   1140  C CB  . LYS A  1 173 ? -7.289  -35.720  25.772  1.00 24.82  ? 173  LYS A CB  1 
ATOM   1141  C CG  . LYS A  1 173 ? -7.252  -34.800  24.572  1.00 27.26  ? 173  LYS A CG  1 
ATOM   1142  C CD  . LYS A  1 173 ? -6.893  -35.581  23.320  1.00 30.80  ? 173  LYS A CD  1 
ATOM   1143  C CE  . LYS A  1 173 ? -6.989  -34.714  22.082  1.00 34.93  ? 173  LYS A CE  1 
ATOM   1144  N NZ  . LYS A  1 173 ? -6.583  -35.451  20.853  1.00 35.51  ? 173  LYS A NZ  1 
ATOM   1145  N N   . ALA A  1 174 ? -8.599  -37.781  27.793  1.00 30.38  ? 174  ALA A N   1 
ATOM   1146  C CA  . ALA A  1 174 ? -8.512  -38.732  28.893  1.00 30.00  ? 174  ALA A CA  1 
ATOM   1147  C C   . ALA A  1 174 ? -9.113  -40.065  28.469  1.00 26.66  ? 174  ALA A C   1 
ATOM   1148  O O   . ALA A  1 174 ? -8.605  -41.128  28.821  1.00 24.54  ? 174  ALA A O   1 
ATOM   1149  C CB  . ALA A  1 174 ? -9.217  -38.192  30.125  1.00 30.14  ? 174  ALA A CB  1 
ATOM   1150  N N   . GLY A  1 175 ? -10.196 -39.995  27.703  1.00 23.40  ? 175  GLY A N   1 
ATOM   1151  C CA  . GLY A  1 175 ? -10.846 -41.184  27.188  1.00 31.54  ? 175  GLY A CA  1 
ATOM   1152  C C   . GLY A  1 175 ? -9.935  -41.958  26.256  1.00 32.92  ? 175  GLY A C   1 
ATOM   1153  O O   . GLY A  1 175 ? -9.934  -43.187  26.258  1.00 34.79  ? 175  GLY A O   1 
ATOM   1154  N N   . VAL A  1 176 ? -9.159  -41.228  25.460  1.00 32.83  ? 176  VAL A N   1 
ATOM   1155  C CA  . VAL A  1 176 ? -8.202  -41.833  24.540  1.00 33.89  ? 176  VAL A CA  1 
ATOM   1156  C C   . VAL A  1 176 ? -7.187  -42.689  25.294  1.00 34.56  ? 176  VAL A C   1 
ATOM   1157  O O   . VAL A  1 176 ? -6.836  -43.786  24.855  1.00 37.33  ? 176  VAL A O   1 
ATOM   1158  C CB  . VAL A  1 176 ? -7.461  -40.757  23.714  1.00 35.25  ? 176  VAL A CB  1 
ATOM   1159  C CG1 . VAL A  1 176 ? -6.259  -41.352  22.995  1.00 35.00  ? 176  VAL A CG1 1 
ATOM   1160  C CG2 . VAL A  1 176 ? -8.410  -40.105  22.721  1.00 36.04  ? 176  VAL A CG2 1 
ATOM   1161  N N   . ILE A  1 177 ? -6.733  -42.190  26.438  1.00 30.61  ? 177  ILE A N   1 
ATOM   1162  C CA  . ILE A  1 177 ? -5.756  -42.908  27.246  1.00 36.63  ? 177  ILE A CA  1 
ATOM   1163  C C   . ILE A  1 177 ? -6.326  -44.226  27.763  1.00 39.41  ? 177  ILE A C   1 
ATOM   1164  O O   . ILE A  1 177 ? -5.705  -45.277  27.612  1.00 37.85  ? 177  ILE A O   1 
ATOM   1165  C CB  . ILE A  1 177 ? -5.278  -42.061  28.437  1.00 38.53  ? 177  ILE A CB  1 
ATOM   1166  C CG1 . ILE A  1 177 ? -4.838  -40.676  27.959  1.00 41.17  ? 177  ILE A CG1 1 
ATOM   1167  C CG2 . ILE A  1 177 ? -4.144  -42.764  29.164  1.00 38.53  ? 177  ILE A CG2 1 
ATOM   1168  C CD1 . ILE A  1 177 ? -4.390  -39.758  29.073  1.00 42.47  ? 177  ILE A CD1 1 
ATOM   1169  N N   . GLY A  1 178 ? -7.511  -44.165  28.365  1.00 41.74  ? 178  GLY A N   1 
ATOM   1170  C CA  . GLY A  1 178 ? -8.177  -45.356  28.864  1.00 42.24  ? 178  GLY A CA  1 
ATOM   1171  C C   . GLY A  1 178 ? -8.554  -46.297  27.737  1.00 40.70  ? 178  GLY A C   1 
ATOM   1172  O O   . GLY A  1 178 ? -8.653  -47.510  27.924  1.00 39.20  ? 178  GLY A O   1 
ATOM   1173  N N   . LEU A  1 179 ? -8.765  -45.723  26.558  1.00 40.12  ? 179  LEU A N   1 
ATOM   1174  C CA  . LEU A  1 179 ? -9.052  -46.492  25.357  1.00 39.23  ? 179  LEU A CA  1 
ATOM   1175  C C   . LEU A  1 179 ? -7.827  -47.298  24.948  1.00 36.31  ? 179  LEU A C   1 
ATOM   1176  O O   . LEU A  1 179 ? -7.909  -48.504  24.717  1.00 40.15  ? 179  LEU A O   1 
ATOM   1177  C CB  . LEU A  1 179 ? -9.479  -45.555  24.225  1.00 45.22  ? 179  LEU A CB  1 
ATOM   1178  C CG  . LEU A  1 179 ? -10.282 -46.055  23.023  1.00 53.02  ? 179  LEU A CG  1 
ATOM   1179  C CD1 . LEU A  1 179 ? -10.834 -44.852  22.284  1.00 56.20  ? 179  LEU A CD1 1 
ATOM   1180  C CD2 . LEU A  1 179 ? -9.446  -46.911  22.084  1.00 54.07  ? 179  LEU A CD2 1 
ATOM   1181  N N   . THR A  1 180 ? -6.691  -46.614  24.863  1.00 31.44  ? 180  THR A N   1 
ATOM   1182  C CA  . THR A  1 180 ? -5.448  -47.221  24.408  1.00 34.17  ? 180  THR A CA  1 
ATOM   1183  C C   . THR A  1 180 ? -4.957  -48.285  25.384  1.00 35.35  ? 180  THR A C   1 
ATOM   1184  O O   . THR A  1 180 ? -4.413  -49.312  24.974  1.00 34.88  ? 180  THR A O   1 
ATOM   1185  C CB  . THR A  1 180 ? -4.350  -46.158  24.214  1.00 35.61  ? 180  THR A CB  1 
ATOM   1186  O OG1 . THR A  1 180 ? -4.861  -45.083  23.417  1.00 41.81  ? 180  THR A OG1 1 
ATOM   1187  C CG2 . THR A  1 180 ? -3.139  -46.756  23.526  1.00 36.20  ? 180  THR A CG2 1 
ATOM   1188  N N   . GLN A  1 181 ? -5.155  -48.031  26.674  1.00 35.78  ? 181  GLN A N   1 
ATOM   1189  C CA  . GLN A  1 181 ? -4.774  -48.978  27.717  1.00 31.45  ? 181  GLN A CA  1 
ATOM   1190  C C   . GLN A  1 181 ? -5.483  -50.313  27.535  1.00 35.65  ? 181  GLN A C   1 
ATOM   1191  O O   . GLN A  1 181 ? -4.864  -51.374  27.616  1.00 34.29  ? 181  GLN A O   1 
ATOM   1192  C CB  . GLN A  1 181 ? -5.089  -48.408  29.101  1.00 38.84  ? 181  GLN A CB  1 
ATOM   1193  C CG  . GLN A  1 181 ? -4.173  -47.278  29.536  1.00 42.67  ? 181  GLN A CG  1 
ATOM   1194  C CD  . GLN A  1 181 ? -4.612  -46.647  30.842  1.00 46.86  ? 181  GLN A CD  1 
ATOM   1195  O OE1 . GLN A  1 181 ? -5.806  -46.527  31.118  1.00 49.03  ? 181  GLN A OE1 1 
ATOM   1196  N NE2 . GLN A  1 181 ? -3.644  -46.245  31.659  1.00 48.05  ? 181  GLN A NE2 1 
ATOM   1197  N N   . THR A  1 182 ? -6.787  -50.247  27.288  1.00 35.42  ? 182  THR A N   1 
ATOM   1198  C CA  . THR A  1 182 ? -7.597  -51.441  27.083  1.00 38.42  ? 182  THR A CA  1 
ATOM   1199  C C   . THR A  1 182 ? -7.149  -52.197  25.838  1.00 41.16  ? 182  THR A C   1 
ATOM   1200  O O   . THR A  1 182 ? -7.052  -53.425  25.846  1.00 44.26  ? 182  THR A O   1 
ATOM   1201  C CB  . THR A  1 182 ? -9.089  -51.089  26.956  1.00 38.23  ? 182  THR A CB  1 
ATOM   1202  O OG1 . THR A  1 182 ? -9.542  -50.479  28.171  1.00 37.44  ? 182  THR A OG1 1 
ATOM   1203  C CG2 . THR A  1 182 ? -9.909  -52.338  26.685  1.00 40.61  ? 182  THR A CG2 1 
ATOM   1204  N N   . ALA A  1 183 ? -6.872  -51.452  24.773  1.00 37.35  ? 183  ALA A N   1 
ATOM   1205  C CA  . ALA A  1 183 ? -6.404  -52.040  23.524  1.00 37.55  ? 183  ALA A CA  1 
ATOM   1206  C C   . ALA A  1 183 ? -5.087  -52.777  23.730  1.00 39.07  ? 183  ALA A C   1 
ATOM   1207  O O   . ALA A  1 183 ? -4.894  -53.875  23.211  1.00 40.41  ? 183  ALA A O   1 
ATOM   1208  C CB  . ALA A  1 183 ? -6.249  -50.967  22.458  1.00 32.37  ? 183  ALA A CB  1 
ATOM   1209  N N   . ALA A  1 184 ? -4.190  -52.167  24.497  1.00 33.98  ? 184  ALA A N   1 
ATOM   1210  C CA  . ALA A  1 184 ? -2.882  -52.749  24.767  1.00 35.25  ? 184  ALA A CA  1 
ATOM   1211  C C   . ALA A  1 184 ? -2.999  -54.095  25.477  1.00 46.32  ? 184  ALA A C   1 
ATOM   1212  O O   . ALA A  1 184 ? -2.274  -55.038  25.161  1.00 51.60  ? 184  ALA A O   1 
ATOM   1213  C CB  . ALA A  1 184 ? -2.043  -51.790  25.592  1.00 34.75  ? 184  ALA A CB  1 
ATOM   1214  N N   . ARG A  1 185 ? -3.918  -54.179  26.433  1.00 45.41  ? 185  ARG A N   1 
ATOM   1215  C CA  . ARG A  1 185 ? -4.087  -55.395  27.219  1.00 44.70  ? 185  ARG A CA  1 
ATOM   1216  C C   . ARG A  1 185 ? -4.739  -56.505  26.397  1.00 47.09  ? 185  ARG A C   1 
ATOM   1217  O O   . ARG A  1 185 ? -4.540  -57.689  26.669  1.00 49.38  ? 185  ARG A O   1 
ATOM   1218  C CB  . ARG A  1 185 ? -4.920  -55.109  28.471  1.00 43.76  ? 185  ARG A CB  1 
ATOM   1219  C CG  . ARG A  1 185 ? -4.788  -56.157  29.566  1.00 49.67  ? 185  ARG A CG  1 
ATOM   1220  C CD  . ARG A  1 185 ? -6.049  -56.221  30.417  1.00 50.55  ? 185  ARG A CD  1 
ATOM   1221  N NE  . ARG A  1 185 ? -5.961  -57.204  31.496  1.00 54.77  ? 185  ARG A NE  1 
ATOM   1222  C CZ  . ARG A  1 185 ? -5.966  -58.523  31.319  1.00 60.80  ? 185  ARG A CZ  1 
ATOM   1223  N NH1 . ARG A  1 185 ? -6.039  -59.035  30.098  1.00 64.44  ? 185  ARG A NH1 1 
ATOM   1224  N NH2 . ARG A  1 185 ? -5.888  -59.334  32.364  1.00 62.39  ? 185  ARG A NH2 1 
ATOM   1225  N N   . GLU A  1 186 ? -5.513  -56.118  25.388  1.00 47.56  ? 186  GLU A N   1 
ATOM   1226  C CA  . GLU A  1 186 ? -6.235  -57.083  24.565  1.00 51.91  ? 186  GLU A CA  1 
ATOM   1227  C C   . GLU A  1 186 ? -5.459  -57.489  23.316  1.00 48.48  ? 186  GLU A C   1 
ATOM   1228  O O   . GLU A  1 186 ? -5.528  -58.639  22.883  1.00 43.55  ? 186  GLU A O   1 
ATOM   1229  C CB  . GLU A  1 186 ? -7.597  -56.520  24.154  1.00 57.35  ? 186  GLU A CB  1 
ATOM   1230  C CG  . GLU A  1 186 ? -8.544  -56.261  25.310  1.00 67.19  ? 186  GLU A CG  1 
ATOM   1231  C CD  . GLU A  1 186 ? -9.924  -55.835  24.846  1.00 75.31  ? 186  GLU A CD  1 
ATOM   1232  O OE1 . GLU A  1 186 ? -10.126 -55.706  23.621  1.00 74.89  ? 186  GLU A OE1 1 
ATOM   1233  O OE2 . GLU A  1 186 ? -10.806 -55.632  25.706  1.00 80.71  ? 186  GLU A OE2 1 
ATOM   1234  N N   . LEU A  1 187 ? -4.724  -56.544  22.740  1.00 44.32  ? 187  LEU A N   1 
ATOM   1235  C CA  . LEU A  1 187 ? -4.038  -56.778  21.473  1.00 44.33  ? 187  LEU A CA  1 
ATOM   1236  C C   . LEU A  1 187 ? -2.588  -57.207  21.658  1.00 42.57  ? 187  LEU A C   1 
ATOM   1237  O O   . LEU A  1 187 ? -1.857  -57.380  20.683  1.00 43.85  ? 187  LEU A O   1 
ATOM   1238  C CB  . LEU A  1 187 ? -4.095  -55.522  20.604  1.00 40.55  ? 187  LEU A CB  1 
ATOM   1239  C CG  . LEU A  1 187 ? -5.498  -55.023  20.264  1.00 41.35  ? 187  LEU A CG  1 
ATOM   1240  C CD1 . LEU A  1 187 ? -5.423  -53.670  19.580  1.00 39.61  ? 187  LEU A CD1 1 
ATOM   1241  C CD2 . LEU A  1 187 ? -6.233  -56.033  19.396  1.00 39.01  ? 187  LEU A CD2 1 
ATOM   1242  N N   . GLY A  1 188 ? -2.173  -57.378  22.908  1.00 43.98  ? 188  GLY A N   1 
ATOM   1243  C CA  . GLY A  1 188 ? -0.822  -57.818  23.199  1.00 50.91  ? 188  GLY A CA  1 
ATOM   1244  C C   . GLY A  1 188 ? -0.579  -59.240  22.732  1.00 58.93  ? 188  GLY A C   1 
ATOM   1245  O O   . GLY A  1 188 ? 0.556   -59.630  22.457  1.00 67.34  ? 188  GLY A O   1 
ATOM   1246  N N   . ARG A  1 189 ? -1.654  -60.015  22.639  1.00 63.79  ? 189  ARG A N   1 
ATOM   1247  C CA  . ARG A  1 189 ? -1.568  -61.409  22.218  1.00 69.78  ? 189  ARG A CA  1 
ATOM   1248  C C   . ARG A  1 189 ? -1.449  -61.537  20.702  1.00 70.26  ? 189  ARG A C   1 
ATOM   1249  O O   . ARG A  1 189 ? -1.148  -62.612  20.185  1.00 76.16  ? 189  ARG A O   1 
ATOM   1250  C CB  . ARG A  1 189 ? -2.787  -62.187  22.718  1.00 75.81  ? 189  ARG A CB  1 
ATOM   1251  C CG  . ARG A  1 189 ? -4.115  -61.490  22.470  1.00 79.14  ? 189  ARG A CG  1 
ATOM   1252  C CD  . ARG A  1 189 ? -5.269  -62.285  23.057  1.00 84.88  ? 189  ARG A CD  1 
ATOM   1253  N NE  . ARG A  1 189 ? -5.027  -62.634  24.454  1.00 90.47  ? 189  ARG A NE  1 
ATOM   1254  C CZ  . ARG A  1 189 ? -5.382  -61.880  25.491  1.00 91.99  ? 189  ARG A CZ  1 
ATOM   1255  N NH1 . ARG A  1 189 ? -6.002  -60.724  25.295  1.00 87.58  ? 189  ARG A NH1 1 
ATOM   1256  N NH2 . ARG A  1 189 ? -5.115  -62.284  26.725  1.00 95.36  ? 189  ARG A NH2 1 
ATOM   1257  N N   . HIS A  1 190 ? -1.688  -60.435  19.997  1.00 61.76  ? 190  HIS A N   1 
ATOM   1258  C CA  . HIS A  1 190 ? -1.585  -60.421  18.542  1.00 57.58  ? 190  HIS A CA  1 
ATOM   1259  C C   . HIS A  1 190 ? -0.324  -59.694  18.085  1.00 58.09  ? 190  HIS A C   1 
ATOM   1260  O O   . HIS A  1 190 ? -0.147  -59.427  16.896  1.00 59.81  ? 190  HIS A O   1 
ATOM   1261  C CB  . HIS A  1 190 ? -2.819  -59.764  17.919  1.00 54.06  ? 190  HIS A CB  1 
ATOM   1262  C CG  . HIS A  1 190 ? -4.108  -60.441  18.267  1.00 56.45  ? 190  HIS A CG  1 
ATOM   1263  N ND1 . HIS A  1 190 ? -5.007  -59.914  19.169  1.00 57.65  ? 190  HIS A ND1 1 
ATOM   1264  C CD2 . HIS A  1 190 ? -4.650  -61.604  17.833  1.00 58.93  ? 190  HIS A CD2 1 
ATOM   1265  C CE1 . HIS A  1 190 ? -6.047  -60.721  19.275  1.00 60.08  ? 190  HIS A CE1 1 
ATOM   1266  N NE2 . HIS A  1 190 ? -5.855  -61.754  18.475  1.00 60.60  ? 190  HIS A NE2 1 
ATOM   1267  N N   . GLY A  1 191 ? 0.548   -59.373  19.035  1.00 47.96  ? 191  GLY A N   1 
ATOM   1268  C CA  . GLY A  1 191 ? 1.786   -58.681  18.729  1.00 43.80  ? 191  GLY A CA  1 
ATOM   1269  C C   . GLY A  1 191 ? 1.565   -57.230  18.350  1.00 41.21  ? 191  GLY A C   1 
ATOM   1270  O O   . GLY A  1 191 ? 2.336   -56.653  17.583  1.00 35.73  ? 191  GLY A O   1 
ATOM   1271  N N   . ILE A  1 192 ? 0.507   -56.637  18.893  1.00 36.09  ? 192  ILE A N   1 
ATOM   1272  C CA  . ILE A  1 192 ? 0.169   -55.249  18.599  1.00 39.60  ? 192  ILE A CA  1 
ATOM   1273  C C   . ILE A  1 192 ? 0.341   -54.365  19.829  1.00 37.43  ? 192  ILE A C   1 
ATOM   1274  O O   . ILE A  1 192 ? -0.331  -54.557  20.842  1.00 33.86  ? 192  ILE A O   1 
ATOM   1275  C CB  . ILE A  1 192 ? -1.275  -55.120  18.083  1.00 41.01  ? 192  ILE A CB  1 
ATOM   1276  C CG1 . ILE A  1 192 ? -1.481  -56.009  16.855  1.00 37.39  ? 192  ILE A CG1 1 
ATOM   1277  C CG2 . ILE A  1 192 ? -1.600  -53.669  17.763  1.00 40.32  ? 192  ILE A CG2 1 
ATOM   1278  C CD1 . ILE A  1 192 ? -2.894  -55.993  16.320  1.00 38.85  ? 192  ILE A CD1 1 
ATOM   1279  N N   . ARG A  1 193 ? 1.245   -53.396  19.735  1.00 39.65  ? 193  ARG A N   1 
ATOM   1280  C CA  . ARG A  1 193 ? 1.509   -52.488  20.845  1.00 39.59  ? 193  ARG A CA  1 
ATOM   1281  C C   . ARG A  1 193 ? 0.674   -51.217  20.727  1.00 39.43  ? 193  ARG A C   1 
ATOM   1282  O O   . ARG A  1 193 ? 0.536   -50.651  19.643  1.00 40.49  ? 193  ARG A O   1 
ATOM   1283  C CB  . ARG A  1 193 ? 2.999   -52.139  20.910  1.00 41.21  ? 193  ARG A CB  1 
ATOM   1284  C CG  . ARG A  1 193 ? 3.899   -53.336  21.180  1.00 30.96  ? 193  ARG A CG  1 
ATOM   1285  C CD  . ARG A  1 193 ? 5.362   -52.935  21.303  1.00 37.55  ? 193  ARG A CD  1 
ATOM   1286  N NE  . ARG A  1 193 ? 5.924   -52.469  20.038  1.00 39.14  ? 193  ARG A NE  1 
ATOM   1287  C CZ  . ARG A  1 193 ? 6.144   -51.192  19.741  1.00 40.92  ? 193  ARG A CZ  1 
ATOM   1288  N NH1 . ARG A  1 193 ? 5.854   -50.244  20.621  1.00 37.57  ? 193  ARG A NH1 1 
ATOM   1289  N NH2 . ARG A  1 193 ? 6.660   -50.863  18.564  1.00 42.69  ? 193  ARG A NH2 1 
ATOM   1290  N N   . CYS A  1 194 ? 0.115   -50.778  21.850  1.00 36.99  ? 194  CYS A N   1 
ATOM   1291  C CA  . CYS A  1 194 ? -0.729  -49.589  21.873  1.00 33.42  ? 194  CYS A CA  1 
ATOM   1292  C C   . CYS A  1 194 ? -0.285  -48.620  22.964  1.00 31.77  ? 194  CYS A C   1 
ATOM   1293  O O   . CYS A  1 194 ? -0.316  -48.951  24.149  1.00 28.88  ? 194  CYS A O   1 
ATOM   1294  C CB  . CYS A  1 194 ? -2.195  -49.978  22.078  1.00 31.32  ? 194  CYS A CB  1 
ATOM   1295  S SG  . CYS A  1 194 ? -2.840  -51.147  20.857  1.00 61.40  ? 194  CYS A SG  1 
ATOM   1296  N N   . ASN A  1 195 ? 0.126   -47.423  22.558  1.00 26.99  ? 195  ASN A N   1 
ATOM   1297  C CA  . ASN A  1 195 ? 0.584   -46.411  23.503  1.00 33.24  ? 195  ASN A CA  1 
ATOM   1298  C C   . ASN A  1 195 ? -0.016  -45.040  23.224  1.00 29.93  ? 195  ASN A C   1 
ATOM   1299  O O   . ASN A  1 195 ? -0.519  -44.781  22.132  1.00 31.23  ? 195  ASN A O   1 
ATOM   1300  C CB  . ASN A  1 195 ? 2.110   -46.314  23.484  1.00 31.78  ? 195  ASN A CB  1 
ATOM   1301  C CG  . ASN A  1 195 ? 2.779   -47.585  23.960  1.00 35.55  ? 195  ASN A CG  1 
ATOM   1302  O OD1 . ASN A  1 195 ? 2.881   -47.831  25.160  1.00 37.96  ? 195  ASN A OD1 1 
ATOM   1303  N ND2 . ASN A  1 195 ? 3.243   -48.399  23.020  1.00 38.99  ? 195  ASN A ND2 1 
ATOM   1304  N N   . SER A  1 196 ? 0.045   -44.163  24.221  1.00 30.72  ? 196  SER A N   1 
ATOM   1305  C CA  . SER A  1 196 ? -0.486  -42.814  24.088  1.00 24.79  ? 196  SER A CA  1 
ATOM   1306  C C   . SER A  1 196 ? 0.611   -41.767  24.232  1.00 25.31  ? 196  SER A C   1 
ATOM   1307  O O   . SER A  1 196 ? 1.464   -41.862  25.114  1.00 25.00  ? 196  SER A O   1 
ATOM   1308  C CB  . SER A  1 196 ? -1.581  -42.562  25.126  1.00 33.62  ? 196  SER A CB  1 
ATOM   1309  O OG  . SER A  1 196 ? -2.696  -43.410  24.912  1.00 42.39  ? 196  SER A OG  1 
ATOM   1310  N N   . VAL A  1 197 ? 0.584   -40.772  23.354  1.00 26.32  ? 197  VAL A N   1 
ATOM   1311  C CA  . VAL A  1 197 ? 1.496   -39.641  23.453  1.00 27.56  ? 197  VAL A CA  1 
ATOM   1312  C C   . VAL A  1 197 ? 0.742   -38.445  24.015  1.00 22.77  ? 197  VAL A C   1 
ATOM   1313  O O   . VAL A  1 197 ? -0.321  -38.083  23.510  1.00 28.64  ? 197  VAL A O   1 
ATOM   1314  C CB  . VAL A  1 197 ? 2.111   -39.280  22.087  1.00 31.08  ? 197  VAL A CB  1 
ATOM   1315  C CG1 . VAL A  1 197 ? 3.088   -38.122  22.232  1.00 25.52  ? 197  VAL A CG1 1 
ATOM   1316  C CG2 . VAL A  1 197 ? 2.803   -40.490  21.483  1.00 33.83  ? 197  VAL A CG2 1 
ATOM   1317  N N   . LEU A  1 198 ? 1.284   -37.843  25.068  1.00 22.82  ? 198  LEU A N   1 
ATOM   1318  C CA  . LEU A  1 198 ? 0.627   -36.721  25.730  1.00 27.47  ? 198  LEU A CA  1 
ATOM   1319  C C   . LEU A  1 198 ? 1.454   -35.446  25.608  1.00 22.72  ? 198  LEU A C   1 
ATOM   1320  O O   . LEU A  1 198 ? 2.229   -35.116  26.504  1.00 27.03  ? 198  LEU A O   1 
ATOM   1321  C CB  . LEU A  1 198 ? 0.371   -37.038  27.207  1.00 27.98  ? 198  LEU A CB  1 
ATOM   1322  C CG  . LEU A  1 198 ? -0.818  -37.936  27.566  1.00 30.80  ? 198  LEU A CG  1 
ATOM   1323  C CD1 . LEU A  1 198 ? -0.594  -39.380  27.138  1.00 34.18  ? 198  LEU A CD1 1 
ATOM   1324  C CD2 . LEU A  1 198 ? -1.109  -37.859  29.057  1.00 30.65  ? 198  LEU A CD2 1 
ATOM   1325  N N   . PRO A  1 199 ? 1.287   -34.722  24.493  1.00 22.31  ? 199  PRO A N   1 
ATOM   1326  C CA  . PRO A  1 199 ? 2.063   -33.508  24.232  1.00 35.42  ? 199  PRO A CA  1 
ATOM   1327  C C   . PRO A  1 199 ? 1.550   -32.307  25.017  1.00 33.39  ? 199  PRO A C   1 
ATOM   1328  O O   . PRO A  1 199 ? 0.352   -32.212  25.281  1.00 30.17  ? 199  PRO A O   1 
ATOM   1329  C CB  . PRO A  1 199 ? 1.874   -33.283  22.722  1.00 34.40  ? 199  PRO A CB  1 
ATOM   1330  C CG  . PRO A  1 199 ? 1.164   -34.514  22.206  1.00 32.46  ? 199  PRO A CG  1 
ATOM   1331  C CD  . PRO A  1 199 ? 0.401   -35.045  23.367  1.00 22.24  ? 199  PRO A CD  1 
ATOM   1332  N N   . GLY A  1 200 ? 2.453   -31.404  25.385  1.00 36.90  ? 200  GLY A N   1 
ATOM   1333  C CA  . GLY A  1 200 ? 2.067   -30.144  25.992  1.00 34.84  ? 200  GLY A CA  1 
ATOM   1334  C C   . GLY A  1 200 ? 1.622   -29.186  24.906  1.00 34.58  ? 200  GLY A C   1 
ATOM   1335  O O   . GLY A  1 200 ? 0.946   -29.589  23.966  1.00 34.57  ? 200  GLY A O   1 
ATOM   1336  N N   . PHE A  1 201 ? 2.005   -27.920  25.017  1.00 35.93  ? 201  PHE A N   1 
ATOM   1337  C CA  . PHE A  1 201 ? 1.660   -26.953  23.982  1.00 36.46  ? 201  PHE A CA  1 
ATOM   1338  C C   . PHE A  1 201 ? 2.719   -26.922  22.885  1.00 43.34  ? 201  PHE A C   1 
ATOM   1339  O O   . PHE A  1 201 ? 3.860   -26.521  23.115  1.00 48.83  ? 201  PHE A O   1 
ATOM   1340  C CB  . PHE A  1 201 ? 1.468   -25.563  24.588  1.00 34.35  ? 201  PHE A CB  1 
ATOM   1341  C CG  . PHE A  1 201 ? 0.165   -25.401  25.316  1.00 38.31  ? 201  PHE A CG  1 
ATOM   1342  C CD1 . PHE A  1 201 ? -0.998  -25.117  24.619  1.00 40.87  ? 201  PHE A CD1 1 
ATOM   1343  C CD2 . PHE A  1 201 ? 0.099   -25.541  26.692  1.00 38.21  ? 201  PHE A CD2 1 
ATOM   1344  C CE1 . PHE A  1 201 ? -2.202  -24.970  25.282  1.00 43.15  ? 201  PHE A CE1 1 
ATOM   1345  C CE2 . PHE A  1 201 ? -1.102  -25.394  27.361  1.00 39.43  ? 201  PHE A CE2 1 
ATOM   1346  C CZ  . PHE A  1 201 ? -2.254  -25.108  26.655  1.00 42.03  ? 201  PHE A CZ  1 
ATOM   1347  N N   . ILE A  1 202 ? 2.328   -27.357  21.691  1.00 46.58  ? 202  ILE A N   1 
ATOM   1348  C CA  . ILE A  1 202 ? 3.247   -27.469  20.564  1.00 46.42  ? 202  ILE A CA  1 
ATOM   1349  C C   . ILE A  1 202 ? 2.836   -26.527  19.432  1.00 44.62  ? 202  ILE A C   1 
ATOM   1350  O O   . ILE A  1 202 ? 1.655   -26.417  19.102  1.00 44.91  ? 202  ILE A O   1 
ATOM   1351  C CB  . ILE A  1 202 ? 3.320   -28.930  20.042  1.00 34.99  ? 202  ILE A CB  1 
ATOM   1352  C CG1 . ILE A  1 202 ? 4.263   -29.768  20.910  1.00 37.23  ? 202  ILE A CG1 1 
ATOM   1353  C CG2 . ILE A  1 202 ? 3.805   -28.979  18.604  1.00 33.46  ? 202  ILE A CG2 1 
ATOM   1354  C CD1 . ILE A  1 202 ? 3.678   -30.208  22.231  1.00 35.52  ? 202  ILE A CD1 1 
ATOM   1355  N N   . ALA A  1 203 ? 3.820   -25.842  18.853  1.00 44.04  ? 203  ALA A N   1 
ATOM   1356  C CA  . ALA A  1 203 ? 3.580   -24.887  17.775  1.00 43.08  ? 203  ALA A CA  1 
ATOM   1357  C C   . ALA A  1 203 ? 2.922   -25.533  16.557  1.00 41.71  ? 203  ALA A C   1 
ATOM   1358  O O   . ALA A  1 203 ? 3.599   -25.932  15.609  1.00 48.47  ? 203  ALA A O   1 
ATOM   1359  C CB  . ALA A  1 203 ? 4.885   -24.216  17.370  1.00 43.16  ? 203  ALA A CB  1 
ATOM   1360  N N   . THR A  1 204 ? 1.597   -25.631  16.598  1.00 35.05  ? 204  THR A N   1 
ATOM   1361  C CA  . THR A  1 204 ? 0.809   -26.125  15.474  1.00 36.41  ? 204  THR A CA  1 
ATOM   1362  C C   . THR A  1 204 ? -0.289  -25.110  15.160  1.00 37.41  ? 204  THR A C   1 
ATOM   1363  O O   . THR A  1 204 ? -0.532  -24.205  15.959  1.00 38.48  ? 204  THR A O   1 
ATOM   1364  C CB  . THR A  1 204 ? 0.180   -27.504  15.776  1.00 34.41  ? 204  THR A CB  1 
ATOM   1365  O OG1 . THR A  1 204 ? -0.710  -27.396  16.894  1.00 34.31  ? 204  THR A OG1 1 
ATOM   1366  C CG2 . THR A  1 204 ? 1.253   -28.537  16.077  1.00 30.95  ? 204  THR A CG2 1 
ATOM   1367  N N   . PRO A  1 205 ? -0.948  -25.242  13.994  1.00 37.65  ? 205  PRO A N   1 
ATOM   1368  C CA  . PRO A  1 205 ? -2.098  -24.378  13.701  1.00 38.70  ? 205  PRO A CA  1 
ATOM   1369  C C   . PRO A  1 205 ? -3.177  -24.407  14.786  1.00 37.22  ? 205  PRO A C   1 
ATOM   1370  O O   . PRO A  1 205 ? -3.929  -23.442  14.918  1.00 37.19  ? 205  PRO A O   1 
ATOM   1371  C CB  . PRO A  1 205 ? -2.633  -24.954  12.391  1.00 40.61  ? 205  PRO A CB  1 
ATOM   1372  C CG  . PRO A  1 205 ? -1.419  -25.473  11.712  1.00 43.39  ? 205  PRO A CG  1 
ATOM   1373  C CD  . PRO A  1 205 ? -0.538  -26.019  12.807  1.00 37.79  ? 205  PRO A CD  1 
ATOM   1374  N N   . MET A  1 206 ? -3.248  -25.495  15.547  1.00 33.34  ? 206  MET A N   1 
ATOM   1375  C CA  . MET A  1 206 ? -4.185  -25.584  16.659  1.00 32.17  ? 206  MET A CA  1 
ATOM   1376  C C   . MET A  1 206 ? -3.814  -24.595  17.760  1.00 31.32  ? 206  MET A C   1 
ATOM   1377  O O   . MET A  1 206 ? -4.682  -23.946  18.343  1.00 33.46  ? 206  MET A O   1 
ATOM   1378  C CB  . MET A  1 206 ? -4.227  -27.007  17.220  1.00 30.14  ? 206  MET A CB  1 
ATOM   1379  C CG  . MET A  1 206 ? -5.058  -27.146  18.489  1.00 34.36  ? 206  MET A CG  1 
ATOM   1380  S SD  . MET A  1 206 ? -5.239  -28.852  19.046  1.00 59.71  ? 206  MET A SD  1 
ATOM   1381  C CE  . MET A  1 206 ? -6.250  -29.531  17.733  1.00 45.00  ? 206  MET A CE  1 
ATOM   1382  N N   . THR A  1 207 ? -2.518  -24.482  18.035  1.00 35.25  ? 207  THR A N   1 
ATOM   1383  C CA  . THR A  1 207 ? -2.028  -23.572  19.064  1.00 39.02  ? 207  THR A CA  1 
ATOM   1384  C C   . THR A  1 207 ? -2.092  -22.125  18.575  1.00 44.09  ? 207  THR A C   1 
ATOM   1385  O O   . THR A  1 207 ? -2.144  -21.188  19.372  1.00 47.15  ? 207  THR A O   1 
ATOM   1386  C CB  . THR A  1 207 ? -0.583  -23.922  19.481  1.00 39.29  ? 207  THR A CB  1 
ATOM   1387  O OG1 . THR A  1 207 ? -0.496  -25.323  19.767  1.00 45.21  ? 207  THR A OG1 1 
ATOM   1388  C CG2 . THR A  1 207 ? -0.166  -23.136  20.717  1.00 37.92  ? 207  THR A CG2 1 
ATOM   1389  N N   . GLN A  1 208 ? -2.108  -21.948  17.258  1.00 38.84  ? 208  GLN A N   1 
ATOM   1390  C CA  . GLN A  1 208 ? -2.221  -20.617  16.672  1.00 38.66  ? 208  GLN A CA  1 
ATOM   1391  C C   . GLN A  1 208 ? -3.611  -20.033  16.899  1.00 38.08  ? 208  GLN A C   1 
ATOM   1392  O O   . GLN A  1 208 ? -3.830  -18.836  16.708  1.00 38.65  ? 208  GLN A O   1 
ATOM   1393  C CB  . GLN A  1 208 ? -1.903  -20.659  15.177  1.00 39.31  ? 208  GLN A CB  1 
ATOM   1394  C CG  . GLN A  1 208 ? -0.470  -21.051  14.866  1.00 42.25  ? 208  GLN A CG  1 
ATOM   1395  C CD  . GLN A  1 208 ? -0.184  -21.075  13.379  1.00 48.58  ? 208  GLN A CD  1 
ATOM   1396  O OE1 . GLN A  1 208 ? -1.051  -20.765  12.563  1.00 50.76  ? 208  GLN A OE1 1 
ATOM   1397  N NE2 . GLN A  1 208 ? 1.039   -21.447  13.018  1.00 51.34  ? 208  GLN A NE2 1 
ATOM   1398  N N   . LYS A  1 209 ? -4.547  -20.885  17.310  1.00 35.74  ? 209  LYS A N   1 
ATOM   1399  C CA  . LYS A  1 209 ? -5.900  -20.447  17.632  1.00 39.46  ? 209  LYS A CA  1 
ATOM   1400  C C   . LYS A  1 209 ? -5.961  -19.908  19.059  1.00 36.62  ? 209  LYS A C   1 
ATOM   1401  O O   . LYS A  1 209 ? -7.013  -19.472  19.527  1.00 32.85  ? 209  LYS A O   1 
ATOM   1402  C CB  . LYS A  1 209 ? -6.895  -21.596  17.453  1.00 43.35  ? 209  LYS A CB  1 
ATOM   1403  C CG  . LYS A  1 209 ? -6.850  -22.241  16.076  1.00 49.43  ? 209  LYS A CG  1 
ATOM   1404  C CD  . LYS A  1 209 ? -7.881  -23.350  15.944  1.00 52.15  ? 209  LYS A CD  1 
ATOM   1405  C CE  . LYS A  1 209 ? -9.295  -22.794  15.965  1.00 55.94  ? 209  LYS A CE  1 
ATOM   1406  N NZ  . LYS A  1 209 ? -10.315 -23.876  15.900  1.00 58.21  ? 209  LYS A NZ  1 
ATOM   1407  N N   . VAL A  1 210 ? -4.823  -19.950  19.744  1.00 35.35  ? 210  VAL A N   1 
ATOM   1408  C CA  . VAL A  1 210 ? -4.697  -19.380  21.079  1.00 36.57  ? 210  VAL A CA  1 
ATOM   1409  C C   . VAL A  1 210 ? -4.101  -17.979  20.981  1.00 40.12  ? 210  VAL A C   1 
ATOM   1410  O O   . VAL A  1 210 ? -3.089  -17.785  20.307  1.00 43.16  ? 210  VAL A O   1 
ATOM   1411  C CB  . VAL A  1 210 ? -3.814  -20.259  21.987  1.00 35.97  ? 210  VAL A CB  1 
ATOM   1412  C CG1 . VAL A  1 210 ? -3.739  -19.683  23.394  1.00 38.45  ? 210  VAL A CG1 1 
ATOM   1413  C CG2 . VAL A  1 210 ? -4.338  -21.686  22.014  1.00 35.65  ? 210  VAL A CG2 1 
ATOM   1414  N N   . PRO A  1 211 ? -4.738  -16.995  21.640  1.00 41.89  ? 211  PRO A N   1 
ATOM   1415  C CA  . PRO A  1 211 ? -4.265  -15.606  21.650  1.00 42.82  ? 211  PRO A CA  1 
ATOM   1416  C C   . PRO A  1 211 ? -2.785  -15.491  22.013  1.00 49.34  ? 211  PRO A C   1 
ATOM   1417  O O   . PRO A  1 211 ? -2.312  -16.211  22.891  1.00 56.01  ? 211  PRO A O   1 
ATOM   1418  C CB  . PRO A  1 211 ? -5.142  -14.948  22.716  1.00 42.76  ? 211  PRO A CB  1 
ATOM   1419  C CG  . PRO A  1 211 ? -6.406  -15.730  22.678  1.00 43.15  ? 211  PRO A CG  1 
ATOM   1420  C CD  . PRO A  1 211 ? -6.004  -17.149  22.381  1.00 41.27  ? 211  PRO A CD  1 
ATOM   1421  N N   . GLN A  1 212 ? -2.076  -14.595  21.333  1.00 47.23  ? 212  GLN A N   1 
ATOM   1422  C CA  . GLN A  1 212 ? -0.630  -14.455  21.488  1.00 46.53  ? 212  GLN A CA  1 
ATOM   1423  C C   . GLN A  1 212 ? -0.216  -14.145  22.925  1.00 46.69  ? 212  GLN A C   1 
ATOM   1424  O O   . GLN A  1 212 ? 0.814   -14.624  23.400  1.00 50.56  ? 212  GLN A O   1 
ATOM   1425  C CB  . GLN A  1 212 ? -0.106  -13.360  20.555  1.00 46.36  ? 212  GLN A CB  1 
ATOM   1426  C CG  . GLN A  1 212 ? 1.406   -13.195  20.570  1.00 48.87  ? 212  GLN A CG  1 
ATOM   1427  C CD  . GLN A  1 212 ? 2.128   -14.355  19.911  1.00 46.07  ? 212  GLN A CD  1 
ATOM   1428  O OE1 . GLN A  1 212 ? 1.682   -14.881  18.891  1.00 47.82  ? 212  GLN A OE1 1 
ATOM   1429  N NE2 . GLN A  1 212 ? 3.250   -14.763  20.495  1.00 41.67  ? 212  GLN A NE2 1 
ATOM   1430  N N   . LYS A  1 213 ? -1.023  -13.349  23.617  1.00 46.09  ? 213  LYS A N   1 
ATOM   1431  C CA  . LYS A  1 213 ? -0.684  -12.925  24.970  1.00 47.62  ? 213  LYS A CA  1 
ATOM   1432  C C   . LYS A  1 213 ? -1.043  -14.006  25.985  1.00 44.34  ? 213  LYS A C   1 
ATOM   1433  O O   . LYS A  1 213 ? -0.566  -13.988  27.120  1.00 46.58  ? 213  LYS A O   1 
ATOM   1434  C CB  . LYS A  1 213 ? -1.380  -11.605  25.311  1.00 53.33  ? 213  LYS A CB  1 
ATOM   1435  C CG  . LYS A  1 213 ? -0.570  -10.364  24.938  1.00 58.68  ? 213  LYS A CG  1 
ATOM   1436  C CD  . LYS A  1 213 ? -0.200  -10.347  23.461  1.00 62.84  ? 213  LYS A CD  1 
ATOM   1437  C CE  . LYS A  1 213 ? 0.800   -9.252   23.137  1.00 67.28  ? 213  LYS A CE  1 
ATOM   1438  N NZ  . LYS A  1 213 ? 1.279   -9.358   21.731  1.00 70.06  ? 213  LYS A NZ  1 
ATOM   1439  N N   . VAL A  1 214 ? -1.887  -14.944  25.569  1.00 41.59  ? 214  VAL A N   1 
ATOM   1440  C CA  . VAL A  1 214 ? -2.148  -16.139  26.361  1.00 39.99  ? 214  VAL A CA  1 
ATOM   1441  C C   . VAL A  1 214 ? -1.001  -17.117  26.143  1.00 39.79  ? 214  VAL A C   1 
ATOM   1442  O O   . VAL A  1 214 ? -0.543  -17.779  27.075  1.00 40.18  ? 214  VAL A O   1 
ATOM   1443  C CB  . VAL A  1 214 ? -3.487  -16.803  25.983  1.00 39.85  ? 214  VAL A CB  1 
ATOM   1444  C CG1 . VAL A  1 214 ? -3.697  -18.082  26.782  1.00 38.35  ? 214  VAL A CG1 1 
ATOM   1445  C CG2 . VAL A  1 214 ? -4.636  -15.838  26.208  1.00 40.12  ? 214  VAL A CG2 1 
ATOM   1446  N N   . VAL A  1 215 ? -0.536  -17.186  24.898  1.00 36.63  ? 215  VAL A N   1 
ATOM   1447  C CA  . VAL A  1 215 ? 0.604   -18.018  24.532  1.00 36.48  ? 215  VAL A CA  1 
ATOM   1448  C C   . VAL A  1 215 ? 1.861   -17.592  25.285  1.00 40.42  ? 215  VAL A C   1 
ATOM   1449  O O   . VAL A  1 215 ? 2.573   -18.430  25.841  1.00 43.11  ? 215  VAL A O   1 
ATOM   1450  C CB  . VAL A  1 215 ? 0.872   -17.960  23.014  1.00 34.56  ? 215  VAL A CB  1 
ATOM   1451  C CG1 . VAL A  1 215 ? 2.218   -18.587  22.679  1.00 33.27  ? 215  VAL A CG1 1 
ATOM   1452  C CG2 . VAL A  1 215 ? -0.249  -18.647  22.250  1.00 36.09  ? 215  VAL A CG2 1 
ATOM   1453  N N   . ASP A  1 216 ? 2.125   -16.288  25.306  1.00 42.70  ? 216  ASP A N   1 
ATOM   1454  C CA  . ASP A  1 216 ? 3.290   -15.750  26.003  1.00 48.51  ? 216  ASP A CA  1 
ATOM   1455  C C   . ASP A  1 216 ? 3.243   -16.066  27.495  1.00 48.04  ? 216  ASP A C   1 
ATOM   1456  O O   . ASP A  1 216 ? 4.278   -16.285  28.125  1.00 49.26  ? 216  ASP A O   1 
ATOM   1457  C CB  . ASP A  1 216 ? 3.393   -14.237  25.792  1.00 55.71  ? 216  ASP A CB  1 
ATOM   1458  C CG  . ASP A  1 216 ? 3.711   -13.867  24.355  1.00 63.14  ? 216  ASP A CG  1 
ATOM   1459  O OD1 . ASP A  1 216 ? 4.229   -14.732  23.617  1.00 64.58  ? 216  ASP A OD1 1 
ATOM   1460  O OD2 . ASP A  1 216 ? 3.448   -12.710  23.965  1.00 66.56  ? 216  ASP A OD2 1 
ATOM   1461  N N   . LYS A  1 217 ? 2.038   -16.093  28.054  1.00 45.43  ? 217  LYS A N   1 
ATOM   1462  C CA  . LYS A  1 217 ? 1.856   -16.427  29.461  1.00 43.59  ? 217  LYS A CA  1 
ATOM   1463  C C   . LYS A  1 217 ? 1.999   -17.929  29.686  1.00 40.41  ? 217  LYS A C   1 
ATOM   1464  O O   . LYS A  1 217 ? 2.440   -18.366  30.747  1.00 44.89  ? 217  LYS A O   1 
ATOM   1465  C CB  . LYS A  1 217 ? 0.491   -15.945  29.957  1.00 42.34  ? 217  LYS A CB  1 
ATOM   1466  N N   . ILE A  1 218 ? 1.621   -18.717  28.686  1.00 39.48  ? 218  ILE A N   1 
ATOM   1467  C CA  . ILE A  1 218 ? 1.774   -20.166  28.761  1.00 42.40  ? 218  ILE A CA  1 
ATOM   1468  C C   . ILE A  1 218 ? 3.252   -20.543  28.710  1.00 46.48  ? 218  ILE A C   1 
ATOM   1469  O O   . ILE A  1 218 ? 3.703   -21.431  29.435  1.00 50.02  ? 218  ILE A O   1 
ATOM   1470  C CB  . ILE A  1 218 ? 1.010   -20.878  27.622  1.00 37.45  ? 218  ILE A CB  1 
ATOM   1471  C CG1 . ILE A  1 218 ? -0.496  -20.833  27.885  1.00 36.05  ? 218  ILE A CG1 1 
ATOM   1472  C CG2 . ILE A  1 218 ? 1.460   -22.324  27.486  1.00 34.89  ? 218  ILE A CG2 1 
ATOM   1473  C CD1 . ILE A  1 218 ? -1.324  -21.498  26.805  1.00 36.61  ? 218  ILE A CD1 1 
ATOM   1474  N N   . THR A  1 219 ? 4.005   -19.848  27.862  1.00 43.36  ? 219  THR A N   1 
ATOM   1475  C CA  . THR A  1 219 ? 5.435   -20.097  27.718  1.00 46.25  ? 219  THR A CA  1 
ATOM   1476  C C   . THR A  1 219 ? 6.197   -19.813  29.010  1.00 44.14  ? 219  THR A C   1 
ATOM   1477  O O   . THR A  1 219 ? 7.226   -20.432  29.280  1.00 41.03  ? 219  THR A O   1 
ATOM   1478  C CB  . THR A  1 219 ? 6.042   -19.249  26.586  1.00 50.94  ? 219  THR A CB  1 
ATOM   1479  O OG1 . THR A  1 219 ? 5.743   -17.866  26.810  1.00 58.95  ? 219  THR A OG1 1 
ATOM   1480  C CG2 . THR A  1 219 ? 5.478   -19.675  25.239  1.00 44.08  ? 219  THR A CG2 1 
ATOM   1481  N N   . GLU A  1 220 ? 5.689   -18.876  29.806  1.00 45.03  ? 220  GLU A N   1 
ATOM   1482  C CA  . GLU A  1 220 ? 6.306   -18.557  31.088  1.00 52.88  ? 220  GLU A CA  1 
ATOM   1483  C C   . GLU A  1 220 ? 5.991   -19.651  32.104  1.00 54.00  ? 220  GLU A C   1 
ATOM   1484  O O   . GLU A  1 220 ? 6.699   -19.812  33.097  1.00 60.95  ? 220  GLU A O   1 
ATOM   1485  C CB  . GLU A  1 220 ? 5.829   -17.194  31.599  1.00 63.07  ? 220  GLU A CB  1 
ATOM   1486  C CG  . GLU A  1 220 ? 4.694   -17.265  32.610  1.00 73.53  ? 220  GLU A CG  1 
ATOM   1487  C CD  . GLU A  1 220 ? 4.001   -15.931  32.811  1.00 83.19  ? 220  GLU A CD  1 
ATOM   1488  O OE1 . GLU A  1 220 ? 4.490   -14.916  32.271  1.00 84.57  ? 220  GLU A OE1 1 
ATOM   1489  O OE2 . GLU A  1 220 ? 2.963   -15.899  33.506  1.00 86.93  ? 220  GLU A OE2 1 
ATOM   1490  N N   . MET A  1 221 ? 4.925   -20.402  31.843  1.00 49.72  ? 221  MET A N   1 
ATOM   1491  C CA  . MET A  1 221 ? 4.529   -21.506  32.710  1.00 47.32  ? 221  MET A CA  1 
ATOM   1492  C C   . MET A  1 221 ? 5.342   -22.755  32.402  1.00 44.48  ? 221  MET A C   1 
ATOM   1493  O O   . MET A  1 221 ? 5.784   -23.458  33.310  1.00 50.71  ? 221  MET A O   1 
ATOM   1494  C CB  . MET A  1 221 ? 3.038   -21.807  32.558  1.00 50.34  ? 221  MET A CB  1 
ATOM   1495  C CG  . MET A  1 221 ? 2.121   -20.685  33.004  1.00 56.34  ? 221  MET A CG  1 
ATOM   1496  S SD  . MET A  1 221 ? 0.387   -21.094  32.733  1.00 63.97  ? 221  MET A SD  1 
ATOM   1497  C CE  . MET A  1 221 ? 0.262   -22.632  33.643  1.00 52.80  ? 221  MET A CE  1 
ATOM   1498  N N   . ILE A  1 222 ? 5.526   -23.027  31.114  1.00 40.87  ? 222  ILE A N   1 
ATOM   1499  C CA  . ILE A  1 222 ? 6.309   -24.174  30.673  1.00 44.10  ? 222  ILE A CA  1 
ATOM   1500  C C   . ILE A  1 222 ? 7.739   -24.067  31.191  1.00 51.52  ? 222  ILE A C   1 
ATOM   1501  O O   . ILE A  1 222 ? 8.428   -23.084  30.914  1.00 57.24  ? 222  ILE A O   1 
ATOM   1502  C CB  . ILE A  1 222 ? 6.328   -24.293  29.137  1.00 36.36  ? 222  ILE A CB  1 
ATOM   1503  C CG1 . ILE A  1 222 ? 4.902   -24.287  28.584  1.00 32.76  ? 222  ILE A CG1 1 
ATOM   1504  C CG2 . ILE A  1 222 ? 7.064   -25.552  28.708  1.00 33.47  ? 222  ILE A CG2 1 
ATOM   1505  C CD1 . ILE A  1 222 ? 4.831   -24.197  27.076  1.00 27.17  ? 222  ILE A CD1 1 
ATOM   1506  N N   . PRO A  1 223 ? 8.179   -25.074  31.961  1.00 51.47  ? 223  PRO A N   1 
ATOM   1507  C CA  . PRO A  1 223 ? 9.510   -25.114  32.577  1.00 49.73  ? 223  PRO A CA  1 
ATOM   1508  C C   . PRO A  1 223 ? 10.643  -24.841  31.590  1.00 46.48  ? 223  PRO A C   1 
ATOM   1509  O O   . PRO A  1 223 ? 11.563  -24.096  31.921  1.00 47.63  ? 223  PRO A O   1 
ATOM   1510  C CB  . PRO A  1 223 ? 9.592   -26.540  33.122  1.00 48.25  ? 223  PRO A CB  1 
ATOM   1511  C CG  . PRO A  1 223 ? 8.184   -26.883  33.435  1.00 46.46  ? 223  PRO A CG  1 
ATOM   1512  C CD  . PRO A  1 223 ? 7.367   -26.243  32.345  1.00 46.33  ? 223  PRO A CD  1 
ATOM   1513  N N   . MET A  1 224 ? 10.573  -25.427  30.398  1.00 44.99  ? 224  MET A N   1 
ATOM   1514  C CA  . MET A  1 224 ? 11.600  -25.208  29.384  1.00 44.84  ? 224  MET A CA  1 
ATOM   1515  C C   . MET A  1 224 ? 11.576  -23.775  28.859  1.00 47.25  ? 224  MET A C   1 
ATOM   1516  O O   . MET A  1 224 ? 12.591  -23.262  28.388  1.00 51.43  ? 224  MET A O   1 
ATOM   1517  C CB  . MET A  1 224 ? 11.435  -26.195  28.229  1.00 39.75  ? 224  MET A CB  1 
ATOM   1518  C CG  . MET A  1 224 ? 11.805  -27.622  28.585  1.00 37.40  ? 224  MET A CG  1 
ATOM   1519  S SD  . MET A  1 224 ? 11.895  -28.690  27.138  1.00 89.79  ? 224  MET A SD  1 
ATOM   1520  C CE  . MET A  1 224 ? 12.370  -30.237  27.899  1.00 40.93  ? 224  MET A CE  1 
ATOM   1521  N N   . GLY A  1 225 ? 10.414  -23.136  28.936  1.00 45.01  ? 225  GLY A N   1 
ATOM   1522  C CA  . GLY A  1 225 ? 10.292  -21.733  28.585  1.00 47.41  ? 225  GLY A CA  1 
ATOM   1523  C C   . GLY A  1 225 ? 10.013  -21.466  27.119  1.00 46.87  ? 225  GLY A C   1 
ATOM   1524  O O   . GLY A  1 225 ? 10.285  -20.372  26.622  1.00 48.31  ? 225  GLY A O   1 
ATOM   1525  N N   . HIS A  1 226 ? 9.469   -22.461  26.426  1.00 42.85  ? 226  HIS A N   1 
ATOM   1526  C CA  . HIS A  1 226 ? 9.114   -22.307  25.019  1.00 44.66  ? 226  HIS A CA  1 
ATOM   1527  C C   . HIS A  1 226 ? 8.127   -23.379  24.573  1.00 45.47  ? 226  HIS A C   1 
ATOM   1528  O O   . HIS A  1 226 ? 8.063   -24.459  25.161  1.00 48.09  ? 226  HIS A O   1 
ATOM   1529  C CB  . HIS A  1 226 ? 10.367  -22.347  24.138  1.00 47.03  ? 226  HIS A CB  1 
ATOM   1530  C CG  . HIS A  1 226 ? 11.172  -23.602  24.281  1.00 50.16  ? 226  HIS A CG  1 
ATOM   1531  N ND1 . HIS A  1 226 ? 10.760  -24.814  23.770  1.00 47.87  ? 226  HIS A ND1 1 
ATOM   1532  C CD2 . HIS A  1 226 ? 12.368  -23.831  24.872  1.00 52.70  ? 226  HIS A CD2 1 
ATOM   1533  C CE1 . HIS A  1 226 ? 11.666  -25.736  24.043  1.00 45.90  ? 226  HIS A CE1 1 
ATOM   1534  N NE2 . HIS A  1 226 ? 12.652  -25.166  24.711  1.00 51.83  ? 226  HIS A NE2 1 
ATOM   1535  N N   . LEU A  1 227 ? 7.356   -23.073  23.534  1.00 46.30  ? 227  LEU A N   1 
ATOM   1536  C CA  . LEU A  1 227 ? 6.435   -24.042  22.954  1.00 42.50  ? 227  LEU A CA  1 
ATOM   1537  C C   . LEU A  1 227 ? 7.206   -25.192  22.321  1.00 41.41  ? 227  LEU A C   1 
ATOM   1538  O O   . LEU A  1 227 ? 8.347   -25.022  21.890  1.00 47.65  ? 227  LEU A O   1 
ATOM   1539  C CB  . LEU A  1 227 ? 5.533   -23.385  21.907  1.00 46.25  ? 227  LEU A CB  1 
ATOM   1540  C CG  . LEU A  1 227 ? 4.540   -22.319  22.373  1.00 49.00  ? 227  LEU A CG  1 
ATOM   1541  C CD1 . LEU A  1 227 ? 3.688   -21.847  21.203  1.00 48.11  ? 227  LEU A CD1 1 
ATOM   1542  C CD2 . LEU A  1 227 ? 3.665   -22.849  23.496  1.00 47.71  ? 227  LEU A CD2 1 
ATOM   1543  N N   . GLY A  1 228 ? 6.579   -26.361  22.264  1.00 33.25  ? 228  GLY A N   1 
ATOM   1544  C CA  . GLY A  1 228 ? 7.199   -27.514  21.642  1.00 33.53  ? 228  GLY A CA  1 
ATOM   1545  C C   . GLY A  1 228 ? 7.103   -27.459  20.132  1.00 32.59  ? 228  GLY A C   1 
ATOM   1546  O O   . GLY A  1 228 ? 6.234   -26.788  19.577  1.00 30.99  ? 228  GLY A O   1 
ATOM   1547  N N   . ASP A  1 229 ? 8.010   -28.159  19.463  1.00 33.39  ? 229  ASP A N   1 
ATOM   1548  C CA  . ASP A  1 229 ? 7.948   -28.287  18.016  1.00 39.15  ? 229  ASP A CA  1 
ATOM   1549  C C   . ASP A  1 229 ? 7.242   -29.584  17.652  1.00 37.42  ? 229  ASP A C   1 
ATOM   1550  O O   . ASP A  1 229 ? 7.299   -30.555  18.405  1.00 32.77  ? 229  ASP A O   1 
ATOM   1551  C CB  . ASP A  1 229 ? 9.350   -28.244  17.404  1.00 46.58  ? 229  ASP A CB  1 
ATOM   1552  C CG  . ASP A  1 229 ? 9.973   -26.866  17.474  1.00 61.56  ? 229  ASP A CG  1 
ATOM   1553  O OD1 . ASP A  1 229 ? 9.216   -25.873  17.508  1.00 69.80  ? 229  ASP A OD1 1 
ATOM   1554  O OD2 . ASP A  1 229 ? 11.218  -26.774  17.492  1.00 62.66  ? 229  ASP A OD2 1 
ATOM   1555  N N   . PRO A  1 230 ? 6.554   -29.598  16.502  1.00 36.78  ? 230  PRO A N   1 
ATOM   1556  C CA  . PRO A  1 230 ? 5.905   -30.820  16.014  1.00 36.56  ? 230  PRO A CA  1 
ATOM   1557  C C   . PRO A  1 230 ? 6.901   -31.966  15.825  1.00 37.77  ? 230  PRO A C   1 
ATOM   1558  O O   . PRO A  1 230 ? 6.516   -33.133  15.921  1.00 35.99  ? 230  PRO A O   1 
ATOM   1559  C CB  . PRO A  1 230 ? 5.303   -30.382  14.677  1.00 35.42  ? 230  PRO A CB  1 
ATOM   1560  C CG  . PRO A  1 230 ? 5.087   -28.917  14.827  1.00 34.58  ? 230  PRO A CG  1 
ATOM   1561  C CD  . PRO A  1 230 ? 6.232   -28.430  15.663  1.00 34.77  ? 230  PRO A CD  1 
ATOM   1562  N N   . GLU A  1 231 ? 8.163   -31.631  15.569  1.00 38.36  ? 231  GLU A N   1 
ATOM   1563  C CA  . GLU A  1 231 ? 9.218   -32.633  15.444  1.00 41.08  ? 231  GLU A CA  1 
ATOM   1564  C C   . GLU A  1 231 ? 9.454   -33.363  16.762  1.00 37.40  ? 231  GLU A C   1 
ATOM   1565  O O   . GLU A  1 231 ? 9.811   -34.540  16.773  1.00 37.54  ? 231  GLU A O   1 
ATOM   1566  C CB  . GLU A  1 231 ? 10.526  -31.992  14.972  1.00 51.33  ? 231  GLU A CB  1 
ATOM   1567  C CG  . GLU A  1 231 ? 10.693  -31.917  13.460  1.00 58.62  ? 231  GLU A CG  1 
ATOM   1568  C CD  . GLU A  1 231 ? 10.090  -30.663  12.858  1.00 63.42  ? 231  GLU A CD  1 
ATOM   1569  O OE1 . GLU A  1 231 ? 9.416   -29.910  13.592  1.00 60.03  ? 231  GLU A OE1 1 
ATOM   1570  O OE2 . GLU A  1 231 ? 10.296  -30.428  11.649  1.00 67.20  ? 231  GLU A OE2 1 
ATOM   1571  N N   . ASP A  1 232 ? 9.259   -32.654  17.871  1.00 38.66  ? 232  ASP A N   1 
ATOM   1572  C CA  . ASP A  1 232 ? 9.447   -33.235  19.196  1.00 38.98  ? 232  ASP A CA  1 
ATOM   1573  C C   . ASP A  1 232 ? 8.430   -34.339  19.455  1.00 38.11  ? 232  ASP A C   1 
ATOM   1574  O O   . ASP A  1 232 ? 8.765   -35.389  20.005  1.00 40.28  ? 232  ASP A O   1 
ATOM   1575  C CB  . ASP A  1 232 ? 9.341   -32.158  20.277  1.00 45.91  ? 232  ASP A CB  1 
ATOM   1576  C CG  . ASP A  1 232 ? 10.374  -31.060  20.112  1.00 58.40  ? 232  ASP A CG  1 
ATOM   1577  O OD1 . ASP A  1 232 ? 11.444  -31.333  19.527  1.00 65.44  ? 232  ASP A OD1 1 
ATOM   1578  O OD2 . ASP A  1 232 ? 10.118  -29.926  20.569  1.00 58.16  ? 232  ASP A OD2 1 
ATOM   1579  N N   . VAL A  1 233 ? 7.187   -34.095  19.056  1.00 36.45  ? 233  VAL A N   1 
ATOM   1580  C CA  . VAL A  1 233 ? 6.133   -35.091  19.198  1.00 35.75  ? 233  VAL A CA  1 
ATOM   1581  C C   . VAL A  1 233 ? 6.374   -36.251  18.239  1.00 38.54  ? 233  VAL A C   1 
ATOM   1582  O O   . VAL A  1 233 ? 6.230   -37.417  18.608  1.00 41.51  ? 233  VAL A O   1 
ATOM   1583  C CB  . VAL A  1 233 ? 4.742   -34.489  18.932  1.00 32.33  ? 233  VAL A CB  1 
ATOM   1584  C CG1 . VAL A  1 233 ? 3.658   -35.530  19.173  1.00 32.29  ? 233  VAL A CG1 1 
ATOM   1585  C CG2 . VAL A  1 233 ? 4.516   -33.268  19.809  1.00 25.80  ? 233  VAL A CG2 1 
ATOM   1586  N N   . ALA A  1 234 ? 6.750   -35.919  17.007  1.00 36.04  ? 234  ALA A N   1 
ATOM   1587  C CA  . ALA A  1 234 ? 7.016   -36.921  15.982  1.00 36.94  ? 234  ALA A CA  1 
ATOM   1588  C C   . ALA A  1 234 ? 8.197   -37.807  16.362  1.00 38.43  ? 234  ALA A C   1 
ATOM   1589  O O   . ALA A  1 234 ? 8.236   -38.986  16.014  1.00 40.68  ? 234  ALA A O   1 
ATOM   1590  C CB  . ALA A  1 234 ? 7.268   -36.250  14.642  1.00 41.17  ? 234  ALA A CB  1 
ATOM   1591  N N   . ASP A  1 235 ? 9.159   -37.228  17.074  1.00 35.90  ? 235  ASP A N   1 
ATOM   1592  C CA  . ASP A  1 235 ? 10.314  -37.974  17.559  1.00 39.17  ? 235  ASP A CA  1 
ATOM   1593  C C   . ASP A  1 235 ? 9.870   -39.094  18.493  1.00 36.33  ? 235  ASP A C   1 
ATOM   1594  O O   . ASP A  1 235 ? 10.404  -40.203  18.454  1.00 34.75  ? 235  ASP A O   1 
ATOM   1595  C CB  . ASP A  1 235 ? 11.293  -37.042  18.276  1.00 48.17  ? 235  ASP A CB  1 
ATOM   1596  C CG  . ASP A  1 235 ? 12.522  -37.768  18.786  1.00 56.84  ? 235  ASP A CG  1 
ATOM   1597  O OD1 . ASP A  1 235 ? 12.488  -38.270  19.929  1.00 61.71  ? 235  ASP A OD1 1 
ATOM   1598  O OD2 . ASP A  1 235 ? 13.525  -37.834  18.044  1.00 56.24  ? 235  ASP A OD2 1 
ATOM   1599  N N   . VAL A  1 236 ? 8.884   -38.791  19.331  1.00 35.14  ? 236  VAL A N   1 
ATOM   1600  C CA  . VAL A  1 236 ? 8.307   -39.775  20.236  1.00 34.31  ? 236  VAL A CA  1 
ATOM   1601  C C   . VAL A  1 236 ? 7.536   -40.834  19.458  1.00 34.84  ? 236  VAL A C   1 
ATOM   1602  O O   . VAL A  1 236 ? 7.652   -42.031  19.730  1.00 30.98  ? 236  VAL A O   1 
ATOM   1603  C CB  . VAL A  1 236 ? 7.373   -39.105  21.260  1.00 27.92  ? 236  VAL A CB  1 
ATOM   1604  C CG1 . VAL A  1 236 ? 6.595   -40.149  22.044  1.00 23.23  ? 236  VAL A CG1 1 
ATOM   1605  C CG2 . VAL A  1 236 ? 8.175   -38.213  22.189  1.00 29.34  ? 236  VAL A CG2 1 
ATOM   1606  N N   . VAL A  1 237 ? 6.754   -40.379  18.485  1.00 36.75  ? 237  VAL A N   1 
ATOM   1607  C CA  . VAL A  1 237 ? 5.975   -41.269  17.633  1.00 36.95  ? 237  VAL A CA  1 
ATOM   1608  C C   . VAL A  1 237 ? 6.884   -42.234  16.878  1.00 37.26  ? 237  VAL A C   1 
ATOM   1609  O O   . VAL A  1 237 ? 6.589   -43.424  16.770  1.00 41.91  ? 237  VAL A O   1 
ATOM   1610  C CB  . VAL A  1 237 ? 5.120   -40.471  16.629  1.00 37.28  ? 237  VAL A CB  1 
ATOM   1611  C CG1 . VAL A  1 237 ? 4.435   -41.403  15.645  1.00 35.20  ? 237  VAL A CG1 1 
ATOM   1612  C CG2 . VAL A  1 237 ? 4.097   -39.620  17.366  1.00 39.60  ? 237  VAL A CG2 1 
ATOM   1613  N N   . ALA A  1 238 ? 7.998   -41.714  16.371  1.00 35.12  ? 238  ALA A N   1 
ATOM   1614  C CA  . ALA A  1 238 ? 8.963   -42.525  15.636  1.00 38.03  ? 238  ALA A CA  1 
ATOM   1615  C C   . ALA A  1 238 ? 9.543   -43.629  16.515  1.00 39.31  ? 238  ALA A C   1 
ATOM   1616  O O   . ALA A  1 238 ? 9.732   -44.759  16.064  1.00 43.22  ? 238  ALA A O   1 
ATOM   1617  C CB  . ALA A  1 238 ? 10.075  -41.649  15.084  1.00 39.10  ? 238  ALA A CB  1 
ATOM   1618  N N   . PHE A  1 239 ? 9.822   -43.294  17.770  1.00 33.62  ? 239  PHE A N   1 
ATOM   1619  C CA  . PHE A  1 239 ? 10.363  -44.258  18.721  1.00 33.76  ? 239  PHE A CA  1 
ATOM   1620  C C   . PHE A  1 239 ? 9.346   -45.339  19.069  1.00 36.64  ? 239  PHE A C   1 
ATOM   1621  O O   . PHE A  1 239 ? 9.679   -46.524  19.111  1.00 41.76  ? 239  PHE A O   1 
ATOM   1622  C CB  . PHE A  1 239 ? 10.826  -43.547  19.993  1.00 34.86  ? 239  PHE A CB  1 
ATOM   1623  C CG  . PHE A  1 239 ? 11.088  -44.474  21.146  1.00 36.73  ? 239  PHE A CG  1 
ATOM   1624  C CD1 . PHE A  1 239 ? 12.207  -45.289  21.158  1.00 41.80  ? 239  PHE A CD1 1 
ATOM   1625  C CD2 . PHE A  1 239 ? 10.219  -44.523  22.224  1.00 38.66  ? 239  PHE A CD2 1 
ATOM   1626  C CE1 . PHE A  1 239 ? 12.451  -46.141  22.219  1.00 43.99  ? 239  PHE A CE1 1 
ATOM   1627  C CE2 . PHE A  1 239 ? 10.457  -45.372  23.288  1.00 40.09  ? 239  PHE A CE2 1 
ATOM   1628  C CZ  . PHE A  1 239 ? 11.575  -46.182  23.286  1.00 42.34  ? 239  PHE A CZ  1 
ATOM   1629  N N   . LEU A  1 240 ? 8.108   -44.926  19.317  1.00 33.28  ? 240  LEU A N   1 
ATOM   1630  C CA  . LEU A  1 240 ? 7.048   -45.857  19.687  1.00 33.00  ? 240  LEU A CA  1 
ATOM   1631  C C   . LEU A  1 240 ? 6.677   -46.780  18.531  1.00 38.53  ? 240  LEU A C   1 
ATOM   1632  O O   . LEU A  1 240 ? 6.235   -47.909  18.744  1.00 44.21  ? 240  LEU A O   1 
ATOM   1633  C CB  . LEU A  1 240 ? 5.809   -45.097  20.166  1.00 31.05  ? 240  LEU A CB  1 
ATOM   1634  C CG  . LEU A  1 240 ? 5.957   -44.324  21.477  1.00 30.25  ? 240  LEU A CG  1 
ATOM   1635  C CD1 . LEU A  1 240 ? 4.635   -43.687  21.876  1.00 29.64  ? 240  LEU A CD1 1 
ATOM   1636  C CD2 . LEU A  1 240 ? 6.473   -45.236  22.579  1.00 29.08  ? 240  LEU A CD2 1 
ATOM   1637  N N   . ALA A  1 241 ? 6.862   -46.296  17.309  1.00 35.67  ? 241  ALA A N   1 
ATOM   1638  C CA  . ALA A  1 241 ? 6.523   -47.068  16.120  1.00 35.25  ? 241  ALA A CA  1 
ATOM   1639  C C   . ALA A  1 241 ? 7.620   -48.068  15.772  1.00 43.72  ? 241  ALA A C   1 
ATOM   1640  O O   . ALA A  1 241 ? 7.388   -49.027  15.037  1.00 49.21  ? 241  ALA A O   1 
ATOM   1641  C CB  . ALA A  1 241 ? 6.267   -46.139  14.946  1.00 32.10  ? 241  ALA A CB  1 
ATOM   1642  N N   . SER A  1 242 ? 8.814   -47.842  16.309  1.00 41.74  ? 242  SER A N   1 
ATOM   1643  C CA  . SER A  1 242 ? 9.973   -48.658  15.968  1.00 41.81  ? 242  SER A CA  1 
ATOM   1644  C C   . SER A  1 242 ? 10.088  -49.910  16.831  1.00 43.04  ? 242  SER A C   1 
ATOM   1645  O O   . SER A  1 242 ? 9.342   -50.094  17.792  1.00 44.53  ? 242  SER A O   1 
ATOM   1646  C CB  . SER A  1 242 ? 11.254  -47.831  16.090  1.00 41.91  ? 242  SER A CB  1 
ATOM   1647  O OG  . SER A  1 242 ? 11.440  -47.373  17.418  1.00 38.05  ? 242  SER A OG  1 
ATOM   1648  N N   . GLU A  1 243 ? 11.039  -50.766  16.471  1.00 49.66  ? 243  GLU A N   1 
ATOM   1649  C CA  . GLU A  1 243 ? 11.316  -51.994  17.206  1.00 52.64  ? 243  GLU A CA  1 
ATOM   1650  C C   . GLU A  1 243 ? 12.042  -51.704  18.516  1.00 51.87  ? 243  GLU A C   1 
ATOM   1651  O O   . GLU A  1 243 ? 12.088  -52.546  19.413  1.00 50.61  ? 243  GLU A O   1 
ATOM   1652  C CB  . GLU A  1 243 ? 12.147  -52.943  16.343  1.00 58.30  ? 243  GLU A CB  1 
ATOM   1653  C CG  . GLU A  1 243 ? 13.354  -52.272  15.706  1.00 66.45  ? 243  GLU A CG  1 
ATOM   1654  C CD  . GLU A  1 243 ? 14.102  -53.184  14.754  1.00 77.99  ? 243  GLU A CD  1 
ATOM   1655  O OE1 . GLU A  1 243 ? 13.942  -54.418  14.860  1.00 82.76  ? 243  GLU A OE1 1 
ATOM   1656  O OE2 . GLU A  1 243 ? 14.847  -52.664  13.897  1.00 80.99  ? 243  GLU A OE2 1 
ATOM   1657  N N   . ASP A  1 244 ? 12.610  -50.506  18.612  1.00 49.77  ? 244  ASP A N   1 
ATOM   1658  C CA  . ASP A  1 244 ? 13.362  -50.090  19.791  1.00 46.93  ? 244  ASP A CA  1 
ATOM   1659  C C   . ASP A  1 244 ? 12.468  -50.000  21.024  1.00 47.26  ? 244  ASP A C   1 
ATOM   1660  O O   . ASP A  1 244 ? 12.939  -50.122  22.155  1.00 47.27  ? 244  ASP A O   1 
ATOM   1661  C CB  . ASP A  1 244 ? 14.044  -48.745  19.534  1.00 43.60  ? 244  ASP A CB  1 
ATOM   1662  C CG  . ASP A  1 244 ? 15.039  -48.804  18.390  1.00 46.30  ? 244  ASP A CG  1 
ATOM   1663  O OD1 . ASP A  1 244 ? 15.059  -49.825  17.670  1.00 52.09  ? 244  ASP A OD1 1 
ATOM   1664  O OD2 . ASP A  1 244 ? 15.797  -47.829  18.205  1.00 42.35  ? 244  ASP A OD2 1 
ATOM   1665  N N   . SER A  1 245 ? 11.177  -49.784  20.797  1.00 42.04  ? 245  SER A N   1 
ATOM   1666  C CA  . SER A  1 245 ? 10.203  -49.740  21.879  1.00 29.61  ? 245  SER A CA  1 
ATOM   1667  C C   . SER A  1 245 ? 9.332   -50.990  21.860  1.00 43.27  ? 245  SER A C   1 
ATOM   1668  O O   . SER A  1 245 ? 8.131   -50.927  22.126  1.00 46.95  ? 245  SER A O   1 
ATOM   1669  C CB  . SER A  1 245 ? 9.335   -48.489  21.767  1.00 34.58  ? 245  SER A CB  1 
ATOM   1670  O OG  . SER A  1 245 ? 8.652   -48.465  20.527  1.00 40.22  ? 245  SER A OG  1 
ATOM   1671  N N   . GLY A  1 246 ? 9.948   -52.126  21.546  1.00 42.72  ? 246  GLY A N   1 
ATOM   1672  C CA  . GLY A  1 246 ? 9.230   -53.380  21.399  1.00 37.95  ? 246  GLY A CA  1 
ATOM   1673  C C   . GLY A  1 246 ? 8.641   -53.926  22.685  1.00 40.63  ? 246  GLY A C   1 
ATOM   1674  O O   . GLY A  1 246 ? 7.822   -54.845  22.657  1.00 47.33  ? 246  GLY A O   1 
ATOM   1675  N N   . TYR A  1 247 ? 9.058   -53.367  23.816  1.00 38.59  ? 247  TYR A N   1 
ATOM   1676  C CA  . TYR A  1 247 ? 8.548   -53.798  25.112  1.00 43.04  ? 247  TYR A CA  1 
ATOM   1677  C C   . TYR A  1 247 ? 7.691   -52.699  25.736  1.00 48.87  ? 247  TYR A C   1 
ATOM   1678  O O   . TYR A  1 247 ? 7.406   -52.719  26.933  1.00 53.83  ? 247  TYR A O   1 
ATOM   1679  C CB  . TYR A  1 247 ? 9.706   -54.179  26.040  1.00 41.93  ? 247  TYR A CB  1 
ATOM   1680  C CG  . TYR A  1 247 ? 9.302   -55.025  27.228  1.00 42.01  ? 247  TYR A CG  1 
ATOM   1681  C CD1 . TYR A  1 247 ? 8.723   -56.276  27.050  1.00 42.89  ? 247  TYR A CD1 1 
ATOM   1682  C CD2 . TYR A  1 247 ? 9.515   -54.581  28.526  1.00 40.52  ? 247  TYR A CD2 1 
ATOM   1683  C CE1 . TYR A  1 247 ? 8.356   -57.055  28.131  1.00 41.71  ? 247  TYR A CE1 1 
ATOM   1684  C CE2 . TYR A  1 247 ? 9.153   -55.354  29.614  1.00 41.92  ? 247  TYR A CE2 1 
ATOM   1685  C CZ  . TYR A  1 247 ? 8.573   -56.589  29.411  1.00 43.36  ? 247  TYR A CZ  1 
ATOM   1686  O OH  . TYR A  1 247 ? 8.210   -57.362  30.490  1.00 46.19  ? 247  TYR A OH  1 
ATOM   1687  N N   . ILE A  1 248 ? 7.276   -51.744  24.907  1.00 46.80  ? 248  ILE A N   1 
ATOM   1688  C CA  . ILE A  1 248 ? 6.483   -50.609  25.367  1.00 42.64  ? 248  ILE A CA  1 
ATOM   1689  C C   . ILE A  1 248 ? 5.038   -50.690  24.885  1.00 39.59  ? 248  ILE A C   1 
ATOM   1690  O O   . ILE A  1 248 ? 4.756   -50.475  23.706  1.00 35.95  ? 248  ILE A O   1 
ATOM   1691  C CB  . ILE A  1 248 ? 7.084   -49.272  24.889  1.00 43.30  ? 248  ILE A CB  1 
ATOM   1692  C CG1 . ILE A  1 248 ? 8.548   -49.154  25.314  1.00 51.12  ? 248  ILE A CG1 1 
ATOM   1693  C CG2 . ILE A  1 248 ? 6.273   -48.100  25.422  1.00 39.50  ? 248  ILE A CG2 1 
ATOM   1694  C CD1 . ILE A  1 248 ? 8.740   -49.033  26.804  1.00 53.32  ? 248  ILE A CD1 1 
ATOM   1695  N N   . THR A  1 249 ? 4.124   -50.998  25.799  1.00 39.97  ? 249  THR A N   1 
ATOM   1696  C CA  . THR A  1 249 ? 2.701   -50.997  25.479  1.00 37.90  ? 249  THR A CA  1 
ATOM   1697  C C   . THR A  1 249 ? 1.894   -50.511  26.681  1.00 36.19  ? 249  THR A C   1 
ATOM   1698  O O   . THR A  1 249 ? 2.296   -50.702  27.831  1.00 31.67  ? 249  THR A O   1 
ATOM   1699  C CB  . THR A  1 249 ? 2.210   -52.394  25.038  1.00 38.25  ? 249  THR A CB  1 
ATOM   1700  O OG1 . THR A  1 249 ? 0.911   -52.284  24.444  1.00 40.22  ? 249  THR A OG1 1 
ATOM   1701  C CG2 . THR A  1 249 ? 2.148   -53.351  26.216  1.00 37.51  ? 249  THR A CG2 1 
ATOM   1702  N N   . GLY A  1 250 ? 0.765   -49.864  26.408  1.00 39.68  ? 250  GLY A N   1 
ATOM   1703  C CA  . GLY A  1 250 ? -0.067  -49.300  27.456  1.00 46.42  ? 250  GLY A CA  1 
ATOM   1704  C C   . GLY A  1 250 ? 0.658   -48.225  28.243  1.00 50.34  ? 250  GLY A C   1 
ATOM   1705  O O   . GLY A  1 250 ? 0.445   -48.072  29.446  1.00 54.93  ? 250  GLY A O   1 
ATOM   1706  N N   . THR A  1 251 ? 1.519   -47.480  27.558  1.00 43.18  ? 251  THR A N   1 
ATOM   1707  C CA  . THR A  1 251 ? 2.343   -46.464  28.202  1.00 44.62  ? 251  THR A CA  1 
ATOM   1708  C C   . THR A  1 251 ? 2.023   -45.066  27.680  1.00 40.24  ? 251  THR A C   1 
ATOM   1709  O O   . THR A  1 251 ? 1.906   -44.854  26.474  1.00 36.25  ? 251  THR A O   1 
ATOM   1710  C CB  . THR A  1 251 ? 3.848   -46.759  28.000  1.00 49.55  ? 251  THR A CB  1 
ATOM   1711  O OG1 . THR A  1 251 ? 4.244   -47.833  28.861  1.00 58.43  ? 251  THR A OG1 1 
ATOM   1712  C CG2 . THR A  1 251 ? 4.697   -45.533  28.309  1.00 48.22  ? 251  THR A CG2 1 
ATOM   1713  N N   . SER A  1 252 ? 1.872   -44.120  28.602  1.00 41.18  ? 252  SER A N   1 
ATOM   1714  C CA  . SER A  1 252 ? 1.658   -42.725  28.244  1.00 37.77  ? 252  SER A CA  1 
ATOM   1715  C C   . SER A  1 252 ? 2.977   -41.960  28.241  1.00 40.61  ? 252  SER A C   1 
ATOM   1716  O O   . SER A  1 252 ? 3.655   -41.873  29.265  1.00 47.76  ? 252  SER A O   1 
ATOM   1717  C CB  . SER A  1 252 ? 0.670   -42.067  29.209  1.00 34.96  ? 252  SER A CB  1 
ATOM   1718  O OG  . SER A  1 252 ? -0.608  -42.673  29.121  1.00 39.24  ? 252  SER A OG  1 
ATOM   1719  N N   . VAL A  1 253 ? 3.338   -41.412  27.086  1.00 37.73  ? 253  VAL A N   1 
ATOM   1720  C CA  . VAL A  1 253 ? 4.555   -40.617  26.966  1.00 36.13  ? 253  VAL A CA  1 
ATOM   1721  C C   . VAL A  1 253 ? 4.214   -39.132  26.920  1.00 39.32  ? 253  VAL A C   1 
ATOM   1722  O O   . VAL A  1 253 ? 3.352   -38.708  26.149  1.00 43.83  ? 253  VAL A O   1 
ATOM   1723  C CB  . VAL A  1 253 ? 5.362   -40.997  25.711  1.00 36.98  ? 253  VAL A CB  1 
ATOM   1724  C CG1 . VAL A  1 253 ? 6.670   -40.223  25.669  1.00 38.04  ? 253  VAL A CG1 1 
ATOM   1725  C CG2 . VAL A  1 253 ? 5.627   -42.495  25.685  1.00 34.93  ? 253  VAL A CG2 1 
ATOM   1726  N N   . GLU A  1 254 ? 4.894   -38.345  27.747  1.00 39.62  ? 254  GLU A N   1 
ATOM   1727  C CA  . GLU A  1 254 ? 4.597   -36.922  27.861  1.00 39.35  ? 254  GLU A CA  1 
ATOM   1728  C C   . GLU A  1 254 ? 5.682   -36.050  27.238  1.00 40.33  ? 254  GLU A C   1 
ATOM   1729  O O   . GLU A  1 254 ? 6.849   -36.116  27.626  1.00 46.88  ? 254  GLU A O   1 
ATOM   1730  C CB  . GLU A  1 254 ? 4.402   -36.541  29.330  1.00 41.81  ? 254  GLU A CB  1 
ATOM   1731  C CG  . GLU A  1 254 ? 3.347   -37.368  30.046  1.00 48.07  ? 254  GLU A CG  1 
ATOM   1732  C CD  . GLU A  1 254 ? 3.117   -36.911  31.472  1.00 56.36  ? 254  GLU A CD  1 
ATOM   1733  O OE1 . GLU A  1 254 ? 3.590   -35.812  31.830  1.00 59.97  ? 254  GLU A OE1 1 
ATOM   1734  O OE2 . GLU A  1 254 ? 2.460   -37.651  32.236  1.00 59.01  ? 254  GLU A OE2 1 
ATOM   1735  N N   . VAL A  1 255 ? 5.284   -35.233  26.267  1.00 36.87  ? 255  VAL A N   1 
ATOM   1736  C CA  . VAL A  1 255 ? 6.189   -34.286  25.625  1.00 35.51  ? 255  VAL A CA  1 
ATOM   1737  C C   . VAL A  1 255 ? 5.709   -32.865  25.889  1.00 39.72  ? 255  VAL A C   1 
ATOM   1738  O O   . VAL A  1 255 ? 5.272   -32.168  24.974  1.00 45.98  ? 255  VAL A O   1 
ATOM   1739  C CB  . VAL A  1 255 ? 6.273   -34.516  24.106  1.00 36.29  ? 255  VAL A CB  1 
ATOM   1740  C CG1 . VAL A  1 255 ? 7.655   -34.145  23.589  1.00 34.15  ? 255  VAL A CG1 1 
ATOM   1741  C CG2 . VAL A  1 255 ? 5.942   -35.958  23.772  1.00 37.41  ? 255  VAL A CG2 1 
ATOM   1742  N N   . THR A  1 256 ? 5.791   -32.439  27.145  1.00 36.17  ? 256  THR A N   1 
ATOM   1743  C CA  . THR A  1 256 ? 5.183   -31.182  27.560  1.00 34.44  ? 256  THR A CA  1 
ATOM   1744  C C   . THR A  1 256 ? 6.207   -30.112  27.922  1.00 31.32  ? 256  THR A C   1 
ATOM   1745  O O   . THR A  1 256 ? 5.844   -28.980  28.243  1.00 27.12  ? 256  THR A O   1 
ATOM   1746  C CB  . THR A  1 256 ? 4.257   -31.397  28.767  1.00 42.80  ? 256  THR A CB  1 
ATOM   1747  O OG1 . THR A  1 256 ? 5.046   -31.603  29.946  1.00 49.56  ? 256  THR A OG1 1 
ATOM   1748  C CG2 . THR A  1 256 ? 3.370   -32.608  28.538  1.00 40.09  ? 256  THR A CG2 1 
ATOM   1749  N N   . GLY A  1 257 ? 7.484   -30.473  27.871  1.00 32.09  ? 257  GLY A N   1 
ATOM   1750  C CA  . GLY A  1 257 ? 8.540   -29.564  28.276  1.00 29.19  ? 257  GLY A CA  1 
ATOM   1751  C C   . GLY A  1 257 ? 8.536   -29.367  29.779  1.00 33.01  ? 257  GLY A C   1 
ATOM   1752  O O   . GLY A  1 257 ? 9.073   -28.385  30.292  1.00 38.70  ? 257  GLY A O   1 
ATOM   1753  N N   . GLY A  1 258 ? 7.922   -30.310  30.486  1.00 33.09  ? 258  GLY A N   1 
ATOM   1754  C CA  . GLY A  1 258 ? 7.848   -30.258  31.933  1.00 36.55  ? 258  GLY A CA  1 
ATOM   1755  C C   . GLY A  1 258 ? 6.541   -29.683  32.440  1.00 37.17  ? 258  GLY A C   1 
ATOM   1756  O O   . GLY A  1 258 ? 6.325   -29.584  33.647  1.00 41.77  ? 258  GLY A O   1 
ATOM   1757  N N   . LEU A  1 259 ? 5.667   -29.295  31.518  1.00 35.49  ? 259  LEU A N   1 
ATOM   1758  C CA  . LEU A  1 259 ? 4.381   -28.723  31.894  1.00 36.89  ? 259  LEU A CA  1 
ATOM   1759  C C   . LEU A  1 259 ? 3.463   -29.798  32.461  1.00 37.88  ? 259  LEU A C   1 
ATOM   1760  O O   . LEU A  1 259 ? 3.112   -30.752  31.765  1.00 35.23  ? 259  LEU A O   1 
ATOM   1761  C CB  . LEU A  1 259 ? 3.722   -28.041  30.695  1.00 34.22  ? 259  LEU A CB  1 
ATOM   1762  C CG  . LEU A  1 259 ? 2.452   -27.245  30.996  1.00 31.64  ? 259  LEU A CG  1 
ATOM   1763  C CD1 . LEU A  1 259 ? 2.738   -26.149  32.010  1.00 29.79  ? 259  LEU A CD1 1 
ATOM   1764  C CD2 . LEU A  1 259 ? 1.870   -26.659  29.719  1.00 27.10  ? 259  LEU A CD2 1 
ATOM   1765  N N   . PHE A  1 260 ? 3.088   -29.635  33.729  1.00 44.01  ? 260  PHE A N   1 
ATOM   1766  C CA  . PHE A  1 260 ? 2.230   -30.586  34.432  1.00 49.33  ? 260  PHE A CA  1 
ATOM   1767  C C   . PHE A  1 260 ? 2.844   -31.981  34.426  1.00 56.36  ? 260  PHE A C   1 
ATOM   1768  O O   . PHE A  1 260 ? 2.338   -32.888  33.766  1.00 60.98  ? 260  PHE A O   1 
ATOM   1769  C CB  . PHE A  1 260 ? 0.832   -30.623  33.807  1.00 52.99  ? 260  PHE A CB  1 
ATOM   1770  C CG  . PHE A  1 260 ? 0.217   -29.266  33.612  1.00 58.47  ? 260  PHE A CG  1 
ATOM   1771  C CD1 . PHE A  1 260 ? 0.381   -28.270  34.561  1.00 66.19  ? 260  PHE A CD1 1 
ATOM   1772  C CD2 . PHE A  1 260 ? -0.520  -28.986  32.474  1.00 58.26  ? 260  PHE A CD2 1 
ATOM   1773  C CE1 . PHE A  1 260 ? -0.183  -27.022  34.380  1.00 69.18  ? 260  PHE A CE1 1 
ATOM   1774  C CE2 . PHE A  1 260 ? -1.086  -27.739  32.287  1.00 62.14  ? 260  PHE A CE2 1 
ATOM   1775  C CZ  . PHE A  1 260 ? -0.917  -26.756  33.241  1.00 66.79  ? 260  PHE A CZ  1 
ATOM   1776  N N   . MET A  1 261 ? 3.939   -32.144  35.161  1.00 59.71  ? 261  MET A N   1 
ATOM   1777  C CA  . MET A  1 261 ? 4.669   -33.408  35.184  1.00 64.12  ? 261  MET A CA  1 
ATOM   1778  C C   . MET A  1 261 ? 3.845   -34.540  35.783  1.00 64.61  ? 261  MET A C   1 
ATOM   1779  O O   . MET A  1 261 ? 3.255   -34.391  36.850  1.00 64.02  ? 261  MET A O   1 
ATOM   1780  C CB  . MET A  1 261 ? 5.972   -33.249  35.965  1.00 64.87  ? 261  MET A CB  1 
ATOM   1781  C CG  . MET A  1 261 ? 6.909   -32.230  35.359  1.00 62.71  ? 261  MET A CG  1 
ATOM   1782  S SD  . MET A  1 261 ? 8.473   -32.099  36.235  1.00 42.39  ? 261  MET A SD  1 
ATOM   1783  C CE  . MET A  1 261 ? 9.335   -30.949  35.170  1.00 87.61  ? 261  MET A CE  1 
ATOM   1784  N N   . HIS B  2 4   ? 34.460  -40.205  15.619  1.00 98.96  ? -3   HIS B N   1 
ATOM   1785  C CA  . HIS B  2 4   ? 33.629  -39.575  14.600  1.00 98.64  ? -3   HIS B CA  1 
ATOM   1786  C C   . HIS B  2 4   ? 34.476  -39.064  13.445  1.00 96.74  ? -3   HIS B C   1 
ATOM   1787  O O   . HIS B  2 4   ? 35.050  -39.832  12.674  1.00 97.78  ? -3   HIS B O   1 
ATOM   1788  C CB  . HIS B  2 4   ? 32.834  -38.401  15.181  1.00 98.49  ? -3   HIS B CB  1 
ATOM   1789  C CG  . HIS B  2 4   ? 32.251  -38.660  16.534  1.00 98.45  ? -3   HIS B CG  1 
ATOM   1790  N ND1 . HIS B  2 4   ? 31.971  -37.646  17.424  1.00 97.80  ? -3   HIS B ND1 1 
ATOM   1791  C CD2 . HIS B  2 4   ? 31.883  -39.811  17.145  1.00 99.55  ? -3   HIS B CD2 1 
ATOM   1792  C CE1 . HIS B  2 4   ? 31.463  -38.161  18.529  1.00 98.37  ? -3   HIS B CE1 1 
ATOM   1793  N NE2 . HIS B  2 4   ? 31.400  -39.473  18.386  1.00 99.15  ? -3   HIS B NE2 1 
ATOM   1794  N N   . HIS B  2 5   ? 34.530  -37.741  13.351  1.00 96.54  ? -2   HIS B N   1 
ATOM   1795  C CA  . HIS B  2 5   ? 35.313  -37.030  12.357  1.00 101.44 ? -2   HIS B CA  1 
ATOM   1796  C C   . HIS B  2 5   ? 35.463  -35.603  12.870  1.00 95.72  ? -2   HIS B C   1 
ATOM   1797  O O   . HIS B  2 5   ? 36.048  -34.739  12.217  1.00 99.22  ? -2   HIS B O   1 
ATOM   1798  C CB  . HIS B  2 5   ? 34.636  -37.074  10.986  1.00 111.00 ? -2   HIS B CB  1 
ATOM   1799  C CG  . HIS B  2 5   ? 35.512  -36.620  9.862   1.00 119.83 ? -2   HIS B CG  1 
ATOM   1800  N ND1 . HIS B  2 5   ? 36.829  -37.013  9.737   1.00 123.68 ? -2   HIS B ND1 1 
ATOM   1801  C CD2 . HIS B  2 5   ? 35.261  -35.812  8.806   1.00 124.45 ? -2   HIS B CD2 1 
ATOM   1802  C CE1 . HIS B  2 5   ? 37.350  -36.462  8.657   1.00 128.40 ? -2   HIS B CE1 1 
ATOM   1803  N NE2 . HIS B  2 5   ? 36.419  -35.729  8.072   1.00 128.91 ? -2   HIS B NE2 1 
ATOM   1804  N N   . HIS B  2 6   ? 34.915  -35.381  14.062  1.00 85.17  ? -1   HIS B N   1 
ATOM   1805  C CA  . HIS B  2 6   ? 34.986  -34.095  14.742  1.00 79.30  ? -1   HIS B CA  1 
ATOM   1806  C C   . HIS B  2 6   ? 35.032  -34.300  16.257  1.00 71.76  ? -1   HIS B C   1 
ATOM   1807  O O   . HIS B  2 6   ? 35.287  -35.407  16.733  1.00 70.16  ? -1   HIS B O   1 
ATOM   1808  C CB  . HIS B  2 6   ? 33.797  -33.213  14.354  1.00 80.46  ? -1   HIS B CB  1 
ATOM   1809  C CG  . HIS B  2 6   ? 32.465  -33.819  14.671  1.00 80.23  ? -1   HIS B CG  1 
ATOM   1810  N ND1 . HIS B  2 6   ? 31.963  -33.886  15.952  1.00 77.92  ? -1   HIS B ND1 1 
ATOM   1811  C CD2 . HIS B  2 6   ? 31.529  -34.384  13.871  1.00 81.77  ? -1   HIS B CD2 1 
ATOM   1812  C CE1 . HIS B  2 6   ? 30.776  -34.467  15.929  1.00 78.35  ? -1   HIS B CE1 1 
ATOM   1813  N NE2 . HIS B  2 6   ? 30.490  -34.779  14.678  1.00 81.16  ? -1   HIS B NE2 1 
ATOM   1814  N N   . HIS B  2 7   ? 34.777  -33.233  17.008  1.00 64.10  ? 0    HIS B N   1 
ATOM   1815  C CA  . HIS B  2 7   ? 34.853  -33.278  18.467  1.00 56.12  ? 0    HIS B CA  1 
ATOM   1816  C C   . HIS B  2 7   ? 33.774  -34.155  19.094  1.00 54.03  ? 0    HIS B C   1 
ATOM   1817  O O   . HIS B  2 7   ? 32.611  -34.114  18.692  1.00 56.93  ? 0    HIS B O   1 
ATOM   1818  C CB  . HIS B  2 7   ? 34.755  -31.865  19.048  1.00 52.49  ? 0    HIS B CB  1 
ATOM   1819  C CG  . HIS B  2 7   ? 35.962  -31.017  18.791  1.00 50.29  ? 0    HIS B CG  1 
ATOM   1820  N ND1 . HIS B  2 7   ? 36.252  -30.489  17.551  1.00 48.59  ? 0    HIS B ND1 1 
ATOM   1821  C CD2 . HIS B  2 7   ? 36.951  -30.602  19.617  1.00 50.67  ? 0    HIS B CD2 1 
ATOM   1822  C CE1 . HIS B  2 7   ? 37.369  -29.788  17.624  1.00 44.39  ? 0    HIS B CE1 1 
ATOM   1823  N NE2 . HIS B  2 7   ? 37.814  -29.841  18.867  1.00 50.70  ? 0    HIS B NE2 1 
ATOM   1824  N N   . MET B  2 8   ? 34.169  -34.945  20.088  1.00 53.84  ? 1    MET B N   1 
ATOM   1825  C CA  . MET B  2 8   ? 33.224  -35.745  20.859  1.00 52.17  ? 1    MET B CA  1 
ATOM   1826  C C   . MET B  2 8   ? 32.648  -34.916  22.000  1.00 50.65  ? 1    MET B C   1 
ATOM   1827  O O   . MET B  2 8   ? 32.957  -35.147  23.169  1.00 47.11  ? 1    MET B O   1 
ATOM   1828  C CB  . MET B  2 8   ? 33.896  -37.005  21.406  1.00 52.85  ? 1    MET B CB  1 
ATOM   1829  C CG  . MET B  2 8   ? 34.430  -37.942  20.337  1.00 55.86  ? 1    MET B CG  1 
ATOM   1830  S SD  . MET B  2 8   ? 35.449  -39.260  21.024  1.00 68.12  ? 1    MET B SD  1 
ATOM   1831  C CE  . MET B  2 8   ? 36.865  -38.327  21.603  1.00 39.76  ? 1    MET B CE  1 
ATOM   1832  N N   . ASP B  2 9   ? 31.808  -33.947  21.649  1.00 52.47  ? 2    ASP B N   1 
ATOM   1833  C CA  . ASP B  2 9   ? 31.207  -33.048  22.628  1.00 51.29  ? 2    ASP B CA  1 
ATOM   1834  C C   . ASP B  2 9   ? 29.956  -33.659  23.248  1.00 49.94  ? 2    ASP B C   1 
ATOM   1835  O O   . ASP B  2 9   ? 29.102  -32.949  23.779  1.00 46.09  ? 2    ASP B O   1 
ATOM   1836  C CB  . ASP B  2 9   ? 30.870  -31.706  21.977  1.00 51.61  ? 2    ASP B CB  1 
ATOM   1837  C CG  . ASP B  2 9   ? 32.085  -31.032  21.370  1.00 52.20  ? 2    ASP B CG  1 
ATOM   1838  O OD1 . ASP B  2 9   ? 33.159  -31.055  22.008  1.00 48.70  ? 2    ASP B OD1 1 
ATOM   1839  O OD2 . ASP B  2 9   ? 31.968  -30.486  20.253  1.00 54.07  ? 2    ASP B OD2 1 
ATOM   1840  N N   . LYS B  2 10  ? 29.857  -34.981  23.177  1.00 51.49  ? 3    LYS B N   1 
ATOM   1841  C CA  . LYS B  2 10  ? 28.703  -35.692  23.705  1.00 53.25  ? 3    LYS B CA  1 
ATOM   1842  C C   . LYS B  2 10  ? 29.155  -36.818  24.630  1.00 54.65  ? 3    LYS B C   1 
ATOM   1843  O O   . LYS B  2 10  ? 29.159  -37.989  24.249  1.00 54.47  ? 3    LYS B O   1 
ATOM   1844  C CB  . LYS B  2 10  ? 27.848  -36.233  22.558  1.00 58.37  ? 3    LYS B CB  1 
ATOM   1845  C CG  . LYS B  2 10  ? 26.363  -35.991  22.738  1.00 61.31  ? 3    LYS B CG  1 
ATOM   1846  C CD  . LYS B  2 10  ? 25.654  -35.789  21.410  1.00 65.65  ? 3    LYS B CD  1 
ATOM   1847  C CE  . LYS B  2 10  ? 26.034  -34.457  20.782  1.00 68.77  ? 3    LYS B CE  1 
ATOM   1848  N NZ  . LYS B  2 10  ? 25.240  -34.172  19.555  1.00 71.86  ? 3    LYS B NZ  1 
ATOM   1849  N N   . VAL B  2 11  ? 29.538  -36.446  25.847  1.00 55.94  ? 4    VAL B N   1 
ATOM   1850  C CA  . VAL B  2 11  ? 30.074  -37.393  26.818  1.00 52.45  ? 4    VAL B CA  1 
ATOM   1851  C C   . VAL B  2 11  ? 29.000  -37.874  27.789  1.00 50.93  ? 4    VAL B C   1 
ATOM   1852  O O   . VAL B  2 11  ? 28.281  -37.069  28.382  1.00 46.30  ? 4    VAL B O   1 
ATOM   1853  C CB  . VAL B  2 11  ? 31.233  -36.769  27.622  1.00 55.89  ? 4    VAL B CB  1 
ATOM   1854  C CG1 . VAL B  2 11  ? 31.778  -37.762  28.638  1.00 54.94  ? 4    VAL B CG1 1 
ATOM   1855  C CG2 . VAL B  2 11  ? 32.334  -36.297  26.684  1.00 57.66  ? 4    VAL B CG2 1 
ATOM   1856  N N   . CYS B  2 12  ? 28.898  -39.190  27.948  1.00 53.20  ? 5    CYS B N   1 
ATOM   1857  C CA  . CYS B  2 12  ? 27.925  -39.775  28.862  1.00 50.32  ? 5    CYS B CA  1 
ATOM   1858  C C   . CYS B  2 12  ? 28.601  -40.525  30.006  1.00 52.22  ? 5    CYS B C   1 
ATOM   1859  O O   . CYS B  2 12  ? 29.563  -41.263  29.796  1.00 54.64  ? 5    CYS B O   1 
ATOM   1860  C CB  . CYS B  2 12  ? 26.984  -40.717  28.111  1.00 48.04  ? 5    CYS B CB  1 
ATOM   1861  S SG  . CYS B  2 12  ? 25.709  -41.463  29.152  1.00 72.35  ? 5    CYS B SG  1 
ATOM   1862  N N   . ALA B  2 13  ? 28.087  -40.330  31.216  1.00 52.64  ? 6    ALA B N   1 
ATOM   1863  C CA  . ALA B  2 13  ? 28.612  -41.009  32.393  1.00 47.94  ? 6    ALA B CA  1 
ATOM   1864  C C   . ALA B  2 13  ? 27.591  -41.997  32.947  1.00 44.22  ? 6    ALA B C   1 
ATOM   1865  O O   . ALA B  2 13  ? 26.683  -41.615  33.684  1.00 45.30  ? 6    ALA B O   1 
ATOM   1866  C CB  . ALA B  2 13  ? 29.005  -39.998  33.459  1.00 48.82  ? 6    ALA B CB  1 
ATOM   1867  N N   . VAL B  2 14  ? 27.742  -43.267  32.587  1.00 42.49  ? 7    VAL B N   1 
ATOM   1868  C CA  . VAL B  2 14  ? 26.814  -44.298  33.036  1.00 42.05  ? 7    VAL B CA  1 
ATOM   1869  C C   . VAL B  2 14  ? 27.301  -44.973  34.312  1.00 38.77  ? 7    VAL B C   1 
ATOM   1870  O O   . VAL B  2 14  ? 28.244  -45.764  34.287  1.00 41.61  ? 7    VAL B O   1 
ATOM   1871  C CB  . VAL B  2 14  ? 26.595  -45.375  31.955  1.00 42.49  ? 7    VAL B CB  1 
ATOM   1872  C CG1 . VAL B  2 14  ? 25.629  -46.439  32.456  1.00 39.45  ? 7    VAL B CG1 1 
ATOM   1873  C CG2 . VAL B  2 14  ? 26.074  -44.744  30.677  1.00 41.76  ? 7    VAL B CG2 1 
ATOM   1874  N N   . PHE B  2 15  ? 26.655  -44.651  35.428  1.00 37.03  ? 8    PHE B N   1 
ATOM   1875  C CA  . PHE B  2 15  ? 26.949  -45.308  36.694  1.00 38.04  ? 8    PHE B CA  1 
ATOM   1876  C C   . PHE B  2 15  ? 26.288  -46.679  36.740  1.00 41.95  ? 8    PHE B C   1 
ATOM   1877  O O   . PHE B  2 15  ? 25.108  -46.820  36.418  1.00 43.99  ? 8    PHE B O   1 
ATOM   1878  C CB  . PHE B  2 15  ? 26.484  -44.449  37.870  1.00 40.67  ? 8    PHE B CB  1 
ATOM   1879  C CG  . PHE B  2 15  ? 27.365  -43.265  38.139  1.00 41.94  ? 8    PHE B CG  1 
ATOM   1880  C CD1 . PHE B  2 15  ? 27.177  -42.074  37.458  1.00 38.04  ? 8    PHE B CD1 1 
ATOM   1881  C CD2 . PHE B  2 15  ? 28.386  -43.345  39.071  1.00 40.87  ? 8    PHE B CD2 1 
ATOM   1882  C CE1 . PHE B  2 15  ? 27.990  -40.985  37.704  1.00 36.31  ? 8    PHE B CE1 1 
ATOM   1883  C CE2 . PHE B  2 15  ? 29.201  -42.259  39.322  1.00 39.50  ? 8    PHE B CE2 1 
ATOM   1884  C CZ  . PHE B  2 15  ? 29.003  -41.079  38.637  1.00 37.49  ? 8    PHE B CZ  1 
ATOM   1885  N N   . GLY B  2 16  ? 27.054  -47.688  37.140  1.00 41.66  ? 9    GLY B N   1 
ATOM   1886  C CA  . GLY B  2 16  ? 26.567  -49.053  37.131  1.00 42.51  ? 9    GLY B CA  1 
ATOM   1887  C C   . GLY B  2 16  ? 26.595  -49.618  35.726  1.00 46.48  ? 9    GLY B C   1 
ATOM   1888  O O   . GLY B  2 16  ? 25.809  -50.500  35.381  1.00 48.74  ? 9    GLY B O   1 
ATOM   1889  N N   . GLY B  2 17  ? 27.511  -49.103  34.912  1.00 50.21  ? 10   GLY B N   1 
ATOM   1890  C CA  . GLY B  2 17  ? 27.645  -49.537  33.534  1.00 54.49  ? 10   GLY B CA  1 
ATOM   1891  C C   . GLY B  2 17  ? 28.467  -50.804  33.394  1.00 53.26  ? 10   GLY B C   1 
ATOM   1892  O O   . GLY B  2 17  ? 28.844  -51.191  32.288  1.00 53.14  ? 10   GLY B O   1 
ATOM   1893  N N   . SER B  2 18  ? 28.745  -51.450  34.520  1.00 60.34  ? 11   SER B N   1 
ATOM   1894  C CA  . SER B  2 18  ? 29.521  -52.683  34.526  1.00 62.93  ? 11   SER B CA  1 
ATOM   1895  C C   . SER B  2 18  ? 28.689  -53.862  34.036  1.00 61.63  ? 11   SER B C   1 
ATOM   1896  O O   . SER B  2 18  ? 29.162  -54.683  33.250  1.00 60.95  ? 11   SER B O   1 
ATOM   1897  C CB  . SER B  2 18  ? 30.059  -52.968  35.929  1.00 66.28  ? 11   SER B CB  1 
ATOM   1898  O OG  . SER B  2 18  ? 30.816  -54.165  35.955  1.00 71.78  ? 11   SER B OG  1 
ATOM   1899  N N   . ARG B  2 19  ? 27.448  -53.941  34.504  1.00 59.26  ? 12   ARG B N   1 
ATOM   1900  C CA  . ARG B  2 19  ? 26.570  -55.047  34.143  1.00 58.00  ? 12   ARG B CA  1 
ATOM   1901  C C   . ARG B  2 19  ? 25.106  -54.618  34.122  1.00 51.19  ? 12   ARG B C   1 
ATOM   1902  O O   . ARG B  2 19  ? 24.773  -53.492  34.493  1.00 48.84  ? 12   ARG B O   1 
ATOM   1903  C CB  . ARG B  2 19  ? 26.758  -56.214  35.114  1.00 60.18  ? 12   ARG B CB  1 
ATOM   1904  C CG  . ARG B  2 19  ? 26.038  -56.041  36.442  1.00 59.92  ? 12   ARG B CG  1 
ATOM   1905  C CD  . ARG B  2 19  ? 26.312  -57.209  37.377  1.00 60.74  ? 12   ARG B CD  1 
ATOM   1906  N NE  . ARG B  2 19  ? 27.514  -57.001  38.179  1.00 61.08  ? 12   ARG B NE  1 
ATOM   1907  C CZ  . ARG B  2 19  ? 27.505  -56.555  39.431  1.00 61.24  ? 12   ARG B CZ  1 
ATOM   1908  N NH1 . ARG B  2 19  ? 26.355  -56.274  40.028  1.00 60.45  ? 12   ARG B NH1 1 
ATOM   1909  N NH2 . ARG B  2 19  ? 28.645  -56.393  40.088  1.00 61.12  ? 12   ARG B NH2 1 
ATOM   1910  N N   . GLY B  2 20  ? 24.238  -55.523  33.683  1.00 51.66  ? 13   GLY B N   1 
ATOM   1911  C CA  . GLY B  2 20  ? 22.808  -55.272  33.670  1.00 53.72  ? 13   GLY B CA  1 
ATOM   1912  C C   . GLY B  2 20  ? 22.376  -54.244  32.642  1.00 55.22  ? 13   GLY B C   1 
ATOM   1913  O O   . GLY B  2 20  ? 22.857  -54.243  31.509  1.00 56.62  ? 13   GLY B O   1 
ATOM   1914  N N   . ILE B  2 21  ? 21.460  -53.368  33.044  1.00 53.86  ? 14   ILE B N   1 
ATOM   1915  C CA  . ILE B  2 21  ? 20.935  -52.335  32.159  1.00 49.00  ? 14   ILE B CA  1 
ATOM   1916  C C   . ILE B  2 21  ? 21.996  -51.286  31.839  1.00 43.89  ? 14   ILE B C   1 
ATOM   1917  O O   . ILE B  2 21  ? 22.095  -50.817  30.705  1.00 45.40  ? 14   ILE B O   1 
ATOM   1918  C CB  . ILE B  2 21  ? 19.702  -51.642  32.777  1.00 47.06  ? 14   ILE B CB  1 
ATOM   1919  C CG1 . ILE B  2 21  ? 18.607  -52.669  33.072  1.00 43.48  ? 14   ILE B CG1 1 
ATOM   1920  C CG2 . ILE B  2 21  ? 19.172  -50.553  31.855  1.00 47.00  ? 14   ILE B CG2 1 
ATOM   1921  C CD1 . ILE B  2 21  ? 17.344  -52.068  33.647  1.00 43.75  ? 14   ILE B CD1 1 
ATOM   1922  N N   . GLY B  2 22  ? 22.793  -50.931  32.842  1.00 42.64  ? 15   GLY B N   1 
ATOM   1923  C CA  . GLY B  2 22  ? 23.838  -49.937  32.678  1.00 43.09  ? 15   GLY B CA  1 
ATOM   1924  C C   . GLY B  2 22  ? 24.868  -50.313  31.630  1.00 44.93  ? 15   GLY B C   1 
ATOM   1925  O O   . GLY B  2 22  ? 25.424  -49.446  30.955  1.00 45.08  ? 15   GLY B O   1 
ATOM   1926  N N   . ARG B  2 23  ? 25.122  -51.611  31.494  1.00 45.37  ? 16   ARG B N   1 
ATOM   1927  C CA  . ARG B  2 23  ? 26.078  -52.104  30.509  1.00 44.58  ? 16   ARG B CA  1 
ATOM   1928  C C   . ARG B  2 23  ? 25.521  -51.989  29.094  1.00 46.48  ? 16   ARG B C   1 
ATOM   1929  O O   . ARG B  2 23  ? 26.234  -51.608  28.166  1.00 49.45  ? 16   ARG B O   1 
ATOM   1930  C CB  . ARG B  2 23  ? 26.455  -53.557  30.806  1.00 47.23  ? 16   ARG B CB  1 
ATOM   1931  N N   . ALA B  2 24  ? 24.243  -52.320  28.939  1.00 42.97  ? 17   ALA B N   1 
ATOM   1932  C CA  . ALA B  2 24  ? 23.586  -52.267  27.638  1.00 40.31  ? 17   ALA B CA  1 
ATOM   1933  C C   . ALA B  2 24  ? 23.504  -50.835  27.120  1.00 40.04  ? 17   ALA B C   1 
ATOM   1934  O O   . ALA B  2 24  ? 23.671  -50.588  25.926  1.00 41.11  ? 17   ALA B O   1 
ATOM   1935  C CB  . ALA B  2 24  ? 22.199  -52.880  27.721  1.00 38.93  ? 17   ALA B CB  1 
ATOM   1936  N N   . VAL B  2 25  ? 23.243  -49.897  28.027  1.00 39.48  ? 18   VAL B N   1 
ATOM   1937  C CA  . VAL B  2 25  ? 23.189  -48.482  27.680  1.00 32.86  ? 18   VAL B CA  1 
ATOM   1938  C C   . VAL B  2 25  ? 24.535  -48.019  27.133  1.00 39.38  ? 18   VAL B C   1 
ATOM   1939  O O   . VAL B  2 25  ? 24.596  -47.298  26.137  1.00 39.22  ? 18   VAL B O   1 
ATOM   1940  C CB  . VAL B  2 25  ? 22.798  -47.615  28.895  1.00 36.83  ? 18   VAL B CB  1 
ATOM   1941  C CG1 . VAL B  2 25  ? 22.885  -46.136  28.550  1.00 34.28  ? 18   VAL B CG1 1 
ATOM   1942  C CG2 . VAL B  2 25  ? 21.399  -47.970  29.372  1.00 42.66  ? 18   VAL B CG2 1 
ATOM   1943  N N   . ALA B  2 26  ? 25.610  -48.452  27.784  1.00 42.80  ? 19   ALA B N   1 
ATOM   1944  C CA  . ALA B  2 26  ? 26.961  -48.122  27.345  1.00 39.54  ? 19   ALA B CA  1 
ATOM   1945  C C   . ALA B  2 26  ? 27.238  -48.681  25.954  1.00 44.78  ? 19   ALA B C   1 
ATOM   1946  O O   . ALA B  2 26  ? 27.845  -48.012  25.119  1.00 47.74  ? 19   ALA B O   1 
ATOM   1947  C CB  . ALA B  2 26  ? 27.985  -48.647  28.341  1.00 37.17  ? 19   ALA B CB  1 
ATOM   1948  N N   . GLN B  2 27  ? 26.788  -49.908  25.711  1.00 46.18  ? 20   GLN B N   1 
ATOM   1949  C CA  . GLN B  2 27  ? 26.962  -50.552  24.413  1.00 51.64  ? 20   GLN B CA  1 
ATOM   1950  C C   . GLN B  2 27  ? 26.187  -49.822  23.323  1.00 53.02  ? 20   GLN B C   1 
ATOM   1951  O O   . GLN B  2 27  ? 26.655  -49.693  22.191  1.00 54.11  ? 20   GLN B O   1 
ATOM   1952  C CB  . GLN B  2 27  ? 26.513  -52.014  24.472  1.00 54.75  ? 20   GLN B CB  1 
ATOM   1953  C CG  . GLN B  2 27  ? 27.317  -52.885  25.420  1.00 58.47  ? 20   GLN B CG  1 
ATOM   1954  C CD  . GLN B  2 27  ? 26.806  -54.311  25.468  1.00 65.34  ? 20   GLN B CD  1 
ATOM   1955  O OE1 . GLN B  2 27  ? 25.814  -54.649  24.821  1.00 66.56  ? 20   GLN B OE1 1 
ATOM   1956  N NE2 . GLN B  2 27  ? 27.481  -55.158  26.236  1.00 70.54  ? 20   GLN B NE2 1 
ATOM   1957  N N   . LEU B  2 28  ? 24.999  -49.344  23.676  1.00 50.87  ? 21   LEU B N   1 
ATOM   1958  C CA  . LEU B  2 28  ? 24.099  -48.725  22.712  1.00 50.06  ? 21   LEU B CA  1 
ATOM   1959  C C   . LEU B  2 28  ? 24.524  -47.303  22.352  1.00 49.55  ? 21   LEU B C   1 
ATOM   1960  O O   . LEU B  2 28  ? 24.351  -46.867  21.214  1.00 53.51  ? 21   LEU B O   1 
ATOM   1961  C CB  . LEU B  2 28  ? 22.670  -48.724  23.257  1.00 50.42  ? 21   LEU B CB  1 
ATOM   1962  C CG  . LEU B  2 28  ? 21.576  -48.195  22.331  1.00 51.65  ? 21   LEU B CG  1 
ATOM   1963  C CD1 . LEU B  2 28  ? 21.626  -48.901  20.986  1.00 55.58  ? 21   LEU B CD1 1 
ATOM   1964  C CD2 . LEU B  2 28  ? 20.214  -48.370  22.979  1.00 47.10  ? 21   LEU B CD2 1 
ATOM   1965  N N   . MET B  2 29  ? 25.080  -46.584  23.322  1.00 44.54  ? 22   MET B N   1 
ATOM   1966  C CA  . MET B  2 29  ? 25.502  -45.207  23.095  1.00 43.87  ? 22   MET B CA  1 
ATOM   1967  C C   . MET B  2 29  ? 26.884  -45.147  22.453  1.00 46.83  ? 22   MET B C   1 
ATOM   1968  O O   . MET B  2 29  ? 27.219  -44.175  21.778  1.00 51.33  ? 22   MET B O   1 
ATOM   1969  C CB  . MET B  2 29  ? 25.496  -44.419  24.406  1.00 38.77  ? 22   MET B CB  1 
ATOM   1970  C CG  . MET B  2 29  ? 24.136  -44.357  25.080  1.00 35.16  ? 22   MET B CG  1 
ATOM   1971  S SD  . MET B  2 29  ? 24.128  -43.338  26.565  1.00 56.02  ? 22   MET B SD  1 
ATOM   1972  C CE  . MET B  2 29  ? 24.221  -41.699  25.851  1.00 36.19  ? 22   MET B CE  1 
ATOM   1973  N N   . ALA B  2 30  ? 27.682  -46.189  22.664  1.00 46.89  ? 23   ALA B N   1 
ATOM   1974  C CA  . ALA B  2 30  ? 29.005  -46.269  22.055  1.00 48.10  ? 23   ALA B CA  1 
ATOM   1975  C C   . ALA B  2 30  ? 28.888  -46.395  20.540  1.00 50.67  ? 23   ALA B C   1 
ATOM   1976  O O   . ALA B  2 30  ? 29.743  -45.914  19.797  1.00 54.33  ? 23   ALA B O   1 
ATOM   1977  C CB  . ALA B  2 30  ? 29.788  -47.440  22.626  1.00 47.63  ? 23   ALA B CB  1 
ATOM   1978  N N   . ARG B  2 31  ? 27.818  -47.043  20.093  1.00 52.24  ? 24   ARG B N   1 
ATOM   1979  C CA  . ARG B  2 31  ? 27.559  -47.226  18.670  1.00 54.13  ? 24   ARG B CA  1 
ATOM   1980  C C   . ARG B  2 31  ? 27.040  -45.946  18.023  1.00 55.35  ? 24   ARG B C   1 
ATOM   1981  O O   . ARG B  2 31  ? 27.100  -45.789  16.804  1.00 61.33  ? 24   ARG B O   1 
ATOM   1982  C CB  . ARG B  2 31  ? 26.557  -48.363  18.457  1.00 54.43  ? 24   ARG B CB  1 
ATOM   1983  C CG  . ARG B  2 31  ? 27.179  -49.667  17.983  1.00 64.70  ? 24   ARG B CG  1 
ATOM   1984  C CD  . ARG B  2 31  ? 27.172  -49.753  16.466  1.00 76.74  ? 24   ARG B CD  1 
ATOM   1985  N NE  . ARG B  2 31  ? 25.811  -49.800  15.937  1.00 82.09  ? 24   ARG B NE  1 
ATOM   1986  C CZ  . ARG B  2 31  ? 25.508  -49.799  14.642  1.00 84.65  ? 24   ARG B CZ  1 
ATOM   1987  N NH1 . ARG B  2 31  ? 26.472  -49.750  13.733  1.00 83.69  ? 24   ARG B NH1 1 
ATOM   1988  N NH2 . ARG B  2 31  ? 24.240  -49.844  14.256  1.00 86.48  ? 24   ARG B NH2 1 
ATOM   1989  N N   . LYS B  2 32  ? 26.536  -45.031  18.845  1.00 57.10  ? 25   LYS B N   1 
ATOM   1990  C CA  . LYS B  2 32  ? 25.937  -43.798  18.344  1.00 61.51  ? 25   LYS B CA  1 
ATOM   1991  C C   . LYS B  2 32  ? 26.908  -42.621  18.365  1.00 68.04  ? 25   LYS B C   1 
ATOM   1992  O O   . LYS B  2 32  ? 26.541  -41.500  18.014  1.00 68.25  ? 25   LYS B O   1 
ATOM   1993  C CB  . LYS B  2 32  ? 24.687  -43.453  19.155  1.00 57.07  ? 25   LYS B CB  1 
ATOM   1994  C CG  . LYS B  2 32  ? 23.512  -44.378  18.894  1.00 54.96  ? 25   LYS B CG  1 
ATOM   1995  C CD  . LYS B  2 32  ? 22.338  -44.044  19.795  1.00 55.50  ? 25   LYS B CD  1 
ATOM   1996  C CE  . LYS B  2 32  ? 21.085  -44.779  19.355  1.00 57.36  ? 25   LYS B CE  1 
ATOM   1997  N NZ  . LYS B  2 32  ? 20.653  -44.353  17.994  1.00 59.15  ? 25   LYS B NZ  1 
ATOM   1998  N N   . GLY B  2 33  ? 28.144  -42.877  18.779  1.00 78.12  ? 26   GLY B N   1 
ATOM   1999  C CA  . GLY B  2 33  ? 29.166  -41.847  18.777  1.00 79.30  ? 26   GLY B CA  1 
ATOM   2000  C C   . GLY B  2 33  ? 29.374  -41.176  20.121  1.00 78.97  ? 26   GLY B C   1 
ATOM   2001  O O   . GLY B  2 33  ? 30.244  -40.319  20.262  1.00 82.11  ? 26   GLY B O   1 
ATOM   2002  N N   . TYR B  2 34  ? 28.573  -41.558  21.110  1.00 73.02  ? 27   TYR B N   1 
ATOM   2003  C CA  . TYR B  2 34  ? 28.740  -41.034  22.461  1.00 68.93  ? 27   TYR B CA  1 
ATOM   2004  C C   . TYR B  2 34  ? 30.017  -41.581  23.086  1.00 68.38  ? 27   TYR B C   1 
ATOM   2005  O O   . TYR B  2 34  ? 30.355  -42.749  22.897  1.00 68.25  ? 27   TYR B O   1 
ATOM   2006  C CB  . TYR B  2 34  ? 27.537  -41.388  23.339  1.00 65.03  ? 27   TYR B CB  1 
ATOM   2007  C CG  . TYR B  2 34  ? 26.247  -40.709  22.940  1.00 62.32  ? 27   TYR B CG  1 
ATOM   2008  C CD1 . TYR B  2 34  ? 25.438  -41.240  21.944  1.00 59.76  ? 27   TYR B CD1 1 
ATOM   2009  C CD2 . TYR B  2 34  ? 25.833  -39.541  23.566  1.00 59.50  ? 27   TYR B CD2 1 
ATOM   2010  C CE1 . TYR B  2 34  ? 24.257  -40.624  21.579  1.00 58.74  ? 27   TYR B CE1 1 
ATOM   2011  C CE2 . TYR B  2 34  ? 24.653  -38.921  23.211  1.00 57.21  ? 27   TYR B CE2 1 
ATOM   2012  C CZ  . TYR B  2 34  ? 23.870  -39.464  22.216  1.00 58.17  ? 27   TYR B CZ  1 
ATOM   2013  O OH  . TYR B  2 34  ? 22.694  -38.845  21.859  1.00 61.21  ? 27   TYR B OH  1 
ATOM   2014  N N   . ARG B  2 35  ? 30.730  -40.736  23.825  1.00 63.24  ? 28   ARG B N   1 
ATOM   2015  C CA  . ARG B  2 35  ? 31.897  -41.199  24.564  1.00 57.44  ? 28   ARG B CA  1 
ATOM   2016  C C   . ARG B  2 35  ? 31.479  -41.563  25.982  1.00 50.31  ? 28   ARG B C   1 
ATOM   2017  O O   . ARG B  2 35  ? 30.924  -40.738  26.708  1.00 46.80  ? 28   ARG B O   1 
ATOM   2018  C CB  . ARG B  2 35  ? 33.005  -40.145  24.578  1.00 58.88  ? 28   ARG B CB  1 
ATOM   2019  C CG  . ARG B  2 35  ? 34.377  -40.742  24.324  1.00 65.00  ? 28   ARG B CG  1 
ATOM   2020  C CD  . ARG B  2 35  ? 35.511  -39.790  24.659  1.00 71.87  ? 28   ARG B CD  1 
ATOM   2021  N NE  . ARG B  2 35  ? 36.806  -40.440  24.474  1.00 79.89  ? 28   ARG B NE  1 
ATOM   2022  C CZ  . ARG B  2 35  ? 37.979  -39.869  24.725  1.00 83.21  ? 28   ARG B CZ  1 
ATOM   2023  N NH1 . ARG B  2 35  ? 38.032  -38.624  25.177  1.00 81.24  ? 28   ARG B NH1 1 
ATOM   2024  N NH2 . ARG B  2 35  ? 39.102  -40.546  24.524  1.00 86.90  ? 28   ARG B NH2 1 
ATOM   2025  N N   . LEU B  2 36  ? 31.748  -42.805  26.370  1.00 47.58  ? 29   LEU B N   1 
ATOM   2026  C CA  . LEU B  2 36  ? 31.194  -43.357  27.601  1.00 45.71  ? 29   LEU B CA  1 
ATOM   2027  C C   . LEU B  2 36  ? 32.188  -43.421  28.755  1.00 40.70  ? 29   LEU B C   1 
ATOM   2028  O O   . LEU B  2 36  ? 33.395  -43.557  28.554  1.00 44.19  ? 29   LEU B O   1 
ATOM   2029  C CB  . LEU B  2 36  ? 30.635  -44.759  27.339  1.00 49.94  ? 29   LEU B CB  1 
ATOM   2030  C CG  . LEU B  2 36  ? 29.190  -44.858  26.840  1.00 48.45  ? 29   LEU B CG  1 
ATOM   2031  C CD1 . LEU B  2 36  ? 28.252  -44.180  27.824  1.00 46.44  ? 29   LEU B CD1 1 
ATOM   2032  C CD2 . LEU B  2 36  ? 29.031  -44.261  25.451  1.00 47.48  ? 29   LEU B CD2 1 
ATOM   2033  N N   . ALA B  2 37  ? 31.654  -43.323  29.968  1.00 40.98  ? 30   ALA B N   1 
ATOM   2034  C CA  . ALA B  2 37  ? 32.434  -43.493  31.185  1.00 45.19  ? 30   ALA B CA  1 
ATOM   2035  C C   . ALA B  2 37  ? 31.821  -44.598  32.036  1.00 50.76  ? 30   ALA B C   1 
ATOM   2036  O O   . ALA B  2 37  ? 30.931  -44.345  32.846  1.00 57.24  ? 30   ALA B O   1 
ATOM   2037  C CB  . ALA B  2 37  ? 32.499  -42.195  31.968  1.00 43.39  ? 30   ALA B CB  1 
ATOM   2038  N N   . VAL B  2 38  ? 32.291  -45.825  31.839  1.00 49.48  ? 31   VAL B N   1 
ATOM   2039  C CA  . VAL B  2 38  ? 31.779  -46.965  32.589  1.00 49.05  ? 31   VAL B CA  1 
ATOM   2040  C C   . VAL B  2 38  ? 32.212  -46.883  34.049  1.00 51.77  ? 31   VAL B C   1 
ATOM   2041  O O   . VAL B  2 38  ? 33.390  -47.048  34.364  1.00 56.68  ? 31   VAL B O   1 
ATOM   2042  C CB  . VAL B  2 38  ? 32.257  -48.298  31.988  1.00 51.37  ? 31   VAL B CB  1 
ATOM   2043  C CG1 . VAL B  2 38  ? 31.653  -49.466  32.748  1.00 48.89  ? 31   VAL B CG1 1 
ATOM   2044  C CG2 . VAL B  2 38  ? 31.895  -48.372  30.512  1.00 53.43  ? 31   VAL B CG2 1 
ATOM   2045  N N   . ILE B  2 39  ? 31.257  -46.627  34.937  1.00 50.57  ? 32   ILE B N   1 
ATOM   2046  C CA  . ILE B  2 39  ? 31.564  -46.443  36.351  1.00 48.19  ? 32   ILE B CA  1 
ATOM   2047  C C   . ILE B  2 39  ? 30.880  -47.482  37.237  1.00 52.26  ? 32   ILE B C   1 
ATOM   2048  O O   . ILE B  2 39  ? 29.676  -47.713  37.129  1.00 57.35  ? 32   ILE B O   1 
ATOM   2049  C CB  . ILE B  2 39  ? 31.159  -45.034  36.831  1.00 45.34  ? 32   ILE B CB  1 
ATOM   2050  C CG1 . ILE B  2 39  ? 31.800  -43.963  35.947  1.00 43.84  ? 32   ILE B CG1 1 
ATOM   2051  C CG2 . ILE B  2 39  ? 31.555  -44.830  38.284  1.00 44.41  ? 32   ILE B CG2 1 
ATOM   2052  C CD1 . ILE B  2 39  ? 31.456  -42.548  36.355  1.00 42.62  ? 32   ILE B CD1 1 
ATOM   2053  N N   . ALA B  2 40  ? 31.667  -48.103  38.112  1.00 53.66  ? 33   ALA B N   1 
ATOM   2054  C CA  . ALA B  2 40  ? 31.161  -49.061  39.089  1.00 51.23  ? 33   ALA B CA  1 
ATOM   2055  C C   . ALA B  2 40  ? 32.154  -49.183  40.240  1.00 55.77  ? 33   ALA B C   1 
ATOM   2056  O O   . ALA B  2 40  ? 33.266  -48.665  40.155  1.00 59.76  ? 33   ALA B O   1 
ATOM   2057  C CB  . ALA B  2 40  ? 30.919  -50.415  38.441  1.00 46.32  ? 33   ALA B CB  1 
ATOM   2058  N N   . ARG B  2 41  ? 31.756  -49.859  41.314  1.00 54.08  ? 34   ARG B N   1 
ATOM   2059  C CA  . ARG B  2 41  ? 32.648  -50.057  42.455  1.00 54.87  ? 34   ARG B CA  1 
ATOM   2060  C C   . ARG B  2 41  ? 33.855  -50.898  42.051  1.00 55.25  ? 34   ARG B C   1 
ATOM   2061  O O   . ARG B  2 41  ? 34.997  -50.534  42.329  1.00 56.47  ? 34   ARG B O   1 
ATOM   2062  C CB  . ARG B  2 41  ? 31.906  -50.716  43.620  1.00 53.82  ? 34   ARG B CB  1 
ATOM   2063  C CG  . ARG B  2 41  ? 30.778  -49.873  44.195  1.00 51.21  ? 34   ARG B CG  1 
ATOM   2064  C CD  . ARG B  2 41  ? 29.985  -50.639  45.244  1.00 51.39  ? 34   ARG B CD  1 
ATOM   2065  N NE  . ARG B  2 41  ? 29.206  -51.728  44.660  1.00 50.94  ? 34   ARG B NE  1 
ATOM   2066  C CZ  . ARG B  2 41  ? 28.421  -52.543  45.357  1.00 54.00  ? 34   ARG B CZ  1 
ATOM   2067  N NH1 . ARG B  2 41  ? 28.307  -52.396  46.670  1.00 56.75  ? 34   ARG B NH1 1 
ATOM   2068  N NH2 . ARG B  2 41  ? 27.748  -53.506  44.742  1.00 53.96  ? 34   ARG B NH2 1 
ATOM   2069  N N   . ASN B  2 42  ? 33.594  -52.023  41.392  1.00 56.20  ? 35   ASN B N   1 
ATOM   2070  C CA  . ASN B  2 42  ? 34.660  -52.868  40.871  1.00 57.78  ? 35   ASN B CA  1 
ATOM   2071  C C   . ASN B  2 42  ? 35.189  -52.331  39.546  1.00 56.39  ? 35   ASN B C   1 
ATOM   2072  O O   . ASN B  2 42  ? 34.459  -52.262  38.557  1.00 55.27  ? 35   ASN B O   1 
ATOM   2073  C CB  . ASN B  2 42  ? 34.172  -54.307  40.699  1.00 60.28  ? 35   ASN B CB  1 
ATOM   2074  C CG  . ASN B  2 42  ? 35.186  -55.186  39.992  1.00 64.19  ? 35   ASN B CG  1 
ATOM   2075  O OD1 . ASN B  2 42  ? 35.128  -55.367  38.776  1.00 63.30  ? 35   ASN B OD1 1 
ATOM   2076  N ND2 . ASN B  2 42  ? 36.126  -55.735  40.753  1.00 69.57  ? 35   ASN B ND2 1 
ATOM   2077  N N   . LEU B  2 43  ? 36.462  -51.952  39.533  1.00 55.61  ? 36   LEU B N   1 
ATOM   2078  C CA  . LEU B  2 43  ? 37.074  -51.363  38.348  1.00 53.81  ? 36   LEU B CA  1 
ATOM   2079  C C   . LEU B  2 43  ? 37.341  -52.405  37.266  1.00 58.48  ? 36   LEU B C   1 
ATOM   2080  O O   . LEU B  2 43  ? 37.231  -52.112  36.074  1.00 59.05  ? 36   LEU B O   1 
ATOM   2081  C CB  . LEU B  2 43  ? 38.377  -50.653  38.721  1.00 49.91  ? 36   LEU B CB  1 
ATOM   2082  C CG  . LEU B  2 43  ? 39.121  -49.953  37.583  1.00 52.08  ? 36   LEU B CG  1 
ATOM   2083  C CD1 . LEU B  2 43  ? 38.251  -48.872  36.959  1.00 46.08  ? 36   LEU B CD1 1 
ATOM   2084  C CD2 . LEU B  2 43  ? 40.437  -49.373  38.076  1.00 52.09  ? 36   LEU B CD2 1 
ATOM   2085  N N   . GLU B  2 44  ? 37.688  -53.618  37.688  1.00 57.77  ? 37   GLU B N   1 
ATOM   2086  C CA  . GLU B  2 44  ? 38.021  -54.698  36.763  1.00 57.95  ? 37   GLU B CA  1 
ATOM   2087  C C   . GLU B  2 44  ? 36.879  -54.996  35.796  1.00 59.32  ? 37   GLU B C   1 
ATOM   2088  O O   . GLU B  2 44  ? 37.102  -55.202  34.603  1.00 61.04  ? 37   GLU B O   1 
ATOM   2089  C CB  . GLU B  2 44  ? 38.393  -55.965  37.537  1.00 57.76  ? 37   GLU B CB  1 
ATOM   2090  N N   . GLY B  2 45  ? 35.656  -55.015  36.316  1.00 59.81  ? 38   GLY B N   1 
ATOM   2091  C CA  . GLY B  2 45  ? 34.484  -55.248  35.494  1.00 55.56  ? 38   GLY B CA  1 
ATOM   2092  C C   . GLY B  2 45  ? 34.126  -54.028  34.671  1.00 51.06  ? 38   GLY B C   1 
ATOM   2093  O O   . GLY B  2 45  ? 33.657  -54.144  33.538  1.00 45.68  ? 38   GLY B O   1 
ATOM   2094  N N   . ALA B  2 46  ? 34.350  -52.852  35.247  1.00 52.80  ? 39   ALA B N   1 
ATOM   2095  C CA  . ALA B  2 46  ? 34.083  -51.598  34.555  1.00 50.85  ? 39   ALA B CA  1 
ATOM   2096  C C   . ALA B  2 46  ? 35.080  -51.384  33.422  1.00 57.35  ? 39   ALA B C   1 
ATOM   2097  O O   . ALA B  2 46  ? 34.743  -50.811  32.387  1.00 57.39  ? 39   ALA B O   1 
ATOM   2098  C CB  . ALA B  2 46  ? 34.126  -50.432  35.530  1.00 44.45  ? 39   ALA B CB  1 
ATOM   2099  N N   . LYS B  2 47  ? 36.308  -51.852  33.623  1.00 61.51  ? 40   LYS B N   1 
ATOM   2100  C CA  . LYS B  2 47  ? 37.353  -51.702  32.618  1.00 61.90  ? 40   LYS B CA  1 
ATOM   2101  C C   . LYS B  2 47  ? 37.182  -52.727  31.503  1.00 64.76  ? 40   LYS B C   1 
ATOM   2102  O O   . LYS B  2 47  ? 37.521  -52.466  30.349  1.00 66.51  ? 40   LYS B O   1 
ATOM   2103  C CB  . LYS B  2 47  ? 38.738  -51.833  33.256  1.00 59.65  ? 40   LYS B CB  1 
ATOM   2104  C CG  . LYS B  2 47  ? 39.854  -51.203  32.439  1.00 57.62  ? 40   LYS B CG  1 
ATOM   2105  C CD  . LYS B  2 47  ? 41.173  -51.198  33.196  1.00 56.65  ? 40   LYS B CD  1 
ATOM   2106  C CE  . LYS B  2 47  ? 41.699  -52.607  33.408  1.00 54.02  ? 40   LYS B CE  1 
ATOM   2107  N NZ  . LYS B  2 47  ? 43.051  -52.600  34.034  1.00 64.01  ? 40   LYS B NZ  1 
ATOM   2108  N N   . ALA B  2 48  ? 36.651  -53.894  31.854  1.00 71.58  ? 41   ALA B N   1 
ATOM   2109  C CA  . ALA B  2 48  ? 36.372  -54.934  30.871  1.00 72.26  ? 41   ALA B CA  1 
ATOM   2110  C C   . ALA B  2 48  ? 35.148  -54.566  30.041  1.00 68.32  ? 41   ALA B C   1 
ATOM   2111  O O   . ALA B  2 48  ? 35.011  -54.990  28.893  1.00 67.60  ? 41   ALA B O   1 
ATOM   2112  C CB  . ALA B  2 48  ? 36.169  -56.277  31.556  1.00 74.66  ? 41   ALA B CB  1 
ATOM   2113  N N   . ALA B  2 49  ? 34.258  -53.775  30.633  1.00 64.74  ? 42   ALA B N   1 
ATOM   2114  C CA  . ALA B  2 49  ? 33.066  -53.305  29.938  1.00 60.88  ? 42   ALA B CA  1 
ATOM   2115  C C   . ALA B  2 49  ? 33.425  -52.203  28.949  1.00 63.76  ? 42   ALA B C   1 
ATOM   2116  O O   . ALA B  2 49  ? 32.959  -52.203  27.810  1.00 68.78  ? 42   ALA B O   1 
ATOM   2117  C CB  . ALA B  2 49  ? 32.029  -52.812  30.934  1.00 56.57  ? 42   ALA B CB  1 
ATOM   2118  N N   . ALA B  2 50  ? 34.260  -51.268  29.391  1.00 58.98  ? 43   ALA B N   1 
ATOM   2119  C CA  . ALA B  2 50  ? 34.716  -50.177  28.538  1.00 56.83  ? 43   ALA B CA  1 
ATOM   2120  C C   . ALA B  2 50  ? 35.645  -50.696  27.445  1.00 60.40  ? 43   ALA B C   1 
ATOM   2121  O O   . ALA B  2 50  ? 35.818  -50.057  26.407  1.00 58.58  ? 43   ALA B O   1 
ATOM   2122  C CB  . ALA B  2 50  ? 35.412  -49.109  29.366  1.00 51.42  ? 43   ALA B CB  1 
ATOM   2123  N N   . GLY B  2 51  ? 36.242  -51.858  27.689  1.00 65.11  ? 44   GLY B N   1 
ATOM   2124  C CA  . GLY B  2 51  ? 37.120  -52.488  26.720  1.00 67.25  ? 44   GLY B CA  1 
ATOM   2125  C C   . GLY B  2 51  ? 36.347  -53.074  25.556  1.00 65.87  ? 44   GLY B C   1 
ATOM   2126  O O   . GLY B  2 51  ? 36.801  -53.026  24.412  1.00 66.98  ? 44   GLY B O   1 
ATOM   2127  N N   . ASP B  2 52  ? 35.175  -53.631  25.849  1.00 71.30  ? 45   ASP B N   1 
ATOM   2128  C CA  . ASP B  2 52  ? 34.306  -54.181  24.814  1.00 73.20  ? 45   ASP B CA  1 
ATOM   2129  C C   . ASP B  2 52  ? 33.736  -53.063  23.952  1.00 72.38  ? 45   ASP B C   1 
ATOM   2130  O O   . ASP B  2 52  ? 33.425  -53.264  22.778  1.00 69.53  ? 45   ASP B O   1 
ATOM   2131  C CB  . ASP B  2 52  ? 33.173  -55.001  25.433  1.00 78.92  ? 45   ASP B CB  1 
ATOM   2132  C CG  . ASP B  2 52  ? 33.681  -56.178  26.241  1.00 85.14  ? 45   ASP B CG  1 
ATOM   2133  O OD1 . ASP B  2 52  ? 34.852  -56.570  26.051  1.00 86.68  ? 45   ASP B OD1 1 
ATOM   2134  O OD2 . ASP B  2 52  ? 32.907  -56.715  27.062  1.00 84.47  ? 45   ASP B OD2 1 
ATOM   2135  N N   . LEU B  2 53  ? 33.610  -51.880  24.545  1.00 75.86  ? 46   LEU B N   1 
ATOM   2136  C CA  . LEU B  2 53  ? 33.163  -50.695  23.822  1.00 82.03  ? 46   LEU B CA  1 
ATOM   2137  C C   . LEU B  2 53  ? 34.239  -50.222  22.848  1.00 98.22  ? 46   LEU B C   1 
ATOM   2138  O O   . LEU B  2 53  ? 34.012  -49.316  22.047  1.00 95.46  ? 46   LEU B O   1 
ATOM   2139  C CB  . LEU B  2 53  ? 32.805  -49.571  24.800  1.00 67.38  ? 46   LEU B CB  1 
ATOM   2140  C CG  . LEU B  2 53  ? 31.361  -49.467  25.303  1.00 58.66  ? 46   LEU B CG  1 
ATOM   2141  C CD1 . LEU B  2 53  ? 30.844  -50.798  25.827  1.00 57.37  ? 46   LEU B CD1 1 
ATOM   2142  C CD2 . LEU B  2 53  ? 31.254  -48.392  26.376  1.00 54.34  ? 46   LEU B CD2 1 
ATOM   2143  N N   . GLY B  2 54  ? 35.410  -50.847  22.927  1.00 117.38 ? 47   GLY B N   1 
ATOM   2144  C CA  . GLY B  2 54  ? 36.534  -50.496  22.081  1.00 120.40 ? 47   GLY B CA  1 
ATOM   2145  C C   . GLY B  2 54  ? 37.405  -49.452  22.747  1.00 118.81 ? 47   GLY B C   1 
ATOM   2146  O O   . GLY B  2 54  ? 37.326  -49.247  23.958  1.00 119.99 ? 47   GLY B O   1 
ATOM   2147  N N   . GLY B  2 55  ? 38.238  -48.786  21.954  1.00 110.91 ? 48   GLY B N   1 
ATOM   2148  C CA  . GLY B  2 55  ? 39.043  -47.690  22.457  1.00 102.79 ? 48   GLY B CA  1 
ATOM   2149  C C   . GLY B  2 55  ? 38.176  -46.469  22.687  1.00 90.32  ? 48   GLY B C   1 
ATOM   2150  O O   . GLY B  2 55  ? 36.948  -46.568  22.678  1.00 93.31  ? 48   GLY B O   1 
ATOM   2151  N N   . ASP B  2 56  ? 38.814  -45.324  22.919  1.00 83.88  ? 49   ASP B N   1 
ATOM   2152  C CA  . ASP B  2 56  ? 38.121  -44.042  23.064  1.00 79.39  ? 49   ASP B CA  1 
ATOM   2153  C C   . ASP B  2 56  ? 37.212  -43.974  24.298  1.00 74.11  ? 49   ASP B C   1 
ATOM   2154  O O   . ASP B  2 56  ? 36.647  -42.924  24.595  1.00 72.66  ? 49   ASP B O   1 
ATOM   2155  C CB  . ASP B  2 56  ? 37.300  -43.742  21.802  1.00 83.57  ? 49   ASP B CB  1 
ATOM   2156  C CG  . ASP B  2 56  ? 37.520  -42.337  21.280  1.00 88.52  ? 49   ASP B CG  1 
ATOM   2157  O OD1 . ASP B  2 56  ? 37.778  -41.430  22.096  1.00 88.48  ? 49   ASP B OD1 1 
ATOM   2158  O OD2 . ASP B  2 56  ? 37.433  -42.142  20.049  1.00 92.77  ? 49   ASP B OD2 1 
ATOM   2159  N N   . HIS B  2 57  ? 37.077  -45.086  25.017  1.00 68.83  ? 50   HIS B N   1 
ATOM   2160  C CA  . HIS B  2 57  ? 36.208  -45.139  26.189  1.00 62.76  ? 50   HIS B CA  1 
ATOM   2161  C C   . HIS B  2 57  ? 36.990  -45.495  27.449  1.00 61.50  ? 50   HIS B C   1 
ATOM   2162  O O   . HIS B  2 57  ? 37.911  -46.311  27.410  1.00 63.77  ? 50   HIS B O   1 
ATOM   2163  C CB  . HIS B  2 57  ? 35.077  -46.147  25.973  1.00 59.13  ? 50   HIS B CB  1 
ATOM   2164  C CG  . HIS B  2 57  ? 34.208  -45.836  24.795  1.00 57.86  ? 50   HIS B CG  1 
ATOM   2165  N ND1 . HIS B  2 57  ? 33.391  -44.727  24.747  1.00 56.89  ? 50   HIS B ND1 1 
ATOM   2166  C CD2 . HIS B  2 57  ? 34.026  -46.488  23.623  1.00 57.28  ? 50   HIS B CD2 1 
ATOM   2167  C CE1 . HIS B  2 57  ? 32.744  -44.709  23.595  1.00 56.80  ? 50   HIS B CE1 1 
ATOM   2168  N NE2 . HIS B  2 57  ? 33.112  -45.767  22.895  1.00 57.21  ? 50   HIS B NE2 1 
ATOM   2169  N N   . LEU B  2 58  ? 36.617  -44.878  28.565  1.00 59.11  ? 51   LEU B N   1 
ATOM   2170  C CA  . LEU B  2 58  ? 37.336  -45.063  29.822  1.00 61.13  ? 51   LEU B CA  1 
ATOM   2171  C C   . LEU B  2 58  ? 36.442  -45.616  30.928  1.00 60.38  ? 51   LEU B C   1 
ATOM   2172  O O   . LEU B  2 58  ? 35.216  -45.594  30.821  1.00 55.77  ? 51   LEU B O   1 
ATOM   2173  C CB  . LEU B  2 58  ? 37.961  -43.741  30.274  1.00 65.20  ? 51   LEU B CB  1 
ATOM   2174  C CG  . LEU B  2 58  ? 39.420  -43.480  29.890  1.00 70.44  ? 51   LEU B CG  1 
ATOM   2175  C CD1 . LEU B  2 58  ? 39.630  -43.549  28.384  1.00 73.12  ? 51   LEU B CD1 1 
ATOM   2176  C CD2 . LEU B  2 58  ? 39.872  -42.134  30.430  1.00 71.03  ? 51   LEU B CD2 1 
ATOM   2177  N N   . ALA B  2 59  ? 37.070  -46.109  31.991  1.00 64.13  ? 52   ALA B N   1 
ATOM   2178  C CA  . ALA B  2 59  ? 36.347  -46.677  33.123  1.00 57.97  ? 52   ALA B CA  1 
ATOM   2179  C C   . ALA B  2 59  ? 36.796  -46.047  34.438  1.00 42.68  ? 52   ALA B C   1 
ATOM   2180  O O   . ALA B  2 59  ? 37.930  -45.585  34.560  1.00 44.24  ? 52   ALA B O   1 
ATOM   2181  C CB  . ALA B  2 59  ? 36.536  -48.182  33.169  1.00 58.19  ? 52   ALA B CB  1 
ATOM   2182  N N   . PHE B  2 60  ? 35.900  -46.033  35.421  1.00 41.51  ? 53   PHE B N   1 
ATOM   2183  C CA  . PHE B  2 60  ? 36.197  -45.430  36.716  1.00 56.39  ? 53   PHE B CA  1 
ATOM   2184  C C   . PHE B  2 60  ? 35.667  -46.275  37.870  1.00 56.93  ? 53   PHE B C   1 
ATOM   2185  O O   . PHE B  2 60  ? 34.693  -47.013  37.718  1.00 57.45  ? 53   PHE B O   1 
ATOM   2186  C CB  . PHE B  2 60  ? 35.611  -44.018  36.795  1.00 54.03  ? 53   PHE B CB  1 
ATOM   2187  C CG  . PHE B  2 60  ? 36.177  -43.068  35.778  1.00 48.86  ? 53   PHE B CG  1 
ATOM   2188  C CD1 . PHE B  2 60  ? 37.324  -42.342  36.053  1.00 51.77  ? 53   PHE B CD1 1 
ATOM   2189  C CD2 . PHE B  2 60  ? 35.561  -42.898  34.549  1.00 44.39  ? 53   PHE B CD2 1 
ATOM   2190  C CE1 . PHE B  2 60  ? 37.847  -41.467  35.120  1.00 52.20  ? 53   PHE B CE1 1 
ATOM   2191  C CE2 . PHE B  2 60  ? 36.079  -42.025  33.612  1.00 42.35  ? 53   PHE B CE2 1 
ATOM   2192  C CZ  . PHE B  2 60  ? 37.224  -41.308  33.899  1.00 47.71  ? 53   PHE B CZ  1 
ATOM   2193  N N   . SER B  2 61  ? 36.316  -46.160  39.024  1.00 61.76  ? 54   SER B N   1 
ATOM   2194  C CA  . SER B  2 61  ? 35.883  -46.865  40.224  1.00 61.97  ? 54   SER B CA  1 
ATOM   2195  C C   . SER B  2 61  ? 35.255  -45.892  41.215  1.00 59.62  ? 54   SER B C   1 
ATOM   2196  O O   . SER B  2 61  ? 35.885  -44.914  41.618  1.00 62.60  ? 54   SER B O   1 
ATOM   2197  C CB  . SER B  2 61  ? 37.057  -47.599  40.874  1.00 67.43  ? 54   SER B CB  1 
ATOM   2198  O OG  . SER B  2 61  ? 36.641  -48.291  42.039  1.00 70.28  ? 54   SER B OG  1 
ATOM   2199  N N   . CYS B  2 62  ? 34.014  -46.163  41.607  1.00 54.88  ? 55   CYS B N   1 
ATOM   2200  C CA  . CYS B  2 62  ? 33.290  -45.254  42.487  1.00 53.56  ? 55   CYS B CA  1 
ATOM   2201  C C   . CYS B  2 62  ? 32.125  -45.917  43.212  1.00 46.04  ? 55   CYS B C   1 
ATOM   2202  O O   . CYS B  2 62  ? 31.517  -46.859  42.707  1.00 43.49  ? 55   CYS B O   1 
ATOM   2203  C CB  . CYS B  2 62  ? 32.772  -44.057  41.689  1.00 55.37  ? 55   CYS B CB  1 
ATOM   2204  S SG  . CYS B  2 62  ? 31.702  -42.945  42.625  1.00 45.61  ? 55   CYS B SG  1 
ATOM   2205  N N   . ASP B  2 63  ? 31.826  -45.410  44.403  1.00 47.90  ? 56   ASP B N   1 
ATOM   2206  C CA  . ASP B  2 63  ? 30.638  -45.813  45.145  1.00 49.80  ? 56   ASP B CA  1 
ATOM   2207  C C   . ASP B  2 63  ? 29.672  -44.636  45.196  1.00 49.11  ? 56   ASP B C   1 
ATOM   2208  O O   . ASP B  2 63  ? 29.984  -43.593  45.770  1.00 48.66  ? 56   ASP B O   1 
ATOM   2209  C CB  . ASP B  2 63  ? 31.002  -46.274  46.559  1.00 52.57  ? 56   ASP B CB  1 
ATOM   2210  C CG  . ASP B  2 63  ? 29.847  -46.961  47.270  1.00 57.32  ? 56   ASP B CG  1 
ATOM   2211  O OD1 . ASP B  2 63  ? 28.717  -46.951  46.737  1.00 55.84  ? 56   ASP B OD1 1 
ATOM   2212  O OD2 . ASP B  2 63  ? 30.070  -47.508  48.370  1.00 63.00  ? 56   ASP B OD2 1 
ATOM   2213  N N   . VAL B  2 64  ? 28.500  -44.806  44.592  1.00 50.47  ? 57   VAL B N   1 
ATOM   2214  C CA  . VAL B  2 64  ? 27.519  -43.729  44.516  1.00 52.12  ? 57   VAL B CA  1 
ATOM   2215  C C   . VAL B  2 64  ? 26.996  -43.337  45.896  1.00 52.75  ? 57   VAL B C   1 
ATOM   2216  O O   . VAL B  2 64  ? 26.534  -42.214  46.096  1.00 52.01  ? 57   VAL B O   1 
ATOM   2217  C CB  . VAL B  2 64  ? 26.330  -44.114  43.611  1.00 51.08  ? 57   VAL B CB  1 
ATOM   2218  C CG1 . VAL B  2 64  ? 26.798  -44.300  42.177  1.00 49.33  ? 57   VAL B CG1 1 
ATOM   2219  C CG2 . VAL B  2 64  ? 25.655  -45.379  44.123  1.00 52.56  ? 57   VAL B CG2 1 
ATOM   2220  N N   . ALA B  2 65  ? 27.085  -44.261  46.848  1.00 57.60  ? 58   ALA B N   1 
ATOM   2221  C CA  . ALA B  2 65  ? 26.617  -44.012  48.206  1.00 62.08  ? 58   ALA B CA  1 
ATOM   2222  C C   . ALA B  2 65  ? 27.552  -43.065  48.957  1.00 65.55  ? 58   ALA B C   1 
ATOM   2223  O O   . ALA B  2 65  ? 27.107  -42.265  49.780  1.00 65.38  ? 58   ALA B O   1 
ATOM   2224  C CB  . ALA B  2 65  ? 26.474  -45.323  48.964  1.00 64.12  ? 58   ALA B CB  1 
ATOM   2225  N N   . LYS B  2 66  ? 28.847  -43.162  48.670  1.00 65.53  ? 59   LYS B N   1 
ATOM   2226  C CA  . LYS B  2 66  ? 29.841  -42.311  49.318  1.00 62.19  ? 59   LYS B CA  1 
ATOM   2227  C C   . LYS B  2 66  ? 29.922  -40.950  48.635  1.00 57.88  ? 59   LYS B C   1 
ATOM   2228  O O   . LYS B  2 66  ? 30.068  -40.867  47.416  1.00 56.02  ? 59   LYS B O   1 
ATOM   2229  C CB  . LYS B  2 66  ? 31.211  -42.990  49.314  1.00 58.53  ? 59   LYS B CB  1 
ATOM   2230  N N   . GLU B  2 67  ? 29.835  -39.886  49.428  1.00 60.69  ? 60   GLU B N   1 
ATOM   2231  C CA  . GLU B  2 67  ? 29.775  -38.529  48.894  1.00 61.41  ? 60   GLU B CA  1 
ATOM   2232  C C   . GLU B  2 67  ? 31.071  -38.094  48.216  1.00 65.72  ? 60   GLU B C   1 
ATOM   2233  O O   . GLU B  2 67  ? 31.047  -37.315  47.264  1.00 65.94  ? 60   GLU B O   1 
ATOM   2234  C CB  . GLU B  2 67  ? 29.424  -37.534  50.005  1.00 67.91  ? 60   GLU B CB  1 
ATOM   2235  C CG  . GLU B  2 67  ? 30.417  -37.502  51.158  1.00 75.10  ? 60   GLU B CG  1 
ATOM   2236  C CD  . GLU B  2 67  ? 30.382  -36.191  51.919  1.00 81.48  ? 60   GLU B CD  1 
ATOM   2237  O OE1 . GLU B  2 67  ? 29.775  -35.224  51.413  1.00 81.85  ? 60   GLU B OE1 1 
ATOM   2238  O OE2 . GLU B  2 67  ? 30.965  -36.126  53.022  1.00 84.89  ? 60   GLU B OE2 1 
ATOM   2239  N N   . HIS B  2 68  ? 32.200  -38.597  48.704  1.00 69.73  ? 61   HIS B N   1 
ATOM   2240  C CA  . HIS B  2 68  ? 33.499  -38.172  48.194  1.00 72.00  ? 61   HIS B CA  1 
ATOM   2241  C C   . HIS B  2 68  ? 33.972  -39.030  47.025  1.00 71.04  ? 61   HIS B C   1 
ATOM   2242  O O   . HIS B  2 68  ? 34.780  -38.584  46.211  1.00 70.26  ? 61   HIS B O   1 
ATOM   2243  C CB  . HIS B  2 68  ? 34.540  -38.186  49.315  1.00 74.75  ? 61   HIS B CB  1 
ATOM   2244  C CG  . HIS B  2 68  ? 34.472  -36.987  50.210  1.00 78.66  ? 61   HIS B CG  1 
ATOM   2245  N ND1 . HIS B  2 68  ? 34.191  -35.723  49.738  1.00 80.10  ? 61   HIS B ND1 1 
ATOM   2246  C CD2 . HIS B  2 68  ? 34.642  -36.861  51.547  1.00 83.48  ? 61   HIS B CD2 1 
ATOM   2247  C CE1 . HIS B  2 68  ? 34.196  -34.868  50.745  1.00 83.88  ? 61   HIS B CE1 1 
ATOM   2248  N NE2 . HIS B  2 68  ? 34.466  -35.533  51.854  1.00 86.50  ? 61   HIS B NE2 1 
ATOM   2249  N N   . ASP B  2 69  ? 33.469  -40.257  46.943  1.00 72.95  ? 62   ASP B N   1 
ATOM   2250  C CA  . ASP B  2 69  ? 33.785  -41.123  45.813  1.00 71.66  ? 62   ASP B CA  1 
ATOM   2251  C C   . ASP B  2 69  ? 33.198  -40.548  44.531  1.00 67.29  ? 62   ASP B C   1 
ATOM   2252  O O   . ASP B  2 69  ? 33.808  -40.630  43.466  1.00 65.41  ? 62   ASP B O   1 
ATOM   2253  C CB  . ASP B  2 69  ? 33.262  -42.542  46.044  1.00 77.52  ? 62   ASP B CB  1 
ATOM   2254  C CG  . ASP B  2 69  ? 34.040  -43.285  47.111  1.00 86.04  ? 62   ASP B CG  1 
ATOM   2255  O OD1 . ASP B  2 69  ? 35.142  -42.822  47.475  1.00 92.14  ? 62   ASP B OD1 1 
ATOM   2256  O OD2 . ASP B  2 69  ? 33.557  -44.338  47.577  1.00 87.09  ? 62   ASP B OD2 1 
ATOM   2257  N N   . VAL B  2 70  ? 32.011  -39.962  44.646  1.00 64.29  ? 63   VAL B N   1 
ATOM   2258  C CA  . VAL B  2 70  ? 31.328  -39.368  43.504  1.00 57.74  ? 63   VAL B CA  1 
ATOM   2259  C C   . VAL B  2 70  ? 32.031  -38.100  43.031  1.00 55.70  ? 63   VAL B C   1 
ATOM   2260  O O   . VAL B  2 70  ? 32.277  -37.923  41.838  1.00 55.47  ? 63   VAL B O   1 
ATOM   2261  C CB  . VAL B  2 70  ? 29.860  -39.035  43.840  1.00 51.39  ? 63   VAL B CB  1 
ATOM   2262  C CG1 . VAL B  2 70  ? 29.165  -38.415  42.637  1.00 47.55  ? 63   VAL B CG1 1 
ATOM   2263  C CG2 . VAL B  2 70  ? 29.125  -40.283  44.304  1.00 47.93  ? 63   VAL B CG2 1 
ATOM   2264  N N   . GLN B  2 71  ? 32.358  -37.224  43.976  1.00 56.94  ? 64   GLN B N   1 
ATOM   2265  C CA  . GLN B  2 71  ? 32.968  -35.938  43.654  1.00 59.54  ? 64   GLN B CA  1 
ATOM   2266  C C   . GLN B  2 71  ? 34.362  -36.107  43.057  1.00 62.36  ? 64   GLN B C   1 
ATOM   2267  O O   . GLN B  2 71  ? 34.741  -35.389  42.132  1.00 62.50  ? 64   GLN B O   1 
ATOM   2268  C CB  . GLN B  2 71  ? 33.029  -35.055  44.902  1.00 61.90  ? 64   GLN B CB  1 
ATOM   2269  C CG  . GLN B  2 71  ? 33.415  -33.613  44.623  1.00 66.43  ? 64   GLN B CG  1 
ATOM   2270  C CD  . GLN B  2 71  ? 33.010  -32.678  45.745  1.00 74.55  ? 64   GLN B CD  1 
ATOM   2271  O OE1 . GLN B  2 71  ? 32.433  -33.104  46.745  1.00 77.46  ? 64   GLN B OE1 1 
ATOM   2272  N NE2 . GLN B  2 71  ? 33.307  -31.393  45.581  1.00 78.58  ? 64   GLN B NE2 1 
ATOM   2273  N N   . ASN B  2 72  ? 35.121  -37.061  43.587  1.00 60.52  ? 65   ASN B N   1 
ATOM   2274  C CA  . ASN B  2 72  ? 36.459  -37.340  43.078  1.00 58.74  ? 65   ASN B CA  1 
ATOM   2275  C C   . ASN B  2 72  ? 36.414  -38.046  41.727  1.00 52.22  ? 65   ASN B C   1 
ATOM   2276  O O   . ASN B  2 72  ? 37.377  -38.007  40.963  1.00 50.53  ? 65   ASN B O   1 
ATOM   2277  C CB  . ASN B  2 72  ? 37.251  -38.181  44.081  1.00 58.77  ? 65   ASN B CB  1 
ATOM   2278  C CG  . ASN B  2 72  ? 37.535  -37.435  45.371  1.00 63.91  ? 65   ASN B CG  1 
ATOM   2279  O OD1 . ASN B  2 72  ? 37.747  -36.222  45.367  1.00 66.28  ? 65   ASN B OD1 1 
ATOM   2280  N ND2 . ASN B  2 72  ? 37.539  -38.159  46.484  1.00 66.22  ? 65   ASN B ND2 1 
ATOM   2281  N N   . THR B  2 73  ? 35.288  -38.692  41.438  1.00 50.45  ? 66   THR B N   1 
ATOM   2282  C CA  . THR B  2 73  ? 35.103  -39.376  40.164  1.00 50.44  ? 66   THR B CA  1 
ATOM   2283  C C   . THR B  2 73  ? 34.689  -38.383  39.084  1.00 49.06  ? 66   THR B C   1 
ATOM   2284  O O   . THR B  2 73  ? 35.111  -38.491  37.933  1.00 50.26  ? 66   THR B O   1 
ATOM   2285  C CB  . THR B  2 73  ? 34.049  -40.493  40.269  1.00 52.14  ? 66   THR B CB  1 
ATOM   2286  O OG1 . THR B  2 73  ? 34.362  -41.341  41.380  1.00 59.57  ? 66   THR B OG1 1 
ATOM   2287  C CG2 . THR B  2 73  ? 34.017  -41.325  38.995  1.00 49.93  ? 66   THR B CG2 1 
ATOM   2288  N N   . PHE B  2 74  ? 33.865  -37.413  39.465  1.00 50.92  ? 67   PHE B N   1 
ATOM   2289  C CA  . PHE B  2 74  ? 33.452  -36.358  38.546  1.00 58.78  ? 67   PHE B CA  1 
ATOM   2290  C C   . PHE B  2 74  ? 34.607  -35.407  38.250  1.00 64.93  ? 67   PHE B C   1 
ATOM   2291  O O   . PHE B  2 74  ? 34.576  -34.664  37.270  1.00 68.70  ? 67   PHE B O   1 
ATOM   2292  C CB  . PHE B  2 74  ? 32.263  -35.582  39.114  1.00 61.94  ? 67   PHE B CB  1 
ATOM   2293  C CG  . PHE B  2 74  ? 30.927  -36.131  38.700  1.00 62.46  ? 67   PHE B CG  1 
ATOM   2294  C CD1 . PHE B  2 74  ? 30.366  -37.208  39.366  1.00 61.86  ? 67   PHE B CD1 1 
ATOM   2295  C CD2 . PHE B  2 74  ? 30.232  -35.568  37.642  1.00 58.20  ? 67   PHE B CD2 1 
ATOM   2296  C CE1 . PHE B  2 74  ? 29.136  -37.711  38.987  1.00 56.89  ? 67   PHE B CE1 1 
ATOM   2297  C CE2 . PHE B  2 74  ? 29.002  -36.068  37.258  1.00 54.18  ? 67   PHE B CE2 1 
ATOM   2298  C CZ  . PHE B  2 74  ? 28.454  -37.141  37.930  1.00 51.96  ? 67   PHE B CZ  1 
ATOM   2299  N N   . GLU B  2 75  ? 35.624  -35.434  39.106  1.00 63.04  ? 68   GLU B N   1 
ATOM   2300  C CA  . GLU B  2 75  ? 36.830  -34.647  38.883  1.00 62.58  ? 68   GLU B CA  1 
ATOM   2301  C C   . GLU B  2 75  ? 37.787  -35.400  37.965  1.00 58.90  ? 68   GLU B C   1 
ATOM   2302  O O   . GLU B  2 75  ? 38.548  -34.793  37.212  1.00 58.68  ? 68   GLU B O   1 
ATOM   2303  C CB  . GLU B  2 75  ? 37.513  -34.317  40.212  1.00 62.21  ? 68   GLU B CB  1 
ATOM   2304  N N   . GLU B  2 76  ? 37.740  -36.727  38.034  1.00 55.93  ? 69   GLU B N   1 
ATOM   2305  C CA  . GLU B  2 76  ? 38.587  -37.572  37.201  1.00 56.48  ? 69   GLU B CA  1 
ATOM   2306  C C   . GLU B  2 76  ? 37.980  -37.762  35.815  1.00 57.52  ? 69   GLU B C   1 
ATOM   2307  O O   . GLU B  2 76  ? 38.698  -37.849  34.819  1.00 63.67  ? 69   GLU B O   1 
ATOM   2308  C CB  . GLU B  2 76  ? 38.812  -38.931  37.868  1.00 51.11  ? 69   GLU B CB  1 
ATOM   2309  N N   . LEU B  2 77  ? 36.654  -37.826  35.759  1.00 56.09  ? 70   LEU B N   1 
ATOM   2310  C CA  . LEU B  2 77  ? 35.948  -37.991  34.494  1.00 57.63  ? 70   LEU B CA  1 
ATOM   2311  C C   . LEU B  2 77  ? 35.998  -36.710  33.668  1.00 66.01  ? 70   LEU B C   1 
ATOM   2312  O O   . LEU B  2 77  ? 35.795  -36.735  32.454  1.00 72.62  ? 70   LEU B O   1 
ATOM   2313  C CB  . LEU B  2 77  ? 34.495  -38.403  34.738  1.00 52.36  ? 70   LEU B CB  1 
ATOM   2314  N N   . GLU B  2 78  ? 36.271  -35.593  34.334  1.00 63.64  ? 71   GLU B N   1 
ATOM   2315  C CA  . GLU B  2 78  ? 36.318  -34.298  33.667  1.00 61.92  ? 71   GLU B CA  1 
ATOM   2316  C C   . GLU B  2 78  ? 37.725  -33.960  33.185  1.00 66.15  ? 71   GLU B C   1 
ATOM   2317  O O   . GLU B  2 78  ? 37.915  -33.023  32.410  1.00 72.92  ? 71   GLU B O   1 
ATOM   2318  C CB  . GLU B  2 78  ? 35.808  -33.198  34.600  1.00 64.13  ? 71   GLU B CB  1 
ATOM   2319  N N   . LYS B  2 79  ? 38.708  -34.727  33.645  1.00 62.04  ? 72   LYS B N   1 
ATOM   2320  C CA  . LYS B  2 79  ? 40.100  -34.476  33.286  1.00 62.87  ? 72   LYS B CA  1 
ATOM   2321  C C   . LYS B  2 79  ? 40.578  -35.412  32.181  1.00 60.76  ? 72   LYS B C   1 
ATOM   2322  O O   . LYS B  2 79  ? 41.738  -35.358  31.772  1.00 62.75  ? 72   LYS B O   1 
ATOM   2323  C CB  . LYS B  2 79  ? 41.000  -34.619  34.515  1.00 57.64  ? 72   LYS B CB  1 
ATOM   2324  N N   . HIS B  2 80  ? 39.681  -36.266  31.698  1.00 60.43  ? 73   HIS B N   1 
ATOM   2325  C CA  . HIS B  2 80  ? 40.030  -37.235  30.664  1.00 62.15  ? 73   HIS B CA  1 
ATOM   2326  C C   . HIS B  2 80  ? 39.066  -37.189  29.482  1.00 63.97  ? 73   HIS B C   1 
ATOM   2327  O O   . HIS B  2 80  ? 39.474  -37.341  28.330  1.00 64.91  ? 73   HIS B O   1 
ATOM   2328  C CB  . HIS B  2 80  ? 40.062  -38.649  31.248  1.00 60.62  ? 73   HIS B CB  1 
ATOM   2329  C CG  . HIS B  2 80  ? 41.119  -38.853  32.287  1.00 62.39  ? 73   HIS B CG  1 
ATOM   2330  N ND1 . HIS B  2 80  ? 40.979  -38.419  33.588  1.00 62.92  ? 73   HIS B ND1 1 
ATOM   2331  C CD2 . HIS B  2 80  ? 42.334  -39.447  32.218  1.00 62.34  ? 73   HIS B CD2 1 
ATOM   2332  C CE1 . HIS B  2 80  ? 42.062  -38.736  34.275  1.00 64.78  ? 73   HIS B CE1 1 
ATOM   2333  N NE2 . HIS B  2 80  ? 42.900  -39.361  33.467  1.00 65.08  ? 73   HIS B NE2 1 
ATOM   2334  N N   . LEU B  2 81  ? 37.787  -36.982  29.774  1.00 61.73  ? 74   LEU B N   1 
ATOM   2335  C CA  . LEU B  2 81  ? 36.751  -37.000  28.747  1.00 61.96  ? 74   LEU B CA  1 
ATOM   2336  C C   . LEU B  2 81  ? 36.316  -35.595  28.350  1.00 64.25  ? 74   LEU B C   1 
ATOM   2337  O O   . LEU B  2 81  ? 36.001  -35.335  27.189  1.00 66.80  ? 74   LEU B O   1 
ATOM   2338  C CB  . LEU B  2 81  ? 35.540  -37.794  29.235  1.00 55.24  ? 74   LEU B CB  1 
ATOM   2339  C CG  . LEU B  2 81  ? 35.820  -39.195  29.777  1.00 51.62  ? 74   LEU B CG  1 
ATOM   2340  C CD1 . LEU B  2 81  ? 34.612  -39.704  30.534  1.00 50.26  ? 74   LEU B CD1 1 
ATOM   2341  C CD2 . LEU B  2 81  ? 36.190  -40.147  28.651  1.00 51.53  ? 74   LEU B CD2 1 
ATOM   2342  N N   . GLY B  2 82  ? 36.299  -34.693  29.325  1.00 63.35  ? 75   GLY B N   1 
ATOM   2343  C CA  . GLY B  2 82  ? 35.819  -33.342  29.106  1.00 63.73  ? 75   GLY B CA  1 
ATOM   2344  C C   . GLY B  2 82  ? 34.633  -33.048  30.000  1.00 66.65  ? 75   GLY B C   1 
ATOM   2345  O O   . GLY B  2 82  ? 34.565  -33.532  31.129  1.00 68.46  ? 75   GLY B O   1 
ATOM   2346  N N   . ARG B  2 83  ? 33.688  -32.263  29.497  1.00 63.30  ? 76   ARG B N   1 
ATOM   2347  C CA  . ARG B  2 83  ? 32.517  -31.900  30.284  1.00 60.32  ? 76   ARG B CA  1 
ATOM   2348  C C   . ARG B  2 83  ? 31.360  -32.864  30.050  1.00 59.00  ? 76   ARG B C   1 
ATOM   2349  O O   . ARG B  2 83  ? 30.939  -33.087  28.915  1.00 63.21  ? 76   ARG B O   1 
ATOM   2350  C CB  . ARG B  2 83  ? 32.094  -30.465  29.970  1.00 58.80  ? 76   ARG B CB  1 
ATOM   2351  C CG  . ARG B  2 83  ? 33.082  -29.438  30.491  1.00 61.12  ? 76   ARG B CG  1 
ATOM   2352  C CD  . ARG B  2 83  ? 32.800  -28.048  29.963  1.00 62.43  ? 76   ARG B CD  1 
ATOM   2353  N NE  . ARG B  2 83  ? 34.024  -27.420  29.476  1.00 63.97  ? 76   ARG B NE  1 
ATOM   2354  C CZ  . ARG B  2 83  ? 34.152  -26.124  29.218  1.00 67.03  ? 76   ARG B CZ  1 
ATOM   2355  N NH1 . ARG B  2 83  ? 33.128  -25.302  29.408  1.00 67.97  ? 76   ARG B NH1 1 
ATOM   2356  N NH2 . ARG B  2 83  ? 35.307  -25.648  28.775  1.00 70.18  ? 76   ARG B NH2 1 
ATOM   2357  N N   . VAL B  2 84  ? 30.855  -33.434  31.139  1.00 54.54  ? 77   VAL B N   1 
ATOM   2358  C CA  . VAL B  2 84  ? 29.767  -34.402  31.073  1.00 51.28  ? 77   VAL B CA  1 
ATOM   2359  C C   . VAL B  2 84  ? 28.421  -33.712  30.881  1.00 47.51  ? 77   VAL B C   1 
ATOM   2360  O O   . VAL B  2 84  ? 28.020  -32.875  31.689  1.00 49.09  ? 77   VAL B O   1 
ATOM   2361  C CB  . VAL B  2 84  ? 29.710  -35.271  32.345  1.00 47.71  ? 77   VAL B CB  1 
ATOM   2362  C CG1 . VAL B  2 84  ? 28.563  -36.267  32.257  1.00 42.82  ? 77   VAL B CG1 1 
ATOM   2363  C CG2 . VAL B  2 84  ? 31.034  -35.990  32.555  1.00 46.41  ? 77   VAL B CG2 1 
ATOM   2364  N N   . ASN B  2 85  ? 27.729  -34.068  29.805  1.00 47.28  ? 78   ASN B N   1 
ATOM   2365  C CA  . ASN B  2 85  ? 26.421  -33.497  29.511  1.00 48.61  ? 78   ASN B CA  1 
ATOM   2366  C C   . ASN B  2 85  ? 25.342  -34.572  29.412  1.00 43.05  ? 78   ASN B C   1 
ATOM   2367  O O   . ASN B  2 85  ? 24.197  -34.288  29.061  1.00 36.14  ? 78   ASN B O   1 
ATOM   2368  C CB  . ASN B  2 85  ? 26.479  -32.679  28.219  1.00 54.15  ? 78   ASN B CB  1 
ATOM   2369  C CG  . ASN B  2 85  ? 27.270  -33.371  27.125  1.00 57.87  ? 78   ASN B CG  1 
ATOM   2370  O OD1 . ASN B  2 85  ? 28.029  -34.304  27.387  1.00 58.59  ? 78   ASN B OD1 1 
ATOM   2371  N ND2 . ASN B  2 85  ? 27.103  -32.908  25.890  1.00 57.81  ? 78   ASN B ND2 1 
ATOM   2372  N N   . PHE B  2 86  ? 25.720  -35.809  29.721  1.00 37.89  ? 79   PHE B N   1 
ATOM   2373  C CA  . PHE B  2 86  ? 24.784  -36.927  29.736  1.00 40.27  ? 79   PHE B CA  1 
ATOM   2374  C C   . PHE B  2 86  ? 25.055  -37.830  30.935  1.00 42.47  ? 79   PHE B C   1 
ATOM   2375  O O   . PHE B  2 86  ? 26.181  -38.282  31.139  1.00 42.13  ? 79   PHE B O   1 
ATOM   2376  C CB  . PHE B  2 86  ? 24.873  -37.729  28.435  1.00 42.69  ? 79   PHE B CB  1 
ATOM   2377  C CG  . PHE B  2 86  ? 24.273  -37.030  27.249  1.00 46.25  ? 79   PHE B CG  1 
ATOM   2378  C CD1 . PHE B  2 86  ? 24.991  -36.073  26.553  1.00 47.22  ? 79   PHE B CD1 1 
ATOM   2379  C CD2 . PHE B  2 86  ? 22.988  -37.332  26.830  1.00 49.54  ? 79   PHE B CD2 1 
ATOM   2380  C CE1 . PHE B  2 86  ? 24.437  -35.425  25.468  1.00 50.52  ? 79   PHE B CE1 1 
ATOM   2381  C CE2 . PHE B  2 86  ? 22.431  -36.690  25.740  1.00 54.12  ? 79   PHE B CE2 1 
ATOM   2382  C CZ  . PHE B  2 86  ? 23.157  -35.736  25.058  1.00 53.94  ? 79   PHE B CZ  1 
ATOM   2383  N N   . LEU B  2 87  ? 24.021  -38.088  31.728  1.00 42.35  ? 80   LEU B N   1 
ATOM   2384  C CA  . LEU B  2 87  ? 24.174  -38.892  32.934  1.00 38.55  ? 80   LEU B CA  1 
ATOM   2385  C C   . LEU B  2 87  ? 23.151  -40.020  32.993  1.00 39.50  ? 80   LEU B C   1 
ATOM   2386  O O   . LEU B  2 87  ? 21.952  -39.792  32.840  1.00 40.72  ? 80   LEU B O   1 
ATOM   2387  C CB  . LEU B  2 87  ? 24.050  -38.013  34.180  1.00 37.44  ? 80   LEU B CB  1 
ATOM   2388  C CG  . LEU B  2 87  ? 24.209  -38.720  35.528  1.00 37.34  ? 80   LEU B CG  1 
ATOM   2389  C CD1 . LEU B  2 87  ? 25.613  -39.280  35.674  1.00 37.56  ? 80   LEU B CD1 1 
ATOM   2390  C CD2 . LEU B  2 87  ? 23.883  -37.778  36.676  1.00 38.35  ? 80   LEU B CD2 1 
ATOM   2391  N N   . VAL B  2 88  ? 23.633  -41.238  33.217  1.00 39.54  ? 81   VAL B N   1 
ATOM   2392  C CA  . VAL B  2 88  ? 22.756  -42.393  33.369  1.00 36.71  ? 81   VAL B CA  1 
ATOM   2393  C C   . VAL B  2 88  ? 22.976  -43.063  34.722  1.00 40.00  ? 81   VAL B C   1 
ATOM   2394  O O   . VAL B  2 88  ? 24.023  -43.665  34.968  1.00 38.72  ? 81   VAL B O   1 
ATOM   2395  C CB  . VAL B  2 88  ? 22.974  -43.425  32.245  1.00 33.95  ? 81   VAL B CB  1 
ATOM   2396  C CG1 . VAL B  2 88  ? 22.162  -44.684  32.515  1.00 34.29  ? 81   VAL B CG1 1 
ATOM   2397  C CG2 . VAL B  2 88  ? 22.606  -42.826  30.896  1.00 31.23  ? 81   VAL B CG2 1 
ATOM   2398  N N   . ASN B  2 89  ? 21.985  -42.945  35.599  1.00 40.15  ? 82   ASN B N   1 
ATOM   2399  C CA  . ASN B  2 89  ? 22.050  -43.557  36.920  1.00 40.92  ? 82   ASN B CA  1 
ATOM   2400  C C   . ASN B  2 89  ? 21.461  -44.960  36.928  1.00 40.16  ? 82   ASN B C   1 
ATOM   2401  O O   . ASN B  2 89  ? 20.302  -45.155  37.293  1.00 40.26  ? 82   ASN B O   1 
ATOM   2402  C CB  . ASN B  2 89  ? 21.327  -42.685  37.948  1.00 40.17  ? 82   ASN B CB  1 
ATOM   2403  C CG  . ASN B  2 89  ? 22.185  -41.540  38.445  1.00 41.73  ? 82   ASN B CG  1 
ATOM   2404  O OD1 . ASN B  2 89  ? 23.364  -41.721  38.748  1.00 43.79  ? 82   ASN B OD1 1 
ATOM   2405  N ND2 . ASN B  2 89  ? 21.598  -40.352  38.527  1.00 40.24  ? 82   ASN B ND2 1 
ATOM   2406  N N   . ALA B  2 90  ? 22.268  -45.935  36.524  1.00 45.75  ? 83   ALA B N   1 
ATOM   2407  C CA  . ALA B  2 90  ? 21.825  -47.322  36.479  1.00 50.02  ? 83   ALA B CA  1 
ATOM   2408  C C   . ALA B  2 90  ? 22.517  -48.154  37.551  1.00 55.07  ? 83   ALA B C   1 
ATOM   2409  O O   . ALA B  2 90  ? 22.605  -49.377  37.440  1.00 62.73  ? 83   ALA B O   1 
ATOM   2410  C CB  . ALA B  2 90  ? 22.078  -47.912  35.104  1.00 52.61  ? 83   ALA B CB  1 
ATOM   2411  N N   . ALA B  2 91  ? 23.013  -47.486  38.587  1.00 49.80  ? 84   ALA B N   1 
ATOM   2412  C CA  . ALA B  2 91  ? 23.627  -48.176  39.713  1.00 47.28  ? 84   ALA B CA  1 
ATOM   2413  C C   . ALA B  2 91  ? 22.592  -48.413  40.804  1.00 48.54  ? 84   ALA B C   1 
ATOM   2414  O O   . ALA B  2 91  ? 21.971  -47.471  41.295  1.00 51.58  ? 84   ALA B O   1 
ATOM   2415  C CB  . ALA B  2 91  ? 24.804  -47.381  40.254  1.00 46.81  ? 84   ALA B CB  1 
ATOM   2416  N N   . GLY B  2 92  ? 22.404  -49.674  41.179  1.00 43.52  ? 85   GLY B N   1 
ATOM   2417  C CA  . GLY B  2 92  ? 21.418  -50.015  42.185  1.00 45.81  ? 85   GLY B CA  1 
ATOM   2418  C C   . GLY B  2 92  ? 21.571  -51.410  42.759  1.00 48.75  ? 85   GLY B C   1 
ATOM   2419  O O   . GLY B  2 92  ? 22.242  -52.266  42.182  1.00 47.41  ? 85   GLY B O   1 
ATOM   2420  N N   . ILE B  2 93  ? 20.944  -51.631  43.909  1.00 50.88  ? 86   ILE B N   1 
ATOM   2421  C CA  . ILE B  2 93  ? 20.949  -52.935  44.558  1.00 53.49  ? 86   ILE B CA  1 
ATOM   2422  C C   . ILE B  2 93  ? 19.537  -53.319  44.988  1.00 56.24  ? 86   ILE B C   1 
ATOM   2423  O O   . ILE B  2 93  ? 18.719  -52.454  45.308  1.00 50.75  ? 86   ILE B O   1 
ATOM   2424  C CB  . ILE B  2 93  ? 21.882  -52.958  45.786  1.00 53.08  ? 86   ILE B CB  1 
ATOM   2425  C CG1 . ILE B  2 93  ? 21.515  -51.835  46.758  1.00 44.68  ? 86   ILE B CG1 1 
ATOM   2426  C CG2 . ILE B  2 93  ? 23.337  -52.838  45.357  1.00 55.91  ? 86   ILE B CG2 1 
ATOM   2427  C CD1 . ILE B  2 93  ? 22.380  -51.794  47.999  1.00 43.58  ? 86   ILE B CD1 1 
ATOM   2428  N N   . ASN B  2 94  ? 19.252  -54.617  44.988  1.00 61.55  ? 87   ASN B N   1 
ATOM   2429  C CA  . ASN B  2 94  ? 17.941  -55.102  45.396  1.00 65.14  ? 87   ASN B CA  1 
ATOM   2430  C C   . ASN B  2 94  ? 18.046  -56.281  46.355  1.00 72.83  ? 87   ASN B C   1 
ATOM   2431  O O   . ASN B  2 94  ? 18.802  -57.224  46.121  1.00 78.99  ? 87   ASN B O   1 
ATOM   2432  C CB  . ASN B  2 94  ? 17.108  -55.497  44.174  1.00 63.83  ? 87   ASN B CB  1 
ATOM   2433  C CG  . ASN B  2 94  ? 15.631  -55.660  44.498  1.00 63.85  ? 87   ASN B CG  1 
ATOM   2434  O OD1 . ASN B  2 94  ? 15.247  -55.807  45.659  1.00 66.94  ? 87   ASN B OD1 1 
ATOM   2435  N ND2 . ASN B  2 94  ? 14.795  -55.637  43.468  1.00 61.70  ? 87   ASN B ND2 1 
ATOM   2436  N N   . ARG B  2 95  ? 17.276  -56.216  47.435  1.00 80.84  ? 88   ARG B N   1 
ATOM   2437  C CA  . ARG B  2 95  ? 17.202  -57.302  48.401  1.00 87.89  ? 88   ARG B CA  1 
ATOM   2438  C C   . ARG B  2 95  ? 15.759  -57.494  48.850  1.00 88.57  ? 88   ARG B C   1 
ATOM   2439  O O   . ARG B  2 95  ? 15.231  -56.699  49.628  1.00 92.69  ? 88   ARG B O   1 
ATOM   2440  C CB  . ARG B  2 95  ? 18.105  -57.021  49.604  1.00 93.11  ? 88   ARG B CB  1 
ATOM   2441  N N   . ASP B  2 96  ? 15.121  -58.546  48.348  1.00 78.37  ? 89   ASP B N   1 
ATOM   2442  C CA  . ASP B  2 96  ? 13.721  -58.809  48.658  1.00 70.49  ? 89   ASP B CA  1 
ATOM   2443  C C   . ASP B  2 96  ? 13.537  -59.270  50.098  1.00 65.88  ? 89   ASP B C   1 
ATOM   2444  O O   . ASP B  2 96  ? 14.506  -59.570  50.795  1.00 65.88  ? 89   ASP B O   1 
ATOM   2445  C CB  . ASP B  2 96  ? 13.145  -59.855  47.701  1.00 69.48  ? 89   ASP B CB  1 
ATOM   2446  C CG  . ASP B  2 96  ? 13.081  -59.362  46.271  1.00 69.32  ? 89   ASP B CG  1 
ATOM   2447  O OD1 . ASP B  2 96  ? 13.149  -58.132  46.062  1.00 73.20  ? 89   ASP B OD1 1 
ATOM   2448  O OD2 . ASP B  2 96  ? 12.957  -60.202  45.356  1.00 67.04  ? 89   ASP B OD2 1 
ATOM   2449  N N   . GLY B  2 97  ? 12.284  -59.323  50.535  1.00 61.19  ? 90   GLY B N   1 
ATOM   2450  C CA  . GLY B  2 97  ? 11.963  -59.744  51.885  1.00 63.83  ? 90   GLY B CA  1 
ATOM   2451  C C   . GLY B  2 97  ? 10.896  -58.878  52.521  1.00 59.10  ? 90   GLY B C   1 
ATOM   2452  O O   . GLY B  2 97  ? 10.640  -57.760  52.074  1.00 58.92  ? 90   GLY B O   1 
ATOM   2453  N N   . LEU B  2 98  ? 10.270  -59.398  53.572  1.00 60.25  ? 91   LEU B N   1 
ATOM   2454  C CA  . LEU B  2 98  ? 9.229   -58.670  54.284  1.00 57.68  ? 91   LEU B CA  1 
ATOM   2455  C C   . LEU B  2 98  ? 9.817   -57.485  55.041  1.00 61.61  ? 91   LEU B C   1 
ATOM   2456  O O   . LEU B  2 98  ? 11.033  -57.383  55.203  1.00 64.67  ? 91   LEU B O   1 
ATOM   2457  C CB  . LEU B  2 98  ? 8.493   -59.601  55.249  1.00 59.32  ? 91   LEU B CB  1 
ATOM   2458  C CG  . LEU B  2 98  ? 7.994   -60.916  54.647  1.00 61.04  ? 91   LEU B CG  1 
ATOM   2459  C CD1 . LEU B  2 98  ? 7.304   -61.765  55.704  1.00 65.27  ? 91   LEU B CD1 1 
ATOM   2460  C CD2 . LEU B  2 98  ? 7.065   -60.655  53.470  1.00 57.19  ? 91   LEU B CD2 1 
ATOM   2461  N N   . LEU B  2 99  ? 8.951   -56.590  55.503  1.00 58.23  ? 92   LEU B N   1 
ATOM   2462  C CA  . LEU B  2 99  ? 9.397   -55.408  56.230  1.00 57.06  ? 92   LEU B CA  1 
ATOM   2463  C C   . LEU B  2 99  ? 9.890   -55.772  57.628  1.00 56.90  ? 92   LEU B C   1 
ATOM   2464  O O   . LEU B  2 99  ? 10.863  -55.200  58.122  1.00 56.59  ? 92   LEU B O   1 
ATOM   2465  C CB  . LEU B  2 99  ? 8.270   -54.378  56.318  1.00 53.46  ? 92   LEU B CB  1 
ATOM   2466  C CG  . LEU B  2 99  ? 8.639   -53.027  56.933  1.00 54.24  ? 92   LEU B CG  1 
ATOM   2467  C CD1 . LEU B  2 99  ? 9.764   -52.371  56.149  1.00 55.73  ? 92   LEU B CD1 1 
ATOM   2468  C CD2 . LEU B  2 99  ? 7.425   -52.115  56.995  1.00 54.72  ? 92   LEU B CD2 1 
ATOM   2469  N N   . VAL B  2 100 ? 9.218   -56.729  58.260  1.00 60.54  ? 93   VAL B N   1 
ATOM   2470  C CA  . VAL B  2 100 ? 9.569   -57.146  59.613  1.00 64.65  ? 93   VAL B CA  1 
ATOM   2471  C C   . VAL B  2 100 ? 10.844  -57.985  59.636  1.00 66.54  ? 93   VAL B C   1 
ATOM   2472  O O   . VAL B  2 100 ? 11.558  -58.015  60.638  1.00 72.50  ? 93   VAL B O   1 
ATOM   2473  C CB  . VAL B  2 100 ? 8.427   -57.947  60.270  1.00 65.64  ? 93   VAL B CB  1 
ATOM   2474  C CG1 . VAL B  2 100 ? 7.270   -57.027  60.628  1.00 64.28  ? 93   VAL B CG1 1 
ATOM   2475  C CG2 . VAL B  2 100 ? 7.963   -59.071  59.354  1.00 66.53  ? 93   VAL B CG2 1 
ATOM   2476  N N   . ARG B  2 101 ? 11.126  -58.664  58.529  1.00 62.11  ? 94   ARG B N   1 
ATOM   2477  C CA  . ARG B  2 101 ? 12.310  -59.509  58.438  1.00 63.25  ? 94   ARG B CA  1 
ATOM   2478  C C   . ARG B  2 101 ? 13.506  -58.746  57.883  1.00 60.89  ? 94   ARG B C   1 
ATOM   2479  O O   . ARG B  2 101 ? 14.579  -59.316  57.687  1.00 63.61  ? 94   ARG B O   1 
ATOM   2480  C CB  . ARG B  2 101 ? 12.027  -60.734  57.569  1.00 63.45  ? 94   ARG B CB  1 
ATOM   2481  C CG  . ARG B  2 101 ? 11.373  -61.886  58.308  1.00 67.29  ? 94   ARG B CG  1 
ATOM   2482  C CD  . ARG B  2 101 ? 11.176  -63.072  57.381  1.00 72.86  ? 94   ARG B CD  1 
ATOM   2483  N NE  . ARG B  2 101 ? 11.058  -64.329  58.111  1.00 82.60  ? 94   ARG B NE  1 
ATOM   2484  C CZ  . ARG B  2 101 ? 10.967  -65.521  57.529  1.00 89.60  ? 94   ARG B CZ  1 
ATOM   2485  N NH1 . ARG B  2 101 ? 10.979  -65.615  56.206  1.00 90.67  ? 94   ARG B NH1 1 
ATOM   2486  N NH2 . ARG B  2 101 ? 10.866  -66.617  58.267  1.00 93.22  ? 94   ARG B NH2 1 
ATOM   2487  N N   . THR B  2 102 ? 13.316  -57.456  57.633  1.00 60.62  ? 95   THR B N   1 
ATOM   2488  C CA  . THR B  2 102 ? 14.378  -56.625  57.082  1.00 62.46  ? 95   THR B CA  1 
ATOM   2489  C C   . THR B  2 102 ? 15.049  -55.792  58.166  1.00 63.71  ? 95   THR B C   1 
ATOM   2490  O O   . THR B  2 102 ? 14.404  -54.973  58.821  1.00 65.82  ? 95   THR B O   1 
ATOM   2491  C CB  . THR B  2 102 ? 13.846  -55.685  55.986  1.00 62.33  ? 95   THR B CB  1 
ATOM   2492  O OG1 . THR B  2 102 ? 13.096  -56.440  55.026  1.00 63.64  ? 95   THR B OG1 1 
ATOM   2493  C CG2 . THR B  2 102 ? 14.999  -54.982  55.285  1.00 60.96  ? 95   THR B CG2 1 
ATOM   2494  N N   . LYS B  2 103 ? 16.348  -56.007  58.352  1.00 65.58  ? 96   LYS B N   1 
ATOM   2495  C CA  . LYS B  2 103 ? 17.120  -55.234  59.316  1.00 64.52  ? 96   LYS B CA  1 
ATOM   2496  C C   . LYS B  2 103 ? 17.257  -53.789  58.848  1.00 64.83  ? 96   LYS B C   1 
ATOM   2497  O O   . LYS B  2 103 ? 17.213  -53.511  57.650  1.00 65.86  ? 96   LYS B O   1 
ATOM   2498  C CB  . LYS B  2 103 ? 18.501  -55.857  59.527  1.00 67.95  ? 96   LYS B CB  1 
ATOM   2499  N N   . THR B  2 104 ? 17.419  -52.875  59.800  1.00 62.91  ? 97   THR B N   1 
ATOM   2500  C CA  . THR B  2 104 ? 17.535  -51.453  59.496  1.00 63.70  ? 97   THR B CA  1 
ATOM   2501  C C   . THR B  2 104 ? 18.761  -51.171  58.630  1.00 65.74  ? 97   THR B C   1 
ATOM   2502  O O   . THR B  2 104 ? 18.759  -50.249  57.813  1.00 62.73  ? 97   THR B O   1 
ATOM   2503  C CB  . THR B  2 104 ? 17.610  -50.612  60.788  1.00 66.31  ? 97   THR B CB  1 
ATOM   2504  O OG1 . THR B  2 104 ? 16.498  -50.932  61.633  1.00 68.53  ? 97   THR B OG1 1 
ATOM   2505  C CG2 . THR B  2 104 ? 17.587  -49.122  60.472  1.00 64.12  ? 97   THR B CG2 1 
ATOM   2506  N N   . GLU B  2 105 ? 19.798  -51.985  58.809  1.00 70.24  ? 98   GLU B N   1 
ATOM   2507  C CA  . GLU B  2 105 ? 21.047  -51.845  58.066  1.00 70.92  ? 98   GLU B CA  1 
ATOM   2508  C C   . GLU B  2 105 ? 20.822  -51.847  56.557  1.00 71.35  ? 98   GLU B C   1 
ATOM   2509  O O   . GLU B  2 105 ? 21.310  -50.971  55.843  1.00 68.84  ? 98   GLU B O   1 
ATOM   2510  C CB  . GLU B  2 105 ? 22.011  -52.973  58.438  1.00 71.51  ? 98   GLU B CB  1 
ATOM   2511  C CG  . GLU B  2 105 ? 21.800  -53.539  59.830  1.00 75.66  ? 98   GLU B CG  1 
ATOM   2512  C CD  . GLU B  2 105 ? 22.557  -54.834  60.046  1.00 86.79  ? 98   GLU B CD  1 
ATOM   2513  O OE1 . GLU B  2 105 ? 23.363  -55.204  59.166  1.00 87.23  ? 98   GLU B OE1 1 
ATOM   2514  O OE2 . GLU B  2 105 ? 22.344  -55.484  61.091  1.00 93.69  ? 98   GLU B OE2 1 
ATOM   2515  N N   . ASP B  2 106 ? 20.077  -52.839  56.080  1.00 80.12  ? 99   ASP B N   1 
ATOM   2516  C CA  . ASP B  2 106 ? 19.819  -52.991  54.653  1.00 80.95  ? 99   ASP B CA  1 
ATOM   2517  C C   . ASP B  2 106 ? 18.833  -51.945  54.146  1.00 77.69  ? 99   ASP B C   1 
ATOM   2518  O O   . ASP B  2 106 ? 18.864  -51.570  52.973  1.00 78.63  ? 99   ASP B O   1 
ATOM   2519  C CB  . ASP B  2 106 ? 19.296  -54.397  54.355  1.00 86.21  ? 99   ASP B CB  1 
ATOM   2520  C CG  . ASP B  2 106 ? 20.286  -55.479  54.739  1.00 96.71  ? 99   ASP B CG  1 
ATOM   2521  O OD1 . ASP B  2 106 ? 21.506  -55.215  54.686  1.00 100.67 ? 99   ASP B OD1 1 
ATOM   2522  O OD2 . ASP B  2 106 ? 19.845  -56.592  55.094  1.00 99.51  ? 99   ASP B OD2 1 
ATOM   2523  N N   . MET B  2 107 ? 17.957  -51.481  55.032  1.00 74.21  ? 100  MET B N   1 
ATOM   2524  C CA  . MET B  2 107 ? 17.005  -50.430  54.690  1.00 69.51  ? 100  MET B CA  1 
ATOM   2525  C C   . MET B  2 107 ? 17.741  -49.134  54.369  1.00 68.08  ? 100  MET B C   1 
ATOM   2526  O O   . MET B  2 107 ? 17.370  -48.405  53.449  1.00 64.59  ? 100  MET B O   1 
ATOM   2527  C CB  . MET B  2 107 ? 16.010  -50.210  55.832  1.00 67.20  ? 100  MET B CB  1 
ATOM   2528  C CG  . MET B  2 107 ? 15.110  -51.404  56.105  1.00 67.11  ? 100  MET B CG  1 
ATOM   2529  S SD  . MET B  2 107 ? 14.109  -51.208  57.592  1.00 81.18  ? 100  MET B SD  1 
ATOM   2530  C CE  . MET B  2 107 ? 13.298  -49.652  57.246  1.00 72.45  ? 100  MET B CE  1 
ATOM   2531  N N   . VAL B  2 108 ? 18.791  -48.860  55.136  1.00 63.92  ? 101  VAL B N   1 
ATOM   2532  C CA  . VAL B  2 108 ? 19.635  -47.696  54.903  1.00 57.79  ? 101  VAL B CA  1 
ATOM   2533  C C   . VAL B  2 108 ? 20.526  -47.928  53.684  1.00 54.24  ? 101  VAL B C   1 
ATOM   2534  O O   . VAL B  2 108 ? 20.827  -46.999  52.933  1.00 52.26  ? 101  VAL B O   1 
ATOM   2535  C CB  . VAL B  2 108 ? 20.504  -47.381  56.140  1.00 54.77  ? 101  VAL B CB  1 
ATOM   2536  C CG1 . VAL B  2 108 ? 21.394  -46.175  55.887  1.00 53.79  ? 101  VAL B CG1 1 
ATOM   2537  C CG2 . VAL B  2 108 ? 19.622  -47.147  57.357  1.00 53.30  ? 101  VAL B CG2 1 
ATOM   2538  N N   . SER B  2 109 ? 20.927  -49.180  53.486  1.00 54.92  ? 102  SER B N   1 
ATOM   2539  C CA  . SER B  2 109 ? 21.813  -49.548  52.386  1.00 54.55  ? 102  SER B CA  1 
ATOM   2540  C C   . SER B  2 109 ? 21.194  -49.255  51.020  1.00 53.30  ? 102  SER B C   1 
ATOM   2541  O O   . SER B  2 109 ? 21.824  -48.623  50.171  1.00 52.31  ? 102  SER B O   1 
ATOM   2542  C CB  . SER B  2 109 ? 22.185  -51.030  52.481  1.00 59.77  ? 102  SER B CB  1 
ATOM   2543  O OG  . SER B  2 109 ? 23.066  -51.402  51.436  1.00 62.81  ? 102  SER B OG  1 
ATOM   2544  N N   . GLN B  2 110 ? 19.964  -49.714  50.809  1.00 53.01  ? 103  GLN B N   1 
ATOM   2545  C CA  . GLN B  2 110 ? 19.275  -49.482  49.543  1.00 47.26  ? 103  GLN B CA  1 
ATOM   2546  C C   . GLN B  2 110 ? 18.879  -48.019  49.383  1.00 40.69  ? 103  GLN B C   1 
ATOM   2547  O O   . GLN B  2 110 ? 18.833  -47.500  48.269  1.00 37.38  ? 103  GLN B O   1 
ATOM   2548  C CB  . GLN B  2 110 ? 18.033  -50.367  49.428  1.00 46.95  ? 103  GLN B CB  1 
ATOM   2549  C CG  . GLN B  2 110 ? 18.327  -51.852  49.320  1.00 49.85  ? 103  GLN B CG  1 
ATOM   2550  C CD  . GLN B  2 110 ? 17.151  -52.633  48.767  1.00 51.44  ? 103  GLN B CD  1 
ATOM   2551  O OE1 . GLN B  2 110 ? 16.428  -52.152  47.895  1.00 49.64  ? 103  GLN B OE1 1 
ATOM   2552  N NE2 . GLN B  2 110 ? 16.952  -53.843  49.275  1.00 57.14  ? 103  GLN B NE2 1 
ATOM   2553  N N   . LEU B  2 111 ? 18.587  -47.362  50.502  1.00 40.17  ? 104  LEU B N   1 
ATOM   2554  C CA  . LEU B  2 111 ? 18.216  -45.952  50.490  1.00 47.14  ? 104  LEU B CA  1 
ATOM   2555  C C   . LEU B  2 111 ? 19.362  -45.086  49.984  1.00 49.65  ? 104  LEU B C   1 
ATOM   2556  O O   . LEU B  2 111 ? 19.153  -44.145  49.220  1.00 46.91  ? 104  LEU B O   1 
ATOM   2557  C CB  . LEU B  2 111 ? 17.794  -45.495  51.888  1.00 50.64  ? 104  LEU B CB  1 
ATOM   2558  C CG  . LEU B  2 111 ? 16.315  -45.157  52.085  1.00 51.39  ? 104  LEU B CG  1 
ATOM   2559  C CD1 . LEU B  2 111 ? 15.437  -46.357  51.763  1.00 48.91  ? 104  LEU B CD1 1 
ATOM   2560  C CD2 . LEU B  2 111 ? 16.064  -44.667  53.503  1.00 53.61  ? 104  LEU B CD2 1 
ATOM   2561  N N   . HIS B  2 112 ? 20.576  -45.414  50.412  1.00 53.20  ? 105  HIS B N   1 
ATOM   2562  C CA  . HIS B  2 112 ? 21.752  -44.646  50.028  1.00 50.80  ? 105  HIS B CA  1 
ATOM   2563  C C   . HIS B  2 112 ? 22.212  -44.977  48.613  1.00 46.63  ? 105  HIS B C   1 
ATOM   2564  O O   . HIS B  2 112 ? 22.655  -44.098  47.874  1.00 44.01  ? 105  HIS B O   1 
ATOM   2565  C CB  . HIS B  2 112 ? 22.890  -44.884  51.022  1.00 53.91  ? 105  HIS B CB  1 
ATOM   2566  C CG  . HIS B  2 112 ? 22.705  -44.174  52.327  1.00 57.90  ? 105  HIS B CG  1 
ATOM   2567  N ND1 . HIS B  2 112 ? 23.718  -43.468  52.940  1.00 63.03  ? 105  HIS B ND1 1 
ATOM   2568  C CD2 . HIS B  2 112 ? 21.622  -44.050  53.129  1.00 56.40  ? 105  HIS B CD2 1 
ATOM   2569  C CE1 . HIS B  2 112 ? 23.269  -42.947  54.068  1.00 63.27  ? 105  HIS B CE1 1 
ATOM   2570  N NE2 . HIS B  2 112 ? 21.999  -43.285  54.206  1.00 60.67  ? 105  HIS B NE2 1 
ATOM   2571  N N   . THR B  2 113 ? 22.096  -46.246  48.237  1.00 45.03  ? 106  THR B N   1 
ATOM   2572  C CA  . THR B  2 113 ? 22.555  -46.700  46.931  1.00 48.96  ? 106  THR B CA  1 
ATOM   2573  C C   . THR B  2 113 ? 21.614  -46.269  45.810  1.00 50.00  ? 106  THR B C   1 
ATOM   2574  O O   . THR B  2 113 ? 22.046  -45.697  44.809  1.00 51.78  ? 106  THR B O   1 
ATOM   2575  C CB  . THR B  2 113 ? 22.704  -48.232  46.893  1.00 54.26  ? 106  THR B CB  1 
ATOM   2576  O OG1 . THR B  2 113 ? 23.582  -48.656  47.943  1.00 61.02  ? 106  THR B OG1 1 
ATOM   2577  C CG2 . THR B  2 113 ? 23.266  -48.681  45.553  1.00 53.12  ? 106  THR B CG2 1 
ATOM   2578  N N   . ASN B  2 114 ? 20.326  -46.544  45.985  1.00 47.84  ? 107  ASN B N   1 
ATOM   2579  C CA  . ASN B  2 114 ? 19.344  -46.304  44.935  1.00 43.27  ? 107  ASN B CA  1 
ATOM   2580  C C   . ASN B  2 114 ? 18.845  -44.863  44.878  1.00 44.31  ? 107  ASN B C   1 
ATOM   2581  O O   . ASN B  2 114 ? 18.494  -44.368  43.807  1.00 47.93  ? 107  ASN B O   1 
ATOM   2582  C CB  . ASN B  2 114 ? 18.152  -47.249  45.107  1.00 41.61  ? 107  ASN B CB  1 
ATOM   2583  C CG  . ASN B  2 114 ? 18.564  -48.708  45.126  1.00 42.60  ? 107  ASN B CG  1 
ATOM   2584  O OD1 . ASN B  2 114 ? 19.651  -49.063  44.673  1.00 44.76  ? 107  ASN B OD1 1 
ATOM   2585  N ND2 . ASN B  2 114 ? 17.692  -49.563  45.649  1.00 40.27  ? 107  ASN B ND2 1 
ATOM   2586  N N   . LEU B  2 115 ? 18.812  -44.190  46.024  1.00 41.28  ? 108  LEU B N   1 
ATOM   2587  C CA  . LEU B  2 115 ? 18.241  -42.848  46.088  1.00 45.37  ? 108  LEU B CA  1 
ATOM   2588  C C   . LEU B  2 115 ? 19.287  -41.772  46.370  1.00 46.03  ? 108  LEU B C   1 
ATOM   2589  O O   . LEU B  2 115 ? 19.476  -40.863  45.562  1.00 45.43  ? 108  LEU B O   1 
ATOM   2590  C CB  . LEU B  2 115 ? 17.136  -42.797  47.146  1.00 46.78  ? 108  LEU B CB  1 
ATOM   2591  C CG  . LEU B  2 115 ? 16.379  -41.479  47.306  1.00 47.98  ? 108  LEU B CG  1 
ATOM   2592  C CD1 . LEU B  2 115 ? 15.981  -40.911  45.954  1.00 50.90  ? 108  LEU B CD1 1 
ATOM   2593  C CD2 . LEU B  2 115 ? 15.150  -41.697  48.168  1.00 46.89  ? 108  LEU B CD2 1 
ATOM   2594  N N   . LEU B  2 116 ? 19.954  -41.870  47.517  1.00 55.46  ? 109  LEU B N   1 
ATOM   2595  C CA  . LEU B  2 116 ? 20.988  -40.908  47.894  1.00 57.97  ? 109  LEU B CA  1 
ATOM   2596  C C   . LEU B  2 116 ? 22.096  -40.892  46.844  1.00 55.19  ? 109  LEU B C   1 
ATOM   2597  O O   . LEU B  2 116 ? 22.631  -39.836  46.507  1.00 55.45  ? 109  LEU B O   1 
ATOM   2598  C CB  . LEU B  2 116 ? 21.561  -41.248  49.274  1.00 63.33  ? 109  LEU B CB  1 
ATOM   2599  C CG  . LEU B  2 116 ? 22.184  -40.188  50.195  1.00 70.48  ? 109  LEU B CG  1 
ATOM   2600  C CD1 . LEU B  2 116 ? 23.432  -39.546  49.600  1.00 71.73  ? 109  LEU B CD1 1 
ATOM   2601  C CD2 . LEU B  2 116 ? 21.168  -39.127  50.590  1.00 73.87  ? 109  LEU B CD2 1 
ATOM   2602  N N   . GLY B  2 117 ? 22.424  -42.072  46.327  1.00 53.12  ? 110  GLY B N   1 
ATOM   2603  C CA  . GLY B  2 117 ? 23.460  -42.210  45.320  1.00 52.09  ? 110  GLY B CA  1 
ATOM   2604  C C   . GLY B  2 117 ? 23.157  -41.448  44.045  1.00 52.33  ? 110  GLY B C   1 
ATOM   2605  O O   . GLY B  2 117 ? 24.032  -40.790  43.483  1.00 58.91  ? 110  GLY B O   1 
ATOM   2606  N N   . SER B  2 118 ? 21.912  -41.536  43.589  1.00 48.34  ? 111  SER B N   1 
ATOM   2607  C CA  . SER B  2 118 ? 21.497  -40.852  42.371  1.00 49.81  ? 111  SER B CA  1 
ATOM   2608  C C   . SER B  2 118 ? 21.463  -39.341  42.569  1.00 50.04  ? 111  SER B C   1 
ATOM   2609  O O   . SER B  2 118 ? 21.741  -38.579  41.643  1.00 51.59  ? 111  SER B O   1 
ATOM   2610  C CB  . SER B  2 118 ? 20.126  -41.354  41.916  1.00 51.72  ? 111  SER B CB  1 
ATOM   2611  O OG  . SER B  2 118 ? 20.167  -42.737  41.605  1.00 54.57  ? 111  SER B OG  1 
ATOM   2612  N N   . MET B  2 119 ? 21.125  -38.912  43.781  1.00 45.12  ? 112  MET B N   1 
ATOM   2613  C CA  . MET B  2 119 ? 21.053  -37.489  44.089  1.00 41.66  ? 112  MET B CA  1 
ATOM   2614  C C   . MET B  2 119 ? 22.445  -36.869  44.140  1.00 42.14  ? 112  MET B C   1 
ATOM   2615  O O   . MET B  2 119 ? 22.612  -35.677  43.883  1.00 45.20  ? 112  MET B O   1 
ATOM   2616  C CB  . MET B  2 119 ? 20.324  -37.258  45.413  1.00 43.09  ? 112  MET B CB  1 
ATOM   2617  C CG  . MET B  2 119 ? 18.878  -37.722  45.414  1.00 41.57  ? 112  MET B CG  1 
ATOM   2618  S SD  . MET B  2 119 ? 17.953  -37.109  46.834  1.00 60.21  ? 112  MET B SD  1 
ATOM   2619  C CE  . MET B  2 119 ? 18.899  -37.803  48.181  1.00 59.87  ? 112  MET B CE  1 
ATOM   2620  N N   . LEU B  2 120 ? 23.441  -37.685  44.473  1.00 42.46  ? 113  LEU B N   1 
ATOM   2621  C CA  . LEU B  2 120 ? 24.825  -37.230  44.501  1.00 44.03  ? 113  LEU B CA  1 
ATOM   2622  C C   . LEU B  2 120 ? 25.384  -37.090  43.090  1.00 49.36  ? 113  LEU B C   1 
ATOM   2623  O O   . LEU B  2 120 ? 26.070  -36.116  42.778  1.00 55.05  ? 113  LEU B O   1 
ATOM   2624  C CB  . LEU B  2 120 ? 25.696  -38.191  45.312  1.00 46.20  ? 113  LEU B CB  1 
ATOM   2625  C CG  . LEU B  2 120 ? 25.497  -38.201  46.827  1.00 50.07  ? 113  LEU B CG  1 
ATOM   2626  C CD1 . LEU B  2 120 ? 26.421  -39.219  47.474  1.00 51.21  ? 113  LEU B CD1 1 
ATOM   2627  C CD2 . LEU B  2 120 ? 25.733  -36.815  47.407  1.00 52.51  ? 113  LEU B CD2 1 
ATOM   2628  N N   . THR B  2 121 ? 25.089  -38.071  42.244  1.00 46.25  ? 114  THR B N   1 
ATOM   2629  C CA  . THR B  2 121 ? 25.576  -38.070  40.870  1.00 47.15  ? 114  THR B CA  1 
ATOM   2630  C C   . THR B  2 121 ? 24.994  -36.906  40.076  1.00 46.61  ? 114  THR B C   1 
ATOM   2631  O O   . THR B  2 121 ? 25.676  -36.312  39.243  1.00 48.99  ? 114  THR B O   1 
ATOM   2632  C CB  . THR B  2 121 ? 25.241  -39.388  40.150  1.00 43.36  ? 114  THR B CB  1 
ATOM   2633  O OG1 . THR B  2 121 ? 23.827  -39.612  40.192  1.00 42.53  ? 114  THR B OG1 1 
ATOM   2634  C CG2 . THR B  2 121 ? 25.953  -40.554  40.817  1.00 41.87  ? 114  THR B CG2 1 
ATOM   2635  N N   . CYS B  2 122 ? 23.732  -36.583  40.340  1.00 46.26  ? 115  CYS B N   1 
ATOM   2636  C CA  . CYS B  2 122 ? 23.073  -35.471  39.663  1.00 47.25  ? 115  CYS B CA  1 
ATOM   2637  C C   . CYS B  2 122 ? 23.659  -34.133  40.103  1.00 49.54  ? 115  CYS B C   1 
ATOM   2638  O O   . CYS B  2 122 ? 23.857  -33.236  39.284  1.00 47.44  ? 115  CYS B O   1 
ATOM   2639  C CB  . CYS B  2 122 ? 21.566  -35.497  39.925  1.00 44.57  ? 115  CYS B CB  1 
ATOM   2640  S SG  . CYS B  2 122 ? 20.691  -36.852  39.111  1.00 50.55  ? 115  CYS B SG  1 
ATOM   2641  N N   . LYS B  2 123 ? 23.935  -34.011  41.398  1.00 51.19  ? 116  LYS B N   1 
ATOM   2642  C CA  . LYS B  2 123 ? 24.510  -32.791  41.957  1.00 53.25  ? 116  LYS B CA  1 
ATOM   2643  C C   . LYS B  2 123 ? 25.859  -32.466  41.331  1.00 54.04  ? 116  LYS B C   1 
ATOM   2644  O O   . LYS B  2 123 ? 26.113  -31.329  40.933  1.00 55.19  ? 116  LYS B O   1 
ATOM   2645  C CB  . LYS B  2 123 ? 24.660  -32.918  43.474  1.00 51.59  ? 116  LYS B CB  1 
ATOM   2646  C CG  . LYS B  2 123 ? 25.414  -31.768  44.118  1.00 53.94  ? 116  LYS B CG  1 
ATOM   2647  C CD  . LYS B  2 123 ? 25.439  -31.899  45.630  1.00 54.15  ? 116  LYS B CD  1 
ATOM   2648  C CE  . LYS B  2 123 ? 26.397  -30.898  46.252  1.00 58.71  ? 116  LYS B CE  1 
ATOM   2649  N NZ  . LYS B  2 123 ? 27.807  -31.167  45.854  1.00 63.09  ? 116  LYS B NZ  1 
ATOM   2650  N N   . ALA B  2 124 ? 26.722  -33.473  41.247  1.00 47.93  ? 117  ALA B N   1 
ATOM   2651  C CA  . ALA B  2 124 ? 28.042  -33.300  40.659  1.00 48.55  ? 117  ALA B CA  1 
ATOM   2652  C C   . ALA B  2 124 ? 27.941  -33.113  39.149  1.00 50.40  ? 117  ALA B C   1 
ATOM   2653  O O   . ALA B  2 124 ? 28.831  -32.536  38.525  1.00 54.43  ? 117  ALA B O   1 
ATOM   2654  C CB  . ALA B  2 124 ? 28.928  -34.484  40.993  1.00 45.40  ? 117  ALA B CB  1 
ATOM   2655  N N   . ALA B  2 125 ? 26.852  -33.607  38.568  1.00 47.63  ? 118  ALA B N   1 
ATOM   2656  C CA  . ALA B  2 125 ? 26.591  -33.416  37.148  1.00 46.98  ? 118  ALA B CA  1 
ATOM   2657  C C   . ALA B  2 125 ? 26.014  -32.029  36.903  1.00 51.18  ? 118  ALA B C   1 
ATOM   2658  O O   . ALA B  2 125 ? 26.240  -31.431  35.851  1.00 52.00  ? 118  ALA B O   1 
ATOM   2659  C CB  . ALA B  2 125 ? 25.646  -34.486  36.626  1.00 42.61  ? 118  ALA B CB  1 
ATOM   2660  N N   . MET B  2 126 ? 25.269  -31.523  37.883  1.00 56.20  ? 119  MET B N   1 
ATOM   2661  C CA  . MET B  2 126 ? 24.721  -30.173  37.811  1.00 61.42  ? 119  MET B CA  1 
ATOM   2662  C C   . MET B  2 126 ? 25.831  -29.144  37.672  1.00 65.70  ? 119  MET B C   1 
ATOM   2663  O O   . MET B  2 126 ? 25.671  -28.142  36.978  1.00 68.63  ? 119  MET B O   1 
ATOM   2664  C CB  . MET B  2 126 ? 23.872  -29.863  39.046  1.00 62.77  ? 119  MET B CB  1 
ATOM   2665  C CG  . MET B  2 126 ? 22.473  -30.435  38.974  1.00 61.85  ? 119  MET B CG  1 
ATOM   2666  S SD  . MET B  2 126 ? 21.661  -29.961  37.439  1.00 69.68  ? 119  MET B SD  1 
ATOM   2667  C CE  . MET B  2 126 ? 20.470  -31.285  37.274  1.00 99.37  ? 119  MET B CE  1 
ATOM   2668  N N   . ARG B  2 127 ? 26.954  -29.402  38.335  1.00 71.59  ? 120  ARG B N   1 
ATOM   2669  C CA  . ARG B  2 127 ? 28.112  -28.525  38.251  1.00 72.08  ? 120  ARG B CA  1 
ATOM   2670  C C   . ARG B  2 127 ? 28.537  -28.350  36.801  1.00 68.60  ? 120  ARG B C   1 
ATOM   2671  O O   . ARG B  2 127 ? 28.642  -27.232  36.308  1.00 67.29  ? 120  ARG B O   1 
ATOM   2672  C CB  . ARG B  2 127 ? 29.281  -29.084  39.064  1.00 78.90  ? 120  ARG B CB  1 
ATOM   2673  C CG  . ARG B  2 127 ? 28.891  -29.754  40.369  1.00 85.20  ? 120  ARG B CG  1 
ATOM   2674  C CD  . ARG B  2 127 ? 28.645  -28.752  41.483  1.00 95.62  ? 120  ARG B CD  1 
ATOM   2675  N NE  . ARG B  2 127 ? 29.413  -29.088  42.680  1.00 105.38 ? 120  ARG B NE  1 
ATOM   2676  C CZ  . ARG B  2 127 ? 29.075  -28.734  43.916  1.00 111.73 ? 120  ARG B CZ  1 
ATOM   2677  N NH1 . ARG B  2 127 ? 27.970  -28.033  44.131  1.00 115.59 ? 120  ARG B NH1 1 
ATOM   2678  N NH2 . ARG B  2 127 ? 29.840  -29.087  44.940  1.00 111.98 ? 120  ARG B NH2 1 
ATOM   2679  N N   . THR B  2 128 ? 28.748  -29.472  36.120  1.00 65.61  ? 121  THR B N   1 
ATOM   2680  C CA  . THR B  2 128 ? 29.344  -29.483  34.789  1.00 65.72  ? 121  THR B CA  1 
ATOM   2681  C C   . THR B  2 128 ? 28.342  -29.199  33.667  1.00 63.27  ? 121  THR B C   1 
ATOM   2682  O O   . THR B  2 128 ? 28.729  -28.774  32.577  1.00 60.90  ? 121  THR B O   1 
ATOM   2683  C CB  . THR B  2 128 ? 30.024  -30.840  34.510  1.00 64.68  ? 121  THR B CB  1 
ATOM   2684  O OG1 . THR B  2 128 ? 30.595  -31.352  35.721  1.00 68.18  ? 121  THR B OG1 1 
ATOM   2685  C CG2 . THR B  2 128 ? 31.114  -30.689  33.465  1.00 64.16  ? 121  THR B CG2 1 
ATOM   2686  N N   . MET B  2 129 ? 27.059  -29.436  33.928  1.00 58.25  ? 122  MET B N   1 
ATOM   2687  C CA  . MET B  2 129 ? 26.033  -29.236  32.906  1.00 54.66  ? 122  MET B CA  1 
ATOM   2688  C C   . MET B  2 129 ? 25.576  -27.781  32.837  1.00 54.47  ? 122  MET B C   1 
ATOM   2689  O O   . MET B  2 129 ? 24.978  -27.358  31.848  1.00 52.84  ? 122  MET B O   1 
ATOM   2690  C CB  . MET B  2 129 ? 24.836  -30.157  33.157  1.00 49.71  ? 122  MET B CB  1 
ATOM   2691  C CG  . MET B  2 129 ? 25.116  -31.625  32.866  1.00 47.33  ? 122  MET B CG  1 
ATOM   2692  S SD  . MET B  2 129 ? 23.688  -32.684  33.164  1.00 57.38  ? 122  MET B SD  1 
ATOM   2693  C CE  . MET B  2 129 ? 24.379  -34.298  32.804  1.00 42.99  ? 122  MET B CE  1 
ATOM   2694  N N   . ILE B  2 130 ? 25.862  -27.018  33.888  1.00 56.33  ? 123  ILE B N   1 
ATOM   2695  C CA  . ILE B  2 130 ? 25.575  -25.588  33.894  1.00 63.53  ? 123  ILE B CA  1 
ATOM   2696  C C   . ILE B  2 130 ? 26.636  -24.840  33.085  1.00 70.21  ? 123  ILE B C   1 
ATOM   2697  O O   . ILE B  2 130 ? 26.327  -23.884  32.372  1.00 72.42  ? 123  ILE B O   1 
ATOM   2698  C CB  . ILE B  2 130 ? 25.507  -25.028  35.334  1.00 63.78  ? 123  ILE B CB  1 
ATOM   2699  C CG1 . ILE B  2 130 ? 24.262  -25.551  36.054  1.00 63.35  ? 123  ILE B CG1 1 
ATOM   2700  C CG2 . ILE B  2 130 ? 25.489  -23.509  35.326  1.00 65.57  ? 123  ILE B CG2 1 
ATOM   2701  C CD1 . ILE B  2 130 ? 22.960  -25.147  35.401  1.00 65.39  ? 123  ILE B CD1 1 
ATOM   2702  N N   . GLN B  2 131 ? 27.882  -25.299  33.178  1.00 76.01  ? 124  GLN B N   1 
ATOM   2703  C CA  . GLN B  2 131 ? 28.989  -24.664  32.465  1.00 85.48  ? 124  GLN B CA  1 
ATOM   2704  C C   . GLN B  2 131 ? 28.804  -24.751  30.954  1.00 86.64  ? 124  GLN B C   1 
ATOM   2705  O O   . GLN B  2 131 ? 28.928  -23.751  30.249  1.00 92.86  ? 124  GLN B O   1 
ATOM   2706  C CB  . GLN B  2 131 ? 30.328  -25.298  32.854  1.00 86.62  ? 124  GLN B CB  1 
ATOM   2707  C CG  . GLN B  2 131 ? 30.387  -25.810  34.279  1.00 86.83  ? 124  GLN B CG  1 
ATOM   2708  C CD  . GLN B  2 131 ? 31.394  -25.075  35.141  1.00 92.53  ? 124  GLN B CD  1 
ATOM   2709  O OE1 . GLN B  2 131 ? 32.559  -25.464  35.219  1.00 93.28  ? 124  GLN B OE1 1 
ATOM   2710  N NE2 . GLN B  2 131 ? 30.945  -24.018  35.808  1.00 96.04  ? 124  GLN B NE2 1 
ATOM   2711  N N   . GLN B  2 132 ? 28.506  -25.945  30.453  1.00 86.04  ? 125  GLN B N   1 
ATOM   2712  C CA  . GLN B  2 132 ? 28.342  -26.121  29.016  1.00 89.18  ? 125  GLN B CA  1 
ATOM   2713  C C   . GLN B  2 132 ? 26.913  -25.815  28.568  1.00 87.74  ? 125  GLN B C   1 
ATOM   2714  O O   . GLN B  2 132 ? 26.536  -26.116  27.434  1.00 87.65  ? 125  GLN B O   1 
ATOM   2715  C CB  . GLN B  2 132 ? 28.739  -27.535  28.596  1.00 89.81  ? 125  GLN B CB  1 
ATOM   2716  C CG  . GLN B  2 132 ? 29.957  -27.567  27.684  1.00 94.92  ? 125  GLN B CG  1 
ATOM   2717  C CD  . GLN B  2 132 ? 29.843  -28.612  26.597  1.00 94.86  ? 125  GLN B CD  1 
ATOM   2718  O OE1 . GLN B  2 132 ? 29.214  -29.653  26.785  1.00 97.06  ? 125  GLN B OE1 1 
ATOM   2719  N NE2 . GLN B  2 132 ? 30.444  -28.336  25.445  1.00 92.88  ? 125  GLN B NE2 1 
ATOM   2720  N N   . GLN B  2 133 ? 26.139  -25.210  29.468  1.00 85.30  ? 126  GLN B N   1 
ATOM   2721  C CA  . GLN B  2 133 ? 24.781  -24.738  29.185  1.00 79.74  ? 126  GLN B CA  1 
ATOM   2722  C C   . GLN B  2 133 ? 23.909  -25.773  28.484  1.00 70.17  ? 126  GLN B C   1 
ATOM   2723  O O   . GLN B  2 133 ? 23.448  -25.552  27.365  1.00 67.47  ? 126  GLN B O   1 
ATOM   2724  C CB  . GLN B  2 133 ? 24.834  -23.457  28.347  1.00 86.51  ? 126  GLN B CB  1 
ATOM   2725  C CG  . GLN B  2 133 ? 25.047  -22.192  29.167  1.00 91.45  ? 126  GLN B CG  1 
ATOM   2726  C CD  . GLN B  2 133 ? 26.084  -21.266  28.559  1.00 94.08  ? 126  GLN B CD  1 
ATOM   2727  O OE1 . GLN B  2 133 ? 27.273  -21.366  28.863  1.00 95.25  ? 126  GLN B OE1 1 
ATOM   2728  N NE2 . GLN B  2 133 ? 25.638  -20.357  27.699  1.00 95.41  ? 126  GLN B NE2 1 
ATOM   2729  N N   . GLY B  2 134 ? 23.685  -26.902  29.147  1.00 60.81  ? 127  GLY B N   1 
ATOM   2730  C CA  . GLY B  2 134 ? 22.870  -27.959  28.580  1.00 53.07  ? 127  GLY B CA  1 
ATOM   2731  C C   . GLY B  2 134 ? 23.324  -29.344  28.991  1.00 49.47  ? 127  GLY B C   1 
ATOM   2732  O O   . GLY B  2 134 ? 24.511  -29.662  28.939  1.00 53.54  ? 127  GLY B O   1 
ATOM   2733  N N   . GLY B  2 135 ? 22.368  -30.171  29.400  1.00 46.10  ? 128  GLY B N   1 
ATOM   2734  C CA  . GLY B  2 135 ? 22.653  -31.534  29.806  1.00 42.87  ? 128  GLY B CA  1 
ATOM   2735  C C   . GLY B  2 135 ? 21.400  -32.387  29.811  1.00 39.72  ? 128  GLY B C   1 
ATOM   2736  O O   . GLY B  2 135 ? 20.286  -31.867  29.778  1.00 33.18  ? 128  GLY B O   1 
ATOM   2737  N N   . SER B  2 136 ? 21.580  -33.703  29.847  1.00 39.37  ? 129  SER B N   1 
ATOM   2738  C CA  . SER B  2 136 ? 20.451  -34.624  29.876  1.00 33.51  ? 129  SER B CA  1 
ATOM   2739  C C   . SER B  2 136 ? 20.691  -35.728  30.899  1.00 35.76  ? 129  SER B C   1 
ATOM   2740  O O   . SER B  2 136 ? 21.714  -36.411  30.858  1.00 37.55  ? 129  SER B O   1 
ATOM   2741  C CB  . SER B  2 136 ? 20.208  -35.224  28.490  1.00 32.53  ? 129  SER B CB  1 
ATOM   2742  O OG  . SER B  2 136 ? 18.995  -35.955  28.456  1.00 32.27  ? 129  SER B OG  1 
ATOM   2743  N N   . ILE B  2 137 ? 19.744  -35.895  31.817  1.00 31.89  ? 130  ILE B N   1 
ATOM   2744  C CA  . ILE B  2 137 ? 19.887  -36.866  32.895  1.00 35.73  ? 130  ILE B CA  1 
ATOM   2745  C C   . ILE B  2 137 ? 18.738  -37.868  32.911  1.00 37.72  ? 130  ILE B C   1 
ATOM   2746  O O   . ILE B  2 137 ? 17.569  -37.490  32.819  1.00 38.17  ? 130  ILE B O   1 
ATOM   2747  C CB  . ILE B  2 137 ? 19.964  -36.168  34.269  1.00 38.60  ? 130  ILE B CB  1 
ATOM   2748  C CG1 . ILE B  2 137 ? 21.129  -35.177  34.298  1.00 43.02  ? 130  ILE B CG1 1 
ATOM   2749  C CG2 . ILE B  2 137 ? 20.105  -37.190  35.386  1.00 37.25  ? 130  ILE B CG2 1 
ATOM   2750  C CD1 . ILE B  2 137 ? 21.300  -34.475  35.626  1.00 45.26  ? 130  ILE B CD1 1 
ATOM   2751  N N   . VAL B  2 138 ? 19.078  -39.149  33.021  1.00 35.94  ? 131  VAL B N   1 
ATOM   2752  C CA  . VAL B  2 138 ? 18.075  -40.200  33.138  1.00 33.50  ? 131  VAL B CA  1 
ATOM   2753  C C   . VAL B  2 138 ? 18.386  -41.120  34.314  1.00 30.89  ? 131  VAL B C   1 
ATOM   2754  O O   . VAL B  2 138 ? 19.420  -41.788  34.340  1.00 29.39  ? 131  VAL B O   1 
ATOM   2755  C CB  . VAL B  2 138 ? 17.974  -41.037  31.847  1.00 35.48  ? 131  VAL B CB  1 
ATOM   2756  C CG1 . VAL B  2 138 ? 17.190  -42.316  32.100  1.00 33.64  ? 131  VAL B CG1 1 
ATOM   2757  C CG2 . VAL B  2 138 ? 17.326  -40.224  30.738  1.00 35.86  ? 131  VAL B CG2 1 
ATOM   2758  N N   . ASN B  2 139 ? 17.487  -41.136  35.293  1.00 29.78  ? 132  ASN B N   1 
ATOM   2759  C CA  . ASN B  2 139 ? 17.614  -42.024  36.441  1.00 28.80  ? 132  ASN B CA  1 
ATOM   2760  C C   . ASN B  2 139 ? 16.828  -43.309  36.224  1.00 30.22  ? 132  ASN B C   1 
ATOM   2761  O O   . ASN B  2 139 ? 15.669  -43.273  35.812  1.00 34.47  ? 132  ASN B O   1 
ATOM   2762  C CB  . ASN B  2 139 ? 17.136  -41.328  37.716  1.00 26.98  ? 132  ASN B CB  1 
ATOM   2763  C CG  . ASN B  2 139 ? 17.979  -40.120  38.071  1.00 32.45  ? 132  ASN B CG  1 
ATOM   2764  O OD1 . ASN B  2 139 ? 19.207  -40.157  37.988  1.00 37.55  ? 132  ASN B OD1 1 
ATOM   2765  N ND2 . ASN B  2 139 ? 17.320  -39.036  38.467  1.00 29.40  ? 132  ASN B ND2 1 
ATOM   2766  N N   . VAL B  2 140 ? 17.459  -44.445  36.497  1.00 29.79  ? 133  VAL B N   1 
ATOM   2767  C CA  . VAL B  2 140 ? 16.799  -45.732  36.321  1.00 32.51  ? 133  VAL B CA  1 
ATOM   2768  C C   . VAL B  2 140 ? 16.088  -46.161  37.597  1.00 38.72  ? 133  VAL B C   1 
ATOM   2769  O O   . VAL B  2 140 ? 16.727  -46.509  38.590  1.00 45.73  ? 133  VAL B O   1 
ATOM   2770  C CB  . VAL B  2 140 ? 17.794  -46.829  35.903  1.00 30.36  ? 133  VAL B CB  1 
ATOM   2771  C CG1 . VAL B  2 140 ? 17.079  -48.160  35.763  1.00 30.02  ? 133  VAL B CG1 1 
ATOM   2772  C CG2 . VAL B  2 140 ? 18.482  -46.451  34.600  1.00 31.43  ? 133  VAL B CG2 1 
ATOM   2773  N N   . GLY B  2 141 ? 14.760  -46.130  37.564  1.00 39.31  ? 134  GLY B N   1 
ATOM   2774  C CA  . GLY B  2 141 ? 13.957  -46.550  38.697  1.00 38.95  ? 134  GLY B CA  1 
ATOM   2775  C C   . GLY B  2 141 ? 13.329  -47.910  38.463  1.00 44.06  ? 134  GLY B C   1 
ATOM   2776  O O   . GLY B  2 141 ? 13.978  -48.822  37.951  1.00 45.28  ? 134  GLY B O   1 
ATOM   2777  N N   . SER B  2 142 ? 12.062  -48.044  38.842  1.00 45.93  ? 135  SER B N   1 
ATOM   2778  C CA  . SER B  2 142 ? 11.319  -49.280  38.626  1.00 44.89  ? 135  SER B CA  1 
ATOM   2779  C C   . SER B  2 142 ? 9.820   -49.017  38.683  1.00 43.09  ? 135  SER B C   1 
ATOM   2780  O O   . SER B  2 142 ? 9.382   -48.003  39.226  1.00 46.37  ? 135  SER B O   1 
ATOM   2781  C CB  . SER B  2 142 ? 11.709  -50.337  39.662  1.00 45.42  ? 135  SER B CB  1 
ATOM   2782  O OG  . SER B  2 142 ? 11.040  -51.562  39.418  1.00 45.02  ? 135  SER B OG  1 
ATOM   2783  N N   . ILE B  2 143 ? 9.037   -49.932  38.121  1.00 45.08  ? 136  ILE B N   1 
ATOM   2784  C CA  . ILE B  2 143 ? 7.584   -49.803  38.133  1.00 46.29  ? 136  ILE B CA  1 
ATOM   2785  C C   . ILE B  2 143 ? 7.049   -50.020  39.550  1.00 45.04  ? 136  ILE B C   1 
ATOM   2786  O O   . ILE B  2 143 ? 5.964   -49.550  39.897  1.00 40.34  ? 136  ILE B O   1 
ATOM   2787  C CB  . ILE B  2 143 ? 6.918   -50.799  37.150  1.00 52.48  ? 136  ILE B CB  1 
ATOM   2788  C CG1 . ILE B  2 143 ? 5.429   -50.484  36.978  1.00 55.62  ? 136  ILE B CG1 1 
ATOM   2789  C CG2 . ILE B  2 143 ? 7.125   -52.238  37.605  1.00 57.94  ? 136  ILE B CG2 1 
ATOM   2790  C CD1 . ILE B  2 143 ? 5.155   -49.085  36.473  1.00 56.07  ? 136  ILE B CD1 1 
ATOM   2791  N N   . VAL B  2 144 ? 7.829   -50.718  40.371  1.00 44.67  ? 137  VAL B N   1 
ATOM   2792  C CA  . VAL B  2 144 ? 7.459   -50.952  41.761  1.00 38.14  ? 137  VAL B CA  1 
ATOM   2793  C C   . VAL B  2 144 ? 7.767   -49.722  42.604  1.00 34.40  ? 137  VAL B C   1 
ATOM   2794  O O   . VAL B  2 144 ? 7.373   -49.636  43.763  1.00 36.73  ? 137  VAL B O   1 
ATOM   2795  C CB  . VAL B  2 144 ? 8.190   -52.172  42.350  1.00 35.29  ? 137  VAL B CB  1 
ATOM   2796  C CG1 . VAL B  2 144 ? 7.957   -53.396  41.478  1.00 31.97  ? 137  VAL B CG1 1 
ATOM   2797  C CG2 . VAL B  2 144 ? 9.675   -51.884  42.488  1.00 35.46  ? 137  VAL B CG2 1 
ATOM   2798  N N   . GLY B  2 145 ? 8.480   -48.768  42.016  1.00 36.69  ? 138  GLY B N   1 
ATOM   2799  C CA  . GLY B  2 145 ? 8.738   -47.505  42.679  1.00 42.27  ? 138  GLY B CA  1 
ATOM   2800  C C   . GLY B  2 145 ? 7.466   -46.685  42.755  1.00 49.19  ? 138  GLY B C   1 
ATOM   2801  O O   . GLY B  2 145 ? 7.301   -45.849  43.643  1.00 52.37  ? 138  GLY B O   1 
ATOM   2802  N N   . LEU B  2 146 ? 6.558   -46.935  41.818  1.00 53.54  ? 139  LEU B N   1 
ATOM   2803  C CA  . LEU B  2 146 ? 5.291   -46.218  41.765  1.00 54.60  ? 139  LEU B CA  1 
ATOM   2804  C C   . LEU B  2 146 ? 4.134   -47.056  42.298  1.00 50.95  ? 139  LEU B C   1 
ATOM   2805  O O   . LEU B  2 146 ? 3.365   -46.598  43.141  1.00 51.54  ? 139  LEU B O   1 
ATOM   2806  C CB  . LEU B  2 146 ? 4.991   -45.771  40.333  1.00 63.02  ? 139  LEU B CB  1 
ATOM   2807  C CG  . LEU B  2 146 ? 5.848   -44.626  39.793  1.00 69.03  ? 139  LEU B CG  1 
ATOM   2808  C CD1 . LEU B  2 146 ? 5.478   -44.310  38.352  1.00 71.38  ? 139  LEU B CD1 1 
ATOM   2809  C CD2 . LEU B  2 146 ? 5.696   -43.393  40.672  1.00 70.68  ? 139  LEU B CD2 1 
ATOM   2810  N N   . LYS B  2 147 ? 4.014   -48.285  41.806  1.00 49.92  ? 140  LYS B N   1 
ATOM   2811  C CA  . LYS B  2 147 ? 2.892   -49.141  42.172  1.00 53.04  ? 140  LYS B CA  1 
ATOM   2812  C C   . LYS B  2 147 ? 3.179   -50.012  43.390  1.00 55.01  ? 140  LYS B C   1 
ATOM   2813  O O   . LYS B  2 147 ? 2.256   -50.513  44.031  1.00 62.03  ? 140  LYS B O   1 
ATOM   2814  C CB  . LYS B  2 147 ? 2.492   -50.026  40.990  1.00 52.17  ? 140  LYS B CB  1 
ATOM   2815  C CG  . LYS B  2 147 ? 1.677   -49.302  39.938  1.00 52.02  ? 140  LYS B CG  1 
ATOM   2816  C CD  . LYS B  2 147 ? 0.941   -50.281  39.045  1.00 57.88  ? 140  LYS B CD  1 
ATOM   2817  C CE  . LYS B  2 147 ? -0.384  -49.698  38.592  1.00 65.41  ? 140  LYS B CE  1 
ATOM   2818  N NZ  . LYS B  2 147 ? -0.195  -48.404  37.883  1.00 68.55  ? 140  LYS B NZ  1 
ATOM   2819  N N   . GLY B  2 148 ? 4.456   -50.193  43.706  1.00 50.57  ? 141  GLY B N   1 
ATOM   2820  C CA  . GLY B  2 148 ? 4.839   -51.017  44.837  1.00 49.70  ? 141  GLY B CA  1 
ATOM   2821  C C   . GLY B  2 148 ? 4.738   -52.496  44.524  1.00 49.89  ? 141  GLY B C   1 
ATOM   2822  O O   . GLY B  2 148 ? 4.088   -52.894  43.557  1.00 48.67  ? 141  GLY B O   1 
ATOM   2823  N N   . ASN B  2 149 ? 5.386   -53.316  45.343  1.00 48.44  ? 142  ASN B N   1 
ATOM   2824  C CA  . ASN B  2 149 ? 5.317   -54.760  45.166  1.00 49.94  ? 142  ASN B CA  1 
ATOM   2825  C C   . ASN B  2 149 ? 5.578   -55.505  46.468  1.00 49.03  ? 142  ASN B C   1 
ATOM   2826  O O   . ASN B  2 149 ? 6.456   -55.129  47.245  1.00 48.69  ? 142  ASN B O   1 
ATOM   2827  C CB  . ASN B  2 149 ? 6.308   -55.214  44.097  1.00 51.07  ? 142  ASN B CB  1 
ATOM   2828  C CG  . ASN B  2 149 ? 6.000   -56.600  43.572  1.00 56.69  ? 142  ASN B CG  1 
ATOM   2829  O OD1 . ASN B  2 149 ? 4.899   -57.117  43.763  1.00 59.41  ? 142  ASN B OD1 1 
ATOM   2830  N ND2 . ASN B  2 149 ? 6.970   -57.208  42.900  1.00 58.69  ? 142  ASN B ND2 1 
ATOM   2831  N N   . SER B  2 150 ? 4.809   -56.563  46.702  1.00 48.98  ? 143  SER B N   1 
ATOM   2832  C CA  . SER B  2 150 ? 4.937   -57.332  47.932  1.00 50.85  ? 143  SER B CA  1 
ATOM   2833  C C   . SER B  2 150 ? 6.294   -58.019  48.019  1.00 53.34  ? 143  SER B C   1 
ATOM   2834  O O   . SER B  2 150 ? 6.645   -58.841  47.170  1.00 53.56  ? 143  SER B O   1 
ATOM   2835  C CB  . SER B  2 150 ? 3.819   -58.369  48.042  1.00 54.61  ? 143  SER B CB  1 
ATOM   2836  O OG  . SER B  2 150 ? 3.946   -59.119  49.240  1.00 56.75  ? 143  SER B OG  1 
ATOM   2837  N N   . GLY B  2 151 ? 7.051   -57.671  49.054  1.00 50.96  ? 144  GLY B N   1 
ATOM   2838  C CA  . GLY B  2 151 ? 8.365   -58.246  49.270  1.00 49.47  ? 144  GLY B CA  1 
ATOM   2839  C C   . GLY B  2 151 ? 9.486   -57.294  48.904  1.00 47.26  ? 144  GLY B C   1 
ATOM   2840  O O   . GLY B  2 151 ? 10.659  -57.586  49.137  1.00 50.77  ? 144  GLY B O   1 
ATOM   2841  N N   . GLN B  2 152 ? 9.127   -56.152  48.326  1.00 46.80  ? 145  GLN B N   1 
ATOM   2842  C CA  . GLN B  2 152 ? 10.115  -55.167  47.901  1.00 47.77  ? 145  GLN B CA  1 
ATOM   2843  C C   . GLN B  2 152 ? 9.769   -53.772  48.409  1.00 45.77  ? 145  GLN B C   1 
ATOM   2844  O O   . GLN B  2 152 ? 9.871   -52.794  47.669  1.00 42.69  ? 145  GLN B O   1 
ATOM   2845  C CB  . GLN B  2 152 ? 10.228  -55.144  46.376  1.00 53.25  ? 145  GLN B CB  1 
ATOM   2846  C CG  . GLN B  2 152 ? 10.378  -56.512  45.737  1.00 62.58  ? 145  GLN B CG  1 
ATOM   2847  C CD  . GLN B  2 152 ? 10.546  -56.431  44.235  1.00 65.33  ? 145  GLN B CD  1 
ATOM   2848  O OE1 . GLN B  2 152 ? 9.741   -56.976  43.479  1.00 67.39  ? 145  GLN B OE1 1 
ATOM   2849  N NE2 . GLN B  2 152 ? 11.598  -55.750  43.792  1.00 64.05  ? 145  GLN B NE2 1 
ATOM   2850  N N   . SER B  2 153 ? 9.361   -53.686  49.671  1.00 55.84  ? 146  SER B N   1 
ATOM   2851  C CA  . SER B  2 153 ? 8.966   -52.410  50.260  1.00 61.67  ? 146  SER B CA  1 
ATOM   2852  C C   . SER B  2 153 ? 10.146  -51.449  50.329  1.00 63.46  ? 146  SER B C   1 
ATOM   2853  O O   . SER B  2 153 ? 10.009  -50.261  50.035  1.00 62.72  ? 146  SER B O   1 
ATOM   2854  C CB  . SER B  2 153 ? 8.375   -52.621  51.657  1.00 66.14  ? 146  SER B CB  1 
ATOM   2855  O OG  . SER B  2 153 ? 9.342   -53.153  52.546  1.00 70.54  ? 146  SER B OG  1 
ATOM   2856  N N   . VAL B  2 154 ? 11.303  -51.974  50.717  1.00 64.26  ? 147  VAL B N   1 
ATOM   2857  C CA  . VAL B  2 154 ? 12.521  -51.179  50.798  1.00 64.94  ? 147  VAL B CA  1 
ATOM   2858  C C   . VAL B  2 154 ? 12.958  -50.718  49.407  1.00 59.36  ? 147  VAL B C   1 
ATOM   2859  O O   . VAL B  2 154 ? 13.383  -49.575  49.225  1.00 55.98  ? 147  VAL B O   1 
ATOM   2860  C CB  . VAL B  2 154 ? 13.662  -51.971  51.482  1.00 70.29  ? 147  VAL B CB  1 
ATOM   2861  C CG1 . VAL B  2 154 ? 13.767  -53.378  50.904  1.00 73.28  ? 147  VAL B CG1 1 
ATOM   2862  C CG2 . VAL B  2 154 ? 14.987  -51.232  51.357  1.00 71.34  ? 147  VAL B CG2 1 
ATOM   2863  N N   . TYR B  2 155 ? 12.831  -51.603  48.425  1.00 55.99  ? 148  TYR B N   1 
ATOM   2864  C CA  . TYR B  2 155 ? 13.208  -51.282  47.056  1.00 50.70  ? 148  TYR B CA  1 
ATOM   2865  C C   . TYR B  2 155 ? 12.219  -50.298  46.445  1.00 51.15  ? 148  TYR B C   1 
ATOM   2866  O O   . TYR B  2 155 ? 12.599  -49.429  45.663  1.00 49.78  ? 148  TYR B O   1 
ATOM   2867  C CB  . TYR B  2 155 ? 13.288  -52.552  46.208  1.00 47.41  ? 148  TYR B CB  1 
ATOM   2868  C CG  . TYR B  2 155 ? 13.899  -52.338  44.842  1.00 47.83  ? 148  TYR B CG  1 
ATOM   2869  C CD1 . TYR B  2 155 ? 15.271  -52.178  44.694  1.00 55.26  ? 148  TYR B CD1 1 
ATOM   2870  C CD2 . TYR B  2 155 ? 13.108  -52.302  43.702  1.00 46.40  ? 148  TYR B CD2 1 
ATOM   2871  C CE1 . TYR B  2 155 ? 15.838  -51.983  43.448  1.00 57.15  ? 148  TYR B CE1 1 
ATOM   2872  C CE2 . TYR B  2 155 ? 13.666  -52.108  42.451  1.00 48.50  ? 148  TYR B CE2 1 
ATOM   2873  C CZ  . TYR B  2 155 ? 15.031  -51.950  42.330  1.00 52.68  ? 148  TYR B CZ  1 
ATOM   2874  O OH  . TYR B  2 155 ? 15.593  -51.756  41.089  1.00 51.36  ? 148  TYR B OH  1 
ATOM   2875  N N   . SER B  2 156 ? 10.949  -50.438  46.811  1.00 46.00  ? 149  SER B N   1 
ATOM   2876  C CA  . SER B  2 156 ? 9.904   -49.549  46.318  1.00 43.24  ? 149  SER B CA  1 
ATOM   2877  C C   . SER B  2 156 ? 10.065  -48.141  46.879  1.00 41.91  ? 149  SER B C   1 
ATOM   2878  O O   . SER B  2 156 ? 9.779   -47.155  46.200  1.00 37.46  ? 149  SER B O   1 
ATOM   2879  C CB  . SER B  2 156 ? 8.523   -50.099  46.671  1.00 46.56  ? 149  SER B CB  1 
ATOM   2880  O OG  . SER B  2 156 ? 8.297   -51.348  46.041  1.00 51.10  ? 149  SER B OG  1 
ATOM   2881  N N   . ALA B  2 157 ? 10.524  -48.055  48.124  1.00 45.35  ? 150  ALA B N   1 
ATOM   2882  C CA  . ALA B  2 157 ? 10.747  -46.770  48.774  1.00 44.69  ? 150  ALA B CA  1 
ATOM   2883  C C   . ALA B  2 157 ? 11.906  -46.021  48.127  1.00 51.04  ? 150  ALA B C   1 
ATOM   2884  O O   . ALA B  2 157 ? 11.766  -44.866  47.726  1.00 55.04  ? 150  ALA B O   1 
ATOM   2885  C CB  . ALA B  2 157 ? 11.009  -46.966  50.258  1.00 37.79  ? 150  ALA B CB  1 
ATOM   2886  N N   . SER B  2 158 ? 13.050  -46.691  48.027  1.00 61.49  ? 151  SER B N   1 
ATOM   2887  C CA  . SER B  2 158 ? 14.255  -46.085  47.474  1.00 66.14  ? 151  SER B CA  1 
ATOM   2888  C C   . SER B  2 158 ? 14.083  -45.706  46.006  1.00 62.72  ? 151  SER B C   1 
ATOM   2889  O O   . SER B  2 158 ? 14.524  -44.641  45.577  1.00 68.98  ? 151  SER B O   1 
ATOM   2890  C CB  . SER B  2 158 ? 15.446  -47.033  47.634  1.00 70.85  ? 151  SER B CB  1 
ATOM   2891  O OG  . SER B  2 158 ? 15.181  -48.289  47.034  1.00 73.35  ? 151  SER B OG  1 
ATOM   2892  N N   . LYS B  2 159 ? 13.438  -46.581  45.241  1.00 52.92  ? 152  LYS B N   1 
ATOM   2893  C CA  . LYS B  2 159 ? 13.228  -46.339  43.819  1.00 50.92  ? 152  LYS B CA  1 
ATOM   2894  C C   . LYS B  2 159 ? 12.087  -45.355  43.584  1.00 52.62  ? 152  LYS B C   1 
ATOM   2895  O O   . LYS B  2 159 ? 12.040  -44.679  42.556  1.00 55.16  ? 152  LYS B O   1 
ATOM   2896  C CB  . LYS B  2 159 ? 12.947  -47.654  43.089  1.00 43.27  ? 152  LYS B CB  1 
ATOM   2897  C CG  . LYS B  2 159 ? 13.943  -47.977  41.989  1.00 38.74  ? 152  LYS B CG  1 
ATOM   2898  C CD  . LYS B  2 159 ? 15.373  -47.937  42.503  1.00 27.95  ? 152  LYS B CD  1 
ATOM   2899  C CE  . LYS B  2 159 ? 16.366  -48.209  41.386  1.00 36.39  ? 152  LYS B CE  1 
ATOM   2900  N NZ  . LYS B  2 159 ? 17.776  -48.107  41.851  1.00 40.58  ? 152  LYS B NZ  1 
ATOM   2901  N N   . GLY B  2 160 ? 11.171  -45.277  44.543  1.00 55.71  ? 153  GLY B N   1 
ATOM   2902  C CA  . GLY B  2 160 ? 10.034  -44.382  44.439  1.00 54.41  ? 153  GLY B CA  1 
ATOM   2903  C C   . GLY B  2 160 ? 10.419  -42.926  44.608  1.00 53.11  ? 153  GLY B C   1 
ATOM   2904  O O   . GLY B  2 160 ? 9.775   -42.036  44.052  1.00 53.24  ? 153  GLY B O   1 
ATOM   2905  N N   . GLY B  2 161 ? 11.474  -42.684  45.378  1.00 47.64  ? 154  GLY B N   1 
ATOM   2906  C CA  . GLY B  2 161 ? 11.947  -41.335  45.623  1.00 46.73  ? 154  GLY B CA  1 
ATOM   2907  C C   . GLY B  2 161 ? 12.584  -40.712  44.396  1.00 48.05  ? 154  GLY B C   1 
ATOM   2908  O O   . GLY B  2 161 ? 12.728  -39.492  44.314  1.00 52.91  ? 154  GLY B O   1 
ATOM   2909  N N   . LEU B  2 162 ? 12.966  -41.554  43.440  1.00 44.36  ? 155  LEU B N   1 
ATOM   2910  C CA  . LEU B  2 162 ? 13.587  -41.090  42.204  1.00 40.87  ? 155  LEU B CA  1 
ATOM   2911  C C   . LEU B  2 162 ? 12.619  -40.267  41.363  1.00 46.09  ? 155  LEU B C   1 
ATOM   2912  O O   . LEU B  2 162 ? 13.034  -39.403  40.593  1.00 49.74  ? 155  LEU B O   1 
ATOM   2913  C CB  . LEU B  2 162 ? 14.106  -42.276  41.387  1.00 35.26  ? 155  LEU B CB  1 
ATOM   2914  C CG  . LEU B  2 162 ? 15.319  -43.018  41.952  1.00 37.26  ? 155  LEU B CG  1 
ATOM   2915  C CD1 . LEU B  2 162 ? 15.680  -44.203  41.071  1.00 38.07  ? 155  LEU B CD1 1 
ATOM   2916  C CD2 . LEU B  2 162 ? 16.501  -42.072  42.093  1.00 33.59  ? 155  LEU B CD2 1 
ATOM   2917  N N   . VAL B  2 163 ? 11.328  -40.542  41.514  1.00 45.45  ? 156  VAL B N   1 
ATOM   2918  C CA  . VAL B  2 163 ? 10.301  -39.846  40.749  1.00 43.96  ? 156  VAL B CA  1 
ATOM   2919  C C   . VAL B  2 163 ? 10.147  -38.400  41.208  1.00 41.92  ? 156  VAL B C   1 
ATOM   2920  O O   . VAL B  2 163 ? 10.274  -37.471  40.410  1.00 41.51  ? 156  VAL B O   1 
ATOM   2921  C CB  . VAL B  2 163 ? 8.941   -40.558  40.858  1.00 44.61  ? 156  VAL B CB  1 
ATOM   2922  C CG1 . VAL B  2 163 ? 7.854   -39.737  40.179  1.00 42.49  ? 156  VAL B CG1 1 
ATOM   2923  C CG2 . VAL B  2 163 ? 9.028   -41.949  40.251  1.00 43.56  ? 156  VAL B CG2 1 
ATOM   2924  N N   . GLY B  2 164 ? 9.874   -38.218  42.496  1.00 40.54  ? 157  GLY B N   1 
ATOM   2925  C CA  . GLY B  2 164 ? 9.713   -36.892  43.064  1.00 40.80  ? 157  GLY B CA  1 
ATOM   2926  C C   . GLY B  2 164 ? 10.967  -36.048  42.942  1.00 43.79  ? 157  GLY B C   1 
ATOM   2927  O O   . GLY B  2 164 ? 10.893  -34.844  42.701  1.00 45.06  ? 157  GLY B O   1 
ATOM   2928  N N   . PHE B  2 165 ? 12.123  -36.686  43.101  1.00 39.50  ? 158  PHE B N   1 
ATOM   2929  C CA  . PHE B  2 165 ? 13.402  -35.991  43.013  1.00 37.63  ? 158  PHE B CA  1 
ATOM   2930  C C   . PHE B  2 165 ? 13.671  -35.465  41.608  1.00 36.89  ? 158  PHE B C   1 
ATOM   2931  O O   . PHE B  2 165 ? 13.979  -34.287  41.426  1.00 37.97  ? 158  PHE B O   1 
ATOM   2932  C CB  . PHE B  2 165 ? 14.543  -36.915  43.443  1.00 37.11  ? 158  PHE B CB  1 
ATOM   2933  C CG  . PHE B  2 165 ? 15.911  -36.336  43.212  1.00 34.38  ? 158  PHE B CG  1 
ATOM   2934  C CD1 . PHE B  2 165 ? 16.414  -35.356  44.051  1.00 38.01  ? 158  PHE B CD1 1 
ATOM   2935  C CD2 . PHE B  2 165 ? 16.696  -36.776  42.158  1.00 29.08  ? 158  PHE B CD2 1 
ATOM   2936  C CE1 . PHE B  2 165 ? 17.671  -34.821  43.841  1.00 41.76  ? 158  PHE B CE1 1 
ATOM   2937  C CE2 . PHE B  2 165 ? 17.954  -36.245  41.943  1.00 34.24  ? 158  PHE B CE2 1 
ATOM   2938  C CZ  . PHE B  2 165 ? 18.442  -35.267  42.786  1.00 40.26  ? 158  PHE B CZ  1 
ATOM   2939  N N   . SER B  2 166 ? 13.554  -36.347  40.620  1.00 34.43  ? 159  SER B N   1 
ATOM   2940  C CA  . SER B  2 166 ? 13.869  -36.006  39.238  1.00 36.42  ? 159  SER B CA  1 
ATOM   2941  C C   . SER B  2 166 ? 12.954  -34.918  38.690  1.00 39.88  ? 159  SER B C   1 
ATOM   2942  O O   . SER B  2 166 ? 13.393  -34.054  37.933  1.00 43.88  ? 159  SER B O   1 
ATOM   2943  C CB  . SER B  2 166 ? 13.783  -37.249  38.353  1.00 37.70  ? 159  SER B CB  1 
ATOM   2944  O OG  . SER B  2 166 ? 14.642  -38.271  38.828  1.00 39.06  ? 159  SER B OG  1 
ATOM   2945  N N   . ARG B  2 167 ? 11.682  -34.965  39.073  1.00 34.87  ? 160  ARG B N   1 
ATOM   2946  C CA  . ARG B  2 167 ? 10.718  -33.970  38.622  1.00 33.55  ? 160  ARG B CA  1 
ATOM   2947  C C   . ARG B  2 167 ? 10.992  -32.615  39.263  1.00 32.22  ? 160  ARG B C   1 
ATOM   2948  O O   . ARG B  2 167 ? 10.932  -31.581  38.597  1.00 33.62  ? 160  ARG B O   1 
ATOM   2949  C CB  . ARG B  2 167 ? 9.290   -34.425  38.929  1.00 38.93  ? 160  ARG B CB  1 
ATOM   2950  C CG  . ARG B  2 167 ? 8.846   -35.624  38.107  1.00 45.52  ? 160  ARG B CG  1 
ATOM   2951  C CD  . ARG B  2 167 ? 7.369   -35.927  38.298  1.00 46.69  ? 160  ARG B CD  1 
ATOM   2952  N NE  . ARG B  2 167 ? 6.931   -37.023  37.438  1.00 50.70  ? 160  ARG B NE  1 
ATOM   2953  C CZ  . ARG B  2 167 ? 5.683   -37.475  37.378  1.00 58.11  ? 160  ARG B CZ  1 
ATOM   2954  N NH1 . ARG B  2 167 ? 4.739   -36.924  38.128  1.00 68.17  ? 160  ARG B NH1 1 
ATOM   2955  N NH2 . ARG B  2 167 ? 5.378   -38.477  36.565  1.00 56.80  ? 160  ARG B NH2 1 
ATOM   2956  N N   . ALA B  2 168 ? 11.297  -32.626  40.557  1.00 31.84  ? 161  ALA B N   1 
ATOM   2957  C CA  . ALA B  2 168 ? 11.654  -31.404  41.267  1.00 34.42  ? 161  ALA B CA  1 
ATOM   2958  C C   . ALA B  2 168 ? 12.963  -30.843  40.725  1.00 34.81  ? 161  ALA B C   1 
ATOM   2959  O O   . ALA B  2 168 ? 13.154  -29.629  40.656  1.00 33.76  ? 161  ALA B O   1 
ATOM   2960  C CB  . ALA B  2 168 ? 11.762  -31.666  42.759  1.00 28.09  ? 161  ALA B CB  1 
ATOM   2961  N N   . LEU B  2 169 ? 13.861  -31.742  40.337  1.00 33.16  ? 162  LEU B N   1 
ATOM   2962  C CA  . LEU B  2 169 ? 15.133  -31.349  39.747  1.00 37.31  ? 162  LEU B CA  1 
ATOM   2963  C C   . LEU B  2 169 ? 14.921  -30.810  38.338  1.00 35.48  ? 162  LEU B C   1 
ATOM   2964  O O   . LEU B  2 169 ? 15.564  -29.844  37.929  1.00 36.23  ? 162  LEU B O   1 
ATOM   2965  C CB  . LEU B  2 169 ? 16.101  -32.531  39.724  1.00 38.75  ? 162  LEU B CB  1 
ATOM   2966  C CG  . LEU B  2 169 ? 17.530  -32.232  39.272  1.00 35.64  ? 162  LEU B CG  1 
ATOM   2967  C CD1 . LEU B  2 169 ? 18.162  -31.184  40.174  1.00 28.25  ? 162  LEU B CD1 1 
ATOM   2968  C CD2 . LEU B  2 169 ? 18.359  -33.507  39.259  1.00 39.27  ? 162  LEU B CD2 1 
ATOM   2969  N N   . ALA B  2 170 ? 14.009  -31.440  37.604  1.00 34.35  ? 163  ALA B N   1 
ATOM   2970  C CA  . ALA B  2 170 ? 13.698  -31.024  36.242  1.00 31.37  ? 163  ALA B CA  1 
ATOM   2971  C C   . ALA B  2 170 ? 13.106  -29.619  36.216  1.00 35.15  ? 163  ALA B C   1 
ATOM   2972  O O   . ALA B  2 170 ? 13.376  -28.844  35.302  1.00 32.42  ? 163  ALA B O   1 
ATOM   2973  C CB  . ALA B  2 170 ? 12.747  -32.012  35.592  1.00 24.57  ? 163  ALA B CB  1 
ATOM   2974  N N   . LYS B  2 171 ? 12.298  -29.297  37.220  1.00 33.37  ? 164  LYS B N   1 
ATOM   2975  C CA  . LYS B  2 171 ? 11.727  -27.961  37.341  1.00 28.29  ? 164  LYS B CA  1 
ATOM   2976  C C   . LYS B  2 171 ? 12.804  -26.947  37.702  1.00 40.95  ? 164  LYS B C   1 
ATOM   2977  O O   . LYS B  2 171 ? 12.729  -25.778  37.324  1.00 30.63  ? 164  LYS B O   1 
ATOM   2978  C CB  . LYS B  2 171 ? 10.617  -27.940  38.395  1.00 29.16  ? 164  LYS B CB  1 
ATOM   2979  C CG  . LYS B  2 171 ? 9.399   -28.768  38.035  1.00 33.31  ? 164  LYS B CG  1 
ATOM   2980  C CD  . LYS B  2 171 ? 8.355   -28.733  39.140  1.00 33.44  ? 164  LYS B CD  1 
ATOM   2981  C CE  . LYS B  2 171 ? 7.118   -29.529  38.752  1.00 29.80  ? 164  LYS B CE  1 
ATOM   2982  N NZ  . LYS B  2 171 ? 6.090   -29.527  39.829  1.00 37.30  ? 164  LYS B NZ  1 
ATOM   2983  N N   . GLU B  2 172 ? 13.810  -27.414  38.433  1.00 43.91  ? 165  GLU B N   1 
ATOM   2984  C CA  . GLU B  2 172 ? 14.868  -26.553  38.945  1.00 46.39  ? 165  GLU B CA  1 
ATOM   2985  C C   . GLU B  2 172 ? 15.795  -26.054  37.840  1.00 45.49  ? 165  GLU B C   1 
ATOM   2986  O O   . GLU B  2 172 ? 16.115  -24.866  37.773  1.00 44.28  ? 165  GLU B O   1 
ATOM   2987  C CB  . GLU B  2 172 ? 15.679  -27.301  40.007  1.00 52.69  ? 165  GLU B CB  1 
ATOM   2988  C CG  . GLU B  2 172 ? 15.980  -26.492  41.257  1.00 57.34  ? 165  GLU B CG  1 
ATOM   2989  C CD  . GLU B  2 172 ? 16.717  -27.303  42.306  1.00 58.71  ? 165  GLU B CD  1 
ATOM   2990  O OE1 . GLU B  2 172 ? 17.850  -27.750  42.027  1.00 59.83  ? 165  GLU B OE1 1 
ATOM   2991  O OE2 . GLU B  2 172 ? 16.162  -27.499  43.408  1.00 59.55  ? 165  GLU B OE2 1 
ATOM   2992  N N   . VAL B  2 173 ? 16.219  -26.966  36.971  1.00 40.95  ? 166  VAL B N   1 
ATOM   2993  C CA  . VAL B  2 173 ? 17.213  -26.648  35.952  1.00 40.67  ? 166  VAL B CA  1 
ATOM   2994  C C   . VAL B  2 173 ? 16.643  -26.694  34.537  1.00 38.81  ? 166  VAL B C   1 
ATOM   2995  O O   . VAL B  2 173 ? 17.377  -26.906  33.571  1.00 42.75  ? 166  VAL B O   1 
ATOM   2996  C CB  . VAL B  2 173 ? 18.406  -27.610  36.034  1.00 39.02  ? 166  VAL B CB  1 
ATOM   2997  C CG1 . VAL B  2 173 ? 19.175  -27.382  37.325  1.00 41.30  ? 166  VAL B CG1 1 
ATOM   2998  C CG2 . VAL B  2 173 ? 17.924  -29.049  35.943  1.00 27.72  ? 166  VAL B CG2 1 
ATOM   2999  N N   . ALA B  2 174 ? 15.336  -26.489  34.420  1.00 35.03  ? 167  ALA B N   1 
ATOM   3000  C CA  . ALA B  2 174 ? 14.676  -26.501  33.121  1.00 36.01  ? 167  ALA B CA  1 
ATOM   3001  C C   . ALA B  2 174 ? 15.130  -25.331  32.256  1.00 44.19  ? 167  ALA B C   1 
ATOM   3002  O O   . ALA B  2 174 ? 15.323  -25.478  31.050  1.00 47.80  ? 167  ALA B O   1 
ATOM   3003  C CB  . ALA B  2 174 ? 13.172  -26.473  33.295  1.00 33.93  ? 167  ALA B CB  1 
ATOM   3004  N N   . ARG B  2 175 ? 15.303  -24.170  32.882  1.00 43.46  ? 168  ARG B N   1 
ATOM   3005  C CA  . ARG B  2 175 ? 15.713  -22.965  32.168  1.00 44.71  ? 168  ARG B CA  1 
ATOM   3006  C C   . ARG B  2 175 ? 17.223  -22.919  31.950  1.00 45.33  ? 168  ARG B C   1 
ATOM   3007  O O   . ARG B  2 175 ? 17.769  -21.897  31.536  1.00 47.57  ? 168  ARG B O   1 
ATOM   3008  C CB  . ARG B  2 175 ? 15.255  -21.716  32.924  1.00 44.99  ? 168  ARG B CB  1 
ATOM   3009  C CG  . ARG B  2 175 ? 13.744  -21.563  33.005  1.00 43.99  ? 168  ARG B CG  1 
ATOM   3010  C CD  . ARG B  2 175 ? 13.136  -21.355  31.626  1.00 41.13  ? 168  ARG B CD  1 
ATOM   3011  N NE  . ARG B  2 175 ? 11.677  -21.404  31.659  1.00 38.00  ? 168  ARG B NE  1 
ATOM   3012  C CZ  . ARG B  2 175 ? 10.896  -20.342  31.833  1.00 43.90  ? 168  ARG B CZ  1 
ATOM   3013  N NH1 . ARG B  2 175 ? 11.432  -19.140  31.990  1.00 47.95  ? 168  ARG B NH1 1 
ATOM   3014  N NH2 . ARG B  2 175 ? 9.578   -20.483  31.850  1.00 44.80  ? 168  ARG B NH2 1 
ATOM   3015  N N   . LYS B  2 176 ? 17.892  -24.032  32.234  1.00 43.29  ? 169  LYS B N   1 
ATOM   3016  C CA  . LYS B  2 176 ? 19.327  -24.144  32.010  1.00 39.48  ? 169  LYS B CA  1 
ATOM   3017  C C   . LYS B  2 176 ? 19.618  -25.201  30.951  1.00 45.78  ? 169  LYS B C   1 
ATOM   3018  O O   . LYS B  2 176 ? 20.731  -25.725  30.874  1.00 55.08  ? 169  LYS B O   1 
ATOM   3019  C CB  . LYS B  2 176 ? 20.050  -24.485  33.314  1.00 34.43  ? 169  LYS B CB  1 
ATOM   3020  N N   . LYS B  2 177 ? 18.603  -25.505  30.145  1.00 43.81  ? 170  LYS B N   1 
ATOM   3021  C CA  . LYS B  2 177 ? 18.693  -26.510  29.085  1.00 42.35  ? 170  LYS B CA  1 
ATOM   3022  C C   . LYS B  2 177 ? 19.085  -27.886  29.619  1.00 36.55  ? 170  LYS B C   1 
ATOM   3023  O O   . LYS B  2 177 ? 19.745  -28.662  28.930  1.00 39.14  ? 170  LYS B O   1 
ATOM   3024  C CB  . LYS B  2 177 ? 19.684  -26.071  28.001  1.00 48.60  ? 170  LYS B CB  1 
ATOM   3025  C CG  . LYS B  2 177 ? 19.064  -25.271  26.862  1.00 51.97  ? 170  LYS B CG  1 
ATOM   3026  C CD  . LYS B  2 177 ? 18.572  -23.909  27.323  1.00 55.48  ? 170  LYS B CD  1 
ATOM   3027  C CE  . LYS B  2 177 ? 17.928  -23.143  26.180  1.00 62.77  ? 170  LYS B CE  1 
ATOM   3028  N NZ  . LYS B  2 177 ? 17.444  -21.802  26.611  1.00 67.52  ? 170  LYS B NZ  1 
ATOM   3029  N N   . ILE B  2 178 ? 18.671  -28.186  30.846  1.00 32.88  ? 171  ILE B N   1 
ATOM   3030  C CA  . ILE B  2 178 ? 18.938  -29.490  31.439  1.00 34.29  ? 171  ILE B CA  1 
ATOM   3031  C C   . ILE B  2 178 ? 17.642  -30.274  31.619  1.00 37.54  ? 171  ILE B C   1 
ATOM   3032  O O   . ILE B  2 178 ? 16.671  -29.768  32.182  1.00 33.98  ? 171  ILE B O   1 
ATOM   3033  C CB  . ILE B  2 178 ? 19.650  -29.363  32.799  1.00 30.93  ? 171  ILE B CB  1 
ATOM   3034  C CG1 . ILE B  2 178 ? 20.918  -28.519  32.663  1.00 30.80  ? 171  ILE B CG1 1 
ATOM   3035  C CG2 . ILE B  2 178 ? 19.981  -30.739  33.360  1.00 27.91  ? 171  ILE B CG2 1 
ATOM   3036  C CD1 . ILE B  2 178 ? 21.679  -28.356  33.958  1.00 33.33  ? 171  ILE B CD1 1 
ATOM   3037  N N   . ARG B  2 179 ? 17.633  -31.511  31.132  1.00 39.83  ? 172  ARG B N   1 
ATOM   3038  C CA  . ARG B  2 179 ? 16.449  -32.358  31.212  1.00 35.67  ? 172  ARG B CA  1 
ATOM   3039  C C   . ARG B  2 179 ? 16.684  -33.559  32.121  1.00 33.93  ? 172  ARG B C   1 
ATOM   3040  O O   . ARG B  2 179 ? 17.670  -34.279  31.970  1.00 35.24  ? 172  ARG B O   1 
ATOM   3041  C CB  . ARG B  2 179 ? 16.035  -32.831  29.817  1.00 36.74  ? 172  ARG B CB  1 
ATOM   3042  C CG  . ARG B  2 179 ? 15.766  -31.704  28.833  1.00 37.42  ? 172  ARG B CG  1 
ATOM   3043  C CD  . ARG B  2 179 ? 15.324  -32.232  27.475  1.00 33.79  ? 172  ARG B CD  1 
ATOM   3044  N NE  . ARG B  2 179 ? 16.362  -33.018  26.815  1.00 37.66  ? 172  ARG B NE  1 
ATOM   3045  C CZ  . ARG B  2 179 ? 16.374  -34.346  26.758  1.00 34.27  ? 172  ARG B CZ  1 
ATOM   3046  N NH1 . ARG B  2 179 ? 15.395  -35.046  27.316  1.00 27.69  ? 172  ARG B NH1 1 
ATOM   3047  N NH2 . ARG B  2 179 ? 17.360  -34.975  26.135  1.00 37.81  ? 172  ARG B NH2 1 
ATOM   3048  N N   . VAL B  2 180 ? 15.773  -33.770  33.066  1.00 37.17  ? 173  VAL B N   1 
ATOM   3049  C CA  . VAL B  2 180 ? 15.864  -34.906  33.975  1.00 39.67  ? 173  VAL B CA  1 
ATOM   3050  C C   . VAL B  2 180 ? 14.634  -35.802  33.846  1.00 37.66  ? 173  VAL B C   1 
ATOM   3051  O O   . VAL B  2 180 ? 13.504  -35.349  34.029  1.00 29.72  ? 173  VAL B O   1 
ATOM   3052  C CB  . VAL B  2 180 ? 16.009  -34.453  35.442  1.00 35.32  ? 173  VAL B CB  1 
ATOM   3053  C CG1 . VAL B  2 180 ? 16.372  -35.636  36.326  1.00 29.64  ? 173  VAL B CG1 1 
ATOM   3054  C CG2 . VAL B  2 180 ? 17.057  -33.357  35.561  1.00 32.33  ? 173  VAL B CG2 1 
ATOM   3055  N N   . ASN B  2 181 ? 14.860  -37.072  33.526  1.00 40.02  ? 174  ASN B N   1 
ATOM   3056  C CA  . ASN B  2 181 ? 13.767  -38.027  33.375  1.00 40.39  ? 174  ASN B CA  1 
ATOM   3057  C C   . ASN B  2 181 ? 14.037  -39.342  34.098  1.00 38.44  ? 174  ASN B C   1 
ATOM   3058  O O   . ASN B  2 181 ? 15.154  -39.597  34.550  1.00 37.07  ? 174  ASN B O   1 
ATOM   3059  C CB  . ASN B  2 181 ? 13.500  -38.302  31.894  1.00 43.87  ? 174  ASN B CB  1 
ATOM   3060  C CG  . ASN B  2 181 ? 12.918  -37.103  31.175  1.00 43.49  ? 174  ASN B CG  1 
ATOM   3061  O OD1 . ASN B  2 181 ? 11.723  -36.826  31.276  1.00 44.01  ? 174  ASN B OD1 1 
ATOM   3062  N ND2 . ASN B  2 181 ? 13.760  -36.389  30.436  1.00 40.31  ? 174  ASN B ND2 1 
ATOM   3063  N N   . VAL B  2 182 ? 13.006  -40.173  34.202  1.00 33.52  ? 175  VAL B N   1 
ATOM   3064  C CA  . VAL B  2 182 ? 13.125  -41.465  34.867  1.00 30.24  ? 175  VAL B CA  1 
ATOM   3065  C C   . VAL B  2 182 ? 12.604  -42.594  33.987  1.00 29.71  ? 175  VAL B C   1 
ATOM   3066  O O   . VAL B  2 182 ? 11.488  -42.529  33.475  1.00 33.98  ? 175  VAL B O   1 
ATOM   3067  C CB  . VAL B  2 182 ? 12.360  -41.486  36.208  1.00 33.42  ? 175  VAL B CB  1 
ATOM   3068  C CG1 . VAL B  2 182 ? 12.305  -42.899  36.774  1.00 40.93  ? 175  VAL B CG1 1 
ATOM   3069  C CG2 . VAL B  2 182 ? 13.003  -40.541  37.204  1.00 27.32  ? 175  VAL B CG2 1 
ATOM   3070  N N   . VAL B  2 183 ? 13.422  -43.624  33.804  1.00 24.48  ? 176  VAL B N   1 
ATOM   3071  C CA  . VAL B  2 183 ? 12.973  -44.836  33.133  1.00 32.34  ? 176  VAL B CA  1 
ATOM   3072  C C   . VAL B  2 183 ? 12.519  -45.840  34.182  1.00 25.54  ? 176  VAL B C   1 
ATOM   3073  O O   . VAL B  2 183 ? 13.261  -46.150  35.114  1.00 25.50  ? 176  VAL B O   1 
ATOM   3074  C CB  . VAL B  2 183 ? 14.078  -45.457  32.258  1.00 34.53  ? 176  VAL B CB  1 
ATOM   3075  C CG1 . VAL B  2 183 ? 13.628  -46.800  31.706  1.00 28.45  ? 176  VAL B CG1 1 
ATOM   3076  C CG2 . VAL B  2 183 ? 14.450  -44.515  31.128  1.00 42.02  ? 176  VAL B CG2 1 
ATOM   3077  N N   . ALA B  2 184 ? 11.294  -46.335  34.036  1.00 25.87  ? 177  ALA B N   1 
ATOM   3078  C CA  . ALA B  2 184 ? 10.732  -47.274  34.999  1.00 30.93  ? 177  ALA B CA  1 
ATOM   3079  C C   . ALA B  2 184 ? 10.491  -48.641  34.369  1.00 40.06  ? 177  ALA B C   1 
ATOM   3080  O O   . ALA B  2 184 ? 9.398   -48.917  33.874  1.00 44.85  ? 177  ALA B O   1 
ATOM   3081  C CB  . ALA B  2 184 ? 9.438   -46.723  35.579  1.00 25.84  ? 177  ALA B CB  1 
ATOM   3082  N N   . PRO B  2 185 ? 11.517  -49.505  34.386  1.00 37.83  ? 178  PRO B N   1 
ATOM   3083  C CA  . PRO B  2 185 ? 11.387  -50.858  33.839  1.00 39.98  ? 178  PRO B CA  1 
ATOM   3084  C C   . PRO B  2 185 ? 10.517  -51.748  34.719  1.00 42.18  ? 178  PRO B C   1 
ATOM   3085  O O   . PRO B  2 185 ? 10.350  -51.468  35.906  1.00 43.74  ? 178  PRO B O   1 
ATOM   3086  C CB  . PRO B  2 185 ? 12.831  -51.362  33.812  1.00 35.37  ? 178  PRO B CB  1 
ATOM   3087  C CG  . PRO B  2 185 ? 13.494  -50.623  34.918  1.00 30.15  ? 178  PRO B CG  1 
ATOM   3088  C CD  . PRO B  2 185 ? 12.866  -49.258  34.923  1.00 28.34  ? 178  PRO B CD  1 
ATOM   3089  N N   . GLY B  2 186 ? 9.969   -52.807  34.134  1.00 45.62  ? 179  GLY B N   1 
ATOM   3090  C CA  . GLY B  2 186 ? 9.176   -53.762  34.883  1.00 44.82  ? 179  GLY B CA  1 
ATOM   3091  C C   . GLY B  2 186 ? 9.998   -54.978  35.257  1.00 46.27  ? 179  GLY B C   1 
ATOM   3092  O O   . GLY B  2 186 ? 10.903  -54.895  36.087  1.00 51.09  ? 179  GLY B O   1 
ATOM   3093  N N   . PHE B  2 187 ? 9.685   -56.110  34.636  1.00 46.12  ? 180  PHE B N   1 
ATOM   3094  C CA  . PHE B  2 187 ? 10.420  -57.343  34.882  1.00 50.46  ? 180  PHE B CA  1 
ATOM   3095  C C   . PHE B  2 187 ? 11.415  -57.621  33.762  1.00 55.41  ? 180  PHE B C   1 
ATOM   3096  O O   . PHE B  2 187 ? 11.026  -57.937  32.638  1.00 56.13  ? 180  PHE B O   1 
ATOM   3097  C CB  . PHE B  2 187 ? 9.456   -58.520  35.033  1.00 52.15  ? 180  PHE B CB  1 
ATOM   3098  C CG  . PHE B  2 187 ? 8.611   -58.456  36.271  1.00 56.88  ? 180  PHE B CG  1 
ATOM   3099  C CD1 . PHE B  2 187 ? 9.076   -57.823  37.411  1.00 59.82  ? 180  PHE B CD1 1 
ATOM   3100  C CD2 . PHE B  2 187 ? 7.350   -59.028  36.294  1.00 58.88  ? 180  PHE B CD2 1 
ATOM   3101  C CE1 . PHE B  2 187 ? 8.300   -57.763  38.553  1.00 63.11  ? 180  PHE B CE1 1 
ATOM   3102  C CE2 . PHE B  2 187 ? 6.569   -58.971  37.432  1.00 62.27  ? 180  PHE B CE2 1 
ATOM   3103  C CZ  . PHE B  2 187 ? 7.044   -58.337  38.563  1.00 63.71  ? 180  PHE B CZ  1 
ATOM   3104  N N   . VAL B  2 188 ? 12.700  -57.498  34.077  1.00 58.86  ? 181  VAL B N   1 
ATOM   3105  C CA  . VAL B  2 188 ? 13.756  -57.749  33.104  1.00 59.54  ? 181  VAL B CA  1 
ATOM   3106  C C   . VAL B  2 188 ? 14.755  -58.769  33.640  1.00 60.53  ? 181  VAL B C   1 
ATOM   3107  O O   . VAL B  2 188 ? 14.545  -59.354  34.702  1.00 58.46  ? 181  VAL B O   1 
ATOM   3108  C CB  . VAL B  2 188 ? 14.501  -56.453  32.733  1.00 55.63  ? 181  VAL B CB  1 
ATOM   3109  N N   . HIS B  2 189 ? 15.838  -58.980  32.901  1.00 66.24  ? 182  HIS B N   1 
ATOM   3110  C CA  . HIS B  2 189 ? 16.880  -59.909  33.323  1.00 73.36  ? 182  HIS B CA  1 
ATOM   3111  C C   . HIS B  2 189 ? 18.188  -59.171  33.591  1.00 72.72  ? 182  HIS B C   1 
ATOM   3112  O O   . HIS B  2 189 ? 18.918  -59.497  34.527  1.00 73.14  ? 182  HIS B O   1 
ATOM   3113  C CB  . HIS B  2 189 ? 17.094  -60.995  32.268  1.00 81.51  ? 182  HIS B CB  1 
ATOM   3114  C CG  . HIS B  2 189 ? 15.829  -61.662  31.821  1.00 85.07  ? 182  HIS B CG  1 
ATOM   3115  N ND1 . HIS B  2 189 ? 15.120  -61.242  30.717  1.00 86.35  ? 182  HIS B ND1 1 
ATOM   3116  C CD2 . HIS B  2 189 ? 15.147  -62.713  32.332  1.00 88.07  ? 182  HIS B CD2 1 
ATOM   3117  C CE1 . HIS B  2 189 ? 14.055  -62.011  30.563  1.00 88.11  ? 182  HIS B CE1 1 
ATOM   3118  N NE2 . HIS B  2 189 ? 14.047  -62.909  31.530  1.00 89.21  ? 182  HIS B NE2 1 
ATOM   3119  N N   . GLU B  2 199 ? 8.950   -66.191  37.262  1.00 82.00  ? 192  GLU B N   1 
ATOM   3120  C CA  . GLU B  2 199 ? 9.702   -66.100  36.016  1.00 82.85  ? 192  GLU B CA  1 
ATOM   3121  C C   . GLU B  2 199 ? 9.056   -66.941  34.920  1.00 87.86  ? 192  GLU B C   1 
ATOM   3122  O O   . GLU B  2 199 ? 9.492   -66.921  33.769  1.00 90.75  ? 192  GLU B O   1 
ATOM   3123  C CB  . GLU B  2 199 ? 11.154  -66.533  36.236  1.00 80.93  ? 192  GLU B CB  1 
ATOM   3124  C CG  . GLU B  2 199 ? 11.305  -67.890  36.905  1.00 79.70  ? 192  GLU B CG  1 
ATOM   3125  C CD  . GLU B  2 199 ? 12.743  -68.203  37.270  1.00 78.39  ? 192  GLU B CD  1 
ATOM   3126  O OE1 . GLU B  2 199 ? 13.616  -67.337  37.049  1.00 74.19  ? 192  GLU B OE1 1 
ATOM   3127  O OE2 . GLU B  2 199 ? 12.999  -69.314  37.781  1.00 81.93  ? 192  GLU B OE2 1 
ATOM   3128  N N   . HIS B  2 200 ? 8.012   -67.676  35.287  1.00 93.25  ? 193  HIS B N   1 
ATOM   3129  C CA  . HIS B  2 200 ? 7.268   -68.490  34.333  1.00 95.22  ? 193  HIS B CA  1 
ATOM   3130  C C   . HIS B  2 200 ? 5.777   -68.460  34.650  1.00 94.96  ? 193  HIS B C   1 
ATOM   3131  O O   . HIS B  2 200 ? 4.959   -68.980  33.892  1.00 94.60  ? 193  HIS B O   1 
ATOM   3132  C CB  . HIS B  2 200 ? 7.787   -69.930  34.330  1.00 103.44 ? 193  HIS B CB  1 
ATOM   3133  C CG  . HIS B  2 200 ? 7.945   -70.521  35.696  1.00 111.05 ? 193  HIS B CG  1 
ATOM   3134  N ND1 . HIS B  2 200 ? 9.012   -70.222  36.517  1.00 112.56 ? 193  HIS B ND1 1 
ATOM   3135  C CD2 . HIS B  2 200 ? 7.178   -71.399  36.384  1.00 116.12 ? 193  HIS B CD2 1 
ATOM   3136  C CE1 . HIS B  2 200 ? 8.892   -70.886  37.652  1.00 117.30 ? 193  HIS B CE1 1 
ATOM   3137  N NE2 . HIS B  2 200 ? 7.787   -71.608  37.597  1.00 119.84 ? 193  HIS B NE2 1 
ATOM   3138  N N   . LEU B  2 201 ? 5.433   -67.842  35.776  1.00 93.51  ? 194  LEU B N   1 
ATOM   3139  C CA  . LEU B  2 201 ? 4.039   -67.683  36.173  1.00 92.05  ? 194  LEU B CA  1 
ATOM   3140  C C   . LEU B  2 201 ? 3.515   -66.315  35.752  1.00 86.13  ? 194  LEU B C   1 
ATOM   3141  O O   . LEU B  2 201 ? 2.340   -66.001  35.944  1.00 82.11  ? 194  LEU B O   1 
ATOM   3142  C CB  . LEU B  2 201 ? 3.882   -67.867  37.683  1.00 95.80  ? 194  LEU B CB  1 
ATOM   3143  N N   . LYS B  2 202 ? 4.396   -65.504  35.174  1.00 84.19  ? 195  LYS B N   1 
ATOM   3144  C CA  . LYS B  2 202 ? 4.024   -64.174  34.706  1.00 82.46  ? 195  LYS B CA  1 
ATOM   3145  C C   . LYS B  2 202 ? 3.425   -64.228  33.304  1.00 81.87  ? 195  LYS B C   1 
ATOM   3146  O O   . LYS B  2 202 ? 3.870   -63.521  32.400  1.00 78.20  ? 195  LYS B O   1 
ATOM   3147  C CB  . LYS B  2 202 ? 5.235   -63.241  34.725  1.00 78.54  ? 195  LYS B CB  1 
ATOM   3148  N N   . LYS B  2 203 ? 2.413   -65.072  33.133  1.00 87.81  ? 196  LYS B N   1 
ATOM   3149  C CA  . LYS B  2 203 ? 1.721   -65.195  31.856  1.00 86.30  ? 196  LYS B CA  1 
ATOM   3150  C C   . LYS B  2 203 ? 0.577   -64.191  31.770  1.00 86.08  ? 196  LYS B C   1 
ATOM   3151  O O   . LYS B  2 203 ? -0.286  -64.289  30.898  1.00 87.41  ? 196  LYS B O   1 
ATOM   3152  C CB  . LYS B  2 203 ? 1.195   -66.618  31.663  1.00 89.48  ? 196  LYS B CB  1 
ATOM   3153  N N   . ASN B  2 204 ? 0.578   -63.226  32.685  1.00 85.27  ? 197  ASN B N   1 
ATOM   3154  C CA  . ASN B  2 204 ? -0.454  -62.201  32.723  1.00 83.98  ? 197  ASN B CA  1 
ATOM   3155  C C   . ASN B  2 204 ? 0.021   -60.905  32.075  1.00 79.76  ? 197  ASN B C   1 
ATOM   3156  O O   . ASN B  2 204 ? -0.771  -59.996  31.828  1.00 81.26  ? 197  ASN B O   1 
ATOM   3157  C CB  . ASN B  2 204 ? -0.892  -61.941  34.164  1.00 88.57  ? 197  ASN B CB  1 
ATOM   3158  C CG  . ASN B  2 204 ? -1.199  -63.221  34.918  1.00 93.72  ? 197  ASN B CG  1 
ATOM   3159  O OD1 . ASN B  2 204 ? -0.358  -63.739  35.652  1.00 95.17  ? 197  ASN B OD1 1 
ATOM   3160  N ND2 . ASN B  2 204 ? -2.407  -63.743  34.734  1.00 95.75  ? 197  ASN B ND2 1 
ATOM   3161  N N   . ILE B  2 205 ? 1.322   -60.825  31.810  1.00 69.74  ? 198  ILE B N   1 
ATOM   3162  C CA  . ILE B  2 205 ? 1.884   -59.690  31.090  1.00 66.64  ? 198  ILE B CA  1 
ATOM   3163  C C   . ILE B  2 205 ? 1.324   -59.664  29.673  1.00 64.03  ? 198  ILE B C   1 
ATOM   3164  O O   . ILE B  2 205 ? 1.391   -60.665  28.962  1.00 66.17  ? 198  ILE B O   1 
ATOM   3165  C CB  . ILE B  2 205 ? 3.424   -59.748  31.039  1.00 45.43  ? 198  ILE B CB  1 
ATOM   3166  C CG1 . ILE B  2 205 ? 4.008   -59.675  32.450  1.00 46.25  ? 198  ILE B CG1 1 
ATOM   3167  C CG2 . ILE B  2 205 ? 3.977   -58.621  30.178  1.00 42.65  ? 198  ILE B CG2 1 
ATOM   3168  C CD1 . ILE B  2 205 ? 5.521   -59.659  32.487  1.00 45.96  ? 198  ILE B CD1 1 
ATOM   3169  N N   . PRO B  2 206 ? 0.752   -58.518  29.268  1.00 56.41  ? 199  PRO B N   1 
ATOM   3170  C CA  . PRO B  2 206 ? 0.137   -58.339  27.947  1.00 51.68  ? 199  PRO B CA  1 
ATOM   3171  C C   . PRO B  2 206 ? 1.047   -58.748  26.790  1.00 47.78  ? 199  PRO B C   1 
ATOM   3172  O O   . PRO B  2 206 ? 0.550   -59.160  25.744  1.00 47.91  ? 199  PRO B O   1 
ATOM   3173  C CB  . PRO B  2 206 ? -0.155  -56.838  27.905  1.00 50.86  ? 199  PRO B CB  1 
ATOM   3174  C CG  . PRO B  2 206 ? -0.382  -56.478  29.328  1.00 50.22  ? 199  PRO B CG  1 
ATOM   3175  C CD  . PRO B  2 206 ? 0.589   -57.321  30.112  1.00 52.98  ? 199  PRO B CD  1 
ATOM   3176  N N   . LEU B  2 207 ? 2.358   -58.641  26.980  1.00 46.93  ? 200  LEU B N   1 
ATOM   3177  C CA  . LEU B  2 207 ? 3.310   -59.049  25.953  1.00 49.11  ? 200  LEU B CA  1 
ATOM   3178  C C   . LEU B  2 207 ? 3.803   -60.475  26.190  1.00 50.47  ? 200  LEU B C   1 
ATOM   3179  O O   . LEU B  2 207 ? 4.548   -61.026  25.380  1.00 45.46  ? 200  LEU B O   1 
ATOM   3180  C CB  . LEU B  2 207 ? 4.488   -58.075  25.899  1.00 40.04  ? 200  LEU B CB  1 
ATOM   3181  C CG  . LEU B  2 207 ? 4.447   -57.053  24.760  1.00 41.51  ? 200  LEU B CG  1 
ATOM   3182  C CD1 . LEU B  2 207 ? 3.051   -56.470  24.595  1.00 37.78  ? 200  LEU B CD1 1 
ATOM   3183  C CD2 . LEU B  2 207 ? 5.464   -55.946  24.994  1.00 40.21  ? 200  LEU B CD2 1 
ATOM   3184  N N   . GLY B  2 208 ? 3.382   -61.062  27.306  1.00 54.62  ? 201  GLY B N   1 
ATOM   3185  C CA  . GLY B  2 208 ? 3.647   -62.461  27.594  1.00 58.82  ? 201  GLY B CA  1 
ATOM   3186  C C   . GLY B  2 208 ? 5.104   -62.833  27.794  1.00 62.67  ? 201  GLY B C   1 
ATOM   3187  O O   . GLY B  2 208 ? 5.486   -63.984  27.578  1.00 67.05  ? 201  GLY B O   1 
ATOM   3188  N N   . ARG B  2 209 ? 5.919   -61.870  28.214  1.00 57.16  ? 202  ARG B N   1 
ATOM   3189  C CA  . ARG B  2 209 ? 7.337   -62.126  28.446  1.00 54.73  ? 202  ARG B CA  1 
ATOM   3190  C C   . ARG B  2 209 ? 7.966   -61.072  29.349  1.00 51.07  ? 202  ARG B C   1 
ATOM   3191  O O   . ARG B  2 209 ? 7.412   -59.988  29.534  1.00 47.98  ? 202  ARG B O   1 
ATOM   3192  C CB  . ARG B  2 209 ? 8.097   -62.179  27.118  1.00 50.82  ? 202  ARG B CB  1 
ATOM   3193  C CG  . ARG B  2 209 ? 8.115   -60.857  26.366  1.00 49.33  ? 202  ARG B CG  1 
ATOM   3194  C CD  . ARG B  2 209 ? 8.964   -60.942  25.108  1.00 50.13  ? 202  ARG B CD  1 
ATOM   3195  N NE  . ARG B  2 209 ? 8.954   -59.688  24.359  1.00 50.03  ? 202  ARG B NE  1 
ATOM   3196  C CZ  . ARG B  2 209 ? 9.839   -58.710  24.524  1.00 50.07  ? 202  ARG B CZ  1 
ATOM   3197  N NH1 . ARG B  2 209 ? 10.813  -58.837  25.415  1.00 43.37  ? 202  ARG B NH1 1 
ATOM   3198  N NH2 . ARG B  2 209 ? 9.751   -57.604  23.797  1.00 51.92  ? 202  ARG B NH2 1 
ATOM   3199  N N   . PHE B  2 210 ? 9.125   -61.399  29.909  1.00 51.28  ? 203  PHE B N   1 
ATOM   3200  C CA  . PHE B  2 210 ? 9.909   -60.425  30.656  1.00 54.54  ? 203  PHE B CA  1 
ATOM   3201  C C   . PHE B  2 210 ? 10.623  -59.488  29.689  1.00 57.90  ? 203  PHE B C   1 
ATOM   3202  O O   . PHE B  2 210 ? 10.605  -59.704  28.477  1.00 61.89  ? 203  PHE B O   1 
ATOM   3203  C CB  . PHE B  2 210 ? 10.925  -61.115  31.569  1.00 54.58  ? 203  PHE B CB  1 
ATOM   3204  C CG  . PHE B  2 210 ? 10.347  -61.606  32.866  1.00 56.82  ? 203  PHE B CG  1 
ATOM   3205  C CD1 . PHE B  2 210 ? 9.000   -61.452  33.147  1.00 50.67  ? 203  PHE B CD1 1 
ATOM   3206  C CD2 . PHE B  2 210 ? 11.156  -62.224  33.806  1.00 63.26  ? 203  PHE B CD2 1 
ATOM   3207  C CE1 . PHE B  2 210 ? 8.472   -61.903  34.341  1.00 52.55  ? 203  PHE B CE1 1 
ATOM   3208  C CE2 . PHE B  2 210 ? 10.634  -62.676  35.003  1.00 63.52  ? 203  PHE B CE2 1 
ATOM   3209  C CZ  . PHE B  2 210 ? 9.290   -62.516  35.270  1.00 61.45  ? 203  PHE B CZ  1 
ATOM   3210  N N   . GLY B  2 211 ? 11.254  -58.452  30.228  1.00 63.22  ? 204  GLY B N   1 
ATOM   3211  C CA  . GLY B  2 211 ? 11.956  -57.486  29.404  1.00 62.99  ? 204  GLY B CA  1 
ATOM   3212  C C   . GLY B  2 211 ? 13.432  -57.795  29.249  1.00 60.51  ? 204  GLY B C   1 
ATOM   3213  O O   . GLY B  2 211 ? 13.989  -58.616  29.977  1.00 58.81  ? 204  GLY B O   1 
ATOM   3214  N N   . GLU B  2 212 ? 14.065  -57.133  28.287  1.00 55.86  ? 205  GLU B N   1 
ATOM   3215  C CA  . GLU B  2 212 ? 15.498  -57.275  28.075  1.00 54.24  ? 205  GLU B CA  1 
ATOM   3216  C C   . GLU B  2 212 ? 16.203  -55.959  28.378  1.00 51.17  ? 205  GLU B C   1 
ATOM   3217  O O   . GLU B  2 212 ? 15.637  -54.884  28.176  1.00 42.65  ? 205  GLU B O   1 
ATOM   3218  C CB  . GLU B  2 212 ? 15.791  -57.724  26.642  1.00 50.78  ? 205  GLU B CB  1 
ATOM   3219  C CG  . GLU B  2 212 ? 15.203  -59.082  26.288  1.00 55.49  ? 205  GLU B CG  1 
ATOM   3220  C CD  . GLU B  2 212 ? 15.787  -60.209  27.121  1.00 63.26  ? 205  GLU B CD  1 
ATOM   3221  O OE1 . GLU B  2 212 ? 16.971  -60.114  27.509  1.00 71.56  ? 205  GLU B OE1 1 
ATOM   3222  O OE2 . GLU B  2 212 ? 15.061  -61.189  27.390  1.00 59.72  ? 205  GLU B OE2 1 
ATOM   3223  N N   . THR B  2 213 ? 17.436  -56.052  28.868  1.00 49.99  ? 206  THR B N   1 
ATOM   3224  C CA  . THR B  2 213 ? 18.205  -54.874  29.257  1.00 51.27  ? 206  THR B CA  1 
ATOM   3225  C C   . THR B  2 213 ? 18.424  -53.923  28.084  1.00 54.72  ? 206  THR B C   1 
ATOM   3226  O O   . THR B  2 213 ? 18.457  -52.704  28.260  1.00 55.61  ? 206  THR B O   1 
ATOM   3227  C CB  . THR B  2 213 ? 19.574  -55.266  29.844  1.00 51.30  ? 206  THR B CB  1 
ATOM   3228  O OG1 . THR B  2 213 ? 20.311  -56.026  28.878  1.00 54.04  ? 206  THR B OG1 1 
ATOM   3229  C CG2 . THR B  2 213 ? 19.396  -56.096  31.106  1.00 51.48  ? 206  THR B CG2 1 
ATOM   3230  N N   . ILE B  2 214 ? 18.570  -54.486  26.888  1.00 56.64  ? 207  ILE B N   1 
ATOM   3231  C CA  . ILE B  2 214 ? 18.777  -53.687  25.686  1.00 58.66  ? 207  ILE B CA  1 
ATOM   3232  C C   . ILE B  2 214 ? 17.515  -52.895  25.342  1.00 60.38  ? 207  ILE B C   1 
ATOM   3233  O O   . ILE B  2 214 ? 17.592  -51.777  24.830  1.00 60.65  ? 207  ILE B O   1 
ATOM   3234  C CB  . ILE B  2 214 ? 19.198  -54.574  24.486  1.00 77.52  ? 207  ILE B CB  1 
ATOM   3235  C CG1 . ILE B  2 214 ? 19.409  -53.727  23.228  1.00 77.02  ? 207  ILE B CG1 1 
ATOM   3236  C CG2 . ILE B  2 214 ? 18.181  -55.683  24.238  1.00 76.82  ? 207  ILE B CG2 1 
ATOM   3237  C CD1 . ILE B  2 214 ? 20.484  -52.669  23.375  1.00 75.38  ? 207  ILE B CD1 1 
ATOM   3238  N N   . GLU B  2 215 ? 16.355  -53.470  25.643  1.00 57.71  ? 208  GLU B N   1 
ATOM   3239  C CA  . GLU B  2 215 ? 15.085  -52.802  25.388  1.00 52.14  ? 208  GLU B CA  1 
ATOM   3240  C C   . GLU B  2 215 ? 14.922  -51.605  26.315  1.00 43.55  ? 208  GLU B C   1 
ATOM   3241  O O   . GLU B  2 215 ? 14.417  -50.557  25.912  1.00 33.49  ? 208  GLU B O   1 
ATOM   3242  C CB  . GLU B  2 215 ? 13.920  -53.777  25.560  1.00 53.98  ? 208  GLU B CB  1 
ATOM   3243  C CG  . GLU B  2 215 ? 13.926  -54.921  24.558  1.00 59.48  ? 208  GLU B CG  1 
ATOM   3244  C CD  . GLU B  2 215 ? 12.718  -55.825  24.694  1.00 62.38  ? 208  GLU B CD  1 
ATOM   3245  O OE1 . GLU B  2 215 ? 12.407  -56.240  25.830  1.00 64.03  ? 208  GLU B OE1 1 
ATOM   3246  O OE2 . GLU B  2 215 ? 12.075  -56.116  23.664  1.00 63.31  ? 208  GLU B OE2 1 
ATOM   3247  N N   . VAL B  2 216 ? 15.357  -51.768  27.559  1.00 41.57  ? 209  VAL B N   1 
ATOM   3248  C CA  . VAL B  2 216 ? 15.347  -50.674  28.519  1.00 38.81  ? 209  VAL B CA  1 
ATOM   3249  C C   . VAL B  2 216 ? 16.404  -49.646  28.130  1.00 42.96  ? 209  VAL B C   1 
ATOM   3250  O O   . VAL B  2 216 ? 16.216  -48.443  28.317  1.00 47.86  ? 209  VAL B O   1 
ATOM   3251  C CB  . VAL B  2 216 ? 15.605  -51.173  29.954  1.00 39.15  ? 209  VAL B CB  1 
ATOM   3252  C CG1 . VAL B  2 216 ? 15.438  -50.038  30.954  1.00 32.58  ? 209  VAL B CG1 1 
ATOM   3253  C CG2 . VAL B  2 216 ? 14.666  -52.321  30.290  1.00 36.87  ? 209  VAL B CG2 1 
ATOM   3254  N N   . ALA B  2 217 ? 17.511  -50.131  27.576  1.00 41.05  ? 210  ALA B N   1 
ATOM   3255  C CA  . ALA B  2 217 ? 18.597  -49.265  27.132  1.00 40.33  ? 210  ALA B CA  1 
ATOM   3256  C C   . ALA B  2 217 ? 18.129  -48.315  26.034  1.00 40.27  ? 210  ALA B C   1 
ATOM   3257  O O   . ALA B  2 217 ? 18.499  -47.141  26.020  1.00 38.83  ? 210  ALA B O   1 
ATOM   3258  C CB  . ALA B  2 217 ? 19.773  -50.096  26.647  1.00 42.51  ? 210  ALA B CB  1 
ATOM   3259  N N   . HIS B  2 218 ? 17.314  -48.829  25.118  1.00 43.97  ? 211  HIS B N   1 
ATOM   3260  C CA  . HIS B  2 218 ? 16.737  -48.008  24.059  1.00 41.29  ? 211  HIS B CA  1 
ATOM   3261  C C   . HIS B  2 218 ? 15.792  -46.959  24.634  1.00 37.07  ? 211  HIS B C   1 
ATOM   3262  O O   . HIS B  2 218 ? 15.625  -45.882  24.063  1.00 34.23  ? 211  HIS B O   1 
ATOM   3263  C CB  . HIS B  2 218 ? 15.997  -48.878  23.040  1.00 37.90  ? 211  HIS B CB  1 
ATOM   3264  C CG  . HIS B  2 218 ? 16.877  -49.423  21.957  1.00 40.69  ? 211  HIS B CG  1 
ATOM   3265  N ND1 . HIS B  2 218 ? 17.361  -48.642  20.930  1.00 39.46  ? 211  HIS B ND1 1 
ATOM   3266  C CD2 . HIS B  2 218 ? 17.353  -50.671  21.737  1.00 40.29  ? 211  HIS B CD2 1 
ATOM   3267  C CE1 . HIS B  2 218 ? 18.101  -49.384  20.126  1.00 42.75  ? 211  HIS B CE1 1 
ATOM   3268  N NE2 . HIS B  2 218 ? 18.112  -50.619  20.593  1.00 42.67  ? 211  HIS B NE2 1 
ATOM   3269  N N   . ALA B  2 219 ? 15.178  -47.281  25.768  1.00 31.39  ? 212  ALA B N   1 
ATOM   3270  C CA  . ALA B  2 219 ? 14.280  -46.353  26.443  1.00 36.74  ? 212  ALA B CA  1 
ATOM   3271  C C   . ALA B  2 219 ? 15.071  -45.276  27.178  1.00 34.34  ? 212  ALA B C   1 
ATOM   3272  O O   . ALA B  2 219 ? 14.572  -44.176  27.415  1.00 35.80  ? 212  ALA B O   1 
ATOM   3273  C CB  . ALA B  2 219 ? 13.374  -47.098  27.405  1.00 29.23  ? 212  ALA B CB  1 
ATOM   3274  N N   . VAL B  2 220 ? 16.307  -45.604  27.538  1.00 37.77  ? 213  VAL B N   1 
ATOM   3275  C CA  . VAL B  2 220 ? 17.186  -44.656  28.210  1.00 37.71  ? 213  VAL B CA  1 
ATOM   3276  C C   . VAL B  2 220 ? 17.745  -43.642  27.217  1.00 44.36  ? 213  VAL B C   1 
ATOM   3277  O O   . VAL B  2 220 ? 17.716  -42.436  27.463  1.00 45.97  ? 213  VAL B O   1 
ATOM   3278  C CB  . VAL B  2 220 ? 18.350  -45.374  28.922  1.00 35.37  ? 213  VAL B CB  1 
ATOM   3279  C CG1 . VAL B  2 220 ? 19.380  -44.369  29.411  1.00 35.17  ? 213  VAL B CG1 1 
ATOM   3280  C CG2 . VAL B  2 220 ? 17.827  -46.214  30.075  1.00 37.06  ? 213  VAL B CG2 1 
ATOM   3281  N N   . VAL B  2 221 ? 18.246  -44.141  26.091  1.00 44.65  ? 214  VAL B N   1 
ATOM   3282  C CA  . VAL B  2 221 ? 18.815  -43.291  25.051  1.00 44.49  ? 214  VAL B CA  1 
ATOM   3283  C C   . VAL B  2 221 ? 17.757  -42.364  24.456  1.00 45.87  ? 214  VAL B C   1 
ATOM   3284  O O   . VAL B  2 221 ? 18.043  -41.212  24.125  1.00 49.75  ? 214  VAL B O   1 
ATOM   3285  C CB  . VAL B  2 221 ? 19.453  -44.134  23.926  1.00 47.45  ? 214  VAL B CB  1 
ATOM   3286  C CG1 . VAL B  2 221 ? 20.032  -43.241  22.841  1.00 49.94  ? 214  VAL B CG1 1 
ATOM   3287  C CG2 . VAL B  2 221 ? 20.530  -45.042  24.496  1.00 47.13  ? 214  VAL B CG2 1 
ATOM   3288  N N   . PHE B  2 222 ? 16.534  -42.872  24.335  1.00 43.20  ? 215  PHE B N   1 
ATOM   3289  C CA  . PHE B  2 222 ? 15.427  -42.101  23.776  1.00 38.87  ? 215  PHE B CA  1 
ATOM   3290  C C   . PHE B  2 222 ? 15.160  -40.814  24.551  1.00 36.38  ? 215  PHE B C   1 
ATOM   3291  O O   . PHE B  2 222 ? 15.060  -39.738  23.961  1.00 40.38  ? 215  PHE B O   1 
ATOM   3292  C CB  . PHE B  2 222 ? 14.154  -42.949  23.736  1.00 39.32  ? 215  PHE B CB  1 
ATOM   3293  C CG  . PHE B  2 222 ? 12.899  -42.146  23.541  1.00 40.47  ? 215  PHE B CG  1 
ATOM   3294  C CD1 . PHE B  2 222 ? 12.615  -41.566  22.316  1.00 42.12  ? 215  PHE B CD1 1 
ATOM   3295  C CD2 . PHE B  2 222 ? 12.002  -41.973  24.583  1.00 36.97  ? 215  PHE B CD2 1 
ATOM   3296  C CE1 . PHE B  2 222 ? 11.461  -40.825  22.134  1.00 39.30  ? 215  PHE B CE1 1 
ATOM   3297  C CE2 . PHE B  2 222 ? 10.847  -41.234  24.407  1.00 35.19  ? 215  PHE B CE2 1 
ATOM   3298  C CZ  . PHE B  2 222 ? 10.577  -40.661  23.181  1.00 36.85  ? 215  PHE B CZ  1 
ATOM   3299  N N   . LEU B  2 223 ? 15.041  -40.928  25.870  1.00 30.21  ? 216  LEU B N   1 
ATOM   3300  C CA  . LEU B  2 223 ? 14.779  -39.767  26.712  1.00 32.29  ? 216  LEU B CA  1 
ATOM   3301  C C   . LEU B  2 223 ? 15.949  -38.792  26.681  1.00 37.38  ? 216  LEU B C   1 
ATOM   3302  O O   . LEU B  2 223 ? 15.761  -37.577  26.750  1.00 43.85  ? 216  LEU B O   1 
ATOM   3303  C CB  . LEU B  2 223 ? 14.491  -40.199  28.150  1.00 31.61  ? 216  LEU B CB  1 
ATOM   3304  C CG  . LEU B  2 223 ? 13.184  -40.959  28.381  1.00 30.49  ? 216  LEU B CG  1 
ATOM   3305  C CD1 . LEU B  2 223 ? 13.061  -41.374  29.836  1.00 37.16  ? 216  LEU B CD1 1 
ATOM   3306  C CD2 . LEU B  2 223 ? 11.988  -40.118  27.960  1.00 26.07  ? 216  LEU B CD2 1 
ATOM   3307  N N   . LEU B  2 224 ? 17.158  -39.336  26.573  1.00 37.31  ? 217  LEU B N   1 
ATOM   3308  C CA  . LEU B  2 224 ? 18.367  -38.524  26.502  1.00 38.35  ? 217  LEU B CA  1 
ATOM   3309  C C   . LEU B  2 224 ? 18.453  -37.754  25.187  1.00 42.95  ? 217  LEU B C   1 
ATOM   3310  O O   . LEU B  2 224 ? 19.167  -36.756  25.089  1.00 46.51  ? 217  LEU B O   1 
ATOM   3311  C CB  . LEU B  2 224 ? 19.610  -39.401  26.672  1.00 40.35  ? 217  LEU B CB  1 
ATOM   3312  C CG  . LEU B  2 224 ? 19.883  -39.985  28.060  1.00 38.78  ? 217  LEU B CG  1 
ATOM   3313  C CD1 . LEU B  2 224 ? 20.968  -41.046  27.989  1.00 40.92  ? 217  LEU B CD1 1 
ATOM   3314  C CD2 . LEU B  2 224 ? 20.279  -38.888  29.034  1.00 32.78  ? 217  LEU B CD2 1 
ATOM   3315  N N   . GLU B  2 225 ? 17.720  -38.218  24.179  1.00 44.25  ? 218  GLU B N   1 
ATOM   3316  C CA  . GLU B  2 225 ? 17.773  -37.608  22.855  1.00 47.91  ? 218  GLU B CA  1 
ATOM   3317  C C   . GLU B  2 225 ? 16.492  -36.855  22.500  1.00 50.21  ? 218  GLU B C   1 
ATOM   3318  O O   . GLU B  2 225 ? 16.457  -36.116  21.517  1.00 53.99  ? 218  GLU B O   1 
ATOM   3319  C CB  . GLU B  2 225 ? 18.057  -38.674  21.794  1.00 52.75  ? 218  GLU B CB  1 
ATOM   3320  C CG  . GLU B  2 225 ? 19.452  -39.272  21.876  1.00 58.62  ? 218  GLU B CG  1 
ATOM   3321  C CD  . GLU B  2 225 ? 19.674  -40.373  20.858  1.00 65.44  ? 218  GLU B CD  1 
ATOM   3322  O OE1 . GLU B  2 225 ? 18.683  -41.010  20.443  1.00 68.99  ? 218  GLU B OE1 1 
ATOM   3323  O OE2 . GLU B  2 225 ? 20.841  -40.606  20.476  1.00 67.04  ? 218  GLU B OE2 1 
ATOM   3324  N N   . SER B  2 226 ? 15.443  -37.045  23.296  1.00 46.26  ? 219  SER B N   1 
ATOM   3325  C CA  . SER B  2 226 ? 14.177  -36.355  23.061  1.00 46.79  ? 219  SER B CA  1 
ATOM   3326  C C   . SER B  2 226 ? 14.190  -34.985  23.734  1.00 45.63  ? 219  SER B C   1 
ATOM   3327  O O   . SER B  2 226 ? 14.066  -34.887  24.953  1.00 47.99  ? 219  SER B O   1 
ATOM   3328  C CB  . SER B  2 226 ? 13.003  -37.192  23.570  1.00 47.41  ? 219  SER B CB  1 
ATOM   3329  O OG  . SER B  2 226 ? 11.772  -36.678  23.092  1.00 53.85  ? 219  SER B OG  1 
ATOM   3330  N N   . PRO B  2 227 ? 14.322  -33.920  22.928  1.00 45.92  ? 220  PRO B N   1 
ATOM   3331  C CA  . PRO B  2 227 ? 14.641  -32.566  23.400  1.00 45.21  ? 220  PRO B CA  1 
ATOM   3332  C C   . PRO B  2 227 ? 13.533  -31.870  24.190  1.00 43.06  ? 220  PRO B C   1 
ATOM   3333  O O   . PRO B  2 227 ? 13.829  -30.927  24.924  1.00 44.49  ? 220  PRO B O   1 
ATOM   3334  C CB  . PRO B  2 227 ? 14.915  -31.808  22.099  1.00 47.68  ? 220  PRO B CB  1 
ATOM   3335  C CG  . PRO B  2 227 ? 14.077  -32.501  21.090  1.00 49.31  ? 220  PRO B CG  1 
ATOM   3336  C CD  . PRO B  2 227 ? 14.097  -33.954  21.472  1.00 48.90  ? 220  PRO B CD  1 
ATOM   3337  N N   . TYR B  2 228 ? 12.288  -32.311  24.047  1.00 38.07  ? 221  TYR B N   1 
ATOM   3338  C CA  . TYR B  2 228 ? 11.183  -31.625  24.711  1.00 38.49  ? 221  TYR B CA  1 
ATOM   3339  C C   . TYR B  2 228 ? 10.574  -32.464  25.833  1.00 37.47  ? 221  TYR B C   1 
ATOM   3340  O O   . TYR B  2 228 ? 9.478   -32.175  26.311  1.00 40.61  ? 221  TYR B O   1 
ATOM   3341  C CB  . TYR B  2 228 ? 10.107  -31.242  23.693  1.00 38.61  ? 221  TYR B CB  1 
ATOM   3342  C CG  . TYR B  2 228 ? 9.213   -30.108  24.145  1.00 39.71  ? 221  TYR B CG  1 
ATOM   3343  C CD1 . TYR B  2 228 ? 9.731   -28.839  24.373  1.00 39.09  ? 221  TYR B CD1 1 
ATOM   3344  C CD2 . TYR B  2 228 ? 7.851   -30.303  24.336  1.00 33.97  ? 221  TYR B CD2 1 
ATOM   3345  C CE1 . TYR B  2 228 ? 8.920   -27.798  24.786  1.00 36.63  ? 221  TYR B CE1 1 
ATOM   3346  C CE2 . TYR B  2 228 ? 7.031   -29.268  24.747  1.00 37.06  ? 221  TYR B CE2 1 
ATOM   3347  C CZ  . TYR B  2 228 ? 7.571   -28.017  24.972  1.00 38.37  ? 221  TYR B CZ  1 
ATOM   3348  O OH  . TYR B  2 228 ? 6.761   -26.982  25.380  1.00 37.37  ? 221  TYR B OH  1 
ATOM   3349  N N   . ILE B  2 229 ? 11.294  -33.496  26.258  1.00 36.81  ? 222  ILE B N   1 
ATOM   3350  C CA  . ILE B  2 229 ? 10.834  -34.343  27.353  1.00 33.29  ? 222  ILE B CA  1 
ATOM   3351  C C   . ILE B  2 229 ? 11.668  -34.136  28.614  1.00 29.99  ? 222  ILE B C   1 
ATOM   3352  O O   . ILE B  2 229 ? 12.880  -34.354  28.610  1.00 33.16  ? 222  ILE B O   1 
ATOM   3353  C CB  . ILE B  2 229 ? 10.874  -35.837  26.971  1.00 31.67  ? 222  ILE B CB  1 
ATOM   3354  C CG1 . ILE B  2 229 ? 9.931   -36.117  25.799  1.00 32.46  ? 222  ILE B CG1 1 
ATOM   3355  C CG2 . ILE B  2 229 ? 10.506  -36.703  28.165  1.00 26.38  ? 222  ILE B CG2 1 
ATOM   3356  C CD1 . ILE B  2 229 ? 9.807   -37.587  25.455  1.00 27.87  ? 222  ILE B CD1 1 
ATOM   3357  N N   . THR B  2 230 ? 11.013  -33.710  29.690  1.00 29.94  ? 223  THR B N   1 
ATOM   3358  C CA  . THR B  2 230 ? 11.670  -33.581  30.987  1.00 26.90  ? 223  THR B CA  1 
ATOM   3359  C C   . THR B  2 230 ? 10.675  -33.830  32.120  1.00 31.80  ? 223  THR B C   1 
ATOM   3360  O O   . THR B  2 230 ? 9.484   -33.539  31.992  1.00 31.11  ? 223  THR B O   1 
ATOM   3361  C CB  . THR B  2 230 ? 12.327  -32.193  31.164  1.00 33.05  ? 223  THR B CB  1 
ATOM   3362  O OG1 . THR B  2 230 ? 13.099  -32.177  32.371  1.00 37.33  ? 223  THR B OG1 1 
ATOM   3363  C CG2 . THR B  2 230 ? 11.277  -31.096  31.225  1.00 28.43  ? 223  THR B CG2 1 
ATOM   3364  N N   . GLY B  2 231 ? 11.167  -34.385  33.222  1.00 35.23  ? 224  GLY B N   1 
ATOM   3365  C CA  . GLY B  2 231 ? 10.323  -34.702  34.360  1.00 34.00  ? 224  GLY B CA  1 
ATOM   3366  C C   . GLY B  2 231 ? 9.296   -35.773  34.043  1.00 35.63  ? 224  GLY B C   1 
ATOM   3367  O O   . GLY B  2 231 ? 8.220   -35.809  34.640  1.00 38.48  ? 224  GLY B O   1 
ATOM   3368  N N   . HIS B  2 232 ? 9.630   -36.649  33.102  1.00 33.57  ? 225  HIS B N   1 
ATOM   3369  C CA  . HIS B  2 232 ? 8.714   -37.703  32.681  1.00 36.16  ? 225  HIS B CA  1 
ATOM   3370  C C   . HIS B  2 232 ? 9.199   -39.086  33.103  1.00 36.69  ? 225  HIS B C   1 
ATOM   3371  O O   . HIS B  2 232 ? 10.390  -39.388  33.030  1.00 37.95  ? 225  HIS B O   1 
ATOM   3372  C CB  . HIS B  2 232 ? 8.519   -37.666  31.164  1.00 39.49  ? 225  HIS B CB  1 
ATOM   3373  C CG  . HIS B  2 232 ? 7.758   -38.837  30.625  1.00 43.99  ? 225  HIS B CG  1 
ATOM   3374  N ND1 . HIS B  2 232 ? 6.508   -39.190  31.088  1.00 47.63  ? 225  HIS B ND1 1 
ATOM   3375  C CD2 . HIS B  2 232 ? 8.071   -39.739  29.664  1.00 44.41  ? 225  HIS B CD2 1 
ATOM   3376  C CE1 . HIS B  2 232 ? 6.084   -40.257  30.435  1.00 48.18  ? 225  HIS B CE1 1 
ATOM   3377  N NE2 . HIS B  2 232 ? 7.014   -40.610  29.565  1.00 47.04  ? 225  HIS B NE2 1 
ATOM   3378  N N   . VAL B  2 233 ? 8.264   -39.921  33.544  1.00 38.39  ? 226  VAL B N   1 
ATOM   3379  C CA  . VAL B  2 233 ? 8.574   -41.298  33.904  1.00 36.74  ? 226  VAL B CA  1 
ATOM   3380  C C   . VAL B  2 233 ? 8.156   -42.247  32.785  1.00 36.71  ? 226  VAL B C   1 
ATOM   3381  O O   . VAL B  2 233 ? 6.967   -42.481  32.568  1.00 36.75  ? 226  VAL B O   1 
ATOM   3382  C CB  . VAL B  2 233 ? 7.881   -41.716  35.214  1.00 33.55  ? 226  VAL B CB  1 
ATOM   3383  C CG1 . VAL B  2 233 ? 8.220   -43.160  35.556  1.00 31.58  ? 226  VAL B CG1 1 
ATOM   3384  C CG2 . VAL B  2 233 ? 8.285   -40.787  36.347  1.00 33.14  ? 226  VAL B CG2 1 
ATOM   3385  N N   . LEU B  2 234 ? 9.141   -42.785  32.073  1.00 33.55  ? 227  LEU B N   1 
ATOM   3386  C CA  . LEU B  2 234 ? 8.872   -43.706  30.977  1.00 35.38  ? 227  LEU B CA  1 
ATOM   3387  C C   . LEU B  2 234 ? 8.814   -45.143  31.486  1.00 34.59  ? 227  LEU B C   1 
ATOM   3388  O O   . LEU B  2 234 ? 9.766   -45.635  32.091  1.00 31.79  ? 227  LEU B O   1 
ATOM   3389  C CB  . LEU B  2 234 ? 9.935   -43.569  29.886  1.00 38.74  ? 227  LEU B CB  1 
ATOM   3390  C CG  . LEU B  2 234 ? 9.654   -44.297  28.571  1.00 38.99  ? 227  LEU B CG  1 
ATOM   3391  C CD1 . LEU B  2 234 ? 8.331   -43.835  27.980  1.00 36.69  ? 227  LEU B CD1 1 
ATOM   3392  C CD2 . LEU B  2 234 ? 10.790  -44.079  27.584  1.00 40.17  ? 227  LEU B CD2 1 
ATOM   3393  N N   . VAL B  2 235 ? 7.693   -45.811  31.237  1.00 34.53  ? 228  VAL B N   1 
ATOM   3394  C CA  . VAL B  2 235 ? 7.479   -47.158  31.750  1.00 38.92  ? 228  VAL B CA  1 
ATOM   3395  C C   . VAL B  2 235 ? 7.815   -48.233  30.721  1.00 39.60  ? 228  VAL B C   1 
ATOM   3396  O O   . VAL B  2 235 ? 7.242   -48.267  29.633  1.00 45.00  ? 228  VAL B O   1 
ATOM   3397  C CB  . VAL B  2 235 ? 6.024   -47.354  32.213  1.00 38.92  ? 228  VAL B CB  1 
ATOM   3398  C CG1 . VAL B  2 235 ? 5.836   -48.746  32.791  1.00 29.96  ? 228  VAL B CG1 1 
ATOM   3399  C CG2 . VAL B  2 235 ? 5.648   -46.293  33.235  1.00 40.25  ? 228  VAL B CG2 1 
ATOM   3400  N N   . VAL B  2 236 ? 8.750   -49.109  31.076  1.00 40.87  ? 229  VAL B N   1 
ATOM   3401  C CA  . VAL B  2 236 ? 9.113   -50.241  30.231  1.00 44.73  ? 229  VAL B CA  1 
ATOM   3402  C C   . VAL B  2 236 ? 8.682   -51.535  30.911  1.00 46.16  ? 229  VAL B C   1 
ATOM   3403  O O   . VAL B  2 236 ? 9.473   -52.182  31.595  1.00 51.17  ? 229  VAL B O   1 
ATOM   3404  C CB  . VAL B  2 236 ? 10.625  -50.282  29.952  1.00 49.62  ? 229  VAL B CB  1 
ATOM   3405  C CG1 . VAL B  2 236 ? 10.929  -51.243  28.812  1.00 49.16  ? 229  VAL B CG1 1 
ATOM   3406  C CG2 . VAL B  2 236 ? 11.139  -48.890  29.628  1.00 48.17  ? 229  VAL B CG2 1 
ATOM   3407  N N   . ASP B  2 237 ? 7.422   -51.908  30.715  1.00 42.81  ? 230  ASP B N   1 
ATOM   3408  C CA  . ASP B  2 237 ? 6.818   -52.985  31.489  1.00 45.23  ? 230  ASP B CA  1 
ATOM   3409  C C   . ASP B  2 237 ? 6.261   -54.111  30.625  1.00 45.10  ? 230  ASP B C   1 
ATOM   3410  O O   . ASP B  2 237 ? 6.185   -55.259  31.063  1.00 50.15  ? 230  ASP B O   1 
ATOM   3411  C CB  . ASP B  2 237 ? 5.704   -52.420  32.367  1.00 56.34  ? 230  ASP B CB  1 
ATOM   3412  C CG  . ASP B  2 237 ? 4.609   -51.756  31.555  1.00 69.58  ? 230  ASP B CG  1 
ATOM   3413  O OD1 . ASP B  2 237 ? 4.892   -51.311  30.421  1.00 72.98  ? 230  ASP B OD1 1 
ATOM   3414  O OD2 . ASP B  2 237 ? 3.464   -51.681  32.047  1.00 75.66  ? 230  ASP B OD2 1 
ATOM   3415  N N   . GLY B  2 238 ? 5.868   -53.780  29.401  1.00 40.42  ? 231  GLY B N   1 
ATOM   3416  C CA  . GLY B  2 238 ? 5.215   -54.740  28.533  1.00 42.11  ? 231  GLY B CA  1 
ATOM   3417  C C   . GLY B  2 238 ? 3.735   -54.815  28.849  1.00 43.61  ? 231  GLY B C   1 
ATOM   3418  O O   . GLY B  2 238 ? 3.051   -55.765  28.468  1.00 44.45  ? 231  GLY B O   1 
ATOM   3419  N N   . GLY B  2 239 ? 3.241   -53.798  29.551  1.00 41.40  ? 232  GLY B N   1 
ATOM   3420  C CA  . GLY B  2 239 ? 1.844   -53.732  29.937  1.00 38.86  ? 232  GLY B CA  1 
ATOM   3421  C C   . GLY B  2 239 ? 1.610   -54.212  31.356  1.00 37.09  ? 232  GLY B C   1 
ATOM   3422  O O   . GLY B  2 239 ? 0.472   -54.434  31.767  1.00 39.43  ? 232  GLY B O   1 
ATOM   3423  N N   . LEU B  2 240 ? 2.696   -54.367  32.107  1.00 37.93  ? 233  LEU B N   1 
ATOM   3424  C CA  . LEU B  2 240 ? 2.630   -54.863  33.478  1.00 40.93  ? 233  LEU B CA  1 
ATOM   3425  C C   . LEU B  2 240 ? 1.910   -53.877  34.394  1.00 42.01  ? 233  LEU B C   1 
ATOM   3426  O O   . LEU B  2 240 ? 1.284   -54.271  35.380  1.00 43.25  ? 233  LEU B O   1 
ATOM   3427  C CB  . LEU B  2 240 ? 4.039   -55.137  34.007  1.00 43.44  ? 233  LEU B CB  1 
ATOM   3428  C CG  . LEU B  2 240 ? 4.164   -55.867  35.344  1.00 51.44  ? 233  LEU B CG  1 
ATOM   3429  C CD1 . LEU B  2 240 ? 3.643   -57.290  35.222  1.00 55.11  ? 233  LEU B CD1 1 
ATOM   3430  C CD2 . LEU B  2 240 ? 5.605   -55.854  35.828  1.00 54.23  ? 233  LEU B CD2 1 
ATOM   3431  N N   . GLN B  2 241 ? 2.005   -52.596  34.053  1.00 40.78  ? 234  GLN B N   1 
ATOM   3432  C CA  . GLN B  2 241 ? 1.387   -51.521  34.824  1.00 41.19  ? 234  GLN B CA  1 
ATOM   3433  C C   . GLN B  2 241 ? -0.128  -51.680  34.921  1.00 47.62  ? 234  GLN B C   1 
ATOM   3434  O O   . GLN B  2 241 ? -0.742  -51.296  35.914  1.00 52.62  ? 234  GLN B O   1 
ATOM   3435  C CB  . GLN B  2 241 ? 1.733   -50.168  34.195  1.00 38.84  ? 234  GLN B CB  1 
ATOM   3436  C CG  . GLN B  2 241 ? 1.083   -48.964  34.849  1.00 46.79  ? 234  GLN B CG  1 
ATOM   3437  C CD  . GLN B  2 241 ? 1.342   -47.686  34.078  1.00 52.46  ? 234  GLN B CD  1 
ATOM   3438  O OE1 . GLN B  2 241 ? 1.903   -47.716  32.982  1.00 49.81  ? 234  GLN B OE1 1 
ATOM   3439  N NE2 . GLN B  2 241 ? 0.937   -46.555  34.645  1.00 58.60  ? 234  GLN B NE2 1 
ATOM   3440  N N   . LEU B  2 242 ? -0.722  -52.261  33.885  1.00 47.64  ? 235  LEU B N   1 
ATOM   3441  C CA  . LEU B  2 242 ? -2.172  -52.388  33.799  1.00 47.21  ? 235  LEU B CA  1 
ATOM   3442  C C   . LEU B  2 242 ? -2.707  -53.575  34.600  1.00 50.54  ? 235  LEU B C   1 
ATOM   3443  O O   . LEU B  2 242 ? -3.915  -53.804  34.650  1.00 55.64  ? 235  LEU B O   1 
ATOM   3444  C CB  . LEU B  2 242 ? -2.596  -52.517  32.334  1.00 45.49  ? 235  LEU B CB  1 
ATOM   3445  C CG  . LEU B  2 242 ? -1.959  -51.511  31.371  1.00 43.81  ? 235  LEU B CG  1 
ATOM   3446  C CD1 . LEU B  2 242 ? -2.393  -51.780  29.937  1.00 45.91  ? 235  LEU B CD1 1 
ATOM   3447  C CD2 . LEU B  2 242 ? -2.291  -50.083  31.778  1.00 41.71  ? 235  LEU B CD2 1 
ATOM   3448  N N   . ILE B  2 243 ? -1.804  -54.323  35.227  1.00 54.34  ? 236  ILE B N   1 
ATOM   3449  C CA  . ILE B  2 243 ? -2.182  -55.526  35.963  1.00 60.92  ? 236  ILE B CA  1 
ATOM   3450  C C   . ILE B  2 243 ? -1.845  -55.404  37.450  1.00 70.32  ? 236  ILE B C   1 
ATOM   3451  O O   . ILE B  2 243 ? -2.556  -55.935  38.306  1.00 76.53  ? 236  ILE B O   1 
ATOM   3452  C CB  . ILE B  2 243 ? -1.489  -56.774  35.374  1.00 55.82  ? 236  ILE B CB  1 
ATOM   3453  C CG1 . ILE B  2 243 ? -1.863  -56.936  33.901  1.00 49.24  ? 236  ILE B CG1 1 
ATOM   3454  C CG2 . ILE B  2 243 ? -1.869  -58.029  36.146  1.00 62.13  ? 236  ILE B CG2 1 
ATOM   3455  C CD1 . ILE B  2 243 ? -3.352  -57.065  33.666  1.00 49.65  ? 236  ILE B CD1 1 
ATOM   3456  N N   . LEU B  2 244 ? -0.765  -54.693  37.751  1.00 74.75  ? 237  LEU B N   1 
ATOM   3457  C CA  . LEU B  2 244 ? -0.326  -54.517  39.132  1.00 82.43  ? 237  LEU B CA  1 
ATOM   3458  C C   . LEU B  2 244 ? -1.235  -53.552  39.887  1.00 87.44  ? 237  LEU B C   1 
ATOM   3459  O O   . LEU B  2 244 ? -1.839  -53.914  40.897  1.00 92.29  ? 237  LEU B O   1 
ATOM   3460  C CB  . LEU B  2 244 ? 1.122   -54.021  39.174  1.00 84.26  ? 237  LEU B CB  1 
ATOM   3461  C CG  . LEU B  2 244 ? 2.233   -55.076  39.256  1.00 89.06  ? 237  LEU B CG  1 
ATOM   3462  C CD1 . LEU B  2 244 ? 2.389   -55.603  40.676  1.00 93.42  ? 237  LEU B CD1 1 
ATOM   3463  C CD2 . LEU B  2 244 ? 1.997   -56.219  38.278  1.00 91.40  ? 237  LEU B CD2 1 
ATOM   3464  N N   . LYS C  2 10  ? -10.261 -47.491  70.481  1.00 65.69  ? 3    LYS C N   1 
ATOM   3465  C CA  . LYS C  2 10  ? -9.163  -47.762  69.560  1.00 62.60  ? 3    LYS C CA  1 
ATOM   3466  C C   . LYS C  2 10  ? -8.035  -46.750  69.735  1.00 60.22  ? 3    LYS C C   1 
ATOM   3467  O O   . LYS C  2 10  ? -8.234  -45.547  69.564  1.00 56.84  ? 3    LYS C O   1 
ATOM   3468  C CB  . LYS C  2 10  ? -9.664  -47.750  68.115  1.00 63.04  ? 3    LYS C CB  1 
ATOM   3469  N N   . VAL C  2 11  ? -6.850  -47.248  70.073  1.00 64.48  ? 4    VAL C N   1 
ATOM   3470  C CA  . VAL C  2 11  ? -5.694  -46.394  70.324  1.00 61.72  ? 4    VAL C CA  1 
ATOM   3471  C C   . VAL C  2 11  ? -4.993  -46.006  69.022  1.00 58.83  ? 4    VAL C C   1 
ATOM   3472  O O   . VAL C  2 11  ? -4.882  -46.816  68.101  1.00 54.64  ? 4    VAL C O   1 
ATOM   3473  C CB  . VAL C  2 11  ? -4.682  -47.089  71.259  1.00 60.75  ? 4    VAL C CB  1 
ATOM   3474  C CG1 . VAL C  2 11  ? -3.630  -46.101  71.742  1.00 61.53  ? 4    VAL C CG1 1 
ATOM   3475  C CG2 . VAL C  2 11  ? -5.401  -47.717  72.442  1.00 62.28  ? 4    VAL C CG2 1 
ATOM   3476  N N   . CYS C  2 12  ? -4.527  -44.763  68.951  1.00 60.19  ? 5    CYS C N   1 
ATOM   3477  C CA  . CYS C  2 12  ? -3.799  -44.280  67.783  1.00 61.30  ? 5    CYS C CA  1 
ATOM   3478  C C   . CYS C  2 12  ? -2.498  -43.589  68.181  1.00 61.22  ? 5    CYS C C   1 
ATOM   3479  O O   . CYS C  2 12  ? -2.416  -42.957  69.234  1.00 61.71  ? 5    CYS C O   1 
ATOM   3480  C CB  . CYS C  2 12  ? -4.668  -43.322  66.967  1.00 64.14  ? 5    CYS C CB  1 
ATOM   3481  S SG  . CYS C  2 12  ? -3.789  -42.473  65.631  1.00 58.01  ? 5    CYS C SG  1 
ATOM   3482  N N   . ALA C  2 13  ? -1.483  -43.714  67.330  1.00 58.64  ? 6    ALA C N   1 
ATOM   3483  C CA  . ALA C  2 13  ? -0.189  -43.087  67.578  1.00 53.59  ? 6    ALA C CA  1 
ATOM   3484  C C   . ALA C  2 13  ? 0.155   -42.096  66.472  1.00 45.21  ? 6    ALA C C   1 
ATOM   3485  O O   . ALA C  2 13  ? 0.175   -42.450  65.294  1.00 42.36  ? 6    ALA C O   1 
ATOM   3486  C CB  . ALA C  2 13  ? 0.897   -44.144  67.701  1.00 54.96  ? 6    ALA C CB  1 
ATOM   3487  N N   . VAL C  2 14  ? 0.427   -40.853  66.858  1.00 44.09  ? 7    VAL C N   1 
ATOM   3488  C CA  . VAL C  2 14  ? 0.726   -39.802  65.893  1.00 41.23  ? 7    VAL C CA  1 
ATOM   3489  C C   . VAL C  2 14  ? 2.171   -39.325  66.003  1.00 44.59  ? 7    VAL C C   1 
ATOM   3490  O O   . VAL C  2 14  ? 2.532   -38.618  66.944  1.00 48.94  ? 7    VAL C O   1 
ATOM   3491  C CB  . VAL C  2 14  ? -0.212  -38.591  66.072  1.00 34.63  ? 7    VAL C CB  1 
ATOM   3492  C CG1 . VAL C  2 14  ? 0.094   -37.525  65.032  1.00 33.17  ? 7    VAL C CG1 1 
ATOM   3493  C CG2 . VAL C  2 14  ? -1.665  -39.028  65.981  1.00 37.26  ? 7    VAL C CG2 1 
ATOM   3494  N N   . PHE C  2 15  ? 2.996   -39.719  65.037  1.00 43.19  ? 8    PHE C N   1 
ATOM   3495  C CA  . PHE C  2 15  ? 4.380   -39.266  64.984  1.00 41.27  ? 8    PHE C CA  1 
ATOM   3496  C C   . PHE C  2 15  ? 4.460   -37.886  64.346  1.00 37.56  ? 8    PHE C C   1 
ATOM   3497  O O   . PHE C  2 15  ? 3.839   -37.634  63.315  1.00 34.41  ? 8    PHE C O   1 
ATOM   3498  C CB  . PHE C  2 15  ? 5.247   -40.263  64.213  1.00 42.22  ? 8    PHE C CB  1 
ATOM   3499  C CG  . PHE C  2 15  ? 5.552   -41.516  64.980  1.00 43.98  ? 8    PHE C CG  1 
ATOM   3500  C CD1 . PHE C  2 15  ? 4.682   -42.593  64.952  1.00 46.54  ? 8    PHE C CD1 1 
ATOM   3501  C CD2 . PHE C  2 15  ? 6.710   -41.616  65.732  1.00 40.31  ? 8    PHE C CD2 1 
ATOM   3502  C CE1 . PHE C  2 15  ? 4.964   -43.747  65.660  1.00 47.66  ? 8    PHE C CE1 1 
ATOM   3503  C CE2 . PHE C  2 15  ? 6.998   -42.767  66.441  1.00 42.43  ? 8    PHE C CE2 1 
ATOM   3504  C CZ  . PHE C  2 15  ? 6.123   -43.833  66.405  1.00 45.53  ? 8    PHE C CZ  1 
ATOM   3505  N N   . GLY C  2 16  ? 5.227   -36.994  64.964  1.00 43.12  ? 9    GLY C N   1 
ATOM   3506  C CA  . GLY C  2 16  ? 5.291   -35.616  64.520  1.00 43.66  ? 9    GLY C CA  1 
ATOM   3507  C C   . GLY C  2 16  ? 3.985   -34.908  64.819  1.00 42.06  ? 9    GLY C C   1 
ATOM   3508  O O   . GLY C  2 16  ? 3.526   -34.069  64.044  1.00 38.58  ? 9    GLY C O   1 
ATOM   3509  N N   . GLY C  2 17  ? 3.387   -35.253  65.955  1.00 43.96  ? 10   GLY C N   1 
ATOM   3510  C CA  . GLY C  2 17  ? 2.091   -34.721  66.330  1.00 45.45  ? 10   GLY C CA  1 
ATOM   3511  C C   . GLY C  2 17  ? 2.157   -33.549  67.289  1.00 50.16  ? 10   GLY C C   1 
ATOM   3512  O O   . GLY C  2 17  ? 1.166   -33.217  67.938  1.00 51.27  ? 10   GLY C O   1 
ATOM   3513  N N   . SER C  2 18  ? 3.324   -32.921  67.381  1.00 50.75  ? 11   SER C N   1 
ATOM   3514  C CA  . SER C  2 18  ? 3.493   -31.762  68.250  1.00 52.11  ? 11   SER C CA  1 
ATOM   3515  C C   . SER C  2 18  ? 3.198   -30.469  67.496  1.00 49.45  ? 11   SER C C   1 
ATOM   3516  O O   . SER C  2 18  ? 2.727   -29.494  68.081  1.00 48.42  ? 11   SER C O   1 
ATOM   3517  C CB  . SER C  2 18  ? 4.907   -31.727  68.834  1.00 51.31  ? 11   SER C CB  1 
ATOM   3518  O OG  . SER C  2 18  ? 5.883   -31.642  67.811  1.00 55.32  ? 11   SER C OG  1 
ATOM   3519  N N   . ARG C  2 19  ? 3.479   -30.467  66.196  1.00 50.05  ? 12   ARG C N   1 
ATOM   3520  C CA  . ARG C  2 19  ? 3.214   -29.305  65.352  1.00 49.75  ? 12   ARG C CA  1 
ATOM   3521  C C   . ARG C  2 19  ? 2.606   -29.706  64.013  1.00 46.29  ? 12   ARG C C   1 
ATOM   3522  O O   . ARG C  2 19  ? 2.599   -30.883  63.649  1.00 35.41  ? 12   ARG C O   1 
ATOM   3523  C CB  . ARG C  2 19  ? 4.496   -28.505  65.105  1.00 50.55  ? 12   ARG C CB  1 
ATOM   3524  C CG  . ARG C  2 19  ? 5.124   -27.902  66.346  1.00 54.11  ? 12   ARG C CG  1 
ATOM   3525  C CD  . ARG C  2 19  ? 6.256   -26.961  65.973  1.00 57.02  ? 12   ARG C CD  1 
ATOM   3526  N NE  . ARG C  2 19  ? 7.205   -27.583  65.055  1.00 57.96  ? 12   ARG C NE  1 
ATOM   3527  C CZ  . ARG C  2 19  ? 8.253   -28.305  65.440  1.00 59.90  ? 12   ARG C CZ  1 
ATOM   3528  N NH1 . ARG C  2 19  ? 8.489   -28.500  66.730  1.00 62.57  ? 12   ARG C NH1 1 
ATOM   3529  N NH2 . ARG C  2 19  ? 9.065   -28.833  64.534  1.00 60.63  ? 12   ARG C NH2 1 
ATOM   3530  N N   . GLY C  2 20  ? 2.100   -28.713  63.287  1.00 47.54  ? 13   GLY C N   1 
ATOM   3531  C CA  . GLY C  2 20  ? 1.606   -28.909  61.936  1.00 44.41  ? 13   GLY C CA  1 
ATOM   3532  C C   . GLY C  2 20  ? 0.432   -29.859  61.806  1.00 40.86  ? 13   GLY C C   1 
ATOM   3533  O O   . GLY C  2 20  ? -0.485  -29.854  62.628  1.00 41.28  ? 13   GLY C O   1 
ATOM   3534  N N   . ILE C  2 21  ? 0.470   -30.677  60.758  1.00 39.02  ? 14   ILE C N   1 
ATOM   3535  C CA  . ILE C  2 21  ? -0.606  -31.612  60.450  1.00 43.25  ? 14   ILE C CA  1 
ATOM   3536  C C   . ILE C  2 21  ? -0.804  -32.642  61.557  1.00 47.41  ? 14   ILE C C   1 
ATOM   3537  O O   . ILE C  2 21  ? -1.934  -32.929  61.952  1.00 52.74  ? 14   ILE C O   1 
ATOM   3538  C CB  . ILE C  2 21  ? -0.336  -32.344  59.123  1.00 48.28  ? 14   ILE C CB  1 
ATOM   3539  C CG1 . ILE C  2 21  ? -0.167  -31.331  57.987  1.00 49.53  ? 14   ILE C CG1 1 
ATOM   3540  C CG2 . ILE C  2 21  ? -1.454  -33.328  58.813  1.00 49.63  ? 14   ILE C CG2 1 
ATOM   3541  C CD1 . ILE C  2 21  ? 0.320   -31.939  56.696  1.00 48.34  ? 14   ILE C CD1 1 
ATOM   3542  N N   . GLY C  2 22  ? 0.301   -33.190  62.054  1.00 42.22  ? 15   GLY C N   1 
ATOM   3543  C CA  . GLY C  2 22  ? 0.254   -34.179  63.115  1.00 42.79  ? 15   GLY C CA  1 
ATOM   3544  C C   . GLY C  2 22  ? -0.446  -33.665  64.358  1.00 43.26  ? 15   GLY C C   1 
ATOM   3545  O O   . GLY C  2 22  ? -1.180  -34.401  65.017  1.00 46.62  ? 15   GLY C O   1 
ATOM   3546  N N   . ARG C  2 23  ? -0.218  -32.395  64.677  1.00 43.61  ? 16   ARG C N   1 
ATOM   3547  C CA  . ARG C  2 23  ? -0.857  -31.768  65.827  1.00 44.01  ? 16   ARG C CA  1 
ATOM   3548  C C   . ARG C  2 23  ? -2.352  -31.597  65.587  1.00 45.98  ? 16   ARG C C   1 
ATOM   3549  O O   . ARG C  2 23  ? -3.160  -31.762  66.500  1.00 48.86  ? 16   ARG C O   1 
ATOM   3550  C CB  . ARG C  2 23  ? -0.212  -30.415  66.132  1.00 44.25  ? 16   ARG C CB  1 
ATOM   3551  N N   . ALA C  2 24  ? -2.712  -31.266  64.351  1.00 44.26  ? 17   ALA C N   1 
ATOM   3552  C CA  . ALA C  2 24  ? -4.111  -31.099  63.980  1.00 44.32  ? 17   ALA C CA  1 
ATOM   3553  C C   . ALA C  2 24  ? -4.822  -32.446  63.935  1.00 43.21  ? 17   ALA C C   1 
ATOM   3554  O O   . ALA C  2 24  ? -6.009  -32.542  64.248  1.00 44.39  ? 17   ALA C O   1 
ATOM   3555  C CB  . ALA C  2 24  ? -4.225  -30.395  62.643  1.00 46.22  ? 17   ALA C CB  1 
ATOM   3556  N N   . VAL C  2 25  ? -4.090  -33.481  63.536  1.00 42.10  ? 18   VAL C N   1 
ATOM   3557  C CA  . VAL C  2 25  ? -4.622  -34.837  63.524  1.00 42.32  ? 18   VAL C CA  1 
ATOM   3558  C C   . VAL C  2 25  ? -4.986  -35.266  64.941  1.00 44.75  ? 18   VAL C C   1 
ATOM   3559  O O   . VAL C  2 25  ? -6.065  -35.809  65.178  1.00 37.73  ? 18   VAL C O   1 
ATOM   3560  C CB  . VAL C  2 25  ? -3.614  -35.838  62.917  1.00 37.72  ? 18   VAL C CB  1 
ATOM   3561  C CG1 . VAL C  2 25  ? -3.996  -37.270  63.263  1.00 38.79  ? 18   VAL C CG1 1 
ATOM   3562  C CG2 . VAL C  2 25  ? -3.526  -35.654  61.408  1.00 36.49  ? 18   VAL C CG2 1 
ATOM   3563  N N   . ALA C  2 26  ? -4.085  -34.998  65.881  1.00 45.17  ? 19   ALA C N   1 
ATOM   3564  C CA  . ALA C  2 26  ? -4.307  -35.332  67.283  1.00 41.83  ? 19   ALA C CA  1 
ATOM   3565  C C   . ALA C  2 26  ? -5.494  -34.565  67.859  1.00 41.70  ? 19   ALA C C   1 
ATOM   3566  O O   . ALA C  2 26  ? -6.300  -35.122  68.600  1.00 45.86  ? 19   ALA C O   1 
ATOM   3567  C CB  . ALA C  2 26  ? -3.054  -35.055  68.097  1.00 41.10  ? 19   ALA C CB  1 
ATOM   3568  N N   . GLN C  2 27  ? -5.600  -33.286  67.516  1.00 42.85  ? 20   GLN C N   1 
ATOM   3569  C CA  . GLN C  2 27  ? -6.698  -32.459  68.001  1.00 52.41  ? 20   GLN C CA  1 
ATOM   3570  C C   . GLN C  2 27  ? -8.053  -33.003  67.555  1.00 56.28  ? 20   GLN C C   1 
ATOM   3571  O O   . GLN C  2 27  ? -9.007  -33.032  68.334  1.00 58.12  ? 20   GLN C O   1 
ATOM   3572  C CB  . GLN C  2 27  ? -6.533  -31.015  67.524  1.00 56.93  ? 20   GLN C CB  1 
ATOM   3573  C CG  . GLN C  2 27  ? -5.447  -30.241  68.248  1.00 61.72  ? 20   GLN C CG  1 
ATOM   3574  C CD  . GLN C  2 27  ? -5.251  -28.850  67.682  1.00 68.91  ? 20   GLN C CD  1 
ATOM   3575  O OE1 . GLN C  2 27  ? -5.264  -28.655  66.466  1.00 71.88  ? 20   GLN C OE1 1 
ATOM   3576  N NE2 . GLN C  2 27  ? -5.074  -27.871  68.562  1.00 72.63  ? 20   GLN C NE2 1 
ATOM   3577  N N   . LEU C  2 28  ? -8.125  -33.443  66.303  1.00 53.75  ? 21   LEU C N   1 
ATOM   3578  C CA  . LEU C  2 28  ? -9.374  -33.934  65.733  1.00 56.05  ? 21   LEU C CA  1 
ATOM   3579  C C   . LEU C  2 28  ? -9.722  -35.334  66.231  1.00 57.69  ? 21   LEU C C   1 
ATOM   3580  O O   . LEU C  2 28  ? -10.870 -35.604  66.587  1.00 61.76  ? 21   LEU C O   1 
ATOM   3581  C CB  . LEU C  2 28  ? -9.298  -33.928  64.204  1.00 55.54  ? 21   LEU C CB  1 
ATOM   3582  C CG  . LEU C  2 28  ? -10.554 -34.375  63.452  1.00 55.19  ? 21   LEU C CG  1 
ATOM   3583  C CD1 . LEU C  2 28  ? -11.736 -33.480  63.793  1.00 58.46  ? 21   LEU C CD1 1 
ATOM   3584  C CD2 . LEU C  2 28  ? -10.305 -34.390  61.952  1.00 51.47  ? 21   LEU C CD2 1 
ATOM   3585  N N   . MET C  2 29  ? -8.732  -36.221  66.258  1.00 57.71  ? 22   MET C N   1 
ATOM   3586  C CA  . MET C  2 29  ? -8.960  -37.602  66.675  1.00 54.95  ? 22   MET C CA  1 
ATOM   3587  C C   . MET C  2 29  ? -9.283  -37.697  68.163  1.00 56.18  ? 22   MET C C   1 
ATOM   3588  O O   . MET C  2 29  ? -9.856  -38.686  68.619  1.00 58.63  ? 22   MET C O   1 
ATOM   3589  C CB  . MET C  2 29  ? -7.746  -38.474  66.344  1.00 55.68  ? 22   MET C CB  1 
ATOM   3590  C CG  . MET C  2 29  ? -7.481  -38.622  64.853  1.00 58.99  ? 22   MET C CG  1 
ATOM   3591  S SD  . MET C  2 29  ? -6.269  -39.901  64.474  1.00 53.68  ? 22   MET C SD  1 
ATOM   3592  C CE  . MET C  2 29  ? -7.181  -41.372  64.932  1.00 57.87  ? 22   MET C CE  1 
ATOM   3593  N N   . ALA C  2 30  ? -8.913  -36.666  68.916  1.00 54.07  ? 23   ALA C N   1 
ATOM   3594  C CA  . ALA C  2 30  ? -9.256  -36.600  70.331  1.00 45.93  ? 23   ALA C CA  1 
ATOM   3595  C C   . ALA C  2 30  ? -10.746 -36.322  70.499  1.00 48.41  ? 23   ALA C C   1 
ATOM   3596  O O   . ALA C  2 30  ? -11.381 -36.823  71.426  1.00 50.34  ? 23   ALA C O   1 
ATOM   3597  C CB  . ALA C  2 30  ? -8.431  -35.533  71.032  1.00 45.98  ? 23   ALA C CB  1 
ATOM   3598  N N   . ARG C  2 31  ? -11.297 -35.522  69.591  1.00 52.01  ? 24   ARG C N   1 
ATOM   3599  C CA  . ARG C  2 31  ? -12.714 -35.177  69.622  1.00 54.63  ? 24   ARG C CA  1 
ATOM   3600  C C   . ARG C  2 31  ? -13.581 -36.379  69.262  1.00 55.14  ? 24   ARG C C   1 
ATOM   3601  O O   . ARG C  2 31  ? -14.737 -36.471  69.675  1.00 58.37  ? 24   ARG C O   1 
ATOM   3602  C CB  . ARG C  2 31  ? -13.003 -34.016  68.668  1.00 53.79  ? 24   ARG C CB  1 
ATOM   3603  N N   . LYS C  2 32  ? -13.010 -37.297  68.490  1.00 52.67  ? 25   LYS C N   1 
ATOM   3604  C CA  . LYS C  2 32  ? -13.723 -38.490  68.051  1.00 52.00  ? 25   LYS C CA  1 
ATOM   3605  C C   . LYS C  2 32  ? -13.624 -39.613  69.078  1.00 51.65  ? 25   LYS C C   1 
ATOM   3606  O O   . LYS C  2 32  ? -14.433 -40.541  69.075  1.00 57.56  ? 25   LYS C O   1 
ATOM   3607  C CB  . LYS C  2 32  ? -13.187 -38.954  66.698  1.00 51.37  ? 25   LYS C CB  1 
ATOM   3608  C CG  . LYS C  2 32  ? -13.581 -38.039  65.552  1.00 52.01  ? 25   LYS C CG  1 
ATOM   3609  C CD  . LYS C  2 32  ? -12.832 -38.381  64.279  1.00 51.37  ? 25   LYS C CD  1 
ATOM   3610  C CE  . LYS C  2 32  ? -13.347 -37.562  63.108  1.00 53.94  ? 25   LYS C CE  1 
ATOM   3611  N NZ  . LYS C  2 32  ? -14.711 -37.993  62.693  1.00 58.09  ? 25   LYS C NZ  1 
ATOM   3612  N N   . GLY C  2 33  ? -12.629 -39.524  69.954  1.00 50.69  ? 26   GLY C N   1 
ATOM   3613  C CA  . GLY C  2 33  ? -12.513 -40.457  71.060  1.00 51.89  ? 26   GLY C CA  1 
ATOM   3614  C C   . GLY C  2 33  ? -11.353 -41.429  70.972  1.00 59.87  ? 26   GLY C C   1 
ATOM   3615  O O   . GLY C  2 33  ? -11.179 -42.267  71.856  1.00 66.84  ? 26   GLY C O   1 
ATOM   3616  N N   . TYR C  2 34  ? -10.561 -41.329  69.910  1.00 60.31  ? 27   TYR C N   1 
ATOM   3617  C CA  . TYR C  2 34  ? -9.397  -42.196  69.756  1.00 61.35  ? 27   TYR C CA  1 
ATOM   3618  C C   . TYR C  2 34  ? -8.364  -41.915  70.841  1.00 68.78  ? 27   TYR C C   1 
ATOM   3619  O O   . TYR C  2 34  ? -8.046  -40.759  71.116  1.00 75.82  ? 27   TYR C O   1 
ATOM   3620  C CB  . TYR C  2 34  ? -8.761  -42.018  68.374  1.00 57.40  ? 27   TYR C CB  1 
ATOM   3621  C CG  . TYR C  2 34  ? -9.560  -42.616  67.238  1.00 63.71  ? 27   TYR C CG  1 
ATOM   3622  C CD1 . TYR C  2 34  ? -9.449  -43.964  66.920  1.00 68.84  ? 27   TYR C CD1 1 
ATOM   3623  C CD2 . TYR C  2 34  ? -10.417 -41.832  66.477  1.00 64.40  ? 27   TYR C CD2 1 
ATOM   3624  C CE1 . TYR C  2 34  ? -10.176 -44.515  65.880  1.00 71.90  ? 27   TYR C CE1 1 
ATOM   3625  C CE2 . TYR C  2 34  ? -11.147 -42.374  65.435  1.00 66.57  ? 27   TYR C CE2 1 
ATOM   3626  C CZ  . TYR C  2 34  ? -11.023 -43.716  65.141  1.00 70.16  ? 27   TYR C CZ  1 
ATOM   3627  O OH  . TYR C  2 34  ? -11.747 -44.262  64.106  1.00 71.57  ? 27   TYR C OH  1 
ATOM   3628  N N   . ARG C  2 35  ? -7.854  -42.973  71.464  1.00 66.83  ? 28   ARG C N   1 
ATOM   3629  C CA  . ARG C  2 35  ? -6.772  -42.835  72.433  1.00 59.88  ? 28   ARG C CA  1 
ATOM   3630  C C   . ARG C  2 35  ? -5.492  -42.464  71.696  1.00 54.84  ? 28   ARG C C   1 
ATOM   3631  O O   . ARG C  2 35  ? -5.060  -43.179  70.792  1.00 55.00  ? 28   ARG C O   1 
ATOM   3632  C CB  . ARG C  2 35  ? -6.581  -44.126  73.231  1.00 61.24  ? 28   ARG C CB  1 
ATOM   3633  N N   . LEU C  2 36  ? -4.886  -41.345  72.078  1.00 48.84  ? 29   LEU C N   1 
ATOM   3634  C CA  . LEU C  2 36  ? -3.788  -40.790  71.295  1.00 53.02  ? 29   LEU C CA  1 
ATOM   3635  C C   . LEU C  2 36  ? -2.470  -40.686  72.049  1.00 56.39  ? 29   LEU C C   1 
ATOM   3636  O O   . LEU C  2 36  ? -2.439  -40.611  73.277  1.00 59.79  ? 29   LEU C O   1 
ATOM   3637  C CB  . LEU C  2 36  ? -4.177  -39.409  70.772  1.00 52.02  ? 29   LEU C CB  1 
ATOM   3638  C CG  . LEU C  2 36  ? -5.413  -39.399  69.876  1.00 54.58  ? 29   LEU C CG  1 
ATOM   3639  C CD1 . LEU C  2 36  ? -5.823  -37.981  69.571  1.00 57.18  ? 29   LEU C CD1 1 
ATOM   3640  C CD2 . LEU C  2 36  ? -5.149  -40.167  68.595  1.00 53.46  ? 29   LEU C CD2 1 
ATOM   3641  N N   . ALA C  2 37  ? -1.383  -40.680  71.286  1.00 59.47  ? 30   ALA C N   1 
ATOM   3642  C CA  . ALA C  2 37  ? -0.047  -40.492  71.830  1.00 62.02  ? 30   ALA C CA  1 
ATOM   3643  C C   . ALA C  2 37  ? 0.758   -39.561  70.931  1.00 64.61  ? 30   ALA C C   1 
ATOM   3644  O O   . ALA C  2 37  ? 1.035   -39.884  69.775  1.00 66.36  ? 30   ALA C O   1 
ATOM   3645  C CB  . ALA C  2 37  ? 0.658   -41.824  71.984  1.00 61.42  ? 30   ALA C CB  1 
ATOM   3646  N N   . VAL C  2 38  ? 1.122   -38.401  71.467  1.00 62.45  ? 31   VAL C N   1 
ATOM   3647  C CA  . VAL C  2 38  ? 1.880   -37.411  70.712  1.00 60.00  ? 31   VAL C CA  1 
ATOM   3648  C C   . VAL C  2 38  ? 3.373   -37.715  70.771  1.00 60.23  ? 31   VAL C C   1 
ATOM   3649  O O   . VAL C  2 38  ? 3.959   -37.782  71.852  1.00 62.80  ? 31   VAL C O   1 
ATOM   3650  C CB  . VAL C  2 38  ? 1.623   -35.989  71.239  1.00 56.18  ? 31   VAL C CB  1 
ATOM   3651  C CG1 . VAL C  2 38  ? 2.478   -34.981  70.490  1.00 52.76  ? 31   VAL C CG1 1 
ATOM   3652  C CG2 . VAL C  2 38  ? 0.147   -35.641  71.115  1.00 55.10  ? 31   VAL C CG2 1 
ATOM   3653  N N   . ILE C  2 39  ? 3.983   -37.899  69.604  1.00 59.47  ? 32   ILE C N   1 
ATOM   3654  C CA  . ILE C  2 39  ? 5.387   -38.286  69.535  1.00 60.41  ? 32   ILE C CA  1 
ATOM   3655  C C   . ILE C  2 39  ? 6.221   -37.307  68.711  1.00 61.73  ? 32   ILE C C   1 
ATOM   3656  O O   . ILE C  2 39  ? 5.880   -36.986  67.572  1.00 64.30  ? 32   ILE C O   1 
ATOM   3657  C CB  . ILE C  2 39  ? 5.544   -39.701  68.944  1.00 57.18  ? 32   ILE C CB  1 
ATOM   3658  C CG1 . ILE C  2 39  ? 4.723   -40.707  69.754  1.00 60.32  ? 32   ILE C CG1 1 
ATOM   3659  C CG2 . ILE C  2 39  ? 7.007   -40.106  68.916  1.00 55.42  ? 32   ILE C CG2 1 
ATOM   3660  C CD1 . ILE C  2 39  ? 4.814   -42.126  69.243  1.00 62.48  ? 32   ILE C CD1 1 
ATOM   3661  N N   . ALA C  2 40  ? 7.316   -36.843  69.304  1.00 63.50  ? 33   ALA C N   1 
ATOM   3662  C CA  . ALA C  2 40  ? 8.246   -35.928  68.651  1.00 58.86  ? 33   ALA C CA  1 
ATOM   3663  C C   . ALA C  2 40  ? 9.579   -35.945  69.394  1.00 57.96  ? 33   ALA C C   1 
ATOM   3664  O O   . ALA C  2 40  ? 9.679   -36.535  70.467  1.00 59.29  ? 33   ALA C O   1 
ATOM   3665  C CB  . ALA C  2 40  ? 7.672   -34.522  68.607  1.00 58.39  ? 33   ALA C CB  1 
ATOM   3666  N N   . ARG C  2 41  ? 10.601  -35.307  68.830  1.00 54.42  ? 34   ARG C N   1 
ATOM   3667  C CA  . ARG C  2 41  ? 11.904  -35.249  69.488  1.00 57.91  ? 34   ARG C CA  1 
ATOM   3668  C C   . ARG C  2 41  ? 11.823  -34.425  70.770  1.00 61.05  ? 34   ARG C C   1 
ATOM   3669  O O   . ARG C  2 41  ? 12.180  -34.900  71.848  1.00 65.33  ? 34   ARG C O   1 
ATOM   3670  C CB  . ARG C  2 41  ? 12.965  -34.664  68.551  1.00 58.30  ? 34   ARG C CB  1 
ATOM   3671  C CG  . ARG C  2 41  ? 13.181  -35.462  67.275  1.00 58.19  ? 34   ARG C CG  1 
ATOM   3672  C CD  . ARG C  2 41  ? 14.069  -34.706  66.298  1.00 60.23  ? 34   ARG C CD  1 
ATOM   3673  N NE  . ARG C  2 41  ? 13.439  -33.473  65.833  1.00 59.27  ? 34   ARG C NE  1 
ATOM   3674  C CZ  . ARG C  2 41  ? 14.003  -32.618  64.987  1.00 57.65  ? 34   ARG C CZ  1 
ATOM   3675  N NH1 . ARG C  2 41  ? 15.216  -32.856  64.508  1.00 57.42  ? 34   ARG C NH1 1 
ATOM   3676  N NH2 . ARG C  2 41  ? 13.353  -31.521  64.619  1.00 56.81  ? 34   ARG C NH2 1 
ATOM   3677  N N   . ASN C  2 42  ? 11.348  -33.189  70.647  1.00 58.52  ? 35   ASN C N   1 
ATOM   3678  C CA  . ASN C  2 42  ? 11.175  -32.318  71.803  1.00 57.51  ? 35   ASN C CA  1 
ATOM   3679  C C   . ASN C  2 42  ? 10.008  -32.775  72.672  1.00 56.13  ? 35   ASN C C   1 
ATOM   3680  O O   . ASN C  2 42  ? 8.854   -32.742  72.245  1.00 59.28  ? 35   ASN C O   1 
ATOM   3681  C CB  . ASN C  2 42  ? 10.964  -30.870  71.354  1.00 55.61  ? 35   ASN C CB  1 
ATOM   3682  C CG  . ASN C  2 42  ? 10.860  -29.907  72.520  1.00 54.88  ? 35   ASN C CG  1 
ATOM   3683  O OD1 . ASN C  2 42  ? 9.773   -29.660  73.041  1.00 58.54  ? 35   ASN C OD1 1 
ATOM   3684  N ND2 . ASN C  2 42  ? 11.994  -29.354  72.933  1.00 56.45  ? 35   ASN C ND2 1 
ATOM   3685  N N   . LEU C  2 43  ? 10.317  -33.204  73.892  1.00 55.68  ? 36   LEU C N   1 
ATOM   3686  C CA  . LEU C  2 43  ? 9.304   -33.727  74.804  1.00 57.50  ? 36   LEU C CA  1 
ATOM   3687  C C   . LEU C  2 43  ? 8.327   -32.646  75.257  1.00 61.02  ? 36   LEU C C   1 
ATOM   3688  O O   . LEU C  2 43  ? 7.124   -32.891  75.354  1.00 63.02  ? 36   LEU C O   1 
ATOM   3689  C CB  . LEU C  2 43  ? 9.968   -34.371  76.022  1.00 58.46  ? 36   LEU C CB  1 
ATOM   3690  C CG  . LEU C  2 43  ? 9.021   -34.991  77.051  1.00 58.19  ? 36   LEU C CG  1 
ATOM   3691  C CD1 . LEU C  2 43  ? 8.202   -36.105  76.419  1.00 51.30  ? 36   LEU C CD1 1 
ATOM   3692  C CD2 . LEU C  2 43  ? 9.794   -35.504  78.256  1.00 63.27  ? 36   LEU C CD2 1 
ATOM   3693  N N   . GLU C  2 44  ? 8.852   -31.456  75.535  1.00 60.64  ? 37   GLU C N   1 
ATOM   3694  C CA  . GLU C  2 44  ? 8.031   -30.328  75.965  1.00 62.03  ? 37   GLU C CA  1 
ATOM   3695  C C   . GLU C  2 44  ? 6.966   -29.983  74.929  1.00 63.11  ? 37   GLU C C   1 
ATOM   3696  O O   . GLU C  2 44  ? 5.830   -29.664  75.278  1.00 65.51  ? 37   GLU C O   1 
ATOM   3697  C CB  . GLU C  2 44  ? 8.907   -29.105  76.246  1.00 67.44  ? 37   GLU C CB  1 
ATOM   3698  C CG  . GLU C  2 44  ? 9.194   -28.872  77.721  1.00 77.80  ? 37   GLU C CG  1 
ATOM   3699  C CD  . GLU C  2 44  ? 8.018   -28.253  78.452  1.00 84.15  ? 37   GLU C CD  1 
ATOM   3700  O OE1 . GLU C  2 44  ? 7.400   -27.320  77.899  1.00 86.38  ? 37   GLU C OE1 1 
ATOM   3701  O OE2 . GLU C  2 44  ? 7.710   -28.700  79.577  1.00 85.94  ? 37   GLU C OE2 1 
ATOM   3702  N N   . GLY C  2 45  ? 7.339   -30.055  73.656  1.00 59.09  ? 38   GLY C N   1 
ATOM   3703  C CA  . GLY C  2 45  ? 6.403   -29.805  72.576  1.00 60.30  ? 38   GLY C CA  1 
ATOM   3704  C C   . GLY C  2 45  ? 5.375   -30.910  72.459  1.00 58.62  ? 38   GLY C C   1 
ATOM   3705  O O   . GLY C  2 45  ? 4.214   -30.662  72.131  1.00 59.06  ? 38   GLY C O   1 
ATOM   3706  N N   . ALA C  2 46  ? 5.807   -32.137  72.732  1.00 60.30  ? 39   ALA C N   1 
ATOM   3707  C CA  . ALA C  2 46  ? 4.921   -33.292  72.677  1.00 56.14  ? 39   ALA C CA  1 
ATOM   3708  C C   . ALA C  2 46  ? 3.888   -33.238  73.797  1.00 57.28  ? 39   ALA C C   1 
ATOM   3709  O O   . ALA C  2 46  ? 2.722   -33.573  73.592  1.00 58.09  ? 39   ALA C O   1 
ATOM   3710  C CB  . ALA C  2 46  ? 5.725   -34.582  72.754  1.00 54.43  ? 39   ALA C CB  1 
ATOM   3711  N N   . LYS C  2 47  ? 4.319   -32.813  74.980  1.00 58.76  ? 40   LYS C N   1 
ATOM   3712  C CA  . LYS C  2 47  ? 3.416   -32.706  76.120  1.00 60.91  ? 40   LYS C CA  1 
ATOM   3713  C C   . LYS C  2 47  ? 2.515   -31.481  76.007  1.00 61.38  ? 40   LYS C C   1 
ATOM   3714  O O   . LYS C  2 47  ? 1.384   -31.491  76.494  1.00 60.70  ? 40   LYS C O   1 
ATOM   3715  C CB  . LYS C  2 47  ? 4.197   -32.654  77.434  1.00 69.17  ? 40   LYS C CB  1 
ATOM   3716  C CG  . LYS C  2 47  ? 4.669   -34.011  77.930  1.00 73.03  ? 40   LYS C CG  1 
ATOM   3717  C CD  . LYS C  2 47  ? 4.925   -33.995  79.428  1.00 77.27  ? 40   LYS C CD  1 
ATOM   3718  C CE  . LYS C  2 47  ? 5.406   -35.349  79.919  1.00 81.79  ? 40   LYS C CE  1 
ATOM   3719  N NZ  . LYS C  2 47  ? 4.437   -36.430  79.581  1.00 82.24  ? 40   LYS C NZ  1 
ATOM   3720  N N   . ALA C  2 48  ? 3.016   -30.429  75.368  1.00 62.86  ? 41   ALA C N   1 
ATOM   3721  C CA  . ALA C  2 48  ? 2.233   -29.214  75.178  1.00 69.99  ? 41   ALA C CA  1 
ATOM   3722  C C   . ALA C  2 48  ? 1.025   -29.494  74.293  1.00 69.35  ? 41   ALA C C   1 
ATOM   3723  O O   . ALA C  2 48  ? -0.069  -28.984  74.537  1.00 69.13  ? 41   ALA C O   1 
ATOM   3724  C CB  . ALA C  2 48  ? 3.092   -28.112  74.577  1.00 50.31  ? 41   ALA C CB  1 
ATOM   3725  N N   . ALA C  2 49  ? 1.233   -30.315  73.268  1.00 68.39  ? 42   ALA C N   1 
ATOM   3726  C CA  . ALA C  2 49  ? 0.160   -30.698  72.360  1.00 67.74  ? 42   ALA C CA  1 
ATOM   3727  C C   . ALA C  2 49  ? -0.814  -31.653  73.040  1.00 71.42  ? 42   ALA C C   1 
ATOM   3728  O O   . ALA C  2 49  ? -2.028  -31.461  72.983  1.00 71.84  ? 42   ALA C O   1 
ATOM   3729  C CB  . ALA C  2 49  ? 0.733   -31.330  71.100  1.00 62.97  ? 42   ALA C CB  1 
ATOM   3730  N N   . ALA C  2 50  ? -0.274  -32.680  73.689  1.00 70.83  ? 43   ALA C N   1 
ATOM   3731  C CA  . ALA C  2 50  ? -1.092  -33.675  74.374  1.00 69.11  ? 43   ALA C CA  1 
ATOM   3732  C C   . ALA C  2 50  ? -1.734  -33.102  75.633  1.00 65.05  ? 43   ALA C C   1 
ATOM   3733  O O   . ALA C  2 50  ? -2.700  -33.658  76.156  1.00 61.18  ? 43   ALA C O   1 
ATOM   3734  C CB  . ALA C  2 50  ? -0.256  -34.896  74.719  1.00 67.51  ? 43   ALA C CB  1 
ATOM   3735  N N   . GLY C  2 51  ? -1.190  -31.991  76.117  1.00 66.26  ? 44   GLY C N   1 
ATOM   3736  C CA  . GLY C  2 51  ? -1.703  -31.350  77.314  1.00 67.25  ? 44   GLY C CA  1 
ATOM   3737  C C   . GLY C  2 51  ? -3.021  -30.642  77.074  1.00 68.47  ? 44   GLY C C   1 
ATOM   3738  O O   . GLY C  2 51  ? -3.869  -30.572  77.964  1.00 70.76  ? 44   GLY C O   1 
ATOM   3739  N N   . ASP C  2 52  ? -3.191  -30.114  75.865  1.00 68.07  ? 45   ASP C N   1 
ATOM   3740  C CA  . ASP C  2 52  ? -4.424  -29.429  75.491  1.00 76.85  ? 45   ASP C CA  1 
ATOM   3741  C C   . ASP C  2 52  ? -5.376  -30.381  74.772  1.00 75.02  ? 45   ASP C C   1 
ATOM   3742  O O   . ASP C  2 52  ? -6.306  -29.950  74.091  1.00 72.18  ? 45   ASP C O   1 
ATOM   3743  C CB  . ASP C  2 52  ? -4.126  -28.218  74.602  1.00 82.17  ? 45   ASP C CB  1 
ATOM   3744  C CG  . ASP C  2 52  ? -5.180  -27.128  74.725  1.00 90.82  ? 45   ASP C CG  1 
ATOM   3745  O OD1 . ASP C  2 52  ? -6.256  -27.393  75.302  1.00 94.00  ? 45   ASP C OD1 1 
ATOM   3746  O OD2 . ASP C  2 52  ? -4.932  -26.002  74.245  1.00 93.71  ? 45   ASP C OD2 1 
ATOM   3747  N N   . LEU C  2 53  ? -5.133  -31.678  74.917  1.00 77.22  ? 46   LEU C N   1 
ATOM   3748  C CA  . LEU C  2 53  ? -6.006  -32.677  74.318  1.00 74.41  ? 46   LEU C CA  1 
ATOM   3749  C C   . LEU C  2 53  ? -7.120  -33.038  75.298  1.00 79.35  ? 46   LEU C C   1 
ATOM   3750  O O   . LEU C  2 53  ? -8.246  -33.322  74.895  1.00 78.51  ? 46   LEU C O   1 
ATOM   3751  C CB  . LEU C  2 53  ? -5.209  -33.916  73.910  1.00 69.96  ? 46   LEU C CB  1 
ATOM   3752  C CG  . LEU C  2 53  ? -5.001  -34.165  72.414  1.00 63.20  ? 46   LEU C CG  1 
ATOM   3753  C CD1 . LEU C  2 53  ? -4.619  -32.886  71.683  1.00 61.53  ? 46   LEU C CD1 1 
ATOM   3754  C CD2 . LEU C  2 53  ? -3.953  -35.250  72.199  1.00 59.57  ? 46   LEU C CD2 1 
ATOM   3755  N N   . GLY C  2 54  ? -6.792  -33.020  76.587  1.00 83.58  ? 47   GLY C N   1 
ATOM   3756  C CA  . GLY C  2 54  ? -7.784  -33.135  77.639  1.00 89.47  ? 47   GLY C CA  1 
ATOM   3757  C C   . GLY C  2 54  ? -8.359  -34.524  77.821  1.00 92.91  ? 47   GLY C C   1 
ATOM   3758  O O   . GLY C  2 54  ? -9.580  -34.690  77.908  1.00 99.07  ? 47   GLY C O   1 
ATOM   3759  N N   . GLY C  2 55  ? -7.481  -35.520  77.882  1.00 91.98  ? 48   GLY C N   1 
ATOM   3760  C CA  . GLY C  2 55  ? -7.895  -36.874  78.183  1.00 92.39  ? 48   GLY C CA  1 
ATOM   3761  C C   . GLY C  2 55  ? -6.732  -37.741  78.618  1.00 93.33  ? 48   GLY C C   1 
ATOM   3762  O O   . GLY C  2 55  ? -5.722  -37.259  79.138  1.00 93.42  ? 48   GLY C O   1 
ATOM   3763  N N   . ASP C  2 56  ? -6.889  -39.038  78.394  1.00 90.02  ? 49   ASP C N   1 
ATOM   3764  C CA  . ASP C  2 56  ? -5.864  -40.017  78.705  1.00 87.39  ? 49   ASP C CA  1 
ATOM   3765  C C   . ASP C  2 56  ? -4.824  -40.072  77.590  1.00 84.86  ? 49   ASP C C   1 
ATOM   3766  O O   . ASP C  2 56  ? -4.340  -41.145  77.235  1.00 86.15  ? 49   ASP C O   1 
ATOM   3767  C CB  . ASP C  2 56  ? -6.499  -41.393  78.914  1.00 87.81  ? 49   ASP C CB  1 
ATOM   3768  N N   . HIS C  2 57  ? -4.492  -38.911  77.034  1.00 79.70  ? 50   HIS C N   1 
ATOM   3769  C CA  . HIS C  2 57  ? -3.530  -38.826  75.943  1.00 73.72  ? 50   HIS C CA  1 
ATOM   3770  C C   . HIS C  2 57  ? -2.128  -38.551  76.477  1.00 73.03  ? 50   HIS C C   1 
ATOM   3771  O O   . HIS C  2 57  ? -1.876  -37.506  77.076  1.00 77.91  ? 50   HIS C O   1 
ATOM   3772  C CB  . HIS C  2 57  ? -3.945  -37.738  74.950  1.00 67.59  ? 50   HIS C CB  1 
ATOM   3773  C CG  . HIS C  2 57  ? -5.408  -37.739  74.634  1.00 65.23  ? 50   HIS C CG  1 
ATOM   3774  N ND1 . HIS C  2 57  ? -5.990  -38.672  73.804  1.00 63.16  ? 50   HIS C ND1 1 
ATOM   3775  C CD2 . HIS C  2 57  ? -6.408  -36.924  75.044  1.00 66.35  ? 50   HIS C CD2 1 
ATOM   3776  C CE1 . HIS C  2 57  ? -7.286  -38.431  73.713  1.00 63.50  ? 50   HIS C CE1 1 
ATOM   3777  N NE2 . HIS C  2 57  ? -7.565  -37.375  74.456  1.00 66.33  ? 50   HIS C NE2 1 
ATOM   3778  N N   . LEU C  2 58  ? -1.220  -39.495  76.260  1.00 72.17  ? 51   LEU C N   1 
ATOM   3779  C CA  . LEU C  2 58  ? 0.148   -39.361  76.746  1.00 72.77  ? 51   LEU C CA  1 
ATOM   3780  C C   . LEU C  2 58  ? 1.073   -38.824  75.658  1.00 70.97  ? 51   LEU C C   1 
ATOM   3781  O O   . LEU C  2 58  ? 0.743   -38.866  74.475  1.00 71.00  ? 51   LEU C O   1 
ATOM   3782  C CB  . LEU C  2 58  ? 0.666   -40.706  77.260  1.00 76.71  ? 51   LEU C CB  1 
ATOM   3783  N N   . ALA C  2 59  ? 2.230   -38.316  76.067  1.00 63.45  ? 52   ALA C N   1 
ATOM   3784  C CA  . ALA C  2 59  ? 3.215   -37.799  75.124  1.00 59.59  ? 52   ALA C CA  1 
ATOM   3785  C C   . ALA C  2 59  ? 4.527   -38.561  75.250  1.00 58.42  ? 52   ALA C C   1 
ATOM   3786  O O   . ALA C  2 59  ? 4.894   -39.005  76.338  1.00 64.84  ? 52   ALA C O   1 
ATOM   3787  C CB  . ALA C  2 59  ? 3.439   -36.317  75.349  1.00 45.16  ? 52   ALA C CB  1 
ATOM   3788  N N   . PHE C  2 60  ? 5.231   -38.712  74.134  1.00 54.86  ? 53   PHE C N   1 
ATOM   3789  C CA  . PHE C  2 60  ? 6.481   -39.462  74.119  1.00 51.42  ? 53   PHE C CA  1 
ATOM   3790  C C   . PHE C  2 60  ? 7.559   -38.743  73.313  1.00 50.42  ? 53   PHE C C   1 
ATOM   3791  O O   . PHE C  2 60  ? 7.264   -38.065  72.329  1.00 49.09  ? 53   PHE C O   1 
ATOM   3792  C CB  . PHE C  2 60  ? 6.253   -40.866  73.553  1.00 50.14  ? 53   PHE C CB  1 
ATOM   3793  C CG  . PHE C  2 60  ? 5.276   -41.690  74.344  1.00 51.98  ? 53   PHE C CG  1 
ATOM   3794  C CD1 . PHE C  2 60  ? 3.921   -41.656  74.051  1.00 51.10  ? 53   PHE C CD1 1 
ATOM   3795  C CD2 . PHE C  2 60  ? 5.711   -42.501  75.378  1.00 58.89  ? 53   PHE C CD2 1 
ATOM   3796  C CE1 . PHE C  2 60  ? 3.021   -42.413  74.777  1.00 54.66  ? 53   PHE C CE1 1 
ATOM   3797  C CE2 . PHE C  2 60  ? 4.815   -43.261  76.107  1.00 61.59  ? 53   PHE C CE2 1 
ATOM   3798  C CZ  . PHE C  2 60  ? 3.469   -43.217  75.806  1.00 60.19  ? 53   PHE C CZ  1 
ATOM   3799  N N   . SER C  2 61  ? 8.808   -38.896  73.742  1.00 51.52  ? 54   SER C N   1 
ATOM   3800  C CA  . SER C  2 61  ? 9.939   -38.321  73.026  1.00 51.05  ? 54   SER C CA  1 
ATOM   3801  C C   . SER C  2 61  ? 10.643  -39.390  72.200  1.00 53.28  ? 54   SER C C   1 
ATOM   3802  O O   . SER C  2 61  ? 11.027  -40.434  72.726  1.00 59.62  ? 54   SER C O   1 
ATOM   3803  C CB  . SER C  2 61  ? 10.923  -37.671  73.999  1.00 55.63  ? 54   SER C CB  1 
ATOM   3804  O OG  . SER C  2 61  ? 12.025  -37.111  73.306  1.00 57.48  ? 54   SER C OG  1 
ATOM   3805  N N   . CYS C  2 62  ? 10.812  -39.127  70.908  1.00 55.28  ? 55   CYS C N   1 
ATOM   3806  C CA  . CYS C  2 62  ? 11.418  -40.106  70.013  1.00 58.93  ? 55   CYS C CA  1 
ATOM   3807  C C   . CYS C  2 62  ? 11.977  -39.488  68.737  1.00 58.77  ? 55   CYS C C   1 
ATOM   3808  O O   . CYS C  2 62  ? 11.442  -38.508  68.219  1.00 59.10  ? 55   CYS C O   1 
ATOM   3809  C CB  . CYS C  2 62  ? 10.398  -41.183  69.644  1.00 60.88  ? 55   CYS C CB  1 
ATOM   3810  S SG  . CYS C  2 62  ? 10.998  -42.395  68.445  1.00 53.03  ? 55   CYS C SG  1 
ATOM   3811  N N   . ASP C  2 63  ? 13.058  -40.077  68.237  1.00 55.23  ? 56   ASP C N   1 
ATOM   3812  C CA  . ASP C  2 63  ? 13.605  -39.707  66.939  1.00 53.28  ? 56   ASP C CA  1 
ATOM   3813  C C   . ASP C  2 63  ? 13.348  -40.845  65.957  1.00 55.29  ? 56   ASP C C   1 
ATOM   3814  O O   . ASP C  2 63  ? 13.884  -41.943  66.112  1.00 58.56  ? 56   ASP C O   1 
ATOM   3815  C CB  . ASP C  2 63  ? 15.102  -39.405  67.043  1.00 54.53  ? 56   ASP C CB  1 
ATOM   3816  C CG  . ASP C  2 63  ? 15.631  -38.641  65.840  1.00 55.21  ? 56   ASP C CG  1 
ATOM   3817  O OD1 . ASP C  2 63  ? 15.104  -38.828  64.723  1.00 48.38  ? 56   ASP C OD1 1 
ATOM   3818  O OD2 . ASP C  2 63  ? 16.580  -37.848  66.014  1.00 63.79  ? 56   ASP C OD2 1 
ATOM   3819  N N   . VAL C  2 64  ? 12.523  -40.577  64.950  1.00 51.07  ? 57   VAL C N   1 
ATOM   3820  C CA  . VAL C  2 64  ? 12.128  -41.599  63.987  1.00 51.18  ? 57   VAL C CA  1 
ATOM   3821  C C   . VAL C  2 64  ? 13.296  -42.047  63.111  1.00 54.46  ? 57   VAL C C   1 
ATOM   3822  O O   . VAL C  2 64  ? 13.241  -43.105  62.485  1.00 56.82  ? 57   VAL C O   1 
ATOM   3823  C CB  . VAL C  2 64  ? 10.983  -41.104  63.083  1.00 47.25  ? 57   VAL C CB  1 
ATOM   3824  C CG1 . VAL C  2 64  ? 9.723   -40.878  63.903  1.00 47.72  ? 57   VAL C CG1 1 
ATOM   3825  C CG2 . VAL C  2 64  ? 11.388  -39.830  62.359  1.00 45.18  ? 57   VAL C CG2 1 
ATOM   3826  N N   . ALA C  2 65  ? 14.353  -41.242  63.075  1.00 56.35  ? 58   ALA C N   1 
ATOM   3827  C CA  . ALA C  2 65  ? 15.537  -41.571  62.289  1.00 56.74  ? 58   ALA C CA  1 
ATOM   3828  C C   . ALA C  2 65  ? 16.416  -42.592  63.007  1.00 62.25  ? 58   ALA C C   1 
ATOM   3829  O O   . ALA C  2 65  ? 17.278  -43.221  62.394  1.00 63.80  ? 58   ALA C O   1 
ATOM   3830  C CB  . ALA C  2 65  ? 16.333  -40.313  61.979  1.00 57.44  ? 58   ALA C CB  1 
ATOM   3831  N N   . LYS C  2 66  ? 16.196  -42.751  64.309  1.00 62.11  ? 59   LYS C N   1 
ATOM   3832  C CA  . LYS C  2 66  ? 16.967  -43.698  65.106  1.00 63.34  ? 59   LYS C CA  1 
ATOM   3833  C C   . LYS C  2 66  ? 16.175  -44.975  65.338  1.00 59.42  ? 59   LYS C C   1 
ATOM   3834  O O   . LYS C  2 66  ? 15.101  -44.948  65.939  1.00 54.41  ? 59   LYS C O   1 
ATOM   3835  C CB  . LYS C  2 66  ? 17.374  -43.068  66.438  1.00 64.19  ? 59   LYS C CB  1 
ATOM   3836  C CG  . LYS C  2 66  ? 18.312  -41.888  66.271  1.00 64.29  ? 59   LYS C CG  1 
ATOM   3837  C CD  . LYS C  2 66  ? 18.441  -41.067  67.539  1.00 64.49  ? 59   LYS C CD  1 
ATOM   3838  C CE  . LYS C  2 66  ? 19.373  -39.887  67.307  1.00 65.56  ? 59   LYS C CE  1 
ATOM   3839  N NZ  . LYS C  2 66  ? 19.380  -38.937  68.450  1.00 67.32  ? 59   LYS C NZ  1 
ATOM   3840  N N   . GLU C  2 67  ? 16.713  -46.093  64.863  1.00 69.91  ? 60   GLU C N   1 
ATOM   3841  C CA  . GLU C  2 67  ? 15.988  -47.359  64.884  1.00 76.32  ? 60   GLU C CA  1 
ATOM   3842  C C   . GLU C  2 67  ? 15.649  -47.846  66.293  1.00 77.54  ? 60   GLU C C   1 
ATOM   3843  O O   . GLU C  2 67  ? 14.648  -48.532  66.483  1.00 78.39  ? 60   GLU C O   1 
ATOM   3844  C CB  . GLU C  2 67  ? 16.786  -48.440  64.151  1.00 88.70  ? 60   GLU C CB  1 
ATOM   3845  C CG  . GLU C  2 67  ? 18.030  -48.893  64.888  1.00 100.96 ? 60   GLU C CG  1 
ATOM   3846  C CD  . GLU C  2 67  ? 18.699  -50.068  64.217  1.00 110.99 ? 60   GLU C CD  1 
ATOM   3847  O OE1 . GLU C  2 67  ? 19.531  -49.838  63.315  1.00 113.97 ? 60   GLU C OE1 1 
ATOM   3848  O OE2 . GLU C  2 67  ? 18.398  -51.221  64.594  1.00 116.30 ? 60   GLU C OE2 1 
ATOM   3849  N N   . HIS C  2 68  ? 16.473  -47.495  67.275  1.00 77.84  ? 61   HIS C N   1 
ATOM   3850  C CA  . HIS C  2 68  ? 16.258  -47.967  68.638  1.00 81.61  ? 61   HIS C CA  1 
ATOM   3851  C C   . HIS C  2 68  ? 15.206  -47.130  69.351  1.00 79.21  ? 61   HIS C C   1 
ATOM   3852  O O   . HIS C  2 68  ? 14.397  -47.655  70.117  1.00 78.85  ? 61   HIS C O   1 
ATOM   3853  C CB  . HIS C  2 68  ? 17.570  -47.959  69.422  1.00 87.66  ? 61   HIS C CB  1 
ATOM   3854  C CG  . HIS C  2 68  ? 18.503  -49.068  69.043  1.00 93.32  ? 61   HIS C CG  1 
ATOM   3855  N ND1 . HIS C  2 68  ? 19.856  -49.022  69.299  1.00 94.96  ? 61   HIS C ND1 1 
ATOM   3856  C CD2 . HIS C  2 68  ? 18.275  -50.256  68.435  1.00 95.23  ? 61   HIS C CD2 1 
ATOM   3857  C CE1 . HIS C  2 68  ? 20.423  -50.132  68.861  1.00 96.77  ? 61   HIS C CE1 1 
ATOM   3858  N NE2 . HIS C  2 68  ? 19.485  -50.898  68.333  1.00 96.52  ? 61   HIS C NE2 1 
ATOM   3859  N N   . ASP C  2 69  ? 15.219  -45.828  69.086  1.00 70.84  ? 62   ASP C N   1 
ATOM   3860  C CA  . ASP C  2 69  ? 14.228  -44.913  69.639  1.00 63.65  ? 62   ASP C CA  1 
ATOM   3861  C C   . ASP C  2 69  ? 12.828  -45.300  69.183  1.00 55.03  ? 62   ASP C C   1 
ATOM   3862  O O   . ASP C  2 69  ? 11.856  -45.133  69.918  1.00 54.11  ? 62   ASP C O   1 
ATOM   3863  C CB  . ASP C  2 69  ? 14.537  -43.473  69.232  1.00 64.21  ? 62   ASP C CB  1 
ATOM   3864  C CG  . ASP C  2 69  ? 15.731  -42.902  69.968  1.00 73.00  ? 62   ASP C CG  1 
ATOM   3865  O OD1 . ASP C  2 69  ? 16.693  -43.656  70.235  1.00 79.98  ? 62   ASP C OD1 1 
ATOM   3866  O OD2 . ASP C  2 69  ? 15.702  -41.696  70.287  1.00 74.95  ? 62   ASP C OD2 1 
ATOM   3867  N N   . VAL C  2 70  ? 12.739  -45.825  67.966  1.00 54.52  ? 63   VAL C N   1 
ATOM   3868  C CA  . VAL C  2 70  ? 11.474  -46.291  67.418  1.00 58.09  ? 63   VAL C CA  1 
ATOM   3869  C C   . VAL C  2 70  ? 10.954  -47.486  68.211  1.00 66.15  ? 63   VAL C C   1 
ATOM   3870  O O   . VAL C  2 70  ? 9.799   -47.500  68.639  1.00 67.37  ? 63   VAL C O   1 
ATOM   3871  C CB  . VAL C  2 70  ? 11.612  -46.678  65.931  1.00 55.55  ? 63   VAL C CB  1 
ATOM   3872  C CG1 . VAL C  2 70  ? 10.323  -47.304  65.419  1.00 54.15  ? 63   VAL C CG1 1 
ATOM   3873  C CG2 . VAL C  2 70  ? 11.994  -45.462  65.097  1.00 53.94  ? 63   VAL C CG2 1 
ATOM   3874  N N   . GLN C  2 71  ? 11.813  -48.481  68.414  1.00 70.87  ? 64   GLN C N   1 
ATOM   3875  C CA  . GLN C  2 71  ? 11.422  -49.690  69.134  1.00 75.15  ? 64   GLN C CA  1 
ATOM   3876  C C   . GLN C  2 71  ? 11.160  -49.406  70.608  1.00 80.90  ? 64   GLN C C   1 
ATOM   3877  O O   . GLN C  2 71  ? 10.216  -49.941  71.193  1.00 82.41  ? 64   GLN C O   1 
ATOM   3878  C CB  . GLN C  2 71  ? 12.495  -50.773  68.994  1.00 74.98  ? 64   GLN C CB  1 
ATOM   3879  C CG  . GLN C  2 71  ? 12.187  -52.044  69.772  1.00 79.77  ? 64   GLN C CG  1 
ATOM   3880  C CD  . GLN C  2 71  ? 13.181  -53.156  69.501  1.00 88.28  ? 64   GLN C CD  1 
ATOM   3881  O OE1 . GLN C  2 71  ? 13.557  -53.402  68.356  1.00 90.18  ? 64   GLN C OE1 1 
ATOM   3882  N NE2 . GLN C  2 71  ? 13.616  -53.831  70.559  1.00 94.90  ? 64   GLN C NE2 1 
ATOM   3883  N N   . ASN C  2 72  ? 12.002  -48.567  71.201  1.00 86.33  ? 65   ASN C N   1 
ATOM   3884  C CA  . ASN C  2 72  ? 11.837  -48.168  72.593  1.00 90.67  ? 65   ASN C CA  1 
ATOM   3885  C C   . ASN C  2 72  ? 10.507  -47.461  72.821  1.00 86.65  ? 65   ASN C C   1 
ATOM   3886  O O   . ASN C  2 72  ? 9.814   -47.727  73.801  1.00 85.59  ? 65   ASN C O   1 
ATOM   3887  C CB  . ASN C  2 72  ? 12.991  -47.265  73.031  1.00 97.82  ? 65   ASN C CB  1 
ATOM   3888  C CG  . ASN C  2 72  ? 14.306  -48.012  73.137  1.00 107.54 ? 65   ASN C CG  1 
ATOM   3889  O OD1 . ASN C  2 72  ? 14.332  -49.192  73.485  1.00 112.66 ? 65   ASN C OD1 1 
ATOM   3890  N ND2 . ASN C  2 72  ? 15.406  -47.330  72.833  1.00 109.92 ? 65   ASN C ND2 1 
ATOM   3891  N N   . THR C  2 73  ? 10.151  -46.571  71.901  1.00 84.54  ? 66   THR C N   1 
ATOM   3892  C CA  . THR C  2 73  ? 8.917   -45.803  72.013  1.00 84.11  ? 66   THR C CA  1 
ATOM   3893  C C   . THR C  2 73  ? 7.699   -46.679  71.738  1.00 81.24  ? 66   THR C C   1 
ATOM   3894  O O   . THR C  2 73  ? 6.657   -46.525  72.375  1.00 78.94  ? 66   THR C O   1 
ATOM   3895  C CB  . THR C  2 73  ? 8.915   -44.606  71.047  1.00 88.91  ? 66   THR C CB  1 
ATOM   3896  O OG1 . THR C  2 73  ? 10.156  -43.899  71.162  1.00 93.97  ? 66   THR C OG1 1 
ATOM   3897  C CG2 . THR C  2 73  ? 7.764   -43.662  71.362  1.00 89.10  ? 66   THR C CG2 1 
ATOM   3898  N N   . PHE C  2 74  ? 7.837   -47.601  70.790  1.00 77.31  ? 67   PHE C N   1 
ATOM   3899  C CA  . PHE C  2 74  ? 6.752   -48.516  70.452  1.00 72.71  ? 67   PHE C CA  1 
ATOM   3900  C C   . PHE C  2 74  ? 6.501   -49.523  71.564  1.00 69.54  ? 67   PHE C C   1 
ATOM   3901  O O   . PHE C  2 74  ? 5.440   -50.144  71.625  1.00 65.53  ? 67   PHE C O   1 
ATOM   3902  C CB  . PHE C  2 74  ? 7.048   -49.250  69.144  1.00 72.06  ? 67   PHE C CB  1 
ATOM   3903  C CG  . PHE C  2 74  ? 6.367   -48.651  67.952  1.00 67.76  ? 67   PHE C CG  1 
ATOM   3904  C CD1 . PHE C  2 74  ? 5.065   -49.001  67.638  1.00 66.48  ? 67   PHE C CD1 1 
ATOM   3905  C CD2 . PHE C  2 74  ? 7.022   -47.734  67.149  1.00 64.77  ? 67   PHE C CD2 1 
ATOM   3906  C CE1 . PHE C  2 74  ? 4.432   -48.450  66.547  1.00 62.88  ? 67   PHE C CE1 1 
ATOM   3907  C CE2 . PHE C  2 74  ? 6.393   -47.181  66.054  1.00 59.36  ? 67   PHE C CE2 1 
ATOM   3908  C CZ  . PHE C  2 74  ? 5.096   -47.539  65.754  1.00 60.07  ? 67   PHE C CZ  1 
ATOM   3909  N N   . GLU C  2 75  ? 7.485   -49.690  72.440  1.00 70.01  ? 68   GLU C N   1 
ATOM   3910  C CA  . GLU C  2 75  ? 7.331   -50.566  73.589  1.00 73.25  ? 68   GLU C CA  1 
ATOM   3911  C C   . GLU C  2 75  ? 6.618   -49.831  74.721  1.00 74.32  ? 68   GLU C C   1 
ATOM   3912  O O   . GLU C  2 75  ? 5.890   -50.438  75.506  1.00 73.69  ? 68   GLU C O   1 
ATOM   3913  C CB  . GLU C  2 75  ? 8.688   -51.083  74.063  1.00 77.82  ? 68   GLU C CB  1 
ATOM   3914  C CG  . GLU C  2 75  ? 8.589   -52.147  75.136  1.00 85.16  ? 68   GLU C CG  1 
ATOM   3915  C CD  . GLU C  2 75  ? 9.779   -52.138  76.070  1.00 93.99  ? 68   GLU C CD  1 
ATOM   3916  O OE1 . GLU C  2 75  ? 10.923  -52.255  75.583  1.00 99.13  ? 68   GLU C OE1 1 
ATOM   3917  O OE2 . GLU C  2 75  ? 9.569   -52.002  77.294  1.00 94.73  ? 68   GLU C OE2 1 
ATOM   3918  N N   . GLU C  2 76  ? 6.831   -48.519  74.796  1.00 75.98  ? 69   GLU C N   1 
ATOM   3919  C CA  . GLU C  2 76  ? 6.177   -47.693  75.807  1.00 76.39  ? 69   GLU C CA  1 
ATOM   3920  C C   . GLU C  2 76  ? 4.682   -47.558  75.514  1.00 76.26  ? 69   GLU C C   1 
ATOM   3921  O O   . GLU C  2 76  ? 3.886   -47.292  76.413  1.00 78.19  ? 69   GLU C O   1 
ATOM   3922  C CB  . GLU C  2 76  ? 6.826   -46.305  75.880  1.00 73.66  ? 69   GLU C CB  1 
ATOM   3923  C CG  . GLU C  2 76  ? 8.323   -46.311  76.180  1.00 74.40  ? 69   GLU C CG  1 
ATOM   3924  C CD  . GLU C  2 76  ? 8.639   -46.277  77.665  1.00 77.23  ? 69   GLU C CD  1 
ATOM   3925  O OE1 . GLU C  2 76  ? 7.892   -45.619  78.419  1.00 76.26  ? 69   GLU C OE1 1 
ATOM   3926  O OE2 . GLU C  2 76  ? 9.638   -46.906  78.077  1.00 80.81  ? 69   GLU C OE2 1 
ATOM   3927  N N   . LEU C  2 77  ? 4.310   -47.742  74.251  1.00 77.88  ? 70   LEU C N   1 
ATOM   3928  C CA  . LEU C  2 77  ? 2.917   -47.641  73.827  1.00 79.71  ? 70   LEU C CA  1 
ATOM   3929  C C   . LEU C  2 77  ? 2.139   -48.881  74.235  1.00 83.53  ? 70   LEU C C   1 
ATOM   3930  O O   . LEU C  2 77  ? 0.958   -48.814  74.581  1.00 85.90  ? 70   LEU C O   1 
ATOM   3931  C CB  . LEU C  2 77  ? 2.837   -47.444  72.311  1.00 77.05  ? 70   LEU C CB  1 
ATOM   3932  C CG  . LEU C  2 77  ? 3.263   -46.066  71.802  1.00 74.19  ? 70   LEU C CG  1 
ATOM   3933  C CD1 . LEU C  2 77  ? 3.731   -46.122  70.353  1.00 72.64  ? 70   LEU C CD1 1 
ATOM   3934  C CD2 . LEU C  2 77  ? 2.118   -45.078  71.957  1.00 73.22  ? 70   LEU C CD2 1 
ATOM   3935  N N   . GLU C  2 78  ? 2.829   -50.014  74.188  1.00 85.83  ? 71   GLU C N   1 
ATOM   3936  C CA  . GLU C  2 78  ? 2.248   -51.313  74.494  1.00 89.31  ? 71   GLU C CA  1 
ATOM   3937  C C   . GLU C  2 78  ? 1.925   -51.447  75.994  1.00 92.01  ? 71   GLU C C   1 
ATOM   3938  O O   . GLU C  2 78  ? 1.088   -52.260  76.400  1.00 96.45  ? 71   GLU C O   1 
ATOM   3939  C CB  . GLU C  2 78  ? 3.211   -52.405  74.008  1.00 93.73  ? 71   GLU C CB  1 
ATOM   3940  C CG  . GLU C  2 78  ? 2.935   -53.813  74.500  1.00 99.39  ? 71   GLU C CG  1 
ATOM   3941  C CD  . GLU C  2 78  ? 4.016   -54.301  75.448  1.00 102.77 ? 71   GLU C CD  1 
ATOM   3942  O OE1 . GLU C  2 78  ? 5.090   -54.698  74.955  1.00 102.89 ? 71   GLU C OE1 1 
ATOM   3943  O OE2 . GLU C  2 78  ? 3.810   -54.277  76.681  1.00 105.82 ? 71   GLU C OE2 1 
ATOM   3944  N N   . LYS C  2 79  ? 2.561   -50.603  76.801  1.00 89.05  ? 72   LYS C N   1 
ATOM   3945  C CA  . LYS C  2 79  ? 2.383   -50.604  78.254  1.00 89.92  ? 72   LYS C CA  1 
ATOM   3946  C C   . LYS C  2 79  ? 1.394   -49.554  78.766  1.00 86.78  ? 72   LYS C C   1 
ATOM   3947  O O   . LYS C  2 79  ? 0.511   -49.866  79.565  1.00 90.38  ? 72   LYS C O   1 
ATOM   3948  C CB  . LYS C  2 79  ? 3.732   -50.387  78.942  1.00 86.72  ? 72   LYS C CB  1 
ATOM   3949  N N   . HIS C  2 80  ? 1.551   -48.311  78.320  1.00 84.00  ? 73   HIS C N   1 
ATOM   3950  C CA  . HIS C  2 80  ? 0.769   -47.204  78.869  1.00 80.62  ? 73   HIS C CA  1 
ATOM   3951  C C   . HIS C  2 80  ? -0.526  -46.948  78.100  1.00 83.80  ? 73   HIS C C   1 
ATOM   3952  O O   . HIS C  2 80  ? -1.542  -46.569  78.686  1.00 82.86  ? 73   HIS C O   1 
ATOM   3953  C CB  . HIS C  2 80  ? 1.617   -45.930  78.901  1.00 74.74  ? 73   HIS C CB  1 
ATOM   3954  C CG  . HIS C  2 80  ? 2.906   -46.087  79.646  1.00 74.74  ? 73   HIS C CG  1 
ATOM   3955  N ND1 . HIS C  2 80  ? 2.956   -46.355  80.997  1.00 76.70  ? 73   HIS C ND1 1 
ATOM   3956  C CD2 . HIS C  2 80  ? 4.191   -46.019  79.227  1.00 73.69  ? 73   HIS C CD2 1 
ATOM   3957  C CE1 . HIS C  2 80  ? 4.218   -46.444  81.379  1.00 78.32  ? 73   HIS C CE1 1 
ATOM   3958  N NE2 . HIS C  2 80  ? 4.987   -46.244  80.324  1.00 76.83  ? 73   HIS C NE2 1 
ATOM   3959  N N   . LEU C  2 81  ? -0.484  -47.158  76.788  1.00 85.71  ? 74   LEU C N   1 
ATOM   3960  C CA  . LEU C  2 81  ? -1.637  -46.893  75.935  1.00 86.90  ? 74   LEU C CA  1 
ATOM   3961  C C   . LEU C  2 81  ? -2.437  -48.161  75.644  1.00 92.23  ? 74   LEU C C   1 
ATOM   3962  O O   . LEU C  2 81  ? -3.666  -48.131  75.597  1.00 95.93  ? 74   LEU C O   1 
ATOM   3963  C CB  . LEU C  2 81  ? -1.187  -46.248  74.623  1.00 78.57  ? 74   LEU C CB  1 
ATOM   3964  N N   . GLY C  2 82  ? -1.733  -49.271  75.449  1.00 97.56  ? 75   GLY C N   1 
ATOM   3965  C CA  . GLY C  2 82  ? -2.371  -50.528  75.104  1.00 99.90  ? 75   GLY C CA  1 
ATOM   3966  C C   . GLY C  2 82  ? -1.945  -51.009  73.730  1.00 100.31 ? 75   GLY C C   1 
ATOM   3967  O O   . GLY C  2 82  ? -0.780  -50.884  73.358  1.00 102.16 ? 75   GLY C O   1 
ATOM   3968  N N   . ARG C  2 83  ? -2.887  -51.558  72.970  1.00 96.12  ? 76   ARG C N   1 
ATOM   3969  C CA  . ARG C  2 83  ? -2.587  -52.043  71.627  1.00 91.41  ? 76   ARG C CA  1 
ATOM   3970  C C   . ARG C  2 83  ? -2.844  -50.974  70.571  1.00 83.89  ? 76   ARG C C   1 
ATOM   3971  O O   . ARG C  2 83  ? -3.953  -50.452  70.458  1.00 83.61  ? 76   ARG C O   1 
ATOM   3972  C CB  . ARG C  2 83  ? -3.405  -53.295  71.313  1.00 94.51  ? 76   ARG C CB  1 
ATOM   3973  C CG  . ARG C  2 83  ? -2.800  -54.581  71.850  1.00 99.02  ? 76   ARG C CG  1 
ATOM   3974  C CD  . ARG C  2 83  ? -3.793  -55.726  71.764  1.00 102.45 ? 76   ARG C CD  1 
ATOM   3975  N NE  . ARG C  2 83  ? -4.900  -55.547  72.699  1.00 104.33 ? 76   ARG C NE  1 
ATOM   3976  C CZ  . ARG C  2 83  ? -5.275  -56.453  73.595  1.00 107.19 ? 76   ARG C CZ  1 
ATOM   3977  N NH1 . ARG C  2 83  ? -4.638  -57.614  73.673  1.00 109.71 ? 76   ARG C NH1 1 
ATOM   3978  N NH2 . ARG C  2 83  ? -6.292  -56.203  74.408  1.00 107.22 ? 76   ARG C NH2 1 
ATOM   3979  N N   . VAL C  2 84  ? -1.809  -50.655  69.800  1.00 75.61  ? 77   VAL C N   1 
ATOM   3980  C CA  . VAL C  2 84  ? -1.927  -49.685  68.719  1.00 68.18  ? 77   VAL C CA  1 
ATOM   3981  C C   . VAL C  2 84  ? -2.750  -50.253  67.568  1.00 63.92  ? 77   VAL C C   1 
ATOM   3982  O O   . VAL C  2 84  ? -2.443  -51.321  67.038  1.00 64.99  ? 77   VAL C O   1 
ATOM   3983  C CB  . VAL C  2 84  ? -0.542  -49.251  68.195  1.00 65.71  ? 77   VAL C CB  1 
ATOM   3984  C CG1 . VAL C  2 84  ? -0.661  -48.614  66.815  1.00 66.73  ? 77   VAL C CG1 1 
ATOM   3985  C CG2 . VAL C  2 84  ? 0.125   -48.299  69.180  1.00 63.22  ? 77   VAL C CG2 1 
ATOM   3986  N N   . ASN C  2 85  ? -3.803  -49.534  67.192  1.00 59.32  ? 78   ASN C N   1 
ATOM   3987  C CA  . ASN C  2 85  ? -4.661  -49.948  66.090  1.00 61.43  ? 78   ASN C CA  1 
ATOM   3988  C C   . ASN C  2 85  ? -4.555  -48.991  64.908  1.00 56.39  ? 78   ASN C C   1 
ATOM   3989  O O   . ASN C  2 85  ? -4.796  -49.373  63.763  1.00 53.32  ? 78   ASN C O   1 
ATOM   3990  C CB  . ASN C  2 85  ? -6.115  -50.047  66.554  1.00 68.55  ? 78   ASN C CB  1 
ATOM   3991  C CG  . ASN C  2 85  ? -6.286  -50.971  67.743  1.00 78.95  ? 78   ASN C CG  1 
ATOM   3992  O OD1 . ASN C  2 85  ? -6.825  -50.577  68.778  1.00 81.58  ? 78   ASN C OD1 1 
ATOM   3993  N ND2 . ASN C  2 85  ? -5.824  -52.207  67.603  1.00 84.96  ? 78   ASN C ND2 1 
ATOM   3994  N N   . PHE C  2 86  ? -4.194  -47.744  65.196  1.00 54.69  ? 79   PHE C N   1 
ATOM   3995  C CA  . PHE C  2 86  ? -4.047  -46.726  64.162  1.00 52.43  ? 79   PHE C CA  1 
ATOM   3996  C C   . PHE C  2 86  ? -2.682  -46.051  64.259  1.00 51.82  ? 79   PHE C C   1 
ATOM   3997  O O   . PHE C  2 86  ? -2.159  -45.844  65.354  1.00 54.05  ? 79   PHE C O   1 
ATOM   3998  C CB  . PHE C  2 86  ? -5.163  -45.685  64.270  1.00 51.06  ? 79   PHE C CB  1 
ATOM   3999  C CG  . PHE C  2 86  ? -6.537  -46.237  64.011  1.00 54.44  ? 79   PHE C CG  1 
ATOM   4000  C CD1 . PHE C  2 86  ? -7.258  -46.845  65.026  1.00 57.36  ? 79   PHE C CD1 1 
ATOM   4001  C CD2 . PHE C  2 86  ? -7.107  -46.149  62.751  1.00 55.49  ? 79   PHE C CD2 1 
ATOM   4002  C CE1 . PHE C  2 86  ? -8.521  -47.356  64.789  1.00 58.77  ? 79   PHE C CE1 1 
ATOM   4003  C CE2 . PHE C  2 86  ? -8.370  -46.657  62.509  1.00 56.58  ? 79   PHE C CE2 1 
ATOM   4004  C CZ  . PHE C  2 86  ? -9.078  -47.261  63.529  1.00 57.81  ? 79   PHE C CZ  1 
ATOM   4005  N N   . LEU C  2 87  ? -2.109  -45.712  63.109  1.00 50.86  ? 80   LEU C N   1 
ATOM   4006  C CA  . LEU C  2 87  ? -0.789  -45.093  63.069  1.00 46.72  ? 80   LEU C CA  1 
ATOM   4007  C C   . LEU C  2 87  ? -0.731  -43.949  62.063  1.00 43.91  ? 80   LEU C C   1 
ATOM   4008  O O   . LEU C  2 87  ? -1.131  -44.102  60.910  1.00 47.19  ? 80   LEU C O   1 
ATOM   4009  C CB  . LEU C  2 87  ? 0.279   -46.135  62.733  1.00 46.55  ? 80   LEU C CB  1 
ATOM   4010  C CG  . LEU C  2 87  ? 1.711   -45.608  62.633  1.00 45.42  ? 80   LEU C CG  1 
ATOM   4011  C CD1 . LEU C  2 87  ? 2.148   -45.009  63.959  1.00 50.22  ? 80   LEU C CD1 1 
ATOM   4012  C CD2 . LEU C  2 87  ? 2.665   -46.708  62.198  1.00 47.62  ? 80   LEU C CD2 1 
ATOM   4013  N N   . VAL C  2 88  ? -0.227  -42.802  62.508  1.00 42.61  ? 81   VAL C N   1 
ATOM   4014  C CA  . VAL C  2 88  ? -0.081  -41.641  61.638  1.00 39.16  ? 81   VAL C CA  1 
ATOM   4015  C C   . VAL C  2 88  ? 1.361   -41.143  61.624  1.00 43.43  ? 81   VAL C C   1 
ATOM   4016  O O   . VAL C  2 88  ? 1.879   -40.683  62.642  1.00 38.94  ? 81   VAL C O   1 
ATOM   4017  C CB  . VAL C  2 88  ? -1.007  -40.489  62.070  1.00 42.71  ? 81   VAL C CB  1 
ATOM   4018  C CG1 . VAL C  2 88  ? -0.768  -39.263  61.200  1.00 39.11  ? 81   VAL C CG1 1 
ATOM   4019  C CG2 . VAL C  2 88  ? -2.463  -40.923  62.002  1.00 46.16  ? 81   VAL C CG2 1 
ATOM   4020  N N   . ASN C  2 89  ? 2.006   -41.241  60.466  1.00 37.79  ? 82   ASN C N   1 
ATOM   4021  C CA  . ASN C  2 89  ? 3.371   -40.756  60.306  1.00 37.32  ? 82   ASN C CA  1 
ATOM   4022  C C   . ASN C  2 89  ? 3.403   -39.356  59.704  1.00 36.39  ? 82   ASN C C   1 
ATOM   4023  O O   . ASN C  2 89  ? 3.351   -39.194  58.486  1.00 40.86  ? 82   ASN C O   1 
ATOM   4024  C CB  . ASN C  2 89  ? 4.182   -41.717  59.437  1.00 43.61  ? 82   ASN C CB  1 
ATOM   4025  C CG  . ASN C  2 89  ? 4.416   -43.053  60.110  1.00 48.66  ? 82   ASN C CG  1 
ATOM   4026  O OD1 . ASN C  2 89  ? 5.296   -43.185  60.961  1.00 55.11  ? 82   ASN C OD1 1 
ATOM   4027  N ND2 . ASN C  2 89  ? 3.632   -44.054  59.729  1.00 45.29  ? 82   ASN C ND2 1 
ATOM   4028  N N   . ALA C  2 90  ? 3.491   -38.347  60.566  1.00 36.66  ? 83   ALA C N   1 
ATOM   4029  C CA  . ALA C  2 90  ? 3.494   -36.959  60.120  1.00 40.17  ? 83   ALA C CA  1 
ATOM   4030  C C   . ALA C  2 90  ? 4.786   -36.247  60.508  1.00 43.70  ? 83   ALA C C   1 
ATOM   4031  O O   . ALA C  2 90  ? 4.869   -35.020  60.453  1.00 49.41  ? 83   ALA C O   1 
ATOM   4032  C CB  . ALA C  2 90  ? 2.293   -36.220  60.691  1.00 39.86  ? 83   ALA C CB  1 
ATOM   4033  N N   . ALA C  2 91  ? 5.792   -37.022  60.900  1.00 45.71  ? 84   ALA C N   1 
ATOM   4034  C CA  . ALA C  2 91  ? 7.084   -36.462  61.279  1.00 46.47  ? 84   ALA C CA  1 
ATOM   4035  C C   . ALA C  2 91  ? 7.923   -36.154  60.044  1.00 50.67  ? 84   ALA C C   1 
ATOM   4036  O O   . ALA C  2 91  ? 8.202   -37.040  59.237  1.00 52.70  ? 84   ALA C O   1 
ATOM   4037  C CB  . ALA C  2 91  ? 7.826   -37.417  62.199  1.00 42.40  ? 84   ALA C CB  1 
ATOM   4038  N N   . GLY C  2 92  ? 8.325   -34.895  59.898  1.00 52.36  ? 85   GLY C N   1 
ATOM   4039  C CA  . GLY C  2 92  ? 9.111   -34.486  58.750  1.00 51.42  ? 85   GLY C CA  1 
ATOM   4040  C C   . GLY C  2 92  ? 9.832   -33.164  58.925  1.00 52.49  ? 85   GLY C C   1 
ATOM   4041  O O   . GLY C  2 92  ? 9.401   -32.301  59.691  1.00 53.34  ? 85   GLY C O   1 
ATOM   4042  N N   . ILE C  2 93  ? 10.941  -33.012  58.208  1.00 54.35  ? 86   ILE C N   1 
ATOM   4043  C CA  . ILE C  2 93  ? 11.708  -31.772  58.210  1.00 51.52  ? 86   ILE C CA  1 
ATOM   4044  C C   . ILE C  2 93  ? 11.930  -31.293  56.781  1.00 54.15  ? 86   ILE C C   1 
ATOM   4045  O O   . ILE C  2 93  ? 12.009  -32.100  55.854  1.00 51.51  ? 86   ILE C O   1 
ATOM   4046  C CB  . ILE C  2 93  ? 13.069  -31.942  58.911  1.00 45.05  ? 86   ILE C CB  1 
ATOM   4047  C CG1 . ILE C  2 93  ? 13.839  -33.116  58.302  1.00 43.40  ? 86   ILE C CG1 1 
ATOM   4048  C CG2 . ILE C  2 93  ? 12.877  -32.149  60.404  1.00 43.10  ? 86   ILE C CG2 1 
ATOM   4049  C CD1 . ILE C  2 93  ? 15.181  -33.368  58.952  1.00 45.10  ? 86   ILE C CD1 1 
ATOM   4050  N N   . ASN C  2 94  ? 12.027  -29.980  56.601  1.00 58.35  ? 87   ASN C N   1 
ATOM   4051  C CA  . ASN C  2 94  ? 12.198  -29.418  55.268  1.00 60.37  ? 87   ASN C CA  1 
ATOM   4052  C C   . ASN C  2 94  ? 13.004  -28.125  55.259  1.00 62.91  ? 87   ASN C C   1 
ATOM   4053  O O   . ASN C  2 94  ? 12.770  -27.224  56.066  1.00 64.23  ? 87   ASN C O   1 
ATOM   4054  C CB  . ASN C  2 94  ? 10.834  -29.172  54.619  1.00 59.09  ? 87   ASN C CB  1 
ATOM   4055  C CG  . ASN C  2 94  ? 10.949  -28.685  53.186  1.00 57.28  ? 87   ASN C CG  1 
ATOM   4056  O OD1 . ASN C  2 94  ? 11.945  -28.937  52.508  1.00 58.29  ? 87   ASN C OD1 1 
ATOM   4057  N ND2 . ASN C  2 94  ? 9.925   -27.981  52.717  1.00 54.64  ? 87   ASN C ND2 1 
ATOM   4058  N N   . ARG C  2 95  ? 13.954  -28.047  54.334  1.00 67.14  ? 88   ARG C N   1 
ATOM   4059  C CA  . ARG C  2 95  ? 14.725  -26.831  54.113  1.00 71.26  ? 88   ARG C CA  1 
ATOM   4060  C C   . ARG C  2 95  ? 14.938  -26.629  52.618  1.00 72.46  ? 88   ARG C C   1 
ATOM   4061  O O   . ARG C  2 95  ? 15.599  -27.437  51.965  1.00 75.14  ? 88   ARG C O   1 
ATOM   4062  C CB  . ARG C  2 95  ? 16.071  -26.896  54.835  1.00 76.47  ? 88   ARG C CB  1 
ATOM   4063  C CG  . ARG C  2 95  ? 16.798  -25.562  54.899  1.00 82.37  ? 88   ARG C CG  1 
ATOM   4064  C CD  . ARG C  2 95  ? 18.287  -25.755  55.131  1.00 86.43  ? 88   ARG C CD  1 
ATOM   4065  N NE  . ARG C  2 95  ? 18.859  -24.679  55.933  1.00 89.49  ? 88   ARG C NE  1 
ATOM   4066  C CZ  . ARG C  2 95  ? 19.060  -24.757  57.244  1.00 92.46  ? 88   ARG C CZ  1 
ATOM   4067  N NH1 . ARG C  2 95  ? 18.740  -25.865  57.899  1.00 91.74  ? 88   ARG C NH1 1 
ATOM   4068  N NH2 . ARG C  2 95  ? 19.585  -23.731  57.901  1.00 97.05  ? 88   ARG C NH2 1 
ATOM   4069  N N   . ASP C  2 96  ? 14.375  -25.555  52.078  1.00 68.76  ? 89   ASP C N   1 
ATOM   4070  C CA  . ASP C  2 96  ? 14.482  -25.285  50.650  1.00 62.62  ? 89   ASP C CA  1 
ATOM   4071  C C   . ASP C  2 96  ? 15.885  -24.822  50.276  1.00 58.26  ? 89   ASP C C   1 
ATOM   4072  O O   . ASP C  2 96  ? 16.566  -24.168  51.065  1.00 60.25  ? 89   ASP C O   1 
ATOM   4073  C CB  . ASP C  2 96  ? 13.450  -24.240  50.220  1.00 65.61  ? 89   ASP C CB  1 
ATOM   4074  C CG  . ASP C  2 96  ? 12.025  -24.705  50.444  1.00 67.81  ? 89   ASP C CG  1 
ATOM   4075  O OD1 . ASP C  2 96  ? 11.826  -25.913  50.693  1.00 67.33  ? 89   ASP C OD1 1 
ATOM   4076  O OD2 . ASP C  2 96  ? 11.104  -23.865  50.365  1.00 69.31  ? 89   ASP C OD2 1 
ATOM   4077  N N   . GLY C  2 97  ? 16.310  -25.172  49.067  1.00 51.94  ? 90   GLY C N   1 
ATOM   4078  C CA  . GLY C  2 97  ? 17.627  -24.809  48.581  1.00 43.69  ? 90   GLY C CA  1 
ATOM   4079  C C   . GLY C  2 97  ? 17.983  -25.575  47.324  1.00 49.22  ? 90   GLY C C   1 
ATOM   4080  O O   . GLY C  2 97  ? 17.492  -26.683  47.104  1.00 47.07  ? 90   GLY C O   1 
ATOM   4081  N N   . LEU C  2 98  ? 18.838  -24.982  46.496  1.00 50.62  ? 91   LEU C N   1 
ATOM   4082  C CA  . LEU C  2 98  ? 19.258  -25.609  45.249  1.00 47.35  ? 91   LEU C CA  1 
ATOM   4083  C C   . LEU C  2 98  ? 20.014  -26.904  45.521  1.00 42.37  ? 91   LEU C C   1 
ATOM   4084  O O   . LEU C  2 98  ? 20.815  -26.982  46.452  1.00 47.52  ? 91   LEU C O   1 
ATOM   4085  C CB  . LEU C  2 98  ? 20.126  -24.652  44.424  1.00 49.01  ? 91   LEU C CB  1 
ATOM   4086  C CG  . LEU C  2 98  ? 19.477  -23.366  43.899  1.00 49.27  ? 91   LEU C CG  1 
ATOM   4087  C CD1 . LEU C  2 98  ? 18.039  -23.626  43.469  1.00 44.64  ? 91   LEU C CD1 1 
ATOM   4088  C CD2 . LEU C  2 98  ? 19.535  -22.244  44.929  1.00 54.46  ? 91   LEU C CD2 1 
ATOM   4089  N N   . LEU C  2 99  ? 19.754  -27.915  44.697  1.00 41.00  ? 92   LEU C N   1 
ATOM   4090  C CA  . LEU C  2 99  ? 20.359  -29.234  44.857  1.00 42.63  ? 92   LEU C CA  1 
ATOM   4091  C C   . LEU C  2 99  ? 21.875  -29.166  44.698  1.00 50.95  ? 92   LEU C C   1 
ATOM   4092  O O   . LEU C  2 99  ? 22.604  -30.035  45.177  1.00 58.20  ? 92   LEU C O   1 
ATOM   4093  C CB  . LEU C  2 99  ? 19.754  -30.214  43.846  1.00 39.99  ? 92   LEU C CB  1 
ATOM   4094  C CG  . LEU C  2 99  ? 19.955  -31.719  44.053  1.00 42.72  ? 92   LEU C CG  1 
ATOM   4095  C CD1 . LEU C  2 99  ? 21.154  -32.239  43.276  1.00 39.38  ? 92   LEU C CD1 1 
ATOM   4096  C CD2 . LEU C  2 99  ? 20.063  -32.062  45.534  1.00 45.84  ? 92   LEU C CD2 1 
ATOM   4097  N N   . VAL C  2 100 ? 22.338  -28.119  44.027  1.00 51.83  ? 93   VAL C N   1 
ATOM   4098  C CA  . VAL C  2 100 ? 23.759  -27.894  43.815  1.00 53.11  ? 93   VAL C CA  1 
ATOM   4099  C C   . VAL C  2 100 ? 24.381  -27.239  45.049  1.00 53.80  ? 93   VAL C C   1 
ATOM   4100  O O   . VAL C  2 100 ? 25.593  -27.300  45.259  1.00 56.24  ? 93   VAL C O   1 
ATOM   4101  C CB  . VAL C  2 100 ? 23.995  -27.014  42.564  1.00 52.65  ? 93   VAL C CB  1 
ATOM   4102  C CG1 . VAL C  2 100 ? 23.528  -25.582  42.815  1.00 54.33  ? 93   VAL C CG1 1 
ATOM   4103  C CG2 . VAL C  2 100 ? 25.453  -27.048  42.139  1.00 47.61  ? 93   VAL C CG2 1 
ATOM   4104  N N   . ARG C  2 101 ? 23.534  -26.630  45.875  1.00 55.71  ? 94   ARG C N   1 
ATOM   4105  C CA  . ARG C  2 101 ? 23.999  -25.891  47.044  1.00 55.77  ? 94   ARG C CA  1 
ATOM   4106  C C   . ARG C  2 101 ? 23.560  -26.539  48.354  1.00 59.66  ? 94   ARG C C   1 
ATOM   4107  O O   . ARG C  2 101 ? 23.518  -25.880  49.391  1.00 63.83  ? 94   ARG C O   1 
ATOM   4108  C CB  . ARG C  2 101 ? 23.498  -24.445  46.991  1.00 56.18  ? 94   ARG C CB  1 
ATOM   4109  N N   . THR C  2 102 ? 23.234  -27.827  48.306  1.00 59.33  ? 95   THR C N   1 
ATOM   4110  C CA  . THR C  2 102 ? 22.825  -28.548  49.509  1.00 58.09  ? 95   THR C CA  1 
ATOM   4111  C C   . THR C  2 102 ? 23.892  -29.532  49.972  1.00 55.89  ? 95   THR C C   1 
ATOM   4112  O O   . THR C  2 102 ? 24.393  -30.337  49.187  1.00 52.99  ? 95   THR C O   1 
ATOM   4113  C CB  . THR C  2 102 ? 21.507  -29.315  49.294  1.00 55.71  ? 95   THR C CB  1 
ATOM   4114  O OG1 . THR C  2 102 ? 21.559  -30.024  48.051  1.00 58.57  ? 95   THR C OG1 1 
ATOM   4115  C CG2 . THR C  2 102 ? 20.326  -28.356  49.279  1.00 52.96  ? 95   THR C CG2 1 
ATOM   4116  N N   . LYS C  2 103 ? 24.231  -29.458  51.256  1.00 57.40  ? 96   LYS C N   1 
ATOM   4117  C CA  . LYS C  2 103 ? 25.199  -30.366  51.858  1.00 56.88  ? 96   LYS C CA  1 
ATOM   4118  C C   . LYS C  2 103 ? 24.661  -31.793  51.867  1.00 58.62  ? 96   LYS C C   1 
ATOM   4119  O O   . LYS C  2 103 ? 23.448  -32.006  51.896  1.00 58.36  ? 96   LYS C O   1 
ATOM   4120  C CB  . LYS C  2 103 ? 25.538  -29.916  53.278  1.00 58.56  ? 96   LYS C CB  1 
ATOM   4121  C CG  . LYS C  2 103 ? 25.923  -28.451  53.378  1.00 62.45  ? 96   LYS C CG  1 
ATOM   4122  C CD  . LYS C  2 103 ? 25.634  -27.900  54.763  1.00 66.53  ? 96   LYS C CD  1 
ATOM   4123  C CE  . LYS C  2 103 ? 25.773  -26.388  54.791  1.00 71.38  ? 96   LYS C CE  1 
ATOM   4124  N NZ  . LYS C  2 103 ? 25.278  -25.819  56.073  1.00 73.06  ? 96   LYS C NZ  1 
ATOM   4125  N N   . THR C  2 104 ? 25.566  -32.765  51.846  1.00 57.52  ? 97   THR C N   1 
ATOM   4126  C CA  . THR C  2 104 ? 25.184  -34.171  51.758  1.00 60.34  ? 97   THR C CA  1 
ATOM   4127  C C   . THR C  2 104 ? 24.409  -34.643  52.987  1.00 66.47  ? 97   THR C C   1 
ATOM   4128  O O   . THR C  2 104 ? 23.442  -35.396  52.868  1.00 65.94  ? 97   THR C O   1 
ATOM   4129  C CB  . THR C  2 104 ? 26.421  -35.073  51.572  1.00 58.41  ? 97   THR C CB  1 
ATOM   4130  O OG1 . THR C  2 104 ? 27.195  -34.607  50.459  1.00 61.35  ? 97   THR C OG1 1 
ATOM   4131  C CG2 . THR C  2 104 ? 26.003  -36.517  51.325  1.00 51.28  ? 97   THR C CG2 1 
ATOM   4132  N N   . GLU C  2 105 ? 24.826  -34.192  54.166  1.00 77.66  ? 98   GLU C N   1 
ATOM   4133  C CA  . GLU C  2 105 ? 24.240  -34.676  55.413  1.00 83.09  ? 98   GLU C CA  1 
ATOM   4134  C C   . GLU C  2 105 ? 22.902  -34.017  55.741  1.00 78.31  ? 98   GLU C C   1 
ATOM   4135  O O   . GLU C  2 105 ? 22.266  -34.356  56.739  1.00 81.12  ? 98   GLU C O   1 
ATOM   4136  C CB  . GLU C  2 105 ? 25.219  -34.475  56.571  1.00 92.65  ? 98   GLU C CB  1 
ATOM   4137  C CG  . GLU C  2 105 ? 26.455  -35.354  56.474  1.00 101.74 ? 98   GLU C CG  1 
ATOM   4138  C CD  . GLU C  2 105 ? 26.113  -36.818  56.256  1.00 105.61 ? 98   GLU C CD  1 
ATOM   4139  O OE1 . GLU C  2 105 ? 25.225  -37.338  56.966  1.00 105.73 ? 98   GLU C OE1 1 
ATOM   4140  O OE2 . GLU C  2 105 ? 26.727  -37.447  55.369  1.00 107.25 ? 98   GLU C OE2 1 
ATOM   4141  N N   . ASP C  2 106 ? 22.482  -33.075  54.904  1.00 70.36  ? 99   ASP C N   1 
ATOM   4142  C CA  . ASP C  2 106 ? 21.132  -32.532  54.991  1.00 68.71  ? 99   ASP C CA  1 
ATOM   4143  C C   . ASP C  2 106 ? 20.216  -33.358  54.100  1.00 66.21  ? 99   ASP C C   1 
ATOM   4144  O O   . ASP C  2 106 ? 19.022  -33.496  54.367  1.00 68.30  ? 99   ASP C O   1 
ATOM   4145  C CB  . ASP C  2 106 ? 21.103  -31.058  54.587  1.00 71.12  ? 99   ASP C CB  1 
ATOM   4146  C CG  . ASP C  2 106 ? 21.639  -30.148  55.673  1.00 76.70  ? 99   ASP C CG  1 
ATOM   4147  O OD1 . ASP C  2 106 ? 21.296  -30.365  56.855  1.00 81.50  ? 99   ASP C OD1 1 
ATOM   4148  O OD2 . ASP C  2 106 ? 22.406  -29.218  55.347  1.00 76.64  ? 99   ASP C OD2 1 
ATOM   4149  N N   . MET C  2 107 ? 20.796  -33.908  53.037  1.00 59.77  ? 100  MET C N   1 
ATOM   4150  C CA  . MET C  2 107 ? 20.096  -34.842  52.167  1.00 55.23  ? 100  MET C CA  1 
ATOM   4151  C C   . MET C  2 107 ? 19.861  -36.153  52.905  1.00 55.71  ? 100  MET C C   1 
ATOM   4152  O O   . MET C  2 107 ? 18.820  -36.788  52.750  1.00 59.79  ? 100  MET C O   1 
ATOM   4153  C CB  . MET C  2 107 ? 20.893  -35.087  50.884  1.00 54.66  ? 100  MET C CB  1 
ATOM   4154  C CG  . MET C  2 107 ? 21.060  -33.858  50.005  1.00 58.02  ? 100  MET C CG  1 
ATOM   4155  S SD  . MET C  2 107 ? 22.380  -34.048  48.791  1.00 75.11  ? 100  MET C SD  1 
ATOM   4156  C CE  . MET C  2 107 ? 22.008  -35.671  48.141  1.00 40.88  ? 100  MET C CE  1 
ATOM   4157  N N   . VAL C  2 108 ? 20.843  -36.549  53.709  1.00 53.16  ? 101  VAL C N   1 
ATOM   4158  C CA  . VAL C  2 108 ? 20.753  -37.769  54.503  1.00 51.18  ? 101  VAL C CA  1 
ATOM   4159  C C   . VAL C  2 108 ? 19.778  -37.592  55.664  1.00 50.60  ? 101  VAL C C   1 
ATOM   4160  O O   . VAL C  2 108 ? 18.998  -38.493  55.977  1.00 51.36  ? 101  VAL C O   1 
ATOM   4161  C CB  . VAL C  2 108 ? 22.137  -38.184  55.051  1.00 51.20  ? 101  VAL C CB  1 
ATOM   4162  C CG1 . VAL C  2 108 ? 22.015  -39.393  55.967  1.00 51.28  ? 101  VAL C CG1 1 
ATOM   4163  C CG2 . VAL C  2 108 ? 23.096  -38.473  53.908  1.00 51.53  ? 101  VAL C CG2 1 
ATOM   4164  N N   . SER C  2 109 ? 19.822  -36.420  56.291  1.00 51.26  ? 102  SER C N   1 
ATOM   4165  C CA  . SER C  2 109 ? 18.977  -36.122  57.443  1.00 56.22  ? 102  SER C CA  1 
ATOM   4166  C C   . SER C  2 109 ? 17.492  -36.201  57.105  1.00 59.30  ? 102  SER C C   1 
ATOM   4167  O O   . SER C  2 109 ? 16.723  -36.860  57.804  1.00 64.09  ? 102  SER C O   1 
ATOM   4168  C CB  . SER C  2 109 ? 19.308  -34.737  58.002  1.00 60.72  ? 102  SER C CB  1 
ATOM   4169  O OG  . SER C  2 109 ? 18.480  -34.423  59.108  1.00 62.61  ? 102  SER C OG  1 
ATOM   4170  N N   . GLN C  2 110 ? 17.094  -35.525  56.032  1.00 60.44  ? 103  GLN C N   1 
ATOM   4171  C CA  . GLN C  2 110 ? 15.700  -35.528  55.604  1.00 55.43  ? 103  GLN C CA  1 
ATOM   4172  C C   . GLN C  2 110 ? 15.272  -36.912  55.131  1.00 55.20  ? 103  GLN C C   1 
ATOM   4173  O O   . GLN C  2 110 ? 14.117  -37.304  55.290  1.00 58.41  ? 103  GLN C O   1 
ATOM   4174  C CB  . GLN C  2 110 ? 15.473  -34.506  54.487  1.00 54.32  ? 103  GLN C CB  1 
ATOM   4175  C CG  . GLN C  2 110 ? 15.788  -33.071  54.874  1.00 60.60  ? 103  GLN C CG  1 
ATOM   4176  C CD  . GLN C  2 110 ? 15.458  -32.087  53.767  1.00 65.51  ? 103  GLN C CD  1 
ATOM   4177  O OE1 . GLN C  2 110 ? 14.410  -32.184  53.127  1.00 63.40  ? 103  GLN C OE1 1 
ATOM   4178  N NE2 . GLN C  2 110 ? 16.356  -31.138  53.531  1.00 71.49  ? 103  GLN C NE2 1 
ATOM   4179  N N   . LEU C  2 111 ? 16.214  -37.649  54.552  1.00 54.22  ? 104  LEU C N   1 
ATOM   4180  C CA  . LEU C  2 111 ? 15.916  -38.954  53.976  1.00 51.91  ? 104  LEU C CA  1 
ATOM   4181  C C   . LEU C  2 111 ? 15.686  -40.008  55.055  1.00 48.55  ? 104  LEU C C   1 
ATOM   4182  O O   . LEU C  2 111 ? 14.991  -40.998  54.828  1.00 47.48  ? 104  LEU C O   1 
ATOM   4183  C CB  . LEU C  2 111 ? 17.046  -39.394  53.045  1.00 53.86  ? 104  LEU C CB  1 
ATOM   4184  C CG  . LEU C  2 111 ? 16.646  -40.375  51.945  1.00 56.65  ? 104  LEU C CG  1 
ATOM   4185  C CD1 . LEU C  2 111 ? 15.409  -39.865  51.229  1.00 56.98  ? 104  LEU C CD1 1 
ATOM   4186  C CD2 . LEU C  2 111 ? 17.789  -40.574  50.964  1.00 59.10  ? 104  LEU C CD2 1 
ATOM   4187  N N   . HIS C  2 112 ? 16.270  -39.789  56.227  1.00 48.86  ? 105  HIS C N   1 
ATOM   4188  C CA  . HIS C  2 112 ? 16.115  -40.722  57.337  1.00 50.62  ? 105  HIS C CA  1 
ATOM   4189  C C   . HIS C  2 112 ? 14.917  -40.361  58.207  1.00 52.73  ? 105  HIS C C   1 
ATOM   4190  O O   . HIS C  2 112 ? 14.358  -41.214  58.895  1.00 53.84  ? 105  HIS C O   1 
ATOM   4191  C CB  . HIS C  2 112 ? 17.387  -40.766  58.184  1.00 50.83  ? 105  HIS C CB  1 
ATOM   4192  C CG  . HIS C  2 112 ? 18.533  -41.457  57.514  1.00 48.74  ? 105  HIS C CG  1 
ATOM   4193  N ND1 . HIS C  2 112 ? 19.654  -41.875  58.199  1.00 52.27  ? 105  HIS C ND1 1 
ATOM   4194  C CD2 . HIS C  2 112 ? 18.730  -41.807  56.221  1.00 45.60  ? 105  HIS C CD2 1 
ATOM   4195  C CE1 . HIS C  2 112 ? 20.492  -42.452  57.356  1.00 51.67  ? 105  HIS C CE1 1 
ATOM   4196  N NE2 . HIS C  2 112 ? 19.956  -42.423  56.150  1.00 48.90  ? 105  HIS C NE2 1 
ATOM   4197  N N   . THR C  2 113 ? 14.524  -39.093  58.168  1.00 49.00  ? 106  THR C N   1 
ATOM   4198  C CA  . THR C  2 113 ? 13.401  -38.616  58.965  1.00 45.31  ? 106  THR C CA  1 
ATOM   4199  C C   . THR C  2 113 ? 12.078  -38.763  58.221  1.00 40.84  ? 106  THR C C   1 
ATOM   4200  O O   . THR C  2 113 ? 11.118  -39.329  58.744  1.00 39.21  ? 106  THR C O   1 
ATOM   4201  C CB  . THR C  2 113 ? 13.586  -37.140  59.367  1.00 42.05  ? 106  THR C CB  1 
ATOM   4202  O OG1 . THR C  2 113 ? 14.746  -37.009  60.197  1.00 42.87  ? 106  THR C OG1 1 
ATOM   4203  C CG2 . THR C  2 113 ? 12.367  -36.636  60.124  1.00 40.62  ? 106  THR C CG2 1 
ATOM   4204  N N   . ASN C  2 114 ? 12.039  -38.257  56.994  1.00 41.88  ? 107  ASN C N   1 
ATOM   4205  C CA  . ASN C  2 114 ? 10.801  -38.205  56.226  1.00 42.82  ? 107  ASN C CA  1 
ATOM   4206  C C   . ASN C  2 114 ? 10.445  -39.527  55.551  1.00 44.64  ? 107  ASN C C   1 
ATOM   4207  O O   . ASN C  2 114 ? 9.278   -39.783  55.256  1.00 46.32  ? 107  ASN C O   1 
ATOM   4208  C CB  . ASN C  2 114 ? 10.890  -37.099  55.173  1.00 43.88  ? 107  ASN C CB  1 
ATOM   4209  C CG  . ASN C  2 114 ? 11.235  -35.750  55.774  1.00 46.02  ? 107  ASN C CG  1 
ATOM   4210  O OD1 . ASN C  2 114 ? 11.610  -35.655  56.942  1.00 48.67  ? 107  ASN C OD1 1 
ATOM   4211  N ND2 . ASN C  2 114 ? 11.114  -34.698  54.974  1.00 49.15  ? 107  ASN C ND2 1 
ATOM   4212  N N   . LEU C  2 115 ? 11.448  -40.366  55.309  1.00 40.81  ? 108  LEU C N   1 
ATOM   4213  C CA  . LEU C  2 115 ? 11.223  -41.628  54.610  1.00 41.51  ? 108  LEU C CA  1 
ATOM   4214  C C   . LEU C  2 115 ? 11.533  -42.838  55.487  1.00 43.75  ? 108  LEU C C   1 
ATOM   4215  O O   . LEU C  2 115 ? 10.643  -43.629  55.798  1.00 43.07  ? 108  LEU C O   1 
ATOM   4216  C CB  . LEU C  2 115 ? 12.058  -41.683  53.330  1.00 36.94  ? 108  LEU C CB  1 
ATOM   4217  C CG  . LEU C  2 115 ? 11.901  -42.945  52.478  1.00 36.57  ? 108  LEU C CG  1 
ATOM   4218  C CD1 . LEU C  2 115 ? 10.436  -43.205  52.169  1.00 37.68  ? 108  LEU C CD1 1 
ATOM   4219  C CD2 . LEU C  2 115 ? 12.707  -42.828  51.193  1.00 36.48  ? 108  LEU C CD2 1 
ATOM   4220  N N   . LEU C  2 116 ? 12.798  -42.978  55.876  1.00 47.38  ? 109  LEU C N   1 
ATOM   4221  C CA  . LEU C  2 116 ? 13.233  -44.095  56.711  1.00 46.73  ? 109  LEU C CA  1 
ATOM   4222  C C   . LEU C  2 116 ? 12.482  -44.125  58.038  1.00 50.05  ? 109  LEU C C   1 
ATOM   4223  O O   . LEU C  2 116 ? 12.206  -45.195  58.582  1.00 53.38  ? 109  LEU C O   1 
ATOM   4224  C CB  . LEU C  2 116 ? 14.741  -44.016  56.963  1.00 43.18  ? 109  LEU C CB  1 
ATOM   4225  C CG  . LEU C  2 116 ? 15.343  -45.006  57.963  1.00 42.74  ? 109  LEU C CG  1 
ATOM   4226  C CD1 . LEU C  2 116 ? 15.196  -46.436  57.468  1.00 44.99  ? 109  LEU C CD1 1 
ATOM   4227  C CD2 . LEU C  2 116 ? 16.802  -44.676  58.237  1.00 46.66  ? 109  LEU C CD2 1 
ATOM   4228  N N   . GLY C  2 117 ? 12.150  -42.943  58.548  1.00 53.97  ? 110  GLY C N   1 
ATOM   4229  C CA  . GLY C  2 117 ? 11.413  -42.825  59.792  1.00 58.84  ? 110  GLY C CA  1 
ATOM   4230  C C   . GLY C  2 117 ? 10.042  -43.468  59.716  1.00 61.61  ? 110  GLY C C   1 
ATOM   4231  O O   . GLY C  2 117 ? 9.607   -44.135  60.654  1.00 65.70  ? 110  GLY C O   1 
ATOM   4232  N N   . SER C  2 118 ? 9.361   -43.271  58.593  1.00 55.06  ? 111  SER C N   1 
ATOM   4233  C CA  . SER C  2 118 ? 8.044   -43.861  58.388  1.00 56.83  ? 111  SER C CA  1 
ATOM   4234  C C   . SER C  2 118 ? 8.152   -45.363  58.149  1.00 55.70  ? 111  SER C C   1 
ATOM   4235  O O   . SER C  2 118 ? 7.242   -46.121  58.483  1.00 57.41  ? 111  SER C O   1 
ATOM   4236  C CB  . SER C  2 118 ? 7.331   -43.190  57.212  1.00 55.76  ? 111  SER C CB  1 
ATOM   4237  O OG  . SER C  2 118 ? 7.166   -41.802  57.440  1.00 57.33  ? 111  SER C OG  1 
ATOM   4238  N N   . MET C  2 119 ? 9.270   -45.786  57.571  1.00 55.29  ? 112  MET C N   1 
ATOM   4239  C CA  . MET C  2 119 ? 9.494   -47.196  57.275  1.00 55.75  ? 112  MET C CA  1 
ATOM   4240  C C   . MET C  2 119 ? 9.725   -48.007  58.546  1.00 58.58  ? 112  MET C C   1 
ATOM   4241  O O   . MET C  2 119 ? 9.376   -49.185  58.614  1.00 59.27  ? 112  MET C O   1 
ATOM   4242  C CB  . MET C  2 119 ? 10.683  -47.361  56.327  1.00 53.31  ? 112  MET C CB  1 
ATOM   4243  C CG  . MET C  2 119 ? 10.476  -46.744  54.955  1.00 50.80  ? 112  MET C CG  1 
ATOM   4244  S SD  . MET C  2 119 ? 11.955  -46.837  53.928  1.00 80.52  ? 112  MET C SD  1 
ATOM   4245  C CE  . MET C  2 119 ? 12.205  -48.609  53.853  1.00 50.96  ? 112  MET C CE  1 
ATOM   4246  N N   . LEU C  2 120 ? 10.316  -47.368  59.551  1.00 61.79  ? 113  LEU C N   1 
ATOM   4247  C CA  . LEU C  2 120 ? 10.614  -48.037  60.811  1.00 61.59  ? 113  LEU C CA  1 
ATOM   4248  C C   . LEU C  2 120 ? 9.395   -48.090  61.725  1.00 58.91  ? 113  LEU C C   1 
ATOM   4249  O O   . LEU C  2 120 ? 9.143   -49.106  62.374  1.00 60.78  ? 113  LEU C O   1 
ATOM   4250  C CB  . LEU C  2 120 ? 11.772  -47.338  61.525  1.00 66.35  ? 113  LEU C CB  1 
ATOM   4251  C CG  . LEU C  2 120 ? 13.150  -47.492  60.879  1.00 69.39  ? 113  LEU C CG  1 
ATOM   4252  C CD1 . LEU C  2 120 ? 14.182  -46.655  61.615  1.00 70.97  ? 113  LEU C CD1 1 
ATOM   4253  C CD2 . LEU C  2 120 ? 13.564  -48.956  60.850  1.00 71.44  ? 113  LEU C CD2 1 
ATOM   4254  N N   . THR C  2 121 ? 8.644   -46.994  61.775  1.00 54.07  ? 114  THR C N   1 
ATOM   4255  C CA  . THR C  2 121 ? 7.451   -46.934  62.610  1.00 51.50  ? 114  THR C CA  1 
ATOM   4256  C C   . THR C  2 121 ? 6.414   -47.951  62.143  1.00 48.21  ? 114  THR C C   1 
ATOM   4257  O O   . THR C  2 121 ? 5.796   -48.632  62.958  1.00 45.71  ? 114  THR C O   1 
ATOM   4258  C CB  . THR C  2 121 ? 6.828   -45.525  62.614  1.00 50.82  ? 114  THR C CB  1 
ATOM   4259  O OG1 . THR C  2 121 ? 6.564   -45.110  61.269  1.00 51.49  ? 114  THR C OG1 1 
ATOM   4260  C CG2 . THR C  2 121 ? 7.771   -44.528  63.272  1.00 50.89  ? 114  THR C CG2 1 
ATOM   4261  N N   . CYS C  2 122 ? 6.236   -48.059  60.830  1.00 43.29  ? 115  CYS C N   1 
ATOM   4262  C CA  . CYS C  2 122 ? 5.322   -49.046  60.263  1.00 46.37  ? 115  CYS C CA  1 
ATOM   4263  C C   . CYS C  2 122 ? 5.784   -50.462  60.588  1.00 47.05  ? 115  CYS C C   1 
ATOM   4264  O O   . CYS C  2 122 ? 4.986   -51.305  61.001  1.00 50.40  ? 115  CYS C O   1 
ATOM   4265  C CB  . CYS C  2 122 ? 5.203   -48.865  58.748  1.00 46.91  ? 115  CYS C CB  1 
ATOM   4266  S SG  . CYS C  2 122 ? 4.323   -47.370  58.239  1.00 77.12  ? 115  CYS C SG  1 
ATOM   4267  N N   . LYS C  2 123 ? 7.078   -50.709  60.406  1.00 50.05  ? 116  LYS C N   1 
ATOM   4268  C CA  . LYS C  2 123 ? 7.680   -52.004  60.702  1.00 52.56  ? 116  LYS C CA  1 
ATOM   4269  C C   . LYS C  2 123 ? 7.420   -52.440  62.141  1.00 54.44  ? 116  LYS C C   1 
ATOM   4270  O O   . LYS C  2 123 ? 7.030   -53.580  62.394  1.00 56.72  ? 116  LYS C O   1 
ATOM   4271  C CB  . LYS C  2 123 ? 9.186   -51.955  60.440  1.00 51.09  ? 116  LYS C CB  1 
ATOM   4272  C CG  . LYS C  2 123 ? 9.929   -53.203  60.870  1.00 53.09  ? 116  LYS C CG  1 
ATOM   4273  C CD  . LYS C  2 123 ? 11.428  -53.036  60.713  1.00 56.43  ? 116  LYS C CD  1 
ATOM   4274  C CE  . LYS C  2 123 ? 12.165  -54.248  61.253  1.00 59.50  ? 116  LYS C CE  1 
ATOM   4275  N NZ  . LYS C  2 123 ? 13.640  -54.071  61.192  1.00 60.20  ? 116  LYS C NZ  1 
ATOM   4276  N N   . ALA C  2 124 ? 7.636   -51.524  63.078  1.00 56.28  ? 117  ALA C N   1 
ATOM   4277  C CA  . ALA C  2 124 ? 7.447   -51.815  64.494  1.00 59.69  ? 117  ALA C CA  1 
ATOM   4278  C C   . ALA C  2 124 ? 5.970   -51.974  64.829  1.00 61.15  ? 117  ALA C C   1 
ATOM   4279  O O   . ALA C  2 124 ? 5.604   -52.722  65.736  1.00 64.69  ? 117  ALA C O   1 
ATOM   4280  C CB  . ALA C  2 124 ? 8.067   -50.720  65.345  1.00 59.81  ? 117  ALA C CB  1 
ATOM   4281  N N   . ALA C  2 125 ? 5.127   -51.265  64.086  1.00 61.15  ? 118  ALA C N   1 
ATOM   4282  C CA  . ALA C  2 125 ? 3.688   -51.297  64.311  1.00 63.60  ? 118  ALA C CA  1 
ATOM   4283  C C   . ALA C  2 125 ? 3.045   -52.505  63.648  1.00 69.28  ? 118  ALA C C   1 
ATOM   4284  O O   . ALA C  2 125 ? 1.839   -52.712  63.761  1.00 73.25  ? 118  ALA C O   1 
ATOM   4285  C CB  . ALA C  2 125 ? 3.044   -50.018  63.797  1.00 59.94  ? 118  ALA C CB  1 
ATOM   4286  N N   . MET C  2 126 ? 3.848   -53.304  62.957  1.00 71.24  ? 119  MET C N   1 
ATOM   4287  C CA  . MET C  2 126 ? 3.302   -54.383  62.146  1.00 69.59  ? 119  MET C CA  1 
ATOM   4288  C C   . MET C  2 126 ? 2.829   -55.559  62.990  1.00 70.86  ? 119  MET C C   1 
ATOM   4289  O O   . MET C  2 126 ? 1.632   -55.817  63.075  1.00 71.45  ? 119  MET C O   1 
ATOM   4290  C CB  . MET C  2 126 ? 4.333   -54.854  61.119  1.00 66.00  ? 119  MET C CB  1 
ATOM   4291  C CG  . MET C  2 126 ? 3.716   -55.431  59.857  1.00 64.57  ? 119  MET C CG  1 
ATOM   4292  S SD  . MET C  2 126 ? 2.425   -54.362  59.184  1.00 66.85  ? 119  MET C SD  1 
ATOM   4293  C CE  . MET C  2 126 ? 3.336   -52.853  58.868  1.00 71.88  ? 119  MET C CE  1 
ATOM   4294  N N   . ARG C  2 127 ? 3.763   -56.261  63.625  1.00 71.35  ? 120  ARG C N   1 
ATOM   4295  C CA  . ARG C  2 127 ? 3.428   -57.500  64.325  1.00 75.04  ? 120  ARG C CA  1 
ATOM   4296  C C   . ARG C  2 127 ? 2.554   -57.273  65.563  1.00 76.43  ? 120  ARG C C   1 
ATOM   4297  O O   . ARG C  2 127 ? 2.058   -58.228  66.161  1.00 80.32  ? 120  ARG C O   1 
ATOM   4298  C CB  . ARG C  2 127 ? 4.701   -58.257  64.714  1.00 77.40  ? 120  ARG C CB  1 
ATOM   4299  C CG  . ARG C  2 127 ? 4.492   -59.762  64.831  1.00 81.66  ? 120  ARG C CG  1 
ATOM   4300  C CD  . ARG C  2 127 ? 5.803   -60.534  64.869  1.00 88.26  ? 120  ARG C CD  1 
ATOM   4301  N NE  . ARG C  2 127 ? 5.598   -61.939  64.525  1.00 94.30  ? 120  ARG C NE  1 
ATOM   4302  C CZ  . ARG C  2 127 ? 6.565   -62.848  64.455  1.00 97.49  ? 120  ARG C CZ  1 
ATOM   4303  N NH1 . ARG C  2 127 ? 7.822   -62.508  64.710  1.00 99.42  ? 120  ARG C NH1 1 
ATOM   4304  N NH2 . ARG C  2 127 ? 6.275   -64.100  64.130  1.00 97.65  ? 120  ARG C NH2 1 
ATOM   4305  N N   . THR C  2 128 ? 2.366   -56.013  65.945  1.00 73.03  ? 121  THR C N   1 
ATOM   4306  C CA  . THR C  2 128 ? 1.420   -55.680  67.005  1.00 71.56  ? 121  THR C CA  1 
ATOM   4307  C C   . THR C  2 128 ? 0.048   -55.390  66.404  1.00 71.99  ? 121  THR C C   1 
ATOM   4308  O O   . THR C  2 128 ? -0.937  -55.239  67.124  1.00 74.10  ? 121  THR C O   1 
ATOM   4309  C CB  . THR C  2 128 ? 1.883   -54.469  67.838  1.00 70.73  ? 121  THR C CB  1 
ATOM   4310  O OG1 . THR C  2 128 ? 0.888   -54.154  68.820  1.00 70.76  ? 121  THR C OG1 1 
ATOM   4311  C CG2 . THR C  2 128 ? 2.098   -53.262  66.949  1.00 68.89  ? 121  THR C CG2 1 
ATOM   4312  N N   . MET C  2 129 ? -0.001  -55.309  65.077  1.00 67.91  ? 122  MET C N   1 
ATOM   4313  C CA  . MET C  2 129 ? -1.256  -55.124  64.354  1.00 63.97  ? 122  MET C CA  1 
ATOM   4314  C C   . MET C  2 129 ? -1.699  -56.424  63.689  1.00 65.56  ? 122  MET C C   1 
ATOM   4315  O O   . MET C  2 129 ? -2.882  -56.618  63.414  1.00 67.24  ? 122  MET C O   1 
ATOM   4316  C CB  . MET C  2 129 ? -1.120  -54.024  63.298  1.00 55.47  ? 122  MET C CB  1 
ATOM   4317  C CG  . MET C  2 129 ? -1.310  -52.607  63.814  1.00 54.35  ? 122  MET C CG  1 
ATOM   4318  S SD  . MET C  2 129 ? -1.086  -51.380  62.508  1.00 56.25  ? 122  MET C SD  1 
ATOM   4319  C CE  . MET C  2 129 ? -1.427  -49.865  63.399  1.00 43.52  ? 122  MET C CE  1 
ATOM   4320  N N   . ILE C  2 130 ? -0.740  -57.308  63.425  1.00 68.21  ? 123  ILE C N   1 
ATOM   4321  C CA  . ILE C  2 130 ? -1.033  -58.594  62.801  1.00 69.31  ? 123  ILE C CA  1 
ATOM   4322  C C   . ILE C  2 130 ? -1.661  -59.539  63.820  1.00 76.01  ? 123  ILE C C   1 
ATOM   4323  O O   . ILE C  2 130 ? -2.482  -60.389  63.473  1.00 80.49  ? 123  ILE C O   1 
ATOM   4324  C CB  . ILE C  2 130 ? 0.236   -59.241  62.204  1.00 65.05  ? 123  ILE C CB  1 
ATOM   4325  C CG1 . ILE C  2 130 ? 0.958   -58.254  61.287  1.00 60.25  ? 123  ILE C CG1 1 
ATOM   4326  C CG2 . ILE C  2 130 ? -0.110  -60.511  61.436  1.00 66.06  ? 123  ILE C CG2 1 
ATOM   4327  C CD1 . ILE C  2 130 ? 2.295   -58.752  60.793  1.00 61.98  ? 123  ILE C CD1 1 
ATOM   4328  N N   . GLN C  2 131 ? -1.274  -59.379  65.082  1.00 77.17  ? 124  GLN C N   1 
ATOM   4329  C CA  . GLN C  2 131 ? -1.859  -60.157  66.169  1.00 79.18  ? 124  GLN C CA  1 
ATOM   4330  C C   . GLN C  2 131 ? -3.351  -59.869  66.285  1.00 78.00  ? 124  GLN C C   1 
ATOM   4331  O O   . GLN C  2 131 ? -4.150  -60.767  66.550  1.00 78.85  ? 124  GLN C O   1 
ATOM   4332  C CB  . GLN C  2 131 ? -1.155  -59.851  67.492  1.00 83.46  ? 124  GLN C CB  1 
ATOM   4333  N N   . GLN C  2 132 ? -3.718  -58.609  66.080  1.00 73.77  ? 125  GLN C N   1 
ATOM   4334  C CA  . GLN C  2 132 ? -5.118  -58.207  66.080  1.00 74.01  ? 125  GLN C CA  1 
ATOM   4335  C C   . GLN C  2 132 ? -5.779  -58.589  64.763  1.00 74.80  ? 125  GLN C C   1 
ATOM   4336  O O   . GLN C  2 132 ? -7.006  -58.631  64.663  1.00 77.53  ? 125  GLN C O   1 
ATOM   4337  C CB  . GLN C  2 132 ? -5.248  -56.700  66.304  1.00 70.82  ? 125  GLN C CB  1 
ATOM   4338  C CG  . GLN C  2 132 ? -4.020  -56.054  66.918  1.00 71.49  ? 125  GLN C CG  1 
ATOM   4339  C CD  . GLN C  2 132 ? -3.964  -54.561  66.662  1.00 70.73  ? 125  GLN C CD  1 
ATOM   4340  O OE1 . GLN C  2 132 ? -4.856  -53.993  66.031  1.00 68.84  ? 125  GLN C OE1 1 
ATOM   4341  N NE2 . GLN C  2 132 ? -2.909  -53.916  67.147  1.00 71.80  ? 125  GLN C NE2 1 
ATOM   4342  N N   . GLN C  2 133 ? -4.946  -58.868  63.761  1.00 75.51  ? 126  GLN C N   1 
ATOM   4343  C CA  . GLN C  2 133 ? -5.397  -59.077  62.388  1.00 74.70  ? 126  GLN C CA  1 
ATOM   4344  C C   . GLN C  2 133 ? -6.198  -57.866  61.926  1.00 74.87  ? 126  GLN C C   1 
ATOM   4345  O O   . GLN C  2 133 ? -7.238  -58.001  61.283  1.00 75.65  ? 126  GLN C O   1 
ATOM   4346  C CB  . GLN C  2 133 ? -6.227  -60.358  62.265  1.00 78.48  ? 126  GLN C CB  1 
ATOM   4347  N N   . GLY C  2 134 ? -5.701  -56.682  62.272  1.00 72.77  ? 127  GLY C N   1 
ATOM   4348  C CA  . GLY C  2 134 ? -6.364  -55.437  61.935  1.00 70.52  ? 127  GLY C CA  1 
ATOM   4349  C C   . GLY C  2 134 ? -5.486  -54.236  62.228  1.00 65.64  ? 127  GLY C C   1 
ATOM   4350  O O   . GLY C  2 134 ? -4.688  -54.251  63.166  1.00 64.58  ? 127  GLY C O   1 
ATOM   4351  N N   . GLY C  2 135 ? -5.631  -53.192  61.419  1.00 63.39  ? 128  GLY C N   1 
ATOM   4352  C CA  . GLY C  2 135 ? -4.849  -51.982  61.589  1.00 54.66  ? 128  GLY C CA  1 
ATOM   4353  C C   . GLY C  2 135 ? -5.010  -51.028  60.423  1.00 46.33  ? 128  GLY C C   1 
ATOM   4354  O O   . GLY C  2 135 ? -5.400  -51.431  59.327  1.00 42.77  ? 128  GLY C O   1 
ATOM   4355  N N   . SER C  2 136 ? -4.711  -49.755  60.661  1.00 43.23  ? 129  SER C N   1 
ATOM   4356  C CA  . SER C  2 136 ? -4.821  -48.738  59.623  1.00 45.47  ? 129  SER C CA  1 
ATOM   4357  C C   . SER C  2 136 ? -3.684  -47.727  59.727  1.00 48.60  ? 129  SER C C   1 
ATOM   4358  O O   . SER C  2 136 ? -3.505  -47.084  60.761  1.00 51.81  ? 129  SER C O   1 
ATOM   4359  C CB  . SER C  2 136 ? -6.171  -48.026  59.712  1.00 43.31  ? 129  SER C CB  1 
ATOM   4360  O OG  . SER C  2 136 ? -6.332  -47.117  58.639  1.00 43.33  ? 129  SER C OG  1 
ATOM   4361  N N   . ILE C  2 137 ? -2.918  -47.592  58.649  1.00 48.72  ? 130  ILE C N   1 
ATOM   4362  C CA  . ILE C  2 137 ? -1.763  -46.703  58.636  1.00 47.02  ? 130  ILE C CA  1 
ATOM   4363  C C   . ILE C  2 137 ? -1.906  -45.608  57.584  1.00 39.46  ? 130  ILE C C   1 
ATOM   4364  O O   . ILE C  2 137 ? -2.284  -45.875  56.444  1.00 34.63  ? 130  ILE C O   1 
ATOM   4365  C CB  . ILE C  2 137 ? -0.458  -47.485  58.372  1.00 51.39  ? 130  ILE C CB  1 
ATOM   4366  C CG1 . ILE C  2 137 ? -0.339  -48.670  59.333  1.00 55.14  ? 130  ILE C CG1 1 
ATOM   4367  C CG2 . ILE C  2 137 ? 0.751   -46.570  58.492  1.00 51.34  ? 130  ILE C CG2 1 
ATOM   4368  C CD1 . ILE C  2 137 ? 0.920   -49.488  59.142  1.00 55.43  ? 130  ILE C CD1 1 
ATOM   4369  N N   . VAL C  2 138 ? -1.609  -44.373  57.977  1.00 37.96  ? 131  VAL C N   1 
ATOM   4370  C CA  . VAL C  2 138 ? -1.595  -43.253  57.043  1.00 39.83  ? 131  VAL C CA  1 
ATOM   4371  C C   . VAL C  2 138 ? -0.270  -42.503  57.126  1.00 40.42  ? 131  VAL C C   1 
ATOM   4372  O O   . VAL C  2 138 ? 0.097   -41.982  58.180  1.00 38.58  ? 131  VAL C O   1 
ATOM   4373  C CB  . VAL C  2 138 ? -2.759  -42.274  57.303  1.00 40.09  ? 131  VAL C CB  1 
ATOM   4374  C CG1 . VAL C  2 138 ? -2.505  -40.946  56.607  1.00 35.69  ? 131  VAL C CG1 1 
ATOM   4375  C CG2 . VAL C  2 138 ? -4.074  -42.879  56.836  1.00 40.08  ? 131  VAL C CG2 1 
ATOM   4376  N N   . ASN C  2 139 ? 0.449   -42.464  56.008  1.00 38.83  ? 132  ASN C N   1 
ATOM   4377  C CA  . ASN C  2 139 ? 1.727   -41.770  55.935  1.00 36.39  ? 132  ASN C CA  1 
ATOM   4378  C C   . ASN C  2 139 ? 1.583   -40.409  55.268  1.00 39.83  ? 132  ASN C C   1 
ATOM   4379  O O   . ASN C  2 139 ? 1.349   -40.321  54.064  1.00 50.03  ? 132  ASN C O   1 
ATOM   4380  C CB  . ASN C  2 139 ? 2.754   -42.616  55.180  1.00 32.82  ? 132  ASN C CB  1 
ATOM   4381  C CG  . ASN C  2 139 ? 3.035   -43.939  55.865  1.00 43.30  ? 132  ASN C CG  1 
ATOM   4382  O OD1 . ASN C  2 139 ? 3.120   -44.010  57.091  1.00 51.14  ? 132  ASN C OD1 1 
ATOM   4383  N ND2 . ASN C  2 139 ? 3.179   -44.996  55.074  1.00 42.36  ? 132  ASN C ND2 1 
ATOM   4384  N N   . VAL C  2 140 ? 1.722   -39.349  56.057  1.00 37.14  ? 133  VAL C N   1 
ATOM   4385  C CA  . VAL C  2 140 ? 1.586   -37.992  55.542  1.00 38.39  ? 133  VAL C CA  1 
ATOM   4386  C C   . VAL C  2 140 ? 2.782   -37.607  54.678  1.00 39.94  ? 133  VAL C C   1 
ATOM   4387  O O   . VAL C  2 140 ? 3.894   -37.434  55.179  1.00 42.36  ? 133  VAL C O   1 
ATOM   4388  C CB  . VAL C  2 140 ? 1.435   -36.967  56.681  1.00 39.74  ? 133  VAL C CB  1 
ATOM   4389  C CG1 . VAL C  2 140 ? 1.314   -35.561  56.114  1.00 38.14  ? 133  VAL C CG1 1 
ATOM   4390  C CG2 . VAL C  2 140 ? 0.227   -37.306  57.542  1.00 33.88  ? 133  VAL C CG2 1 
ATOM   4391  N N   . GLY C  2 141 ? 2.547   -37.478  53.376  1.00 37.79  ? 134  GLY C N   1 
ATOM   4392  C CA  . GLY C  2 141 ? 3.588   -37.079  52.449  1.00 38.35  ? 134  GLY C CA  1 
ATOM   4393  C C   . GLY C  2 141 ? 3.376   -35.665  51.945  1.00 38.88  ? 134  GLY C C   1 
ATOM   4394  O O   . GLY C  2 141 ? 3.166   -34.741  52.732  1.00 36.90  ? 134  GLY C O   1 
ATOM   4395  N N   . SER C  2 142 ? 3.433   -35.499  50.628  1.00 40.27  ? 135  SER C N   1 
ATOM   4396  C CA  . SER C  2 142 ? 3.203   -34.202  50.003  1.00 43.87  ? 135  SER C CA  1 
ATOM   4397  C C   . SER C  2 142 ? 2.951   -34.365  48.509  1.00 49.76  ? 135  SER C C   1 
ATOM   4398  O O   . SER C  2 142 ? 3.421   -35.323  47.894  1.00 52.32  ? 135  SER C O   1 
ATOM   4399  C CB  . SER C  2 142 ? 4.394   -33.269  50.236  1.00 44.28  ? 135  SER C CB  1 
ATOM   4400  O OG  . SER C  2 142 ? 4.121   -31.965  49.751  1.00 49.01  ? 135  SER C OG  1 
ATOM   4401  N N   . ILE C  2 143 ? 2.208   -33.427  47.929  1.00 59.59  ? 136  ILE C N   1 
ATOM   4402  C CA  . ILE C  2 143 ? 1.918   -33.458  46.501  1.00 63.00  ? 136  ILE C CA  1 
ATOM   4403  C C   . ILE C  2 143 ? 3.203   -33.236  45.704  1.00 56.42  ? 136  ILE C C   1 
ATOM   4404  O O   . ILE C  2 143 ? 3.320   -33.661  44.554  1.00 51.64  ? 136  ILE C O   1 
ATOM   4405  C CB  . ILE C  2 143 ? 0.857   -32.398  46.114  1.00 73.78  ? 136  ILE C CB  1 
ATOM   4406  C CG1 . ILE C  2 143 ? 0.377   -32.610  44.675  1.00 76.28  ? 136  ILE C CG1 1 
ATOM   4407  C CG2 . ILE C  2 143 ? 1.394   -30.985  46.316  1.00 73.12  ? 136  ILE C CG2 1 
ATOM   4408  C CD1 . ILE C  2 143 ? -0.281  -33.952  44.442  1.00 78.37  ? 136  ILE C CD1 1 
ATOM   4409  N N   . VAL C  2 144 ? 4.173   -32.583  46.336  1.00 51.66  ? 137  VAL C N   1 
ATOM   4410  C CA  . VAL C  2 144 ? 5.470   -32.344  45.721  1.00 44.98  ? 137  VAL C CA  1 
ATOM   4411  C C   . VAL C  2 144 ? 6.259   -33.655  45.664  1.00 39.09  ? 137  VAL C C   1 
ATOM   4412  O O   . VAL C  2 144 ? 7.137   -33.834  44.822  1.00 31.48  ? 137  VAL C O   1 
ATOM   4413  C CB  . VAL C  2 144 ? 6.257   -31.262  46.494  1.00 46.54  ? 137  VAL C CB  1 
ATOM   4414  C CG1 . VAL C  2 144 ? 7.575   -30.958  45.815  1.00 47.28  ? 137  VAL C CG1 1 
ATOM   4415  C CG2 . VAL C  2 144 ? 5.420   -29.994  46.617  1.00 49.44  ? 137  VAL C CG2 1 
ATOM   4416  N N   . GLY C  2 145 ? 5.916   -34.587  46.546  1.00 37.58  ? 138  GLY C N   1 
ATOM   4417  C CA  . GLY C  2 145 ? 6.563   -35.886  46.561  1.00 38.27  ? 138  GLY C CA  1 
ATOM   4418  C C   . GLY C  2 145 ? 6.373   -36.677  45.280  1.00 40.29  ? 138  GLY C C   1 
ATOM   4419  O O   . GLY C  2 145 ? 7.147   -37.585  44.983  1.00 41.71  ? 138  GLY C O   1 
ATOM   4420  N N   . LEU C  2 146 ? 5.348   -36.339  44.507  1.00 49.54  ? 139  LEU C N   1 
ATOM   4421  C CA  . LEU C  2 146 ? 5.040   -37.126  43.321  1.00 55.36  ? 139  LEU C CA  1 
ATOM   4422  C C   . LEU C  2 146 ? 5.034   -36.275  42.056  1.00 50.54  ? 139  LEU C C   1 
ATOM   4423  O O   . LEU C  2 146 ? 5.039   -36.802  40.945  1.00 47.72  ? 139  LEU C O   1 
ATOM   4424  C CB  . LEU C  2 146 ? 3.691   -37.847  43.491  1.00 60.02  ? 139  LEU C CB  1 
ATOM   4425  C CG  . LEU C  2 146 ? 2.395   -37.050  43.724  1.00 65.00  ? 139  LEU C CG  1 
ATOM   4426  C CD1 . LEU C  2 146 ? 1.339   -37.337  42.652  1.00 69.50  ? 139  LEU C CD1 1 
ATOM   4427  C CD2 . LEU C  2 146 ? 1.806   -37.287  45.115  1.00 64.97  ? 139  LEU C CD2 1 
ATOM   4428  N N   . LYS C  2 147 ? 5.050   -34.957  42.228  1.00 40.00  ? 140  LYS C N   1 
ATOM   4429  C CA  A LYS C  2 147 ? 5.013   -34.016  41.105  0.50 37.89  ? 140  LYS C CA  1 
ATOM   4430  C CA  B LYS C  2 147 ? 5.049   -34.057  41.084  0.50 38.18  ? 140  LYS C CA  1 
ATOM   4431  C C   . LYS C  2 147 ? 6.233   -33.098  41.117  1.00 37.90  ? 140  LYS C C   1 
ATOM   4432  O O   . LYS C  2 147 ? 6.536   -32.439  40.119  1.00 39.60  ? 140  LYS C O   1 
ATOM   4433  C CB  A LYS C  2 147 ? 3.741   -33.172  41.147  0.50 37.55  ? 140  LYS C CB  1 
ATOM   4434  C CB  B LYS C  2 147 ? 3.750   -33.262  41.024  0.50 37.88  ? 140  LYS C CB  1 
ATOM   4435  C CG  A LYS C  2 147 ? 2.719   -33.502  40.073  0.50 37.45  ? 140  LYS C CG  1 
ATOM   4436  C CG  B LYS C  2 147 ? 2.523   -34.126  40.807  0.50 37.20  ? 140  LYS C CG  1 
ATOM   4437  C CD  A LYS C  2 147 ? 2.523   -34.998  39.938  0.50 36.35  ? 140  LYS C CD  1 
ATOM   4438  C CD  B LYS C  2 147 ? 1.726   -33.606  39.627  0.50 37.22  ? 140  LYS C CD  1 
ATOM   4439  C CE  A LYS C  2 147 ? 1.288   -35.306  39.117  0.50 37.01  ? 140  LYS C CE  1 
ATOM   4440  C CE  B LYS C  2 147 ? 1.080   -32.267  39.940  0.50 36.15  ? 140  LYS C CE  1 
ATOM   4441  N NZ  A LYS C  2 147 ? 1.063   -36.771  39.018  0.50 33.93  ? 140  LYS C NZ  1 
ATOM   4442  N NZ  B LYS C  2 147 ? 0.223   -31.800  38.817  0.50 34.88  ? 140  LYS C NZ  1 
ATOM   4443  N N   . GLY C  2 148 ? 6.914   -33.035  42.258  1.00 37.59  ? 141  GLY C N   1 
ATOM   4444  C CA  . GLY C  2 148 ? 8.105   -32.211  42.396  1.00 31.54  ? 141  GLY C CA  1 
ATOM   4445  C C   . GLY C  2 148 ? 7.875   -30.711  42.410  1.00 39.53  ? 141  GLY C C   1 
ATOM   4446  O O   . GLY C  2 148 ? 6.817   -30.223  42.018  1.00 41.90  ? 141  GLY C O   1 
ATOM   4447  N N   . ASN C  2 149 ? 8.885   -29.980  42.873  1.00 39.77  ? 142  ASN C N   1 
ATOM   4448  C CA  . ASN C  2 149 ? 8.863   -28.522  42.878  1.00 40.66  ? 142  ASN C CA  1 
ATOM   4449  C C   . ASN C  2 149 ? 10.277  -27.972  43.024  1.00 42.15  ? 142  ASN C C   1 
ATOM   4450  O O   . ASN C  2 149 ? 11.087  -28.526  43.766  1.00 34.58  ? 142  ASN C O   1 
ATOM   4451  C CB  . ASN C  2 149 ? 7.973   -27.994  44.004  1.00 43.81  ? 142  ASN C CB  1 
ATOM   4452  C CG  . ASN C  2 149 ? 7.825   -26.489  43.972  1.00 47.21  ? 142  ASN C CG  1 
ATOM   4453  O OD1 . ASN C  2 149 ? 8.023   -25.857  42.935  1.00 49.74  ? 142  ASN C OD1 1 
ATOM   4454  N ND2 . ASN C  2 149 ? 7.473   -25.906  45.111  1.00 44.28  ? 142  ASN C ND2 1 
ATOM   4455  N N   . SER C  2 150 ? 10.569  -26.888  42.312  1.00 41.26  ? 143  SER C N   1 
ATOM   4456  C CA  . SER C  2 150 ? 11.898  -26.284  42.340  1.00 43.36  ? 143  SER C CA  1 
ATOM   4457  C C   . SER C  2 150 ? 12.287  -25.827  43.744  1.00 46.19  ? 143  SER C C   1 
ATOM   4458  O O   . SER C  2 150 ? 11.520  -25.144  44.422  1.00 50.18  ? 143  SER C O   1 
ATOM   4459  C CB  . SER C  2 150 ? 11.966  -25.102  41.370  1.00 50.03  ? 143  SER C CB  1 
ATOM   4460  O OG  . SER C  2 150 ? 13.268  -24.545  41.337  1.00 57.74  ? 143  SER C OG  1 
ATOM   4461  N N   . GLY C  2 151 ? 13.485  -26.213  44.172  1.00 43.06  ? 144  GLY C N   1 
ATOM   4462  C CA  . GLY C  2 151 ? 13.986  -25.839  45.482  1.00 43.76  ? 144  GLY C CA  1 
ATOM   4463  C C   . GLY C  2 151 ? 13.627  -26.835  46.568  1.00 37.45  ? 144  GLY C C   1 
ATOM   4464  O O   . GLY C  2 151 ? 13.958  -26.637  47.735  1.00 45.72  ? 144  GLY C O   1 
ATOM   4465  N N   . GLN C  2 152 ? 12.947  -27.911  46.184  1.00 38.87  ? 145  GLN C N   1 
ATOM   4466  C CA  . GLN C  2 152 ? 12.536  -28.934  47.140  1.00 41.40  ? 145  GLN C CA  1 
ATOM   4467  C C   . GLN C  2 152 ? 12.827  -30.339  46.624  1.00 38.46  ? 145  GLN C C   1 
ATOM   4468  O O   . GLN C  2 152 ? 12.049  -31.263  46.854  1.00 35.97  ? 145  GLN C O   1 
ATOM   4469  C CB  . GLN C  2 152 ? 11.045  -28.798  47.461  1.00 46.10  ? 145  GLN C CB  1 
ATOM   4470  C CG  . GLN C  2 152 ? 10.670  -27.499  48.155  1.00 49.26  ? 145  GLN C CG  1 
ATOM   4471  C CD  . GLN C  2 152 ? 9.181   -27.382  48.411  1.00 48.63  ? 145  GLN C CD  1 
ATOM   4472  O OE1 . GLN C  2 152 ? 8.379   -28.113  47.830  1.00 49.22  ? 145  GLN C OE1 1 
ATOM   4473  N NE2 . GLN C  2 152 ? 8.803   -26.460  49.289  1.00 49.37  ? 145  GLN C NE2 1 
ATOM   4474  N N   . SER C  2 153 ? 13.951  -30.493  45.930  1.00 37.68  ? 146  SER C N   1 
ATOM   4475  C CA  . SER C  2 153 ? 14.322  -31.774  45.339  1.00 39.11  ? 146  SER C CA  1 
ATOM   4476  C C   . SER C  2 153 ? 14.519  -32.851  46.400  1.00 39.79  ? 146  SER C C   1 
ATOM   4477  O O   . SER C  2 153 ? 14.012  -33.966  46.266  1.00 36.62  ? 146  SER C O   1 
ATOM   4478  C CB  . SER C  2 153 ? 15.596  -31.628  44.502  1.00 40.30  ? 146  SER C CB  1 
ATOM   4479  O OG  . SER C  2 153 ? 16.694  -31.234  45.305  1.00 42.64  ? 146  SER C OG  1 
ATOM   4480  N N   . VAL C  2 154 ? 15.256  -32.510  47.452  1.00 42.18  ? 147  VAL C N   1 
ATOM   4481  C CA  . VAL C  2 154 ? 15.529  -33.448  48.534  1.00 41.92  ? 147  VAL C CA  1 
ATOM   4482  C C   . VAL C  2 154 ? 14.243  -33.839  49.255  1.00 45.38  ? 147  VAL C C   1 
ATOM   4483  O O   . VAL C  2 154 ? 14.015  -35.015  49.545  1.00 47.38  ? 147  VAL C O   1 
ATOM   4484  C CB  . VAL C  2 154 ? 16.524  -32.858  49.550  1.00 43.76  ? 147  VAL C CB  1 
ATOM   4485  C CG1 . VAL C  2 154 ? 16.790  -33.851  50.672  1.00 45.07  ? 147  VAL C CG1 1 
ATOM   4486  C CG2 . VAL C  2 154 ? 17.819  -32.471  48.855  1.00 46.80  ? 147  VAL C CG2 1 
ATOM   4487  N N   . TYR C  2 155 ? 13.401  -32.849  49.532  1.00 41.58  ? 148  TYR C N   1 
ATOM   4488  C CA  . TYR C  2 155 ? 12.135  -33.090  50.211  1.00 40.29  ? 148  TYR C CA  1 
ATOM   4489  C C   . TYR C  2 155 ? 11.191  -33.907  49.333  1.00 41.36  ? 148  TYR C C   1 
ATOM   4490  O O   . TYR C  2 155 ? 10.385  -34.690  49.834  1.00 40.54  ? 148  TYR C O   1 
ATOM   4491  C CB  . TYR C  2 155 ? 11.480  -31.766  50.609  1.00 40.17  ? 148  TYR C CB  1 
ATOM   4492  C CG  . TYR C  2 155 ? 10.275  -31.923  51.508  1.00 43.70  ? 148  TYR C CG  1 
ATOM   4493  C CD1 . TYR C  2 155 ? 10.427  -32.210  52.859  1.00 44.39  ? 148  TYR C CD1 1 
ATOM   4494  C CD2 . TYR C  2 155 ? 8.987   -31.780  51.010  1.00 44.42  ? 148  TYR C CD2 1 
ATOM   4495  C CE1 . TYR C  2 155 ? 9.330   -32.353  53.687  1.00 44.73  ? 148  TYR C CE1 1 
ATOM   4496  C CE2 . TYR C  2 155 ? 7.883   -31.921  51.832  1.00 45.78  ? 148  TYR C CE2 1 
ATOM   4497  C CZ  . TYR C  2 155 ? 8.061   -32.208  53.169  1.00 48.68  ? 148  TYR C CZ  1 
ATOM   4498  O OH  . TYR C  2 155 ? 6.967   -32.349  53.992  1.00 53.18  ? 148  TYR C OH  1 
ATOM   4499  N N   . SER C  2 156 ? 11.300  -33.722  48.021  1.00 46.34  ? 149  SER C N   1 
ATOM   4500  C CA  . SER C  2 156 ? 10.486  -34.472  47.070  1.00 44.33  ? 149  SER C CA  1 
ATOM   4501  C C   . SER C  2 156 ? 10.931  -35.927  47.007  1.00 44.27  ? 149  SER C C   1 
ATOM   4502  O O   . SER C  2 156 ? 10.120  -36.828  46.796  1.00 41.27  ? 149  SER C O   1 
ATOM   4503  C CB  . SER C  2 156 ? 10.562  -33.843  45.679  1.00 44.00  ? 149  SER C CB  1 
ATOM   4504  O OG  . SER C  2 156 ? 10.348  -32.445  45.736  1.00 47.41  ? 149  SER C OG  1 
ATOM   4505  N N   . ALA C  2 157 ? 12.230  -36.147  47.185  1.00 45.47  ? 150  ALA C N   1 
ATOM   4506  C CA  . ALA C  2 157 ? 12.790  -37.491  47.166  1.00 49.91  ? 150  ALA C CA  1 
ATOM   4507  C C   . ALA C  2 157 ? 12.399  -38.263  48.420  1.00 50.92  ? 150  ALA C C   1 
ATOM   4508  O O   . ALA C  2 157 ? 12.042  -39.439  48.352  1.00 50.42  ? 150  ALA C O   1 
ATOM   4509  C CB  . ALA C  2 157 ? 14.302  -37.432  47.031  1.00 51.58  ? 150  ALA C CB  1 
ATOM   4510  N N   . SER C  2 158 ? 12.468  -37.590  49.564  1.00 53.94  ? 151  SER C N   1 
ATOM   4511  C CA  . SER C  2 158 ? 12.165  -38.217  50.845  1.00 53.55  ? 151  SER C CA  1 
ATOM   4512  C C   . SER C  2 158 ? 10.675  -38.508  50.992  1.00 54.11  ? 151  SER C C   1 
ATOM   4513  O O   . SER C  2 158 ? 10.287  -39.578  51.461  1.00 55.56  ? 151  SER C O   1 
ATOM   4514  C CB  . SER C  2 158 ? 12.643  -37.331  51.997  1.00 53.96  ? 151  SER C CB  1 
ATOM   4515  O OG  . SER C  2 158 ? 12.020  -36.058  51.957  1.00 56.63  ? 151  SER C OG  1 
ATOM   4516  N N   . LYS C  2 159 ? 9.843   -37.554  50.589  1.00 54.84  ? 152  LYS C N   1 
ATOM   4517  C CA  . LYS C  2 159 ? 8.397   -37.718  50.680  1.00 56.63  ? 152  LYS C CA  1 
ATOM   4518  C C   . LYS C  2 159 ? 7.847   -38.509  49.497  1.00 52.70  ? 152  LYS C C   1 
ATOM   4519  O O   . LYS C  2 159 ? 6.699   -38.952  49.516  1.00 53.15  ? 152  LYS C O   1 
ATOM   4520  C CB  . LYS C  2 159 ? 7.709   -36.355  50.765  1.00 58.62  ? 152  LYS C CB  1 
ATOM   4521  C CG  . LYS C  2 159 ? 7.933   -35.629  52.082  1.00 56.37  ? 152  LYS C CG  1 
ATOM   4522  C CD  . LYS C  2 159 ? 7.388   -36.438  53.248  1.00 52.26  ? 152  LYS C CD  1 
ATOM   4523  C CE  . LYS C  2 159 ? 7.533   -35.693  54.563  1.00 54.65  ? 152  LYS C CE  1 
ATOM   4524  N NZ  . LYS C  2 159 ? 7.037   -36.505  55.709  1.00 56.76  ? 152  LYS C NZ  1 
ATOM   4525  N N   . GLY C  2 160 ? 8.673   -38.685  48.471  1.00 49.81  ? 153  GLY C N   1 
ATOM   4526  C CA  . GLY C  2 160 ? 8.268   -39.418  47.286  1.00 51.17  ? 153  GLY C CA  1 
ATOM   4527  C C   . GLY C  2 160 ? 8.359   -40.920  47.463  1.00 49.20  ? 153  GLY C C   1 
ATOM   4528  O O   . GLY C  2 160 ? 7.597   -41.675  46.860  1.00 46.55  ? 153  GLY C O   1 
ATOM   4529  N N   . GLY C  2 161 ? 9.298   -41.355  48.296  1.00 46.18  ? 154  GLY C N   1 
ATOM   4530  C CA  . GLY C  2 161 ? 9.479   -42.768  48.566  1.00 44.15  ? 154  GLY C CA  1 
ATOM   4531  C C   . GLY C  2 161 ? 8.346   -43.349  49.388  1.00 47.40  ? 154  GLY C C   1 
ATOM   4532  O O   . GLY C  2 161 ? 8.147   -44.563  49.410  1.00 53.78  ? 154  GLY C O   1 
ATOM   4533  N N   . LEU C  2 162 ? 7.605   -42.477  50.066  1.00 44.42  ? 155  LEU C N   1 
ATOM   4534  C CA  . LEU C  2 162 ? 6.482   -42.897  50.898  1.00 42.71  ? 155  LEU C CA  1 
ATOM   4535  C C   . LEU C  2 162 ? 5.392   -43.563  50.068  1.00 46.18  ? 155  LEU C C   1 
ATOM   4536  O O   . LEU C  2 162 ? 4.732   -44.493  50.528  1.00 47.79  ? 155  LEU C O   1 
ATOM   4537  C CB  . LEU C  2 162 ? 5.900   -41.703  51.658  1.00 42.36  ? 155  LEU C CB  1 
ATOM   4538  C CG  . LEU C  2 162 ? 6.809   -41.019  52.680  1.00 46.90  ? 155  LEU C CG  1 
ATOM   4539  C CD1 . LEU C  2 162 ? 6.084   -39.855  53.337  1.00 48.82  ? 155  LEU C CD1 1 
ATOM   4540  C CD2 . LEU C  2 162 ? 7.288   -42.014  53.725  1.00 44.98  ? 155  LEU C CD2 1 
ATOM   4541  N N   . VAL C  2 163 ? 5.212   -43.079  48.843  1.00 45.54  ? 156  VAL C N   1 
ATOM   4542  C CA  . VAL C  2 163 ? 4.194   -43.612  47.946  1.00 41.81  ? 156  VAL C CA  1 
ATOM   4543  C C   . VAL C  2 163 ? 4.476   -45.066  47.580  1.00 43.38  ? 156  VAL C C   1 
ATOM   4544  O O   . VAL C  2 163 ? 3.643   -45.944  47.808  1.00 42.18  ? 156  VAL C O   1 
ATOM   4545  C CB  . VAL C  2 163 ? 4.094   -42.778  46.656  1.00 37.24  ? 156  VAL C CB  1 
ATOM   4546  C CG1 . VAL C  2 163 ? 3.081   -43.394  45.702  1.00 32.07  ? 156  VAL C CG1 1 
ATOM   4547  C CG2 . VAL C  2 163 ? 3.725   -41.338  46.983  1.00 37.40  ? 156  VAL C CG2 1 
ATOM   4548  N N   . GLY C  2 164 ? 5.654   -45.314  47.016  1.00 46.55  ? 157  GLY C N   1 
ATOM   4549  C CA  . GLY C  2 164 ? 6.044   -46.654  46.617  1.00 47.41  ? 157  GLY C CA  1 
ATOM   4550  C C   . GLY C  2 164 ? 6.129   -47.616  47.786  1.00 49.91  ? 157  GLY C C   1 
ATOM   4551  O O   . GLY C  2 164 ? 5.764   -48.785  47.665  1.00 51.47  ? 157  GLY C O   1 
ATOM   4552  N N   . PHE C  2 165 ? 6.606   -47.119  48.923  1.00 48.51  ? 158  PHE C N   1 
ATOM   4553  C CA  . PHE C  2 165 ? 6.755   -47.940  50.120  1.00 45.02  ? 158  PHE C CA  1 
ATOM   4554  C C   . PHE C  2 165 ? 5.412   -48.364  50.703  1.00 43.88  ? 158  PHE C C   1 
ATOM   4555  O O   . PHE C  2 165 ? 5.178   -49.550  50.939  1.00 44.96  ? 158  PHE C O   1 
ATOM   4556  C CB  . PHE C  2 165 ? 7.561   -47.192  51.183  1.00 44.92  ? 158  PHE C CB  1 
ATOM   4557  C CG  . PHE C  2 165 ? 7.569   -47.871  52.523  1.00 47.33  ? 158  PHE C CG  1 
ATOM   4558  C CD1 . PHE C  2 165 ? 8.339   -49.002  52.736  1.00 47.77  ? 158  PHE C CD1 1 
ATOM   4559  C CD2 . PHE C  2 165 ? 6.809   -47.376  53.570  1.00 48.27  ? 158  PHE C CD2 1 
ATOM   4560  C CE1 . PHE C  2 165 ? 8.347   -49.630  53.966  1.00 49.08  ? 158  PHE C CE1 1 
ATOM   4561  C CE2 . PHE C  2 165 ? 6.814   -47.999  54.802  1.00 50.56  ? 158  PHE C CE2 1 
ATOM   4562  C CZ  . PHE C  2 165 ? 7.584   -49.127  55.001  1.00 50.73  ? 158  PHE C CZ  1 
ATOM   4563  N N   . SER C  2 166 ? 4.541   -47.388  50.943  1.00 38.87  ? 159  SER C N   1 
ATOM   4564  C CA  . SER C  2 166 ? 3.237   -47.648  51.543  1.00 41.98  ? 159  SER C CA  1 
ATOM   4565  C C   . SER C  2 166 ? 2.421   -48.618  50.701  1.00 44.33  ? 159  SER C C   1 
ATOM   4566  O O   . SER C  2 166 ? 1.752   -49.502  51.233  1.00 44.91  ? 159  SER C O   1 
ATOM   4567  C CB  . SER C  2 166 ? 2.461   -46.345  51.729  1.00 40.06  ? 159  SER C CB  1 
ATOM   4568  O OG  . SER C  2 166 ? 3.193   -45.425  52.519  1.00 46.90  ? 159  SER C OG  1 
ATOM   4569  N N   . ARG C  2 167 ? 2.486   -48.447  49.386  1.00 46.62  ? 160  ARG C N   1 
ATOM   4570  C CA  . ARG C  2 167 ? 1.769   -49.317  48.464  1.00 46.13  ? 160  ARG C CA  1 
ATOM   4571  C C   . ARG C  2 167 ? 2.323   -50.736  48.496  1.00 46.90  ? 160  ARG C C   1 
ATOM   4572  O O   . ARG C  2 167 ? 1.565   -51.704  48.488  1.00 45.36  ? 160  ARG C O   1 
ATOM   4573  C CB  . ARG C  2 167 ? 1.829   -48.754  47.044  1.00 49.94  ? 160  ARG C CB  1 
ATOM   4574  C CG  . ARG C  2 167 ? 0.949   -47.533  46.839  1.00 54.54  ? 160  ARG C CG  1 
ATOM   4575  C CD  . ARG C  2 167 ? 1.015   -47.025  45.410  1.00 57.08  ? 160  ARG C CD  1 
ATOM   4576  N NE  . ARG C  2 167 ? 0.068   -45.938  45.183  1.00 58.65  ? 160  ARG C NE  1 
ATOM   4577  C CZ  . ARG C  2 167 ? -0.045  -45.270  44.040  1.00 61.21  ? 160  ARG C CZ  1 
ATOM   4578  N NH1 . ARG C  2 167 ? 0.735   -45.574  43.011  1.00 60.62  ? 160  ARG C NH1 1 
ATOM   4579  N NH2 . ARG C  2 167 ? -0.937  -44.295  43.925  1.00 63.94  ? 160  ARG C NH2 1 
ATOM   4580  N N   . ALA C  2 168 ? 3.646   -50.854  48.534  1.00 48.13  ? 161  ALA C N   1 
ATOM   4581  C CA  . ALA C  2 168 ? 4.294   -52.157  48.614  1.00 48.74  ? 161  ALA C CA  1 
ATOM   4582  C C   . ALA C  2 168 ? 3.985   -52.827  49.949  1.00 49.09  ? 161  ALA C C   1 
ATOM   4583  O O   . ALA C  2 168 ? 3.727   -54.030  50.009  1.00 48.74  ? 161  ALA C O   1 
ATOM   4584  C CB  . ALA C  2 168 ? 5.795   -52.018  48.424  1.00 47.32  ? 161  ALA C CB  1 
ATOM   4585  N N   . LEU C  2 169 ? 4.012   -52.034  51.016  1.00 48.90  ? 162  LEU C N   1 
ATOM   4586  C CA  . LEU C  2 169 ? 3.701   -52.528  52.351  1.00 50.73  ? 162  LEU C CA  1 
ATOM   4587  C C   . LEU C  2 169 ? 2.235   -52.930  52.464  1.00 47.83  ? 162  LEU C C   1 
ATOM   4588  O O   . LEU C  2 169 ? 1.906   -53.942  53.084  1.00 45.25  ? 162  LEU C O   1 
ATOM   4589  C CB  . LEU C  2 169 ? 4.034   -51.471  53.405  1.00 53.69  ? 162  LEU C CB  1 
ATOM   4590  C CG  . LEU C  2 169 ? 3.602   -51.802  54.834  1.00 55.91  ? 162  LEU C CG  1 
ATOM   4591  C CD1 . LEU C  2 169 ? 4.270   -53.083  55.315  1.00 56.84  ? 162  LEU C CD1 1 
ATOM   4592  C CD2 . LEU C  2 169 ? 3.909   -50.646  55.771  1.00 54.80  ? 162  LEU C CD2 1 
ATOM   4593  N N   . ALA C  2 170 ? 1.361   -52.131  51.860  1.00 42.17  ? 163  ALA C N   1 
ATOM   4594  C CA  . ALA C  2 170 ? -0.072  -52.397  51.898  1.00 42.91  ? 163  ALA C CA  1 
ATOM   4595  C C   . ALA C  2 170 ? -0.401  -53.719  51.218  1.00 44.74  ? 163  ALA C C   1 
ATOM   4596  O O   . ALA C  2 170 ? -1.369  -54.381  51.578  1.00 46.56  ? 163  ALA C O   1 
ATOM   4597  C CB  . ALA C  2 170 ? -0.844  -51.262  51.246  1.00 35.50  ? 163  ALA C CB  1 
ATOM   4598  N N   . LYS C  2 171 ? 0.412   -54.102  50.241  1.00 37.99  ? 164  LYS C N   1 
ATOM   4599  C CA  . LYS C  2 171 ? 0.193   -55.342  49.506  1.00 44.68  ? 164  LYS C CA  1 
ATOM   4600  C C   . LYS C  2 171 ? 0.649   -56.564  50.298  1.00 44.59  ? 164  LYS C C   1 
ATOM   4601  O O   . LYS C  2 171 ? 0.051   -57.635  50.198  1.00 46.70  ? 164  LYS C O   1 
ATOM   4602  C CB  . LYS C  2 171 ? 0.911   -55.288  48.156  1.00 45.07  ? 164  LYS C CB  1 
ATOM   4603  C CG  . LYS C  2 171 ? 0.314   -54.275  47.196  1.00 45.48  ? 164  LYS C CG  1 
ATOM   4604  C CD  . LYS C  2 171 ? 1.235   -53.993  46.023  1.00 46.78  ? 164  LYS C CD  1 
ATOM   4605  C CE  . LYS C  2 171 ? 0.616   -54.449  44.713  1.00 53.33  ? 164  LYS C CE  1 
ATOM   4606  N NZ  . LYS C  2 171 ? 1.294   -53.823  43.542  1.00 56.88  ? 164  LYS C NZ  1 
ATOM   4607  N N   . GLU C  2 172 ? 1.707   -56.399  51.085  1.00 46.79  ? 165  GLU C N   1 
ATOM   4608  C CA  . GLU C  2 172 ? 2.229   -57.490  51.902  1.00 53.85  ? 165  GLU C CA  1 
ATOM   4609  C C   . GLU C  2 172 ? 1.266   -57.873  53.018  1.00 55.56  ? 165  GLU C C   1 
ATOM   4610  O O   . GLU C  2 172 ? 1.253   -59.016  53.475  1.00 58.23  ? 165  GLU C O   1 
ATOM   4611  C CB  . GLU C  2 172 ? 3.579   -57.112  52.516  1.00 61.30  ? 165  GLU C CB  1 
ATOM   4612  C CG  . GLU C  2 172 ? 4.711   -56.927  51.525  1.00 67.10  ? 165  GLU C CG  1 
ATOM   4613  C CD  . GLU C  2 172 ? 6.053   -56.759  52.212  1.00 72.16  ? 165  GLU C CD  1 
ATOM   4614  O OE1 . GLU C  2 172 ? 6.150   -57.085  53.415  1.00 73.67  ? 165  GLU C OE1 1 
ATOM   4615  O OE2 . GLU C  2 172 ? 7.010   -56.300  51.555  1.00 74.07  ? 165  GLU C OE2 1 
ATOM   4616  N N   . VAL C  2 173 ? 0.458   -56.913  53.452  1.00 54.67  ? 166  VAL C N   1 
ATOM   4617  C CA  . VAL C  2 173 ? -0.294  -57.065  54.690  1.00 53.07  ? 166  VAL C CA  1 
ATOM   4618  C C   . VAL C  2 173 ? -1.800  -56.843  54.500  1.00 49.62  ? 166  VAL C C   1 
ATOM   4619  O O   . VAL C  2 173 ? -2.567  -56.840  55.465  1.00 43.57  ? 166  VAL C O   1 
ATOM   4620  C CB  . VAL C  2 173 ? 0.258   -56.096  55.763  1.00 52.53  ? 166  VAL C CB  1 
ATOM   4621  C CG1 . VAL C  2 173 ? -0.288  -54.685  55.554  1.00 49.40  ? 166  VAL C CG1 1 
ATOM   4622  C CG2 . VAL C  2 173 ? -0.033  -56.611  57.165  1.00 58.68  ? 166  VAL C CG2 1 
ATOM   4623  N N   . ALA C  2 174 ? -2.223  -56.681  53.250  1.00 48.23  ? 167  ALA C N   1 
ATOM   4624  C CA  . ALA C  2 174 ? -3.638  -56.477  52.950  1.00 51.91  ? 167  ALA C CA  1 
ATOM   4625  C C   . ALA C  2 174 ? -4.483  -57.678  53.365  1.00 60.28  ? 167  ALA C C   1 
ATOM   4626  O O   . ALA C  2 174 ? -5.647  -57.528  53.736  1.00 59.51  ? 167  ALA C O   1 
ATOM   4627  C CB  . ALA C  2 174 ? -3.832  -56.192  51.474  1.00 44.85  ? 167  ALA C CB  1 
ATOM   4628  N N   . ARG C  2 175 ? -3.894  -58.867  53.303  1.00 64.40  ? 168  ARG C N   1 
ATOM   4629  C CA  . ARG C  2 175 ? -4.613  -60.088  53.648  1.00 65.46  ? 168  ARG C CA  1 
ATOM   4630  C C   . ARG C  2 175 ? -4.713  -60.282  55.159  1.00 70.40  ? 168  ARG C C   1 
ATOM   4631  O O   . ARG C  2 175 ? -5.446  -61.151  55.632  1.00 74.53  ? 168  ARG C O   1 
ATOM   4632  C CB  . ARG C  2 175 ? -3.944  -61.301  52.999  1.00 65.80  ? 168  ARG C CB  1 
ATOM   4633  C CG  . ARG C  2 175 ? -4.144  -61.369  51.492  1.00 64.14  ? 168  ARG C CG  1 
ATOM   4634  C CD  . ARG C  2 175 ? -5.624  -61.439  51.140  1.00 60.08  ? 168  ARG C CD  1 
ATOM   4635  N NE  . ARG C  2 175 ? -5.863  -61.243  49.712  1.00 56.46  ? 168  ARG C NE  1 
ATOM   4636  C CZ  . ARG C  2 175 ? -5.911  -62.226  48.819  1.00 59.58  ? 168  ARG C CZ  1 
ATOM   4637  N NH1 . ARG C  2 175 ? -5.736  -63.483  49.204  1.00 61.92  ? 168  ARG C NH1 1 
ATOM   4638  N NH2 . ARG C  2 175 ? -6.134  -61.953  47.541  1.00 60.48  ? 168  ARG C NH2 1 
ATOM   4639  N N   . LYS C  2 176 ? -3.978  -59.470  55.913  1.00 68.94  ? 169  LYS C N   1 
ATOM   4640  C CA  . LYS C  2 176 ? -4.081  -59.488  57.367  1.00 67.60  ? 169  LYS C CA  1 
ATOM   4641  C C   . LYS C  2 176 ? -4.916  -58.309  57.857  1.00 65.16  ? 169  LYS C C   1 
ATOM   4642  O O   . LYS C  2 176 ? -4.780  -57.869  59.000  1.00 65.06  ? 169  LYS C O   1 
ATOM   4643  C CB  . LYS C  2 176 ? -2.694  -59.474  58.010  1.00 67.81  ? 169  LYS C CB  1 
ATOM   4644  C CG  . LYS C  2 176 ? -1.943  -60.783  57.841  1.00 70.92  ? 169  LYS C CG  1 
ATOM   4645  C CD  . LYS C  2 176 ? -2.785  -61.946  58.338  1.00 75.82  ? 169  LYS C CD  1 
ATOM   4646  C CE  . LYS C  2 176 ? -2.106  -63.284  58.113  1.00 79.97  ? 169  LYS C CE  1 
ATOM   4647  N NZ  . LYS C  2 176 ? -3.022  -64.406  58.461  1.00 84.15  ? 169  LYS C NZ  1 
ATOM   4648  N N   . LYS C  2 177 ? -5.779  -57.814  56.972  1.00 65.01  ? 170  LYS C N   1 
ATOM   4649  C CA  . LYS C  2 177 ? -6.713  -56.732  57.277  1.00 64.62  ? 170  LYS C CA  1 
ATOM   4650  C C   . LYS C  2 177 ? -6.017  -55.489  57.825  1.00 60.16  ? 170  LYS C C   1 
ATOM   4651  O O   . LYS C  2 177 ? -6.495  -54.867  58.773  1.00 58.25  ? 170  LYS C O   1 
ATOM   4652  C CB  . LYS C  2 177 ? -7.778  -57.211  58.266  1.00 64.14  ? 170  LYS C CB  1 
ATOM   4653  N N   . ILE C  2 178 ? -4.889  -55.132  57.221  1.00 59.68  ? 171  ILE C N   1 
ATOM   4654  C CA  . ILE C  2 178 ? -4.162  -53.932  57.615  1.00 58.50  ? 171  ILE C CA  1 
ATOM   4655  C C   . ILE C  2 178 ? -3.986  -53.001  56.420  1.00 52.58  ? 171  ILE C C   1 
ATOM   4656  O O   . ILE C  2 178 ? -3.351  -53.360  55.427  1.00 50.31  ? 171  ILE C O   1 
ATOM   4657  C CB  . ILE C  2 178 ? -2.789  -54.274  58.215  1.00 60.65  ? 171  ILE C CB  1 
ATOM   4658  C CG1 . ILE C  2 178 ? -2.965  -55.115  59.481  1.00 66.13  ? 171  ILE C CG1 1 
ATOM   4659  C CG2 . ILE C  2 178 ? -2.008  -53.005  58.517  1.00 57.32  ? 171  ILE C CG2 1 
ATOM   4660  C CD1 . ILE C  2 178 ? -1.668  -55.528  60.131  1.00 68.48  ? 171  ILE C CD1 1 
ATOM   4661  N N   . ARG C  2 179 ? -4.558  -51.806  56.523  1.00 47.05  ? 172  ARG C N   1 
ATOM   4662  C CA  . ARG C  2 179 ? -4.549  -50.849  55.423  1.00 45.38  ? 172  ARG C CA  1 
ATOM   4663  C C   . ARG C  2 179 ? -3.477  -49.780  55.608  1.00 40.58  ? 172  ARG C C   1 
ATOM   4664  O O   . ARG C  2 179 ? -3.340  -49.204  56.686  1.00 38.82  ? 172  ARG C O   1 
ATOM   4665  C CB  . ARG C  2 179 ? -5.926  -50.193  55.284  1.00 46.02  ? 172  ARG C CB  1 
ATOM   4666  C CG  . ARG C  2 179 ? -7.059  -51.183  55.053  1.00 45.54  ? 172  ARG C CG  1 
ATOM   4667  C CD  . ARG C  2 179 ? -8.420  -50.500  55.029  1.00 45.79  ? 172  ARG C CD  1 
ATOM   4668  N NE  . ARG C  2 179 ? -8.783  -49.940  56.328  1.00 49.84  ? 172  ARG C NE  1 
ATOM   4669  C CZ  . ARG C  2 179 ? -8.715  -48.647  56.632  1.00 49.31  ? 172  ARG C CZ  1 
ATOM   4670  N NH1 . ARG C  2 179 ? -8.302  -47.772  55.725  1.00 39.89  ? 172  ARG C NH1 1 
ATOM   4671  N NH2 . ARG C  2 179 ? -9.067  -48.228  57.840  1.00 53.55  ? 172  ARG C NH2 1 
ATOM   4672  N N   . VAL C  2 180 ? -2.717  -49.523  54.548  1.00 41.69  ? 173  VAL C N   1 
ATOM   4673  C CA  . VAL C  2 180 ? -1.689  -48.489  54.570  1.00 41.95  ? 173  VAL C CA  1 
ATOM   4674  C C   . VAL C  2 180 ? -1.923  -47.481  53.448  1.00 41.09  ? 173  VAL C C   1 
ATOM   4675  O O   . VAL C  2 180 ? -1.858  -47.829  52.270  1.00 37.72  ? 173  VAL C O   1 
ATOM   4676  C CB  . VAL C  2 180 ? -0.274  -49.086  54.431  1.00 39.77  ? 173  VAL C CB  1 
ATOM   4677  C CG1 . VAL C  2 180 ? 0.775   -47.993  54.549  1.00 38.27  ? 173  VAL C CG1 1 
ATOM   4678  C CG2 . VAL C  2 180 ? -0.041  -50.165  55.479  1.00 39.32  ? 173  VAL C CG2 1 
ATOM   4679  N N   . ASN C  2 181 ? -2.198  -46.233  53.817  1.00 40.35  ? 174  ASN C N   1 
ATOM   4680  C CA  . ASN C  2 181 ? -2.466  -45.190  52.831  1.00 40.50  ? 174  ASN C CA  1 
ATOM   4681  C C   . ASN C  2 181 ? -1.552  -43.978  52.981  1.00 40.88  ? 174  ASN C C   1 
ATOM   4682  O O   . ASN C  2 181 ? -0.742  -43.906  53.905  1.00 48.48  ? 174  ASN C O   1 
ATOM   4683  C CB  . ASN C  2 181 ? -3.927  -44.744  52.916  1.00 44.58  ? 174  ASN C CB  1 
ATOM   4684  C CG  . ASN C  2 181 ? -4.890  -45.808  52.427  1.00 48.81  ? 174  ASN C CG  1 
ATOM   4685  O OD1 . ASN C  2 181 ? -5.152  -45.920  51.229  1.00 51.95  ? 174  ASN C OD1 1 
ATOM   4686  N ND2 . ASN C  2 181 ? -5.425  -46.594  53.354  1.00 51.36  ? 174  ASN C ND2 1 
ATOM   4687  N N   . VAL C  2 182 ? -1.689  -43.029  52.060  1.00 37.63  ? 175  VAL C N   1 
ATOM   4688  C CA  . VAL C  2 182 ? -0.854  -41.833  52.046  1.00 34.38  ? 175  VAL C CA  1 
ATOM   4689  C C   . VAL C  2 182 ? -1.681  -40.574  51.803  1.00 39.49  ? 175  VAL C C   1 
ATOM   4690  O O   . VAL C  2 182 ? -2.492  -40.524  50.879  1.00 43.55  ? 175  VAL C O   1 
ATOM   4691  C CB  . VAL C  2 182 ? 0.245   -41.926  50.962  1.00 30.57  ? 175  VAL C CB  1 
ATOM   4692  C CG1 . VAL C  2 182 ? 0.925   -40.578  50.761  1.00 32.92  ? 175  VAL C CG1 1 
ATOM   4693  C CG2 . VAL C  2 182 ? 1.265   -42.989  51.322  1.00 31.53  ? 175  VAL C CG2 1 
ATOM   4694  N N   . VAL C  2 183 ? -1.479  -39.563  52.640  1.00 37.12  ? 176  VAL C N   1 
ATOM   4695  C CA  . VAL C  2 183 ? -2.083  -38.257  52.413  1.00 38.94  ? 176  VAL C CA  1 
ATOM   4696  C C   . VAL C  2 183 ? -1.034  -37.296  51.866  1.00 35.66  ? 176  VAL C C   1 
ATOM   4697  O O   . VAL C  2 183 ? 0.036   -37.135  52.452  1.00 35.56  ? 176  VAL C O   1 
ATOM   4698  C CB  . VAL C  2 183 ? -2.698  -37.676  53.700  1.00 48.07  ? 176  VAL C CB  1 
ATOM   4699  C CG1 . VAL C  2 183 ? -3.177  -36.250  53.465  1.00 50.81  ? 176  VAL C CG1 1 
ATOM   4700  C CG2 . VAL C  2 183 ? -3.842  -38.551  54.180  1.00 50.54  ? 176  VAL C CG2 1 
ATOM   4701  N N   . ALA C  2 184 ? -1.341  -36.668  50.736  1.00 36.59  ? 177  ALA C N   1 
ATOM   4702  C CA  . ALA C  2 184 ? -0.413  -35.742  50.099  1.00 38.73  ? 177  ALA C CA  1 
ATOM   4703  C C   . ALA C  2 184 ? -0.971  -34.324  50.081  1.00 40.28  ? 177  ALA C C   1 
ATOM   4704  O O   . ALA C  2 184 ? -1.669  -33.938  49.143  1.00 45.69  ? 177  ALA C O   1 
ATOM   4705  C CB  . ALA C  2 184 ? -0.095  -36.204  48.686  1.00 42.31  ? 177  ALA C CB  1 
ATOM   4706  N N   . PRO C  2 185 ? -0.666  -33.542  51.126  1.00 37.91  ? 178  PRO C N   1 
ATOM   4707  C CA  . PRO C  2 185 ? -1.116  -32.151  51.232  1.00 41.59  ? 178  PRO C CA  1 
ATOM   4708  C C   . PRO C  2 185 ? -0.451  -31.254  50.195  1.00 41.79  ? 178  PRO C C   1 
ATOM   4709  O O   . PRO C  2 185 ? 0.653   -31.554  49.740  1.00 38.88  ? 178  PRO C O   1 
ATOM   4710  C CB  . PRO C  2 185 ? -0.690  -31.745  52.649  1.00 43.22  ? 178  PRO C CB  1 
ATOM   4711  C CG  . PRO C  2 185 ? -0.425  -33.033  53.364  1.00 44.47  ? 178  PRO C CG  1 
ATOM   4712  C CD  . PRO C  2 185 ? 0.078   -33.967  52.321  1.00 31.10  ? 178  PRO C CD  1 
ATOM   4713  N N   . GLY C  2 186 ? -1.122  -30.168  49.828  1.00 48.41  ? 179  GLY C N   1 
ATOM   4714  C CA  . GLY C  2 186 ? -0.561  -29.200  48.905  1.00 47.80  ? 179  GLY C CA  1 
ATOM   4715  C C   . GLY C  2 186 ? 0.195   -28.115  49.646  1.00 45.26  ? 179  GLY C C   1 
ATOM   4716  O O   . GLY C  2 186 ? 1.292   -28.346  50.154  1.00 44.58  ? 179  GLY C O   1 
ATOM   4717  N N   . PHE C  2 187 ? -0.395  -26.927  49.708  1.00 44.27  ? 180  PHE C N   1 
ATOM   4718  C CA  . PHE C  2 187 ? 0.205   -25.818  50.438  1.00 43.17  ? 180  PHE C CA  1 
ATOM   4719  C C   . PHE C  2 187 ? -0.574  -25.540  51.715  1.00 42.92  ? 180  PHE C C   1 
ATOM   4720  O O   . PHE C  2 187 ? -1.724  -25.102  51.670  1.00 46.12  ? 180  PHE C O   1 
ATOM   4721  C CB  . PHE C  2 187 ? 0.264   -24.562  49.567  1.00 45.36  ? 180  PHE C CB  1 
ATOM   4722  C CG  . PHE C  2 187 ? 1.236   -24.660  48.425  1.00 49.08  ? 180  PHE C CG  1 
ATOM   4723  C CD1 . PHE C  2 187 ? 2.250   -25.605  48.438  1.00 48.15  ? 180  PHE C CD1 1 
ATOM   4724  C CD2 . PHE C  2 187 ? 1.138   -23.806  47.338  1.00 52.33  ? 180  PHE C CD2 1 
ATOM   4725  C CE1 . PHE C  2 187 ? 3.146   -25.698  47.388  1.00 46.29  ? 180  PHE C CE1 1 
ATOM   4726  C CE2 . PHE C  2 187 ? 2.032   -23.893  46.285  1.00 50.02  ? 180  PHE C CE2 1 
ATOM   4727  C CZ  . PHE C  2 187 ? 3.037   -24.841  46.311  1.00 47.52  ? 180  PHE C CZ  1 
ATOM   4728  N N   . VAL C  2 188 ? 0.060   -25.801  52.853  1.00 49.36  ? 181  VAL C N   1 
ATOM   4729  C CA  . VAL C  2 188 ? -0.578  -25.617  54.150  1.00 57.08  ? 181  VAL C CA  1 
ATOM   4730  C C   . VAL C  2 188 ? 0.094   -24.496  54.940  1.00 67.11  ? 181  VAL C C   1 
ATOM   4731  O O   . VAL C  2 188 ? 1.245   -24.629  55.354  1.00 71.60  ? 181  VAL C O   1 
ATOM   4732  C CB  . VAL C  2 188 ? -0.537  -26.913  54.982  1.00 61.71  ? 181  VAL C CB  1 
ATOM   4733  C CG1 . VAL C  2 188 ? -1.533  -26.840  56.129  1.00 66.26  ? 181  VAL C CG1 1 
ATOM   4734  C CG2 . VAL C  2 188 ? -0.817  -28.125  54.099  1.00 62.89  ? 181  VAL C CG2 1 
ATOM   4735  N N   . HIS C  2 189 ? -0.625  -23.396  55.149  1.00 71.97  ? 182  HIS C N   1 
ATOM   4736  C CA  . HIS C  2 189 ? -0.090  -22.269  55.909  1.00 81.32  ? 182  HIS C CA  1 
ATOM   4737  C C   . HIS C  2 189 ? -0.128  -22.557  57.413  1.00 81.08  ? 182  HIS C C   1 
ATOM   4738  O O   . HIS C  2 189 ? -1.131  -23.043  57.937  1.00 77.99  ? 182  HIS C O   1 
ATOM   4739  C CB  . HIS C  2 189 ? -0.855  -20.977  55.578  1.00 87.52  ? 182  HIS C CB  1 
ATOM   4740  C CG  . HIS C  2 189 ? -2.319  -21.028  55.895  1.00 90.61  ? 182  HIS C CG  1 
ATOM   4741  N ND1 . HIS C  2 189 ? -2.800  -21.237  57.169  1.00 95.89  ? 182  HIS C ND1 1 
ATOM   4742  C CD2 . HIS C  2 189 ? -3.408  -20.875  55.104  1.00 88.66  ? 182  HIS C CD2 1 
ATOM   4743  C CE1 . HIS C  2 189 ? -4.121  -21.225  57.148  1.00 95.06  ? 182  HIS C CE1 1 
ATOM   4744  N NE2 . HIS C  2 189 ? -4.515  -21.006  55.907  1.00 90.67  ? 182  HIS C NE2 1 
ATOM   4745  N N   . THR C  2 190 ? 0.974   -22.268  58.099  1.00 86.94  ? 183  THR C N   1 
ATOM   4746  C CA  . THR C  2 190 ? 1.076   -22.546  59.528  1.00 90.06  ? 183  THR C CA  1 
ATOM   4747  C C   . THR C  2 190 ? 1.404   -21.276  60.305  1.00 91.81  ? 183  THR C C   1 
ATOM   4748  O O   . THR C  2 190 ? 0.506   -20.582  60.784  1.00 93.51  ? 183  THR C O   1 
ATOM   4749  C CB  . THR C  2 190 ? 2.153   -23.618  59.832  1.00 89.89  ? 183  THR C CB  1 
ATOM   4750  O OG1 . THR C  2 190 ? 3.456   -23.093  59.551  1.00 87.58  ? 183  THR C OG1 1 
ATOM   4751  C CG2 . THR C  2 190 ? 1.919   -24.883  59.007  1.00 89.06  ? 183  THR C CG2 1 
ATOM   4752  N N   . LYS C  2 194 ? 1.251   -16.503  57.430  1.00 122.64 ? 187  LYS C N   1 
ATOM   4753  C CA  . LYS C  2 194 ? 1.842   -17.791  57.768  1.00 117.30 ? 187  LYS C CA  1 
ATOM   4754  C C   . LYS C  2 194 ? 2.878   -18.154  56.722  1.00 113.34 ? 187  LYS C C   1 
ATOM   4755  O O   . LYS C  2 194 ? 3.703   -19.048  56.913  1.00 113.00 ? 187  LYS C O   1 
ATOM   4756  C CB  . LYS C  2 194 ? 0.767   -18.868  57.861  1.00 121.68 ? 187  LYS C CB  1 
ATOM   4757  N N   . ASP C  2 195 ? 2.824   -17.439  55.609  1.00 105.76 ? 188  ASP C N   1 
ATOM   4758  C CA  . ASP C  2 195 ? 3.798   -17.605  54.549  1.00 98.27  ? 188  ASP C CA  1 
ATOM   4759  C C   . ASP C  2 195 ? 4.223   -16.247  54.037  1.00 98.92  ? 188  ASP C C   1 
ATOM   4760  O O   . ASP C  2 195 ? 3.849   -15.224  54.605  1.00 97.62  ? 188  ASP C O   1 
ATOM   4761  C CB  . ASP C  2 195 ? 3.224   -18.436  53.409  1.00 93.32  ? 188  ASP C CB  1 
ATOM   4762  N N   . LEU C  2 196 ? 4.989   -16.235  52.952  1.00 99.94  ? 189  LEU C N   1 
ATOM   4763  C CA  . LEU C  2 196 ? 5.467   -14.977  52.395  1.00 105.92 ? 189  LEU C CA  1 
ATOM   4764  C C   . LEU C  2 196 ? 4.944   -14.751  50.976  1.00 112.76 ? 189  LEU C C   1 
ATOM   4765  O O   . LEU C  2 196 ? 4.384   -13.695  50.673  1.00 105.79 ? 189  LEU C O   1 
ATOM   4766  C CB  . LEU C  2 196 ? 7.000   -14.924  52.396  1.00 97.04  ? 189  LEU C CB  1 
ATOM   4767  C CG  . LEU C  2 196 ? 7.846   -16.014  53.074  1.00 87.83  ? 189  LEU C CG  1 
ATOM   4768  C CD1 . LEU C  2 196 ? 9.308   -15.860  52.633  1.00 87.73  ? 189  LEU C CD1 1 
ATOM   4769  C CD2 . LEU C  2 196 ? 7.711   -16.018  54.612  1.00 84.83  ? 189  LEU C CD2 1 
ATOM   4770  N N   . LYS C  2 197 ? 5.133   -15.745  50.112  1.00 127.57 ? 190  LYS C N   1 
ATOM   4771  C CA  . LYS C  2 197 ? 4.678   -15.661  48.729  1.00 131.65 ? 190  LYS C CA  1 
ATOM   4772  C C   . LYS C  2 197 ? 3.347   -16.385  48.571  1.00 127.84 ? 190  LYS C C   1 
ATOM   4773  O O   . LYS C  2 197 ? 2.988   -16.809  47.475  1.00 128.32 ? 190  LYS C O   1 
ATOM   4774  C CB  . LYS C  2 197 ? 5.721   -16.251  47.778  1.00 133.58 ? 190  LYS C CB  1 
ATOM   4775  N N   . GLU C  2 198 ? 2.620   -16.524  49.676  1.00 109.82 ? 191  GLU C N   1 
ATOM   4776  C CA  . GLU C  2 198 ? 1.318   -17.184  49.661  1.00 90.91  ? 191  GLU C CA  1 
ATOM   4777  C C   . GLU C  2 198 ? 0.327   -16.450  48.766  1.00 84.54  ? 191  GLU C C   1 
ATOM   4778  O O   . GLU C  2 198 ? -0.414  -17.077  48.010  1.00 84.12  ? 191  GLU C O   1 
ATOM   4779  C CB  . GLU C  2 198 ? 0.753   -17.294  51.079  1.00 78.13  ? 191  GLU C CB  1 
ATOM   4780  C CG  . GLU C  2 198 ? -0.646  -17.893  51.153  1.00 70.01  ? 191  GLU C CG  1 
ATOM   4781  C CD  . GLU C  2 198 ? -1.130  -18.059  52.581  1.00 65.49  ? 191  GLU C CD  1 
ATOM   4782  O OE1 . GLU C  2 198 ? -0.281  -18.067  53.497  1.00 61.22  ? 191  GLU C OE1 1 
ATOM   4783  O OE2 . GLU C  2 198 ? -2.356  -18.184  52.790  1.00 66.70  ? 191  GLU C OE2 1 
ATOM   4784  N N   . GLU C  2 199 ? 0.324   -15.123  48.858  1.00 83.05  ? 192  GLU C N   1 
ATOM   4785  C CA  . GLU C  2 199 ? -0.583  -14.284  48.079  1.00 81.84  ? 192  GLU C CA  1 
ATOM   4786  C C   . GLU C  2 199 ? -0.442  -14.500  46.573  1.00 80.48  ? 192  GLU C C   1 
ATOM   4787  O O   . GLU C  2 199 ? -1.438  -14.617  45.859  1.00 81.55  ? 192  GLU C O   1 
ATOM   4788  C CB  . GLU C  2 199 ? -0.351  -12.808  48.410  1.00 84.27  ? 192  GLU C CB  1 
ATOM   4789  C CG  . GLU C  2 199 ? -0.795  -12.405  49.805  1.00 87.85  ? 192  GLU C CG  1 
ATOM   4790  C CD  . GLU C  2 199 ? -0.693  -10.911  50.037  1.00 93.79  ? 192  GLU C CD  1 
ATOM   4791  O OE1 . GLU C  2 199 ? 0.355   -10.324  49.692  1.00 95.13  ? 192  GLU C OE1 1 
ATOM   4792  O OE2 . GLU C  2 199 ? -1.663  -10.321  50.557  1.00 96.55  ? 192  GLU C OE2 1 
ATOM   4793  N N   . HIS C  2 200 ? 0.796   -14.552  46.096  1.00 78.45  ? 193  HIS C N   1 
ATOM   4794  C CA  . HIS C  2 200 ? 1.056   -14.741  44.673  1.00 75.77  ? 193  HIS C CA  1 
ATOM   4795  C C   . HIS C  2 200 ? 0.773   -16.176  44.241  1.00 76.72  ? 193  HIS C C   1 
ATOM   4796  O O   . HIS C  2 200 ? 0.472   -16.436  43.076  1.00 78.84  ? 193  HIS C O   1 
ATOM   4797  C CB  . HIS C  2 200 ? 2.502   -14.367  44.339  1.00 73.92  ? 193  HIS C CB  1 
ATOM   4798  N N   . LEU C  2 201 ? 0.865   -17.104  45.189  1.00 72.54  ? 194  LEU C N   1 
ATOM   4799  C CA  . LEU C  2 201 ? 0.685   -18.522  44.896  1.00 68.71  ? 194  LEU C CA  1 
ATOM   4800  C C   . LEU C  2 201 ? -0.774  -18.955  45.014  1.00 67.10  ? 194  LEU C C   1 
ATOM   4801  O O   . LEU C  2 201 ? -1.233  -19.820  44.268  1.00 67.27  ? 194  LEU C O   1 
ATOM   4802  C CB  . LEU C  2 201 ? 1.558   -19.370  45.825  1.00 67.96  ? 194  LEU C CB  1 
ATOM   4803  C CG  . LEU C  2 201 ? 2.959   -19.756  45.338  1.00 69.19  ? 194  LEU C CG  1 
ATOM   4804  C CD1 . LEU C  2 201 ? 3.738   -18.551  44.825  1.00 73.10  ? 194  LEU C CD1 1 
ATOM   4805  C CD2 . LEU C  2 201 ? 3.729   -20.466  46.444  1.00 68.38  ? 194  LEU C CD2 1 
ATOM   4806  N N   . LYS C  2 202 ? -1.499  -18.352  45.952  1.00 67.70  ? 195  LYS C N   1 
ATOM   4807  C CA  . LYS C  2 202 ? -2.900  -18.699  46.175  1.00 67.03  ? 195  LYS C CA  1 
ATOM   4808  C C   . LYS C  2 202 ? -3.785  -18.221  45.029  1.00 65.82  ? 195  LYS C C   1 
ATOM   4809  O O   . LYS C  2 202 ? -4.889  -18.729  44.834  1.00 66.38  ? 195  LYS C O   1 
ATOM   4810  C CB  . LYS C  2 202 ? -3.400  -18.105  47.495  1.00 68.54  ? 195  LYS C CB  1 
ATOM   4811  C CG  . LYS C  2 202 ? -3.473  -16.584  47.500  1.00 70.10  ? 195  LYS C CG  1 
ATOM   4812  C CD  . LYS C  2 202 ? -3.877  -16.041  48.860  1.00 71.34  ? 195  LYS C CD  1 
ATOM   4813  C CE  . LYS C  2 202 ? -5.326  -16.364  49.178  1.00 72.49  ? 195  LYS C CE  1 
ATOM   4814  N NZ  . LYS C  2 202 ? -5.752  -15.790  50.483  1.00 74.39  ? 195  LYS C NZ  1 
ATOM   4815  N N   . LYS C  2 203 ? -3.291  -17.245  44.274  1.00 56.76  ? 196  LYS C N   1 
ATOM   4816  C CA  . LYS C  2 203 ? -4.062  -16.638  43.193  1.00 62.17  ? 196  LYS C CA  1 
ATOM   4817  C C   . LYS C  2 203 ? -4.336  -17.621  42.058  1.00 64.69  ? 196  LYS C C   1 
ATOM   4818  O O   . LYS C  2 203 ? -5.275  -17.437  41.283  1.00 68.74  ? 196  LYS C O   1 
ATOM   4819  C CB  . LYS C  2 203 ? -3.334  -15.406  42.651  1.00 62.75  ? 196  LYS C CB  1 
ATOM   4820  N N   . ASN C  2 204 ? -3.517  -18.663  41.964  1.00 63.75  ? 197  ASN C N   1 
ATOM   4821  C CA  . ASN C  2 204 ? -3.678  -19.667  40.919  1.00 62.35  ? 197  ASN C CA  1 
ATOM   4822  C C   . ASN C  2 204 ? -4.522  -20.850  41.379  1.00 59.26  ? 197  ASN C C   1 
ATOM   4823  O O   . ASN C  2 204 ? -5.345  -21.362  40.619  1.00 61.51  ? 197  ASN C O   1 
ATOM   4824  C CB  . ASN C  2 204 ? -2.312  -20.157  40.438  1.00 68.98  ? 197  ASN C CB  1 
ATOM   4825  C CG  . ASN C  2 204 ? -1.505  -19.063  39.770  1.00 76.31  ? 197  ASN C CG  1 
ATOM   4826  O OD1 . ASN C  2 204 ? -2.061  -18.154  39.153  1.00 78.84  ? 197  ASN C OD1 1 
ATOM   4827  N ND2 . ASN C  2 204 ? -0.184  -19.144  39.889  1.00 78.02  ? 197  ASN C ND2 1 
ATOM   4828  N N   . ILE C  2 205 ? -4.309  -21.275  42.622  1.00 53.57  ? 198  ILE C N   1 
ATOM   4829  C CA  . ILE C  2 205 ? -5.037  -22.396  43.215  1.00 46.98  ? 198  ILE C CA  1 
ATOM   4830  C C   . ILE C  2 205 ? -6.549  -22.207  43.088  1.00 49.59  ? 198  ILE C C   1 
ATOM   4831  O O   . ILE C  2 205 ? -7.077  -21.165  43.477  1.00 52.03  ? 198  ILE C O   1 
ATOM   4832  C CB  . ILE C  2 205 ? -4.665  -22.573  44.704  1.00 39.21  ? 198  ILE C CB  1 
ATOM   4833  C CG1 . ILE C  2 205 ? -3.145  -22.581  44.875  1.00 37.33  ? 198  ILE C CG1 1 
ATOM   4834  C CG2 . ILE C  2 205 ? -5.277  -23.845  45.272  1.00 28.17  ? 198  ILE C CG2 1 
ATOM   4835  C CD1 . ILE C  2 205 ? -2.693  -22.720  46.312  1.00 35.74  ? 198  ILE C CD1 1 
ATOM   4836  N N   . PRO C  2 206 ? -7.244  -23.213  42.526  1.00 46.35  ? 199  PRO C N   1 
ATOM   4837  C CA  . PRO C  2 206 ? -8.686  -23.181  42.244  1.00 45.64  ? 199  PRO C CA  1 
ATOM   4838  C C   . PRO C  2 206 ? -9.549  -22.697  43.409  1.00 49.12  ? 199  PRO C C   1 
ATOM   4839  O O   . PRO C  2 206 ? -10.521 -21.979  43.181  1.00 52.44  ? 199  PRO C O   1 
ATOM   4840  C CB  . PRO C  2 206 ? -9.001  -24.642  41.916  1.00 42.22  ? 199  PRO C CB  1 
ATOM   4841  C CG  . PRO C  2 206 ? -7.746  -25.150  41.314  1.00 42.85  ? 199  PRO C CG  1 
ATOM   4842  C CD  . PRO C  2 206 ? -6.628  -24.468  42.057  1.00 43.88  ? 199  PRO C CD  1 
ATOM   4843  N N   . LEU C  2 207 ? -9.201  -23.080  44.633  1.00 51.74  ? 200  LEU C N   1 
ATOM   4844  C CA  . LEU C  2 207 ? -9.970  -22.657  45.799  1.00 47.17  ? 200  LEU C CA  1 
ATOM   4845  C C   . LEU C  2 207 ? -9.514  -21.286  46.295  1.00 43.85  ? 200  LEU C C   1 
ATOM   4846  O O   . LEU C  2 207 ? -10.088 -20.733  47.233  1.00 43.27  ? 200  LEU C O   1 
ATOM   4847  C CB  . LEU C  2 207 ? -9.863  -23.693  46.919  1.00 41.27  ? 200  LEU C CB  1 
ATOM   4848  C CG  . LEU C  2 207 ? -10.404 -25.083  46.576  1.00 39.71  ? 200  LEU C CG  1 
ATOM   4849  C CD1 . LEU C  2 207 ? -10.518 -25.940  47.825  1.00 37.84  ? 200  LEU C CD1 1 
ATOM   4850  C CD2 . LEU C  2 207 ? -11.746 -24.985  45.865  1.00 39.27  ? 200  LEU C CD2 1 
ATOM   4851  N N   . GLY C  2 208 ? -8.479  -20.747  45.658  1.00 41.32  ? 201  GLY C N   1 
ATOM   4852  C CA  . GLY C  2 208 ? -8.016  -19.398  45.931  1.00 45.21  ? 201  GLY C CA  1 
ATOM   4853  C C   . GLY C  2 208 ? -7.490  -19.167  47.334  1.00 49.87  ? 201  GLY C C   1 
ATOM   4854  O O   . GLY C  2 208 ? -7.647  -18.076  47.882  1.00 55.39  ? 201  GLY C O   1 
ATOM   4855  N N   . ARG C  2 209 ? -6.862  -20.188  47.910  1.00 45.57  ? 202  ARG C N   1 
ATOM   4856  C CA  . ARG C  2 209 ? -6.303  -20.091  49.256  1.00 44.87  ? 202  ARG C CA  1 
ATOM   4857  C C   . ARG C  2 209 ? -5.419  -21.288  49.582  1.00 45.63  ? 202  ARG C C   1 
ATOM   4858  O O   . ARG C  2 209 ? -5.535  -22.346  48.961  1.00 46.17  ? 202  ARG C O   1 
ATOM   4859  C CB  . ARG C  2 209 ? -7.419  -19.985  50.298  1.00 44.35  ? 202  ARG C CB  1 
ATOM   4860  C CG  . ARG C  2 209 ? -8.351  -21.183  50.320  1.00 43.53  ? 202  ARG C CG  1 
ATOM   4861  C CD  . ARG C  2 209 ? -9.351  -21.092  51.458  1.00 45.99  ? 202  ARG C CD  1 
ATOM   4862  N NE  . ARG C  2 209 ? -10.257 -22.236  51.473  1.00 51.10  ? 202  ARG C NE  1 
ATOM   4863  C CZ  . ARG C  2 209 ? -9.990  -23.392  52.072  1.00 52.11  ? 202  ARG C CZ  1 
ATOM   4864  N NH1 . ARG C  2 209 ? -8.839  -23.561  52.708  1.00 50.49  ? 202  ARG C NH1 1 
ATOM   4865  N NH2 . ARG C  2 209 ? -10.874 -24.380  52.034  1.00 52.47  ? 202  ARG C NH2 1 
ATOM   4866  N N   . PHE C  2 210 ? -4.534  -21.118  50.560  1.00 43.49  ? 203  PHE C N   1 
ATOM   4867  C CA  . PHE C  2 210 ? -3.749  -22.233  51.073  1.00 40.93  ? 203  PHE C CA  1 
ATOM   4868  C C   . PHE C  2 210 ? -4.634  -23.152  51.902  1.00 43.92  ? 203  PHE C C   1 
ATOM   4869  O O   . PHE C  2 210 ? -5.777  -22.816  52.209  1.00 47.03  ? 203  PHE C O   1 
ATOM   4870  C CB  . PHE C  2 210 ? -2.572  -21.741  51.918  1.00 38.87  ? 203  PHE C CB  1 
ATOM   4871  C CG  . PHE C  2 210 ? -1.326  -21.464  51.128  1.00 41.82  ? 203  PHE C CG  1 
ATOM   4872  C CD1 . PHE C  2 210 ? -1.376  -21.319  49.751  1.00 42.15  ? 203  PHE C CD1 1 
ATOM   4873  C CD2 . PHE C  2 210 ? -0.099  -21.366  51.763  1.00 42.57  ? 203  PHE C CD2 1 
ATOM   4874  C CE1 . PHE C  2 210 ? -0.227  -21.067  49.025  1.00 42.47  ? 203  PHE C CE1 1 
ATOM   4875  C CE2 . PHE C  2 210 ? 1.053   -21.117  51.043  1.00 44.56  ? 203  PHE C CE2 1 
ATOM   4876  C CZ  . PHE C  2 210 ? 0.989   -20.968  49.672  1.00 44.57  ? 203  PHE C CZ  1 
ATOM   4877  N N   . GLY C  2 211 ? -4.100  -24.312  52.268  1.00 42.84  ? 204  GLY C N   1 
ATOM   4878  C CA  . GLY C  2 211 ? -4.836  -25.255  53.085  1.00 42.19  ? 204  GLY C CA  1 
ATOM   4879  C C   . GLY C  2 211 ? -4.584  -25.052  54.565  1.00 48.64  ? 204  GLY C C   1 
ATOM   4880  O O   . GLY C  2 211 ? -3.558  -24.499  54.961  1.00 53.93  ? 204  GLY C O   1 
ATOM   4881  N N   . GLU C  2 212 ? -5.531  -25.492  55.386  1.00 49.90  ? 205  GLU C N   1 
ATOM   4882  C CA  . GLU C  2 212 ? -5.369  -25.447  56.832  1.00 51.69  ? 205  GLU C CA  1 
ATOM   4883  C C   . GLU C  2 212 ? -5.084  -26.852  57.347  1.00 49.08  ? 205  GLU C C   1 
ATOM   4884  O O   . GLU C  2 212 ? -5.500  -27.838  56.737  1.00 46.56  ? 205  GLU C O   1 
ATOM   4885  C CB  . GLU C  2 212 ? -6.614  -24.862  57.502  1.00 57.45  ? 205  GLU C CB  1 
ATOM   4886  C CG  . GLU C  2 212 ? -6.321  -23.730  58.477  1.00 64.02  ? 205  GLU C CG  1 
ATOM   4887  C CD  . GLU C  2 212 ? -5.590  -24.199  59.720  1.00 69.89  ? 205  GLU C CD  1 
ATOM   4888  O OE1 . GLU C  2 212 ? -6.087  -25.131  60.387  1.00 69.28  ? 205  GLU C OE1 1 
ATOM   4889  O OE2 . GLU C  2 212 ? -4.517  -23.638  60.029  1.00 74.34  ? 205  GLU C OE2 1 
ATOM   4890  N N   . THR C  2 213 ? -4.372  -26.940  58.465  1.00 52.42  ? 206  THR C N   1 
ATOM   4891  C CA  . THR C  2 213 ? -3.949  -28.227  59.005  1.00 49.30  ? 206  THR C CA  1 
ATOM   4892  C C   . THR C  2 213 ? -5.130  -29.090  59.443  1.00 48.08  ? 206  THR C C   1 
ATOM   4893  O O   . THR C  2 213 ? -5.056  -30.318  59.407  1.00 47.94  ? 206  THR C O   1 
ATOM   4894  C CB  . THR C  2 213 ? -2.996  -28.044  60.198  1.00 48.50  ? 206  THR C CB  1 
ATOM   4895  O OG1 . THR C  2 213 ? -3.663  -27.316  61.236  1.00 52.37  ? 206  THR C OG1 1 
ATOM   4896  C CG2 . THR C  2 213 ? -1.749  -27.285  59.771  1.00 46.04  ? 206  THR C CG2 1 
ATOM   4897  N N   . ILE C  2 214 ? -6.219  -28.446  59.852  1.00 45.66  ? 207  ILE C N   1 
ATOM   4898  C CA  . ILE C  2 214 ? -7.409  -29.171  60.280  1.00 46.51  ? 207  ILE C CA  1 
ATOM   4899  C C   . ILE C  2 214 ? -8.097  -29.823  59.080  1.00 50.03  ? 207  ILE C C   1 
ATOM   4900  O O   . ILE C  2 214 ? -8.767  -30.847  59.215  1.00 51.63  ? 207  ILE C O   1 
ATOM   4901  C CB  . ILE C  2 214 ? -8.401  -28.243  61.025  1.00 45.54  ? 207  ILE C CB  1 
ATOM   4902  C CG1 . ILE C  2 214 ? -9.535  -29.057  61.657  1.00 48.19  ? 207  ILE C CG1 1 
ATOM   4903  C CG2 . ILE C  2 214 ? -8.946  -27.164  60.097  1.00 42.78  ? 207  ILE C CG2 1 
ATOM   4904  C CD1 . ILE C  2 214 ? -10.531 -28.223  62.432  1.00 50.65  ? 207  ILE C CD1 1 
ATOM   4905  N N   . GLU C  2 215 ? -7.910  -29.235  57.902  1.00 48.32  ? 208  GLU C N   1 
ATOM   4906  C CA  . GLU C  2 215 ? -8.492  -29.771  56.677  1.00 45.84  ? 208  GLU C CA  1 
ATOM   4907  C C   . GLU C  2 215 ? -7.746  -31.023  56.230  1.00 43.78  ? 208  GLU C C   1 
ATOM   4908  O O   . GLU C  2 215 ? -8.346  -31.963  55.707  1.00 39.25  ? 208  GLU C O   1 
ATOM   4909  C CB  . GLU C  2 215 ? -8.476  -28.715  55.571  1.00 43.99  ? 208  GLU C CB  1 
ATOM   4910  C CG  . GLU C  2 215 ? -9.358  -27.512  55.861  1.00 51.73  ? 208  GLU C CG  1 
ATOM   4911  C CD  . GLU C  2 215 ? -9.210  -26.413  54.829  1.00 57.49  ? 208  GLU C CD  1 
ATOM   4912  O OE1 . GLU C  2 215 ? -8.060  -26.049  54.506  1.00 52.92  ? 208  GLU C OE1 1 
ATOM   4913  O OE2 . GLU C  2 215 ? -10.245 -25.914  54.338  1.00 64.00  ? 208  GLU C OE2 1 
ATOM   4914  N N   . VAL C  2 216 ? -6.435  -31.028  56.442  1.00 45.06  ? 209  VAL C N   1 
ATOM   4915  C CA  . VAL C  2 216 ? -5.613  -32.191  56.134  1.00 45.03  ? 209  VAL C CA  1 
ATOM   4916  C C   . VAL C  2 216 ? -5.874  -33.292  57.159  1.00 47.09  ? 209  VAL C C   1 
ATOM   4917  O O   . VAL C  2 216 ? -5.812  -34.481  56.843  1.00 44.45  ? 209  VAL C O   1 
ATOM   4918  C CB  . VAL C  2 216 ? -4.113  -31.835  56.118  1.00 45.43  ? 209  VAL C CB  1 
ATOM   4919  C CG1 . VAL C  2 216 ? -3.288  -33.020  55.642  1.00 40.85  ? 209  VAL C CG1 1 
ATOM   4920  C CG2 . VAL C  2 216 ? -3.867  -30.624  55.232  1.00 45.66  ? 209  VAL C CG2 1 
ATOM   4921  N N   . ALA C  2 217 ? -6.177  -32.880  58.386  1.00 47.74  ? 210  ALA C N   1 
ATOM   4922  C CA  . ALA C  2 217 ? -6.477  -33.815  59.464  1.00 43.74  ? 210  ALA C CA  1 
ATOM   4923  C C   . ALA C  2 217 ? -7.730  -34.629  59.156  1.00 47.84  ? 210  ALA C C   1 
ATOM   4924  O O   . ALA C  2 217 ? -7.776  -35.831  59.417  1.00 52.76  ? 210  ALA C O   1 
ATOM   4925  C CB  . ALA C  2 217 ? -6.640  -33.070  60.779  1.00 35.49  ? 210  ALA C CB  1 
ATOM   4926  N N   . HIS C  2 218 ? -8.742  -33.968  58.601  1.00 48.19  ? 211  HIS C N   1 
ATOM   4927  C CA  . HIS C  2 218 ? -9.986  -34.636  58.230  1.00 46.74  ? 211  HIS C CA  1 
ATOM   4928  C C   . HIS C  2 218 ? -9.756  -35.707  57.169  1.00 43.52  ? 211  HIS C C   1 
ATOM   4929  O O   . HIS C  2 218 ? -10.403 -36.754  57.182  1.00 46.59  ? 211  HIS C O   1 
ATOM   4930  C CB  . HIS C  2 218 ? -11.015 -33.620  57.728  1.00 43.24  ? 211  HIS C CB  1 
ATOM   4931  C CG  . HIS C  2 218 ? -11.768 -32.929  58.822  1.00 44.25  ? 211  HIS C CG  1 
ATOM   4932  N ND1 . HIS C  2 218 ? -12.724 -33.567  59.583  1.00 42.57  ? 211  HIS C ND1 1 
ATOM   4933  C CD2 . HIS C  2 218 ? -11.715 -31.655  59.276  1.00 45.05  ? 211  HIS C CD2 1 
ATOM   4934  C CE1 . HIS C  2 218 ? -13.222 -32.717  60.463  1.00 46.08  ? 211  HIS C CE1 1 
ATOM   4935  N NE2 . HIS C  2 218 ? -12.627 -31.550  60.298  1.00 46.57  ? 211  HIS C NE2 1 
ATOM   4936  N N   . ALA C  2 219 ? -8.832  -35.438  56.252  1.00 36.60  ? 212  ALA C N   1 
ATOM   4937  C CA  . ALA C  2 219 ? -8.496  -36.389  55.200  1.00 37.25  ? 212  ALA C CA  1 
ATOM   4938  C C   . ALA C  2 219 ? -7.843  -37.640  55.780  1.00 40.99  ? 212  ALA C C   1 
ATOM   4939  O O   . ALA C  2 219 ? -8.160  -38.761  55.379  1.00 40.33  ? 212  ALA C O   1 
ATOM   4940  C CB  . ALA C  2 219 ? -7.581  -35.742  54.175  1.00 33.65  ? 212  ALA C CB  1 
ATOM   4941  N N   . VAL C  2 220 ? -6.932  -37.436  56.727  1.00 46.77  ? 213  VAL C N   1 
ATOM   4942  C CA  . VAL C  2 220 ? -6.234  -38.537  57.383  1.00 49.81  ? 213  VAL C CA  1 
ATOM   4943  C C   . VAL C  2 220 ? -7.207  -39.461  58.108  1.00 56.72  ? 213  VAL C C   1 
ATOM   4944  O O   . VAL C  2 220 ? -7.144  -40.682  57.959  1.00 60.74  ? 213  VAL C O   1 
ATOM   4945  C CB  . VAL C  2 220 ? -5.188  -38.017  58.388  1.00 50.94  ? 213  VAL C CB  1 
ATOM   4946  C CG1 . VAL C  2 220 ? -4.590  -39.170  59.181  1.00 53.27  ? 213  VAL C CG1 1 
ATOM   4947  C CG2 . VAL C  2 220 ? -4.102  -37.236  57.666  1.00 52.13  ? 213  VAL C CG2 1 
ATOM   4948  N N   . VAL C  2 221 ? -8.107  -38.868  58.886  1.00 57.42  ? 214  VAL C N   1 
ATOM   4949  C CA  . VAL C  2 221 ? -9.101  -39.629  59.635  1.00 54.26  ? 214  VAL C CA  1 
ATOM   4950  C C   . VAL C  2 221 ? -10.013 -40.419  58.700  1.00 47.55  ? 214  VAL C C   1 
ATOM   4951  O O   . VAL C  2 221 ? -10.359 -41.567  58.981  1.00 47.93  ? 214  VAL C O   1 
ATOM   4952  C CB  . VAL C  2 221 ? -9.959  -38.709  60.524  1.00 57.10  ? 214  VAL C CB  1 
ATOM   4953  C CG1 . VAL C  2 221 ? -11.016 -39.515  61.256  1.00 56.73  ? 214  VAL C CG1 1 
ATOM   4954  C CG2 . VAL C  2 221 ? -9.081  -37.958  61.512  1.00 58.59  ? 214  VAL C CG2 1 
ATOM   4955  N N   . PHE C  2 222 ? -10.389 -39.800  57.584  1.00 44.89  ? 215  PHE C N   1 
ATOM   4956  C CA  . PHE C  2 222 ? -11.233 -40.454  56.590  1.00 45.42  ? 215  PHE C CA  1 
ATOM   4957  C C   . PHE C  2 222 ? -10.583 -41.723  56.044  1.00 47.75  ? 215  PHE C C   1 
ATOM   4958  O O   . PHE C  2 222 ? -11.235 -42.761  55.935  1.00 50.31  ? 215  PHE C O   1 
ATOM   4959  C CB  . PHE C  2 222 ? -11.551 -39.495  55.440  1.00 44.98  ? 215  PHE C CB  1 
ATOM   4960  C CG  . PHE C  2 222 ? -12.083 -40.177  54.210  1.00 45.68  ? 215  PHE C CG  1 
ATOM   4961  C CD1 . PHE C  2 222 ? -13.355 -40.725  54.200  1.00 45.52  ? 215  PHE C CD1 1 
ATOM   4962  C CD2 . PHE C  2 222 ? -11.312 -40.265  53.062  1.00 44.06  ? 215  PHE C CD2 1 
ATOM   4963  C CE1 . PHE C  2 222 ? -13.847 -41.354  53.068  1.00 40.68  ? 215  PHE C CE1 1 
ATOM   4964  C CE2 . PHE C  2 222 ? -11.798 -40.891  51.929  1.00 42.03  ? 215  PHE C CE2 1 
ATOM   4965  C CZ  . PHE C  2 222 ? -13.067 -41.435  51.932  1.00 40.48  ? 215  PHE C CZ  1 
ATOM   4966  N N   . LEU C  2 223 ? -9.300  -41.634  55.706  1.00 43.40  ? 216  LEU C N   1 
ATOM   4967  C CA  . LEU C  2 223 ? -8.565  -42.788  55.197  1.00 42.55  ? 216  LEU C CA  1 
ATOM   4968  C C   . LEU C  2 223 ? -8.418  -43.866  56.262  1.00 43.40  ? 216  LEU C C   1 
ATOM   4969  O O   . LEU C  2 223 ? -8.495  -45.058  55.967  1.00 44.96  ? 216  LEU C O   1 
ATOM   4970  C CB  . LEU C  2 223 ? -7.184  -42.371  54.689  1.00 47.40  ? 216  LEU C CB  1 
ATOM   4971  C CG  . LEU C  2 223 ? -7.120  -41.666  53.333  1.00 51.91  ? 216  LEU C CG  1 
ATOM   4972  C CD1 . LEU C  2 223 ? -5.673  -41.467  52.914  1.00 55.48  ? 216  LEU C CD1 1 
ATOM   4973  C CD2 . LEU C  2 223 ? -7.883  -42.451  52.278  1.00 46.96  ? 216  LEU C CD2 1 
ATOM   4974  N N   . LEU C  2 224 ? -8.205  -43.437  57.502  1.00 47.79  ? 217  LEU C N   1 
ATOM   4975  C CA  . LEU C  2 224 ? -8.018  -44.359  58.616  1.00 45.26  ? 217  LEU C CA  1 
ATOM   4976  C C   . LEU C  2 224 ? -9.283  -45.154  58.922  1.00 45.91  ? 217  LEU C C   1 
ATOM   4977  O O   . LEU C  2 224 ? -9.215  -46.261  59.454  1.00 50.37  ? 217  LEU C O   1 
ATOM   4978  C CB  . LEU C  2 224 ? -7.571  -43.598  59.866  1.00 47.54  ? 217  LEU C CB  1 
ATOM   4979  C CG  . LEU C  2 224 ? -6.119  -43.121  59.908  1.00 44.86  ? 217  LEU C CG  1 
ATOM   4980  C CD1 . LEU C  2 224 ? -5.897  -42.194  61.091  1.00 44.58  ? 217  LEU C CD1 1 
ATOM   4981  C CD2 . LEU C  2 224 ? -5.177  -44.310  59.978  1.00 47.27  ? 217  LEU C CD2 1 
ATOM   4982  N N   . GLU C  2 225 ? -10.434 -44.589  58.577  1.00 46.68  ? 218  GLU C N   1 
ATOM   4983  C CA  . GLU C  2 225 ? -11.712 -45.194  58.931  1.00 52.91  ? 218  GLU C CA  1 
ATOM   4984  C C   . GLU C  2 225 ? -12.411 -45.855  57.745  1.00 53.55  ? 218  GLU C C   1 
ATOM   4985  O O   . GLU C  2 225 ? -13.326 -46.656  57.933  1.00 57.78  ? 218  GLU C O   1 
ATOM   4986  C CB  . GLU C  2 225 ? -12.632 -44.142  59.554  1.00 57.66  ? 218  GLU C CB  1 
ATOM   4987  C CG  . GLU C  2 225 ? -12.111 -43.565  60.861  1.00 61.09  ? 218  GLU C CG  1 
ATOM   4988  C CD  . GLU C  2 225 ? -12.982 -42.444  61.392  1.00 66.26  ? 218  GLU C CD  1 
ATOM   4989  O OE1 . GLU C  2 225 ? -13.876 -41.982  60.653  1.00 72.18  ? 218  GLU C OE1 1 
ATOM   4990  O OE2 . GLU C  2 225 ? -12.772 -42.024  62.550  1.00 64.59  ? 218  GLU C OE2 1 
ATOM   4991  N N   . SER C  2 226 ? -11.984 -45.521  56.531  1.00 50.62  ? 219  SER C N   1 
ATOM   4992  C CA  . SER C  2 226 ? -12.587 -46.093  55.329  1.00 51.24  ? 219  SER C CA  1 
ATOM   4993  C C   . SER C  2 226 ? -12.144 -47.543  55.143  1.00 52.91  ? 219  SER C C   1 
ATOM   4994  O O   . SER C  2 226 ? -10.981 -47.806  54.843  1.00 54.90  ? 219  SER C O   1 
ATOM   4995  C CB  . SER C  2 226 ? -12.228 -45.262  54.097  1.00 54.21  ? 219  SER C CB  1 
ATOM   4996  O OG  . SER C  2 226 ? -13.035 -45.623  52.990  1.00 60.25  ? 219  SER C OG  1 
ATOM   4997  N N   . PRO C  2 227 ? -13.084 -48.486  55.311  1.00 52.60  ? 220  PRO C N   1 
ATOM   4998  C CA  . PRO C  2 227 ? -12.808 -49.927  55.400  1.00 53.42  ? 220  PRO C CA  1 
ATOM   4999  C C   . PRO C  2 227 ? -12.234 -50.561  54.131  1.00 52.87  ? 220  PRO C C   1 
ATOM   5000  O O   . PRO C  2 227 ? -11.589 -51.605  54.230  1.00 53.01  ? 220  PRO C O   1 
ATOM   5001  C CB  . PRO C  2 227 ? -14.188 -50.529  55.706  1.00 54.19  ? 220  PRO C CB  1 
ATOM   5002  C CG  . PRO C  2 227 ? -15.018 -49.387  56.199  1.00 53.00  ? 220  PRO C CG  1 
ATOM   5003  C CD  . PRO C  2 227 ? -14.521 -48.199  55.448  1.00 51.08  ? 220  PRO C CD  1 
ATOM   5004  N N   . TYR C  2 228 ? -12.461 -49.957  52.969  1.00 51.53  ? 221  TYR C N   1 
ATOM   5005  C CA  . TYR C  2 228 ? -12.073 -50.592  51.712  1.00 50.53  ? 221  TYR C CA  1 
ATOM   5006  C C   . TYR C  2 228 ? -11.016 -49.796  50.943  1.00 55.09  ? 221  TYR C C   1 
ATOM   5007  O O   . TYR C  2 228 ? -10.769 -50.054  49.765  1.00 61.03  ? 221  TYR C O   1 
ATOM   5008  C CB  . TYR C  2 228 ? -13.311 -50.809  50.835  1.00 43.54  ? 221  TYR C CB  1 
ATOM   5009  C CG  . TYR C  2 228 ? -13.124 -51.832  49.735  1.00 40.76  ? 221  TYR C CG  1 
ATOM   5010  C CD1 . TYR C  2 228 ? -12.817 -53.154  50.032  1.00 43.17  ? 221  TYR C CD1 1 
ATOM   5011  C CD2 . TYR C  2 228 ? -13.267 -51.479  48.399  1.00 37.63  ? 221  TYR C CD2 1 
ATOM   5012  C CE1 . TYR C  2 228 ? -12.648 -54.092  49.030  1.00 43.27  ? 221  TYR C CE1 1 
ATOM   5013  C CE2 . TYR C  2 228 ? -13.103 -52.410  47.392  1.00 40.46  ? 221  TYR C CE2 1 
ATOM   5014  C CZ  . TYR C  2 228 ? -12.791 -53.714  47.712  1.00 44.23  ? 221  TYR C CZ  1 
ATOM   5015  O OH  . TYR C  2 228 ? -12.628 -54.644  46.710  1.00 46.31  ? 221  TYR C OH  1 
ATOM   5016  N N   . ILE C  2 229 ? -10.384 -48.837  51.611  1.00 58.22  ? 222  ILE C N   1 
ATOM   5017  C CA  . ILE C  2 229 ? -9.341  -48.038  50.974  1.00 57.08  ? 222  ILE C CA  1 
ATOM   5018  C C   . ILE C  2 229 ? -7.955  -48.377  51.514  1.00 56.16  ? 222  ILE C C   1 
ATOM   5019  O O   . ILE C  2 229 ? -7.683  -48.208  52.703  1.00 62.85  ? 222  ILE C O   1 
ATOM   5020  C CB  . ILE C  2 229 ? -9.586  -46.528  51.159  1.00 56.35  ? 222  ILE C CB  1 
ATOM   5021  C CG1 . ILE C  2 229 ? -10.896 -46.111  50.489  1.00 58.44  ? 222  ILE C CG1 1 
ATOM   5022  C CG2 . ILE C  2 229 ? -8.425  -45.728  50.588  1.00 53.90  ? 222  ILE C CG2 1 
ATOM   5023  C CD1 . ILE C  2 229 ? -11.152 -44.619  50.525  1.00 57.17  ? 222  ILE C CD1 1 
ATOM   5024  N N   . THR C  2 230 ? -7.083  -48.856  50.633  1.00 49.19  ? 223  THR C N   1 
ATOM   5025  C CA  . THR C  2 230 ? -5.699  -49.133  50.997  1.00 50.25  ? 223  THR C CA  1 
ATOM   5026  C C   . THR C  2 230 ? -4.761  -48.803  49.839  1.00 48.02  ? 223  THR C C   1 
ATOM   5027  O O   . THR C  2 230 ? -5.090  -49.026  48.673  1.00 48.11  ? 223  THR C O   1 
ATOM   5028  C CB  . THR C  2 230 ? -5.502  -50.606  51.424  1.00 49.64  ? 223  THR C CB  1 
ATOM   5029  O OG1 . THR C  2 230 ? -4.121  -50.839  51.729  1.00 50.29  ? 223  THR C OG1 1 
ATOM   5030  C CG2 . THR C  2 230 ? -5.939  -51.557  50.320  1.00 47.12  ? 223  THR C CG2 1 
ATOM   5031  N N   . GLY C  2 231 ? -3.597  -48.252  50.168  1.00 47.11  ? 224  GLY C N   1 
ATOM   5032  C CA  . GLY C  2 231 ? -2.604  -47.911  49.166  1.00 44.56  ? 224  GLY C CA  1 
ATOM   5033  C C   . GLY C  2 231 ? -3.019  -46.770  48.257  1.00 43.24  ? 224  GLY C C   1 
ATOM   5034  O O   . GLY C  2 231 ? -2.555  -46.677  47.120  1.00 44.76  ? 224  GLY C O   1 
ATOM   5035  N N   . HIS C  2 232 ? -3.891  -45.898  48.752  1.00 42.39  ? 225  HIS C N   1 
ATOM   5036  C CA  . HIS C  2 232 ? -4.349  -44.760  47.963  1.00 44.81  ? 225  HIS C CA  1 
ATOM   5037  C C   . HIS C  2 232 ? -3.726  -43.451  48.433  1.00 41.17  ? 225  HIS C C   1 
ATOM   5038  O O   . HIS C  2 232 ? -3.747  -43.133  49.621  1.00 41.26  ? 225  HIS C O   1 
ATOM   5039  C CB  . HIS C  2 232 ? -5.874  -44.648  48.008  1.00 41.08  ? 225  HIS C CB  1 
ATOM   5040  C CG  . HIS C  2 232 ? -6.405  -43.414  47.347  1.00 38.32  ? 225  HIS C CG  1 
ATOM   5041  N ND1 . HIS C  2 232 ? -6.931  -42.357  48.057  1.00 39.86  ? 225  HIS C ND1 1 
ATOM   5042  C CD2 . HIS C  2 232 ? -6.479  -43.064  46.041  1.00 37.35  ? 225  HIS C CD2 1 
ATOM   5043  C CE1 . HIS C  2 232 ? -7.314  -41.412  47.217  1.00 40.74  ? 225  HIS C CE1 1 
ATOM   5044  N NE2 . HIS C  2 232 ? -7.050  -41.815  45.988  1.00 40.54  ? 225  HIS C NE2 1 
ATOM   5045  N N   . VAL C  2 233 ? -3.173  -42.697  47.489  1.00 39.44  ? 226  VAL C N   1 
ATOM   5046  C CA  . VAL C  2 233 ? -2.632  -41.378  47.785  1.00 36.66  ? 226  VAL C CA  1 
ATOM   5047  C C   . VAL C  2 233 ? -3.735  -40.329  47.697  1.00 37.02  ? 226  VAL C C   1 
ATOM   5048  O O   . VAL C  2 233 ? -4.076  -39.862  46.609  1.00 40.38  ? 226  VAL C O   1 
ATOM   5049  C CB  . VAL C  2 233 ? -1.489  -41.000  46.827  1.00 36.35  ? 226  VAL C CB  1 
ATOM   5050  C CG1 . VAL C  2 233 ? -0.922  -39.635  47.189  1.00 33.66  ? 226  VAL C CG1 1 
ATOM   5051  C CG2 . VAL C  2 233 ? -0.399  -42.060  46.860  1.00 38.31  ? 226  VAL C CG2 1 
ATOM   5052  N N   . LEU C  2 234 ? -4.297  -39.970  48.846  1.00 32.78  ? 227  LEU C N   1 
ATOM   5053  C CA  . LEU C  2 234 ? -5.363  -38.977  48.896  1.00 32.40  ? 227  LEU C CA  1 
ATOM   5054  C C   . LEU C  2 234 ? -4.793  -37.569  48.778  1.00 27.52  ? 227  LEU C C   1 
ATOM   5055  O O   . LEU C  2 234 ? -4.004  -37.137  49.616  1.00 28.66  ? 227  LEU C O   1 
ATOM   5056  C CB  . LEU C  2 234 ? -6.169  -39.118  50.187  1.00 39.06  ? 227  LEU C CB  1 
ATOM   5057  C CG  . LEU C  2 234 ? -7.399  -38.219  50.324  1.00 38.95  ? 227  LEU C CG  1 
ATOM   5058  C CD1 . LEU C  2 234 ? -8.353  -38.444  49.162  1.00 41.05  ? 227  LEU C CD1 1 
ATOM   5059  C CD2 . LEU C  2 234 ? -8.097  -38.470  51.649  1.00 36.10  ? 227  LEU C CD2 1 
ATOM   5060  N N   . VAL C  2 235 ? -5.198  -36.858  47.732  1.00 36.01  ? 228  VAL C N   1 
ATOM   5061  C CA  . VAL C  2 235 ? -4.670  -35.527  47.463  1.00 35.06  ? 228  VAL C CA  1 
ATOM   5062  C C   . VAL C  2 235 ? -5.573  -34.427  48.012  1.00 37.04  ? 228  VAL C C   1 
ATOM   5063  O O   . VAL C  2 235 ? -6.708  -34.261  47.567  1.00 42.04  ? 228  VAL C O   1 
ATOM   5064  C CB  . VAL C  2 235 ? -4.476  -35.299  45.952  1.00 33.24  ? 228  VAL C CB  1 
ATOM   5065  C CG1 . VAL C  2 235 ? -3.955  -33.897  45.692  1.00 30.00  ? 228  VAL C CG1 1 
ATOM   5066  C CG2 . VAL C  2 235 ? -3.530  -36.341  45.374  1.00 33.51  ? 228  VAL C CG2 1 
ATOM   5067  N N   . VAL C  2 236 ? -5.061  -33.678  48.983  1.00 34.64  ? 229  VAL C N   1 
ATOM   5068  C CA  . VAL C  2 236 ? -5.760  -32.504  49.491  1.00 35.43  ? 229  VAL C CA  1 
ATOM   5069  C C   . VAL C  2 236 ? -4.912  -31.260  49.206  1.00 34.54  ? 229  VAL C C   1 
ATOM   5070  O O   . VAL C  2 236 ? -3.957  -30.954  49.922  1.00 31.89  ? 229  VAL C O   1 
ATOM   5071  C CB  . VAL C  2 236 ? -6.081  -32.641  51.005  1.00 43.45  ? 229  VAL C CB  1 
ATOM   5072  C CG1 . VAL C  2 236 ? -4.881  -33.186  51.779  1.00 41.41  ? 229  VAL C CG1 1 
ATOM   5073  C CG2 . VAL C  2 236 ? -6.564  -31.316  51.584  1.00 46.60  ? 229  VAL C CG2 1 
ATOM   5074  N N   . ASP C  2 237 ? -5.254  -30.557  48.131  1.00 36.13  ? 230  ASP C N   1 
ATOM   5075  C CA  . ASP C  2 237 ? -4.435  -29.445  47.662  1.00 40.89  ? 230  ASP C CA  1 
ATOM   5076  C C   . ASP C  2 237 ? -5.270  -28.323  47.057  1.00 38.82  ? 230  ASP C C   1 
ATOM   5077  O O   . ASP C  2 237 ? -4.730  -27.333  46.564  1.00 42.38  ? 230  ASP C O   1 
ATOM   5078  C CB  . ASP C  2 237 ? -3.416  -29.939  46.634  1.00 42.01  ? 230  ASP C CB  1 
ATOM   5079  C CG  . ASP C  2 237 ? -4.071  -30.456  45.367  1.00 41.98  ? 230  ASP C CG  1 
ATOM   5080  O OD1 . ASP C  2 237 ? -5.245  -30.879  45.429  1.00 44.74  ? 230  ASP C OD1 1 
ATOM   5081  O OD2 . ASP C  2 237 ? -3.410  -30.444  44.308  1.00 41.60  ? 230  ASP C OD2 1 
ATOM   5082  N N   . GLY C  2 238 ? -6.588  -28.485  47.090  1.00 32.09  ? 231  GLY C N   1 
ATOM   5083  C CA  . GLY C  2 238 ? -7.487  -27.486  46.546  1.00 37.37  ? 231  GLY C CA  1 
ATOM   5084  C C   . GLY C  2 238 ? -7.373  -27.346  45.042  1.00 43.10  ? 231  GLY C C   1 
ATOM   5085  O O   . GLY C  2 238 ? -7.680  -26.293  44.486  1.00 47.78  ? 231  GLY C O   1 
ATOM   5086  N N   . GLY C  2 239 ? -6.929  -28.412  44.382  1.00 38.62  ? 232  GLY C N   1 
ATOM   5087  C CA  . GLY C  2 239 ? -6.806  -28.420  42.936  1.00 34.62  ? 232  GLY C CA  1 
ATOM   5088  C C   . GLY C  2 239 ? -5.461  -27.910  42.457  1.00 32.96  ? 232  GLY C C   1 
ATOM   5089  O O   . GLY C  2 239 ? -5.313  -27.508  41.303  1.00 31.37  ? 232  GLY C O   1 
ATOM   5090  N N   . LEU C  2 240 ? -4.477  -27.931  43.348  1.00 38.08  ? 233  LEU C N   1 
ATOM   5091  C CA  . LEU C  2 240 ? -3.140  -27.444  43.030  1.00 38.75  ? 233  LEU C CA  1 
ATOM   5092  C C   . LEU C  2 240 ? -2.440  -28.341  42.011  1.00 37.54  ? 233  LEU C C   1 
ATOM   5093  O O   . LEU C  2 240 ? -1.626  -27.873  41.214  1.00 32.19  ? 233  LEU C O   1 
ATOM   5094  C CB  . LEU C  2 240 ? -2.300  -27.341  44.306  1.00 40.43  ? 233  LEU C CB  1 
ATOM   5095  C CG  . LEU C  2 240 ? -0.856  -26.857  44.163  1.00 40.85  ? 233  LEU C CG  1 
ATOM   5096  C CD1 . LEU C  2 240 ? -0.809  -25.469  43.542  1.00 41.87  ? 233  LEU C CD1 1 
ATOM   5097  C CD2 . LEU C  2 240 ? -0.156  -26.870  45.512  1.00 37.30  ? 233  LEU C CD2 1 
ATOM   5098  N N   . GLN C  2 241 ? -2.771  -29.629  42.032  1.00 38.73  ? 234  GLN C N   1 
ATOM   5099  C CA  . GLN C  2 241 ? -2.121  -30.603  41.158  1.00 38.69  ? 234  GLN C CA  1 
ATOM   5100  C C   . GLN C  2 241 ? -2.512  -30.432  39.691  1.00 45.60  ? 234  GLN C C   1 
ATOM   5101  O O   . GLN C  2 241 ? -1.933  -31.066  38.811  1.00 43.65  ? 234  GLN C O   1 
ATOM   5102  C CB  . GLN C  2 241 ? -2.445  -32.027  41.614  1.00 31.66  ? 234  GLN C CB  1 
ATOM   5103  C CG  . GLN C  2 241 ? -3.928  -32.351  41.640  1.00 34.91  ? 234  GLN C CG  1 
ATOM   5104  C CD  . GLN C  2 241 ? -4.197  -33.809  41.958  1.00 39.96  ? 234  GLN C CD  1 
ATOM   5105  O OE1 . GLN C  2 241 ? -3.304  -34.651  41.866  1.00 43.38  ? 234  GLN C OE1 1 
ATOM   5106  N NE2 . GLN C  2 241 ? -5.433  -34.114  42.338  1.00 37.72  ? 234  GLN C NE2 1 
ATOM   5107  N N   . LEU C  2 242 ? -3.495  -29.579  39.431  1.00 49.96  ? 235  LEU C N   1 
ATOM   5108  C CA  . LEU C  2 242 ? -3.910  -29.296  38.063  1.00 54.18  ? 235  LEU C CA  1 
ATOM   5109  C C   . LEU C  2 242 ? -3.157  -28.084  37.518  1.00 58.60  ? 235  LEU C C   1 
ATOM   5110  O O   . LEU C  2 242 ? -3.403  -27.635  36.397  1.00 59.12  ? 235  LEU C O   1 
ATOM   5111  C CB  . LEU C  2 242 ? -5.420  -29.062  37.999  1.00 55.36  ? 235  LEU C CB  1 
ATOM   5112  C CG  . LEU C  2 242 ? -6.294  -30.131  38.663  1.00 53.13  ? 235  LEU C CG  1 
ATOM   5113  C CD1 . LEU C  2 242 ? -7.771  -29.822  38.468  1.00 53.06  ? 235  LEU C CD1 1 
ATOM   5114  C CD2 . LEU C  2 242 ? -5.959  -31.522  38.142  1.00 52.74  ? 235  LEU C CD2 1 
ATOM   5115  N N   . ILE C  2 243 ? -2.236  -27.565  38.324  1.00 60.57  ? 236  ILE C N   1 
ATOM   5116  C CA  . ILE C  2 243 ? -1.477  -26.370  37.972  1.00 62.51  ? 236  ILE C CA  1 
ATOM   5117  C C   . ILE C  2 243 ? 0.026   -26.620  38.018  1.00 65.73  ? 236  ILE C C   1 
ATOM   5118  O O   . ILE C  2 243 ? 0.780   -26.091  37.199  1.00 69.64  ? 236  ILE C O   1 
ATOM   5119  C CB  . ILE C  2 243 ? -1.808  -25.202  38.919  1.00 65.60  ? 236  ILE C CB  1 
ATOM   5120  C CG1 . ILE C  2 243 ? -3.319  -25.027  39.047  1.00 63.04  ? 236  ILE C CG1 1 
ATOM   5121  C CG2 . ILE C  2 243 ? -1.153  -23.912  38.440  1.00 71.39  ? 236  ILE C CG2 1 
ATOM   5122  C CD1 . ILE C  2 243 ? -3.708  -23.980  40.045  1.00 63.63  ? 236  ILE C CD1 1 
ATOM   5123  N N   . LEU C  2 244 ? 0.453   -27.427  38.984  1.00 62.61  ? 237  LEU C N   1 
ATOM   5124  C CA  . LEU C  2 244 ? 1.869   -27.689  39.211  1.00 63.40  ? 237  LEU C CA  1 
ATOM   5125  C C   . LEU C  2 244 ? 2.538   -28.310  37.988  1.00 66.57  ? 237  LEU C C   1 
ATOM   5126  O O   . LEU C  2 244 ? 2.873   -29.494  37.986  1.00 68.11  ? 237  LEU C O   1 
ATOM   5127  C CB  . LEU C  2 244 ? 2.048   -28.605  40.424  1.00 56.76  ? 237  LEU C CB  1 
ATOM   5128  C CG  . LEU C  2 244 ? 3.213   -28.271  41.357  1.00 49.86  ? 237  LEU C CG  1 
ATOM   5129  C CD1 . LEU C  2 244 ? 2.946   -26.966  42.096  1.00 46.10  ? 237  LEU C CD1 1 
ATOM   5130  C CD2 . LEU C  2 244 ? 3.467   -29.408  42.334  1.00 47.64  ? 237  LEU C CD2 1 
ATOM   5131  N N   . SER D  3 3   ? -22.638 -42.831  64.259  1.00 111.35 ? 3    SER D N   1 
ATOM   5132  C CA  . SER D  3 3   ? -23.676 -41.924  64.729  1.00 113.11 ? 3    SER D CA  1 
ATOM   5133  C C   . SER D  3 3   ? -23.108 -40.531  64.971  1.00 112.27 ? 3    SER D C   1 
ATOM   5134  O O   . SER D  3 3   ? -23.848 -39.578  65.213  1.00 114.47 ? 3    SER D O   1 
ATOM   5135  C CB  . SER D  3 3   ? -24.321 -42.460  66.008  1.00 117.51 ? 3    SER D CB  1 
ATOM   5136  O OG  . SER D  3 3   ? -25.369 -41.608  66.449  1.00 118.10 ? 3    SER D OG  1 
ATOM   5137  N N   . GLN D  3 4   ? -21.785 -40.422  64.899  1.00 102.90 ? 4    GLN D N   1 
ATOM   5138  C CA  . GLN D  3 4   ? -21.104 -39.154  65.123  1.00 95.91  ? 4    GLN D CA  1 
ATOM   5139  C C   . GLN D  3 4   ? -21.272 -38.243  63.912  1.00 88.39  ? 4    GLN D C   1 
ATOM   5140  O O   . GLN D  3 4   ? -21.067 -37.031  63.996  1.00 90.33  ? 4    GLN D O   1 
ATOM   5141  C CB  . GLN D  3 4   ? -19.620 -39.390  65.419  1.00 92.34  ? 4    GLN D CB  1 
ATOM   5142  C CG  . GLN D  3 4   ? -18.906 -38.209  66.057  1.00 90.15  ? 4    GLN D CG  1 
ATOM   5143  C CD  . GLN D  3 4   ? -17.501 -38.560  66.509  1.00 89.42  ? 4    GLN D CD  1 
ATOM   5144  O OE1 . GLN D  3 4   ? -16.641 -37.689  66.636  1.00 91.34  ? 4    GLN D OE1 1 
ATOM   5145  N NE2 . GLN D  3 4   ? -17.263 -39.844  66.758  1.00 88.39  ? 4    GLN D NE2 1 
ATOM   5146  N N   . LEU D  3 5   ? -21.656 -38.841  62.788  1.00 79.42  ? 5    LEU D N   1 
ATOM   5147  C CA  . LEU D  3 5   ? -21.854 -38.110  61.543  1.00 72.18  ? 5    LEU D CA  1 
ATOM   5148  C C   . LEU D  3 5   ? -23.323 -38.122  61.129  1.00 67.62  ? 5    LEU D C   1 
ATOM   5149  O O   . LEU D  3 5   ? -23.638 -38.236  59.945  1.00 63.93  ? 5    LEU D O   1 
ATOM   5150  C CB  . LEU D  3 5   ? -20.996 -38.715  60.430  1.00 69.44  ? 5    LEU D CB  1 
ATOM   5151  C CG  . LEU D  3 5   ? -19.555 -39.080  60.794  1.00 73.88  ? 5    LEU D CG  1 
ATOM   5152  C CD1 . LEU D  3 5   ? -18.954 -40.002  59.743  1.00 71.30  ? 5    LEU D CD1 1 
ATOM   5153  C CD2 . LEU D  3 5   ? -18.707 -37.829  60.963  1.00 76.13  ? 5    LEU D CD2 1 
ATOM   5154  N N   . GLN D  3 6   ? -24.219 -38.008  62.105  1.00 65.74  ? 6    GLN D N   1 
ATOM   5155  C CA  . GLN D  3 6   ? -25.652 -38.094  61.835  1.00 64.51  ? 6    GLN D CA  1 
ATOM   5156  C C   . GLN D  3 6   ? -26.225 -36.759  61.367  1.00 65.56  ? 6    GLN D C   1 
ATOM   5157  O O   . GLN D  3 6   ? -27.268 -36.717  60.715  1.00 63.64  ? 6    GLN D O   1 
ATOM   5158  C CB  . GLN D  3 6   ? -26.402 -38.580  63.079  1.00 67.09  ? 6    GLN D CB  1 
ATOM   5159  C CG  . GLN D  3 6   ? -26.388 -37.602  64.242  1.00 72.02  ? 6    GLN D CG  1 
ATOM   5160  C CD  . GLN D  3 6   ? -27.224 -38.080  65.413  1.00 78.61  ? 6    GLN D CD  1 
ATOM   5161  O OE1 . GLN D  3 6   ? -27.235 -39.267  65.740  1.00 80.52  ? 6    GLN D OE1 1 
ATOM   5162  N NE2 . GLN D  3 6   ? -27.937 -37.157  66.047  1.00 81.82  ? 6    GLN D NE2 1 
ATOM   5163  N N   . ASN D  3 7   ? -25.540 -35.672  61.707  1.00 67.24  ? 7    ASN D N   1 
ATOM   5164  C CA  . ASN D  3 7   ? -25.951 -34.339  61.283  1.00 62.98  ? 7    ASN D CA  1 
ATOM   5165  C C   . ASN D  3 7   ? -24.881 -33.704  60.406  1.00 58.70  ? 7    ASN D C   1 
ATOM   5166  O O   . ASN D  3 7   ? -24.837 -32.485  60.236  1.00 60.82  ? 7    ASN D O   1 
ATOM   5167  C CB  . ASN D  3 7   ? -26.238 -33.452  62.494  1.00 65.75  ? 7    ASN D CB  1 
ATOM   5168  C CG  . ASN D  3 7   ? -27.277 -34.051  63.419  1.00 69.11  ? 7    ASN D CG  1 
ATOM   5169  O OD1 . ASN D  3 7   ? -27.001 -34.326  64.587  1.00 74.37  ? 7    ASN D OD1 1 
ATOM   5170  N ND2 . ASN D  3 7   ? -28.482 -34.258  62.901  1.00 66.39  ? 7    ASN D ND2 1 
ATOM   5171  N N   . ARG D  3 8   ? -24.019 -34.553  59.857  1.00 56.02  ? 8    ARG D N   1 
ATOM   5172  C CA  . ARG D  3 8   ? -22.901 -34.122  59.027  1.00 57.79  ? 8    ARG D CA  1 
ATOM   5173  C C   . ARG D  3 8   ? -23.374 -33.364  57.790  1.00 57.93  ? 8    ARG D C   1 
ATOM   5174  O O   . ARG D  3 8   ? -22.706 -32.443  57.320  1.00 59.42  ? 8    ARG D O   1 
ATOM   5175  C CB  . ARG D  3 8   ? -22.067 -35.335  58.615  1.00 61.43  ? 8    ARG D CB  1 
ATOM   5176  C CG  . ARG D  3 8   ? -20.743 -35.013  57.948  1.00 63.48  ? 8    ARG D CG  1 
ATOM   5177  C CD  . ARG D  3 8   ? -20.080 -36.292  57.465  1.00 62.03  ? 8    ARG D CD  1 
ATOM   5178  N NE  . ARG D  3 8   ? -18.682 -36.096  57.099  1.00 59.15  ? 8    ARG D NE  1 
ATOM   5179  C CZ  . ARG D  3 8   ? -17.900 -37.054  56.616  1.00 56.22  ? 8    ARG D CZ  1 
ATOM   5180  N NH1 . ARG D  3 8   ? -18.381 -38.277  56.434  1.00 46.74  ? 8    ARG D NH1 1 
ATOM   5181  N NH2 . ARG D  3 8   ? -16.637 -36.792  56.311  1.00 62.52  ? 8    ARG D NH2 1 
ATOM   5182  N N   . LEU D  3 9   ? -24.532 -33.758  57.270  1.00 52.35  ? 9    LEU D N   1 
ATOM   5183  C CA  . LEU D  3 9   ? -25.087 -33.130  56.077  1.00 47.19  ? 9    LEU D CA  1 
ATOM   5184  C C   . LEU D  3 9   ? -26.494 -32.598  56.324  1.00 55.40  ? 9    LEU D C   1 
ATOM   5185  O O   . LEU D  3 9   ? -27.384 -32.761  55.489  1.00 53.00  ? 9    LEU D O   1 
ATOM   5186  C CB  . LEU D  3 9   ? -25.097 -34.121  54.913  1.00 36.72  ? 9    LEU D CB  1 
ATOM   5187  C CG  . LEU D  3 9   ? -23.715 -34.565  54.431  1.00 33.32  ? 9    LEU D CG  1 
ATOM   5188  C CD1 . LEU D  3 9   ? -23.832 -35.580  53.309  1.00 31.32  ? 9    LEU D CD1 1 
ATOM   5189  C CD2 . LEU D  3 9   ? -22.907 -33.359  53.986  1.00 30.80  ? 9    LEU D CD2 1 
ATOM   5190  N N   . ARG D  3 10  ? -26.688 -31.960  57.474  1.00 66.71  ? 10   ARG D N   1 
ATOM   5191  C CA  . ARG D  3 10  ? -27.979 -31.376  57.816  1.00 76.34  ? 10   ARG D CA  1 
ATOM   5192  C C   . ARG D  3 10  ? -28.284 -30.178  56.924  1.00 86.12  ? 10   ARG D C   1 
ATOM   5193  O O   . ARG D  3 10  ? -27.382 -29.420  56.563  1.00 85.00  ? 10   ARG D O   1 
ATOM   5194  C CB  . ARG D  3 10  ? -28.010 -30.961  59.288  1.00 75.59  ? 10   ARG D CB  1 
ATOM   5195  N N   . SER D  3 11  ? -29.559 -30.021  56.574  1.00 100.49 ? 11   SER D N   1 
ATOM   5196  C CA  . SER D  3 11  ? -30.020 -28.939  55.704  1.00 105.43 ? 11   SER D CA  1 
ATOM   5197  C C   . SER D  3 11  ? -29.292 -28.940  54.363  1.00 99.53  ? 11   SER D C   1 
ATOM   5198  O O   . SER D  3 11  ? -28.983 -27.883  53.811  1.00 102.15 ? 11   SER D O   1 
ATOM   5199  C CB  . SER D  3 11  ? -29.851 -27.582  56.395  1.00 109.09 ? 11   SER D CB  1 
ATOM   5200  N N   . ALA D  3 12  ? -29.021 -30.133  53.844  1.00 80.36  ? 12   ALA D N   1 
ATOM   5201  C CA  . ALA D  3 12  ? -28.341 -30.274  52.563  1.00 64.59  ? 12   ALA D CA  1 
ATOM   5202  C C   . ALA D  3 12  ? -29.182 -31.089  51.588  1.00 61.38  ? 12   ALA D C   1 
ATOM   5203  O O   . ALA D  3 12  ? -29.718 -32.139  51.944  1.00 66.03  ? 12   ALA D O   1 
ATOM   5204  C CB  . ALA D  3 12  ? -26.978 -30.916  52.753  1.00 54.86  ? 12   ALA D CB  1 
ATOM   5205  N N   . LEU D  3 13  ? -29.296 -30.598  50.358  1.00 55.95  ? 13   LEU D N   1 
ATOM   5206  C CA  . LEU D  3 13  ? -30.056 -31.289  49.324  1.00 48.61  ? 13   LEU D CA  1 
ATOM   5207  C C   . LEU D  3 13  ? -29.124 -32.044  48.384  1.00 44.31  ? 13   LEU D C   1 
ATOM   5208  O O   . LEU D  3 13  ? -28.311 -31.441  47.683  1.00 41.04  ? 13   LEU D O   1 
ATOM   5209  C CB  . LEU D  3 13  ? -30.915 -30.299  48.537  1.00 46.27  ? 13   LEU D CB  1 
ATOM   5210  C CG  . LEU D  3 13  ? -31.757 -30.880  47.400  1.00 37.61  ? 13   LEU D CG  1 
ATOM   5211  C CD1 . LEU D  3 13  ? -32.724 -31.929  47.926  1.00 33.00  ? 13   LEU D CD1 1 
ATOM   5212  C CD2 . LEU D  3 13  ? -32.502 -29.774  46.673  1.00 35.49  ? 13   LEU D CD2 1 
ATOM   5213  N N   . ALA D  3 14  ? -29.248 -33.368  48.373  1.00 45.51  ? 14   ALA D N   1 
ATOM   5214  C CA  . ALA D  3 14  ? -28.359 -34.213  47.586  1.00 41.17  ? 14   ALA D CA  1 
ATOM   5215  C C   . ALA D  3 14  ? -29.076 -34.867  46.409  1.00 43.26  ? 14   ALA D C   1 
ATOM   5216  O O   . ALA D  3 14  ? -30.018 -35.637  46.594  1.00 48.66  ? 14   ALA D O   1 
ATOM   5217  C CB  . ALA D  3 14  ? -27.730 -35.275  48.470  1.00 42.03  ? 14   ALA D CB  1 
ATOM   5218  N N   . LEU D  3 15  ? -28.620 -34.556  45.200  1.00 41.14  ? 15   LEU D N   1 
ATOM   5219  C CA  . LEU D  3 15  ? -29.152 -35.179  43.994  1.00 39.76  ? 15   LEU D CA  1 
ATOM   5220  C C   . LEU D  3 15  ? -28.304 -36.382  43.597  1.00 41.32  ? 15   LEU D C   1 
ATOM   5221  O O   . LEU D  3 15  ? -27.109 -36.249  43.331  1.00 40.73  ? 15   LEU D O   1 
ATOM   5222  C CB  . LEU D  3 15  ? -29.209 -34.172  42.845  1.00 39.27  ? 15   LEU D CB  1 
ATOM   5223  C CG  . LEU D  3 15  ? -29.614 -34.736  41.480  1.00 38.68  ? 15   LEU D CG  1 
ATOM   5224  C CD1 . LEU D  3 15  ? -31.028 -35.296  41.525  1.00 39.03  ? 15   LEU D CD1 1 
ATOM   5225  C CD2 . LEU D  3 15  ? -29.487 -33.676  40.396  1.00 39.38  ? 15   LEU D CD2 1 
ATOM   5226  N N   . VAL D  3 16  ? -28.926 -37.556  43.561  1.00 40.81  ? 16   VAL D N   1 
ATOM   5227  C CA  . VAL D  3 16  ? -28.216 -38.784  43.222  1.00 36.81  ? 16   VAL D CA  1 
ATOM   5228  C C   . VAL D  3 16  ? -28.834 -39.478  42.013  1.00 38.79  ? 16   VAL D C   1 
ATOM   5229  O O   . VAL D  3 16  ? -29.954 -39.985  42.084  1.00 39.76  ? 16   VAL D O   1 
ATOM   5230  C CB  . VAL D  3 16  ? -28.200 -39.770  44.407  1.00 34.29  ? 16   VAL D CB  1 
ATOM   5231  C CG1 . VAL D  3 16  ? -27.443 -41.036  44.035  1.00 31.61  ? 16   VAL D CG1 1 
ATOM   5232  C CG2 . VAL D  3 16  ? -27.585 -39.117  45.636  1.00 33.98  ? 16   VAL D CG2 1 
ATOM   5233  N N   . THR D  3 17  ? -28.104 -39.495  40.902  1.00 38.45  ? 17   THR D N   1 
ATOM   5234  C CA  . THR D  3 17  ? -28.544 -40.225  39.718  1.00 40.11  ? 17   THR D CA  1 
ATOM   5235  C C   . THR D  3 17  ? -28.152 -41.690  39.852  1.00 42.03  ? 17   THR D C   1 
ATOM   5236  O O   . THR D  3 17  ? -27.210 -42.022  40.571  1.00 43.98  ? 17   THR D O   1 
ATOM   5237  C CB  . THR D  3 17  ? -27.941 -39.647  38.423  1.00 39.02  ? 17   THR D CB  1 
ATOM   5238  O OG1 . THR D  3 17  ? -26.541 -39.948  38.364  1.00 39.28  ? 17   THR D OG1 1 
ATOM   5239  C CG2 . THR D  3 17  ? -28.141 -38.140  38.365  1.00 36.78  ? 17   THR D CG2 1 
ATOM   5240  N N   . GLY D  3 18  ? -28.876 -42.564  39.161  1.00 42.13  ? 18   GLY D N   1 
ATOM   5241  C CA  . GLY D  3 18  ? -28.632 -43.992  39.252  1.00 43.26  ? 18   GLY D CA  1 
ATOM   5242  C C   . GLY D  3 18  ? -28.886 -44.505  40.655  1.00 42.40  ? 18   GLY D C   1 
ATOM   5243  O O   . GLY D  3 18  ? -28.272 -45.477  41.094  1.00 40.39  ? 18   GLY D O   1 
ATOM   5244  N N   . ALA D  3 19  ? -29.805 -43.847  41.357  1.00 45.38  ? 19   ALA D N   1 
ATOM   5245  C CA  . ALA D  3 19  ? -30.107 -44.174  42.745  1.00 41.08  ? 19   ALA D CA  1 
ATOM   5246  C C   . ALA D  3 19  ? -31.092 -45.332  42.857  1.00 47.73  ? 19   ALA D C   1 
ATOM   5247  O O   . ALA D  3 19  ? -31.584 -45.634  43.944  1.00 53.55  ? 19   ALA D O   1 
ATOM   5248  C CB  . ALA D  3 19  ? -30.653 -42.950  43.464  1.00 37.02  ? 19   ALA D CB  1 
ATOM   5249  N N   . GLY D  3 20  ? -31.374 -45.978  41.731  1.00 53.75  ? 20   GLY D N   1 
ATOM   5250  C CA  . GLY D  3 20  ? -32.312 -47.084  41.703  1.00 60.87  ? 20   GLY D CA  1 
ATOM   5251  C C   . GLY D  3 20  ? -31.792 -48.324  42.404  1.00 63.14  ? 20   GLY D C   1 
ATOM   5252  O O   . GLY D  3 20  ? -32.558 -49.054  43.033  1.00 66.75  ? 20   GLY D O   1 
ATOM   5253  N N   . SER D  3 21  ? -30.489 -48.562  42.296  1.00 58.53  ? 21   SER D N   1 
ATOM   5254  C CA  . SER D  3 21  ? -29.875 -49.735  42.908  1.00 59.44  ? 21   SER D CA  1 
ATOM   5255  C C   . SER D  3 21  ? -28.369 -49.569  43.061  1.00 55.98  ? 21   SER D C   1 
ATOM   5256  O O   . SER D  3 21  ? -27.802 -48.551  42.663  1.00 56.80  ? 21   SER D O   1 
ATOM   5257  C CB  . SER D  3 21  ? -30.173 -50.987  42.079  1.00 64.16  ? 21   SER D CB  1 
ATOM   5258  O OG  . SER D  3 21  ? -29.547 -50.919  40.809  1.00 63.28  ? 21   SER D OG  1 
ATOM   5259  N N   . GLY D  3 22  ? -27.731 -50.581  43.643  1.00 54.81  ? 22   GLY D N   1 
ATOM   5260  C CA  . GLY D  3 22  ? -26.286 -50.618  43.773  1.00 57.35  ? 22   GLY D CA  1 
ATOM   5261  C C   . GLY D  3 22  ? -25.696 -49.460  44.552  1.00 51.45  ? 22   GLY D C   1 
ATOM   5262  O O   . GLY D  3 22  ? -26.170 -49.117  45.635  1.00 51.44  ? 22   GLY D O   1 
ATOM   5263  N N   . ILE D  3 23  ? -24.652 -48.859  43.989  1.00 52.39  ? 23   ILE D N   1 
ATOM   5264  C CA  . ILE D  3 23  ? -23.954 -47.750  44.628  1.00 49.53  ? 23   ILE D CA  1 
ATOM   5265  C C   . ILE D  3 23  ? -24.861 -46.534  44.792  1.00 51.26  ? 23   ILE D C   1 
ATOM   5266  O O   . ILE D  3 23  ? -24.881 -45.905  45.850  1.00 53.40  ? 23   ILE D O   1 
ATOM   5267  C CB  . ILE D  3 23  ? -22.701 -47.348  43.826  1.00 45.14  ? 23   ILE D CB  1 
ATOM   5268  C CG1 . ILE D  3 23  ? -21.726 -48.525  43.740  1.00 46.86  ? 23   ILE D CG1 1 
ATOM   5269  C CG2 . ILE D  3 23  ? -22.025 -46.140  44.453  1.00 42.17  ? 23   ILE D CG2 1 
ATOM   5270  C CD1 . ILE D  3 23  ? -20.472 -48.226  42.948  1.00 48.78  ? 23   ILE D CD1 1 
ATOM   5271  N N   . GLY D  3 24  ? -25.615 -46.217  43.744  1.00 48.13  ? 24   GLY D N   1 
ATOM   5272  C CA  . GLY D  3 24  ? -26.516 -45.078  43.758  1.00 43.12  ? 24   GLY D CA  1 
ATOM   5273  C C   . GLY D  3 24  ? -27.524 -45.115  44.891  1.00 37.92  ? 24   GLY D C   1 
ATOM   5274  O O   . GLY D  3 24  ? -27.787 -44.096  45.530  1.00 32.02  ? 24   GLY D O   1 
ATOM   5275  N N   . ARG D  3 25  ? -28.091 -46.292  45.138  1.00 38.68  ? 25   ARG D N   1 
ATOM   5276  C CA  . ARG D  3 25  ? -29.031 -46.466  46.238  1.00 42.40  ? 25   ARG D CA  1 
ATOM   5277  C C   . ARG D  3 25  ? -28.313 -46.405  47.582  1.00 45.00  ? 25   ARG D C   1 
ATOM   5278  O O   . ARG D  3 25  ? -28.799 -45.784  48.528  1.00 43.45  ? 25   ARG D O   1 
ATOM   5279  C CB  . ARG D  3 25  ? -29.781 -47.793  46.104  1.00 44.43  ? 25   ARG D CB  1 
ATOM   5280  C CG  . ARG D  3 25  ? -30.562 -48.184  47.350  1.00 45.92  ? 25   ARG D CG  1 
ATOM   5281  C CD  . ARG D  3 25  ? -31.367 -49.451  47.130  1.00 49.22  ? 25   ARG D CD  1 
ATOM   5282  N NE  . ARG D  3 25  ? -32.456 -49.247  46.181  1.00 47.59  ? 25   ARG D NE  1 
ATOM   5283  C CZ  . ARG D  3 25  ? -33.309 -50.195  45.810  1.00 54.76  ? 25   ARG D CZ  1 
ATOM   5284  N NH1 . ARG D  3 25  ? -33.200 -51.419  46.307  1.00 56.64  ? 25   ARG D NH1 1 
ATOM   5285  N NH2 . ARG D  3 25  ? -34.272 -49.919  44.941  1.00 62.51  ? 25   ARG D NH2 1 
ATOM   5286  N N   . ALA D  3 26  ? -27.154 -47.051  47.655  1.00 46.53  ? 26   ALA D N   1 
ATOM   5287  C CA  . ALA D  3 26  ? -26.361 -47.075  48.879  1.00 41.21  ? 26   ALA D CA  1 
ATOM   5288  C C   . ALA D  3 26  ? -25.892 -45.676  49.259  1.00 39.16  ? 26   ALA D C   1 
ATOM   5289  O O   . ALA D  3 26  ? -25.790 -45.346  50.440  1.00 42.11  ? 26   ALA D O   1 
ATOM   5290  C CB  . ALA D  3 26  ? -25.173 -48.006  48.721  1.00 32.44  ? 26   ALA D CB  1 
ATOM   5291  N N   . VAL D  3 27  ? -25.604 -44.859  48.252  1.00 41.27  ? 27   VAL D N   1 
ATOM   5292  C CA  . VAL D  3 27  ? -25.222 -43.470  48.478  1.00 37.81  ? 27   VAL D CA  1 
ATOM   5293  C C   . VAL D  3 27  ? -26.394 -42.690  49.064  1.00 36.10  ? 27   VAL D C   1 
ATOM   5294  O O   . VAL D  3 27  ? -26.236 -41.960  50.042  1.00 36.15  ? 27   VAL D O   1 
ATOM   5295  C CB  . VAL D  3 27  ? -24.742 -42.793  47.176  1.00 37.87  ? 27   VAL D CB  1 
ATOM   5296  C CG1 . VAL D  3 27  ? -24.775 -41.278  47.310  1.00 37.74  ? 27   VAL D CG1 1 
ATOM   5297  C CG2 . VAL D  3 27  ? -23.343 -43.272  46.814  1.00 34.57  ? 27   VAL D CG2 1 
ATOM   5298  N N   . SER D  3 28  ? -27.570 -42.866  48.468  1.00 41.13  ? 28   SER D N   1 
ATOM   5299  C CA  . SER D  3 28  ? -28.783 -42.196  48.927  1.00 42.46  ? 28   SER D CA  1 
ATOM   5300  C C   . SER D  3 28  ? -29.092 -42.524  50.385  1.00 43.92  ? 28   SER D C   1 
ATOM   5301  O O   . SER D  3 28  ? -29.478 -41.647  51.158  1.00 45.00  ? 28   SER D O   1 
ATOM   5302  C CB  . SER D  3 28  ? -29.971 -42.581  48.042  1.00 45.78  ? 28   SER D CB  1 
ATOM   5303  O OG  . SER D  3 28  ? -29.739 -42.218  46.692  1.00 47.73  ? 28   SER D OG  1 
ATOM   5304  N N   . VAL D  3 29  ? -28.916 -43.789  50.754  1.00 41.41  ? 29   VAL D N   1 
ATOM   5305  C CA  . VAL D  3 29  ? -29.131 -44.229  52.128  1.00 41.49  ? 29   VAL D CA  1 
ATOM   5306  C C   . VAL D  3 29  ? -28.121 -43.583  53.070  1.00 39.06  ? 29   VAL D C   1 
ATOM   5307  O O   . VAL D  3 29  ? -28.479 -43.086  54.138  1.00 42.56  ? 29   VAL D O   1 
ATOM   5308  C CB  . VAL D  3 29  ? -29.034 -45.764  52.248  1.00 43.38  ? 29   VAL D CB  1 
ATOM   5309  C CG1 . VAL D  3 29  ? -29.109 -46.195  53.706  1.00 44.16  ? 29   VAL D CG1 1 
ATOM   5310  C CG2 . VAL D  3 29  ? -30.130 -46.431  51.432  1.00 42.43  ? 29   VAL D CG2 1 
ATOM   5311  N N   . ARG D  3 30  ? -26.859 -43.591  52.655  1.00 42.64  ? 30   ARG D N   1 
ATOM   5312  C CA  . ARG D  3 30  ? -25.771 -43.019  53.440  1.00 45.47  ? 30   ARG D CA  1 
ATOM   5313  C C   . ARG D  3 30  ? -25.959 -41.520  53.662  1.00 46.58  ? 30   ARG D C   1 
ATOM   5314  O O   . ARG D  3 30  ? -25.763 -41.019  54.770  1.00 46.25  ? 30   ARG D O   1 
ATOM   5315  C CB  . ARG D  3 30  ? -24.433 -43.282  52.746  1.00 43.42  ? 30   ARG D CB  1 
ATOM   5316  C CG  . ARG D  3 30  ? -23.207 -42.811  53.510  1.00 44.98  ? 30   ARG D CG  1 
ATOM   5317  C CD  . ARG D  3 30  ? -22.925 -43.689  54.717  1.00 51.45  ? 30   ARG D CD  1 
ATOM   5318  N NE  . ARG D  3 30  ? -21.540 -43.559  55.163  1.00 53.28  ? 30   ARG D NE  1 
ATOM   5319  C CZ  . ARG D  3 30  ? -21.110 -42.626  56.005  1.00 51.77  ? 30   ARG D CZ  1 
ATOM   5320  N NH1 . ARG D  3 30  ? -21.958 -41.737  56.501  1.00 52.26  ? 30   ARG D NH1 1 
ATOM   5321  N NH2 . ARG D  3 30  ? -19.831 -42.583  56.353  1.00 50.04  ? 30   ARG D NH2 1 
ATOM   5322  N N   . LEU D  3 31  ? -26.340 -40.810  52.604  1.00 47.99  ? 31   LEU D N   1 
ATOM   5323  C CA  . LEU D  3 31  ? -26.524 -39.365  52.680  1.00 44.53  ? 31   LEU D CA  1 
ATOM   5324  C C   . LEU D  3 31  ? -27.757 -39.001  53.501  1.00 41.23  ? 31   LEU D C   1 
ATOM   5325  O O   . LEU D  3 31  ? -27.749 -38.018  54.241  1.00 40.34  ? 31   LEU D O   1 
ATOM   5326  C CB  . LEU D  3 31  ? -26.630 -38.761  51.277  1.00 45.62  ? 31   LEU D CB  1 
ATOM   5327  C CG  . LEU D  3 31  ? -25.407 -38.921  50.369  1.00 44.24  ? 31   LEU D CG  1 
ATOM   5328  C CD1 . LEU D  3 31  ? -25.597 -38.164  49.064  1.00 40.54  ? 31   LEU D CD1 1 
ATOM   5329  C CD2 . LEU D  3 31  ? -24.133 -38.476  51.073  1.00 42.66  ? 31   LEU D CD2 1 
ATOM   5330  N N   . ALA D  3 32  ? -28.814 -39.797  53.369  1.00 37.35  ? 32   ALA D N   1 
ATOM   5331  C CA  . ALA D  3 32  ? -30.031 -39.576  54.140  1.00 41.33  ? 32   ALA D CA  1 
ATOM   5332  C C   . ALA D  3 32  ? -29.782 -39.849  55.619  1.00 43.18  ? 32   ALA D C   1 
ATOM   5333  O O   . ALA D  3 32  ? -30.375 -39.211  56.488  1.00 43.32  ? 32   ALA D O   1 
ATOM   5334  C CB  . ALA D  3 32  ? -31.161 -40.450  53.620  1.00 45.60  ? 32   ALA D CB  1 
ATOM   5335  N N   . GLY D  3 33  ? -28.896 -40.801  55.895  1.00 43.32  ? 33   GLY D N   1 
ATOM   5336  C CA  . GLY D  3 33  ? -28.539 -41.140  57.259  1.00 44.84  ? 33   GLY D CA  1 
ATOM   5337  C C   . GLY D  3 33  ? -27.714 -40.054  57.923  1.00 49.26  ? 33   GLY D C   1 
ATOM   5338  O O   . GLY D  3 33  ? -27.577 -40.027  59.146  1.00 54.42  ? 33   GLY D O   1 
ATOM   5339  N N   . GLU D  3 34  ? -27.160 -39.157  57.114  1.00 50.29  ? 34   GLU D N   1 
ATOM   5340  C CA  . GLU D  3 34  ? -26.382 -38.039  57.634  1.00 51.53  ? 34   GLU D CA  1 
ATOM   5341  C C   . GLU D  3 34  ? -27.217 -36.763  57.675  1.00 53.40  ? 34   GLU D C   1 
ATOM   5342  O O   . GLU D  3 34  ? -26.678 -35.660  57.761  1.00 54.93  ? 34   GLU D O   1 
ATOM   5343  C CB  . GLU D  3 34  ? -25.121 -37.820  56.796  1.00 49.40  ? 34   GLU D CB  1 
ATOM   5344  C CG  . GLU D  3 34  ? -24.127 -38.968  56.862  1.00 50.87  ? 34   GLU D CG  1 
ATOM   5345  C CD  . GLU D  3 34  ? -22.767 -38.592  56.307  1.00 57.83  ? 34   GLU D CD  1 
ATOM   5346  O OE1 . GLU D  3 34  ? -22.635 -37.477  55.761  1.00 63.57  ? 34   GLU D OE1 1 
ATOM   5347  O OE2 . GLU D  3 34  ? -21.829 -39.408  56.422  1.00 61.17  ? 34   GLU D OE2 1 
ATOM   5348  N N   . GLY D  3 35  ? -28.536 -36.923  57.612  1.00 55.73  ? 35   GLY D N   1 
ATOM   5349  C CA  . GLY D  3 35  ? -29.453 -35.807  57.755  1.00 54.10  ? 35   GLY D CA  1 
ATOM   5350  C C   . GLY D  3 35  ? -29.624 -34.961  56.508  1.00 51.62  ? 35   GLY D C   1 
ATOM   5351  O O   . GLY D  3 35  ? -29.958 -33.779  56.594  1.00 49.12  ? 35   GLY D O   1 
ATOM   5352  N N   . ALA D  3 36  ? -29.401 -35.563  55.344  1.00 49.48  ? 36   ALA D N   1 
ATOM   5353  C CA  . ALA D  3 36  ? -29.546 -34.847  54.083  1.00 49.65  ? 36   ALA D CA  1 
ATOM   5354  C C   . ALA D  3 36  ? -30.759 -35.338  53.302  1.00 53.52  ? 36   ALA D C   1 
ATOM   5355  O O   . ALA D  3 36  ? -30.995 -36.542  53.196  1.00 55.70  ? 36   ALA D O   1 
ATOM   5356  C CB  . ALA D  3 36  ? -28.285 -34.988  53.243  1.00 44.89  ? 36   ALA D CB  1 
ATOM   5357  N N   . THR D  3 37  ? -31.527 -34.399  52.760  1.00 54.85  ? 37   THR D N   1 
ATOM   5358  C CA  . THR D  3 37  ? -32.673 -34.738  51.925  1.00 52.71  ? 37   THR D CA  1 
ATOM   5359  C C   . THR D  3 37  ? -32.194 -35.170  50.544  1.00 51.96  ? 37   THR D C   1 
ATOM   5360  O O   . THR D  3 37  ? -31.571 -34.392  49.822  1.00 51.70  ? 37   THR D O   1 
ATOM   5361  C CB  . THR D  3 37  ? -33.649 -33.557  51.787  1.00 52.62  ? 37   THR D CB  1 
ATOM   5362  O OG1 . THR D  3 37  ? -34.073 -33.129  53.088  1.00 55.36  ? 37   THR D OG1 1 
ATOM   5363  C CG2 . THR D  3 37  ? -34.865 -33.968  50.975  1.00 53.26  ? 37   THR D CG2 1 
ATOM   5364  N N   . VAL D  3 38  ? -32.487 -36.414  50.183  1.00 50.94  ? 38   VAL D N   1 
ATOM   5365  C CA  . VAL D  3 38  ? -31.975 -36.988  48.946  1.00 45.69  ? 38   VAL D CA  1 
ATOM   5366  C C   . VAL D  3 38  ? -32.971 -36.901  47.795  1.00 49.86  ? 38   VAL D C   1 
ATOM   5367  O O   . VAL D  3 38  ? -34.110 -37.356  47.905  1.00 51.20  ? 38   VAL D O   1 
ATOM   5368  C CB  . VAL D  3 38  ? -31.579 -38.465  49.142  1.00 39.73  ? 38   VAL D CB  1 
ATOM   5369  C CG1 . VAL D  3 38  ? -31.170 -39.089  47.816  1.00 35.99  ? 38   VAL D CG1 1 
ATOM   5370  C CG2 . VAL D  3 38  ? -30.458 -38.582  50.161  1.00 38.87  ? 38   VAL D CG2 1 
ATOM   5371  N N   . ALA D  3 39  ? -32.530 -36.308  46.690  1.00 50.72  ? 39   ALA D N   1 
ATOM   5372  C CA  . ALA D  3 39  ? -33.291 -36.331  45.450  1.00 51.02  ? 39   ALA D CA  1 
ATOM   5373  C C   . ALA D  3 39  ? -32.845 -37.526  44.615  1.00 51.22  ? 39   ALA D C   1 
ATOM   5374  O O   . ALA D  3 39  ? -31.828 -37.467  43.924  1.00 52.35  ? 39   ALA D O   1 
ATOM   5375  C CB  . ALA D  3 39  ? -33.110 -35.034  44.680  1.00 49.39  ? 39   ALA D CB  1 
ATOM   5376  N N   . ALA D  3 40  ? -33.605 -38.613  44.693  1.00 56.32  ? 40   ALA D N   1 
ATOM   5377  C CA  . ALA D  3 40  ? -33.234 -39.854  44.024  1.00 57.84  ? 40   ALA D CA  1 
ATOM   5378  C C   . ALA D  3 40  ? -33.692 -39.878  42.569  1.00 58.11  ? 40   ALA D C   1 
ATOM   5379  O O   . ALA D  3 40  ? -34.889 -39.909  42.283  1.00 58.21  ? 40   ALA D O   1 
ATOM   5380  C CB  . ALA D  3 40  ? -33.805 -41.047  44.777  1.00 61.25  ? 40   ALA D CB  1 
ATOM   5381  N N   . CYS D  3 41  ? -32.728 -39.866  41.654  1.00 56.86  ? 41   CYS D N   1 
ATOM   5382  C CA  . CYS D  3 41  ? -33.021 -39.960  40.229  1.00 54.59  ? 41   CYS D CA  1 
ATOM   5383  C C   . CYS D  3 41  ? -32.492 -41.267  39.652  1.00 53.97  ? 41   CYS D C   1 
ATOM   5384  O O   . CYS D  3 41  ? -31.467 -41.783  40.099  1.00 53.38  ? 41   CYS D O   1 
ATOM   5385  C CB  . CYS D  3 41  ? -32.422 -38.775  39.472  1.00 51.36  ? 41   CYS D CB  1 
ATOM   5386  S SG  . CYS D  3 41  ? -32.531 -38.932  37.675  1.00 48.94  ? 41   CYS D SG  1 
ATOM   5387  N N   . ASP D  3 42  ? -33.195 -41.792  38.653  1.00 53.26  ? 42   ASP D N   1 
ATOM   5388  C CA  . ASP D  3 42  ? -32.823 -43.055  38.029  1.00 51.94  ? 42   ASP D CA  1 
ATOM   5389  C C   . ASP D  3 42  ? -33.585 -43.252  36.724  1.00 57.89  ? 42   ASP D C   1 
ATOM   5390  O O   . ASP D  3 42  ? -34.637 -42.647  36.515  1.00 65.08  ? 42   ASP D O   1 
ATOM   5391  C CB  . ASP D  3 42  ? -33.096 -44.223  38.982  1.00 48.83  ? 42   ASP D CB  1 
ATOM   5392  C CG  . ASP D  3 42  ? -32.500 -45.527  38.494  1.00 40.20  ? 42   ASP D CG  1 
ATOM   5393  O OD1 . ASP D  3 42  ? -33.171 -46.238  37.719  1.00 42.95  ? 42   ASP D OD1 1 
ATOM   5394  O OD2 . ASP D  3 42  ? -31.358 -45.841  38.886  1.00 39.37  ? 42   ASP D OD2 1 
ATOM   5395  N N   . LEU D  3 43  ? -33.048 -44.094  35.846  1.00 57.55  ? 43   LEU D N   1 
ATOM   5396  C CA  . LEU D  3 43  ? -33.730 -44.444  34.606  1.00 56.96  ? 43   LEU D CA  1 
ATOM   5397  C C   . LEU D  3 43  ? -35.040 -45.156  34.922  1.00 57.78  ? 43   LEU D C   1 
ATOM   5398  O O   . LEU D  3 43  ? -36.073 -44.884  34.310  1.00 60.26  ? 43   LEU D O   1 
ATOM   5399  C CB  . LEU D  3 43  ? -32.839 -45.325  33.729  1.00 50.49  ? 43   LEU D CB  1 
ATOM   5400  C CG  . LEU D  3 43  ? -33.340 -45.608  32.313  1.00 50.07  ? 43   LEU D CG  1 
ATOM   5401  C CD1 . LEU D  3 43  ? -33.412 -44.322  31.504  1.00 51.05  ? 43   LEU D CD1 1 
ATOM   5402  C CD2 . LEU D  3 43  ? -32.451 -46.632  31.626  1.00 50.77  ? 43   LEU D CD2 1 
ATOM   5403  N N   . ASP D  3 44  ? -34.984 -46.070  35.886  1.00 57.94  ? 44   ASP D N   1 
ATOM   5404  C CA  . ASP D  3 44  ? -36.172 -46.757  36.374  1.00 57.11  ? 44   ASP D CA  1 
ATOM   5405  C C   . ASP D  3 44  ? -36.869 -45.884  37.412  1.00 55.42  ? 44   ASP D C   1 
ATOM   5406  O O   . ASP D  3 44  ? -36.281 -45.532  38.433  1.00 57.99  ? 44   ASP D O   1 
ATOM   5407  C CB  . ASP D  3 44  ? -35.801 -48.118  36.971  1.00 60.05  ? 44   ASP D CB  1 
ATOM   5408  C CG  . ASP D  3 44  ? -37.010 -49.014  37.203  1.00 70.83  ? 44   ASP D CG  1 
ATOM   5409  O OD1 . ASP D  3 44  ? -38.122 -48.494  37.430  1.00 77.45  ? 44   ASP D OD1 1 
ATOM   5410  O OD2 . ASP D  3 44  ? -36.842 -50.251  37.160  1.00 71.96  ? 44   ASP D OD2 1 
ATOM   5411  N N   . ARG D  3 45  ? -38.122 -45.535  37.143  1.00 58.45  ? 45   ARG D N   1 
ATOM   5412  C CA  . ARG D  3 45  ? -38.892 -44.691  38.049  1.00 60.57  ? 45   ARG D CA  1 
ATOM   5413  C C   . ARG D  3 45  ? -39.238 -45.432  39.338  1.00 60.12  ? 45   ARG D C   1 
ATOM   5414  O O   . ARG D  3 45  ? -39.146 -44.871  40.430  1.00 54.93  ? 45   ARG D O   1 
ATOM   5415  C CB  . ARG D  3 45  ? -40.171 -44.199  37.365  1.00 65.83  ? 45   ARG D CB  1 
ATOM   5416  C CG  . ARG D  3 45  ? -41.016 -43.270  38.222  1.00 67.31  ? 45   ARG D CG  1 
ATOM   5417  C CD  . ARG D  3 45  ? -42.290 -42.853  37.502  1.00 73.00  ? 45   ARG D CD  1 
ATOM   5418  N NE  . ARG D  3 45  ? -42.012 -42.142  36.257  1.00 75.55  ? 45   ARG D NE  1 
ATOM   5419  C CZ  . ARG D  3 45  ? -41.839 -40.827  36.171  1.00 77.37  ? 45   ARG D CZ  1 
ATOM   5420  N NH1 . ARG D  3 45  ? -41.915 -40.072  37.259  1.00 77.00  ? 45   ARG D NH1 1 
ATOM   5421  N NH2 . ARG D  3 45  ? -41.590 -40.265  34.996  1.00 79.11  ? 45   ARG D NH2 1 
ATOM   5422  N N   . ALA D  3 46  ? -39.631 -46.694  39.202  1.00 61.70  ? 46   ALA D N   1 
ATOM   5423  C CA  . ALA D  3 46  ? -40.033 -47.505  40.346  1.00 60.58  ? 46   ALA D CA  1 
ATOM   5424  C C   . ALA D  3 46  ? -38.856 -47.800  41.270  1.00 57.07  ? 46   ALA D C   1 
ATOM   5425  O O   . ALA D  3 46  ? -39.008 -47.826  42.492  1.00 57.88  ? 46   ALA D O   1 
ATOM   5426  C CB  . ALA D  3 46  ? -40.671 -48.802  39.874  1.00 67.18  ? 46   ALA D CB  1 
ATOM   5427  N N   . ALA D  3 47  ? -37.686 -48.024  40.681  1.00 53.22  ? 47   ALA D N   1 
ATOM   5428  C CA  . ALA D  3 47  ? -36.484 -48.315  41.454  1.00 47.28  ? 47   ALA D CA  1 
ATOM   5429  C C   . ALA D  3 47  ? -36.058 -47.103  42.274  1.00 60.09  ? 47   ALA D C   1 
ATOM   5430  O O   . ALA D  3 47  ? -35.531 -47.242  43.378  1.00 65.30  ? 47   ALA D O   1 
ATOM   5431  C CB  . ALA D  3 47  ? -35.358 -48.760  40.538  1.00 46.36  ? 47   ALA D CB  1 
ATOM   5432  N N   . ALA D  3 48  ? -36.290 -45.914  41.727  1.00 58.26  ? 48   ALA D N   1 
ATOM   5433  C CA  . ALA D  3 48  ? -35.974 -44.675  42.427  1.00 55.51  ? 48   ALA D CA  1 
ATOM   5434  C C   . ALA D  3 48  ? -36.978 -44.417  43.545  1.00 60.93  ? 48   ALA D C   1 
ATOM   5435  O O   . ALA D  3 48  ? -36.640 -43.832  44.574  1.00 62.09  ? 48   ALA D O   1 
ATOM   5436  C CB  . ALA D  3 48  ? -35.948 -43.506  41.454  1.00 53.35  ? 48   ALA D CB  1 
ATOM   5437  N N   . GLN D  3 49  ? -38.215 -44.858  43.335  1.00 62.29  ? 49   GLN D N   1 
ATOM   5438  C CA  . GLN D  3 49  ? -39.266 -44.706  44.335  1.00 64.41  ? 49   GLN D CA  1 
ATOM   5439  C C   . GLN D  3 49  ? -39.034 -45.632  45.522  1.00 66.00  ? 49   GLN D C   1 
ATOM   5440  O O   . GLN D  3 49  ? -39.277 -45.257  46.669  1.00 69.71  ? 49   GLN D O   1 
ATOM   5441  C CB  . GLN D  3 49  ? -40.639 -44.976  43.718  1.00 67.85  ? 49   GLN D CB  1 
ATOM   5442  C CG  . GLN D  3 49  ? -41.133 -43.876  42.793  1.00 71.53  ? 49   GLN D CG  1 
ATOM   5443  C CD  . GLN D  3 49  ? -42.466 -44.208  42.151  1.00 79.98  ? 49   GLN D CD  1 
ATOM   5444  O OE1 . GLN D  3 49  ? -42.671 -45.317  41.656  1.00 84.16  ? 49   GLN D OE1 1 
ATOM   5445  N NE2 . GLN D  3 49  ? -43.383 -43.247  42.160  1.00 83.18  ? 49   GLN D NE2 1 
ATOM   5446  N N   . GLU D  3 50  ? -38.565 -46.844  45.237  1.00 65.71  ? 50   GLU D N   1 
ATOM   5447  C CA  . GLU D  3 50  ? -38.248 -47.811  46.282  1.00 65.92  ? 50   GLU D CA  1 
ATOM   5448  C C   . GLU D  3 50  ? -37.107 -47.311  47.157  1.00 54.71  ? 50   GLU D C   1 
ATOM   5449  O O   . GLU D  3 50  ? -37.120 -47.494  48.375  1.00 53.35  ? 50   GLU D O   1 
ATOM   5450  C CB  . GLU D  3 50  ? -37.884 -49.166  45.672  1.00 73.70  ? 50   GLU D CB  1 
ATOM   5451  C CG  . GLU D  3 50  ? -37.362 -50.176  46.683  1.00 79.44  ? 50   GLU D CG  1 
ATOM   5452  C CD  . GLU D  3 50  ? -37.087 -51.532  46.068  1.00 85.57  ? 50   GLU D CD  1 
ATOM   5453  O OE1 . GLU D  3 50  ? -38.035 -52.338  45.958  1.00 91.50  ? 50   GLU D OE1 1 
ATOM   5454  O OE2 . GLU D  3 50  ? -35.924 -51.795  45.696  1.00 83.68  ? 50   GLU D OE2 1 
ATOM   5455  N N   . THR D  3 51  ? -36.122 -46.681  46.525  1.00 49.26  ? 51   THR D N   1 
ATOM   5456  C CA  . THR D  3 51  ? -34.979 -46.125  47.239  1.00 49.80  ? 51   THR D CA  1 
ATOM   5457  C C   . THR D  3 51  ? -35.436 -45.090  48.259  1.00 53.19  ? 51   THR D C   1 
ATOM   5458  O O   . THR D  3 51  ? -35.011 -45.114  49.414  1.00 56.34  ? 51   THR D O   1 
ATOM   5459  C CB  . THR D  3 51  ? -33.968 -45.482  46.271  1.00 43.92  ? 51   THR D CB  1 
ATOM   5460  O OG1 . THR D  3 51  ? -33.452 -46.482  45.384  1.00 47.09  ? 51   THR D OG1 1 
ATOM   5461  C CG2 . THR D  3 51  ? -32.815 -44.853  47.038  1.00 39.15  ? 51   THR D CG2 1 
ATOM   5462  N N   . VAL D  3 52  ? -36.315 -44.192  47.825  1.00 51.07  ? 52   VAL D N   1 
ATOM   5463  C CA  . VAL D  3 52  ? -36.870 -43.162  48.696  1.00 46.78  ? 52   VAL D CA  1 
ATOM   5464  C C   . VAL D  3 52  ? -37.653 -43.786  49.850  1.00 50.34  ? 52   VAL D C   1 
ATOM   5465  O O   . VAL D  3 52  ? -37.616 -43.295  50.979  1.00 54.24  ? 52   VAL D O   1 
ATOM   5466  C CB  . VAL D  3 52  ? -37.782 -42.201  47.905  1.00 44.91  ? 52   VAL D CB  1 
ATOM   5467  C CG1 . VAL D  3 52  ? -38.450 -41.198  48.833  1.00 49.48  ? 52   VAL D CG1 1 
ATOM   5468  C CG2 . VAL D  3 52  ? -36.979 -41.483  46.833  1.00 41.02  ? 52   VAL D CG2 1 
ATOM   5469  N N   . ARG D  3 53  ? -38.345 -44.884  49.562  1.00 50.36  ? 53   ARG D N   1 
ATOM   5470  C CA  . ARG D  3 53  ? -39.107 -45.596  50.579  1.00 49.81  ? 53   ARG D CA  1 
ATOM   5471  C C   . ARG D  3 53  ? -38.186 -46.239  51.612  1.00 53.90  ? 53   ARG D C   1 
ATOM   5472  O O   . ARG D  3 53  ? -38.578 -46.447  52.760  1.00 63.05  ? 53   ARG D O   1 
ATOM   5473  C CB  . ARG D  3 53  ? -39.996 -46.661  49.934  1.00 58.41  ? 53   ARG D CB  1 
ATOM   5474  N N   . LEU D  3 54  ? -36.961 -46.547  51.198  1.00 50.26  ? 54   LEU D N   1 
ATOM   5475  C CA  . LEU D  3 54  ? -35.988 -47.177  52.084  1.00 61.24  ? 54   LEU D CA  1 
ATOM   5476  C C   . LEU D  3 54  ? -35.112 -46.149  52.795  1.00 60.20  ? 54   LEU D C   1 
ATOM   5477  O O   . LEU D  3 54  ? -34.171 -46.509  53.502  1.00 62.14  ? 54   LEU D O   1 
ATOM   5478  C CB  . LEU D  3 54  ? -35.111 -48.156  51.300  1.00 57.91  ? 54   LEU D CB  1 
ATOM   5479  C CG  . LEU D  3 54  ? -35.815 -49.387  50.725  1.00 61.99  ? 54   LEU D CG  1 
ATOM   5480  C CD1 . LEU D  3 54  ? -34.846 -50.228  49.907  1.00 61.42  ? 54   LEU D CD1 1 
ATOM   5481  C CD2 . LEU D  3 54  ? -36.442 -50.216  51.836  1.00 62.41  ? 54   LEU D CD2 1 
ATOM   5482  N N   . LEU D  3 55  ? -35.422 -44.870  52.604  1.00 64.91  ? 55   LEU D N   1 
ATOM   5483  C CA  . LEU D  3 55  ? -34.691 -43.801  53.276  1.00 65.81  ? 55   LEU D CA  1 
ATOM   5484  C C   . LEU D  3 55  ? -35.313 -43.486  54.632  1.00 71.78  ? 55   LEU D C   1 
ATOM   5485  O O   . LEU D  3 55  ? -34.631 -43.021  55.546  1.00 72.70  ? 55   LEU D O   1 
ATOM   5486  C CB  . LEU D  3 55  ? -34.653 -42.539  52.411  1.00 66.55  ? 55   LEU D CB  1 
ATOM   5487  C CG  . LEU D  3 55  ? -33.918 -42.639  51.074  1.00 68.36  ? 55   LEU D CG  1 
ATOM   5488  C CD1 . LEU D  3 55  ? -33.802 -41.274  50.412  1.00 69.13  ? 55   LEU D CD1 1 
ATOM   5489  C CD2 . LEU D  3 55  ? -32.547 -43.269  51.258  1.00 67.77  ? 55   LEU D CD2 1 
ATOM   5490  N N   . GLY D  3 56  ? -36.611 -43.742  54.753  1.00 75.16  ? 56   GLY D N   1 
ATOM   5491  C CA  . GLY D  3 56  ? -37.327 -43.485  55.989  1.00 80.48  ? 56   GLY D CA  1 
ATOM   5492  C C   . GLY D  3 56  ? -38.519 -42.571  55.785  1.00 84.10  ? 56   GLY D C   1 
ATOM   5493  O O   . GLY D  3 56  ? -38.660 -41.558  56.471  1.00 86.75  ? 56   GLY D O   1 
ATOM   5494  N N   . ASN D  3 68  ? -38.802 -33.385  52.678  1.00 63.32  ? 68   ASN D N   1 
ATOM   5495  C CA  . ASN D  3 68  ? -38.695 -34.839  52.683  1.00 66.00  ? 68   ASN D CA  1 
ATOM   5496  C C   . ASN D  3 68  ? -38.102 -35.371  51.382  1.00 62.14  ? 68   ASN D C   1 
ATOM   5497  O O   . ASN D  3 68  ? -38.027 -34.654  50.385  1.00 59.58  ? 68   ASN D O   1 
ATOM   5498  C CB  . ASN D  3 68  ? -40.066 -35.472  52.929  1.00 70.87  ? 68   ASN D CB  1 
ATOM   5499  N N   . HIS D  3 69  ? -37.681 -36.633  51.400  1.00 59.13  ? 69   HIS D N   1 
ATOM   5500  C CA  . HIS D  3 69  ? -37.071 -37.260  50.233  1.00 56.48  ? 69   HIS D CA  1 
ATOM   5501  C C   . HIS D  3 69  ? -38.072 -37.396  49.089  1.00 56.48  ? 69   HIS D C   1 
ATOM   5502  O O   . HIS D  3 69  ? -39.275 -37.516  49.318  1.00 62.79  ? 69   HIS D O   1 
ATOM   5503  C CB  . HIS D  3 69  ? -36.505 -38.634  50.598  1.00 57.31  ? 69   HIS D CB  1 
ATOM   5504  C CG  . HIS D  3 69  ? -35.645 -38.630  51.824  1.00 55.26  ? 69   HIS D CG  1 
ATOM   5505  N ND1 . HIS D  3 69  ? -34.454 -37.942  51.896  1.00 51.97  ? 69   HIS D ND1 1 
ATOM   5506  C CD2 . HIS D  3 69  ? -35.801 -39.238  53.023  1.00 54.07  ? 69   HIS D CD2 1 
ATOM   5507  C CE1 . HIS D  3 69  ? -33.915 -38.122  53.088  1.00 47.84  ? 69   HIS D CE1 1 
ATOM   5508  N NE2 . HIS D  3 69  ? -34.712 -38.905  53.792  1.00 49.73  ? 69   HIS D NE2 1 
ATOM   5509  N N   . ALA D  3 70  ? -37.569 -37.379  47.859  1.00 58.41  ? 70   ALA D N   1 
ATOM   5510  C CA  . ALA D  3 70  ? -38.424 -37.501  46.683  1.00 65.12  ? 70   ALA D CA  1 
ATOM   5511  C C   . ALA D  3 70  ? -37.752 -38.328  45.591  1.00 66.03  ? 70   ALA D C   1 
ATOM   5512  O O   . ALA D  3 70  ? -36.525 -38.417  45.531  1.00 61.93  ? 70   ALA D O   1 
ATOM   5513  C CB  . ALA D  3 70  ? -38.794 -36.125  46.152  1.00 66.01  ? 70   ALA D CB  1 
ATOM   5514  N N   . ALA D  3 71  ? -38.565 -38.932  44.730  1.00 67.59  ? 71   ALA D N   1 
ATOM   5515  C CA  . ALA D  3 71  ? -38.057 -39.764  43.645  1.00 63.12  ? 71   ALA D CA  1 
ATOM   5516  C C   . ALA D  3 71  ? -38.203 -39.067  42.297  1.00 63.13  ? 71   ALA D C   1 
ATOM   5517  O O   . ALA D  3 71  ? -39.247 -38.485  42.000  1.00 67.47  ? 71   ALA D O   1 
ATOM   5518  C CB  . ALA D  3 71  ? -38.774 -41.104  43.626  1.00 62.34  ? 71   ALA D CB  1 
ATOM   5519  N N   . PHE D  3 72  ? -37.155 -39.132  41.483  1.00 59.44  ? 72   PHE D N   1 
ATOM   5520  C CA  . PHE D  3 72  ? -37.171 -38.505  40.166  1.00 57.96  ? 72   PHE D CA  1 
ATOM   5521  C C   . PHE D  3 72  ? -36.834 -39.491  39.053  1.00 54.90  ? 72   PHE D C   1 
ATOM   5522  O O   . PHE D  3 72  ? -36.179 -40.508  39.281  1.00 55.20  ? 72   PHE D O   1 
ATOM   5523  C CB  . PHE D  3 72  ? -36.194 -37.329  40.119  1.00 56.90  ? 72   PHE D CB  1 
ATOM   5524  C CG  . PHE D  3 72  ? -36.637 -36.139  40.918  1.00 56.18  ? 72   PHE D CG  1 
ATOM   5525  C CD1 . PHE D  3 72  ? -37.527 -35.223  40.382  1.00 55.35  ? 72   PHE D CD1 1 
ATOM   5526  C CD2 . PHE D  3 72  ? -36.160 -35.931  42.201  1.00 54.97  ? 72   PHE D CD2 1 
ATOM   5527  C CE1 . PHE D  3 72  ? -37.936 -34.124  41.113  1.00 57.00  ? 72   PHE D CE1 1 
ATOM   5528  C CE2 . PHE D  3 72  ? -36.566 -34.834  42.937  1.00 55.83  ? 72   PHE D CE2 1 
ATOM   5529  C CZ  . PHE D  3 72  ? -37.455 -33.930  42.392  1.00 56.45  ? 72   PHE D CZ  1 
ATOM   5530  N N   . GLN D  3 73  ? -37.289 -39.177  37.845  1.00 54.05  ? 73   GLN D N   1 
ATOM   5531  C CA  . GLN D  3 73  ? -36.965 -39.972  36.669  1.00 56.06  ? 73   GLN D CA  1 
ATOM   5532  C C   . GLN D  3 73  ? -36.333 -39.082  35.608  1.00 54.53  ? 73   GLN D C   1 
ATOM   5533  O O   . GLN D  3 73  ? -36.837 -37.996  35.321  1.00 56.54  ? 73   GLN D O   1 
ATOM   5534  C CB  . GLN D  3 73  ? -38.216 -40.663  36.116  1.00 61.32  ? 73   GLN D CB  1 
ATOM   5535  C CG  . GLN D  3 73  ? -37.949 -41.662  34.992  1.00 64.41  ? 73   GLN D CG  1 
ATOM   5536  C CD  . GLN D  3 73  ? -37.859 -41.010  33.622  1.00 67.59  ? 73   GLN D CD  1 
ATOM   5537  O OE1 . GLN D  3 73  ? -38.284 -39.870  33.432  1.00 71.13  ? 73   GLN D OE1 1 
ATOM   5538  N NE2 . GLN D  3 73  ? -37.301 -41.735  32.658  1.00 65.46  ? 73   GLN D NE2 1 
ATOM   5539  N N   . ALA D  3 74  ? -35.230 -39.548  35.030  1.00 54.04  ? 74   ALA D N   1 
ATOM   5540  C CA  . ALA D  3 74  ? -34.540 -38.804  33.984  1.00 53.47  ? 74   ALA D CA  1 
ATOM   5541  C C   . ALA D  3 74  ? -33.536 -39.680  33.244  1.00 57.06  ? 74   ALA D C   1 
ATOM   5542  O O   . ALA D  3 74  ? -32.784 -40.434  33.860  1.00 59.92  ? 74   ALA D O   1 
ATOM   5543  C CB  . ALA D  3 74  ? -33.836 -37.586  34.571  1.00 53.28  ? 74   ALA D CB  1 
ATOM   5544  N N   . ASP D  3 75  ? -33.537 -39.579  31.920  1.00 56.09  ? 75   ASP D N   1 
ATOM   5545  C CA  . ASP D  3 75  ? -32.499 -40.201  31.112  1.00 54.17  ? 75   ASP D CA  1 
ATOM   5546  C C   . ASP D  3 75  ? -31.341 -39.219  30.999  1.00 56.85  ? 75   ASP D C   1 
ATOM   5547  O O   . ASP D  3 75  ? -31.397 -38.270  30.216  1.00 65.23  ? 75   ASP D O   1 
ATOM   5548  C CB  . ASP D  3 75  ? -33.030 -40.582  29.728  1.00 56.46  ? 75   ASP D CB  1 
ATOM   5549  C CG  . ASP D  3 75  ? -32.094 -41.512  28.974  1.00 58.34  ? 75   ASP D CG  1 
ATOM   5550  O OD1 . ASP D  3 75  ? -30.908 -41.617  29.354  1.00 56.36  ? 75   ASP D OD1 1 
ATOM   5551  O OD2 . ASP D  3 75  ? -32.544 -42.139  27.992  1.00 63.48  ? 75   ASP D OD2 1 
ATOM   5552  N N   . VAL D  3 76  ? -30.294 -39.447  31.785  1.00 53.28  ? 76   VAL D N   1 
ATOM   5553  C CA  . VAL D  3 76  ? -29.167 -38.522  31.850  1.00 51.30  ? 76   VAL D CA  1 
ATOM   5554  C C   . VAL D  3 76  ? -28.403 -38.443  30.530  1.00 51.88  ? 76   VAL D C   1 
ATOM   5555  O O   . VAL D  3 76  ? -27.633 -37.510  30.309  1.00 50.97  ? 76   VAL D O   1 
ATOM   5556  C CB  . VAL D  3 76  ? -28.185 -38.910  32.974  1.00 54.56  ? 76   VAL D CB  1 
ATOM   5557  C CG1 . VAL D  3 76  ? -28.899 -38.929  34.318  1.00 50.88  ? 76   VAL D CG1 1 
ATOM   5558  C CG2 . VAL D  3 76  ? -27.546 -40.260  32.682  1.00 60.70  ? 76   VAL D CG2 1 
ATOM   5559  N N   . SER D  3 77  ? -28.628 -39.415  29.651  1.00 49.68  ? 77   SER D N   1 
ATOM   5560  C CA  . SER D  3 77  ? -27.971 -39.435  28.350  1.00 52.96  ? 77   SER D CA  1 
ATOM   5561  C C   . SER D  3 77  ? -28.540 -38.366  27.421  1.00 53.45  ? 77   SER D C   1 
ATOM   5562  O O   . SER D  3 77  ? -27.985 -38.099  26.356  1.00 74.12  ? 77   SER D O   1 
ATOM   5563  C CB  . SER D  3 77  ? -28.104 -40.816  27.703  1.00 56.28  ? 77   SER D CB  1 
ATOM   5564  O OG  . SER D  3 77  ? -29.459 -41.122  27.425  1.00 57.52  ? 77   SER D OG  1 
ATOM   5565  N N   . GLU D  3 78  ? -29.650 -37.759  27.829  1.00 54.21  ? 78   GLU D N   1 
ATOM   5566  C CA  . GLU D  3 78  ? -30.277 -36.697  27.050  1.00 57.45  ? 78   GLU D CA  1 
ATOM   5567  C C   . GLU D  3 78  ? -30.049 -35.333  27.693  1.00 56.19  ? 78   GLU D C   1 
ATOM   5568  O O   . GLU D  3 78  ? -30.193 -35.176  28.905  1.00 53.61  ? 78   GLU D O   1 
ATOM   5569  C CB  . GLU D  3 78  ? -31.776 -36.961  26.890  1.00 69.94  ? 78   GLU D CB  1 
ATOM   5570  C CG  . GLU D  3 78  ? -32.112 -38.204  26.079  1.00 78.83  ? 78   GLU D CG  1 
ATOM   5571  C CD  . GLU D  3 78  ? -31.840 -38.033  24.595  1.00 91.31  ? 78   GLU D CD  1 
ATOM   5572  O OE1 . GLU D  3 78  ? -31.557 -36.895  24.163  1.00 96.00  ? 78   GLU D OE1 1 
ATOM   5573  O OE2 . GLU D  3 78  ? -31.913 -39.039  23.858  1.00 96.27  ? 78   GLU D OE2 1 
ATOM   5574  N N   . ALA D  3 79  ? -29.696 -34.349  26.872  1.00 37.98  ? 79   ALA D N   1 
ATOM   5575  C CA  . ALA D  3 79  ? -29.403 -33.004  27.357  1.00 39.17  ? 79   ALA D CA  1 
ATOM   5576  C C   . ALA D  3 79  ? -30.648 -32.323  27.912  1.00 41.27  ? 79   ALA D C   1 
ATOM   5577  O O   . ALA D  3 79  ? -30.567 -31.537  28.856  1.00 43.25  ? 79   ALA D O   1 
ATOM   5578  C CB  . ALA D  3 79  ? -28.794 -32.164  26.246  1.00 44.31  ? 79   ALA D CB  1 
ATOM   5579  N N   . ARG D  3 80  ? -31.797 -32.629  27.320  1.00 44.21  ? 80   ARG D N   1 
ATOM   5580  C CA  . ARG D  3 80  ? -33.060 -32.046  27.753  1.00 48.07  ? 80   ARG D CA  1 
ATOM   5581  C C   . ARG D  3 80  ? -33.492 -32.607  29.103  1.00 46.81  ? 80   ARG D C   1 
ATOM   5582  O O   . ARG D  3 80  ? -33.879 -31.858  30.001  1.00 44.40  ? 80   ARG D O   1 
ATOM   5583  C CB  . ARG D  3 80  ? -34.150 -32.293  26.707  1.00 52.00  ? 80   ARG D CB  1 
ATOM   5584  N N   . ALA D  3 81  ? -33.418 -33.927  29.241  1.00 46.96  ? 81   ALA D N   1 
ATOM   5585  C CA  . ALA D  3 81  ? -33.825 -34.599  30.471  1.00 48.57  ? 81   ALA D CA  1 
ATOM   5586  C C   . ALA D  3 81  ? -32.907 -34.240  31.634  1.00 46.60  ? 81   ALA D C   1 
ATOM   5587  O O   . ALA D  3 81  ? -33.336 -34.205  32.788  1.00 48.07  ? 81   ALA D O   1 
ATOM   5588  C CB  . ALA D  3 81  ? -33.852 -36.105  30.264  1.00 47.32  ? 81   ALA D CB  1 
ATOM   5589  N N   . ALA D  3 82  ? -31.642 -33.978  31.324  1.00 48.27  ? 82   ALA D N   1 
ATOM   5590  C CA  . ALA D  3 82  ? -30.667 -33.604  32.341  1.00 48.88  ? 82   ALA D CA  1 
ATOM   5591  C C   . ALA D  3 82  ? -30.969 -32.219  32.902  1.00 52.79  ? 82   ALA D C   1 
ATOM   5592  O O   . ALA D  3 82  ? -30.695 -31.938  34.069  1.00 55.18  ? 82   ALA D O   1 
ATOM   5593  C CB  . ALA D  3 82  ? -29.263 -33.650  31.769  1.00 48.17  ? 82   ALA D CB  1 
ATOM   5594  N N   . ARG D  3 83  ? -31.532 -31.355  32.064  1.00 55.11  ? 83   ARG D N   1 
ATOM   5595  C CA  . ARG D  3 83  ? -31.916 -30.016  32.492  1.00 59.17  ? 83   ARG D CA  1 
ATOM   5596  C C   . ARG D  3 83  ? -33.277 -30.041  33.174  1.00 60.82  ? 83   ARG D C   1 
ATOM   5597  O O   . ARG D  3 83  ? -33.522 -29.289  34.118  1.00 62.79  ? 83   ARG D O   1 
ATOM   5598  C CB  . ARG D  3 83  ? -31.938 -29.052  31.305  1.00 68.30  ? 83   ARG D CB  1 
ATOM   5599  C CG  . ARG D  3 83  ? -30.920 -27.928  31.405  1.00 76.86  ? 83   ARG D CG  1 
ATOM   5600  C CD  . ARG D  3 83  ? -31.023 -27.212  32.744  1.00 83.43  ? 83   ARG D CD  1 
ATOM   5601  N NE  . ARG D  3 83  ? -30.159 -26.037  32.811  1.00 88.26  ? 83   ARG D NE  1 
ATOM   5602  C CZ  . ARG D  3 83  ? -30.023 -25.271  33.889  1.00 89.93  ? 83   ARG D CZ  1 
ATOM   5603  N NH1 . ARG D  3 83  ? -30.691 -25.556  34.998  1.00 85.80  ? 83   ARG D NH1 1 
ATOM   5604  N NH2 . ARG D  3 83  ? -29.215 -24.219  33.859  1.00 93.52  ? 83   ARG D NH2 1 
ATOM   5605  N N   . CYS D  3 84  ? -34.161 -30.908  32.687  1.00 58.59  ? 84   CYS D N   1 
ATOM   5606  C CA  . CYS D  3 84  ? -35.475 -31.083  33.293  1.00 56.13  ? 84   CYS D CA  1 
ATOM   5607  C C   . CYS D  3 84  ? -35.340 -31.612  34.713  1.00 51.22  ? 84   CYS D C   1 
ATOM   5608  O O   . CYS D  3 84  ? -36.086 -31.214  35.605  1.00 51.92  ? 84   CYS D O   1 
ATOM   5609  C CB  . CYS D  3 84  ? -36.339 -32.032  32.459  1.00 53.03  ? 84   CYS D CB  1 
ATOM   5610  S SG  . CYS D  3 84  ? -36.907 -31.350  30.886  1.00 85.25  ? 84   CYS D SG  1 
ATOM   5611  N N   . LEU D  3 85  ? -34.378 -32.507  34.913  1.00 50.42  ? 85   LEU D N   1 
ATOM   5612  C CA  . LEU D  3 85  ? -34.127 -33.099  36.222  1.00 49.22  ? 85   LEU D CA  1 
ATOM   5613  C C   . LEU D  3 85  ? -33.753 -32.046  37.259  1.00 47.58  ? 85   LEU D C   1 
ATOM   5614  O O   . LEU D  3 85  ? -34.320 -32.011  38.350  1.00 49.72  ? 85   LEU D O   1 
ATOM   5615  C CB  . LEU D  3 85  ? -33.018 -34.147  36.127  1.00 43.50  ? 85   LEU D CB  1 
ATOM   5616  C CG  . LEU D  3 85  ? -32.536 -34.715  37.462  1.00 41.58  ? 85   LEU D CG  1 
ATOM   5617  C CD1 . LEU D  3 85  ? -33.650 -35.487  38.151  1.00 39.91  ? 85   LEU D CD1 1 
ATOM   5618  C CD2 . LEU D  3 85  ? -31.311 -35.590  37.258  1.00 44.91  ? 85   LEU D CD2 1 
ATOM   5619  N N   . LEU D  3 86  ? -32.792 -31.195  36.913  1.00 46.72  ? 86   LEU D N   1 
ATOM   5620  C CA  . LEU D  3 86  ? -32.339 -30.143  37.814  1.00 44.82  ? 86   LEU D CA  1 
ATOM   5621  C C   . LEU D  3 86  ? -33.451 -29.140  38.095  1.00 49.01  ? 86   LEU D C   1 
ATOM   5622  O O   . LEU D  3 86  ? -33.580 -28.642  39.211  1.00 52.79  ? 86   LEU D O   1 
ATOM   5623  C CB  . LEU D  3 86  ? -31.118 -29.425  37.235  1.00 44.51  ? 86   LEU D CB  1 
ATOM   5624  C CG  . LEU D  3 86  ? -29.740 -29.917  37.689  1.00 45.34  ? 86   LEU D CG  1 
ATOM   5625  C CD1 . LEU D  3 86  ? -29.556 -29.689  39.181  1.00 49.86  ? 86   LEU D CD1 1 
ATOM   5626  C CD2 . LEU D  3 86  ? -29.532 -31.384  37.339  1.00 41.91  ? 86   LEU D CD2 1 
ATOM   5627  N N   . GLU D  3 87  ? -34.257 -28.854  37.078  1.00 49.61  ? 87   GLU D N   1 
ATOM   5628  C CA  . GLU D  3 87  ? -35.359 -27.912  37.226  1.00 52.68  ? 87   GLU D CA  1 
ATOM   5629  C C   . GLU D  3 87  ? -36.528 -28.532  37.989  1.00 50.59  ? 87   GLU D C   1 
ATOM   5630  O O   . GLU D  3 87  ? -37.289 -27.825  38.648  1.00 47.99  ? 87   GLU D O   1 
ATOM   5631  C CB  . GLU D  3 87  ? -35.819 -27.411  35.856  1.00 60.46  ? 87   GLU D CB  1 
ATOM   5632  C CG  . GLU D  3 87  ? -34.829 -26.467  35.192  1.00 67.21  ? 87   GLU D CG  1 
ATOM   5633  C CD  . GLU D  3 87  ? -35.300 -25.983  33.835  1.00 77.29  ? 87   GLU D CD  1 
ATOM   5634  O OE1 . GLU D  3 87  ? -35.678 -26.830  32.999  1.00 82.37  ? 87   GLU D OE1 1 
ATOM   5635  O OE2 . GLU D  3 87  ? -35.295 -24.755  33.607  1.00 79.47  ? 87   GLU D OE2 1 
ATOM   5636  N N   . GLN D  3 88  ? -36.669 -29.850  37.903  1.00 48.51  ? 88   GLN D N   1 
ATOM   5637  C CA  . GLN D  3 88  ? -37.676 -30.551  38.691  1.00 51.77  ? 88   GLN D CA  1 
ATOM   5638  C C   . GLN D  3 88  ? -37.298 -30.523  40.167  1.00 53.78  ? 88   GLN D C   1 
ATOM   5639  O O   . GLN D  3 88  ? -38.161 -30.446  41.041  1.00 61.24  ? 88   GLN D O   1 
ATOM   5640  C CB  . GLN D  3 88  ? -37.843 -31.994  38.212  1.00 53.07  ? 88   GLN D CB  1 
ATOM   5641  C CG  . GLN D  3 88  ? -38.746 -32.146  36.999  1.00 60.17  ? 88   GLN D CG  1 
ATOM   5642  C CD  . GLN D  3 88  ? -38.834 -33.580  36.513  1.00 67.47  ? 88   GLN D CD  1 
ATOM   5643  O OE1 . GLN D  3 88  ? -38.128 -34.459  37.008  1.00 67.79  ? 88   GLN D OE1 1 
ATOM   5644  N NE2 . GLN D  3 88  ? -39.703 -33.822  35.539  1.00 71.83  ? 88   GLN D NE2 1 
ATOM   5645  N N   . VAL D  3 89  ? -35.998 -30.584  40.436  1.00 48.39  ? 89   VAL D N   1 
ATOM   5646  C CA  . VAL D  3 89  ? -35.493 -30.524  41.801  1.00 49.88  ? 89   VAL D CA  1 
ATOM   5647  C C   . VAL D  3 89  ? -35.596 -29.105  42.354  1.00 50.99  ? 89   VAL D C   1 
ATOM   5648  O O   . VAL D  3 89  ? -36.034 -28.902  43.487  1.00 54.40  ? 89   VAL D O   1 
ATOM   5649  C CB  . VAL D  3 89  ? -34.030 -31.005  41.879  1.00 49.25  ? 89   VAL D CB  1 
ATOM   5650  C CG1 . VAL D  3 89  ? -33.456 -30.751  43.262  1.00 51.73  ? 89   VAL D CG1 1 
ATOM   5651  C CG2 . VAL D  3 89  ? -33.939 -32.482  41.524  1.00 49.05  ? 89   VAL D CG2 1 
ATOM   5652  N N   . GLN D  3 90  ? -35.201 -28.126  41.544  1.00 51.15  ? 90   GLN D N   1 
ATOM   5653  C CA  . GLN D  3 90  ? -35.256 -26.723  41.947  1.00 51.69  ? 90   GLN D CA  1 
ATOM   5654  C C   . GLN D  3 90  ? -36.686 -26.251  42.194  1.00 58.08  ? 90   GLN D C   1 
ATOM   5655  O O   . GLN D  3 90  ? -36.911 -25.304  42.944  1.00 60.01  ? 90   GLN D O   1 
ATOM   5656  C CB  . GLN D  3 90  ? -34.601 -25.834  40.888  1.00 52.81  ? 90   GLN D CB  1 
ATOM   5657  C CG  . GLN D  3 90  ? -33.091 -25.962  40.805  1.00 53.36  ? 90   GLN D CG  1 
ATOM   5658  C CD  . GLN D  3 90  ? -32.500 -25.115  39.696  1.00 53.79  ? 90   GLN D CD  1 
ATOM   5659  O OE1 . GLN D  3 90  ? -32.440 -23.889  39.798  1.00 56.05  ? 90   GLN D OE1 1 
ATOM   5660  N NE2 . GLN D  3 90  ? -32.066 -25.766  38.623  1.00 52.45  ? 90   GLN D NE2 1 
ATOM   5661  N N   . ALA D  3 91  ? -37.648 -26.909  41.556  1.00 57.85  ? 91   ALA D N   1 
ATOM   5662  C CA  . ALA D  3 91  ? -39.052 -26.552  41.725  1.00 58.44  ? 91   ALA D CA  1 
ATOM   5663  C C   . ALA D  3 91  ? -39.643 -27.223  42.960  1.00 57.66  ? 91   ALA D C   1 
ATOM   5664  O O   . ALA D  3 91  ? -40.473 -26.641  43.658  1.00 57.50  ? 91   ALA D O   1 
ATOM   5665  C CB  . ALA D  3 91  ? -39.847 -26.929  40.486  1.00 52.86  ? 91   ALA D CB  1 
ATOM   5666  N N   . CYS D  3 92  ? -39.202 -28.448  43.227  1.00 55.03  ? 92   CYS D N   1 
ATOM   5667  C CA  . CYS D  3 92  ? -39.731 -29.233  44.335  1.00 54.71  ? 92   CYS D CA  1 
ATOM   5668  C C   . CYS D  3 92  ? -39.210 -28.757  45.688  1.00 52.36  ? 92   CYS D C   1 
ATOM   5669  O O   . CYS D  3 92  ? -39.970 -28.653  46.651  1.00 53.96  ? 92   CYS D O   1 
ATOM   5670  C CB  . CYS D  3 92  ? -39.393 -30.713  44.143  1.00 53.54  ? 92   CYS D CB  1 
ATOM   5671  S SG  . CYS D  3 92  ? -39.902 -31.779  45.511  1.00 81.64  ? 92   CYS D SG  1 
ATOM   5672  N N   . PHE D  3 93  ? -37.914 -28.471  45.759  1.00 50.54  ? 93   PHE D N   1 
ATOM   5673  C CA  . PHE D  3 93  ? -37.285 -28.103  47.024  1.00 53.18  ? 93   PHE D CA  1 
ATOM   5674  C C   . PHE D  3 93  ? -36.979 -26.610  47.113  1.00 56.52  ? 93   PHE D C   1 
ATOM   5675  O O   . PHE D  3 93  ? -36.434 -26.144  48.115  1.00 58.29  ? 93   PHE D O   1 
ATOM   5676  C CB  . PHE D  3 93  ? -36.000 -28.907  47.229  1.00 41.56  ? 93   PHE D CB  1 
ATOM   5677  C CG  . PHE D  3 93  ? -36.220 -30.392  47.301  1.00 48.77  ? 93   PHE D CG  1 
ATOM   5678  C CD1 . PHE D  3 93  ? -36.686 -30.980  48.465  1.00 47.70  ? 93   PHE D CD1 1 
ATOM   5679  C CD2 . PHE D  3 93  ? -35.959 -31.199  46.206  1.00 50.57  ? 93   PHE D CD2 1 
ATOM   5680  C CE1 . PHE D  3 93  ? -36.890 -32.345  48.534  1.00 47.16  ? 93   PHE D CE1 1 
ATOM   5681  C CE2 . PHE D  3 93  ? -36.160 -32.566  46.270  1.00 49.67  ? 93   PHE D CE2 1 
ATOM   5682  C CZ  . PHE D  3 93  ? -36.626 -33.139  47.436  1.00 43.01  ? 93   PHE D CZ  1 
ATOM   5683  N N   . SER D  3 94  ? -37.331 -25.874  46.061  1.00 59.85  ? 94   SER D N   1 
ATOM   5684  C CA  . SER D  3 94  ? -37.121 -24.428  45.993  1.00 61.29  ? 94   SER D CA  1 
ATOM   5685  C C   . SER D  3 94  ? -35.653 -24.047  46.193  1.00 59.10  ? 94   SER D C   1 
ATOM   5686  O O   . SER D  3 94  ? -35.345 -22.956  46.675  1.00 61.21  ? 94   SER D O   1 
ATOM   5687  C CB  . SER D  3 94  ? -37.998 -23.710  47.023  1.00 67.22  ? 94   SER D CB  1 
ATOM   5688  O OG  . SER D  3 94  ? -37.965 -22.304  46.830  1.00 72.15  ? 94   SER D OG  1 
ATOM   5689  N N   . ARG D  3 95  ? -34.756 -24.953  45.815  1.00 55.09  ? 95   ARG D N   1 
ATOM   5690  C CA  . ARG D  3 95  ? -33.318 -24.724  45.919  1.00 53.76  ? 95   ARG D CA  1 
ATOM   5691  C C   . ARG D  3 95  ? -32.553 -25.753  45.091  1.00 52.33  ? 95   ARG D C   1 
ATOM   5692  O O   . ARG D  3 95  ? -33.018 -26.880  44.915  1.00 51.49  ? 95   ARG D O   1 
ATOM   5693  C CB  . ARG D  3 95  ? -32.863 -24.777  47.381  1.00 52.69  ? 95   ARG D CB  1 
ATOM   5694  C CG  . ARG D  3 95  ? -33.062 -26.125  48.053  1.00 53.66  ? 95   ARG D CG  1 
ATOM   5695  C CD  . ARG D  3 95  ? -32.518 -26.113  49.471  1.00 60.05  ? 95   ARG D CD  1 
ATOM   5696  N NE  . ARG D  3 95  ? -32.710 -27.395  50.143  1.00 67.07  ? 95   ARG D NE  1 
ATOM   5697  C CZ  . ARG D  3 95  ? -32.325 -27.649  51.389  1.00 73.72  ? 95   ARG D CZ  1 
ATOM   5698  N NH1 . ARG D  3 95  ? -31.723 -26.708  52.104  1.00 75.88  ? 95   ARG D NH1 1 
ATOM   5699  N NH2 . ARG D  3 95  ? -32.540 -28.845  51.921  1.00 76.57  ? 95   ARG D NH2 1 
ATOM   5700  N N   . PRO D  3 96  ? -31.377 -25.366  44.571  1.00 51.18  ? 96   PRO D N   1 
ATOM   5701  C CA  . PRO D  3 96  ? -30.538 -26.291  43.802  1.00 48.63  ? 96   PRO D CA  1 
ATOM   5702  C C   . PRO D  3 96  ? -29.788 -27.270  44.702  1.00 49.25  ? 96   PRO D C   1 
ATOM   5703  O O   . PRO D  3 96  ? -29.515 -26.944  45.857  1.00 51.94  ? 96   PRO D O   1 
ATOM   5704  C CB  . PRO D  3 96  ? -29.565 -25.357  43.081  1.00 48.14  ? 96   PRO D CB  1 
ATOM   5705  C CG  . PRO D  3 96  ? -29.439 -24.192  43.996  1.00 46.84  ? 96   PRO D CG  1 
ATOM   5706  C CD  . PRO D  3 96  ? -30.797 -24.012  44.621  1.00 48.50  ? 96   PRO D CD  1 
ATOM   5707  N N   . PRO D  3 97  ? -29.464 -28.463  44.179  1.00 51.05  ? 97   PRO D N   1 
ATOM   5708  C CA  . PRO D  3 97  ? -28.716 -29.470  44.940  1.00 49.37  ? 97   PRO D CA  1 
ATOM   5709  C C   . PRO D  3 97  ? -27.303 -29.007  45.283  1.00 51.76  ? 97   PRO D C   1 
ATOM   5710  O O   . PRO D  3 97  ? -26.538 -28.659  44.383  1.00 53.63  ? 97   PRO D O   1 
ATOM   5711  C CB  . PRO D  3 97  ? -28.673 -30.674  43.990  1.00 43.71  ? 97   PRO D CB  1 
ATOM   5712  C CG  . PRO D  3 97  ? -29.784 -30.447  43.023  1.00 44.69  ? 97   PRO D CG  1 
ATOM   5713  C CD  . PRO D  3 97  ? -29.870 -28.964  42.855  1.00 47.15  ? 97   PRO D CD  1 
ATOM   5714  N N   . SER D  3 98  ? -26.965 -29.002  46.569  1.00 50.39  ? 98   SER D N   1 
ATOM   5715  C CA  . SER D  3 98  ? -25.616 -28.654  47.001  1.00 47.98  ? 98   SER D CA  1 
ATOM   5716  C C   . SER D  3 98  ? -24.693 -29.858  46.848  1.00 43.73  ? 98   SER D C   1 
ATOM   5717  O O   . SER D  3 98  ? -23.479 -29.712  46.712  1.00 41.88  ? 98   SER D O   1 
ATOM   5718  C CB  . SER D  3 98  ? -25.619 -28.163  48.449  1.00 52.27  ? 98   SER D CB  1 
ATOM   5719  O OG  . SER D  3 98  ? -26.114 -29.159  49.327  1.00 54.75  ? 98   SER D OG  1 
ATOM   5720  N N   . VAL D  3 99  ? -25.283 -31.048  46.874  1.00 45.91  ? 99   VAL D N   1 
ATOM   5721  C CA  . VAL D  3 99  ? -24.542 -32.284  46.661  1.00 43.83  ? 99   VAL D CA  1 
ATOM   5722  C C   . VAL D  3 99  ? -25.069 -33.000  45.423  1.00 43.97  ? 99   VAL D C   1 
ATOM   5723  O O   . VAL D  3 99  ? -26.249 -33.338  45.347  1.00 49.72  ? 99   VAL D O   1 
ATOM   5724  C CB  . VAL D  3 99  ? -24.641 -33.225  47.876  1.00 48.18  ? 99   VAL D CB  1 
ATOM   5725  C CG1 . VAL D  3 99  ? -23.986 -34.563  47.565  1.00 45.94  ? 99   VAL D CG1 1 
ATOM   5726  C CG2 . VAL D  3 99  ? -24.008 -32.581  49.101  1.00 48.86  ? 99   VAL D CG2 1 
ATOM   5727  N N   . VAL D  3 100 ? -24.193 -33.222  44.449  1.00 41.00  ? 100  VAL D N   1 
ATOM   5728  C CA  . VAL D  3 100 ? -24.596 -33.862  43.204  1.00 40.79  ? 100  VAL D CA  1 
ATOM   5729  C C   . VAL D  3 100 ? -23.771 -35.114  42.938  1.00 41.18  ? 100  VAL D C   1 
ATOM   5730  O O   . VAL D  3 100 ? -22.572 -35.034  42.671  1.00 46.15  ? 100  VAL D O   1 
ATOM   5731  C CB  . VAL D  3 100 ? -24.461 -32.900  42.012  1.00 41.92  ? 100  VAL D CB  1 
ATOM   5732  C CG1 . VAL D  3 100 ? -24.992 -33.551  40.743  1.00 36.60  ? 100  VAL D CG1 1 
ATOM   5733  C CG2 . VAL D  3 100 ? -25.199 -31.604  42.302  1.00 46.52  ? 100  VAL D CG2 1 
ATOM   5734  N N   . VAL D  3 101 ? -24.421 -36.270  43.010  1.00 40.51  ? 101  VAL D N   1 
ATOM   5735  C CA  . VAL D  3 101 ? -23.735 -37.543  42.835  1.00 35.35  ? 101  VAL D CA  1 
ATOM   5736  C C   . VAL D  3 101 ? -24.196 -38.252  41.565  1.00 32.58  ? 101  VAL D C   1 
ATOM   5737  O O   . VAL D  3 101 ? -25.382 -38.525  41.390  1.00 37.32  ? 101  VAL D O   1 
ATOM   5738  C CB  . VAL D  3 101 ? -23.961 -38.469  44.042  1.00 33.83  ? 101  VAL D CB  1 
ATOM   5739  C CG1 . VAL D  3 101 ? -23.041 -39.673  43.960  1.00 32.96  ? 101  VAL D CG1 1 
ATOM   5740  C CG2 . VAL D  3 101 ? -23.728 -37.710  45.338  1.00 35.65  ? 101  VAL D CG2 1 
ATOM   5741  N N   . SER D  3 102 ? -23.248 -38.548  40.682  1.00 33.06  ? 102  SER D N   1 
ATOM   5742  C CA  . SER D  3 102 ? -23.555 -39.211  39.420  1.00 36.72  ? 102  SER D CA  1 
ATOM   5743  C C   . SER D  3 102 ? -23.180 -40.690  39.458  1.00 36.90  ? 102  SER D C   1 
ATOM   5744  O O   . SER D  3 102 ? -22.044 -41.057  39.161  1.00 36.46  ? 102  SER D O   1 
ATOM   5745  C CB  . SER D  3 102 ? -22.831 -38.519  38.264  1.00 43.45  ? 102  SER D CB  1 
ATOM   5746  O OG  . SER D  3 102 ? -23.181 -37.148  38.191  1.00 52.54  ? 102  SER D OG  1 
ATOM   5747  N N   . CYS D  3 103 ? -24.140 -41.534  39.823  1.00 41.34  ? 103  CYS D N   1 
ATOM   5748  C CA  . CYS D  3 103 ? -23.913 -42.975  39.872  1.00 43.71  ? 103  CYS D CA  1 
ATOM   5749  C C   . CYS D  3 103 ? -24.536 -43.673  38.669  1.00 51.10  ? 103  CYS D C   1 
ATOM   5750  O O   . CYS D  3 103 ? -24.396 -44.883  38.504  1.00 58.13  ? 103  CYS D O   1 
ATOM   5751  C CB  . CYS D  3 103 ? -24.478 -43.569  41.163  1.00 42.20  ? 103  CYS D CB  1 
ATOM   5752  S SG  . CYS D  3 103 ? -23.754 -42.917  42.682  1.00 62.32  ? 103  CYS D SG  1 
ATOM   5753  N N   . ALA D  3 104 ? -25.231 -42.906  37.836  1.00 49.21  ? 104  ALA D N   1 
ATOM   5754  C CA  . ALA D  3 104 ? -25.873 -43.457  36.649  1.00 45.14  ? 104  ALA D CA  1 
ATOM   5755  C C   . ALA D  3 104 ? -24.831 -43.925  35.639  1.00 43.77  ? 104  ALA D C   1 
ATOM   5756  O O   . ALA D  3 104 ? -24.060 -43.122  35.114  1.00 46.10  ? 104  ALA D O   1 
ATOM   5757  C CB  . ALA D  3 104 ? -26.799 -42.428  36.020  1.00 42.42  ? 104  ALA D CB  1 
ATOM   5758  N N   . GLY D  3 105 ? -24.811 -45.228  35.374  1.00 42.61  ? 105  GLY D N   1 
ATOM   5759  C CA  . GLY D  3 105 ? -23.854 -45.797  34.442  1.00 47.31  ? 105  GLY D CA  1 
ATOM   5760  C C   . GLY D  3 105 ? -24.176 -47.227  34.055  1.00 47.77  ? 105  GLY D C   1 
ATOM   5761  O O   . GLY D  3 105 ? -24.803 -47.961  34.819  1.00 41.58  ? 105  GLY D O   1 
ATOM   5762  N N   . ILE D  3 106 ? -23.746 -47.622  32.859  1.00 50.16  ? 106  ILE D N   1 
ATOM   5763  C CA  . ILE D  3 106 ? -23.989 -48.971  32.354  1.00 48.97  ? 106  ILE D CA  1 
ATOM   5764  C C   . ILE D  3 106 ? -22.731 -49.590  31.752  1.00 42.79  ? 106  ILE D C   1 
ATOM   5765  O O   . ILE D  3 106 ? -21.713 -48.917  31.583  1.00 31.64  ? 106  ILE D O   1 
ATOM   5766  C CB  . ILE D  3 106 ? -25.095 -48.988  31.279  1.00 47.93  ? 106  ILE D CB  1 
ATOM   5767  C CG1 . ILE D  3 106 ? -24.685 -48.125  30.084  1.00 42.86  ? 106  ILE D CG1 1 
ATOM   5768  C CG2 . ILE D  3 106 ? -26.422 -48.524  31.861  1.00 51.03  ? 106  ILE D CG2 1 
ATOM   5769  C CD1 . ILE D  3 106 ? -25.651 -48.190  28.924  1.00 42.46  ? 106  ILE D CD1 1 
ATOM   5770  N N   . THR D  3 107 ? -22.814 -50.879  31.431  1.00 43.64  ? 107  THR D N   1 
ATOM   5771  C CA  . THR D  3 107 ? -21.715 -51.591  30.787  1.00 42.49  ? 107  THR D CA  1 
ATOM   5772  C C   . THR D  3 107 ? -22.208 -52.474  29.645  1.00 48.24  ? 107  THR D C   1 
ATOM   5773  O O   . THR D  3 107 ? -23.082 -53.319  29.837  1.00 53.98  ? 107  THR D O   1 
ATOM   5774  C CB  . THR D  3 107 ? -20.945 -52.487  31.780  1.00 44.00  ? 107  THR D CB  1 
ATOM   5775  O OG1 . THR D  3 107 ? -21.832 -53.467  32.332  1.00 52.61  ? 107  THR D OG1 1 
ATOM   5776  C CG2 . THR D  3 107 ? -20.343 -51.664  32.902  1.00 42.52  ? 107  THR D CG2 1 
ATOM   5777  N N   . GLN D  3 108 ? -21.647 -52.272  28.458  1.00 48.85  ? 108  GLN D N   1 
ATOM   5778  C CA  . GLN D  3 108 ? -21.866 -53.187  27.343  1.00 50.92  ? 108  GLN D CA  1 
ATOM   5779  C C   . GLN D  3 108 ? -20.534 -53.788  26.913  1.00 49.52  ? 108  GLN D C   1 
ATOM   5780  O O   . GLN D  3 108 ? -19.899 -53.315  25.970  1.00 44.67  ? 108  GLN D O   1 
ATOM   5781  C CB  . GLN D  3 108 ? -22.540 -52.481  26.165  1.00 54.32  ? 108  GLN D CB  1 
ATOM   5782  C CG  . GLN D  3 108 ? -24.037 -52.279  26.336  1.00 60.73  ? 108  GLN D CG  1 
ATOM   5783  C CD  . GLN D  3 108 ? -24.779 -52.315  25.014  1.00 69.72  ? 108  GLN D CD  1 
ATOM   5784  O OE1 . GLN D  3 108 ? -24.280 -52.850  24.025  1.00 69.94  ? 108  GLN D OE1 1 
ATOM   5785  N NE2 . GLN D  3 108 ? -25.978 -51.744  24.991  1.00 74.03  ? 108  GLN D NE2 1 
ATOM   5786  N N   . ASP D  3 109 ? -20.119 -54.836  27.616  1.00 52.66  ? 109  ASP D N   1 
ATOM   5787  C CA  . ASP D  3 109 ? -18.802 -55.427  27.413  1.00 52.46  ? 109  ASP D CA  1 
ATOM   5788  C C   . ASP D  3 109 ? -18.692 -56.223  26.118  1.00 54.33  ? 109  ASP D C   1 
ATOM   5789  O O   . ASP D  3 109 ? -19.561 -57.034  25.794  1.00 58.97  ? 109  ASP D O   1 
ATOM   5790  C CB  . ASP D  3 109 ? -18.440 -56.325  28.598  1.00 55.41  ? 109  ASP D CB  1 
ATOM   5791  C CG  . ASP D  3 109 ? -18.058 -55.533  29.832  1.00 59.17  ? 109  ASP D CG  1 
ATOM   5792  O OD1 . ASP D  3 109 ? -18.437 -54.346  29.920  1.00 58.83  ? 109  ASP D OD1 1 
ATOM   5793  O OD2 . ASP D  3 109 ? -17.378 -56.098  30.714  1.00 61.33  ? 109  ASP D OD2 1 
ATOM   5794  N N   . GLU D  3 110 ? -17.607 -55.979  25.389  1.00 55.84  ? 110  GLU D N   1 
ATOM   5795  C CA  . GLU D  3 110 ? -17.282 -56.717  24.175  1.00 59.92  ? 110  GLU D CA  1 
ATOM   5796  C C   . GLU D  3 110 ? -15.840 -56.416  23.775  1.00 57.63  ? 110  GLU D C   1 
ATOM   5797  O O   . GLU D  3 110 ? -15.328 -55.333  24.057  1.00 51.98  ? 110  GLU D O   1 
ATOM   5798  C CB  . GLU D  3 110 ? -18.244 -56.361  23.037  1.00 62.87  ? 110  GLU D CB  1 
ATOM   5799  C CG  . GLU D  3 110 ? -18.079 -57.225  21.796  1.00 68.30  ? 110  GLU D CG  1 
ATOM   5800  C CD  . GLU D  3 110 ? -18.035 -58.707  22.123  1.00 74.27  ? 110  GLU D CD  1 
ATOM   5801  O OE1 . GLU D  3 110 ? -18.959 -59.197  22.807  1.00 79.89  ? 110  GLU D OE1 1 
ATOM   5802  O OE2 . GLU D  3 110 ? -17.070 -59.381  21.704  1.00 72.83  ? 110  GLU D OE2 1 
ATOM   5803  N N   . PHE D  3 111 ? -15.183 -57.376  23.131  1.00 61.31  ? 111  PHE D N   1 
ATOM   5804  C CA  . PHE D  3 111 ? -13.800 -57.194  22.701  1.00 58.20  ? 111  PHE D CA  1 
ATOM   5805  C C   . PHE D  3 111 ? -13.694 -56.100  21.644  1.00 54.94  ? 111  PHE D C   1 
ATOM   5806  O O   . PHE D  3 111 ? -14.650 -55.835  20.915  1.00 58.42  ? 111  PHE D O   1 
ATOM   5807  C CB  . PHE D  3 111 ? -13.225 -58.507  22.164  1.00 60.76  ? 111  PHE D CB  1 
ATOM   5808  C CG  . PHE D  3 111 ? -13.167 -59.606  23.187  1.00 61.04  ? 111  PHE D CG  1 
ATOM   5809  C CD1 . PHE D  3 111 ? -12.226 -59.576  24.202  1.00 58.30  ? 111  PHE D CD1 1 
ATOM   5810  C CD2 . PHE D  3 111 ? -14.050 -60.673  23.129  1.00 64.36  ? 111  PHE D CD2 1 
ATOM   5811  C CE1 . PHE D  3 111 ? -12.169 -60.586  25.144  1.00 60.42  ? 111  PHE D CE1 1 
ATOM   5812  C CE2 . PHE D  3 111 ? -13.997 -61.686  24.068  1.00 65.36  ? 111  PHE D CE2 1 
ATOM   5813  C CZ  . PHE D  3 111 ? -13.055 -61.642  25.077  1.00 62.87  ? 111  PHE D CZ  1 
ATOM   5814  N N   . LEU D  3 112 ? -12.525 -55.469  21.572  1.00 49.19  ? 112  LEU D N   1 
ATOM   5815  C CA  . LEU D  3 112 ? -12.290 -54.360  20.651  1.00 47.94  ? 112  LEU D CA  1 
ATOM   5816  C C   . LEU D  3 112 ? -12.541 -54.746  19.199  1.00 48.95  ? 112  LEU D C   1 
ATOM   5817  O O   . LEU D  3 112 ? -13.153 -53.990  18.446  1.00 56.55  ? 112  LEU D O   1 
ATOM   5818  C CB  . LEU D  3 112 ? -10.860 -53.838  20.805  1.00 49.27  ? 112  LEU D CB  1 
ATOM   5819  C CG  . LEU D  3 112 ? -10.399 -52.801  19.778  1.00 48.15  ? 112  LEU D CG  1 
ATOM   5820  C CD1 . LEU D  3 112 ? -11.256 -51.547  19.851  1.00 48.63  ? 112  LEU D CD1 1 
ATOM   5821  C CD2 . LEU D  3 112 ? -8.930  -52.462  19.975  1.00 47.34  ? 112  LEU D CD2 1 
ATOM   5822  N N   . LEU D  3 113 ? -12.071 -55.927  18.814  1.00 44.39  ? 113  LEU D N   1 
ATOM   5823  C CA  . LEU D  3 113 ? -12.182 -56.382  17.433  1.00 45.35  ? 113  LEU D CA  1 
ATOM   5824  C C   . LEU D  3 113 ? -13.629 -56.619  17.006  1.00 44.42  ? 113  LEU D C   1 
ATOM   5825  O O   . LEU D  3 113 ? -13.939 -56.598  15.815  1.00 46.68  ? 113  LEU D O   1 
ATOM   5826  C CB  . LEU D  3 113 ? -11.370 -57.663  17.230  1.00 47.68  ? 113  LEU D CB  1 
ATOM   5827  C CG  . LEU D  3 113 ? -9.856  -57.548  17.412  1.00 49.19  ? 113  LEU D CG  1 
ATOM   5828  C CD1 . LEU D  3 113 ? -9.180  -58.884  17.141  1.00 52.99  ? 113  LEU D CD1 1 
ATOM   5829  C CD2 . LEU D  3 113 ? -9.287  -56.463  16.513  1.00 47.51  ? 113  LEU D CD2 1 
ATOM   5830  N N   . HIS D  3 114 ? -14.512 -56.839  17.975  1.00 43.97  ? 114  HIS D N   1 
ATOM   5831  C CA  . HIS D  3 114 ? -15.895 -57.184  17.662  1.00 46.90  ? 114  HIS D CA  1 
ATOM   5832  C C   . HIS D  3 114 ? -16.913 -56.276  18.349  1.00 49.10  ? 114  HIS D C   1 
ATOM   5833  O O   . HIS D  3 114 ? -18.103 -56.589  18.387  1.00 47.73  ? 114  HIS D O   1 
ATOM   5834  C CB  . HIS D  3 114 ? -16.168 -58.642  18.037  1.00 44.46  ? 114  HIS D CB  1 
ATOM   5835  C CG  . HIS D  3 114 ? -15.207 -59.612  17.425  1.00 46.89  ? 114  HIS D CG  1 
ATOM   5836  N ND1 . HIS D  3 114 ? -14.087 -60.068  18.086  1.00 50.17  ? 114  HIS D ND1 1 
ATOM   5837  C CD2 . HIS D  3 114 ? -15.193 -60.206  16.208  1.00 53.83  ? 114  HIS D CD2 1 
ATOM   5838  C CE1 . HIS D  3 114 ? -13.428 -60.905  17.305  1.00 54.62  ? 114  HIS D CE1 1 
ATOM   5839  N NE2 . HIS D  3 114 ? -14.078 -61.006  16.160  1.00 57.90  ? 114  HIS D NE2 1 
ATOM   5840  N N   . MET D  3 115 ? -16.450 -55.152  18.887  1.00 50.42  ? 115  MET D N   1 
ATOM   5841  C CA  . MET D  3 115 ? -17.351 -54.196  19.522  1.00 50.57  ? 115  MET D CA  1 
ATOM   5842  C C   . MET D  3 115 ? -18.091 -53.369  18.477  1.00 46.25  ? 115  MET D C   1 
ATOM   5843  O O   . MET D  3 115 ? -17.470 -52.702  17.650  1.00 45.69  ? 115  MET D O   1 
ATOM   5844  C CB  . MET D  3 115 ? -16.585 -53.273  20.471  1.00 50.21  ? 115  MET D CB  1 
ATOM   5845  C CG  . MET D  3 115 ? -17.440 -52.168  21.070  1.00 46.36  ? 115  MET D CG  1 
ATOM   5846  S SD  . MET D  3 115 ? -16.526 -51.105  22.201  1.00 50.38  ? 115  MET D SD  1 
ATOM   5847  C CE  . MET D  3 115 ? -16.085 -52.275  23.481  1.00 32.92  ? 115  MET D CE  1 
ATOM   5848  N N   . SER D  3 116 ? -19.419 -53.416  18.516  1.00 44.66  ? 116  SER D N   1 
ATOM   5849  C CA  . SER D  3 116 ? -20.229 -52.660  17.568  1.00 48.15  ? 116  SER D CA  1 
ATOM   5850  C C   . SER D  3 116 ? -20.247 -51.182  17.937  1.00 44.38  ? 116  SER D C   1 
ATOM   5851  O O   . SER D  3 116 ? -19.772 -50.793  19.005  1.00 44.38  ? 116  SER D O   1 
ATOM   5852  C CB  . SER D  3 116 ? -21.657 -53.209  17.512  1.00 54.11  ? 116  SER D CB  1 
ATOM   5853  O OG  . SER D  3 116 ? -22.377 -52.889  18.689  1.00 54.80  ? 116  SER D OG  1 
ATOM   5854  N N   . GLU D  3 117 ? -20.798 -50.361  17.049  1.00 46.04  ? 117  GLU D N   1 
ATOM   5855  C CA  . GLU D  3 117 ? -20.839 -48.921  17.264  1.00 50.98  ? 117  GLU D CA  1 
ATOM   5856  C C   . GLU D  3 117 ? -21.807 -48.551  18.385  1.00 57.54  ? 117  GLU D C   1 
ATOM   5857  O O   . GLU D  3 117 ? -21.581 -47.588  19.118  1.00 61.91  ? 117  GLU D O   1 
ATOM   5858  C CB  . GLU D  3 117 ? -21.227 -48.199  15.972  1.00 56.14  ? 117  GLU D CB  1 
ATOM   5859  C CG  . GLU D  3 117 ? -21.101 -46.687  16.045  1.00 62.03  ? 117  GLU D CG  1 
ATOM   5860  C CD  . GLU D  3 117 ? -21.432 -46.010  14.730  1.00 71.37  ? 117  GLU D CD  1 
ATOM   5861  O OE1 . GLU D  3 117 ? -21.798 -46.719  13.769  1.00 77.84  ? 117  GLU D OE1 1 
ATOM   5862  O OE2 . GLU D  3 117 ? -21.325 -44.767  14.657  1.00 73.57  ? 117  GLU D OE2 1 
ATOM   5863  N N   . ASP D  3 118 ? -22.882 -49.323  18.519  1.00 55.76  ? 118  ASP D N   1 
ATOM   5864  C CA  . ASP D  3 118 ? -23.876 -49.063  19.554  1.00 57.06  ? 118  ASP D CA  1 
ATOM   5865  C C   . ASP D  3 118 ? -23.344 -49.424  20.937  1.00 52.21  ? 118  ASP D C   1 
ATOM   5866  O O   . ASP D  3 118 ? -23.718 -48.804  21.932  1.00 54.81  ? 118  ASP D O   1 
ATOM   5867  C CB  . ASP D  3 118 ? -25.167 -49.833  19.273  1.00 67.21  ? 118  ASP D CB  1 
ATOM   5868  C CG  . ASP D  3 118 ? -26.239 -49.565  20.312  1.00 72.61  ? 118  ASP D CG  1 
ATOM   5869  O OD1 . ASP D  3 118 ? -26.925 -48.526  20.209  1.00 71.33  ? 118  ASP D OD1 1 
ATOM   5870  O OD2 . ASP D  3 118 ? -26.394 -50.393  21.235  1.00 77.37  ? 118  ASP D OD2 1 
ATOM   5871  N N   . ASP D  3 119 ? -22.476 -50.430  20.996  1.00 45.93  ? 119  ASP D N   1 
ATOM   5872  C CA  . ASP D  3 119 ? -21.819 -50.792  22.246  1.00 42.55  ? 119  ASP D CA  1 
ATOM   5873  C C   . ASP D  3 119 ? -20.975 -49.622  22.732  1.00 40.57  ? 119  ASP D C   1 
ATOM   5874  O O   . ASP D  3 119 ? -20.832 -49.395  23.932  1.00 41.25  ? 119  ASP D O   1 
ATOM   5875  C CB  . ASP D  3 119 ? -20.944 -52.036  22.074  1.00 46.35  ? 119  ASP D CB  1 
ATOM   5876  C CG  . ASP D  3 119 ? -21.726 -53.240  21.588  1.00 56.96  ? 119  ASP D CG  1 
ATOM   5877  O OD1 . ASP D  3 119 ? -22.973 -53.183  21.589  1.00 60.40  ? 119  ASP D OD1 1 
ATOM   5878  O OD2 . ASP D  3 119 ? -21.091 -54.247  21.208  1.00 60.37  ? 119  ASP D OD2 1 
ATOM   5879  N N   . TRP D  3 120 ? -20.419 -48.883  21.779  1.00 40.15  ? 120  TRP D N   1 
ATOM   5880  C CA  . TRP D  3 120 ? -19.607 -47.713  22.078  1.00 37.34  ? 120  TRP D CA  1 
ATOM   5881  C C   . TRP D  3 120 ? -20.474 -46.495  22.379  1.00 35.93  ? 120  TRP D C   1 
ATOM   5882  O O   . TRP D  3 120 ? -20.281 -45.822  23.391  1.00 34.98  ? 120  TRP D O   1 
ATOM   5883  C CB  . TRP D  3 120 ? -18.665 -47.412  20.909  1.00 32.26  ? 120  TRP D CB  1 
ATOM   5884  C CG  . TRP D  3 120 ? -17.950 -46.104  21.030  1.00 31.19  ? 120  TRP D CG  1 
ATOM   5885  C CD1 . TRP D  3 120 ? -18.365 -44.895  20.551  1.00 31.28  ? 120  TRP D CD1 1 
ATOM   5886  C CD2 . TRP D  3 120 ? -16.690 -45.871  21.668  1.00 30.14  ? 120  TRP D CD2 1 
ATOM   5887  N NE1 . TRP D  3 120 ? -17.443 -43.923  20.854  1.00 33.99  ? 120  TRP D NE1 1 
ATOM   5888  C CE2 . TRP D  3 120 ? -16.404 -44.497  21.539  1.00 35.82  ? 120  TRP D CE2 1 
ATOM   5889  C CE3 . TRP D  3 120 ? -15.775 -46.691  22.336  1.00 44.40  ? 120  TRP D CE3 1 
ATOM   5890  C CZ2 . TRP D  3 120 ? -15.244 -43.925  22.053  1.00 38.42  ? 120  TRP D CZ2 1 
ATOM   5891  C CZ3 . TRP D  3 120 ? -14.623 -46.120  22.846  1.00 45.82  ? 120  TRP D CZ3 1 
ATOM   5892  C CH2 . TRP D  3 120 ? -14.368 -44.751  22.702  1.00 43.14  ? 120  TRP D CH2 1 
ATOM   5893  N N   . ASP D  3 121 ? -21.430 -46.222  21.497  1.00 38.85  ? 121  ASP D N   1 
ATOM   5894  C CA  . ASP D  3 121 ? -22.251 -45.018  21.588  1.00 40.21  ? 121  ASP D CA  1 
ATOM   5895  C C   . ASP D  3 121 ? -23.064 -44.933  22.876  1.00 44.60  ? 121  ASP D C   1 
ATOM   5896  O O   . ASP D  3 121 ? -23.125 -43.877  23.503  1.00 50.75  ? 121  ASP D O   1 
ATOM   5897  C CB  . ASP D  3 121 ? -23.194 -44.929  20.385  1.00 46.15  ? 121  ASP D CB  1 
ATOM   5898  C CG  . ASP D  3 121 ? -22.465 -44.615  19.094  1.00 52.86  ? 121  ASP D CG  1 
ATOM   5899  O OD1 . ASP D  3 121 ? -21.354 -44.049  19.160  1.00 52.79  ? 121  ASP D OD1 1 
ATOM   5900  O OD2 . ASP D  3 121 ? -23.006 -44.929  18.014  1.00 57.47  ? 121  ASP D OD2 1 
ATOM   5901  N N   . LYS D  3 122 ? -23.686 -46.039  23.269  1.00 43.27  ? 122  LYS D N   1 
ATOM   5902  C CA  . LYS D  3 122 ? -24.582 -46.027  24.421  1.00 44.47  ? 122  LYS D CA  1 
ATOM   5903  C C   . LYS D  3 122 ? -23.836 -45.884  25.746  1.00 37.29  ? 122  LYS D C   1 
ATOM   5904  O O   . LYS D  3 122 ? -24.317 -45.224  26.666  1.00 36.98  ? 122  LYS D O   1 
ATOM   5905  C CB  . LYS D  3 122 ? -25.443 -47.291  24.447  1.00 54.13  ? 122  LYS D CB  1 
ATOM   5906  C CG  . LYS D  3 122 ? -26.932 -46.994  24.492  1.00 62.22  ? 122  LYS D CG  1 
ATOM   5907  C CD  . LYS D  3 122 ? -27.716 -48.105  25.167  1.00 70.66  ? 122  LYS D CD  1 
ATOM   5908  C CE  . LYS D  3 122 ? -29.159 -47.683  25.400  1.00 76.25  ? 122  LYS D CE  1 
ATOM   5909  N NZ  . LYS D  3 122 ? -29.906 -48.666  26.231  1.00 78.15  ? 122  LYS D NZ  1 
ATOM   5910  N N   . VAL D  3 123 ? -22.664 -46.503  25.843  1.00 33.74  ? 123  VAL D N   1 
ATOM   5911  C CA  . VAL D  3 123 ? -21.868 -46.427  27.062  1.00 32.68  ? 123  VAL D CA  1 
ATOM   5912  C C   . VAL D  3 123 ? -21.287 -45.025  27.240  1.00 30.94  ? 123  VAL D C   1 
ATOM   5913  O O   . VAL D  3 123 ? -21.273 -44.484  28.347  1.00 29.63  ? 123  VAL D O   1 
ATOM   5914  C CB  . VAL D  3 123 ? -20.735 -47.473  27.057  1.00 37.23  ? 123  VAL D CB  1 
ATOM   5915  C CG1 . VAL D  3 123 ? -19.762 -47.223  28.200  1.00 37.88  ? 123  VAL D CG1 1 
ATOM   5916  C CG2 . VAL D  3 123 ? -21.318 -48.874  27.150  1.00 39.77  ? 123  VAL D CG2 1 
ATOM   5917  N N   . ILE D  3 124 ? -20.825 -44.433  26.144  1.00 32.43  ? 124  ILE D N   1 
ATOM   5918  C CA  . ILE D  3 124 ? -20.306 -43.070  26.175  1.00 31.95  ? 124  ILE D CA  1 
ATOM   5919  C C   . ILE D  3 124 ? -21.413 -42.067  26.499  1.00 32.73  ? 124  ILE D C   1 
ATOM   5920  O O   . ILE D  3 124 ? -21.218 -41.150  27.297  1.00 30.38  ? 124  ILE D O   1 
ATOM   5921  C CB  . ILE D  3 124 ? -19.644 -42.689  24.835  1.00 33.38  ? 124  ILE D CB  1 
ATOM   5922  C CG1 . ILE D  3 124 ? -18.409 -43.557  24.587  1.00 34.25  ? 124  ILE D CG1 1 
ATOM   5923  C CG2 . ILE D  3 124 ? -19.264 -41.216  24.820  1.00 28.18  ? 124  ILE D CG2 1 
ATOM   5924  C CD1 . ILE D  3 124 ? -17.359 -43.451  25.669  1.00 35.41  ? 124  ILE D CD1 1 
ATOM   5925  N N   . ALA D  3 125 ? -22.578 -42.257  25.888  1.00 36.70  ? 125  ALA D N   1 
ATOM   5926  C CA  . ALA D  3 125 ? -23.699 -41.340  26.070  1.00 37.48  ? 125  ALA D CA  1 
ATOM   5927  C C   . ALA D  3 125 ? -24.200 -41.318  27.511  1.00 38.28  ? 125  ALA D C   1 
ATOM   5928  O O   . ALA D  3 125 ? -24.579 -40.267  28.027  1.00 41.98  ? 125  ALA D O   1 
ATOM   5929  C CB  . ALA D  3 125 ? -24.835 -41.704  25.126  1.00 41.73  ? 125  ALA D CB  1 
ATOM   5930  N N   . VAL D  3 126 ? -24.201 -42.479  28.158  1.00 39.47  ? 126  VAL D N   1 
ATOM   5931  C CA  . VAL D  3 126 ? -24.708 -42.591  29.522  1.00 42.20  ? 126  VAL D CA  1 
ATOM   5932  C C   . VAL D  3 126 ? -23.643 -42.254  30.562  1.00 42.50  ? 126  VAL D C   1 
ATOM   5933  O O   . VAL D  3 126 ? -23.841 -41.378  31.404  1.00 44.36  ? 126  VAL D O   1 
ATOM   5934  C CB  . VAL D  3 126 ? -25.250 -44.007  29.805  1.00 44.63  ? 126  VAL D CB  1 
ATOM   5935  C CG1 . VAL D  3 126 ? -25.578 -44.167  31.282  1.00 43.65  ? 126  VAL D CG1 1 
ATOM   5936  C CG2 . VAL D  3 126 ? -26.475 -44.289  28.948  1.00 47.21  ? 126  VAL D CG2 1 
ATOM   5937  N N   . ASN D  3 127 ? -22.515 -42.953  30.497  1.00 41.82  ? 127  ASN D N   1 
ATOM   5938  C CA  . ASN D  3 127 ? -21.460 -42.798  31.491  1.00 31.43  ? 127  ASN D CA  1 
ATOM   5939  C C   . ASN D  3 127 ? -20.712 -41.474  31.365  1.00 34.94  ? 127  ASN D C   1 
ATOM   5940  O O   . ASN D  3 127 ? -20.500 -40.777  32.356  1.00 39.04  ? 127  ASN D O   1 
ATOM   5941  C CB  . ASN D  3 127 ? -20.471 -43.962  31.393  1.00 30.83  ? 127  ASN D CB  1 
ATOM   5942  C CG  . ASN D  3 127 ? -21.146 -45.314  31.535  1.00 38.25  ? 127  ASN D CG  1 
ATOM   5943  O OD1 . ASN D  3 127 ? -22.372 -45.415  31.511  1.00 41.48  ? 127  ASN D OD1 1 
ATOM   5944  N ND2 . ASN D  3 127 ? -20.345 -46.363  31.679  1.00 41.35  ? 127  ASN D ND2 1 
ATOM   5945  N N   . LEU D  3 128 ? -20.316 -41.128  30.144  1.00 31.76  ? 128  LEU D N   1 
ATOM   5946  C CA  . LEU D  3 128 ? -19.510 -39.933  29.920  1.00 36.77  ? 128  LEU D CA  1 
ATOM   5947  C C   . LEU D  3 128 ? -20.363 -38.685  29.702  1.00 33.02  ? 128  LEU D C   1 
ATOM   5948  O O   . LEU D  3 128 ? -20.315 -37.748  30.500  1.00 26.15  ? 128  LEU D O   1 
ATOM   5949  C CB  . LEU D  3 128 ? -18.576 -40.139  28.725  1.00 42.33  ? 128  LEU D CB  1 
ATOM   5950  C CG  . LEU D  3 128 ? -17.643 -38.972  28.400  1.00 40.95  ? 128  LEU D CG  1 
ATOM   5951  C CD1 . LEU D  3 128 ? -16.826 -38.604  29.621  1.00 37.98  ? 128  LEU D CD1 1 
ATOM   5952  C CD2 . LEU D  3 128 ? -16.735 -39.318  27.232  1.00 42.15  ? 128  LEU D CD2 1 
ATOM   5953  N N   . LYS D  3 129 ? -21.134 -38.675  28.619  1.00 33.63  ? 129  LYS D N   1 
ATOM   5954  C CA  . LYS D  3 129 ? -21.972 -37.526  28.290  1.00 41.19  ? 129  LYS D CA  1 
ATOM   5955  C C   . LYS D  3 129 ? -23.010 -37.263  29.376  1.00 46.91  ? 129  LYS D C   1 
ATOM   5956  O O   . LYS D  3 129 ? -23.272 -36.113  29.728  1.00 53.19  ? 129  LYS D O   1 
ATOM   5957  C CB  . LYS D  3 129 ? -22.668 -37.732  26.942  1.00 44.67  ? 129  LYS D CB  1 
ATOM   5958  C CG  . LYS D  3 129 ? -23.547 -36.563  26.520  1.00 47.83  ? 129  LYS D CG  1 
ATOM   5959  C CD  . LYS D  3 129 ? -24.195 -36.803  25.166  1.00 49.96  ? 129  LYS D CD  1 
ATOM   5960  C CE  . LYS D  3 129 ? -25.037 -35.609  24.741  1.00 51.05  ? 129  LYS D CE  1 
ATOM   5961  N NZ  . LYS D  3 129 ? -25.668 -35.814  23.408  1.00 52.36  ? 129  LYS D NZ  1 
ATOM   5962  N N   . GLY D  3 130 ? -23.592 -38.335  29.904  1.00 42.24  ? 130  GLY D N   1 
ATOM   5963  C CA  . GLY D  3 130 ? -24.586 -38.230  30.957  1.00 33.17  ? 130  GLY D CA  1 
ATOM   5964  C C   . GLY D  3 130 ? -24.045 -37.537  32.192  1.00 32.79  ? 130  GLY D C   1 
ATOM   5965  O O   . GLY D  3 130 ? -24.724 -36.710  32.798  1.00 36.18  ? 130  GLY D O   1 
ATOM   5966  N N   . THR D  3 131 ? -22.815 -37.877  32.562  1.00 31.40  ? 131  THR D N   1 
ATOM   5967  C CA  . THR D  3 131 ? -22.154 -37.244  33.695  1.00 34.77  ? 131  THR D CA  1 
ATOM   5968  C C   . THR D  3 131 ? -21.902 -35.766  33.412  1.00 39.52  ? 131  THR D C   1 
ATOM   5969  O O   . THR D  3 131 ? -22.130 -34.913  34.271  1.00 39.82  ? 131  THR D O   1 
ATOM   5970  C CB  . THR D  3 131 ? -20.822 -37.939  34.028  1.00 37.01  ? 131  THR D CB  1 
ATOM   5971  O OG1 . THR D  3 131 ? -21.072 -39.300  34.402  1.00 40.55  ? 131  THR D OG1 1 
ATOM   5972  C CG2 . THR D  3 131 ? -20.117 -37.229  35.171  1.00 38.63  ? 131  THR D CG2 1 
ATOM   5973  N N   . PHE D  3 132 ? -21.438 -35.472  32.201  1.00 37.23  ? 132  PHE D N   1 
ATOM   5974  C CA  . PHE D  3 132 ? -21.174 -34.098  31.784  1.00 36.47  ? 132  PHE D CA  1 
ATOM   5975  C C   . PHE D  3 132 ? -22.434 -33.242  31.834  1.00 37.57  ? 132  PHE D C   1 
ATOM   5976  O O   . PHE D  3 132 ? -22.398 -32.094  32.277  1.00 40.15  ? 132  PHE D O   1 
ATOM   5977  C CB  . PHE D  3 132 ? -20.582 -34.071  30.373  1.00 32.71  ? 132  PHE D CB  1 
ATOM   5978  C CG  . PHE D  3 132 ? -20.749 -32.752  29.670  1.00 36.49  ? 132  PHE D CG  1 
ATOM   5979  C CD1 . PHE D  3 132 ? -19.956 -31.666  30.004  1.00 37.05  ? 132  PHE D CD1 1 
ATOM   5980  C CD2 . PHE D  3 132 ? -21.698 -32.599  28.671  1.00 42.40  ? 132  PHE D CD2 1 
ATOM   5981  C CE1 . PHE D  3 132 ? -20.109 -30.453  29.358  1.00 39.17  ? 132  PHE D CE1 1 
ATOM   5982  C CE2 . PHE D  3 132 ? -21.856 -31.387  28.023  1.00 44.28  ? 132  PHE D CE2 1 
ATOM   5983  C CZ  . PHE D  3 132 ? -21.060 -30.313  28.367  1.00 42.44  ? 132  PHE D CZ  1 
ATOM   5984  N N   . LEU D  3 133 ? -23.545 -33.809  31.376  1.00 33.13  ? 133  LEU D N   1 
ATOM   5985  C CA  . LEU D  3 133 ? -24.814 -33.095  31.337  1.00 34.89  ? 133  LEU D CA  1 
ATOM   5986  C C   . LEU D  3 133 ? -25.321 -32.767  32.737  1.00 37.26  ? 133  LEU D C   1 
ATOM   5987  O O   . LEU D  3 133 ? -25.762 -31.648  32.998  1.00 40.31  ? 133  LEU D O   1 
ATOM   5988  C CB  . LEU D  3 133 ? -25.859 -33.913  30.578  1.00 38.83  ? 133  LEU D CB  1 
ATOM   5989  C CG  . LEU D  3 133 ? -25.640 -34.031  29.070  1.00 43.81  ? 133  LEU D CG  1 
ATOM   5990  C CD1 . LEU D  3 133 ? -26.607 -35.032  28.462  1.00 46.00  ? 133  LEU D CD1 1 
ATOM   5991  C CD2 . LEU D  3 133 ? -25.781 -32.671  28.404  1.00 47.27  ? 133  LEU D CD2 1 
ATOM   5992  N N   . VAL D  3 134 ? -25.257 -33.746  33.633  1.00 35.36  ? 134  VAL D N   1 
ATOM   5993  C CA  . VAL D  3 134 ? -25.686 -33.544  35.012  1.00 38.06  ? 134  VAL D CA  1 
ATOM   5994  C C   . VAL D  3 134 ? -24.758 -32.561  35.717  1.00 42.06  ? 134  VAL D C   1 
ATOM   5995  O O   . VAL D  3 134 ? -25.212 -31.678  36.444  1.00 44.23  ? 134  VAL D O   1 
ATOM   5996  C CB  . VAL D  3 134 ? -25.728 -34.873  35.796  1.00 34.32  ? 134  VAL D CB  1 
ATOM   5997  C CG1 . VAL D  3 134 ? -26.036 -34.620  37.265  1.00 32.93  ? 134  VAL D CG1 1 
ATOM   5998  C CG2 . VAL D  3 134 ? -26.759 -35.812  35.187  1.00 31.52  ? 134  VAL D CG2 1 
ATOM   5999  N N   . THR D  3 135 ? -23.457 -32.713  35.483  1.00 42.69  ? 135  THR D N   1 
ATOM   6000  C CA  . THR D  3 135 ? -22.457 -31.837  36.083  1.00 42.75  ? 135  THR D CA  1 
ATOM   6001  C C   . THR D  3 135 ? -22.652 -30.390  35.644  1.00 44.79  ? 135  THR D C   1 
ATOM   6002  O O   . THR D  3 135 ? -22.625 -29.474  36.466  1.00 46.87  ? 135  THR D O   1 
ATOM   6003  C CB  . THR D  3 135 ? -21.028 -32.281  35.722  1.00 45.60  ? 135  THR D CB  1 
ATOM   6004  O OG1 . THR D  3 135 ? -20.839 -33.649  36.103  1.00 49.36  ? 135  THR D OG1 1 
ATOM   6005  C CG2 . THR D  3 135 ? -20.002 -31.412  36.433  1.00 46.25  ? 135  THR D CG2 1 
ATOM   6006  N N   . GLN D  3 136 ? -22.850 -30.195  34.344  1.00 42.79  ? 136  GLN D N   1 
ATOM   6007  C CA  . GLN D  3 136 ? -23.061 -28.862  33.791  1.00 41.67  ? 136  GLN D CA  1 
ATOM   6008  C C   . GLN D  3 136 ? -24.340 -28.229  34.330  1.00 44.19  ? 136  GLN D C   1 
ATOM   6009  O O   . GLN D  3 136 ? -24.336 -27.077  34.760  1.00 45.92  ? 136  GLN D O   1 
ATOM   6010  C CB  . GLN D  3 136 ? -23.113 -28.916  32.264  1.00 40.35  ? 136  GLN D CB  1 
ATOM   6011  C CG  . GLN D  3 136 ? -23.387 -27.572  31.614  1.00 48.40  ? 136  GLN D CG  1 
ATOM   6012  C CD  . GLN D  3 136 ? -23.521 -27.666  30.108  1.00 57.99  ? 136  GLN D CD  1 
ATOM   6013  O OE1 . GLN D  3 136 ? -24.102 -28.615  29.583  1.00 64.60  ? 136  GLN D OE1 1 
ATOM   6014  N NE2 . GLN D  3 136 ? -22.978 -26.680  29.403  1.00 61.11  ? 136  GLN D NE2 1 
ATOM   6015  N N   . ALA D  3 137 ? -25.429 -28.991  34.304  1.00 39.43  ? 137  ALA D N   1 
ATOM   6016  C CA  . ALA D  3 137 ? -26.725 -28.499  34.760  1.00 41.20  ? 137  ALA D CA  1 
ATOM   6017  C C   . ALA D  3 137 ? -26.701 -28.150  36.245  1.00 44.72  ? 137  ALA D C   1 
ATOM   6018  O O   . ALA D  3 137 ? -27.275 -27.144  36.665  1.00 48.79  ? 137  ALA D O   1 
ATOM   6019  C CB  . ALA D  3 137 ? -27.809 -29.527  34.477  1.00 38.45  ? 137  ALA D CB  1 
ATOM   6020  N N   . ALA D  3 138 ? -26.034 -28.984  37.034  1.00 43.12  ? 138  ALA D N   1 
ATOM   6021  C CA  . ALA D  3 138 ? -25.936 -28.763  38.471  1.00 44.92  ? 138  ALA D CA  1 
ATOM   6022  C C   . ALA D  3 138 ? -25.081 -27.541  38.779  1.00 45.46  ? 138  ALA D C   1 
ATOM   6023  O O   . ALA D  3 138 ? -25.403 -26.753  39.669  1.00 43.89  ? 138  ALA D O   1 
ATOM   6024  C CB  . ALA D  3 138 ? -25.368 -29.990  39.156  1.00 45.40  ? 138  ALA D CB  1 
ATOM   6025  N N   . ALA D  3 139 ? -23.989 -27.394  38.036  1.00 39.43  ? 139  ALA D N   1 
ATOM   6026  C CA  . ALA D  3 139 ? -23.091 -26.259  38.205  1.00 38.29  ? 139  ALA D CA  1 
ATOM   6027  C C   . ALA D  3 139 ? -23.793 -24.951  37.862  1.00 36.46  ? 139  ALA D C   1 
ATOM   6028  O O   . ALA D  3 139 ? -23.572 -23.929  38.509  1.00 36.99  ? 139  ALA D O   1 
ATOM   6029  C CB  . ALA D  3 139 ? -21.853 -26.435  37.348  1.00 41.52  ? 139  ALA D CB  1 
ATOM   6030  N N   . GLN D  3 140 ? -24.640 -24.991  36.839  1.00 35.40  ? 140  GLN D N   1 
ATOM   6031  C CA  . GLN D  3 140 ? -25.405 -23.820  36.429  1.00 32.64  ? 140  GLN D CA  1 
ATOM   6032  C C   . GLN D  3 140 ? -26.403 -23.410  37.504  1.00 34.70  ? 140  GLN D C   1 
ATOM   6033  O O   . GLN D  3 140 ? -26.584 -22.223  37.778  1.00 39.13  ? 140  GLN D O   1 
ATOM   6034  C CB  . GLN D  3 140 ? -26.138 -24.091  35.114  1.00 33.06  ? 140  GLN D CB  1 
ATOM   6035  C CG  . GLN D  3 140 ? -25.235 -24.167  33.897  1.00 33.58  ? 140  GLN D CG  1 
ATOM   6036  C CD  . GLN D  3 140 ? -25.947 -24.731  32.683  1.00 41.78  ? 140  GLN D CD  1 
ATOM   6037  O OE1 . GLN D  3 140 ? -26.989 -25.375  32.806  1.00 41.83  ? 140  GLN D OE1 1 
ATOM   6038  N NE2 . GLN D  3 140 ? -25.387 -24.491  31.502  1.00 45.70  ? 140  GLN D NE2 1 
ATOM   6039  N N   . ALA D  3 141 ? -27.047 -24.401  38.112  1.00 35.74  ? 141  ALA D N   1 
ATOM   6040  C CA  . ALA D  3 141 ? -28.060 -24.154  39.131  1.00 37.96  ? 141  ALA D CA  1 
ATOM   6041  C C   . ALA D  3 141 ? -27.458 -23.524  40.383  1.00 40.51  ? 141  ALA D C   1 
ATOM   6042  O O   . ALA D  3 141 ? -28.087 -22.689  41.032  1.00 38.72  ? 141  ALA D O   1 
ATOM   6043  C CB  . ALA D  3 141 ? -28.778 -25.447  39.483  1.00 40.32  ? 141  ALA D CB  1 
ATOM   6044  N N   . LEU D  3 142 ? -26.236 -23.929  40.716  1.00 40.24  ? 142  LEU D N   1 
ATOM   6045  C CA  . LEU D  3 142 ? -25.556 -23.420  41.901  1.00 37.58  ? 142  LEU D CA  1 
ATOM   6046  C C   . LEU D  3 142 ? -25.035 -22.001  41.693  1.00 41.48  ? 142  LEU D C   1 
ATOM   6047  O O   . LEU D  3 142 ? -25.188 -21.143  42.562  1.00 46.37  ? 142  LEU D O   1 
ATOM   6048  C CB  . LEU D  3 142 ? -24.405 -24.347  42.294  1.00 33.53  ? 142  LEU D CB  1 
ATOM   6049  C CG  . LEU D  3 142 ? -24.805 -25.708  42.867  1.00 37.55  ? 142  LEU D CG  1 
ATOM   6050  C CD1 . LEU D  3 142 ? -23.588 -26.605  43.024  1.00 30.51  ? 142  LEU D CD1 1 
ATOM   6051  C CD2 . LEU D  3 142 ? -25.517 -25.530  44.198  1.00 42.01  ? 142  LEU D CD2 1 
ATOM   6052  N N   . VAL D  3 143 ? -24.418 -21.762  40.539  1.00 39.85  ? 143  VAL D N   1 
ATOM   6053  C CA  . VAL D  3 143 ? -23.849 -20.454  40.229  1.00 41.97  ? 143  VAL D CA  1 
ATOM   6054  C C   . VAL D  3 143 ? -24.933 -19.384  40.121  1.00 44.29  ? 143  VAL D C   1 
ATOM   6055  O O   . VAL D  3 143 ? -24.790 -18.287  40.664  1.00 46.85  ? 143  VAL D O   1 
ATOM   6056  C CB  . VAL D  3 143 ? -23.035 -20.490  38.917  1.00 39.07  ? 143  VAL D CB  1 
ATOM   6057  C CG1 . VAL D  3 143 ? -22.655 -19.084  38.478  1.00 37.39  ? 143  VAL D CG1 1 
ATOM   6058  C CG2 . VAL D  3 143 ? -21.792 -21.349  39.089  1.00 37.91  ? 143  VAL D CG2 1 
ATOM   6059  N N   . SER D  3 144 ? -26.020 -19.716  39.430  1.00 46.92  ? 144  SER D N   1 
ATOM   6060  C CA  . SER D  3 144 ? -27.126 -18.785  39.233  1.00 51.94  ? 144  SER D CA  1 
ATOM   6061  C C   . SER D  3 144 ? -27.767 -18.374  40.557  1.00 53.01  ? 144  SER D C   1 
ATOM   6062  O O   . SER D  3 144 ? -28.328 -17.284  40.672  1.00 52.39  ? 144  SER D O   1 
ATOM   6063  C CB  . SER D  3 144 ? -28.182 -19.399  38.312  1.00 57.66  ? 144  SER D CB  1 
ATOM   6064  O OG  . SER D  3 144 ? -28.718 -20.585  38.871  1.00 63.62  ? 144  SER D OG  1 
ATOM   6065  N N   . ASN D  3 145 ? -27.681 -19.250  41.552  1.00 51.61  ? 145  ASN D N   1 
ATOM   6066  C CA  . ASN D  3 145 ? -28.206 -18.950  42.878  1.00 53.02  ? 145  ASN D CA  1 
ATOM   6067  C C   . ASN D  3 145 ? -27.107 -18.479  43.825  1.00 54.38  ? 145  ASN D C   1 
ATOM   6068  O O   . ASN D  3 145 ? -27.377 -18.095  44.963  1.00 55.93  ? 145  ASN D O   1 
ATOM   6069  C CB  . ASN D  3 145 ? -28.914 -20.172  43.465  1.00 51.81  ? 145  ASN D CB  1 
ATOM   6070  C CG  . ASN D  3 145 ? -30.085 -20.627  42.617  1.00 55.16  ? 145  ASN D CG  1 
ATOM   6071  O OD1 . ASN D  3 145 ? -30.026 -20.593  41.388  1.00 62.45  ? 145  ASN D OD1 1 
ATOM   6072  N ND2 . ASN D  3 145 ? -31.162 -21.045  43.271  1.00 54.24  ? 145  ASN D ND2 1 
ATOM   6073  N N   . GLY D  3 146 ? -25.868 -18.510  43.344  1.00 51.73  ? 146  GLY D N   1 
ATOM   6074  C CA  . GLY D  3 146 ? -24.728 -18.072  44.130  1.00 52.10  ? 146  GLY D CA  1 
ATOM   6075  C C   . GLY D  3 146 ? -24.480 -18.947  45.343  1.00 51.13  ? 146  GLY D C   1 
ATOM   6076  O O   . GLY D  3 146 ? -24.079 -18.458  46.400  1.00 50.71  ? 146  GLY D O   1 
ATOM   6077  N N   . CYS D  3 147 ? -24.719 -20.245  45.189  1.00 51.78  ? 147  CYS D N   1 
ATOM   6078  C CA  . CYS D  3 147 ? -24.548 -21.192  46.285  1.00 50.24  ? 147  CYS D CA  1 
ATOM   6079  C C   . CYS D  3 147 ? -23.330 -22.083  46.074  1.00 45.00  ? 147  CYS D C   1 
ATOM   6080  O O   . CYS D  3 147 ? -23.004 -22.448  44.945  1.00 44.10  ? 147  CYS D O   1 
ATOM   6081  C CB  . CYS D  3 147 ? -25.801 -22.057  46.444  1.00 48.30  ? 147  CYS D CB  1 
ATOM   6082  S SG  . CYS D  3 147 ? -27.328 -21.130  46.716  1.00 74.04  ? 147  CYS D SG  1 
ATOM   6083  N N   . ARG D  3 148 ? -22.658 -22.428  47.167  1.00 44.58  ? 148  ARG D N   1 
ATOM   6084  C CA  . ARG D  3 148 ? -21.551 -23.374  47.113  1.00 43.93  ? 148  ARG D CA  1 
ATOM   6085  C C   . ARG D  3 148 ? -22.090 -24.789  46.937  1.00 44.70  ? 148  ARG D C   1 
ATOM   6086  O O   . ARG D  3 148 ? -23.299 -25.013  47.013  1.00 41.44  ? 148  ARG D O   1 
ATOM   6087  C CB  . ARG D  3 148 ? -20.694 -23.284  48.377  1.00 42.62  ? 148  ARG D CB  1 
ATOM   6088  C CG  . ARG D  3 148 ? -20.017 -21.938  48.578  1.00 47.46  ? 148  ARG D CG  1 
ATOM   6089  C CD  . ARG D  3 148 ? -19.139 -21.946  49.821  1.00 52.78  ? 148  ARG D CD  1 
ATOM   6090  N NE  . ARG D  3 148 ? -18.466 -20.667  50.027  1.00 58.49  ? 148  ARG D NE  1 
ATOM   6091  N N   . GLY D  3 149 ? -21.198 -25.744  46.702  1.00 43.45  ? 149  GLY D N   1 
ATOM   6092  C CA  . GLY D  3 149 ? -21.618 -27.120  46.516  1.00 43.40  ? 149  GLY D CA  1 
ATOM   6093  C C   . GLY D  3 149 ? -20.485 -28.092  46.257  1.00 43.71  ? 149  GLY D C   1 
ATOM   6094  O O   . GLY D  3 149 ? -19.327 -27.698  46.124  1.00 42.73  ? 149  GLY D O   1 
ATOM   6095  N N   . SER D  3 150 ? -20.831 -29.373  46.184  1.00 43.33  ? 150  SER D N   1 
ATOM   6096  C CA  . SER D  3 150 ? -19.856 -30.425  45.935  1.00 41.31  ? 150  SER D CA  1 
ATOM   6097  C C   . SER D  3 150 ? -20.361 -31.397  44.874  1.00 41.01  ? 150  SER D C   1 
ATOM   6098  O O   . SER D  3 150 ? -21.384 -32.054  45.059  1.00 43.35  ? 150  SER D O   1 
ATOM   6099  C CB  . SER D  3 150 ? -19.538 -31.177  47.228  1.00 42.02  ? 150  SER D CB  1 
ATOM   6100  O OG  . SER D  3 150 ? -18.653 -32.257  46.985  1.00 44.43  ? 150  SER D OG  1 
ATOM   6101  N N   . ILE D  3 151 ? -19.638 -31.480  43.762  1.00 42.76  ? 151  ILE D N   1 
ATOM   6102  C CA  . ILE D  3 151 ? -20.001 -32.383  42.675  1.00 42.20  ? 151  ILE D CA  1 
ATOM   6103  C C   . ILE D  3 151 ? -19.175 -33.663  42.731  1.00 44.32  ? 151  ILE D C   1 
ATOM   6104  O O   . ILE D  3 151 ? -17.946 -33.621  42.679  1.00 48.74  ? 151  ILE D O   1 
ATOM   6105  C CB  . ILE D  3 151 ? -19.814 -31.716  41.302  1.00 46.32  ? 151  ILE D CB  1 
ATOM   6106  C CG1 . ILE D  3 151 ? -20.676 -30.456  41.203  1.00 49.66  ? 151  ILE D CG1 1 
ATOM   6107  C CG2 . ILE D  3 151 ? -20.153 -32.692  40.184  1.00 47.01  ? 151  ILE D CG2 1 
ATOM   6108  C CD1 . ILE D  3 151 ? -20.559 -29.737  39.878  1.00 50.59  ? 151  ILE D CD1 1 
ATOM   6109  N N   . ILE D  3 152 ? -19.857 -34.799  42.836  1.00 42.70  ? 152  ILE D N   1 
ATOM   6110  C CA  . ILE D  3 152 ? -19.187 -36.087  42.970  1.00 40.02  ? 152  ILE D CA  1 
ATOM   6111  C C   . ILE D  3 152 ? -19.538 -37.032  41.824  1.00 35.21  ? 152  ILE D C   1 
ATOM   6112  O O   . ILE D  3 152 ? -20.666 -37.512  41.728  1.00 36.07  ? 152  ILE D O   1 
ATOM   6113  C CB  . ILE D  3 152 ? -19.549 -36.766  44.303  1.00 43.85  ? 152  ILE D CB  1 
ATOM   6114  C CG1 . ILE D  3 152 ? -19.398 -35.778  45.462  1.00 44.51  ? 152  ILE D CG1 1 
ATOM   6115  C CG2 . ILE D  3 152 ? -18.693 -38.005  44.520  1.00 43.54  ? 152  ILE D CG2 1 
ATOM   6116  C CD1 . ILE D  3 152 ? -19.939 -36.292  46.775  1.00 47.12  ? 152  ILE D CD1 1 
ATOM   6117  N N   . ASN D  3 153 ? -18.563 -37.298  40.961  1.00 35.02  ? 153  ASN D N   1 
ATOM   6118  C CA  . ASN D  3 153 ? -18.762 -38.203  39.836  1.00 33.74  ? 153  ASN D CA  1 
ATOM   6119  C C   . ASN D  3 153 ? -18.157 -39.575  40.110  1.00 34.02  ? 153  ASN D C   1 
ATOM   6120  O O   . ASN D  3 153 ? -17.031 -39.681  40.591  1.00 38.32  ? 153  ASN D O   1 
ATOM   6121  C CB  . ASN D  3 153 ? -18.159 -37.609  38.562  1.00 40.60  ? 153  ASN D CB  1 
ATOM   6122  C CG  . ASN D  3 153 ? -18.732 -36.246  38.228  1.00 47.45  ? 153  ASN D CG  1 
ATOM   6123  O OD1 . ASN D  3 153 ? -19.919 -35.993  38.429  1.00 49.26  ? 153  ASN D OD1 1 
ATOM   6124  N ND2 . ASN D  3 153 ? -17.886 -35.358  37.718  1.00 51.13  ? 153  ASN D ND2 1 
ATOM   6125  N N   . ILE D  3 154 ? -18.903 -40.629  39.802  1.00 34.44  ? 154  ILE D N   1 
ATOM   6126  C CA  . ILE D  3 154 ? -18.429 -41.980  40.078  1.00 35.14  ? 154  ILE D CA  1 
ATOM   6127  C C   . ILE D  3 154 ? -17.777 -42.623  38.849  1.00 38.63  ? 154  ILE D C   1 
ATOM   6128  O O   . ILE D  3 154 ? -18.464 -43.017  37.908  1.00 46.04  ? 154  ILE D O   1 
ATOM   6129  C CB  . ILE D  3 154 ? -19.573 -42.891  40.554  1.00 33.18  ? 154  ILE D CB  1 
ATOM   6130  C CG1 . ILE D  3 154 ? -20.326 -42.248  41.716  1.00 30.71  ? 154  ILE D CG1 1 
ATOM   6131  C CG2 . ILE D  3 154 ? -19.036 -44.251  40.959  1.00 33.78  ? 154  ILE D CG2 1 
ATOM   6132  C CD1 . ILE D  3 154 ? -19.492 -42.061  42.960  1.00 29.16  ? 154  ILE D CD1 1 
ATOM   6133  N N   . SER D  3 155 ? -16.455 -42.735  38.874  1.00 31.56  ? 155  SER D N   1 
ATOM   6134  C CA  A SER D  3 155 ? -15.717 -43.394  37.804  0.50 29.25  ? 155  SER D CA  1 
ATOM   6135  C CA  B SER D  3 155 ? -15.722 -43.389  37.810  0.50 29.09  ? 155  SER D CA  1 
ATOM   6136  C C   . SER D  3 155 ? -15.521 -44.856  38.147  1.00 34.47  ? 155  SER D C   1 
ATOM   6137  O O   . SER D  3 155 ? -16.405 -45.502  38.711  1.00 42.99  ? 155  SER D O   1 
ATOM   6138  C CB  A SER D  3 155 ? -14.368 -42.724  37.582  0.50 24.80  ? 155  SER D CB  1 
ATOM   6139  C CB  B SER D  3 155 ? -14.380 -42.716  37.613  0.50 24.80  ? 155  SER D CB  1 
ATOM   6140  O OG  A SER D  3 155 ? -14.508 -41.333  37.404  0.50 23.67  ? 155  SER D OG  1 
ATOM   6141  O OG  B SER D  3 155 ? -13.621 -43.346  36.590  0.50 22.84  ? 155  SER D OG  1 
HETATM 6142  N N   . OAS D  3 156 ? -14.359 -45.377  37.785  1.00 31.16  ? 156  OAS D N   1 
HETATM 6143  C CA  . OAS D  3 156 ? -13.997 -46.731  38.144  1.00 37.15  ? 156  OAS D CA  1 
HETATM 6144  C CB  . OAS D  3 156 ? -14.672 -47.781  37.266  1.00 35.59  ? 156  OAS D CB  1 
HETATM 6145  O OG  . OAS D  3 156 ? -14.142 -49.039  37.679  1.00 46.59  ? 156  OAS D OG  1 
HETATM 6146  C C   . OAS D  3 156 ? -12.506 -46.867  38.055  1.00 43.83  ? 156  OAS D C   1 
HETATM 6147  O O   . OAS D  3 156 ? -11.854 -46.010  37.414  1.00 49.49  ? 156  OAS D O   1 
HETATM 6148  C C2A . OAS D  3 156 ? -14.198 -51.511  38.100  1.00 51.33  ? 156  OAS D C2A 1 
HETATM 6149  C C1A . OAS D  3 156 ? -14.856 -50.298  37.518  1.00 55.14  ? 156  OAS D C1A 1 
HETATM 6150  O OAC . OAS D  3 156 ? -15.940 -50.338  36.949  1.00 60.72  ? 156  OAS D OAC 1 
ATOM   6151  N N   . ILE D  3 157 ? -11.951 -47.901  38.682  1.00 43.72  ? 157  ILE D N   1 
ATOM   6152  C CA  . ILE D  3 157 ? -10.518 -48.147  38.606  1.00 40.95  ? 157  ILE D CA  1 
ATOM   6153  C C   . ILE D  3 157 ? -10.130 -48.472  37.154  1.00 43.15  ? 157  ILE D C   1 
ATOM   6154  O O   . ILE D  3 157 ? -8.983  -48.286  36.738  1.00 44.12  ? 157  ILE D O   1 
ATOM   6155  C CB  . ILE D  3 157 ? -10.097 -49.284  39.558  1.00 44.65  ? 157  ILE D CB  1 
ATOM   6156  C CG1 . ILE D  3 157 ? -8.575  -49.396  39.651  1.00 49.09  ? 157  ILE D CG1 1 
ATOM   6157  C CG2 . ILE D  3 157 ? -10.702 -50.594  39.123  1.00 47.83  ? 157  ILE D CG2 1 
ATOM   6158  C CD1 . ILE D  3 157 ? -7.919  -48.110  40.100  1.00 52.83  ? 157  ILE D CD1 1 
ATOM   6159  N N   . VAL D  3 158 ? -11.108 -48.928  36.377  1.00 40.59  ? 158  VAL D N   1 
ATOM   6160  C CA  . VAL D  3 158 ? -10.907 -49.198  34.960  1.00 35.49  ? 158  VAL D CA  1 
ATOM   6161  C C   . VAL D  3 158 ? -10.542 -47.909  34.225  1.00 31.12  ? 158  VAL D C   1 
ATOM   6162  O O   . VAL D  3 158 ? -9.768  -47.925  33.270  1.00 32.24  ? 158  VAL D O   1 
ATOM   6163  C CB  . VAL D  3 158 ? -12.163 -49.837  34.323  1.00 35.21  ? 158  VAL D CB  1 
ATOM   6164  C CG1 . VAL D  3 158 ? -11.964 -50.044  32.833  1.00 39.30  ? 158  VAL D CG1 1 
ATOM   6165  C CG2 . VAL D  3 158 ? -12.482 -51.160  34.996  1.00 32.17  ? 158  VAL D CG2 1 
ATOM   6166  N N   . GLY D  3 159 ? -11.072 -46.786  34.701  1.00 29.21  ? 159  GLY D N   1 
ATOM   6167  C CA  . GLY D  3 159 ? -10.798 -45.495  34.093  1.00 31.76  ? 159  GLY D CA  1 
ATOM   6168  C C   . GLY D  3 159 ? -9.379  -44.993  34.302  1.00 40.30  ? 159  GLY D C   1 
ATOM   6169  O O   . GLY D  3 159 ? -9.041  -43.881  33.898  1.00 46.40  ? 159  GLY D O   1 
ATOM   6170  N N   . LYS D  3 160 ? -8.544  -45.814  34.932  1.00 37.74  ? 160  LYS D N   1 
ATOM   6171  C CA  . LYS D  3 160 ? -7.156  -45.454  35.187  1.00 36.41  ? 160  LYS D CA  1 
ATOM   6172  C C   . LYS D  3 160 ? -6.190  -46.429  34.514  1.00 41.39  ? 160  LYS D C   1 
ATOM   6173  O O   . LYS D  3 160 ? -5.129  -46.031  34.032  1.00 45.36  ? 160  LYS D O   1 
ATOM   6174  C CB  . LYS D  3 160 ? -6.891  -45.404  36.693  1.00 38.19  ? 160  LYS D CB  1 
ATOM   6175  C CG  . LYS D  3 160 ? -5.426  -45.263  37.070  1.00 44.67  ? 160  LYS D CG  1 
ATOM   6176  C CD  . LYS D  3 160 ? -5.230  -45.414  38.569  1.00 48.01  ? 160  LYS D CD  1 
ATOM   6177  C CE  . LYS D  3 160 ? -3.911  -46.099  38.884  1.00 50.68  ? 160  LYS D CE  1 
ATOM   6178  N NZ  . LYS D  3 160 ? -3.759  -46.351  40.344  1.00 53.69  ? 160  LYS D NZ  1 
ATOM   6179  N N   . VAL D  3 161 ? -6.567  -47.703  34.475  1.00 39.93  ? 161  VAL D N   1 
ATOM   6180  C CA  . VAL D  3 161 ? -5.688  -48.741  33.944  1.00 37.23  ? 161  VAL D CA  1 
ATOM   6181  C C   . VAL D  3 161 ? -6.290  -49.504  32.763  1.00 36.70  ? 161  VAL D C   1 
ATOM   6182  O O   . VAL D  3 161 ? -5.591  -50.253  32.083  1.00 39.65  ? 161  VAL D O   1 
ATOM   6183  C CB  . VAL D  3 161 ? -5.315  -49.760  35.035  1.00 37.42  ? 161  VAL D CB  1 
ATOM   6184  C CG1 . VAL D  3 161 ? -4.485  -49.096  36.122  1.00 39.61  ? 161  VAL D CG1 1 
ATOM   6185  C CG2 . VAL D  3 161 ? -6.570  -50.381  35.622  1.00 36.31  ? 161  VAL D CG2 1 
ATOM   6186  N N   . GLY D  3 162 ? -7.584  -49.319  32.524  1.00 40.54  ? 162  GLY D N   1 
ATOM   6187  C CA  . GLY D  3 162 ? -8.266  -50.050  31.470  1.00 41.97  ? 162  GLY D CA  1 
ATOM   6188  C C   . GLY D  3 162 ? -8.604  -51.469  31.891  1.00 48.11  ? 162  GLY D C   1 
ATOM   6189  O O   . GLY D  3 162 ? -8.140  -51.941  32.930  1.00 48.13  ? 162  GLY D O   1 
ATOM   6190  N N   . ASN D  3 163 ? -9.412  -52.151  31.084  1.00 49.65  ? 163  ASN D N   1 
ATOM   6191  C CA  . ASN D  3 163 ? -9.818  -53.521  31.386  1.00 52.51  ? 163  ASN D CA  1 
ATOM   6192  C C   . ASN D  3 163 ? -10.356 -54.243  30.153  1.00 56.84  ? 163  ASN D C   1 
ATOM   6193  O O   . ASN D  3 163 ? -11.034 -53.642  29.322  1.00 57.28  ? 163  ASN D O   1 
ATOM   6194  C CB  . ASN D  3 163 ? -10.872 -53.530  32.496  1.00 48.19  ? 163  ASN D CB  1 
ATOM   6195  C CG  . ASN D  3 163 ? -11.158 -54.925  33.018  1.00 48.27  ? 163  ASN D CG  1 
ATOM   6196  O OD1 . ASN D  3 163 ? -10.301 -55.807  32.965  1.00 52.70  ? 163  ASN D OD1 1 
ATOM   6197  N ND2 . ASN D  3 163 ? -12.367 -55.130  33.525  1.00 45.98  ? 163  ASN D ND2 1 
ATOM   6198  N N   . VAL D  3 164 ? -10.052 -55.534  30.047  1.00 54.08  ? 164  VAL D N   1 
ATOM   6199  C CA  . VAL D  3 164 ? -10.476 -56.350  28.910  1.00 51.95  ? 164  VAL D CA  1 
ATOM   6200  C C   . VAL D  3 164 ? -11.996 -56.378  28.746  1.00 45.56  ? 164  VAL D C   1 
ATOM   6201  O O   . VAL D  3 164 ? -12.735 -56.570  29.712  1.00 38.90  ? 164  VAL D O   1 
ATOM   6202  C CB  . VAL D  3 164 ? -9.945  -57.801  29.040  1.00 49.11  ? 164  VAL D CB  1 
ATOM   6203  C CG1 . VAL D  3 164 ? -10.852 -58.792  28.323  1.00 50.04  ? 164  VAL D CG1 1 
ATOM   6204  C CG2 . VAL D  3 164 ? -8.536  -57.893  28.498  1.00 50.43  ? 164  VAL D CG2 1 
ATOM   6205  N N   . GLY D  3 165 ? -12.451 -56.169  27.514  1.00 48.85  ? 165  GLY D N   1 
ATOM   6206  C CA  . GLY D  3 165 ? -13.866 -56.215  27.199  1.00 51.87  ? 165  GLY D CA  1 
ATOM   6207  C C   . GLY D  3 165 ? -14.560 -54.894  27.456  1.00 54.54  ? 165  GLY D C   1 
ATOM   6208  O O   . GLY D  3 165 ? -15.731 -54.724  27.125  1.00 60.42  ? 165  GLY D O   1 
ATOM   6209  N N   . GLN D  3 166 ? -13.832 -53.950  28.042  1.00 55.23  ? 166  GLN D N   1 
ATOM   6210  C CA  . GLN D  3 166 ? -14.410 -52.665  28.410  1.00 51.96  ? 166  GLN D CA  1 
ATOM   6211  C C   . GLN D  3 166 ? -13.678 -51.495  27.760  1.00 48.63  ? 166  GLN D C   1 
ATOM   6212  O O   . GLN D  3 166 ? -13.272 -50.556  28.441  1.00 48.63  ? 166  GLN D O   1 
ATOM   6213  C CB  . GLN D  3 166 ? -14.404 -52.501  29.931  1.00 51.79  ? 166  GLN D CB  1 
ATOM   6214  C CG  . GLN D  3 166 ? -15.296 -53.490  30.663  1.00 55.26  ? 166  GLN D CG  1 
ATOM   6215  C CD  . GLN D  3 166 ? -15.269 -53.299  32.166  1.00 57.05  ? 166  GLN D CD  1 
ATOM   6216  O OE1 . GLN D  3 166 ? -14.205 -53.131  32.763  1.00 59.05  ? 166  GLN D OE1 1 
ATOM   6217  N NE2 . GLN D  3 166 ? -16.443 -53.316  32.786  1.00 55.94  ? 166  GLN D NE2 1 
ATOM   6218  N N   . THR D  3 167 ? -13.512 -51.556  26.442  1.00 43.96  ? 167  THR D N   1 
ATOM   6219  C CA  . THR D  3 167 ? -12.883 -50.465  25.704  1.00 44.82  ? 167  THR D CA  1 
ATOM   6220  C C   . THR D  3 167 ? -13.740 -49.209  25.792  1.00 43.21  ? 167  THR D C   1 
ATOM   6221  O O   . THR D  3 167 ? -13.234 -48.110  26.021  1.00 42.10  ? 167  THR D O   1 
ATOM   6222  C CB  . THR D  3 167 ? -12.662 -50.829  24.223  1.00 46.88  ? 167  THR D CB  1 
ATOM   6223  O OG1 . THR D  3 167 ? -11.892 -52.034  24.131  1.00 45.92  ? 167  THR D OG1 1 
ATOM   6224  C CG2 . THR D  3 167 ? -11.930 -49.708  23.501  1.00 47.09  ? 167  THR D CG2 1 
ATOM   6225  N N   . ASN D  3 168 ? -15.044 -49.388  25.615  1.00 46.03  ? 168  ASN D N   1 
ATOM   6226  C CA  . ASN D  3 168 ? -15.997 -48.288  25.680  1.00 43.97  ? 168  ASN D CA  1 
ATOM   6227  C C   . ASN D  3 168 ? -16.242 -47.820  27.111  1.00 46.88  ? 168  ASN D C   1 
ATOM   6228  O O   . ASN D  3 168 ? -16.587 -46.662  27.345  1.00 47.79  ? 168  ASN D O   1 
ATOM   6229  C CB  . ASN D  3 168 ? -17.319 -48.703  25.030  1.00 42.06  ? 168  ASN D CB  1 
ATOM   6230  C CG  . ASN D  3 168 ? -17.842 -50.023  25.566  1.00 42.61  ? 168  ASN D CG  1 
ATOM   6231  O OD1 . ASN D  3 168 ? -17.120 -50.767  26.231  1.00 44.00  ? 168  ASN D OD1 1 
ATOM   6232  N ND2 . ASN D  3 168 ? -19.099 -50.326  25.267  1.00 39.97  ? 168  ASN D ND2 1 
ATOM   6233  N N   . TYR D  3 169 ? -16.060 -48.727  28.064  1.00 46.64  ? 169  TYR D N   1 
ATOM   6234  C CA  . TYR D  3 169 ? -16.280 -48.413  29.470  1.00 43.29  ? 169  TYR D CA  1 
ATOM   6235  C C   . TYR D  3 169 ? -15.072 -47.710  30.078  1.00 41.84  ? 169  TYR D C   1 
ATOM   6236  O O   . TYR D  3 169 ? -15.218 -46.839  30.935  1.00 43.69  ? 169  TYR D O   1 
ATOM   6237  C CB  . TYR D  3 169 ? -16.602 -49.684  30.256  1.00 44.41  ? 169  TYR D CB  1 
ATOM   6238  C CG  . TYR D  3 169 ? -16.869 -49.449  31.724  1.00 45.81  ? 169  TYR D CG  1 
ATOM   6239  C CD1 . TYR D  3 169 ? -18.112 -49.010  32.160  1.00 45.01  ? 169  TYR D CD1 1 
ATOM   6240  C CD2 . TYR D  3 169 ? -15.882 -49.669  32.675  1.00 47.74  ? 169  TYR D CD2 1 
ATOM   6241  C CE1 . TYR D  3 169 ? -18.363 -48.795  33.501  1.00 44.42  ? 169  TYR D CE1 1 
ATOM   6242  C CE2 . TYR D  3 169 ? -16.123 -49.455  34.016  1.00 44.28  ? 169  TYR D CE2 1 
ATOM   6243  C CZ  . TYR D  3 169 ? -17.366 -49.019  34.425  1.00 42.14  ? 169  TYR D CZ  1 
ATOM   6244  O OH  . TYR D  3 169 ? -17.615 -48.805  35.761  1.00 41.23  ? 169  TYR D OH  1 
ATOM   6245  N N   . ALA D  3 170 ? -13.880 -48.094  29.632  1.00 42.29  ? 170  ALA D N   1 
ATOM   6246  C CA  . ALA D  3 170 ? -12.651 -47.480  30.122  1.00 42.30  ? 170  ALA D CA  1 
ATOM   6247  C C   . ALA D  3 170 ? -12.537 -46.039  29.643  1.00 41.43  ? 170  ALA D C   1 
ATOM   6248  O O   . ALA D  3 170 ? -12.167 -45.149  30.408  1.00 43.10  ? 170  ALA D O   1 
ATOM   6249  C CB  . ALA D  3 170 ? -11.439 -48.282  29.677  1.00 45.24  ? 170  ALA D CB  1 
ATOM   6250  N N   . ALA D  3 171 ? -12.857 -45.819  28.372  1.00 32.99  ? 171  ALA D N   1 
ATOM   6251  C CA  . ALA D  3 171 ? -12.788 -44.489  27.778  1.00 33.18  ? 171  ALA D CA  1 
ATOM   6252  C C   . ALA D  3 171 ? -13.776 -43.539  28.442  1.00 36.67  ? 171  ALA D C   1 
ATOM   6253  O O   . ALA D  3 171 ? -13.464 -42.374  28.685  1.00 42.16  ? 171  ALA D O   1 
ATOM   6254  C CB  . ALA D  3 171 ? -13.049 -44.564  26.282  1.00 27.62  ? 171  ALA D CB  1 
ATOM   6255  N N   . SER D  3 172 ? -14.970 -44.045  28.733  1.00 39.36  ? 172  SER D N   1 
ATOM   6256  C CA  . SER D  3 172 ? -16.003 -43.241  29.372  1.00 37.43  ? 172  SER D CA  1 
ATOM   6257  C C   . SER D  3 172 ? -15.592 -42.857  30.787  1.00 32.44  ? 172  SER D C   1 
ATOM   6258  O O   . SER D  3 172 ? -15.696 -41.695  31.178  1.00 31.81  ? 172  SER D O   1 
ATOM   6259  C CB  . SER D  3 172 ? -17.334 -43.996  29.397  1.00 41.20  ? 172  SER D CB  1 
ATOM   6260  O OG  . SER D  3 172 ? -17.232 -45.186  30.158  1.00 46.01  ? 172  SER D OG  1 
ATOM   6261  N N   . LYS D  3 173 ? -15.115 -43.838  31.546  1.00 31.95  ? 173  LYS D N   1 
ATOM   6262  C CA  . LYS D  3 173 ? -14.730 -43.614  32.934  1.00 34.13  ? 173  LYS D CA  1 
ATOM   6263  C C   . LYS D  3 173 ? -13.495 -42.730  33.052  1.00 39.49  ? 173  LYS D C   1 
ATOM   6264  O O   . LYS D  3 173 ? -13.386 -41.929  33.980  1.00 43.04  ? 173  LYS D O   1 
ATOM   6265  C CB  . LYS D  3 173 ? -14.492 -44.949  33.639  1.00 33.71  ? 173  LYS D CB  1 
ATOM   6266  C CG  . LYS D  3 173 ? -15.773 -45.716  33.893  1.00 36.56  ? 173  LYS D CG  1 
ATOM   6267  C CD  . LYS D  3 173 ? -16.785 -44.824  34.590  1.00 36.40  ? 173  LYS D CD  1 
ATOM   6268  C CE  . LYS D  3 173 ? -18.163 -45.445  34.602  1.00 39.56  ? 173  LYS D CE  1 
ATOM   6269  N NZ  . LYS D  3 173 ? -19.129 -44.620  35.379  1.00 42.38  ? 173  LYS D NZ  1 
ATOM   6270  N N   . ALA D  3 174 ? -12.568 -42.875  32.112  1.00 35.57  ? 174  ALA D N   1 
ATOM   6271  C CA  . ALA D  3 174 ? -11.386 -42.024  32.082  1.00 35.68  ? 174  ALA D CA  1 
ATOM   6272  C C   . ALA D  3 174 ? -11.779 -40.601  31.700  1.00 38.88  ? 174  ALA D C   1 
ATOM   6273  O O   . ALA D  3 174 ? -11.217 -39.632  32.211  1.00 37.43  ? 174  ALA D O   1 
ATOM   6274  C CB  . ALA D  3 174 ? -10.356 -42.574  31.112  1.00 35.77  ? 174  ALA D CB  1 
ATOM   6275  N N   . GLY D  3 175 ? -12.753 -40.487  30.803  1.00 40.79  ? 175  GLY D N   1 
ATOM   6276  C CA  . GLY D  3 175 ? -13.250 -39.194  30.374  1.00 35.19  ? 175  GLY D CA  1 
ATOM   6277  C C   . GLY D  3 175 ? -13.980 -38.469  31.486  1.00 35.35  ? 175  GLY D C   1 
ATOM   6278  O O   . GLY D  3 175 ? -13.939 -37.241  31.571  1.00 35.91  ? 175  GLY D O   1 
ATOM   6279  N N   . VAL D  3 176 ? -14.660 -39.235  32.334  1.00 34.86  ? 176  VAL D N   1 
ATOM   6280  C CA  . VAL D  3 176 ? -15.343 -38.680  33.497  1.00 33.27  ? 176  VAL D CA  1 
ATOM   6281  C C   . VAL D  3 176 ? -14.339 -37.981  34.405  1.00 36.95  ? 176  VAL D C   1 
ATOM   6282  O O   . VAL D  3 176 ? -14.585 -36.873  34.884  1.00 38.59  ? 176  VAL D O   1 
ATOM   6283  C CB  . VAL D  3 176 ? -16.094 -39.773  34.289  1.00 28.22  ? 176  VAL D CB  1 
ATOM   6284  C CG1 . VAL D  3 176 ? -16.508 -39.260  35.660  1.00 26.53  ? 176  VAL D CG1 1 
ATOM   6285  C CG2 . VAL D  3 176 ? -17.307 -40.254  33.507  1.00 25.38  ? 176  VAL D CG2 1 
ATOM   6286  N N   . ILE D  3 177 ? -13.201 -38.634  34.622  1.00 36.88  ? 177  ILE D N   1 
ATOM   6287  C CA  . ILE D  3 177 ? -12.116 -38.062  35.410  1.00 34.89  ? 177  ILE D CA  1 
ATOM   6288  C C   . ILE D  3 177 ? -11.618 -36.767  34.777  1.00 33.96  ? 177  ILE D C   1 
ATOM   6289  O O   . ILE D  3 177 ? -11.333 -35.792  35.472  1.00 30.94  ? 177  ILE D O   1 
ATOM   6290  C CB  . ILE D  3 177 ? -10.938 -39.048  35.545  1.00 31.42  ? 177  ILE D CB  1 
ATOM   6291  C CG1 . ILE D  3 177 ? -11.428 -40.397  36.076  1.00 28.97  ? 177  ILE D CG1 1 
ATOM   6292  C CG2 . ILE D  3 177 ? -9.854  -38.473  36.445  1.00 28.92  ? 177  ILE D CG2 1 
ATOM   6293  C CD1 . ILE D  3 177 ? -10.350 -41.459  36.138  1.00 24.79  ? 177  ILE D CD1 1 
ATOM   6294  N N   . GLY D  3 178 ? -11.531 -36.765  33.450  1.00 37.86  ? 178  GLY D N   1 
ATOM   6295  C CA  . GLY D  3 178 ? -11.045 -35.615  32.709  1.00 39.30  ? 178  GLY D CA  1 
ATOM   6296  C C   . GLY D  3 178 ? -11.931 -34.389  32.825  1.00 40.38  ? 178  GLY D C   1 
ATOM   6297  O O   . GLY D  3 178 ? -11.442 -33.288  33.078  1.00 37.51  ? 178  GLY D O   1 
ATOM   6298  N N   . LEU D  3 179 ? -13.235 -34.574  32.638  1.00 44.75  ? 179  LEU D N   1 
ATOM   6299  C CA  . LEU D  3 179 ? -14.170 -33.457  32.704  1.00 42.17  ? 179  LEU D CA  1 
ATOM   6300  C C   . LEU D  3 179 ? -14.355 -32.992  34.146  1.00 39.55  ? 179  LEU D C   1 
ATOM   6301  O O   . LEU D  3 179 ? -14.682 -31.832  34.395  1.00 40.77  ? 179  LEU D O   1 
ATOM   6302  C CB  . LEU D  3 179 ? -15.519 -33.838  32.080  1.00 41.75  ? 179  LEU D CB  1 
ATOM   6303  C CG  . LEU D  3 179 ? -16.451 -34.822  32.795  1.00 39.02  ? 179  LEU D CG  1 
ATOM   6304  C CD1 . LEU D  3 179 ? -17.470 -34.094  33.663  1.00 29.92  ? 179  LEU D CD1 1 
ATOM   6305  C CD2 . LEU D  3 179 ? -17.156 -35.710  31.786  1.00 40.52  ? 179  LEU D CD2 1 
ATOM   6306  N N   . THR D  3 180 ? -14.142 -33.904  35.090  1.00 38.17  ? 180  THR D N   1 
ATOM   6307  C CA  . THR D  3 180 ? -14.252 -33.579  36.508  1.00 35.71  ? 180  THR D CA  1 
ATOM   6308  C C   . THR D  3 180 ? -13.119 -32.655  36.939  1.00 37.10  ? 180  THR D C   1 
ATOM   6309  O O   . THR D  3 180 ? -13.334 -31.699  37.686  1.00 39.68  ? 180  THR D O   1 
ATOM   6310  C CB  . THR D  3 180 ? -14.234 -34.847  37.381  1.00 31.95  ? 180  THR D CB  1 
ATOM   6311  O OG1 . THR D  3 180 ? -15.300 -35.718  36.983  1.00 31.45  ? 180  THR D OG1 1 
ATOM   6312  C CG2 . THR D  3 180 ? -14.400 -34.488  38.848  1.00 37.03  ? 180  THR D CG2 1 
ATOM   6313  N N   . GLN D  3 181 ? -11.913 -32.946  36.461  1.00 33.99  ? 181  GLN D N   1 
ATOM   6314  C CA  . GLN D  3 181 ? -10.750 -32.117  36.753  1.00 30.19  ? 181  GLN D CA  1 
ATOM   6315  C C   . GLN D  3 181 ? -10.909 -30.729  36.144  1.00 31.25  ? 181  GLN D C   1 
ATOM   6316  O O   . GLN D  3 181 ? -10.556 -29.725  36.761  1.00 28.66  ? 181  GLN D O   1 
ATOM   6317  C CB  . GLN D  3 181 ? -9.474  -32.780  36.233  1.00 28.91  ? 181  GLN D CB  1 
ATOM   6318  C CG  . GLN D  3 181 ? -9.092  -34.051  36.973  1.00 32.35  ? 181  GLN D CG  1 
ATOM   6319  C CD  . GLN D  3 181 ? -7.935  -34.781  36.321  1.00 37.08  ? 181  GLN D CD  1 
ATOM   6320  O OE1 . GLN D  3 181 ? -7.730  -34.688  35.111  1.00 39.91  ? 181  GLN D OE1 1 
ATOM   6321  N NE2 . GLN D  3 181 ? -7.168  -35.510  37.123  1.00 40.65  ? 181  GLN D NE2 1 
ATOM   6322  N N   . THR D  3 182 ? -11.445 -30.684  34.928  1.00 36.05  ? 182  THR D N   1 
ATOM   6323  C CA  . THR D  3 182 ? -11.697 -29.422  34.243  1.00 41.24  ? 182  THR D CA  1 
ATOM   6324  C C   . THR D  3 182 ? -12.713 -28.578  35.005  1.00 44.02  ? 182  THR D C   1 
ATOM   6325  O O   . THR D  3 182 ? -12.483 -27.396  35.265  1.00 46.38  ? 182  THR D O   1 
ATOM   6326  C CB  . THR D  3 182 ? -12.206 -29.653  32.809  1.00 46.36  ? 182  THR D CB  1 
ATOM   6327  O OG1 . THR D  3 182 ? -11.163 -30.235  32.017  1.00 50.05  ? 182  THR D OG1 1 
ATOM   6328  C CG2 . THR D  3 182 ? -12.641 -28.339  32.180  1.00 46.10  ? 182  THR D CG2 1 
ATOM   6329  N N   . ALA D  3 183 ? -13.835 -29.198  35.360  1.00 39.91  ? 183  ALA D N   1 
ATOM   6330  C CA  . ALA D  3 183 ? -14.894 -28.524  36.100  1.00 38.65  ? 183  ALA D CA  1 
ATOM   6331  C C   . ALA D  3 183 ? -14.382 -27.980  37.429  1.00 35.76  ? 183  ALA D C   1 
ATOM   6332  O O   . ALA D  3 183 ? -14.730 -26.872  37.831  1.00 38.25  ? 183  ALA D O   1 
ATOM   6333  C CB  . ALA D  3 183 ? -16.060 -29.469  36.332  1.00 37.73  ? 183  ALA D CB  1 
ATOM   6334  N N   . ALA D  3 184 ? -13.549 -28.765  38.102  1.00 32.57  ? 184  ALA D N   1 
ATOM   6335  C CA  . ALA D  3 184 ? -12.987 -28.367  39.387  1.00 30.66  ? 184  ALA D CA  1 
ATOM   6336  C C   . ALA D  3 184 ? -12.160 -27.089  39.267  1.00 32.39  ? 184  ALA D C   1 
ATOM   6337  O O   . ALA D  3 184 ? -12.139 -26.269  40.184  1.00 35.29  ? 184  ALA D O   1 
ATOM   6338  C CB  . ALA D  3 184 ? -12.145 -29.488  39.961  1.00 27.79  ? 184  ALA D CB  1 
ATOM   6339  N N   . ARG D  3 185 ? -11.484 -26.924  38.133  1.00 36.04  ? 185  ARG D N   1 
ATOM   6340  C CA  . ARG D  3 185 ? -10.685 -25.727  37.887  1.00 37.99  ? 185  ARG D CA  1 
ATOM   6341  C C   . ARG D  3 185 ? -11.557 -24.510  37.598  1.00 39.88  ? 185  ARG D C   1 
ATOM   6342  O O   . ARG D  3 185 ? -11.200 -23.386  37.948  1.00 45.14  ? 185  ARG D O   1 
ATOM   6343  C CB  . ARG D  3 185 ? -9.716  -25.947  36.724  1.00 37.97  ? 185  ARG D CB  1 
ATOM   6344  C CG  . ARG D  3 185 ? -8.352  -26.473  37.133  1.00 44.56  ? 185  ARG D CG  1 
ATOM   6345  C CD  . ARG D  3 185 ? -7.341  -26.303  36.009  1.00 48.88  ? 185  ARG D CD  1 
ATOM   6346  N NE  . ARG D  3 185 ? -7.063  -24.896  35.726  1.00 50.59  ? 185  ARG D NE  1 
ATOM   6347  C CZ  . ARG D  3 185 ? -6.256  -24.474  34.758  1.00 51.21  ? 185  ARG D CZ  1 
ATOM   6348  N NH1 . ARG D  3 185 ? -5.646  -25.350  33.972  1.00 52.30  ? 185  ARG D NH1 1 
ATOM   6349  N NH2 . ARG D  3 185 ? -6.060  -23.175  34.573  1.00 49.63  ? 185  ARG D NH2 1 
ATOM   6350  N N   . GLU D  3 186 ? -12.695 -24.738  36.952  1.00 38.41  ? 186  GLU D N   1 
ATOM   6351  C CA  . GLU D  3 186 ? -13.580 -23.646  36.565  1.00 38.18  ? 186  GLU D CA  1 
ATOM   6352  C C   . GLU D  3 186 ? -14.531 -23.256  37.692  1.00 34.65  ? 186  GLU D C   1 
ATOM   6353  O O   . GLU D  3 186 ? -14.899 -22.089  37.829  1.00 35.27  ? 186  GLU D O   1 
ATOM   6354  C CB  . GLU D  3 186 ? -14.383 -24.024  35.319  1.00 39.02  ? 186  GLU D CB  1 
ATOM   6355  C CG  . GLU D  3 186 ? -13.535 -24.349  34.101  1.00 42.72  ? 186  GLU D CG  1 
ATOM   6356  C CD  . GLU D  3 186 ? -14.370 -24.568  32.854  1.00 45.58  ? 186  GLU D CD  1 
ATOM   6357  O OE1 . GLU D  3 186 ? -15.587 -24.293  32.899  1.00 48.35  ? 186  GLU D OE1 1 
ATOM   6358  O OE2 . GLU D  3 186 ? -13.810 -25.015  31.831  1.00 45.92  ? 186  GLU D OE2 1 
ATOM   6359  N N   . LEU D  3 187 ? -14.922 -24.238  38.498  1.00 36.95  ? 187  LEU D N   1 
ATOM   6360  C CA  . LEU D  3 187 ? -15.925 -24.020  39.533  1.00 37.27  ? 187  LEU D CA  1 
ATOM   6361  C C   . LEU D  3 187 ? -15.308 -23.740  40.900  1.00 40.66  ? 187  LEU D C   1 
ATOM   6362  O O   . LEU D  3 187 ? -16.022 -23.574  41.889  1.00 41.15  ? 187  LEU D O   1 
ATOM   6363  C CB  . LEU D  3 187 ? -16.856 -25.229  39.622  1.00 38.34  ? 187  LEU D CB  1 
ATOM   6364  C CG  . LEU D  3 187 ? -17.608 -25.587  38.338  1.00 37.84  ? 187  LEU D CG  1 
ATOM   6365  C CD1 . LEU D  3 187 ? -18.476 -26.815  38.552  1.00 35.21  ? 187  LEU D CD1 1 
ATOM   6366  C CD2 . LEU D  3 187 ? -18.440 -24.410  37.850  1.00 35.61  ? 187  LEU D CD2 1 
ATOM   6367  N N   . GLY D  3 188 ? -13.982 -23.688  40.952  1.00 42.67  ? 188  GLY D N   1 
ATOM   6368  C CA  . GLY D  3 188 ? -13.285 -23.399  42.191  1.00 43.21  ? 188  GLY D CA  1 
ATOM   6369  C C   . GLY D  3 188 ? -13.571 -21.994  42.683  1.00 44.50  ? 188  GLY D C   1 
ATOM   6370  O O   . GLY D  3 188 ? -13.764 -21.768  43.878  1.00 43.36  ? 188  GLY D O   1 
ATOM   6371  N N   . ARG D  3 189 ? -13.606 -21.046  41.752  1.00 47.72  ? 189  ARG D N   1 
ATOM   6372  C CA  . ARG D  3 189 ? -13.868 -19.651  42.086  1.00 53.24  ? 189  ARG D CA  1 
ATOM   6373  C C   . ARG D  3 189 ? -15.330 -19.416  42.444  1.00 52.31  ? 189  ARG D C   1 
ATOM   6374  O O   . ARG D  3 189 ? -15.674 -18.395  43.040  1.00 54.80  ? 189  ARG D O   1 
ATOM   6375  C CB  . ARG D  3 189 ? -13.463 -18.745  40.925  1.00 62.76  ? 189  ARG D CB  1 
ATOM   6376  C CG  . ARG D  3 189 ? -13.947 -19.216  39.565  1.00 68.94  ? 189  ARG D CG  1 
ATOM   6377  C CD  . ARG D  3 189 ? -13.252 -18.431  38.471  1.00 79.01  ? 189  ARG D CD  1 
ATOM   6378  N NE  . ARG D  3 189 ? -11.811 -18.383  38.703  1.00 86.84  ? 189  ARG D NE  1 
ATOM   6379  C CZ  . ARG D  3 189 ? -10.968 -17.603  38.034  1.00 93.56  ? 189  ARG D CZ  1 
ATOM   6380  N NH1 . ARG D  3 189 ? -11.419 -16.797  37.083  1.00 94.97  ? 189  ARG D NH1 1 
ATOM   6381  N NH2 . ARG D  3 189 ? -9.673  -17.629  38.318  1.00 97.85  ? 189  ARG D NH2 1 
ATOM   6382  N N   . HIS D  3 190 ? -16.186 -20.361  42.075  1.00 45.60  ? 190  HIS D N   1 
ATOM   6383  C CA  . HIS D  3 190 ? -17.602 -20.276  42.407  1.00 45.90  ? 190  HIS D CA  1 
ATOM   6384  C C   . HIS D  3 190 ? -17.899 -21.037  43.695  1.00 40.96  ? 190  HIS D C   1 
ATOM   6385  O O   . HIS D  3 190 ? -19.039 -21.076  44.157  1.00 39.32  ? 190  HIS D O   1 
ATOM   6386  C CB  . HIS D  3 190 ? -18.458 -20.817  41.260  1.00 42.85  ? 190  HIS D CB  1 
ATOM   6387  C CG  . HIS D  3 190 ? -18.329 -20.036  39.990  1.00 48.16  ? 190  HIS D CG  1 
ATOM   6388  N ND1 . HIS D  3 190 ? -19.025 -18.869  39.759  1.00 50.73  ? 190  HIS D ND1 1 
ATOM   6389  C CD2 . HIS D  3 190 ? -17.585 -20.255  38.880  1.00 53.13  ? 190  HIS D CD2 1 
ATOM   6390  C CE1 . HIS D  3 190 ? -18.716 -18.403  38.563  1.00 54.45  ? 190  HIS D CE1 1 
ATOM   6391  N NE2 . HIS D  3 190 ? -17.844 -19.226  38.008  1.00 54.68  ? 190  HIS D NE2 1 
ATOM   6392  N N   . GLY D  3 191 ? -16.864 -21.640  44.270  1.00 41.91  ? 191  GLY D N   1 
ATOM   6393  C CA  . GLY D  3 191 ? -17.007 -22.380  45.510  1.00 42.17  ? 191  GLY D CA  1 
ATOM   6394  C C   . GLY D  3 191 ? -17.656 -23.736  45.319  1.00 44.68  ? 191  GLY D C   1 
ATOM   6395  O O   . GLY D  3 191 ? -18.345 -24.235  46.208  1.00 41.57  ? 191  GLY D O   1 
ATOM   6396  N N   . ILE D  3 192 ? -17.439 -24.333  44.152  1.00 34.05  ? 192  ILE D N   1 
ATOM   6397  C CA  . ILE D  3 192 ? -17.980 -25.655  43.862  1.00 39.25  ? 192  ILE D CA  1 
ATOM   6398  C C   . ILE D  3 192 ? -16.854 -26.667  43.682  1.00 35.16  ? 192  ILE D C   1 
ATOM   6399  O O   . ILE D  3 192 ? -16.007 -26.519  42.800  1.00 32.17  ? 192  ILE D O   1 
ATOM   6400  C CB  . ILE D  3 192 ? -18.862 -25.645  42.600  1.00 40.22  ? 192  ILE D CB  1 
ATOM   6401  C CG1 . ILE D  3 192 ? -19.922 -24.546  42.697  1.00 39.61  ? 192  ILE D CG1 1 
ATOM   6402  C CG2 . ILE D  3 192 ? -19.509 -27.007  42.389  1.00 36.59  ? 192  ILE D CG2 1 
ATOM   6403  C CD1 . ILE D  3 192 ? -20.786 -24.426  41.463  1.00 37.89  ? 192  ILE D CD1 1 
ATOM   6404  N N   . ARG D  3 193 ? -16.849 -27.692  44.527  1.00 31.22  ? 193  ARG D N   1 
ATOM   6405  C CA  . ARG D  3 193 ? -15.819 -28.720  44.474  1.00 36.58  ? 193  ARG D CA  1 
ATOM   6406  C C   . ARG D  3 193 ? -16.242 -29.880  43.580  1.00 35.14  ? 193  ARG D C   1 
ATOM   6407  O O   . ARG D  3 193 ? -17.373 -30.358  43.658  1.00 37.99  ? 193  ARG D O   1 
ATOM   6408  C CB  . ARG D  3 193 ? -15.495 -29.226  45.882  1.00 37.57  ? 193  ARG D CB  1 
ATOM   6409  C CG  . ARG D  3 193 ? -14.836 -28.182  46.771  1.00 42.83  ? 193  ARG D CG  1 
ATOM   6410  C CD  . ARG D  3 193 ? -14.500 -28.732  48.150  1.00 49.66  ? 193  ARG D CD  1 
ATOM   6411  N NE  . ARG D  3 193 ? -15.690 -28.966  48.965  1.00 54.32  ? 193  ARG D NE  1 
ATOM   6412  C CZ  . ARG D  3 193 ? -16.156 -30.170  49.281  1.00 52.86  ? 193  ARG D CZ  1 
ATOM   6413  N NH1 . ARG D  3 193 ? -15.531 -31.259  48.855  1.00 52.11  ? 193  ARG D NH1 1 
ATOM   6414  N NH2 . ARG D  3 193 ? -17.246 -30.286  50.029  1.00 50.19  ? 193  ARG D NH2 1 
ATOM   6415  N N   . CYS D  3 194 ? -15.324 -30.326  42.728  1.00 35.07  ? 194  CYS D N   1 
ATOM   6416  C CA  . CYS D  3 194 ? -15.592 -31.437  41.825  1.00 35.81  ? 194  CYS D CA  1 
ATOM   6417  C C   . CYS D  3 194 ? -14.560 -32.541  42.008  1.00 34.09  ? 194  CYS D C   1 
ATOM   6418  O O   . CYS D  3 194 ? -13.364 -32.323  41.817  1.00 32.38  ? 194  CYS D O   1 
ATOM   6419  C CB  . CYS D  3 194 ? -15.602 -30.960  40.373  1.00 37.02  ? 194  CYS D CB  1 
ATOM   6420  S SG  . CYS D  3 194 ? -16.755 -29.611  40.047  1.00 52.85  ? 194  CYS D SG  1 
ATOM   6421  N N   . ASN D  3 195 ? -15.027 -33.727  42.382  1.00 33.98  ? 195  ASN D N   1 
ATOM   6422  C CA  . ASN D  3 195 ? -14.139 -34.862  42.592  1.00 35.89  ? 195  ASN D CA  1 
ATOM   6423  C C   . ASN D  3 195 ? -14.678 -36.141  41.969  1.00 33.36  ? 195  ASN D C   1 
ATOM   6424  O O   . ASN D  3 195 ? -15.882 -36.280  41.750  1.00 31.16  ? 195  ASN D O   1 
ATOM   6425  C CB  . ASN D  3 195 ? -13.894 -35.081  44.085  1.00 41.65  ? 195  ASN D CB  1 
ATOM   6426  C CG  . ASN D  3 195 ? -13.119 -33.946  44.719  1.00 43.61  ? 195  ASN D CG  1 
ATOM   6427  O OD1 . ASN D  3 195 ? -11.897 -33.875  44.600  1.00 42.17  ? 195  ASN D OD1 1 
ATOM   6428  N ND2 . ASN D  3 195 ? -13.825 -33.053  45.402  1.00 45.72  ? 195  ASN D ND2 1 
ATOM   6429  N N   . SER D  3 196 ? -13.777 -37.073  41.686  1.00 35.15  ? 196  SER D N   1 
ATOM   6430  C CA  . SER D  3 196 ? -14.162 -38.359  41.126  1.00 36.12  ? 196  SER D CA  1 
ATOM   6431  C C   . SER D  3 196 ? -13.911 -39.485  42.119  1.00 25.56  ? 196  SER D C   1 
ATOM   6432  O O   . SER D  3 196 ? -12.895 -39.501  42.811  1.00 30.46  ? 196  SER D O   1 
ATOM   6433  C CB  . SER D  3 196 ? -13.405 -38.633  39.825  1.00 41.83  ? 196  SER D CB  1 
ATOM   6434  O OG  . SER D  3 196 ? -13.805 -37.740  38.801  1.00 44.93  ? 196  SER D OG  1 
ATOM   6435  N N   . VAL D  3 197 ? -14.850 -40.419  42.192  1.00 27.83  ? 197  VAL D N   1 
ATOM   6436  C CA  . VAL D  3 197 ? -14.666 -41.620  42.991  1.00 28.79  ? 197  VAL D CA  1 
ATOM   6437  C C   . VAL D  3 197 ? -14.339 -42.784  42.070  1.00 26.61  ? 197  VAL D C   1 
ATOM   6438  O O   . VAL D  3 197 ? -15.041 -43.021  41.088  1.00 34.29  ? 197  VAL D O   1 
ATOM   6439  C CB  . VAL D  3 197 ? -15.913 -41.951  43.827  1.00 33.49  ? 197  VAL D CB  1 
ATOM   6440  C CG1 . VAL D  3 197 ? -15.718 -43.260  44.578  1.00 36.72  ? 197  VAL D CG1 1 
ATOM   6441  C CG2 . VAL D  3 197 ? -16.220 -40.817  44.791  1.00 31.06  ? 197  VAL D CG2 1 
ATOM   6442  N N   . LEU D  3 198 ? -13.263 -43.498  42.379  1.00 27.14  ? 198  LEU D N   1 
ATOM   6443  C CA  . LEU D  3 198 ? -12.833 -44.627  41.564  1.00 32.62  ? 198  LEU D CA  1 
ATOM   6444  C C   . LEU D  3 198 ? -12.948 -45.931  42.344  1.00 32.48  ? 198  LEU D C   1 
ATOM   6445  O O   . LEU D  3 198 ? -11.982 -46.378  42.960  1.00 41.73  ? 198  LEU D O   1 
ATOM   6446  C CB  . LEU D  3 198 ? -11.393 -44.429  41.079  1.00 40.54  ? 198  LEU D CB  1 
ATOM   6447  C CG  . LEU D  3 198 ? -11.140 -43.567  39.837  1.00 43.63  ? 198  LEU D CG  1 
ATOM   6448  C CD1 . LEU D  3 198 ? -11.551 -42.118  40.053  1.00 45.95  ? 198  LEU D CD1 1 
ATOM   6449  C CD2 . LEU D  3 198 ? -9.678  -43.652  39.426  1.00 44.16  ? 198  LEU D CD2 1 
ATOM   6450  N N   . PRO D  3 199 ? -14.138 -46.546  42.324  1.00 26.70  ? 199  PRO D N   1 
ATOM   6451  C CA  . PRO D  3 199 ? -14.358 -47.790  43.063  1.00 33.73  ? 199  PRO D CA  1 
ATOM   6452  C C   . PRO D  3 199 ? -13.741 -48.995  42.365  1.00 31.61  ? 199  PRO D C   1 
ATOM   6453  O O   . PRO D  3 199 ? -13.619 -49.004  41.141  1.00 36.25  ? 199  PRO D O   1 
ATOM   6454  C CB  . PRO D  3 199 ? -15.889 -47.916  43.101  1.00 37.03  ? 199  PRO D CB  1 
ATOM   6455  C CG  . PRO D  3 199 ? -16.422 -46.596  42.604  1.00 36.82  ? 199  PRO D CG  1 
ATOM   6456  C CD  . PRO D  3 199 ? -15.374 -46.069  41.689  1.00 26.32  ? 199  PRO D CD  1 
ATOM   6457  N N   . GLY D  3 200 ? -13.354 -49.999  43.143  1.00 33.35  ? 200  GLY D N   1 
ATOM   6458  C CA  . GLY D  3 200 ? -12.934 -51.269  42.585  1.00 33.77  ? 200  GLY D CA  1 
ATOM   6459  C C   . GLY D  3 200 ? -14.171 -52.088  42.283  1.00 37.69  ? 200  GLY D C   1 
ATOM   6460  O O   . GLY D  3 200 ? -15.254 -51.534  42.120  1.00 38.74  ? 200  GLY D O   1 
ATOM   6461  N N   . PHE D  3 201 ? -14.026 -53.405  42.215  1.00 40.34  ? 201  PHE D N   1 
ATOM   6462  C CA  . PHE D  3 201 ? -15.181 -54.254  41.959  1.00 44.15  ? 201  PHE D CA  1 
ATOM   6463  C C   . PHE D  3 201 ? -16.067 -54.348  43.197  1.00 51.23  ? 201  PHE D C   1 
ATOM   6464  O O   . PHE D  3 201 ? -15.634 -54.803  44.256  1.00 54.17  ? 201  PHE D O   1 
ATOM   6465  C CB  . PHE D  3 201 ? -14.738 -55.639  41.494  1.00 43.24  ? 201  PHE D CB  1 
ATOM   6466  C CG  . PHE D  3 201 ? -14.309 -55.675  40.056  1.00 45.39  ? 201  PHE D CG  1 
ATOM   6467  C CD1 . PHE D  3 201 ? -15.246 -55.820  39.047  1.00 45.70  ? 201  PHE D CD1 1 
ATOM   6468  C CD2 . PHE D  3 201 ? -12.974 -55.544  39.711  1.00 45.33  ? 201  PHE D CD2 1 
ATOM   6469  C CE1 . PHE D  3 201 ? -14.859 -55.846  37.720  1.00 44.08  ? 201  PHE D CE1 1 
ATOM   6470  C CE2 . PHE D  3 201 ? -12.580 -55.571  38.385  1.00 41.09  ? 201  PHE D CE2 1 
ATOM   6471  C CZ  . PHE D  3 201 ? -13.524 -55.722  37.390  1.00 40.13  ? 201  PHE D CZ  1 
ATOM   6472  N N   . ILE D  3 202 ? -17.311 -53.901  43.048  1.00 54.02  ? 202  ILE D N   1 
ATOM   6473  C CA  . ILE D  3 202 ? -18.253 -53.807  44.158  1.00 52.47  ? 202  ILE D CA  1 
ATOM   6474  C C   . ILE D  3 202 ? -19.440 -54.750  43.962  1.00 57.22  ? 202  ILE D C   1 
ATOM   6475  O O   . ILE D  3 202 ? -19.927 -54.920  42.845  1.00 59.24  ? 202  ILE D O   1 
ATOM   6476  C CB  . ILE D  3 202 ? -18.775 -52.361  44.320  1.00 50.46  ? 202  ILE D CB  1 
ATOM   6477  C CG1 . ILE D  3 202 ? -17.616 -51.362  44.293  1.00 48.75  ? 202  ILE D CG1 1 
ATOM   6478  C CG2 . ILE D  3 202 ? -19.580 -52.214  45.599  1.00 52.00  ? 202  ILE D CG2 1 
ATOM   6479  C CD1 . ILE D  3 202 ? -16.648 -51.511  45.445  1.00 50.44  ? 202  ILE D CD1 1 
ATOM   6480  N N   . ALA D  3 203 ? -19.901 -55.360  45.051  1.00 60.95  ? 203  ALA D N   1 
ATOM   6481  C CA  . ALA D  3 203 ? -21.045 -56.267  45.003  1.00 64.22  ? 203  ALA D CA  1 
ATOM   6482  C C   . ALA D  3 203 ? -22.346 -55.516  44.727  1.00 63.50  ? 203  ALA D C   1 
ATOM   6483  O O   . ALA D  3 203 ? -23.087 -55.173  45.650  1.00 64.56  ? 203  ALA D O   1 
ATOM   6484  C CB  . ALA D  3 203 ? -21.152 -57.050  46.302  1.00 69.54  ? 203  ALA D CB  1 
ATOM   6485  N N   . THR D  3 204 ? -22.615 -55.265  43.450  1.00 62.61  ? 204  THR D N   1 
ATOM   6486  C CA  . THR D  3 204 ? -23.818 -54.555  43.027  1.00 61.37  ? 204  THR D CA  1 
ATOM   6487  C C   . THR D  3 204 ? -24.528 -55.348  41.929  1.00 61.84  ? 204  THR D C   1 
ATOM   6488  O O   . THR D  3 204 ? -23.946 -56.276  41.367  1.00 60.36  ? 204  THR D O   1 
ATOM   6489  C CB  . THR D  3 204 ? -23.483 -53.134  42.512  1.00 60.53  ? 204  THR D CB  1 
ATOM   6490  O OG1 . THR D  3 204 ? -22.679 -53.226  41.329  1.00 62.76  ? 204  THR D OG1 1 
ATOM   6491  C CG2 . THR D  3 204 ? -22.740 -52.333  43.572  1.00 58.65  ? 204  THR D CG2 1 
ATOM   6492  N N   . PRO D  3 205 ? -25.792 -54.997  41.623  1.00 61.65  ? 205  PRO D N   1 
ATOM   6493  C CA  . PRO D  3 205 ? -26.486 -55.616  40.486  1.00 64.41  ? 205  PRO D CA  1 
ATOM   6494  C C   . PRO D  3 205 ? -25.744 -55.476  39.152  1.00 67.36  ? 205  PRO D C   1 
ATOM   6495  O O   . PRO D  3 205 ? -26.094 -56.156  38.188  1.00 77.76  ? 205  PRO D O   1 
ATOM   6496  C CB  . PRO D  3 205 ? -27.814 -54.859  40.441  1.00 60.05  ? 205  PRO D CB  1 
ATOM   6497  C CG  . PRO D  3 205 ? -28.066 -54.492  41.856  1.00 58.22  ? 205  PRO D CG  1 
ATOM   6498  C CD  . PRO D  3 205 ? -26.715 -54.196  42.451  1.00 65.44  ? 205  PRO D CD  1 
ATOM   6499  N N   . MET D  3 206 ? -24.739 -54.607  39.103  1.00 65.05  ? 206  MET D N   1 
ATOM   6500  C CA  . MET D  3 206 ? -23.946 -54.409  37.896  1.00 63.37  ? 206  MET D CA  1 
ATOM   6501  C C   . MET D  3 206 ? -22.910 -55.517  37.711  1.00 64.71  ? 206  MET D C   1 
ATOM   6502  O O   . MET D  3 206 ? -22.674 -55.975  36.592  1.00 68.39  ? 206  MET D O   1 
ATOM   6503  C CB  . MET D  3 206 ? -23.258 -53.043  37.935  1.00 59.46  ? 206  MET D CB  1 
ATOM   6504  C CG  . MET D  3 206 ? -22.289 -52.787  36.792  1.00 60.16  ? 206  MET D CG  1 
ATOM   6505  S SD  . MET D  3 206 ? -21.657 -51.098  36.805  1.00 75.93  ? 206  MET D SD  1 
ATOM   6506  C CE  . MET D  3 206 ? -19.924 -51.381  36.449  1.00 110.10 ? 206  MET D CE  1 
ATOM   6507  N N   . THR D  3 207 ? -22.298 -55.951  38.809  1.00 56.03  ? 207  THR D N   1 
ATOM   6508  C CA  . THR D  3 207 ? -21.264 -56.980  38.745  1.00 54.33  ? 207  THR D CA  1 
ATOM   6509  C C   . THR D  3 207 ? -21.845 -58.390  38.762  1.00 55.65  ? 207  THR D C   1 
ATOM   6510  O O   . THR D  3 207 ? -21.106 -59.373  38.739  1.00 54.37  ? 207  THR D O   1 
ATOM   6511  C CB  . THR D  3 207 ? -20.259 -56.845  39.904  1.00 53.93  ? 207  THR D CB  1 
ATOM   6512  O OG1 . THR D  3 207 ? -20.966 -56.767  41.148  1.00 58.79  ? 207  THR D OG1 1 
ATOM   6513  C CG2 . THR D  3 207 ? -19.412 -55.598  39.727  1.00 48.53  ? 207  THR D CG2 1 
ATOM   6514  N N   . GLN D  3 208 ? -23.169 -58.485  38.801  1.00 59.52  ? 208  GLN D N   1 
ATOM   6515  C CA  . GLN D  3 208 ? -23.840 -59.777  38.718  1.00 63.48  ? 208  GLN D CA  1 
ATOM   6516  C C   . GLN D  3 208 ? -23.854 -60.258  37.270  1.00 67.22  ? 208  GLN D C   1 
ATOM   6517  O O   . GLN D  3 208 ? -24.129 -61.426  36.993  1.00 69.22  ? 208  GLN D O   1 
ATOM   6518  C CB  . GLN D  3 208 ? -25.266 -59.688  39.263  1.00 65.89  ? 208  GLN D CB  1 
ATOM   6519  C CG  . GLN D  3 208 ? -25.350 -59.243  40.714  1.00 63.74  ? 208  GLN D CG  1 
ATOM   6520  C CD  . GLN D  3 208 ? -26.776 -59.193  41.227  1.00 66.13  ? 208  GLN D CD  1 
ATOM   6521  O OE1 . GLN D  3 208 ? -27.673 -59.811  40.656  1.00 69.57  ? 208  GLN D OE1 1 
ATOM   6522  N NE2 . GLN D  3 208 ? -26.994 -58.450  42.307  1.00 66.61  ? 208  GLN D NE2 1 
ATOM   6523  N N   . LYS D  3 209 ? -23.548 -59.344  36.354  1.00 70.63  ? 209  LYS D N   1 
ATOM   6524  C CA  . LYS D  3 209 ? -23.517 -59.645  34.928  1.00 76.27  ? 209  LYS D CA  1 
ATOM   6525  C C   . LYS D  3 209 ? -22.321 -60.518  34.564  1.00 79.90  ? 209  LYS D C   1 
ATOM   6526  O O   . LYS D  3 209 ? -22.437 -61.440  33.758  1.00 84.32  ? 209  LYS D O   1 
ATOM   6527  C CB  . LYS D  3 209 ? -23.486 -58.349  34.114  1.00 72.63  ? 209  LYS D CB  1 
ATOM   6528  C CG  . LYS D  3 209 ? -24.723 -57.481  34.274  1.00 70.60  ? 209  LYS D CG  1 
ATOM   6529  C CD  . LYS D  3 209 ? -24.525 -56.116  33.634  1.00 68.11  ? 209  LYS D CD  1 
ATOM   6530  C CE  . LYS D  3 209 ? -24.151 -56.239  32.166  1.00 68.03  ? 209  LYS D CE  1 
ATOM   6531  N NZ  . LYS D  3 209 ? -23.900 -54.909  31.547  1.00 67.34  ? 209  LYS D NZ  1 
ATOM   6532  N N   . VAL D  3 210 ? -21.171 -60.218  35.161  1.00 78.15  ? 210  VAL D N   1 
ATOM   6533  C CA  . VAL D  3 210 ? -19.949 -60.965  34.889  1.00 77.78  ? 210  VAL D CA  1 
ATOM   6534  C C   . VAL D  3 210 ? -20.028 -62.356  35.524  1.00 82.03  ? 210  VAL D C   1 
ATOM   6535  O O   . VAL D  3 210 ? -20.574 -62.513  36.619  1.00 80.37  ? 210  VAL D O   1 
ATOM   6536  C CB  . VAL D  3 210 ? -18.695 -60.191  35.391  1.00 68.03  ? 210  VAL D CB  1 
ATOM   6537  C CG1 . VAL D  3 210 ? -19.100 -58.859  36.011  1.00 64.49  ? 210  VAL D CG1 1 
ATOM   6538  C CG2 . VAL D  3 210 ? -17.872 -61.021  36.370  1.00 66.39  ? 210  VAL D CG2 1 
ATOM   6539  N N   . PRO D  3 211 ? -19.511 -63.375  34.817  1.00 83.64  ? 211  PRO D N   1 
ATOM   6540  C CA  . PRO D  3 211 ? -19.543 -64.772  35.269  1.00 86.08  ? 211  PRO D CA  1 
ATOM   6541  C C   . PRO D  3 211 ? -18.842 -64.988  36.608  1.00 83.41  ? 211  PRO D C   1 
ATOM   6542  O O   . PRO D  3 211 ? -17.906 -64.262  36.939  1.00 79.37  ? 211  PRO D O   1 
ATOM   6543  C CB  . PRO D  3 211 ? -18.810 -65.518  34.149  1.00 86.24  ? 211  PRO D CB  1 
ATOM   6544  C CG  . PRO D  3 211 ? -18.979 -64.655  32.949  1.00 86.86  ? 211  PRO D CG  1 
ATOM   6545  C CD  . PRO D  3 211 ? -18.932 -63.250  33.468  1.00 85.35  ? 211  PRO D CD  1 
ATOM   6546  N N   . GLN D  3 212 ? -19.298 -65.986  37.360  1.00 91.03  ? 212  GLN D N   1 
ATOM   6547  C CA  . GLN D  3 212 ? -18.745 -66.285  38.677  1.00 91.55  ? 212  GLN D CA  1 
ATOM   6548  C C   . GLN D  3 212 ? -17.289 -66.735  38.596  1.00 88.89  ? 212  GLN D C   1 
ATOM   6549  O O   . GLN D  3 212 ? -16.499 -66.474  39.505  1.00 86.68  ? 212  GLN D O   1 
ATOM   6550  C CB  . GLN D  3 212 ? -19.584 -67.359  39.373  1.00 99.62  ? 212  GLN D CB  1 
ATOM   6551  C CG  . GLN D  3 212 ? -20.252 -66.894  40.659  1.00 104.08 ? 212  GLN D CG  1 
ATOM   6552  C CD  . GLN D  3 212 ? -19.263 -66.680  41.788  1.00 107.37 ? 212  GLN D CD  1 
ATOM   6553  O OE1 . GLN D  3 212 ? -18.126 -67.147  41.732  1.00 109.18 ? 212  GLN D OE1 1 
ATOM   6554  N NE2 . GLN D  3 212 ? -19.694 -65.970  42.825  1.00 108.27 ? 212  GLN D NE2 1 
ATOM   6555  N N   . LYS D  3 213 ? -16.941 -67.412  37.507  1.00 88.38  ? 213  LYS D N   1 
ATOM   6556  C CA  . LYS D  3 213 ? -15.574 -67.872  37.293  1.00 85.26  ? 213  LYS D CA  1 
ATOM   6557  C C   . LYS D  3 213 ? -14.616 -66.690  37.187  1.00 79.73  ? 213  LYS D C   1 
ATOM   6558  O O   . LYS D  3 213 ? -13.443 -66.793  37.547  1.00 77.30  ? 213  LYS D O   1 
ATOM   6559  C CB  . LYS D  3 213 ? -15.488 -68.738  36.034  1.00 88.42  ? 213  LYS D CB  1 
ATOM   6560  N N   . VAL D  3 214 ? -15.128 -65.567  36.694  1.00 72.22  ? 214  VAL D N   1 
ATOM   6561  C CA  . VAL D  3 214 ? -14.337 -64.349  36.576  1.00 66.50  ? 214  VAL D CA  1 
ATOM   6562  C C   . VAL D  3 214 ? -14.256 -63.619  37.914  1.00 63.81  ? 214  VAL D C   1 
ATOM   6563  O O   . VAL D  3 214 ? -13.227 -63.031  38.245  1.00 60.55  ? 214  VAL D O   1 
ATOM   6564  C CB  . VAL D  3 214 ? -14.920 -63.398  35.515  1.00 60.34  ? 214  VAL D CB  1 
ATOM   6565  N N   . VAL D  3 215 ? -15.346 -63.665  38.676  1.00 63.40  ? 215  VAL D N   1 
ATOM   6566  C CA  . VAL D  3 215 ? -15.416 -63.004  39.977  1.00 58.96  ? 215  VAL D CA  1 
ATOM   6567  C C   . VAL D  3 215 ? -14.368 -63.547  40.945  1.00 61.01  ? 215  VAL D C   1 
ATOM   6568  O O   . VAL D  3 215 ? -13.674 -62.783  41.617  1.00 52.36  ? 215  VAL D O   1 
ATOM   6569  C CB  . VAL D  3 215 ? -16.813 -63.162  40.612  1.00 55.40  ? 215  VAL D CB  1 
ATOM   6570  C CG1 . VAL D  3 215 ? -16.843 -62.540  41.999  1.00 51.20  ? 215  VAL D CG1 1 
ATOM   6571  C CG2 . VAL D  3 215 ? -17.874 -62.538  39.722  1.00 53.79  ? 215  VAL D CG2 1 
ATOM   6572  N N   . ASP D  3 216 ? -14.260 -64.871  41.006  1.00 73.43  ? 216  ASP D N   1 
ATOM   6573  C CA  . ASP D  3 216 ? -13.288 -65.529  41.872  1.00 77.58  ? 216  ASP D CA  1 
ATOM   6574  C C   . ASP D  3 216 ? -11.859 -65.157  41.491  1.00 80.57  ? 216  ASP D C   1 
ATOM   6575  O O   . ASP D  3 216 ? -11.008 -64.963  42.359  1.00 81.36  ? 216  ASP D O   1 
ATOM   6576  C CB  . ASP D  3 216 ? -13.468 -67.047  41.816  1.00 82.07  ? 216  ASP D CB  1 
ATOM   6577  C CG  . ASP D  3 216 ? -14.758 -67.502  42.465  1.00 86.13  ? 216  ASP D CG  1 
ATOM   6578  O OD1 . ASP D  3 216 ? -15.585 -66.634  42.814  1.00 83.70  ? 216  ASP D OD1 1 
ATOM   6579  O OD2 . ASP D  3 216 ? -14.948 -68.727  42.622  1.00 91.75  ? 216  ASP D OD2 1 
ATOM   6580  N N   . LYS D  3 217 ? -11.605 -65.058  40.190  1.00 89.04  ? 217  LYS D N   1 
ATOM   6581  C CA  . LYS D  3 217 ? -10.291 -64.666  39.692  1.00 89.59  ? 217  LYS D CA  1 
ATOM   6582  C C   . LYS D  3 217 ? -9.970  -63.231  40.095  1.00 86.16  ? 217  LYS D C   1 
ATOM   6583  O O   . LYS D  3 217 ? -8.824  -62.903  40.402  1.00 86.30  ? 217  LYS D O   1 
ATOM   6584  C CB  . LYS D  3 217 ? -10.225 -64.818  38.171  1.00 91.06  ? 217  LYS D CB  1 
ATOM   6585  N N   . ILE D  3 218 ? -10.992 -62.382  40.090  1.00 78.06  ? 218  ILE D N   1 
ATOM   6586  C CA  . ILE D  3 218 ? -10.851 -60.998  40.523  1.00 72.41  ? 218  ILE D CA  1 
ATOM   6587  C C   . ILE D  3 218 ? -10.600 -60.935  42.026  1.00 68.27  ? 218  ILE D C   1 
ATOM   6588  O O   . ILE D  3 218 ? -9.775  -60.150  42.498  1.00 66.28  ? 218  ILE D O   1 
ATOM   6589  C CB  . ILE D  3 218 ? -12.103 -60.167  40.173  1.00 71.88  ? 218  ILE D CB  1 
ATOM   6590  C CG1 . ILE D  3 218 ? -12.254 -60.047  38.655  1.00 73.25  ? 218  ILE D CG1 1 
ATOM   6591  C CG2 . ILE D  3 218 ? -12.031 -58.787  40.804  1.00 70.66  ? 218  ILE D CG2 1 
ATOM   6592  C CD1 . ILE D  3 218 ? -13.515 -59.331  38.222  1.00 70.50  ? 218  ILE D CD1 1 
ATOM   6593  N N   . THR D  3 219 ? -11.312 -61.779  42.767  1.00 65.74  ? 219  THR D N   1 
ATOM   6594  C CA  . THR D  3 219 ? -11.204 -61.827  44.221  1.00 65.42  ? 219  THR D CA  1 
ATOM   6595  C C   . THR D  3 219 ? -9.772  -62.110  44.680  1.00 65.98  ? 219  THR D C   1 
ATOM   6596  O O   . THR D  3 219 ? -9.315  -61.566  45.684  1.00 68.91  ? 219  THR D O   1 
ATOM   6597  C CB  . THR D  3 219 ? -12.149 -62.896  44.809  1.00 64.16  ? 219  THR D CB  1 
ATOM   6598  O OG1 . THR D  3 219 ? -13.443 -62.780  44.202  1.00 45.85  ? 219  THR D OG1 1 
ATOM   6599  C CG2 . THR D  3 219 ? -12.283 -62.725  46.312  1.00 66.98  ? 219  THR D CG2 1 
ATOM   6600  N N   . GLU D  3 220 ? -9.069  -62.953  43.932  1.00 72.69  ? 220  GLU D N   1 
ATOM   6601  C CA  . GLU D  3 220 ? -7.679  -63.281  44.232  1.00 76.98  ? 220  GLU D CA  1 
ATOM   6602  C C   . GLU D  3 220 ? -6.758  -62.085  43.998  1.00 72.41  ? 220  GLU D C   1 
ATOM   6603  O O   . GLU D  3 220 ? -5.837  -61.830  44.779  1.00 72.82  ? 220  GLU D O   1 
ATOM   6604  C CB  . GLU D  3 220 ? -7.219  -64.464  43.381  1.00 87.74  ? 220  GLU D CB  1 
ATOM   6605  C CG  . GLU D  3 220 ? -8.019  -65.738  43.600  1.00 99.14  ? 220  GLU D CG  1 
ATOM   6606  C CD  . GLU D  3 220 ? -7.609  -66.850  42.657  1.00 108.76 ? 220  GLU D CD  1 
ATOM   6607  O OE1 . GLU D  3 220 ? -6.963  -66.545  41.632  1.00 111.09 ? 220  GLU D OE1 1 
ATOM   6608  O OE2 . GLU D  3 220 ? -7.924  -68.025  42.939  1.00 113.53 ? 220  GLU D OE2 1 
ATOM   6609  N N   . MET D  3 221 ? -7.018  -61.354  42.919  1.00 67.53  ? 221  MET D N   1 
ATOM   6610  C CA  . MET D  3 221 ? -6.187  -60.219  42.538  1.00 66.90  ? 221  MET D CA  1 
ATOM   6611  C C   . MET D  3 221 ? -6.351  -59.062  43.516  1.00 64.18  ? 221  MET D C   1 
ATOM   6612  O O   . MET D  3 221 ? -5.408  -58.308  43.756  1.00 69.66  ? 221  MET D O   1 
ATOM   6613  C CB  . MET D  3 221 ? -6.525  -59.768  41.116  1.00 71.30  ? 221  MET D CB  1 
ATOM   6614  C CG  . MET D  3 221 ? -6.271  -60.829  40.055  1.00 78.36  ? 221  MET D CG  1 
ATOM   6615  S SD  . MET D  3 221 ? -6.671  -60.268  38.388  1.00 94.47  ? 221  MET D SD  1 
ATOM   6616  C CE  . MET D  3 221 ? -5.507  -58.922  38.192  1.00 69.04  ? 221  MET D CE  1 
ATOM   6617  N N   . ILE D  3 222 ? -7.548  -58.926  44.079  1.00 58.10  ? 222  ILE D N   1 
ATOM   6618  C CA  . ILE D  3 222 ? -7.801  -57.901  45.084  1.00 52.72  ? 222  ILE D CA  1 
ATOM   6619  C C   . ILE D  3 222 ? -6.969  -58.175  46.331  1.00 54.10  ? 222  ILE D C   1 
ATOM   6620  O O   . ILE D  3 222 ? -7.094  -59.237  46.941  1.00 57.26  ? 222  ILE D O   1 
ATOM   6621  C CB  . ILE D  3 222 ? -9.291  -57.829  45.474  1.00 45.68  ? 222  ILE D CB  1 
ATOM   6622  C CG1 . ILE D  3 222 ? -10.142 -57.419  44.272  1.00 40.04  ? 222  ILE D CG1 1 
ATOM   6623  C CG2 . ILE D  3 222 ? -9.494  -56.849  46.620  1.00 44.08  ? 222  ILE D CG2 1 
ATOM   6624  C CD1 . ILE D  3 222 ? -11.617 -57.290  44.587  1.00 35.45  ? 222  ILE D CD1 1 
ATOM   6625  N N   . PRO D  3 223 ? -6.104  -57.218  46.702  1.00 51.75  ? 223  PRO D N   1 
ATOM   6626  C CA  . PRO D  3 223 ? -5.220  -57.341  47.866  1.00 50.52  ? 223  PRO D CA  1 
ATOM   6627  C C   . PRO D  3 223 ? -5.973  -57.662  49.155  1.00 50.14  ? 223  PRO D C   1 
ATOM   6628  O O   . PRO D  3 223 ? -5.492  -58.463  49.955  1.00 50.47  ? 223  PRO D O   1 
ATOM   6629  C CB  . PRO D  3 223 ? -4.562  -55.962  47.947  1.00 47.31  ? 223  PRO D CB  1 
ATOM   6630  C CG  . PRO D  3 223 ? -4.568  -55.475  46.545  1.00 46.17  ? 223  PRO D CG  1 
ATOM   6631  C CD  . PRO D  3 223 ? -5.866  -55.964  45.966  1.00 48.04  ? 223  PRO D CD  1 
ATOM   6632  N N   . MET D  3 224 ? -7.139  -57.054  49.346  1.00 49.48  ? 224  MET D N   1 
ATOM   6633  C CA  . MET D  3 224 ? -7.946  -57.320  50.532  1.00 48.60  ? 224  MET D CA  1 
ATOM   6634  C C   . MET D  3 224 ? -8.634  -58.680  50.435  1.00 47.57  ? 224  MET D C   1 
ATOM   6635  O O   . MET D  3 224 ? -9.162  -59.190  51.422  1.00 44.73  ? 224  MET D O   1 
ATOM   6636  C CB  . MET D  3 224 ? -8.980  -56.213  50.741  1.00 45.78  ? 224  MET D CB  1 
ATOM   6637  C CG  . MET D  3 224 ? -8.368  -54.857  51.053  1.00 46.02  ? 224  MET D CG  1 
ATOM   6638  S SD  . MET D  3 224 ? -9.584  -53.631  51.569  1.00 79.49  ? 224  MET D SD  1 
ATOM   6639  C CE  . MET D  3 224 ? -10.217 -54.393  53.061  1.00 93.44  ? 224  MET D CE  1 
ATOM   6640  N N   . GLY D  3 225 ? -8.624  -59.259  49.238  1.00 49.81  ? 225  GLY D N   1 
ATOM   6641  C CA  . GLY D  3 225 ? -9.119  -60.608  49.035  1.00 56.28  ? 225  GLY D CA  1 
ATOM   6642  C C   . GLY D  3 225 ? -10.629 -60.742  49.025  1.00 61.85  ? 225  GLY D C   1 
ATOM   6643  O O   . GLY D  3 225 ? -11.157 -61.832  49.246  1.00 67.02  ? 225  GLY D O   1 
ATOM   6644  N N   . HIS D  3 226 ? -11.327 -59.641  48.768  1.00 59.19  ? 226  HIS D N   1 
ATOM   6645  C CA  . HIS D  3 226 ? -12.784 -59.669  48.697  1.00 58.25  ? 226  HIS D CA  1 
ATOM   6646  C C   . HIS D  3 226 ? -13.329 -58.484  47.908  1.00 53.80  ? 226  HIS D C   1 
ATOM   6647  O O   . HIS D  3 226 ? -12.770 -57.387  47.950  1.00 50.69  ? 226  HIS D O   1 
ATOM   6648  C CB  . HIS D  3 226 ? -13.393 -59.689  50.103  1.00 62.30  ? 226  HIS D CB  1 
ATOM   6649  C CG  . HIS D  3 226 ? -13.155 -58.436  50.889  1.00 64.96  ? 226  HIS D CG  1 
ATOM   6650  N ND1 . HIS D  3 226 ? -13.917 -57.299  50.726  1.00 65.06  ? 226  HIS D ND1 1 
ATOM   6651  C CD2 . HIS D  3 226 ? -12.244 -58.143  51.847  1.00 67.28  ? 226  HIS D CD2 1 
ATOM   6652  C CE1 . HIS D  3 226 ? -13.484 -56.359  51.548  1.00 65.38  ? 226  HIS D CE1 1 
ATOM   6653  N NE2 . HIS D  3 226 ? -12.470 -56.846  52.239  1.00 66.68  ? 226  HIS D NE2 1 
ATOM   6654  N N   . LEU D  3 227 ? -14.421 -58.715  47.187  1.00 55.99  ? 227  LEU D N   1 
ATOM   6655  C CA  . LEU D  3 227 ? -15.087 -57.654  46.441  1.00 54.68  ? 227  LEU D CA  1 
ATOM   6656  C C   . LEU D  3 227 ? -15.676 -56.622  47.395  1.00 52.44  ? 227  LEU D C   1 
ATOM   6657  O O   . LEU D  3 227 ? -16.134 -56.962  48.485  1.00 54.95  ? 227  LEU D O   1 
ATOM   6658  C CB  . LEU D  3 227 ? -16.182 -58.228  45.538  1.00 55.07  ? 227  LEU D CB  1 
ATOM   6659  C CG  . LEU D  3 227 ? -15.802 -58.532  44.085  1.00 56.25  ? 227  LEU D CG  1 
ATOM   6660  C CD1 . LEU D  3 227 ? -14.663 -59.539  44.003  1.00 57.73  ? 227  LEU D CD1 1 
ATOM   6661  C CD2 . LEU D  3 227 ? -17.015 -59.024  43.310  1.00 58.93  ? 227  LEU D CD2 1 
ATOM   6662  N N   . GLY D  3 228 ? -15.659 -55.362  46.977  1.00 50.53  ? 228  GLY D N   1 
ATOM   6663  C CA  . GLY D  3 228 ? -16.119 -54.276  47.821  1.00 47.66  ? 228  GLY D CA  1 
ATOM   6664  C C   . GLY D  3 228 ? -17.617 -54.254  48.044  1.00 51.22  ? 228  GLY D C   1 
ATOM   6665  O O   . GLY D  3 228 ? -18.381 -54.858  47.293  1.00 55.90  ? 228  GLY D O   1 
ATOM   6666  N N   . ASP D  3 229 ? -18.032 -53.553  49.093  1.00 49.31  ? 229  ASP D N   1 
ATOM   6667  C CA  . ASP D  3 229 ? -19.446 -53.372  49.389  1.00 55.13  ? 229  ASP D CA  1 
ATOM   6668  C C   . ASP D  3 229 ? -19.887 -51.963  49.009  1.00 53.32  ? 229  ASP D C   1 
ATOM   6669  O O   . ASP D  3 229 ? -19.106 -51.017  49.121  1.00 50.24  ? 229  ASP D O   1 
ATOM   6670  C CB  . ASP D  3 229 ? -19.726 -53.646  50.868  1.00 65.94  ? 229  ASP D CB  1 
ATOM   6671  C CG  . ASP D  3 229 ? -19.850 -55.126  51.172  1.00 75.40  ? 229  ASP D CG  1 
ATOM   6672  O OD1 . ASP D  3 229 ? -20.502 -55.843  50.383  1.00 76.68  ? 229  ASP D OD1 1 
ATOM   6673  O OD2 . ASP D  3 229 ? -19.294 -55.576  52.197  1.00 79.98  ? 229  ASP D OD2 1 
ATOM   6674  N N   . PRO D  3 230 ? -21.138 -51.822  48.542  1.00 45.83  ? 230  PRO D N   1 
ATOM   6675  C CA  . PRO D  3 230 ? -21.697 -50.535  48.111  1.00 44.09  ? 230  PRO D CA  1 
ATOM   6676  C C   . PRO D  3 230 ? -21.606 -49.450  49.183  1.00 45.23  ? 230  PRO D C   1 
ATOM   6677  O O   . PRO D  3 230 ? -21.473 -48.272  48.851  1.00 45.39  ? 230  PRO D O   1 
ATOM   6678  C CB  . PRO D  3 230 ? -23.158 -50.877  47.808  1.00 46.14  ? 230  PRO D CB  1 
ATOM   6679  C CG  . PRO D  3 230 ? -23.131 -52.316  47.440  1.00 46.63  ? 230  PRO D CG  1 
ATOM   6680  C CD  . PRO D  3 230 ? -22.080 -52.932  48.316  1.00 46.91  ? 230  PRO D CD  1 
ATOM   6681  N N   . GLU D  3 231 ? -21.674 -49.851  50.449  1.00 46.06  ? 231  GLU D N   1 
ATOM   6682  C CA  . GLU D  3 231 ? -21.593 -48.911  51.561  1.00 52.11  ? 231  GLU D CA  1 
ATOM   6683  C C   . GLU D  3 231 ? -20.210 -48.275  51.653  1.00 52.11  ? 231  GLU D C   1 
ATOM   6684  O O   . GLU D  3 231 ? -20.071 -47.126  52.076  1.00 53.61  ? 231  GLU D O   1 
ATOM   6685  C CB  . GLU D  3 231 ? -21.935 -49.608  52.882  1.00 62.94  ? 231  GLU D CB  1 
ATOM   6686  C CG  . GLU D  3 231 ? -23.365 -50.127  52.979  1.00 72.63  ? 231  GLU D CG  1 
ATOM   6687  C CD  . GLU D  3 231 ? -23.567 -51.452  52.265  1.00 77.74  ? 231  GLU D CD  1 
ATOM   6688  O OE1 . GLU D  3 231 ? -22.590 -51.982  51.694  1.00 74.77  ? 231  GLU D OE1 1 
ATOM   6689  O OE2 . GLU D  3 231 ? -24.706 -51.965  52.277  1.00 83.83  ? 231  GLU D OE2 1 
ATOM   6690  N N   . ASP D  3 232 ? -19.189 -49.029  51.257  1.00 50.25  ? 232  ASP D N   1 
ATOM   6691  C CA  . ASP D  3 232 ? -17.815 -48.545  51.293  1.00 50.16  ? 232  ASP D CA  1 
ATOM   6692  C C   . ASP D  3 232 ? -17.621 -47.377  50.330  1.00 47.94  ? 232  ASP D C   1 
ATOM   6693  O O   . ASP D  3 232 ? -16.897 -46.427  50.628  1.00 50.36  ? 232  ASP D O   1 
ATOM   6694  C CB  . ASP D  3 232 ? -16.839 -49.675  50.958  1.00 51.95  ? 232  ASP D CB  1 
ATOM   6695  C CG  . ASP D  3 232 ? -16.970 -50.856  51.902  1.00 55.69  ? 232  ASP D CG  1 
ATOM   6696  O OD1 . ASP D  3 232 ? -17.282 -50.637  53.092  1.00 60.41  ? 232  ASP D OD1 1 
ATOM   6697  O OD2 . ASP D  3 232 ? -16.763 -52.004  51.454  1.00 51.20  ? 232  ASP D OD2 1 
ATOM   6698  N N   . VAL D  3 233 ? -18.273 -47.455  49.174  1.00 43.89  ? 233  VAL D N   1 
ATOM   6699  C CA  . VAL D  3 233 ? -18.239 -46.368  48.203  1.00 45.16  ? 233  VAL D CA  1 
ATOM   6700  C C   . VAL D  3 233 ? -19.042 -45.183  48.728  1.00 50.00  ? 233  VAL D C   1 
ATOM   6701  O O   . VAL D  3 233 ? -18.677 -44.025  48.518  1.00 51.04  ? 233  VAL D O   1 
ATOM   6702  C CB  . VAL D  3 233 ? -18.802 -46.807  46.836  1.00 44.52  ? 233  VAL D CB  1 
ATOM   6703  C CG1 . VAL D  3 233 ? -18.642 -45.694  45.810  1.00 41.90  ? 233  VAL D CG1 1 
ATOM   6704  C CG2 . VAL D  3 233 ? -18.113 -48.076  46.359  1.00 44.62  ? 233  VAL D CG2 1 
ATOM   6705  N N   . ALA D  3 234 ? -20.135 -45.487  49.420  1.00 49.55  ? 234  ALA D N   1 
ATOM   6706  C CA  . ALA D  3 234 ? -21.006 -44.463  49.981  1.00 49.28  ? 234  ALA D CA  1 
ATOM   6707  C C   . ALA D  3 234 ? -20.294 -43.654  51.062  1.00 46.67  ? 234  ALA D C   1 
ATOM   6708  O O   . ALA D  3 234 ? -20.574 -42.469  51.248  1.00 44.03  ? 234  ALA D O   1 
ATOM   6709  C CB  . ALA D  3 234 ? -22.269 -45.097  50.538  1.00 50.42  ? 234  ALA D CB  1 
ATOM   6710  N N   . ASP D  3 235 ? -19.375 -44.301  51.773  1.00 48.58  ? 235  ASP D N   1 
ATOM   6711  C CA  . ASP D  3 235 ? -18.599 -43.630  52.809  1.00 52.42  ? 235  ASP D CA  1 
ATOM   6712  C C   . ASP D  3 235 ? -17.729 -42.535  52.201  1.00 49.13  ? 235  ASP D C   1 
ATOM   6713  O O   . ASP D  3 235 ? -17.582 -41.454  52.773  1.00 51.21  ? 235  ASP D O   1 
ATOM   6714  C CB  . ASP D  3 235 ? -17.729 -44.633  53.568  1.00 61.74  ? 235  ASP D CB  1 
ATOM   6715  C CG  . ASP D  3 235 ? -16.998 -44.002  54.737  1.00 71.80  ? 235  ASP D CG  1 
ATOM   6716  O OD1 . ASP D  3 235 ? -17.619 -43.197  55.463  1.00 77.25  ? 235  ASP D OD1 1 
ATOM   6717  O OD2 . ASP D  3 235 ? -15.801 -44.306  54.929  1.00 71.50  ? 235  ASP D OD2 1 
ATOM   6718  N N   . VAL D  3 236 ? -17.157 -42.825  51.037  1.00 40.10  ? 236  VAL D N   1 
ATOM   6719  C CA  . VAL D  3 236 ? -16.334 -41.860  50.320  1.00 38.63  ? 236  VAL D CA  1 
ATOM   6720  C C   . VAL D  3 236 ? -17.178 -40.690  49.830  1.00 37.96  ? 236  VAL D C   1 
ATOM   6721  O O   . VAL D  3 236 ? -16.802 -39.528  49.990  1.00 41.55  ? 236  VAL D O   1 
ATOM   6722  C CB  . VAL D  3 236 ? -15.619 -42.510  49.118  1.00 35.45  ? 236  VAL D CB  1 
ATOM   6723  C CG1 . VAL D  3 236 ? -14.828 -41.468  48.339  1.00 28.41  ? 236  VAL D CG1 1 
ATOM   6724  C CG2 . VAL D  3 236 ? -14.713 -43.640  49.586  1.00 36.06  ? 236  VAL D CG2 1 
ATOM   6725  N N   . VAL D  3 237 ? -18.323 -41.009  49.233  1.00 35.67  ? 237  VAL D N   1 
ATOM   6726  C CA  . VAL D  3 237 ? -19.238 -39.997  48.718  1.00 39.73  ? 237  VAL D CA  1 
ATOM   6727  C C   . VAL D  3 237 ? -19.714 -39.069  49.832  1.00 44.66  ? 237  VAL D C   1 
ATOM   6728  O O   . VAL D  3 237 ? -19.788 -37.853  49.651  1.00 47.18  ? 237  VAL D O   1 
ATOM   6729  C CB  . VAL D  3 237 ? -20.457 -40.644  48.030  1.00 34.36  ? 237  VAL D CB  1 
ATOM   6730  C CG1 . VAL D  3 237 ? -21.450 -39.582  47.589  1.00 28.15  ? 237  VAL D CG1 1 
ATOM   6731  C CG2 . VAL D  3 237 ? -20.009 -41.485  46.845  1.00 35.33  ? 237  VAL D CG2 1 
ATOM   6732  N N   . ALA D  3 238 ? -20.022 -39.650  50.987  1.00 47.66  ? 238  ALA D N   1 
ATOM   6733  C CA  . ALA D  3 238 ? -20.456 -38.877  52.145  1.00 49.21  ? 238  ALA D CA  1 
ATOM   6734  C C   . ALA D  3 238 ? -19.364 -37.915  52.599  1.00 45.94  ? 238  ALA D C   1 
ATOM   6735  O O   . ALA D  3 238 ? -19.646 -36.803  53.043  1.00 46.44  ? 238  ALA D O   1 
ATOM   6736  C CB  . ALA D  3 238 ? -20.854 -39.804  53.282  1.00 52.71  ? 238  ALA D CB  1 
ATOM   6737  N N   . PHE D  3 239 ? -18.115 -38.353  52.479  1.00 45.35  ? 239  PHE D N   1 
ATOM   6738  C CA  . PHE D  3 239 ? -16.972 -37.530  52.855  1.00 44.41  ? 239  PHE D CA  1 
ATOM   6739  C C   . PHE D  3 239 ? -16.791 -36.359  51.895  1.00 36.32  ? 239  PHE D C   1 
ATOM   6740  O O   . PHE D  3 239 ? -16.618 -35.217  52.322  1.00 34.75  ? 239  PHE D O   1 
ATOM   6741  C CB  . PHE D  3 239 ? -15.698 -38.376  52.898  1.00 42.20  ? 239  PHE D CB  1 
ATOM   6742  C CG  . PHE D  3 239 ? -14.444 -37.575  53.099  1.00 37.10  ? 239  PHE D CG  1 
ATOM   6743  C CD1 . PHE D  3 239 ? -14.140 -37.036  54.338  1.00 38.38  ? 239  PHE D CD1 1 
ATOM   6744  C CD2 . PHE D  3 239 ? -13.564 -37.369  52.050  1.00 34.58  ? 239  PHE D CD2 1 
ATOM   6745  C CE1 . PHE D  3 239 ? -12.986 -36.300  54.525  1.00 35.86  ? 239  PHE D CE1 1 
ATOM   6746  C CE2 . PHE D  3 239 ? -12.408 -36.635  52.231  1.00 36.50  ? 239  PHE D CE2 1 
ATOM   6747  C CZ  . PHE D  3 239 ? -12.119 -36.099  53.471  1.00 35.25  ? 239  PHE D CZ  1 
ATOM   6748  N N   . LEU D  3 240 ? -16.835 -36.649  50.599  1.00 30.99  ? 240  LEU D N   1 
ATOM   6749  C CA  . LEU D  3 240 ? -16.661 -35.623  49.577  1.00 35.82  ? 240  LEU D CA  1 
ATOM   6750  C C   . LEU D  3 240 ? -17.823 -34.634  49.570  1.00 38.96  ? 240  LEU D C   1 
ATOM   6751  O O   . LEU D  3 240 ? -17.671 -33.490  49.141  1.00 41.79  ? 240  LEU D O   1 
ATOM   6752  C CB  . LEU D  3 240 ? -16.509 -36.264  48.195  1.00 35.18  ? 240  LEU D CB  1 
ATOM   6753  C CG  . LEU D  3 240 ? -15.238 -37.083  47.957  1.00 34.41  ? 240  LEU D CG  1 
ATOM   6754  C CD1 . LEU D  3 240 ? -15.262 -37.719  46.577  1.00 38.46  ? 240  LEU D CD1 1 
ATOM   6755  C CD2 . LEU D  3 240 ? -13.998 -36.216  48.127  1.00 28.77  ? 240  LEU D CD2 1 
ATOM   6756  N N   . ALA D  3 241 ? -18.979 -35.077  50.051  1.00 37.80  ? 241  ALA D N   1 
ATOM   6757  C CA  . ALA D  3 241 ? -20.167 -34.233  50.087  1.00 36.80  ? 241  ALA D CA  1 
ATOM   6758  C C   . ALA D  3 241 ? -20.133 -33.263  51.263  1.00 41.36  ? 241  ALA D C   1 
ATOM   6759  O O   . ALA D  3 241 ? -20.746 -32.196  51.217  1.00 45.34  ? 241  ALA D O   1 
ATOM   6760  C CB  . ALA D  3 241 ? -21.419 -35.091  50.150  1.00 38.12  ? 241  ALA D CB  1 
ATOM   6761  N N   . SER D  3 242 ? -19.413 -33.639  52.315  1.00 39.10  ? 242  SER D N   1 
ATOM   6762  C CA  . SER D  3 242 ? -19.361 -32.843  53.537  1.00 41.72  ? 242  SER D CA  1 
ATOM   6763  C C   . SER D  3 242 ? -18.326 -31.726  53.459  1.00 42.15  ? 242  SER D C   1 
ATOM   6764  O O   . SER D  3 242 ? -17.565 -31.636  52.496  1.00 44.14  ? 242  SER D O   1 
ATOM   6765  C CB  . SER D  3 242 ? -19.063 -33.742  54.737  1.00 44.63  ? 242  SER D CB  1 
ATOM   6766  O OG  . SER D  3 242 ? -17.864 -34.470  54.539  1.00 40.44  ? 242  SER D OG  1 
ATOM   6767  N N   . GLU D  3 243 ? -18.305 -30.877  54.483  1.00 48.52  ? 243  GLU D N   1 
ATOM   6768  C CA  . GLU D  3 243 ? -17.331 -29.795  54.563  1.00 56.93  ? 243  GLU D CA  1 
ATOM   6769  C C   . GLU D  3 243 ? -16.003 -30.288  55.128  1.00 55.58  ? 243  GLU D C   1 
ATOM   6770  O O   . GLU D  3 243 ? -15.024 -29.541  55.175  1.00 56.09  ? 243  GLU D O   1 
ATOM   6771  C CB  . GLU D  3 243 ? -17.866 -28.645  55.416  1.00 68.94  ? 243  GLU D CB  1 
ATOM   6772  C CG  . GLU D  3 243 ? -18.978 -27.843  54.759  1.00 80.77  ? 243  GLU D CG  1 
ATOM   6773  C CD  . GLU D  3 243 ? -19.408 -26.654  55.595  1.00 91.09  ? 243  GLU D CD  1 
ATOM   6774  O OE1 . GLU D  3 243 ? -18.661 -26.281  56.525  1.00 94.83  ? 243  GLU D OE1 1 
ATOM   6775  O OE2 . GLU D  3 243 ? -20.493 -26.095  55.328  1.00 93.35  ? 243  GLU D OE2 1 
ATOM   6776  N N   . ASP D  3 244 ? -15.972 -31.547  55.555  1.00 50.64  ? 244  ASP D N   1 
ATOM   6777  C CA  . ASP D  3 244 ? -14.740 -32.161  56.039  1.00 46.05  ? 244  ASP D CA  1 
ATOM   6778  C C   . ASP D  3 244 ? -13.721 -32.250  54.909  1.00 41.68  ? 244  ASP D C   1 
ATOM   6779  O O   . ASP D  3 244 ? -12.513 -32.260  55.143  1.00 43.22  ? 244  ASP D O   1 
ATOM   6780  C CB  . ASP D  3 244 ? -15.015 -33.549  56.619  1.00 47.84  ? 244  ASP D CB  1 
ATOM   6781  C CG  . ASP D  3 244 ? -15.934 -33.507  57.824  1.00 50.58  ? 244  ASP D CG  1 
ATOM   6782  O OD1 . ASP D  3 244 ? -16.028 -32.440  58.465  1.00 50.54  ? 244  ASP D OD1 1 
ATOM   6783  O OD2 . ASP D  3 244 ? -16.559 -34.544  58.132  1.00 53.49  ? 244  ASP D OD2 1 
ATOM   6784  N N   . SER D  3 245 ? -14.226 -32.316  53.683  1.00 40.77  ? 245  SER D N   1 
ATOM   6785  C CA  . SER D  3 245 ? -13.385 -32.325  52.496  1.00 38.64  ? 245  SER D CA  1 
ATOM   6786  C C   . SER D  3 245 ? -13.442 -30.970  51.801  1.00 38.31  ? 245  SER D C   1 
ATOM   6787  O O   . SER D  3 245 ? -13.434 -30.891  50.573  1.00 41.87  ? 245  SER D O   1 
ATOM   6788  C CB  . SER D  3 245 ? -13.824 -33.431  51.538  1.00 40.51  ? 245  SER D CB  1 
ATOM   6789  O OG  . SER D  3 245 ? -15.182 -33.262  51.171  1.00 44.25  ? 245  SER D OG  1 
ATOM   6790  N N   . GLY D  3 246 ? -13.498 -29.907  52.597  1.00 37.33  ? 246  GLY D N   1 
ATOM   6791  C CA  . GLY D  3 246 ? -13.649 -28.560  52.078  1.00 38.27  ? 246  GLY D CA  1 
ATOM   6792  C C   . GLY D  3 246 ? -12.502 -28.080  51.208  1.00 40.75  ? 246  GLY D C   1 
ATOM   6793  O O   . GLY D  3 246 ? -12.670 -27.163  50.405  1.00 41.44  ? 246  GLY D O   1 
ATOM   6794  N N   . TYR D  3 247 ? -11.334 -28.695  51.364  1.00 40.14  ? 247  TYR D N   1 
ATOM   6795  C CA  . TYR D  3 247 ? -10.159 -28.291  50.601  1.00 39.57  ? 247  TYR D CA  1 
ATOM   6796  C C   . TYR D  3 247 ? -9.784  -29.342  49.557  1.00 42.71  ? 247  TYR D C   1 
ATOM   6797  O O   . TYR D  3 247 ? -8.725  -29.266  48.935  1.00 47.73  ? 247  TYR D O   1 
ATOM   6798  C CB  . TYR D  3 247 ? -8.978  -28.026  51.540  1.00 35.34  ? 247  TYR D CB  1 
ATOM   6799  C CG  . TYR D  3 247 ? -7.852  -27.238  50.906  1.00 37.63  ? 247  TYR D CG  1 
ATOM   6800  C CD1 . TYR D  3 247 ? -8.044  -25.925  50.494  1.00 39.74  ? 247  TYR D CD1 1 
ATOM   6801  C CD2 . TYR D  3 247 ? -6.596  -27.804  50.726  1.00 32.70  ? 247  TYR D CD2 1 
ATOM   6802  C CE1 . TYR D  3 247 ? -7.020  -25.200  49.914  1.00 36.92  ? 247  TYR D CE1 1 
ATOM   6803  C CE2 . TYR D  3 247 ? -5.564  -27.085  50.148  1.00 31.43  ? 247  TYR D CE2 1 
ATOM   6804  C CZ  . TYR D  3 247 ? -5.782  -25.784  49.744  1.00 33.96  ? 247  TYR D CZ  1 
ATOM   6805  O OH  . TYR D  3 247 ? -4.759  -25.066  49.170  1.00 37.24  ? 247  TYR D OH  1 
ATOM   6806  N N   . ILE D  3 248 ? -10.660 -30.321  49.363  1.00 40.21  ? 248  ILE D N   1 
ATOM   6807  C CA  . ILE D  3 248 ? -10.417 -31.369  48.379  1.00 35.97  ? 248  ILE D CA  1 
ATOM   6808  C C   . ILE D  3 248 ? -11.264 -31.166  47.128  1.00 37.27  ? 248  ILE D C   1 
ATOM   6809  O O   . ILE D  3 248 ? -12.490 -31.271  47.171  1.00 42.62  ? 248  ILE D O   1 
ATOM   6810  C CB  . ILE D  3 248 ? -10.706 -32.766  48.958  1.00 31.13  ? 248  ILE D CB  1 
ATOM   6811  C CG1 . ILE D  3 248 ? -9.813  -33.034  50.171  1.00 32.80  ? 248  ILE D CG1 1 
ATOM   6812  C CG2 . ILE D  3 248 ? -10.499 -33.835  47.896  1.00 28.11  ? 248  ILE D CG2 1 
ATOM   6813  C CD1 . ILE D  3 248 ? -9.993  -34.413  50.767  1.00 29.27  ? 248  ILE D CD1 1 
ATOM   6814  N N   . THR D  3 249 ? -10.602 -30.869  46.015  1.00 34.24  ? 249  THR D N   1 
ATOM   6815  C CA  . THR D  3 249 ? -11.282 -30.728  44.733  1.00 38.05  ? 249  THR D CA  1 
ATOM   6816  C C   . THR D  3 249 ? -10.340 -31.124  43.599  1.00 44.60  ? 249  THR D C   1 
ATOM   6817  O O   . THR D  3 249 ? -9.120  -31.006  43.724  1.00 47.62  ? 249  THR D O   1 
ATOM   6818  C CB  . THR D  3 249 ? -11.799 -29.290  44.511  1.00 41.23  ? 249  THR D CB  1 
ATOM   6819  O OG1 . THR D  3 249 ? -12.572 -29.235  43.305  1.00 43.20  ? 249  THR D OG1 1 
ATOM   6820  C CG2 . THR D  3 249 ? -10.644 -28.306  44.419  1.00 41.10  ? 249  THR D CG2 1 
ATOM   6821  N N   . GLY D  3 250 ? -10.912 -31.603  42.498  1.00 46.90  ? 250  GLY D N   1 
ATOM   6822  C CA  . GLY D  3 250 ? -10.123 -32.095  41.382  1.00 48.24  ? 250  GLY D CA  1 
ATOM   6823  C C   . GLY D  3 250 ? -9.291  -33.294  41.790  1.00 47.51  ? 250  GLY D C   1 
ATOM   6824  O O   . GLY D  3 250 ? -8.161  -33.465  41.334  1.00 50.28  ? 250  GLY D O   1 
ATOM   6825  N N   . THR D  3 251 ? -9.859  -34.127  42.655  1.00 47.29  ? 251  THR D N   1 
ATOM   6826  C CA  . THR D  3 251 ? -9.137  -35.257  43.224  1.00 51.93  ? 251  THR D CA  1 
ATOM   6827  C C   . THR D  3 251 ? -9.886  -36.570  43.017  1.00 50.19  ? 251  THR D C   1 
ATOM   6828  O O   . THR D  3 251 ? -11.090 -36.654  43.258  1.00 51.98  ? 251  THR D O   1 
ATOM   6829  C CB  . THR D  3 251 ? -8.887  -35.051  44.734  1.00 56.00  ? 251  THR D CB  1 
ATOM   6830  O OG1 . THR D  3 251 ? -8.147  -33.841  44.938  1.00 62.71  ? 251  THR D OG1 1 
ATOM   6831  C CG2 . THR D  3 251 ? -8.112  -36.220  45.318  1.00 55.95  ? 251  THR D CG2 1 
ATOM   6832  N N   . SER D  3 252 ? -9.164  -37.590  42.564  1.00 46.03  ? 252  SER D N   1 
ATOM   6833  C CA  . SER D  3 252 ? -9.727  -38.925  42.417  1.00 41.77  ? 252  SER D CA  1 
ATOM   6834  C C   . SER D  3 252 ? -9.465  -39.757  43.669  1.00 41.53  ? 252  SER D C   1 
ATOM   6835  O O   . SER D  3 252 ? -8.320  -39.904  44.096  1.00 46.52  ? 252  SER D O   1 
ATOM   6836  C CB  . SER D  3 252 ? -9.146  -39.624  41.187  1.00 39.05  ? 252  SER D CB  1 
ATOM   6837  O OG  . SER D  3 252 ? -9.501  -38.942  39.996  1.00 37.49  ? 252  SER D OG  1 
ATOM   6838  N N   . VAL D  3 253 ? -10.529 -40.294  44.256  1.00 40.09  ? 253  VAL D N   1 
ATOM   6839  C CA  . VAL D  3 253 ? -10.401 -41.113  45.455  1.00 39.19  ? 253  VAL D CA  1 
ATOM   6840  C C   . VAL D  3 253 ? -10.666 -42.582  45.143  1.00 43.07  ? 253  VAL D C   1 
ATOM   6841  O O   . VAL D  3 253 ? -11.808 -42.981  44.914  1.00 46.84  ? 253  VAL D O   1 
ATOM   6842  C CB  . VAL D  3 253 ? -11.363 -40.649  46.561  1.00 35.89  ? 253  VAL D CB  1 
ATOM   6843  C CG1 . VAL D  3 253 ? -11.142 -41.460  47.828  1.00 30.73  ? 253  VAL D CG1 1 
ATOM   6844  C CG2 . VAL D  3 253 ? -11.176 -39.165  46.835  1.00 37.20  ? 253  VAL D CG2 1 
ATOM   6845  N N   . GLU D  3 254 ? -9.606  -43.382  45.137  1.00 45.93  ? 254  GLU D N   1 
ATOM   6846  C CA  . GLU D  3 254 ? -9.722  -44.800  44.816  1.00 47.38  ? 254  GLU D CA  1 
ATOM   6847  C C   . GLU D  3 254 ? -10.182 -45.622  46.015  1.00 46.16  ? 254  GLU D C   1 
ATOM   6848  O O   . GLU D  3 254 ? -9.553  -45.604  47.073  1.00 47.59  ? 254  GLU D O   1 
ATOM   6849  C CB  . GLU D  3 254 ? -8.388  -45.349  44.303  1.00 49.60  ? 254  GLU D CB  1 
ATOM   6850  C CG  . GLU D  3 254 ? -7.833  -44.637  43.081  1.00 51.59  ? 254  GLU D CG  1 
ATOM   6851  C CD  . GLU D  3 254 ? -6.596  -45.321  42.526  1.00 57.47  ? 254  GLU D CD  1 
ATOM   6852  O OE1 . GLU D  3 254 ? -6.447  -46.544  42.734  1.00 57.76  ? 254  GLU D OE1 1 
ATOM   6853  O OE2 . GLU D  3 254 ? -5.771  -44.636  41.885  1.00 60.58  ? 254  GLU D OE2 1 
ATOM   6854  N N   . VAL D  3 255 ? -11.285 -46.338  45.840  1.00 45.35  ? 255  VAL D N   1 
ATOM   6855  C CA  . VAL D  3 255 ? -11.735 -47.306  46.831  1.00 50.61  ? 255  VAL D CA  1 
ATOM   6856  C C   . VAL D  3 255 ? -11.845 -48.665  46.128  1.00 50.36  ? 255  VAL D C   1 
ATOM   6857  O O   . VAL D  3 255 ? -12.906 -49.065  45.645  1.00 50.67  ? 255  VAL D O   1 
ATOM   6858  C CB  . VAL D  3 255 ? -13.072 -46.865  47.498  1.00 34.70  ? 255  VAL D CB  1 
ATOM   6859  C CG1 . VAL D  3 255 ? -14.091 -46.392  46.457  1.00 30.95  ? 255  VAL D CG1 1 
ATOM   6860  C CG2 . VAL D  3 255 ? -13.635 -47.960  48.403  1.00 32.75  ? 255  VAL D CG2 1 
ATOM   6861  N N   . THR D  3 256 ? -10.715 -49.362  46.053  1.00 49.25  ? 256  THR D N   1 
ATOM   6862  C CA  . THR D  3 256 ? -10.607 -50.560  45.227  1.00 49.56  ? 256  THR D CA  1 
ATOM   6863  C C   . THR D  3 256 ? -10.199 -51.799  46.013  1.00 44.46  ? 256  THR D C   1 
ATOM   6864  O O   . THR D  3 256 ? -10.222 -52.912  45.487  1.00 40.95  ? 256  THR D O   1 
ATOM   6865  C CB  . THR D  3 256 ? -9.587  -50.356  44.091  1.00 50.04  ? 256  THR D CB  1 
ATOM   6866  O OG1 . THR D  3 256 ? -8.274  -50.209  44.648  1.00 53.30  ? 256  THR D OG1 1 
ATOM   6867  C CG2 . THR D  3 256 ? -9.930  -49.118  43.277  1.00 47.03  ? 256  THR D CG2 1 
ATOM   6868  N N   . GLY D  3 257 ? -9.826  -51.605  47.272  1.00 43.39  ? 257  GLY D N   1 
ATOM   6869  C CA  . GLY D  3 257 ? -9.305  -52.693  48.075  1.00 42.39  ? 257  GLY D CA  1 
ATOM   6870  C C   . GLY D  3 257 ? -7.849  -52.940  47.735  1.00 45.57  ? 257  GLY D C   1 
ATOM   6871  O O   . GLY D  3 257 ? -7.264  -53.944  48.139  1.00 49.33  ? 257  GLY D O   1 
ATOM   6872  N N   . GLY D  3 258 ? -7.266  -52.014  46.980  1.00 41.00  ? 258  GLY D N   1 
ATOM   6873  C CA  . GLY D  3 258 ? -5.866  -52.095  46.612  1.00 42.93  ? 258  GLY D CA  1 
ATOM   6874  C C   . GLY D  3 258 ? -5.622  -52.515  45.176  1.00 42.47  ? 258  GLY D C   1 
ATOM   6875  O O   . GLY D  3 258 ? -4.489  -52.465  44.695  1.00 44.25  ? 258  GLY D O   1 
ATOM   6876  N N   . LEU D  3 259 ? -6.682  -52.932  44.491  1.00 43.93  ? 259  LEU D N   1 
ATOM   6877  C CA  . LEU D  3 259 ? -6.575  -53.394  43.110  1.00 46.11  ? 259  LEU D CA  1 
ATOM   6878  C C   . LEU D  3 259 ? -6.097  -52.279  42.183  1.00 45.98  ? 259  LEU D C   1 
ATOM   6879  O O   . LEU D  3 259 ? -6.689  -51.198  42.147  1.00 44.56  ? 259  LEU D O   1 
ATOM   6880  C CB  . LEU D  3 259 ? -7.919  -53.938  42.622  1.00 46.61  ? 259  LEU D CB  1 
ATOM   6881  C CG  . LEU D  3 259 ? -7.894  -54.693  41.291  1.00 45.53  ? 259  LEU D CG  1 
ATOM   6882  C CD1 . LEU D  3 259 ? -7.188  -56.034  41.447  1.00 46.36  ? 259  LEU D CD1 1 
ATOM   6883  C CD2 . LEU D  3 259 ? -9.306  -54.887  40.759  1.00 43.37  ? 259  LEU D CD2 1 
ATOM   6884  N N   . PHE D  3 260 ? -5.023  -52.557  41.445  1.00 47.32  ? 260  PHE D N   1 
ATOM   6885  C CA  . PHE D  3 260 ? -4.416  -51.602  40.517  1.00 49.59  ? 260  PHE D CA  1 
ATOM   6886  C C   . PHE D  3 260 ? -4.048  -50.287  41.207  1.00 54.19  ? 260  PHE D C   1 
ATOM   6887  O O   . PHE D  3 260 ? -4.254  -49.207  40.652  1.00 56.57  ? 260  PHE D O   1 
ATOM   6888  C CB  . PHE D  3 260 ? -5.353  -51.330  39.337  1.00 49.63  ? 260  PHE D CB  1 
ATOM   6889  C CG  . PHE D  3 260 ? -5.790  -52.571  38.608  1.00 49.87  ? 260  PHE D CG  1 
ATOM   6890  C CD1 . PHE D  3 260 ? -4.894  -53.595  38.349  1.00 48.47  ? 260  PHE D CD1 1 
ATOM   6891  C CD2 . PHE D  3 260 ? -7.099  -52.709  38.176  1.00 51.83  ? 260  PHE D CD2 1 
ATOM   6892  C CE1 . PHE D  3 260 ? -5.299  -54.735  37.676  1.00 50.43  ? 260  PHE D CE1 1 
ATOM   6893  C CE2 . PHE D  3 260 ? -7.508  -53.846  37.503  1.00 52.33  ? 260  PHE D CE2 1 
ATOM   6894  C CZ  . PHE D  3 260 ? -6.606  -54.860  37.253  1.00 51.90  ? 260  PHE D CZ  1 
ATOM   6895  N N   . MET D  3 261 ? -3.504  -50.389  42.418  1.00 77.90  ? 261  MET D N   1 
ATOM   6896  C CA  . MET D  3 261 ? -3.119  -49.214  43.195  1.00 75.17  ? 261  MET D CA  1 
ATOM   6897  C C   . MET D  3 261 ? -1.936  -48.492  42.560  1.00 75.94  ? 261  MET D C   1 
ATOM   6898  O O   . MET D  3 261 ? -1.240  -49.049  41.710  1.00 76.95  ? 261  MET D O   1 
ATOM   6899  C CB  . MET D  3 261 ? -2.780  -49.606  44.636  1.00 74.29  ? 261  MET D CB  1 
ATOM   6900  C CG  . MET D  3 261 ? -1.643  -50.612  44.757  1.00 75.56  ? 261  MET D CG  1 
ATOM   6901  S SD  . MET D  3 261 ? -1.005  -50.793  46.438  1.00 78.36  ? 261  MET D SD  1 
ATOM   6902  C CE  . MET D  3 261 ? -2.451  -51.384  47.310  1.00 56.23  ? 261  MET D CE  1 
ATOM   6903  N N   . SER E  1 3   ? 65.655  -14.973  32.134  1.00 68.71  ? 3    SER E N   1 
ATOM   6904  C CA  . SER E  1 3   ? 64.884  -14.648  30.939  1.00 73.33  ? 3    SER E CA  1 
ATOM   6905  C C   . SER E  1 3   ? 65.073  -13.189  30.531  1.00 82.06  ? 3    SER E C   1 
ATOM   6906  O O   . SER E  1 3   ? 65.089  -12.292  31.376  1.00 87.88  ? 3    SER E O   1 
ATOM   6907  C CB  . SER E  1 3   ? 63.401  -14.940  31.164  1.00 71.89  ? 3    SER E CB  1 
ATOM   6908  O OG  . SER E  1 3   ? 63.180  -16.330  31.359  1.00 72.42  ? 3    SER E OG  1 
ATOM   6909  N N   . GLN E  1 4   ? 65.215  -12.958  29.230  1.00 85.89  ? 4    GLN E N   1 
ATOM   6910  C CA  . GLN E  1 4   ? 65.369  -11.607  28.701  1.00 88.50  ? 4    GLN E CA  1 
ATOM   6911  C C   . GLN E  1 4   ? 64.025  -10.885  28.653  1.00 87.54  ? 4    GLN E C   1 
ATOM   6912  O O   . GLN E  1 4   ? 63.966  -9.676   28.430  1.00 90.78  ? 4    GLN E O   1 
ATOM   6913  C CB  . GLN E  1 4   ? 65.999  -11.647  27.306  1.00 97.40  ? 4    GLN E CB  1 
ATOM   6914  N N   . LEU E  1 5   ? 62.950  -11.636  28.871  1.00 80.65  ? 5    LEU E N   1 
ATOM   6915  C CA  . LEU E  1 5   ? 61.599  -11.088  28.828  1.00 77.62  ? 5    LEU E CA  1 
ATOM   6916  C C   . LEU E  1 5   ? 60.898  -11.251  30.173  1.00 73.64  ? 5    LEU E C   1 
ATOM   6917  O O   . LEU E  1 5   ? 59.673  -11.178  30.255  1.00 68.65  ? 5    LEU E O   1 
ATOM   6918  C CB  . LEU E  1 5   ? 60.781  -11.772  27.732  1.00 73.42  ? 5    LEU E CB  1 
ATOM   6919  C CG  . LEU E  1 5   ? 61.548  -12.265  26.503  1.00 69.69  ? 5    LEU E CG  1 
ATOM   6920  C CD1 . LEU E  1 5   ? 60.894  -13.519  25.944  1.00 63.55  ? 5    LEU E CD1 1 
ATOM   6921  C CD2 . LEU E  1 5   ? 61.629  -11.183  25.437  1.00 71.11  ? 5    LEU E CD2 1 
ATOM   6922  N N   . GLN E  1 6   ? 61.683  -11.472  31.224  1.00 74.55  ? 6    GLN E N   1 
ATOM   6923  C CA  . GLN E  1 6   ? 61.141  -11.750  32.552  1.00 69.18  ? 6    GLN E CA  1 
ATOM   6924  C C   . GLN E  1 6   ? 60.413  -10.548  33.150  1.00 66.71  ? 6    GLN E C   1 
ATOM   6925  O O   . GLN E  1 6   ? 59.615  -10.695  34.075  1.00 64.12  ? 6    GLN E O   1 
ATOM   6926  C CB  . GLN E  1 6   ? 62.260  -12.201  33.494  1.00 70.98  ? 6    GLN E CB  1 
ATOM   6927  N N   . ASN E  1 7   ? 60.693  -9.361   32.622  1.00 65.14  ? 7    ASN E N   1 
ATOM   6928  C CA  . ASN E  1 7   ? 60.031  -8.145   33.078  1.00 63.99  ? 7    ASN E CA  1 
ATOM   6929  C C   . ASN E  1 7   ? 59.483  -7.327   31.915  1.00 61.86  ? 7    ASN E C   1 
ATOM   6930  O O   . ASN E  1 7   ? 59.357  -6.106   32.009  1.00 65.20  ? 7    ASN E O   1 
ATOM   6931  C CB  . ASN E  1 7   ? 60.990  -7.292   33.910  1.00 66.87  ? 7    ASN E CB  1 
ATOM   6932  C CG  . ASN E  1 7   ? 61.182  -7.831   35.315  1.00 71.19  ? 7    ASN E CG  1 
ATOM   6933  O OD1 . ASN E  1 7   ? 60.243  -8.334   35.932  1.00 74.28  ? 7    ASN E OD1 1 
ATOM   6934  N ND2 . ASN E  1 7   ? 62.402  -7.725   35.828  1.00 72.38  ? 7    ASN E ND2 1 
ATOM   6935  N N   . ARG E  1 8   ? 59.159  -8.007   30.820  1.00 57.57  ? 8    ARG E N   1 
ATOM   6936  C CA  . ARG E  1 8   ? 58.621  -7.344   29.639  1.00 56.50  ? 8    ARG E CA  1 
ATOM   6937  C C   . ARG E  1 8   ? 57.237  -6.770   29.927  1.00 51.38  ? 8    ARG E C   1 
ATOM   6938  O O   . ARG E  1 8   ? 56.846  -5.749   29.361  1.00 50.55  ? 8    ARG E O   1 
ATOM   6939  C CB  . ARG E  1 8   ? 58.562  -8.315   28.456  1.00 54.20  ? 8    ARG E CB  1 
ATOM   6940  C CG  . ARG E  1 8   ? 58.103  -7.674   27.155  1.00 54.27  ? 8    ARG E CG  1 
ATOM   6941  C CD  . ARG E  1 8   ? 58.382  -8.561   25.952  1.00 52.62  ? 8    ARG E CD  1 
ATOM   6942  N NE  . ARG E  1 8   ? 57.578  -9.780   25.952  1.00 47.67  ? 8    ARG E NE  1 
ATOM   6943  C CZ  . ARG E  1 8   ? 57.477  -10.604  24.913  1.00 42.69  ? 8    ARG E CZ  1 
ATOM   6944  N NH1 . ARG E  1 8   ? 58.125  -10.337  23.786  1.00 40.05  ? 8    ARG E NH1 1 
ATOM   6945  N NH2 . ARG E  1 8   ? 56.725  -11.692  24.996  1.00 40.50  ? 8    ARG E NH2 1 
ATOM   6946  N N   . LEU E  1 9   ? 56.506  -7.428   30.820  1.00 47.71  ? 9    LEU E N   1 
ATOM   6947  C CA  . LEU E  1 9   ? 55.166  -6.991   31.189  1.00 48.32  ? 9    LEU E CA  1 
ATOM   6948  C C   . LEU E  1 9   ? 55.078  -6.688   32.681  1.00 51.39  ? 9    LEU E C   1 
ATOM   6949  O O   . LEU E  1 9   ? 54.041  -6.908   33.303  1.00 53.48  ? 9    LEU E O   1 
ATOM   6950  C CB  . LEU E  1 9   ? 54.137  -8.055   30.810  1.00 48.97  ? 9    LEU E CB  1 
ATOM   6951  C CG  . LEU E  1 9   ? 54.106  -8.455   29.334  1.00 49.49  ? 9    LEU E CG  1 
ATOM   6952  C CD1 . LEU E  1 9   ? 53.193  -9.649   29.122  1.00 46.51  ? 9    LEU E CD1 1 
ATOM   6953  C CD2 . LEU E  1 9   ? 53.662  -7.282   28.479  1.00 50.07  ? 9    LEU E CD2 1 
ATOM   6954  N N   . ARG E  1 10  ? 56.167  -6.173   33.243  1.00 52.17  ? 10   ARG E N   1 
ATOM   6955  C CA  . ARG E  1 10  ? 56.265  -5.934   34.681  1.00 55.71  ? 10   ARG E CA  1 
ATOM   6956  C C   . ARG E  1 10  ? 55.210  -4.961   35.207  1.00 56.28  ? 10   ARG E C   1 
ATOM   6957  O O   . ARG E  1 10  ? 54.869  -4.987   36.389  1.00 60.72  ? 10   ARG E O   1 
ATOM   6958  C CB  . ARG E  1 10  ? 57.661  -5.413   35.032  1.00 55.22  ? 10   ARG E CB  1 
ATOM   6959  N N   . SER E  1 11  ? 54.693  -4.111   34.327  1.00 59.59  ? 11   SER E N   1 
ATOM   6960  C CA  . SER E  1 11  ? 53.730  -3.089   34.723  1.00 65.58  ? 11   SER E CA  1 
ATOM   6961  C C   . SER E  1 11  ? 52.282  -3.508   34.475  1.00 64.02  ? 11   SER E C   1 
ATOM   6962  O O   . SER E  1 11  ? 51.379  -3.118   35.216  1.00 66.27  ? 11   SER E O   1 
ATOM   6963  C CB  . SER E  1 11  ? 54.017  -1.783   33.979  1.00 68.89  ? 11   SER E CB  1 
ATOM   6964  O OG  . SER E  1 11  ? 52.940  -0.871   34.112  1.00 71.13  ? 11   SER E OG  1 
ATOM   6965  N N   . ALA E  1 12  ? 52.075  -4.308   33.435  1.00 58.67  ? 12   ALA E N   1 
ATOM   6966  C CA  . ALA E  1 12  ? 50.736  -4.605   32.933  1.00 49.87  ? 12   ALA E CA  1 
ATOM   6967  C C   . ALA E  1 12  ? 49.843  -5.355   33.919  1.00 47.45  ? 12   ALA E C   1 
ATOM   6968  O O   . ALA E  1 12  ? 50.311  -6.170   34.715  1.00 47.31  ? 12   ALA E O   1 
ATOM   6969  C CB  . ALA E  1 12  ? 50.839  -5.394   31.636  1.00 46.02  ? 12   ALA E CB  1 
ATOM   6970  N N   . LEU E  1 13  ? 48.549  -5.055   33.853  1.00 42.75  ? 13   LEU E N   1 
ATOM   6971  C CA  . LEU E  1 13  ? 47.522  -5.830   34.539  1.00 41.64  ? 13   LEU E CA  1 
ATOM   6972  C C   . LEU E  1 13  ? 46.731  -6.610   33.494  1.00 40.59  ? 13   LEU E C   1 
ATOM   6973  O O   . LEU E  1 13  ? 46.120  -6.019   32.604  1.00 40.99  ? 13   LEU E O   1 
ATOM   6974  C CB  . LEU E  1 13  ? 46.597  -4.923   35.352  1.00 37.61  ? 13   LEU E CB  1 
ATOM   6975  C CG  . LEU E  1 13  ? 45.318  -5.567   35.893  1.00 38.58  ? 13   LEU E CG  1 
ATOM   6976  C CD1 . LEU E  1 13  ? 45.642  -6.703   36.852  1.00 43.41  ? 13   LEU E CD1 1 
ATOM   6977  C CD2 . LEU E  1 13  ? 44.431  -4.528   36.565  1.00 34.64  ? 13   LEU E CD2 1 
ATOM   6978  N N   . ALA E  1 14  ? 46.746  -7.934   33.601  1.00 37.05  ? 14   ALA E N   1 
ATOM   6979  C CA  . ALA E  1 14  ? 46.184  -8.778   32.553  1.00 37.78  ? 14   ALA E CA  1 
ATOM   6980  C C   . ALA E  1 14  ? 44.889  -9.472   32.964  1.00 40.39  ? 14   ALA E C   1 
ATOM   6981  O O   . ALA E  1 14  ? 44.853  -10.213  33.945  1.00 47.69  ? 14   ALA E O   1 
ATOM   6982  C CB  . ALA E  1 14  ? 47.208  -9.812   32.118  1.00 40.11  ? 14   ALA E CB  1 
ATOM   6983  N N   . LEU E  1 15  ? 43.829  -9.226   32.200  1.00 38.33  ? 15   LEU E N   1 
ATOM   6984  C CA  . LEU E  1 15  ? 42.579  -9.956   32.364  1.00 35.89  ? 15   LEU E CA  1 
ATOM   6985  C C   . LEU E  1 15  ? 42.515  -11.088  31.348  1.00 33.45  ? 15   LEU E C   1 
ATOM   6986  O O   . LEU E  1 15  ? 42.531  -10.849  30.141  1.00 30.64  ? 15   LEU E O   1 
ATOM   6987  C CB  . LEU E  1 15  ? 41.374  -9.027   32.202  1.00 40.64  ? 15   LEU E CB  1 
ATOM   6988  C CG  . LEU E  1 15  ? 40.004  -9.705   32.092  1.00 42.38  ? 15   LEU E CG  1 
ATOM   6989  C CD1 . LEU E  1 15  ? 39.693  -10.525  33.337  1.00 44.62  ? 15   LEU E CD1 1 
ATOM   6990  C CD2 . LEU E  1 15  ? 38.910  -8.678   31.838  1.00 40.69  ? 15   LEU E CD2 1 
ATOM   6991  N N   . VAL E  1 16  ? 42.451  -12.322  31.837  1.00 35.88  ? 16   VAL E N   1 
ATOM   6992  C CA  . VAL E  1 16  ? 42.418  -13.483  30.956  1.00 36.57  ? 16   VAL E CA  1 
ATOM   6993  C C   . VAL E  1 16  ? 41.171  -14.326  31.197  1.00 36.16  ? 16   VAL E C   1 
ATOM   6994  O O   . VAL E  1 16  ? 41.064  -15.011  32.214  1.00 34.61  ? 16   VAL E O   1 
ATOM   6995  C CB  . VAL E  1 16  ? 43.666  -14.368  31.141  1.00 39.88  ? 16   VAL E CB  1 
ATOM   6996  C CG1 . VAL E  1 16  ? 43.643  -15.528  30.157  1.00 42.70  ? 16   VAL E CG1 1 
ATOM   6997  C CG2 . VAL E  1 16  ? 44.932  -13.546  30.965  1.00 40.04  ? 16   VAL E CG2 1 
ATOM   6998  N N   . THR E  1 17  ? 40.229  -14.271  30.260  1.00 34.32  ? 17   THR E N   1 
ATOM   6999  C CA  . THR E  1 17  ? 39.012  -15.068  30.360  1.00 35.98  ? 17   THR E CA  1 
ATOM   7000  C C   . THR E  1 17  ? 39.287  -16.495  29.901  1.00 36.53  ? 17   THR E C   1 
ATOM   7001  O O   . THR E  1 17  ? 40.072  -16.714  28.980  1.00 37.91  ? 17   THR E O   1 
ATOM   7002  C CB  . THR E  1 17  ? 37.861  -14.473  29.523  1.00 29.92  ? 17   THR E CB  1 
ATOM   7003  O OG1 . THR E  1 17  ? 38.028  -14.829  28.145  1.00 30.33  ? 17   THR E OG1 1 
ATOM   7004  C CG2 . THR E  1 17  ? 37.826  -12.958  29.658  1.00 26.39  ? 17   THR E CG2 1 
ATOM   7005  N N   . GLY E  1 18  ? 38.641  -17.461  30.545  1.00 34.84  ? 18   GLY E N   1 
ATOM   7006  C CA  . GLY E  1 18  ? 38.862  -18.860  30.233  1.00 31.81  ? 18   GLY E CA  1 
ATOM   7007  C C   . GLY E  1 18  ? 40.250  -19.304  30.651  1.00 29.61  ? 18   GLY E C   1 
ATOM   7008  O O   . GLY E  1 18  ? 40.845  -20.190  30.037  1.00 30.74  ? 18   GLY E O   1 
ATOM   7009  N N   . ALA E  1 19  ? 40.764  -18.682  31.708  1.00 27.70  ? 19   ALA E N   1 
ATOM   7010  C CA  . ALA E  1 19  ? 42.117  -18.947  32.180  1.00 29.88  ? 19   ALA E CA  1 
ATOM   7011  C C   . ALA E  1 19  ? 42.189  -20.201  33.043  1.00 27.51  ? 19   ALA E C   1 
ATOM   7012  O O   . ALA E  1 19  ? 43.248  -20.540  33.571  1.00 31.93  ? 19   ALA E O   1 
ATOM   7013  C CB  . ALA E  1 19  ? 42.643  -17.750  32.954  1.00 23.58  ? 19   ALA E CB  1 
ATOM   7014  N N   . GLY E  1 20  ? 41.063  -20.890  33.182  1.00 30.36  ? 20   GLY E N   1 
ATOM   7015  C CA  . GLY E  1 20  ? 40.988  -22.052  34.047  1.00 32.49  ? 20   GLY E CA  1 
ATOM   7016  C C   . GLY E  1 20  ? 41.509  -23.334  33.427  1.00 34.56  ? 20   GLY E C   1 
ATOM   7017  O O   . GLY E  1 20  ? 41.672  -24.337  34.121  1.00 40.14  ? 20   GLY E O   1 
ATOM   7018  N N   . SER E  1 21  ? 41.777  -23.307  32.125  1.00 35.47  ? 21   SER E N   1 
ATOM   7019  C CA  . SER E  1 21  ? 42.208  -24.511  31.423  1.00 36.83  ? 21   SER E CA  1 
ATOM   7020  C C   . SER E  1 21  ? 42.811  -24.216  30.055  1.00 40.38  ? 21   SER E C   1 
ATOM   7021  O O   . SER E  1 21  ? 42.564  -23.162  29.470  1.00 42.66  ? 21   SER E O   1 
ATOM   7022  C CB  . SER E  1 21  ? 41.031  -25.477  31.261  1.00 36.86  ? 21   SER E CB  1 
ATOM   7023  O OG  . SER E  1 21  ? 41.412  -26.630  30.532  1.00 37.42  ? 21   SER E OG  1 
ATOM   7024  N N   . GLY E  1 22  ? 43.601  -25.163  29.559  1.00 46.71  ? 22   GLY E N   1 
ATOM   7025  C CA  . GLY E  1 22  ? 44.139  -25.111  28.211  1.00 44.84  ? 22   GLY E CA  1 
ATOM   7026  C C   . GLY E  1 22  ? 44.967  -23.885  27.881  1.00 46.82  ? 22   GLY E C   1 
ATOM   7027  O O   . GLY E  1 22  ? 45.939  -23.570  28.568  1.00 50.27  ? 22   GLY E O   1 
ATOM   7028  N N   . ILE E  1 23  ? 44.574  -23.195  26.815  1.00 47.33  ? 23   ILE E N   1 
ATOM   7029  C CA  . ILE E  1 23  ? 45.297  -22.024  26.334  1.00 43.32  ? 23   ILE E CA  1 
ATOM   7030  C C   . ILE E  1 23  ? 45.239  -20.875  27.335  1.00 37.44  ? 23   ILE E C   1 
ATOM   7031  O O   . ILE E  1 23  ? 46.253  -20.231  27.610  1.00 36.62  ? 23   ILE E O   1 
ATOM   7032  C CB  . ILE E  1 23  ? 44.742  -21.549  24.975  1.00 41.16  ? 23   ILE E CB  1 
ATOM   7033  C CG1 . ILE E  1 23  ? 44.895  -22.653  23.927  1.00 36.73  ? 23   ILE E CG1 1 
ATOM   7034  C CG2 . ILE E  1 23  ? 45.441  -20.277  24.521  1.00 39.63  ? 23   ILE E CG2 1 
ATOM   7035  C CD1 . ILE E  1 23  ? 44.364  -22.281  22.561  1.00 33.51  ? 23   ILE E CD1 1 
ATOM   7036  N N   . GLY E  1 24  ? 44.051  -20.629  27.881  1.00 38.38  ? 24   GLY E N   1 
ATOM   7037  C CA  . GLY E  1 24  ? 43.855  -19.566  28.851  1.00 35.61  ? 24   GLY E CA  1 
ATOM   7038  C C   . GLY E  1 24  ? 44.740  -19.704  30.075  1.00 38.68  ? 24   GLY E C   1 
ATOM   7039  O O   . GLY E  1 24  ? 45.241  -18.712  30.606  1.00 38.91  ? 24   GLY E O   1 
ATOM   7040  N N   . ARG E  1 25  ? 44.931  -20.940  30.527  1.00 38.09  ? 25   ARG E N   1 
ATOM   7041  C CA  . ARG E  1 25  ? 45.798  -21.210  31.666  1.00 35.30  ? 25   ARG E CA  1 
ATOM   7042  C C   . ARG E  1 25  ? 47.261  -20.972  31.303  1.00 38.21  ? 25   ARG E C   1 
ATOM   7043  O O   . ARG E  1 25  ? 48.016  -20.390  32.081  1.00 36.43  ? 25   ARG E O   1 
ATOM   7044  C CB  . ARG E  1 25  ? 45.599  -22.643  32.164  1.00 33.76  ? 25   ARG E CB  1 
ATOM   7045  C CG  . ARG E  1 25  ? 46.636  -23.101  33.176  1.00 35.51  ? 25   ARG E CG  1 
ATOM   7046  C CD  . ARG E  1 25  ? 46.202  -24.379  33.873  1.00 40.38  ? 25   ARG E CD  1 
ATOM   7047  N NE  . ARG E  1 25  ? 45.070  -24.148  34.765  1.00 43.41  ? 25   ARG E NE  1 
ATOM   7048  C CZ  . ARG E  1 25  ? 44.475  -25.097  35.481  1.00 42.89  ? 25   ARG E CZ  1 
ATOM   7049  N NH1 . ARG E  1 25  ? 44.902  -26.351  35.410  1.00 47.99  ? 25   ARG E NH1 1 
ATOM   7050  N NH2 . ARG E  1 25  ? 43.451  -24.793  36.266  1.00 36.81  ? 25   ARG E NH2 1 
ATOM   7051  N N   . ALA E  1 26  ? 47.649  -21.421  30.113  1.00 36.07  ? 26   ALA E N   1 
ATOM   7052  C CA  . ALA E  1 26  ? 49.013  -21.248  29.629  1.00 30.65  ? 26   ALA E CA  1 
ATOM   7053  C C   . ALA E  1 26  ? 49.342  -19.773  29.434  1.00 30.22  ? 26   ALA E C   1 
ATOM   7054  O O   . ALA E  1 26  ? 50.454  -19.332  29.727  1.00 35.54  ? 26   ALA E O   1 
ATOM   7055  C CB  . ALA E  1 26  ? 49.216  -22.009  28.334  1.00 25.35  ? 26   ALA E CB  1 
ATOM   7056  N N   . VAL E  1 27  ? 48.369  -19.020  28.930  1.00 30.23  ? 27   VAL E N   1 
ATOM   7057  C CA  . VAL E  1 27  ? 48.518  -17.579  28.758  1.00 31.11  ? 27   VAL E CA  1 
ATOM   7058  C C   . VAL E  1 27  ? 48.799  -16.908  30.097  1.00 31.39  ? 27   VAL E C   1 
ATOM   7059  O O   . VAL E  1 27  ? 49.711  -16.090  30.212  1.00 36.61  ? 27   VAL E O   1 
ATOM   7060  C CB  . VAL E  1 27  ? 47.260  -16.953  28.117  1.00 32.34  ? 27   VAL E CB  1 
ATOM   7061  C CG1 . VAL E  1 27  ? 47.236  -15.447  28.330  1.00 34.46  ? 27   VAL E CG1 1 
ATOM   7062  C CG2 . VAL E  1 27  ? 47.193  -17.292  26.634  1.00 34.36  ? 27   VAL E CG2 1 
ATOM   7063  N N   . SER E  1 28  ? 48.019  -17.277  31.109  1.00 33.99  ? 28   SER E N   1 
ATOM   7064  C CA  . SER E  1 28  ? 48.173  -16.725  32.451  1.00 31.34  ? 28   SER E CA  1 
ATOM   7065  C C   . SER E  1 28  ? 49.563  -16.997  33.019  1.00 32.30  ? 28   SER E C   1 
ATOM   7066  O O   . SER E  1 28  ? 50.143  -16.148  33.695  1.00 34.26  ? 28   SER E O   1 
ATOM   7067  C CB  . SER E  1 28  ? 47.106  -17.297  33.385  1.00 30.63  ? 28   SER E CB  1 
ATOM   7068  O OG  . SER E  1 28  ? 45.807  -17.057  32.876  1.00 27.90  ? 28   SER E OG  1 
ATOM   7069  N N   . VAL E  1 29  ? 50.093  -18.183  32.739  1.00 32.51  ? 29   VAL E N   1 
ATOM   7070  C CA  . VAL E  1 29  ? 51.423  -18.561  33.205  1.00 34.87  ? 29   VAL E CA  1 
ATOM   7071  C C   . VAL E  1 29  ? 52.502  -17.713  32.536  1.00 40.70  ? 29   VAL E C   1 
ATOM   7072  O O   . VAL E  1 29  ? 53.410  -17.210  33.199  1.00 43.62  ? 29   VAL E O   1 
ATOM   7073  C CB  . VAL E  1 29  ? 51.710  -20.054  32.940  1.00 32.66  ? 29   VAL E CB  1 
ATOM   7074  C CG1 . VAL E  1 29  ? 53.154  -20.392  33.278  1.00 33.26  ? 29   VAL E CG1 1 
ATOM   7075  C CG2 . VAL E  1 29  ? 50.754  -20.928  33.737  1.00 30.04  ? 29   VAL E CG2 1 
ATOM   7076  N N   . ARG E  1 30  ? 52.389  -17.553  31.220  1.00 37.81  ? 30   ARG E N   1 
ATOM   7077  C CA  . ARG E  1 30  ? 53.379  -16.812  30.446  1.00 35.56  ? 30   ARG E CA  1 
ATOM   7078  C C   . ARG E  1 30  ? 53.370  -15.322  30.778  1.00 39.41  ? 30   ARG E C   1 
ATOM   7079  O O   . ARG E  1 30  ? 54.427  -14.708  30.924  1.00 43.68  ? 30   ARG E O   1 
ATOM   7080  C CB  . ARG E  1 30  ? 53.142  -17.009  28.947  1.00 37.74  ? 30   ARG E CB  1 
ATOM   7081  C CG  . ARG E  1 30  ? 54.137  -16.275  28.065  1.00 40.70  ? 30   ARG E CG  1 
ATOM   7082  C CD  . ARG E  1 30  ? 55.557  -16.750  28.327  1.00 46.10  ? 30   ARG E CD  1 
ATOM   7083  N NE  . ARG E  1 30  ? 56.544  -15.921  27.642  1.00 51.50  ? 30   ARG E NE  1 
ATOM   7084  C CZ  . ARG E  1 30  ? 56.962  -16.130  26.398  1.00 52.00  ? 30   ARG E CZ  1 
ATOM   7085  N NH1 . ARG E  1 30  ? 56.477  -17.146  25.697  1.00 52.41  ? 30   ARG E NH1 1 
ATOM   7086  N NH2 . ARG E  1 30  ? 57.863  -15.323  25.856  1.00 52.36  ? 30   ARG E NH2 1 
ATOM   7087  N N   . LEU E  1 31  ? 52.176  -14.746  30.891  1.00 38.85  ? 31   LEU E N   1 
ATOM   7088  C CA  . LEU E  1 31  ? 52.042  -13.329  31.213  1.00 36.98  ? 31   LEU E CA  1 
ATOM   7089  C C   . LEU E  1 31  ? 52.597  -13.035  32.602  1.00 38.87  ? 31   LEU E C   1 
ATOM   7090  O O   . LEU E  1 31  ? 53.304  -12.048  32.801  1.00 44.54  ? 31   LEU E O   1 
ATOM   7091  C CB  . LEU E  1 31  ? 50.579  -12.886  31.125  1.00 32.74  ? 31   LEU E CB  1 
ATOM   7092  C CG  . LEU E  1 31  ? 49.897  -12.973  29.757  1.00 31.68  ? 31   LEU E CG  1 
ATOM   7093  C CD1 . LEU E  1 31  ? 48.503  -12.369  29.812  1.00 24.17  ? 31   LEU E CD1 1 
ATOM   7094  C CD2 . LEU E  1 31  ? 50.734  -12.302  28.679  1.00 34.67  ? 31   LEU E CD2 1 
ATOM   7095  N N   . ALA E  1 32  ? 52.278  -13.902  33.558  1.00 32.67  ? 32   ALA E N   1 
ATOM   7096  C CA  . ALA E  1 32  ? 52.788  -13.765  34.916  1.00 30.73  ? 32   ALA E CA  1 
ATOM   7097  C C   . ALA E  1 32  ? 54.282  -14.057  34.959  1.00 31.15  ? 32   ALA E C   1 
ATOM   7098  O O   . ALA E  1 32  ? 54.992  -13.589  35.849  1.00 32.92  ? 32   ALA E O   1 
ATOM   7099  C CB  . ALA E  1 32  ? 52.039  -14.685  35.865  1.00 27.34  ? 32   ALA E CB  1 
ATOM   7100  N N   . GLY E  1 33  ? 54.754  -14.832  33.988  1.00 33.71  ? 33   GLY E N   1 
ATOM   7101  C CA  . GLY E  1 33  ? 56.163  -15.164  33.892  1.00 34.81  ? 33   GLY E CA  1 
ATOM   7102  C C   . GLY E  1 33  ? 56.975  -14.031  33.298  1.00 35.35  ? 33   GLY E C   1 
ATOM   7103  O O   . GLY E  1 33  ? 58.195  -14.129  33.166  1.00 39.31  ? 33   GLY E O   1 
ATOM   7104  N N   . GLU E  1 34  ? 56.293  -12.949  32.938  1.00 35.66  ? 34   GLU E N   1 
ATOM   7105  C CA  . GLU E  1 34  ? 56.956  -11.788  32.363  1.00 41.53  ? 34   GLU E CA  1 
ATOM   7106  C C   . GLU E  1 34  ? 56.684  -10.536  33.191  1.00 39.83  ? 34   GLU E C   1 
ATOM   7107  O O   . GLU E  1 34  ? 56.866  -9.414   32.720  1.00 39.60  ? 34   GLU E O   1 
ATOM   7108  C CB  . GLU E  1 34  ? 56.516  -11.588  30.912  1.00 44.67  ? 34   GLU E CB  1 
ATOM   7109  C CG  . GLU E  1 34  ? 56.879  -12.759  30.007  1.00 51.14  ? 34   GLU E CG  1 
ATOM   7110  C CD  . GLU E  1 34  ? 56.926  -12.379  28.540  1.00 59.90  ? 34   GLU E CD  1 
ATOM   7111  O OE1 . GLU E  1 34  ? 56.776  -11.179  28.230  1.00 60.04  ? 34   GLU E OE1 1 
ATOM   7112  O OE2 . GLU E  1 34  ? 57.116  -13.282  27.697  1.00 63.47  ? 34   GLU E OE2 1 
ATOM   7113  N N   . GLY E  1 35  ? 56.247  -10.742  34.430  1.00 40.93  ? 35   GLY E N   1 
ATOM   7114  C CA  . GLY E  1 35  ? 56.112  -9.657   35.386  1.00 43.77  ? 35   GLY E CA  1 
ATOM   7115  C C   . GLY E  1 35  ? 54.713  -9.094   35.544  1.00 37.38  ? 35   GLY E C   1 
ATOM   7116  O O   . GLY E  1 35  ? 54.500  -8.170   36.329  1.00 39.40  ? 35   GLY E O   1 
ATOM   7117  N N   . ALA E  1 36  ? 53.755  -9.647   34.808  1.00 34.41  ? 36   ALA E N   1 
ATOM   7118  C CA  . ALA E  1 36  ? 52.389  -9.135   34.840  1.00 41.58  ? 36   ALA E CA  1 
ATOM   7119  C C   . ALA E  1 36  ? 51.546  -9.806   35.919  1.00 40.58  ? 36   ALA E C   1 
ATOM   7120  O O   . ALA E  1 36  ? 51.718  -10.989  36.214  1.00 41.94  ? 36   ALA E O   1 
ATOM   7121  C CB  . ALA E  1 36  ? 51.732  -9.305   33.479  1.00 31.58  ? 36   ALA E CB  1 
ATOM   7122  N N   . THR E  1 37  ? 50.637  -9.038   36.510  1.00 40.99  ? 37   THR E N   1 
ATOM   7123  C CA  . THR E  1 37  ? 49.671  -9.582   37.455  1.00 41.89  ? 37   THR E CA  1 
ATOM   7124  C C   . THR E  1 37  ? 48.413  -9.995   36.700  1.00 37.59  ? 37   THR E C   1 
ATOM   7125  O O   . THR E  1 37  ? 47.764  -9.168   36.059  1.00 35.98  ? 37   THR E O   1 
ATOM   7126  C CB  . THR E  1 37  ? 49.310  -8.570   38.556  1.00 46.05  ? 37   THR E CB  1 
ATOM   7127  O OG1 . THR E  1 37  ? 48.738  -7.399   37.963  1.00 51.73  ? 37   THR E OG1 1 
ATOM   7128  C CG2 . THR E  1 37  ? 50.550  -8.179   39.345  1.00 44.44  ? 37   THR E CG2 1 
ATOM   7129  N N   . VAL E  1 38  ? 48.075  -11.278  36.777  1.00 37.64  ? 38   VAL E N   1 
ATOM   7130  C CA  . VAL E  1 38  ? 46.991  -11.832  35.976  1.00 37.60  ? 38   VAL E CA  1 
ATOM   7131  C C   . VAL E  1 38  ? 45.683  -11.966  36.750  1.00 36.88  ? 38   VAL E C   1 
ATOM   7132  O O   . VAL E  1 38  ? 45.638  -12.579  37.816  1.00 36.50  ? 38   VAL E O   1 
ATOM   7133  C CB  . VAL E  1 38  ? 47.372  -13.217  35.415  1.00 41.36  ? 38   VAL E CB  1 
ATOM   7134  C CG1 . VAL E  1 38  ? 46.237  -13.784  34.575  1.00 41.33  ? 38   VAL E CG1 1 
ATOM   7135  C CG2 . VAL E  1 38  ? 48.650  -13.122  34.598  1.00 43.83  ? 38   VAL E CG2 1 
ATOM   7136  N N   . ALA E  1 39  ? 44.621  -11.381  36.204  1.00 36.89  ? 39   ALA E N   1 
ATOM   7137  C CA  . ALA E  1 39  ? 43.277  -11.580  36.729  1.00 34.35  ? 39   ALA E CA  1 
ATOM   7138  C C   . ALA E  1 39  ? 42.625  -12.749  36.002  1.00 36.34  ? 39   ALA E C   1 
ATOM   7139  O O   . ALA E  1 39  ? 42.114  -12.595  34.893  1.00 42.72  ? 39   ALA E O   1 
ATOM   7140  C CB  . ALA E  1 39  ? 42.445  -10.316  36.577  1.00 29.73  ? 39   ALA E CB  1 
ATOM   7141  N N   . ALA E  1 40  ? 42.655  -13.921  36.628  1.00 36.84  ? 40   ALA E N   1 
ATOM   7142  C CA  . ALA E  1 40  ? 42.168  -15.140  35.994  1.00 34.15  ? 40   ALA E CA  1 
ATOM   7143  C C   . ALA E  1 40  ? 40.648  -15.240  36.050  1.00 39.12  ? 40   ALA E C   1 
ATOM   7144  O O   . ALA E  1 40  ? 40.067  -15.458  37.113  1.00 43.33  ? 40   ALA E O   1 
ATOM   7145  C CB  . ALA E  1 40  ? 42.801  -16.361  36.644  1.00 33.95  ? 40   ALA E CB  1 
ATOM   7146  N N   . CYS E  1 41  ? 40.011  -15.080  34.895  1.00 36.66  ? 41   CYS E N   1 
ATOM   7147  C CA  . CYS E  1 41  ? 38.565  -15.217  34.795  1.00 31.36  ? 41   CYS E CA  1 
ATOM   7148  C C   . CYS E  1 41  ? 38.188  -16.529  34.120  1.00 31.35  ? 41   CYS E C   1 
ATOM   7149  O O   . CYS E  1 41  ? 38.794  -16.923  33.124  1.00 34.19  ? 41   CYS E O   1 
ATOM   7150  C CB  . CYS E  1 41  ? 37.960  -14.043  34.025  1.00 26.98  ? 41   CYS E CB  1 
ATOM   7151  S SG  . CYS E  1 41  ? 36.183  -14.202  33.736  1.00 62.14  ? 41   CYS E SG  1 
ATOM   7152  N N   . ASP E  1 42  ? 37.181  -17.201  34.667  1.00 34.19  ? 42   ASP E N   1 
ATOM   7153  C CA  . ASP E  1 42  ? 36.722  -18.468  34.115  1.00 34.42  ? 42   ASP E CA  1 
ATOM   7154  C C   . ASP E  1 42  ? 35.311  -18.785  34.596  1.00 38.53  ? 42   ASP E C   1 
ATOM   7155  O O   . ASP E  1 42  ? 34.911  -18.376  35.686  1.00 39.79  ? 42   ASP E O   1 
ATOM   7156  C CB  . ASP E  1 42  ? 37.680  -19.597  34.500  1.00 33.92  ? 42   ASP E CB  1 
ATOM   7157  C CG  . ASP E  1 42  ? 37.480  -20.842  33.662  1.00 38.11  ? 42   ASP E CG  1 
ATOM   7158  O OD1 . ASP E  1 42  ? 36.605  -21.662  34.010  1.00 43.22  ? 42   ASP E OD1 1 
ATOM   7159  O OD2 . ASP E  1 42  ? 38.199  -21.002  32.654  1.00 39.76  ? 42   ASP E OD2 1 
ATOM   7160  N N   . LEU E  1 43  ? 34.558  -19.510  33.774  1.00 39.47  ? 43   LEU E N   1 
ATOM   7161  C CA  . LEU E  1 43  ? 33.207  -19.921  34.138  1.00 44.99  ? 43   LEU E CA  1 
ATOM   7162  C C   . LEU E  1 43  ? 33.256  -20.887  35.317  1.00 50.93  ? 43   LEU E C   1 
ATOM   7163  O O   . LEU E  1 43  ? 32.400  -20.852  36.201  1.00 52.67  ? 43   LEU E O   1 
ATOM   7164  C CB  . LEU E  1 43  ? 32.498  -20.561  32.944  1.00 40.49  ? 43   LEU E CB  1 
ATOM   7165  C CG  . LEU E  1 43  ? 31.024  -20.924  33.125  1.00 41.45  ? 43   LEU E CG  1 
ATOM   7166  C CD1 . LEU E  1 43  ? 30.244  -19.739  33.664  1.00 43.01  ? 43   LEU E CD1 1 
ATOM   7167  C CD2 . LEU E  1 43  ? 30.438  -21.389  31.806  1.00 42.70  ? 43   LEU E CD2 1 
ATOM   7168  N N   . ASP E  1 44  ? 34.269  -21.748  35.322  1.00 50.08  ? 44   ASP E N   1 
ATOM   7169  C CA  . ASP E  1 44  ? 34.520  -22.628  36.454  1.00 51.45  ? 44   ASP E CA  1 
ATOM   7170  C C   . ASP E  1 44  ? 35.359  -21.887  37.487  1.00 49.74  ? 44   ASP E C   1 
ATOM   7171  O O   . ASP E  1 44  ? 36.526  -21.579  37.243  1.00 47.95  ? 44   ASP E O   1 
ATOM   7172  C CB  . ASP E  1 44  ? 35.231  -23.907  36.004  1.00 54.18  ? 44   ASP E CB  1 
ATOM   7173  C CG  . ASP E  1 44  ? 35.203  -24.998  37.062  1.00 65.76  ? 44   ASP E CG  1 
ATOM   7174  O OD1 . ASP E  1 44  ? 34.815  -24.713  38.214  1.00 74.43  ? 44   ASP E OD1 1 
ATOM   7175  O OD2 . ASP E  1 44  ? 35.577  -26.146  36.739  1.00 67.30  ? 44   ASP E OD2 1 
ATOM   7176  N N   . ARG E  1 45  ? 34.760  -21.594  38.637  1.00 53.33  ? 45   ARG E N   1 
ATOM   7177  C CA  . ARG E  1 45  ? 35.453  -20.869  39.694  1.00 53.94  ? 45   ARG E CA  1 
ATOM   7178  C C   . ARG E  1 45  ? 36.625  -21.678  40.240  1.00 48.21  ? 45   ARG E C   1 
ATOM   7179  O O   . ARG E  1 45  ? 37.690  -21.131  40.522  1.00 43.59  ? 45   ARG E O   1 
ATOM   7180  C CB  . ARG E  1 45  ? 34.486  -20.512  40.824  1.00 66.06  ? 45   ARG E CB  1 
ATOM   7181  C CG  . ARG E  1 45  ? 35.122  -19.720  41.956  1.00 75.28  ? 45   ARG E CG  1 
ATOM   7182  C CD  . ARG E  1 45  ? 34.116  -19.407  43.052  1.00 88.39  ? 45   ARG E CD  1 
ATOM   7183  N NE  . ARG E  1 45  ? 33.014  -18.580  42.569  1.00 94.98  ? 45   ARG E NE  1 
ATOM   7184  C CZ  . ARG E  1 45  ? 33.024  -17.251  42.560  1.00 97.33  ? 45   ARG E CZ  1 
ATOM   7185  N NH1 . ARG E  1 45  ? 34.083  -16.591  43.009  1.00 98.09  ? 45   ARG E NH1 1 
ATOM   7186  N NH2 . ARG E  1 45  ? 31.975  -16.581  42.102  1.00 97.92  ? 45   ARG E NH2 1 
ATOM   7187  N N   . ALA E  1 46  ? 36.421  -22.985  40.376  1.00 49.71  ? 46   ALA E N   1 
ATOM   7188  C CA  . ALA E  1 46  ? 37.451  -23.877  40.899  1.00 50.21  ? 46   ALA E CA  1 
ATOM   7189  C C   . ALA E  1 46  ? 38.659  -23.947  39.969  1.00 46.39  ? 46   ALA E C   1 
ATOM   7190  O O   . ALA E  1 46  ? 39.801  -24.014  40.425  1.00 45.34  ? 46   ALA E O   1 
ATOM   7191  C CB  . ALA E  1 46  ? 36.878  -25.268  41.125  1.00 54.26  ? 46   ALA E CB  1 
ATOM   7192  N N   . ALA E  1 47  ? 38.401  -23.933  38.665  1.00 41.61  ? 47   ALA E N   1 
ATOM   7193  C CA  . ALA E  1 47  ? 39.470  -23.978  37.674  1.00 40.79  ? 47   ALA E CA  1 
ATOM   7194  C C   . ALA E  1 47  ? 40.223  -22.653  37.628  1.00 40.32  ? 47   ALA E C   1 
ATOM   7195  O O   . ALA E  1 47  ? 41.418  -22.618  37.336  1.00 43.72  ? 47   ALA E O   1 
ATOM   7196  C CB  . ALA E  1 47  ? 38.910  -24.318  36.302  1.00 34.30  ? 47   ALA E CB  1 
ATOM   7197  N N   . ALA E  1 48  ? 39.516  -21.566  37.917  1.00 39.22  ? 48   ALA E N   1 
ATOM   7198  C CA  . ALA E  1 48  ? 40.127  -20.243  37.944  1.00 41.81  ? 48   ALA E CA  1 
ATOM   7199  C C   . ALA E  1 48  ? 41.028  -20.093  39.165  1.00 51.42  ? 48   ALA E C   1 
ATOM   7200  O O   . ALA E  1 48  ? 42.111  -19.513  39.082  1.00 53.41  ? 48   ALA E O   1 
ATOM   7201  C CB  . ALA E  1 48  ? 39.059  -19.162  37.934  1.00 38.29  ? 48   ALA E CB  1 
ATOM   7202  N N   . GLN E  1 49  ? 40.574  -20.622  40.298  1.00 50.09  ? 49   GLN E N   1 
ATOM   7203  C CA  . GLN E  1 49  ? 41.349  -20.579  41.533  1.00 50.59  ? 49   GLN E CA  1 
ATOM   7204  C C   . GLN E  1 49  ? 42.607  -21.436  41.429  1.00 50.25  ? 49   GLN E C   1 
ATOM   7205  O O   . GLN E  1 49  ? 43.657  -21.081  41.964  1.00 49.98  ? 49   GLN E O   1 
ATOM   7206  C CB  . GLN E  1 49  ? 40.497  -21.041  42.717  1.00 51.77  ? 49   GLN E CB  1 
ATOM   7207  C CG  . GLN E  1 49  ? 39.364  -20.095  43.078  1.00 52.51  ? 49   GLN E CG  1 
ATOM   7208  C CD  . GLN E  1 49  ? 38.523  -20.607  44.231  1.00 59.25  ? 49   GLN E CD  1 
ATOM   7209  O OE1 . GLN E  1 49  ? 38.643  -21.763  44.637  1.00 65.03  ? 49   GLN E OE1 1 
ATOM   7210  N NE2 . GLN E  1 49  ? 37.667  -19.745  44.768  1.00 60.85  ? 49   GLN E NE2 1 
ATOM   7211  N N   . GLU E  1 50  ? 42.490  -22.565  40.737  1.00 51.42  ? 50   GLU E N   1 
ATOM   7212  C CA  . GLU E  1 50  ? 43.611  -23.481  40.554  1.00 50.36  ? 50   GLU E CA  1 
ATOM   7213  C C   . GLU E  1 50  ? 44.727  -22.834  39.739  1.00 49.00  ? 50   GLU E C   1 
ATOM   7214  O O   . GLU E  1 50  ? 45.909  -23.086  39.974  1.00 50.16  ? 50   GLU E O   1 
ATOM   7215  C CB  . GLU E  1 50  ? 43.139  -24.769  39.875  1.00 54.25  ? 50   GLU E CB  1 
ATOM   7216  C CG  . GLU E  1 50  ? 44.229  -25.810  39.680  1.00 61.12  ? 50   GLU E CG  1 
ATOM   7217  C CD  . GLU E  1 50  ? 43.727  -27.053  38.972  1.00 69.98  ? 50   GLU E CD  1 
ATOM   7218  O OE1 . GLU E  1 50  ? 42.516  -27.122  38.675  1.00 74.44  ? 50   GLU E OE1 1 
ATOM   7219  O OE2 . GLU E  1 50  ? 44.544  -27.961  38.710  1.00 74.00  ? 50   GLU E OE2 1 
ATOM   7220  N N   . THR E  1 51  ? 44.340  -21.996  38.782  1.00 45.40  ? 51   THR E N   1 
ATOM   7221  C CA  . THR E  1 51  ? 45.297  -21.297  37.932  1.00 43.56  ? 51   THR E CA  1 
ATOM   7222  C C   . THR E  1 51  ? 46.132  -20.306  38.741  1.00 47.88  ? 51   THR E C   1 
ATOM   7223  O O   . THR E  1 51  ? 47.328  -20.142  38.497  1.00 51.58  ? 51   THR E O   1 
ATOM   7224  C CB  . THR E  1 51  ? 44.583  -20.550  36.784  1.00 38.12  ? 51   THR E CB  1 
ATOM   7225  O OG1 . THR E  1 51  ? 43.802  -21.477  36.021  1.00 36.14  ? 51   THR E OG1 1 
ATOM   7226  C CG2 . THR E  1 51  ? 45.592  -19.874  35.868  1.00 33.12  ? 51   THR E CG2 1 
ATOM   7227  N N   . VAL E  1 52  ? 45.494  -19.658  39.711  1.00 49.79  ? 52   VAL E N   1 
ATOM   7228  C CA  . VAL E  1 52  ? 46.158  -18.662  40.546  1.00 47.15  ? 52   VAL E CA  1 
ATOM   7229  C C   . VAL E  1 52  ? 47.259  -19.288  41.401  1.00 45.56  ? 52   VAL E C   1 
ATOM   7230  O O   . VAL E  1 52  ? 48.300  -18.672  41.639  1.00 50.83  ? 52   VAL E O   1 
ATOM   7231  C CB  . VAL E  1 52  ? 45.146  -17.937  41.456  1.00 52.54  ? 52   VAL E CB  1 
ATOM   7232  C CG1 . VAL E  1 52  ? 45.842  -16.892  42.317  1.00 56.54  ? 52   VAL E CG1 1 
ATOM   7233  C CG2 . VAL E  1 52  ? 44.057  -17.292  40.616  1.00 43.23  ? 52   VAL E CG2 1 
ATOM   7234  N N   . ARG E  1 53  ? 47.033  -20.519  41.850  1.00 42.07  ? 53   ARG E N   1 
ATOM   7235  C CA  . ARG E  1 53  ? 48.029  -21.233  42.643  1.00 44.17  ? 53   ARG E CA  1 
ATOM   7236  C C   . ARG E  1 53  ? 49.277  -21.550  41.822  1.00 45.11  ? 53   ARG E C   1 
ATOM   7237  O O   . ARG E  1 53  ? 50.358  -21.752  42.375  1.00 49.15  ? 53   ARG E O   1 
ATOM   7238  C CB  . ARG E  1 53  ? 47.437  -22.520  43.220  1.00 47.56  ? 53   ARG E CB  1 
ATOM   7239  C CG  . ARG E  1 53  ? 46.461  -22.291  44.360  1.00 53.98  ? 53   ARG E CG  1 
ATOM   7240  C CD  . ARG E  1 53  ? 46.140  -23.589  45.082  1.00 60.92  ? 53   ARG E CD  1 
ATOM   7241  N NE  . ARG E  1 53  ? 45.389  -24.515  44.240  1.00 61.95  ? 53   ARG E NE  1 
ATOM   7242  C CZ  . ARG E  1 53  ? 44.062  -24.568  44.191  1.00 60.16  ? 53   ARG E CZ  1 
ATOM   7243  N NH1 . ARG E  1 53  ? 43.336  -23.746  44.938  1.00 60.58  ? 53   ARG E NH1 1 
ATOM   7244  N NH2 . ARG E  1 53  ? 43.459  -25.442  43.397  1.00 57.97  ? 53   ARG E NH2 1 
ATOM   7245  N N   . LEU E  1 54  ? 49.120  -21.594  40.503  1.00 45.27  ? 54   LEU E N   1 
ATOM   7246  C CA  . LEU E  1 54  ? 50.251  -21.802  39.606  1.00 40.74  ? 54   LEU E CA  1 
ATOM   7247  C C   . LEU E  1 54  ? 51.084  -20.533  39.484  1.00 45.40  ? 54   LEU E C   1 
ATOM   7248  O O   . LEU E  1 54  ? 52.309  -20.590  39.383  1.00 54.16  ? 54   LEU E O   1 
ATOM   7249  C CB  . LEU E  1 54  ? 49.770  -22.246  38.224  1.00 37.45  ? 54   LEU E CB  1 
ATOM   7250  C CG  . LEU E  1 54  ? 49.164  -23.645  38.135  1.00 39.59  ? 54   LEU E CG  1 
ATOM   7251  C CD1 . LEU E  1 54  ? 48.697  -23.936  36.718  1.00 40.68  ? 54   LEU E CD1 1 
ATOM   7252  C CD2 . LEU E  1 54  ? 50.180  -24.674  38.591  1.00 39.75  ? 54   LEU E CD2 1 
ATOM   7253  N N   . LEU E  1 55  ? 50.407  -19.390  39.496  1.00 41.83  ? 55   LEU E N   1 
ATOM   7254  C CA  . LEU E  1 55  ? 51.068  -18.101  39.337  1.00 42.34  ? 55   LEU E CA  1 
ATOM   7255  C C   . LEU E  1 55  ? 51.878  -17.731  40.576  1.00 46.00  ? 55   LEU E C   1 
ATOM   7256  O O   . LEU E  1 55  ? 51.419  -17.907  41.705  1.00 50.87  ? 55   LEU E O   1 
ATOM   7257  C CB  . LEU E  1 55  ? 50.038  -17.011  39.036  1.00 37.98  ? 55   LEU E CB  1 
ATOM   7258  C CG  . LEU E  1 55  ? 49.033  -17.320  37.924  1.00 37.24  ? 55   LEU E CG  1 
ATOM   7259  C CD1 . LEU E  1 55  ? 48.109  -16.137  37.690  1.00 38.91  ? 55   LEU E CD1 1 
ATOM   7260  C CD2 . LEU E  1 55  ? 49.746  -17.711  36.638  1.00 40.47  ? 55   LEU E CD2 1 
ATOM   7261  N N   . GLY E  1 67  ? 52.994  -10.914  40.847  1.00 62.23  ? 67   GLY E N   1 
ATOM   7262  C CA  . GLY E  1 67  ? 52.444  -10.051  41.877  1.00 64.95  ? 67   GLY E CA  1 
ATOM   7263  C C   . GLY E  1 67  ? 51.208  -10.639  42.528  1.00 64.65  ? 67   GLY E C   1 
ATOM   7264  O O   . GLY E  1 67  ? 51.065  -11.857  42.626  1.00 63.83  ? 67   GLY E O   1 
ATOM   7265  N N   . ASN E  1 68  ? 50.310  -9.767   42.975  1.00 63.20  ? 68   ASN E N   1 
ATOM   7266  C CA  . ASN E  1 68  ? 49.081  -10.197  43.632  1.00 57.96  ? 68   ASN E CA  1 
ATOM   7267  C C   . ASN E  1 68  ? 48.013  -10.642  42.636  1.00 51.01  ? 68   ASN E C   1 
ATOM   7268  O O   . ASN E  1 68  ? 47.198  -9.840   42.183  1.00 50.32  ? 68   ASN E O   1 
ATOM   7269  C CB  . ASN E  1 68  ? 48.540  -9.074   44.519  1.00 64.87  ? 68   ASN E CB  1 
ATOM   7270  C CG  . ASN E  1 68  ? 48.713  -7.701   43.895  1.00 70.19  ? 68   ASN E CG  1 
ATOM   7271  O OD1 . ASN E  1 68  ? 48.744  -7.561   42.673  1.00 69.34  ? 68   ASN E OD1 1 
ATOM   7272  N ND2 . ASN E  1 68  ? 48.837  -6.681   44.735  1.00 75.89  ? 68   ASN E ND2 1 
ATOM   7273  N N   . HIS E  1 69  ? 48.024  -11.929  42.303  1.00 47.00  ? 69   HIS E N   1 
ATOM   7274  C CA  . HIS E  1 69  ? 47.072  -12.485  41.348  1.00 40.66  ? 69   HIS E CA  1 
ATOM   7275  C C   . HIS E  1 69  ? 45.720  -12.749  42.004  1.00 46.49  ? 69   HIS E C   1 
ATOM   7276  O O   . HIS E  1 69  ? 45.637  -12.940  43.218  1.00 50.77  ? 69   HIS E O   1 
ATOM   7277  C CB  . HIS E  1 69  ? 47.623  -13.774  40.736  1.00 33.44  ? 69   HIS E CB  1 
ATOM   7278  C CG  . HIS E  1 69  ? 48.974  -13.616  40.111  1.00 37.16  ? 69   HIS E CG  1 
ATOM   7279  N ND1 . HIS E  1 69  ? 49.156  -13.060  38.863  1.00 34.28  ? 69   HIS E ND1 1 
ATOM   7280  C CD2 . HIS E  1 69  ? 50.209  -13.940  40.562  1.00 39.47  ? 69   HIS E CD2 1 
ATOM   7281  C CE1 . HIS E  1 69  ? 50.445  -13.048  38.572  1.00 34.11  ? 69   HIS E CE1 1 
ATOM   7282  N NE2 . HIS E  1 69  ? 51.106  -13.577  39.586  1.00 38.96  ? 69   HIS E NE2 1 
ATOM   7283  N N   . ALA E  1 70  ? 44.662  -12.762  41.197  1.00 40.61  ? 70   ALA E N   1 
ATOM   7284  C CA  . ALA E  1 70  ? 43.312  -12.967  41.710  1.00 41.56  ? 70   ALA E CA  1 
ATOM   7285  C C   . ALA E  1 70  ? 42.440  -13.731  40.717  1.00 44.28  ? 70   ALA E C   1 
ATOM   7286  O O   . ALA E  1 70  ? 42.625  -13.625  39.505  1.00 46.00  ? 70   ALA E O   1 
ATOM   7287  C CB  . ALA E  1 70  ? 42.671  -11.632  42.055  1.00 41.14  ? 70   ALA E CB  1 
ATOM   7288  N N   . ALA E  1 71  ? 41.487  -14.496  41.241  1.00 46.71  ? 71   ALA E N   1 
ATOM   7289  C CA  . ALA E  1 71  ? 40.580  -15.277  40.406  1.00 39.37  ? 71   ALA E CA  1 
ATOM   7290  C C   . ALA E  1 71  ? 39.189  -14.656  40.369  1.00 36.79  ? 71   ALA E C   1 
ATOM   7291  O O   . ALA E  1 71  ? 38.671  -14.207  41.390  1.00 38.35  ? 71   ALA E O   1 
ATOM   7292  C CB  . ALA E  1 71  ? 40.501  -16.711  40.905  1.00 38.23  ? 71   ALA E CB  1 
ATOM   7293  N N   . PHE E  1 72  ? 38.588  -14.639  39.184  1.00 37.46  ? 72   PHE E N   1 
ATOM   7294  C CA  . PHE E  1 72  ? 37.238  -14.117  39.016  1.00 44.54  ? 72   PHE E CA  1 
ATOM   7295  C C   . PHE E  1 72  ? 36.354  -15.128  38.294  1.00 45.54  ? 72   PHE E C   1 
ATOM   7296  O O   . PHE E  1 72  ? 36.822  -15.869  37.430  1.00 45.54  ? 72   PHE E O   1 
ATOM   7297  C CB  . PHE E  1 72  ? 37.260  -12.795  38.245  1.00 46.73  ? 72   PHE E CB  1 
ATOM   7298  C CG  . PHE E  1 72  ? 37.988  -11.689  38.956  1.00 43.82  ? 72   PHE E CG  1 
ATOM   7299  C CD1 . PHE E  1 72  ? 39.348  -11.507  38.773  1.00 38.72  ? 72   PHE E CD1 1 
ATOM   7300  C CD2 . PHE E  1 72  ? 37.310  -10.829  39.804  1.00 48.21  ? 72   PHE E CD2 1 
ATOM   7301  C CE1 . PHE E  1 72  ? 40.019  -10.491  39.424  1.00 43.04  ? 72   PHE E CE1 1 
ATOM   7302  C CE2 . PHE E  1 72  ? 37.976  -9.810   40.458  1.00 49.99  ? 72   PHE E CE2 1 
ATOM   7303  C CZ  . PHE E  1 72  ? 39.332  -9.641   40.267  1.00 49.28  ? 72   PHE E CZ  1 
ATOM   7304  N N   . GLN E  1 73  ? 35.076  -15.159  38.654  1.00 48.43  ? 73   GLN E N   1 
ATOM   7305  C CA  . GLN E  1 73  ? 34.124  -16.047  38.000  1.00 50.88  ? 73   GLN E CA  1 
ATOM   7306  C C   . GLN E  1 73  ? 33.089  -15.230  37.239  1.00 49.82  ? 73   GLN E C   1 
ATOM   7307  O O   . GLN E  1 73  ? 32.457  -14.334  37.800  1.00 50.42  ? 73   GLN E O   1 
ATOM   7308  C CB  . GLN E  1 73  ? 33.444  -16.962  39.024  1.00 56.58  ? 73   GLN E CB  1 
ATOM   7309  C CG  . GLN E  1 73  ? 32.676  -18.133  38.419  1.00 60.62  ? 73   GLN E CG  1 
ATOM   7310  C CD  . GLN E  1 73  ? 31.300  -17.744  37.910  1.00 66.27  ? 73   GLN E CD  1 
ATOM   7311  O OE1 . GLN E  1 73  ? 30.712  -16.762  38.364  1.00 70.14  ? 73   GLN E OE1 1 
ATOM   7312  N NE2 . GLN E  1 73  ? 30.781  -18.513  36.960  1.00 69.06  ? 73   GLN E NE2 1 
ATOM   7313  N N   . ALA E  1 74  ? 32.917  -15.547  35.959  1.00 50.68  ? 74   ALA E N   1 
ATOM   7314  C CA  . ALA E  1 74  ? 31.967  -14.831  35.118  1.00 51.05  ? 74   ALA E CA  1 
ATOM   7315  C C   . ALA E  1 74  ? 31.598  -15.630  33.874  1.00 50.61  ? 74   ALA E C   1 
ATOM   7316  O O   . ALA E  1 74  ? 32.440  -16.309  33.285  1.00 45.99  ? 74   ALA E O   1 
ATOM   7317  C CB  . ALA E  1 74  ? 32.534  -13.474  34.721  1.00 52.05  ? 74   ALA E CB  1 
ATOM   7318  N N   . ASP E  1 75  ? 30.331  -15.547  33.484  1.00 51.94  ? 75   ASP E N   1 
ATOM   7319  C CA  . ASP E  1 75  ? 29.872  -16.131  32.231  1.00 48.92  ? 75   ASP E CA  1 
ATOM   7320  C C   . ASP E  1 75  ? 29.869  -15.049  31.157  1.00 45.94  ? 75   ASP E C   1 
ATOM   7321  O O   . ASP E  1 75  ? 28.989  -14.189  31.136  1.00 48.49  ? 75   ASP E O   1 
ATOM   7322  C CB  . ASP E  1 75  ? 28.480  -16.745  32.389  1.00 53.85  ? 75   ASP E CB  1 
ATOM   7323  C CG  . ASP E  1 75  ? 28.043  -17.523  31.165  1.00 58.53  ? 75   ASP E CG  1 
ATOM   7324  O OD1 . ASP E  1 75  ? 28.923  -18.003  30.420  1.00 59.09  ? 75   ASP E OD1 1 
ATOM   7325  O OD2 . ASP E  1 75  ? 26.820  -17.660  30.949  1.00 65.03  ? 75   ASP E OD2 1 
ATOM   7326  N N   . VAL E  1 76  ? 30.860  -15.098  30.272  1.00 45.01  ? 76   VAL E N   1 
ATOM   7327  C CA  . VAL E  1 76  ? 31.081  -14.035  29.294  1.00 45.45  ? 76   VAL E CA  1 
ATOM   7328  C C   . VAL E  1 76  ? 29.914  -13.854  28.323  1.00 47.58  ? 76   VAL E C   1 
ATOM   7329  O O   . VAL E  1 76  ? 29.773  -12.797  27.707  1.00 48.03  ? 76   VAL E O   1 
ATOM   7330  C CB  . VAL E  1 76  ? 32.368  -14.290  28.482  1.00 43.90  ? 76   VAL E CB  1 
ATOM   7331  C CG1 . VAL E  1 76  ? 33.575  -14.341  29.406  1.00 37.71  ? 76   VAL E CG1 1 
ATOM   7332  C CG2 . VAL E  1 76  ? 32.251  -15.578  27.682  1.00 49.18  ? 76   VAL E CG2 1 
ATOM   7333  N N   . SER E  1 77  ? 29.077  -14.879  28.195  1.00 46.85  ? 77   SER E N   1 
ATOM   7334  C CA  . SER E  1 77  ? 27.934  -14.824  27.292  1.00 48.28  ? 77   SER E CA  1 
ATOM   7335  C C   . SER E  1 77  ? 26.891  -13.813  27.762  1.00 50.18  ? 77   SER E C   1 
ATOM   7336  O O   . SER E  1 77  ? 26.192  -13.209  26.949  1.00 53.04  ? 77   SER E O   1 
ATOM   7337  C CB  . SER E  1 77  ? 27.293  -16.207  27.155  1.00 52.46  ? 77   SER E CB  1 
ATOM   7338  O OG  . SER E  1 77  ? 26.760  -16.647  28.392  1.00 55.25  ? 77   SER E OG  1 
ATOM   7339  N N   . GLU E  1 78  ? 26.794  -13.630  29.076  1.00 47.08  ? 78   GLU E N   1 
ATOM   7340  C CA  . GLU E  1 78  ? 25.809  -12.721  29.654  1.00 49.50  ? 78   GLU E CA  1 
ATOM   7341  C C   . GLU E  1 78  ? 26.362  -11.307  29.807  1.00 51.65  ? 78   GLU E C   1 
ATOM   7342  O O   . GLU E  1 78  ? 27.512  -11.118  30.204  1.00 50.06  ? 78   GLU E O   1 
ATOM   7343  C CB  . GLU E  1 78  ? 25.329  -13.251  31.006  1.00 50.50  ? 78   GLU E CB  1 
ATOM   7344  C CG  . GLU E  1 78  ? 24.556  -14.555  30.910  1.00 61.23  ? 78   GLU E CG  1 
ATOM   7345  C CD  . GLU E  1 78  ? 24.116  -15.076  32.262  1.00 73.76  ? 78   GLU E CD  1 
ATOM   7346  O OE1 . GLU E  1 78  ? 24.952  -15.106  33.190  1.00 70.34  ? 78   GLU E OE1 1 
ATOM   7347  O OE2 . GLU E  1 78  ? 22.932  -15.450  32.399  1.00 85.44  ? 78   GLU E OE2 1 
ATOM   7348  N N   . ALA E  1 79  ? 25.530  -10.319  29.494  1.00 54.52  ? 79   ALA E N   1 
ATOM   7349  C CA  . ALA E  1 79  ? 25.947  -8.920   29.493  1.00 46.42  ? 79   ALA E CA  1 
ATOM   7350  C C   . ALA E  1 79  ? 26.313  -8.419   30.885  1.00 45.96  ? 79   ALA E C   1 
ATOM   7351  O O   . ALA E  1 79  ? 27.318  -7.728   31.055  1.00 46.60  ? 79   ALA E O   1 
ATOM   7352  C CB  . ALA E  1 79  ? 24.853  -8.048   28.897  1.00 51.63  ? 79   ALA E CB  1 
ATOM   7353  N N   . ARG E  1 80  ? 25.493  -8.760   31.875  1.00 45.40  ? 80   ARG E N   1 
ATOM   7354  C CA  . ARG E  1 80  ? 25.746  -8.341   33.249  1.00 47.74  ? 80   ARG E CA  1 
ATOM   7355  C C   . ARG E  1 80  ? 27.051  -8.931   33.772  1.00 42.34  ? 80   ARG E C   1 
ATOM   7356  O O   . ARG E  1 80  ? 27.868  -8.223   34.355  1.00 39.31  ? 80   ARG E O   1 
ATOM   7357  C CB  . ARG E  1 80  ? 24.592  -8.746   34.170  1.00 54.32  ? 80   ARG E CB  1 
ATOM   7358  C CG  . ARG E  1 80  ? 23.430  -7.768   34.215  1.00 63.43  ? 80   ARG E CG  1 
ATOM   7359  C CD  . ARG E  1 80  ? 22.881  -7.671   35.630  1.00 68.81  ? 80   ARG E CD  1 
ATOM   7360  N NE  . ARG E  1 80  ? 21.713  -6.802   35.711  1.00 77.93  ? 80   ARG E NE  1 
ATOM   7361  C CZ  . ARG E  1 80  ? 21.774  -5.481   35.841  1.00 80.58  ? 80   ARG E CZ  1 
ATOM   7362  N NH1 . ARG E  1 80  ? 22.952  -4.873   35.900  1.00 79.16  ? 80   ARG E NH1 1 
ATOM   7363  N NH2 . ARG E  1 80  ? 20.659  -4.768   35.907  1.00 83.83  ? 80   ARG E NH2 1 
ATOM   7364  N N   . ALA E  1 81  ? 27.241  -10.229  33.551  1.00 43.09  ? 81   ALA E N   1 
ATOM   7365  C CA  . ALA E  1 81  ? 28.418  -10.935  34.050  1.00 41.77  ? 81   ALA E CA  1 
ATOM   7366  C C   . ALA E  1 81  ? 29.707  -10.409  33.433  1.00 48.59  ? 81   ALA E C   1 
ATOM   7367  O O   . ALA E  1 81  ? 30.755  -10.396  34.078  1.00 53.17  ? 81   ALA E O   1 
ATOM   7368  C CB  . ALA E  1 81  ? 28.285  -12.420  33.787  1.00 36.16  ? 81   ALA E CB  1 
ATOM   7369  N N   . ALA E  1 82  ? 29.624  -9.985   32.178  1.00 52.65  ? 82   ALA E N   1 
ATOM   7370  C CA  . ALA E  1 82  ? 30.776  -9.417   31.496  1.00 49.38  ? 82   ALA E CA  1 
ATOM   7371  C C   . ALA E  1 82  ? 31.080  -8.018   32.026  1.00 50.61  ? 82   ALA E C   1 
ATOM   7372  O O   . ALA E  1 82  ? 32.236  -7.673   32.249  1.00 53.07  ? 82   ALA E O   1 
ATOM   7373  C CB  . ALA E  1 82  ? 30.546  -9.382   29.988  1.00 51.34  ? 82   ALA E CB  1 
ATOM   7374  N N   . ARG E  1 83  ? 30.040  -7.218   32.239  1.00 51.76  ? 83   ARG E N   1 
ATOM   7375  C CA  . ARG E  1 83  ? 30.223  -5.840   32.684  1.00 57.74  ? 83   ARG E CA  1 
ATOM   7376  C C   . ARG E  1 83  ? 30.704  -5.820   34.134  1.00 60.41  ? 83   ARG E C   1 
ATOM   7377  O O   . ARG E  1 83  ? 31.657  -5.115   34.479  1.00 59.81  ? 83   ARG E O   1 
ATOM   7378  C CB  . ARG E  1 83  ? 28.918  -5.052   32.537  1.00 66.33  ? 83   ARG E CB  1 
ATOM   7379  C CG  . ARG E  1 83  ? 29.077  -3.579   32.198  1.00 72.83  ? 83   ARG E CG  1 
ATOM   7380  C CD  . ARG E  1 83  ? 28.482  -2.675   33.276  1.00 77.45  ? 83   ARG E CD  1 
ATOM   7381  N NE  . ARG E  1 83  ? 28.131  -1.374   32.710  1.00 85.49  ? 83   ARG E NE  1 
ATOM   7382  C CZ  . ARG E  1 83  ? 29.008  -0.400   32.523  1.00 87.31  ? 83   ARG E CZ  1 
ATOM   7383  N NH1 . ARG E  1 83  ? 30.262  -0.595   32.885  1.00 85.60  ? 83   ARG E NH1 1 
ATOM   7384  N NH2 . ARG E  1 83  ? 28.639  0.754    31.985  1.00 90.24  ? 83   ARG E NH2 1 
ATOM   7385  N N   . CYS E  1 84  ? 30.048  -6.618   34.971  1.00 61.17  ? 84   CYS E N   1 
ATOM   7386  C CA  . CYS E  1 84  ? 30.357  -6.673   36.396  1.00 57.85  ? 84   CYS E CA  1 
ATOM   7387  C C   . CYS E  1 84  ? 31.758  -7.236   36.620  1.00 56.66  ? 84   CYS E C   1 
ATOM   7388  O O   . CYS E  1 84  ? 32.404  -6.943   37.627  1.00 53.26  ? 84   CYS E O   1 
ATOM   7389  C CB  . CYS E  1 84  ? 29.311  -7.513   37.136  1.00 57.70  ? 84   CYS E CB  1 
ATOM   7390  S SG  . CYS E  1 84  ? 29.155  -7.153   38.906  1.00 108.27 ? 84   CYS E SG  1 
ATOM   7391  N N   . LEU E  1 85  ? 32.221  -8.039   35.668  1.00 54.05  ? 85   LEU E N   1 
ATOM   7392  C CA  . LEU E  1 85  ? 33.564  -8.605   35.717  1.00 45.67  ? 85   LEU E CA  1 
ATOM   7393  C C   . LEU E  1 85  ? 34.625  -7.516   35.689  1.00 41.88  ? 85   LEU E C   1 
ATOM   7394  O O   . LEU E  1 85  ? 35.531  -7.499   36.520  1.00 40.47  ? 85   LEU E O   1 
ATOM   7395  C CB  . LEU E  1 85  ? 33.782  -9.568   34.550  1.00 36.30  ? 85   LEU E CB  1 
ATOM   7396  C CG  . LEU E  1 85  ? 35.218  -10.041  34.316  1.00 29.95  ? 85   LEU E CG  1 
ATOM   7397  C CD1 . LEU E  1 85  ? 35.688  -10.926  35.460  1.00 29.08  ? 85   LEU E CD1 1 
ATOM   7398  C CD2 . LEU E  1 85  ? 35.343  -10.762  32.980  1.00 26.09  ? 85   LEU E CD2 1 
ATOM   7399  N N   . LEU E  1 86  ? 34.506  -6.609   34.725  1.00 41.19  ? 86   LEU E N   1 
ATOM   7400  C CA  . LEU E  1 86  ? 35.468  -5.524   34.569  1.00 42.98  ? 86   LEU E CA  1 
ATOM   7401  C C   . LEU E  1 86  ? 35.407  -4.543   35.736  1.00 42.73  ? 86   LEU E C   1 
ATOM   7402  O O   . LEU E  1 86  ? 36.362  -3.811   35.989  1.00 42.09  ? 86   LEU E O   1 
ATOM   7403  C CB  . LEU E  1 86  ? 35.232  -4.786   33.248  1.00 45.54  ? 86   LEU E CB  1 
ATOM   7404  C CG  . LEU E  1 86  ? 36.006  -5.303   32.031  1.00 47.76  ? 86   LEU E CG  1 
ATOM   7405  C CD1 . LEU E  1 86  ? 37.503  -5.254   32.297  1.00 45.77  ? 86   LEU E CD1 1 
ATOM   7406  C CD2 . LEU E  1 86  ? 35.572  -6.712   31.646  1.00 48.54  ? 86   LEU E CD2 1 
ATOM   7407  N N   . GLU E  1 87  ? 34.283  -4.533   36.444  1.00 44.20  ? 87   GLU E N   1 
ATOM   7408  C CA  . GLU E  1 87  ? 34.132  -3.672   37.610  1.00 49.03  ? 87   GLU E CA  1 
ATOM   7409  C C   . GLU E  1 87  ? 34.634  -4.365   38.874  1.00 48.30  ? 87   GLU E C   1 
ATOM   7410  O O   . GLU E  1 87  ? 35.052  -3.706   39.825  1.00 45.96  ? 87   GLU E O   1 
ATOM   7411  C CB  . GLU E  1 87  ? 32.673  -3.242   37.771  1.00 53.05  ? 87   GLU E CB  1 
ATOM   7412  C CG  . GLU E  1 87  ? 32.274  -2.108   36.837  1.00 61.72  ? 87   GLU E CG  1 
ATOM   7413  C CD  . GLU E  1 87  ? 30.772  -1.956   36.699  1.00 75.00  ? 87   GLU E CD  1 
ATOM   7414  O OE1 . GLU E  1 87  ? 30.037  -2.867   37.135  1.00 76.62  ? 87   GLU E OE1 1 
ATOM   7415  O OE2 . GLU E  1 87  ? 30.327  -0.925   36.151  1.00 82.94  ? 87   GLU E OE2 1 
ATOM   7416  N N   . GLN E  1 88  ? 34.598  -5.695   38.877  1.00 46.47  ? 88   GLN E N   1 
ATOM   7417  C CA  . GLN E  1 88  ? 35.169  -6.467   39.975  1.00 41.37  ? 88   GLN E CA  1 
ATOM   7418  C C   . GLN E  1 88  ? 36.688  -6.387   39.939  1.00 36.83  ? 88   GLN E C   1 
ATOM   7419  O O   . GLN E  1 88  ? 37.335  -6.201   40.968  1.00 39.58  ? 88   GLN E O   1 
ATOM   7420  C CB  . GLN E  1 88  ? 34.720  -7.927   39.914  1.00 46.78  ? 88   GLN E CB  1 
ATOM   7421  C CG  . GLN E  1 88  ? 33.315  -8.177   40.431  1.00 57.62  ? 88   GLN E CG  1 
ATOM   7422  C CD  . GLN E  1 88  ? 32.956  -9.650   40.433  1.00 64.63  ? 88   GLN E CD  1 
ATOM   7423  O OE1 . GLN E  1 88  ? 33.800  -10.507  40.171  1.00 63.95  ? 88   GLN E OE1 1 
ATOM   7424  N NE2 . GLN E  1 88  ? 31.697  -9.952   40.730  1.00 68.85  ? 88   GLN E NE2 1 
ATOM   7425  N N   . VAL E  1 89  ? 37.251  -6.532   38.745  1.00 36.49  ? 89   VAL E N   1 
ATOM   7426  C CA  . VAL E  1 89  ? 38.694  -6.459   38.564  1.00 38.55  ? 89   VAL E CA  1 
ATOM   7427  C C   . VAL E  1 89  ? 39.211  -5.054   38.865  1.00 39.86  ? 89   VAL E C   1 
ATOM   7428  O O   . VAL E  1 89  ? 40.213  -4.892   39.561  1.00 44.25  ? 89   VAL E O   1 
ATOM   7429  C CB  . VAL E  1 89  ? 39.103  -6.864   37.133  1.00 40.77  ? 89   VAL E CB  1 
ATOM   7430  C CG1 . VAL E  1 89  ? 40.603  -6.716   36.946  1.00 44.42  ? 89   VAL E CG1 1 
ATOM   7431  C CG2 . VAL E  1 89  ? 38.668  -8.293   36.841  1.00 40.62  ? 89   VAL E CG2 1 
ATOM   7432  N N   . GLN E  1 90  ? 38.521  -4.041   38.349  1.00 38.77  ? 90   GLN E N   1 
ATOM   7433  C CA  . GLN E  1 90  ? 38.915  -2.655   38.582  1.00 39.13  ? 90   GLN E CA  1 
ATOM   7434  C C   . GLN E  1 90  ? 38.843  -2.284   40.057  1.00 43.48  ? 90   GLN E C   1 
ATOM   7435  O O   . GLN E  1 90  ? 39.693  -1.556   40.559  1.00 49.77  ? 90   GLN E O   1 
ATOM   7436  C CB  . GLN E  1 90  ? 38.045  -1.697   37.769  1.00 39.38  ? 90   GLN E CB  1 
ATOM   7437  C CG  . GLN E  1 90  ? 38.541  -1.449   36.357  1.00 42.34  ? 90   GLN E CG  1 
ATOM   7438  C CD  . GLN E  1 90  ? 37.682  -0.447   35.614  1.00 48.44  ? 90   GLN E CD  1 
ATOM   7439  O OE1 . GLN E  1 90  ? 38.088  0.695    35.394  1.00 49.74  ? 90   GLN E OE1 1 
ATOM   7440  N NE2 . GLN E  1 90  ? 36.485  -0.869   35.225  1.00 53.34  ? 90   GLN E NE2 1 
ATOM   7441  N N   . ALA E  1 91  ? 37.825  -2.782   40.750  1.00 40.02  ? 91   ALA E N   1 
ATOM   7442  C CA  . ALA E  1 91  ? 37.683  -2.512   42.176  1.00 42.71  ? 91   ALA E CA  1 
ATOM   7443  C C   . ALA E  1 91  ? 38.700  -3.316   42.977  1.00 45.79  ? 91   ALA E C   1 
ATOM   7444  O O   . ALA E  1 91  ? 39.023  -2.974   44.116  1.00 50.77  ? 91   ALA E O   1 
ATOM   7445  C CB  . ALA E  1 91  ? 36.272  -2.826   42.641  1.00 42.69  ? 91   ALA E CB  1 
ATOM   7446  N N   . CYS E  1 92  ? 39.204  -4.385   42.370  1.00 43.39  ? 92   CYS E N   1 
ATOM   7447  C CA  . CYS E  1 92  ? 40.164  -5.261   43.027  1.00 42.18  ? 92   CYS E CA  1 
ATOM   7448  C C   . CYS E  1 92  ? 41.590  -4.732   42.905  1.00 46.01  ? 92   CYS E C   1 
ATOM   7449  O O   . CYS E  1 92  ? 42.407  -4.919   43.805  1.00 56.78  ? 92   CYS E O   1 
ATOM   7450  C CB  . CYS E  1 92  ? 40.077  -6.674   42.443  1.00 36.99  ? 92   CYS E CB  1 
ATOM   7451  S SG  . CYS E  1 92  ? 41.200  -7.875   43.188  1.00 50.11  ? 92   CYS E SG  1 
ATOM   7452  N N   . PHE E  1 93  ? 41.884  -4.064   41.793  1.00 42.92  ? 93   PHE E N   1 
ATOM   7453  C CA  . PHE E  1 93  ? 43.246  -3.613   41.521  1.00 40.48  ? 93   PHE E CA  1 
ATOM   7454  C C   . PHE E  1 93  ? 43.365  -2.099   41.371  1.00 44.13  ? 93   PHE E C   1 
ATOM   7455  O O   . PHE E  1 93  ? 44.453  -1.588   41.100  1.00 46.64  ? 93   PHE E O   1 
ATOM   7456  C CB  . PHE E  1 93  ? 43.781  -4.293   40.260  1.00 35.41  ? 93   PHE E CB  1 
ATOM   7457  C CG  . PHE E  1 93  ? 43.889  -5.784   40.376  1.00 33.20  ? 93   PHE E CG  1 
ATOM   7458  C CD1 . PHE E  1 93  ? 44.950  -6.362   41.053  1.00 36.99  ? 93   PHE E CD1 1 
ATOM   7459  C CD2 . PHE E  1 93  ? 42.934  -6.609   39.807  1.00 31.35  ? 93   PHE E CD2 1 
ATOM   7460  C CE1 . PHE E  1 93  ? 45.054  -7.735   41.162  1.00 37.68  ? 93   PHE E CE1 1 
ATOM   7461  C CE2 . PHE E  1 93  ? 43.033  -7.983   39.913  1.00 31.35  ? 93   PHE E CE2 1 
ATOM   7462  C CZ  . PHE E  1 93  ? 44.094  -8.546   40.592  1.00 34.58  ? 93   PHE E CZ  1 
ATOM   7463  N N   . SER E  1 94  ? 42.249  -1.393   41.548  1.00 56.84  ? 94   SER E N   1 
ATOM   7464  C CA  . SER E  1 94  ? 42.205  0.064    41.407  1.00 54.46  ? 94   SER E CA  1 
ATOM   7465  C C   . SER E  1 94  ? 42.772  0.510    40.061  1.00 50.00  ? 94   SER E C   1 
ATOM   7466  O O   . SER E  1 94  ? 43.407  1.560    39.960  1.00 47.78  ? 94   SER E O   1 
ATOM   7467  C CB  . SER E  1 94  ? 42.963  0.739    42.553  1.00 52.36  ? 94   SER E CB  1 
ATOM   7468  O OG  . SER E  1 94  ? 42.414  0.375    43.808  1.00 52.66  ? 94   SER E OG  1 
ATOM   7469  N N   . ARG E  1 95  ? 42.525  -0.293   39.031  1.00 47.84  ? 95   ARG E N   1 
ATOM   7470  C CA  . ARG E  1 95  ? 43.153  -0.101   37.730  1.00 49.11  ? 95   ARG E CA  1 
ATOM   7471  C C   . ARG E  1 95  ? 42.469  -0.943   36.656  1.00 49.76  ? 95   ARG E C   1 
ATOM   7472  O O   . ARG E  1 95  ? 42.131  -2.103   36.895  1.00 51.39  ? 95   ARG E O   1 
ATOM   7473  C CB  . ARG E  1 95  ? 44.638  -0.462   37.818  1.00 53.34  ? 95   ARG E CB  1 
ATOM   7474  C CG  . ARG E  1 95  ? 45.415  -0.338   36.523  1.00 56.96  ? 95   ARG E CG  1 
ATOM   7475  C CD  . ARG E  1 95  ? 46.633  -1.242   36.567  1.00 59.09  ? 95   ARG E CD  1 
ATOM   7476  N NE  . ARG E  1 95  ? 47.310  -1.160   37.857  1.00 62.24  ? 95   ARG E NE  1 
ATOM   7477  C CZ  . ARG E  1 95  ? 48.370  -1.886   38.195  1.00 61.88  ? 95   ARG E CZ  1 
ATOM   7478  N NH1 . ARG E  1 95  ? 48.883  -2.757   37.336  1.00 54.55  ? 95   ARG E NH1 1 
ATOM   7479  N NH2 . ARG E  1 95  ? 48.917  -1.741   39.394  1.00 67.55  ? 95   ARG E NH2 1 
ATOM   7480  N N   . PRO E  1 96  ? 42.251  -0.359   35.467  1.00 49.22  ? 96   PRO E N   1 
ATOM   7481  C CA  . PRO E  1 96  ? 41.716  -1.130   34.340  1.00 44.08  ? 96   PRO E CA  1 
ATOM   7482  C C   . PRO E  1 96  ? 42.769  -2.061   33.746  1.00 46.43  ? 96   PRO E C   1 
ATOM   7483  O O   . PRO E  1 96  ? 43.926  -1.659   33.613  1.00 51.85  ? 96   PRO E O   1 
ATOM   7484  C CB  . PRO E  1 96  ? 41.316  -0.047   33.338  1.00 44.63  ? 96   PRO E CB  1 
ATOM   7485  C CG  . PRO E  1 96  ? 42.246  1.080    33.632  1.00 46.35  ? 96   PRO E CG  1 
ATOM   7486  C CD  . PRO E  1 96  ? 42.433  1.062    35.125  1.00 50.14  ? 96   PRO E CD  1 
ATOM   7487  N N   . PRO E  1 97  ? 42.377  -3.296   33.401  1.00 42.70  ? 97   PRO E N   1 
ATOM   7488  C CA  . PRO E  1 97  ? 43.297  -4.250   32.772  1.00 38.76  ? 97   PRO E CA  1 
ATOM   7489  C C   . PRO E  1 97  ? 43.811  -3.744   31.428  1.00 33.04  ? 97   PRO E C   1 
ATOM   7490  O O   . PRO E  1 97  ? 43.030  -3.614   30.486  1.00 36.32  ? 97   PRO E O   1 
ATOM   7491  C CB  . PRO E  1 97  ? 42.435  -5.504   32.586  1.00 35.19  ? 97   PRO E CB  1 
ATOM   7492  C CG  . PRO E  1 97  ? 41.332  -5.362   33.576  1.00 40.62  ? 97   PRO E CG  1 
ATOM   7493  C CD  . PRO E  1 97  ? 41.055  -3.892   33.656  1.00 45.19  ? 97   PRO E CD  1 
ATOM   7494  N N   . SER E  1 98  ? 45.107  -3.462   31.344  1.00 37.91  ? 98   SER E N   1 
ATOM   7495  C CA  . SER E  1 98  ? 45.700  -2.986   30.099  1.00 41.59  ? 98   SER E CA  1 
ATOM   7496  C C   . SER E  1 98  ? 45.903  -4.138   29.122  1.00 42.58  ? 98   SER E C   1 
ATOM   7497  O O   . SER E  1 98  ? 46.135  -3.924   27.932  1.00 46.88  ? 98   SER E O   1 
ATOM   7498  C CB  . SER E  1 98  ? 47.028  -2.277   30.369  1.00 51.25  ? 98   SER E CB  1 
ATOM   7499  O OG  . SER E  1 98  ? 47.943  -3.134   31.029  1.00 59.78  ? 98   SER E OG  1 
ATOM   7500  N N   . VAL E  1 99  ? 45.816  -5.362   29.633  1.00 43.05  ? 99   VAL E N   1 
ATOM   7501  C CA  . VAL E  1 99  ? 45.910  -6.551   28.795  1.00 43.86  ? 99   VAL E CA  1 
ATOM   7502  C C   . VAL E  1 99  ? 44.662  -7.413   28.952  1.00 45.36  ? 99   VAL E C   1 
ATOM   7503  O O   . VAL E  1 99  ? 44.365  -7.900   30.042  1.00 49.40  ? 99   VAL E O   1 
ATOM   7504  C CB  . VAL E  1 99  ? 47.155  -7.391   29.135  1.00 46.21  ? 99   VAL E CB  1 
ATOM   7505  C CG1 . VAL E  1 99  ? 47.154  -8.688   28.340  1.00 44.93  ? 99   VAL E CG1 1 
ATOM   7506  C CG2 . VAL E  1 99  ? 48.422  -6.593   28.866  1.00 49.48  ? 99   VAL E CG2 1 
ATOM   7507  N N   . VAL E  1 100 ? 43.929  -7.591   27.858  1.00 42.59  ? 100  VAL E N   1 
ATOM   7508  C CA  . VAL E  1 100 ? 42.701  -8.377   27.886  1.00 42.86  ? 100  VAL E CA  1 
ATOM   7509  C C   . VAL E  1 100 ? 42.746  -9.506   26.862  1.00 41.57  ? 100  VAL E C   1 
ATOM   7510  O O   . VAL E  1 100 ? 42.872  -9.265   25.662  1.00 41.94  ? 100  VAL E O   1 
ATOM   7511  C CB  . VAL E  1 100 ? 41.467  -7.497   27.621  1.00 42.14  ? 100  VAL E CB  1 
ATOM   7512  C CG1 . VAL E  1 100 ? 40.209  -8.351   27.559  1.00 39.28  ? 100  VAL E CG1 1 
ATOM   7513  C CG2 . VAL E  1 100 ? 41.343  -6.430   28.698  1.00 42.14  ? 100  VAL E CG2 1 
ATOM   7514  N N   . VAL E  1 101 ? 42.647  -10.739  27.348  1.00 40.12  ? 101  VAL E N   1 
ATOM   7515  C CA  . VAL E  1 101 ? 42.717  -11.912  26.485  1.00 35.44  ? 101  VAL E CA  1 
ATOM   7516  C C   . VAL E  1 101 ? 41.466  -12.775  26.613  1.00 39.82  ? 101  VAL E C   1 
ATOM   7517  O O   . VAL E  1 101 ? 41.153  -13.272  27.695  1.00 43.85  ? 101  VAL E O   1 
ATOM   7518  C CB  . VAL E  1 101 ? 43.951  -12.775  26.808  1.00 31.90  ? 101  VAL E CB  1 
ATOM   7519  C CG1 . VAL E  1 101 ? 44.153  -13.827  25.731  1.00 28.25  ? 101  VAL E CG1 1 
ATOM   7520  C CG2 . VAL E  1 101 ? 45.190  -11.904  26.939  1.00 31.37  ? 101  VAL E CG2 1 
ATOM   7521  N N   . SER E  1 102 ? 40.756  -12.952  25.503  1.00 35.73  ? 102  SER E N   1 
ATOM   7522  C CA  . SER E  1 102 ? 39.543  -13.763  25.492  1.00 31.99  ? 102  SER E CA  1 
ATOM   7523  C C   . SER E  1 102 ? 39.822  -15.185  25.015  1.00 35.64  ? 102  SER E C   1 
ATOM   7524  O O   . SER E  1 102 ? 39.896  -15.443  23.814  1.00 38.74  ? 102  SER E O   1 
ATOM   7525  C CB  . SER E  1 102 ? 38.474  -13.117  24.608  1.00 32.99  ? 102  SER E CB  1 
ATOM   7526  O OG  . SER E  1 102 ? 38.037  -11.883  25.150  1.00 40.02  ? 102  SER E OG  1 
ATOM   7527  N N   . CYS E  1 103 ? 39.977  -16.104  25.964  1.00 35.19  ? 103  CYS E N   1 
ATOM   7528  C CA  . CYS E  1 103 ? 40.190  -17.510  25.642  1.00 33.57  ? 103  CYS E CA  1 
ATOM   7529  C C   . CYS E  1 103 ? 38.953  -18.335  25.973  1.00 38.38  ? 103  CYS E C   1 
ATOM   7530  O O   . CYS E  1 103 ? 38.901  -19.532  25.692  1.00 44.17  ? 103  CYS E O   1 
ATOM   7531  C CB  . CYS E  1 103 ? 41.400  -18.065  26.396  1.00 32.63  ? 103  CYS E CB  1 
ATOM   7532  S SG  . CYS E  1 103 ? 42.952  -17.197  26.090  1.00 52.04  ? 103  CYS E SG  1 
ATOM   7533  N N   . ALA E  1 104 ? 37.962  -17.688  26.579  1.00 36.79  ? 104  ALA E N   1 
ATOM   7534  C CA  . ALA E  1 104 ? 36.727  -18.362  26.965  1.00 34.09  ? 104  ALA E CA  1 
ATOM   7535  C C   . ALA E  1 104 ? 35.960  -18.843  25.740  1.00 35.68  ? 104  ALA E C   1 
ATOM   7536  O O   . ALA E  1 104 ? 35.455  -18.037  24.959  1.00 40.04  ? 104  ALA E O   1 
ATOM   7537  C CB  . ALA E  1 104 ? 35.859  -17.438  27.804  1.00 34.22  ? 104  ALA E CB  1 
ATOM   7538  N N   . GLY E  1 105 ? 35.876  -20.159  25.577  1.00 36.48  ? 105  GLY E N   1 
ATOM   7539  C CA  . GLY E  1 105 ? 35.179  -20.737  24.442  1.00 38.53  ? 105  GLY E CA  1 
ATOM   7540  C C   . GLY E  1 105 ? 34.808  -22.195  24.632  1.00 35.50  ? 105  GLY E C   1 
ATOM   7541  O O   . GLY E  1 105 ? 35.452  -22.920  25.390  1.00 28.37  ? 105  GLY E O   1 
ATOM   7542  N N   . ILE E  1 106 ? 33.755  -22.620  23.939  1.00 37.08  ? 106  ILE E N   1 
ATOM   7543  C CA  . ILE E  1 106 ? 33.309  -24.009  23.979  1.00 38.73  ? 106  ILE E CA  1 
ATOM   7544  C C   . ILE E  1 106 ? 33.044  -24.539  22.575  1.00 38.00  ? 106  ILE E C   1 
ATOM   7545  O O   . ILE E  1 106 ? 32.974  -23.772  21.614  1.00 30.12  ? 106  ILE E O   1 
ATOM   7546  C CB  . ILE E  1 106 ? 32.026  -24.176  24.816  1.00 40.12  ? 106  ILE E CB  1 
ATOM   7547  C CG1 . ILE E  1 106 ? 30.894  -23.328  24.230  1.00 33.46  ? 106  ILE E CG1 1 
ATOM   7548  C CG2 . ILE E  1 106 ? 32.280  -23.813  26.271  1.00 45.34  ? 106  ILE E CG2 1 
ATOM   7549  C CD1 . ILE E  1 106 ? 29.574  -23.488  24.948  1.00 31.49  ? 106  ILE E CD1 1 
ATOM   7550  N N   . THR E  1 107 ? 32.898  -25.855  22.465  1.00 40.38  ? 107  THR E N   1 
ATOM   7551  C CA  . THR E  1 107 ? 32.545  -26.481  21.197  1.00 40.72  ? 107  THR E CA  1 
ATOM   7552  C C   . THR E  1 107 ? 31.340  -27.396  21.358  1.00 43.55  ? 107  THR E C   1 
ATOM   7553  O O   . THR E  1 107 ? 31.236  -28.137  22.336  1.00 45.10  ? 107  THR E O   1 
ATOM   7554  C CB  . THR E  1 107 ? 33.713  -27.303  20.612  1.00 39.70  ? 107  THR E CB  1 
ATOM   7555  O OG1 . THR E  1 107 ? 34.114  -28.308  21.552  1.00 41.92  ? 107  THR E OG1 1 
ATOM   7556  C CG2 . THR E  1 107 ? 34.896  -26.406  20.293  1.00 36.77  ? 107  THR E CG2 1 
ATOM   7557  N N   . GLN E  1 108 ? 30.427  -27.332  20.396  1.00 43.61  ? 108  GLN E N   1 
ATOM   7558  C CA  . GLN E  1 108 ? 29.304  -28.256  20.345  1.00 46.67  ? 108  GLN E CA  1 
ATOM   7559  C C   . GLN E  1 108 ? 29.136  -28.747  18.913  1.00 51.53  ? 108  GLN E C   1 
ATOM   7560  O O   . GLN E  1 108 ? 28.180  -28.389  18.224  1.00 52.25  ? 108  GLN E O   1 
ATOM   7561  C CB  . GLN E  1 108 ? 28.022  -27.595  20.847  1.00 43.86  ? 108  GLN E CB  1 
ATOM   7562  C CG  . GLN E  1 108 ? 27.040  -28.578  21.453  1.00 51.45  ? 108  GLN E CG  1 
ATOM   7563  C CD  . GLN E  1 108 ? 27.588  -29.244  22.702  1.00 58.43  ? 108  GLN E CD  1 
ATOM   7564  O OE1 . GLN E  1 108 ? 27.970  -28.572  23.661  1.00 59.83  ? 108  GLN E OE1 1 
ATOM   7565  N NE2 . GLN E  1 108 ? 27.640  -30.572  22.692  1.00 60.56  ? 108  GLN E NE2 1 
ATOM   7566  N N   . ASP E  1 109 ? 30.084  -29.571  18.479  1.00 55.61  ? 109  ASP E N   1 
ATOM   7567  C CA  . ASP E  1 109 ? 30.176  -29.994  17.087  1.00 56.18  ? 109  ASP E CA  1 
ATOM   7568  C C   . ASP E  1 109 ? 29.032  -30.901  16.646  1.00 57.64  ? 109  ASP E C   1 
ATOM   7569  O O   . ASP E  1 109 ? 28.609  -31.796  17.379  1.00 57.36  ? 109  ASP E O   1 
ATOM   7570  C CB  . ASP E  1 109 ? 31.511  -30.701  16.846  1.00 50.81  ? 109  ASP E CB  1 
ATOM   7571  C CG  . ASP E  1 109 ? 32.689  -29.750  16.889  1.00 43.27  ? 109  ASP E CG  1 
ATOM   7572  O OD1 . ASP E  1 109 ? 32.531  -28.622  17.404  1.00 36.49  ? 109  ASP E OD1 1 
ATOM   7573  O OD2 . ASP E  1 109 ? 33.777  -30.131  16.410  1.00 47.55  ? 109  ASP E OD2 1 
ATOM   7574  N N   . GLU E  1 110 ? 28.548  -30.654  15.433  1.00 58.66  ? 110  GLU E N   1 
ATOM   7575  C CA  . GLU E  1 110 ? 27.497  -31.456  14.820  1.00 60.91  ? 110  GLU E CA  1 
ATOM   7576  C C   . GLU E  1 110 ? 27.409  -31.117  13.337  1.00 58.03  ? 110  GLU E C   1 
ATOM   7577  O O   . GLU E  1 110 ? 27.654  -29.977  12.944  1.00 57.83  ? 110  GLU E O   1 
ATOM   7578  C CB  . GLU E  1 110 ? 26.150  -31.214  15.508  1.00 65.96  ? 110  GLU E CB  1 
ATOM   7579  C CG  . GLU E  1 110 ? 25.001  -32.060  14.973  1.00 70.40  ? 110  GLU E CG  1 
ATOM   7580  C CD  . GLU E  1 110 ? 25.176  -33.542  15.250  1.00 76.54  ? 110  GLU E CD  1 
ATOM   7581  O OE1 . GLU E  1 110 ? 25.943  -33.896  16.171  1.00 83.64  ? 110  GLU E OE1 1 
ATOM   7582  O OE2 . GLU E  1 110 ? 24.545  -34.357  14.545  1.00 77.57  ? 110  GLU E OE2 1 
ATOM   7583  N N   . PHE E  1 111 ? 27.075  -32.107  12.514  1.00 56.70  ? 111  PHE E N   1 
ATOM   7584  C CA  . PHE E  1 111 ? 26.895  -31.874  11.087  1.00 55.05  ? 111  PHE E CA  1 
ATOM   7585  C C   . PHE E  1 111 ? 25.771  -30.871  10.854  1.00 54.36  ? 111  PHE E C   1 
ATOM   7586  O O   . PHE E  1 111 ? 24.815  -30.807  11.627  1.00 58.57  ? 111  PHE E O   1 
ATOM   7587  C CB  . PHE E  1 111 ? 26.605  -33.184  10.352  1.00 59.85  ? 111  PHE E CB  1 
ATOM   7588  C CG  . PHE E  1 111 ? 27.757  -34.148  10.354  1.00 64.01  ? 111  PHE E CG  1 
ATOM   7589  C CD1 . PHE E  1 111 ? 28.885  -33.899  9.589   1.00 66.98  ? 111  PHE E CD1 1 
ATOM   7590  C CD2 . PHE E  1 111 ? 27.709  -35.306  11.113  1.00 66.13  ? 111  PHE E CD2 1 
ATOM   7591  C CE1 . PHE E  1 111 ? 29.948  -34.784  9.587   1.00 70.73  ? 111  PHE E CE1 1 
ATOM   7592  C CE2 . PHE E  1 111 ? 28.768  -36.195  11.113  1.00 69.94  ? 111  PHE E CE2 1 
ATOM   7593  C CZ  . PHE E  1 111 ? 29.888  -35.933  10.349  1.00 72.28  ? 111  PHE E CZ  1 
ATOM   7594  N N   . LEU E  1 112 ? 25.900  -30.087  9.789   1.00 47.62  ? 112  LEU E N   1 
ATOM   7595  C CA  . LEU E  1 112 ? 24.953  -29.020  9.480   1.00 44.52  ? 112  LEU E CA  1 
ATOM   7596  C C   . LEU E  1 112 ? 23.519  -29.527  9.348   1.00 45.33  ? 112  LEU E C   1 
ATOM   7597  O O   . LEU E  1 112 ? 22.576  -28.858  9.766   1.00 40.65  ? 112  LEU E O   1 
ATOM   7598  C CB  . LEU E  1 112 ? 25.373  -28.306  8.194   1.00 45.55  ? 112  LEU E CB  1 
ATOM   7599  C CG  . LEU E  1 112 ? 24.463  -27.187  7.686   1.00 48.03  ? 112  LEU E CG  1 
ATOM   7600  C CD1 . LEU E  1 112 ? 24.315  -26.098  8.735   1.00 44.64  ? 112  LEU E CD1 1 
ATOM   7601  C CD2 . LEU E  1 112 ? 25.006  -26.615  6.387   1.00 51.04  ? 112  LEU E CD2 1 
ATOM   7602  N N   . LEU E  1 113 ? 23.364  -30.716  8.776   1.00 42.82  ? 113  LEU E N   1 
ATOM   7603  C CA  . LEU E  1 113 ? 22.044  -31.284  8.529   1.00 45.32  ? 113  LEU E CA  1 
ATOM   7604  C C   . LEU E  1 113 ? 21.347  -31.743  9.807   1.00 45.72  ? 113  LEU E C   1 
ATOM   7605  O O   . LEU E  1 113 ? 20.150  -32.030  9.796   1.00 59.27  ? 113  LEU E O   1 
ATOM   7606  C CB  . LEU E  1 113 ? 22.148  -32.459  7.554   1.00 52.82  ? 113  LEU E CB  1 
ATOM   7607  C CG  . LEU E  1 113 ? 22.601  -32.133  6.130   1.00 54.48  ? 113  LEU E CG  1 
ATOM   7608  C CD1 . LEU E  1 113 ? 22.719  -33.403  5.303   1.00 57.90  ? 113  LEU E CD1 1 
ATOM   7609  C CD2 . LEU E  1 113 ? 21.641  -31.153  5.476   1.00 48.88  ? 113  LEU E CD2 1 
ATOM   7610  N N   . HIS E  1 114 ? 22.091  -31.812  10.906  1.00 44.06  ? 114  HIS E N   1 
ATOM   7611  C CA  . HIS E  1 114 ? 21.537  -32.317  12.158  1.00 46.06  ? 114  HIS E CA  1 
ATOM   7612  C C   . HIS E  1 114 ? 21.781  -31.374  13.334  1.00 42.38  ? 114  HIS E C   1 
ATOM   7613  O O   . HIS E  1 114 ? 21.420  -31.685  14.469  1.00 42.77  ? 114  HIS E O   1 
ATOM   7614  C CB  . HIS E  1 114 ? 22.122  -33.696  12.474  1.00 45.88  ? 114  HIS E CB  1 
ATOM   7615  C CG  . HIS E  1 114 ? 21.929  -34.701  11.381  1.00 53.15  ? 114  HIS E CG  1 
ATOM   7616  N ND1 . HIS E  1 114 ? 22.681  -34.698  10.226  1.00 52.07  ? 114  HIS E ND1 1 
ATOM   7617  C CD2 . HIS E  1 114 ? 21.069  -35.740  11.267  1.00 57.92  ? 114  HIS E CD2 1 
ATOM   7618  C CE1 . HIS E  1 114 ? 22.294  -35.693  9.448   1.00 50.98  ? 114  HIS E CE1 1 
ATOM   7619  N NE2 . HIS E  1 114 ? 21.316  -36.341  10.056  1.00 59.75  ? 114  HIS E NE2 1 
ATOM   7620  N N   . MET E  1 115 ? 22.389  -30.225  13.062  1.00 40.24  ? 115  MET E N   1 
ATOM   7621  C CA  . MET E  1 115 ? 22.697  -29.263  14.116  1.00 43.44  ? 115  MET E CA  1 
ATOM   7622  C C   . MET E  1 115 ? 21.435  -28.599  14.656  1.00 43.48  ? 115  MET E C   1 
ATOM   7623  O O   . MET E  1 115 ? 20.700  -27.943  13.916  1.00 45.97  ? 115  MET E O   1 
ATOM   7624  C CB  . MET E  1 115 ? 23.669  -28.197  13.606  1.00 44.34  ? 115  MET E CB  1 
ATOM   7625  C CG  . MET E  1 115 ? 23.980  -27.113  14.626  1.00 45.46  ? 115  MET E CG  1 
ATOM   7626  S SD  . MET E  1 115 ? 25.222  -25.940  14.050  1.00 43.70  ? 115  MET E SD  1 
ATOM   7627  C CE  . MET E  1 115 ? 26.640  -27.017  13.863  1.00 35.93  ? 115  MET E CE  1 
ATOM   7628  N N   . SER E  1 116 ? 21.190  -28.772  15.950  1.00 41.93  ? 116  SER E N   1 
ATOM   7629  C CA  . SER E  1 116 ? 20.027  -28.174  16.595  1.00 41.70  ? 116  SER E CA  1 
ATOM   7630  C C   . SER E  1 116 ? 20.232  -26.678  16.809  1.00 43.34  ? 116  SER E C   1 
ATOM   7631  O O   . SER E  1 116 ? 21.310  -26.145  16.548  1.00 49.86  ? 116  SER E O   1 
ATOM   7632  C CB  . SER E  1 116 ? 19.739  -28.862  17.930  1.00 40.53  ? 116  SER E CB  1 
ATOM   7633  O OG  . SER E  1 116 ? 20.799  -28.662  18.849  1.00 38.58  ? 116  SER E OG  1 
ATOM   7634  N N   . GLU E  1 117 ? 19.191  -26.006  17.287  1.00 49.13  ? 117  GLU E N   1 
ATOM   7635  C CA  . GLU E  1 117 ? 19.248  -24.567  17.516  1.00 46.78  ? 117  GLU E CA  1 
ATOM   7636  C C   . GLU E  1 117 ? 20.062  -24.235  18.763  1.00 38.40  ? 117  GLU E C   1 
ATOM   7637  O O   . GLU E  1 117 ? 20.776  -23.233  18.799  1.00 36.23  ? 117  GLU E O   1 
ATOM   7638  C CB  . GLU E  1 117 ? 17.836  -23.990  17.639  1.00 54.63  ? 117  GLU E CB  1 
ATOM   7639  C CG  . GLU E  1 117 ? 17.789  -22.473  17.730  1.00 55.74  ? 117  GLU E CG  1 
ATOM   7640  C CD  . GLU E  1 117 ? 16.382  -21.943  17.929  1.00 61.38  ? 117  GLU E CD  1 
ATOM   7641  O OE1 . GLU E  1 117 ? 15.442  -22.761  18.012  1.00 65.85  ? 117  GLU E OE1 1 
ATOM   7642  O OE2 . GLU E  1 117 ? 16.216  -20.707  18.003  1.00 61.37  ? 117  GLU E OE2 1 
ATOM   7643  N N   . ASP E  1 118 ? 19.950  -25.080  19.784  1.00 39.19  ? 118  ASP E N   1 
ATOM   7644  C CA  . ASP E  1 118 ? 20.686  -24.877  21.028  1.00 46.39  ? 118  ASP E CA  1 
ATOM   7645  C C   . ASP E  1 118 ? 22.186  -25.024  20.804  1.00 44.84  ? 118  ASP E C   1 
ATOM   7646  O O   . ASP E  1 118 ? 22.984  -24.291  21.388  1.00 42.59  ? 118  ASP E O   1 
ATOM   7647  C CB  . ASP E  1 118 ? 20.215  -25.858  22.104  1.00 52.21  ? 118  ASP E CB  1 
ATOM   7648  C CG  . ASP E  1 118 ? 18.809  -25.560  22.591  1.00 56.16  ? 118  ASP E CG  1 
ATOM   7649  O OD1 . ASP E  1 118 ? 18.378  -24.392  22.489  1.00 58.22  ? 118  ASP E OD1 1 
ATOM   7650  O OD2 . ASP E  1 118 ? 18.137  -26.492  23.081  1.00 55.70  ? 118  ASP E OD2 1 
ATOM   7651  N N   . ASP E  1 119 ? 22.562  -25.976  19.955  1.00 45.18  ? 119  ASP E N   1 
ATOM   7652  C CA  . ASP E  1 119 ? 23.962  -26.190  19.610  1.00 41.86  ? 119  ASP E CA  1 
ATOM   7653  C C   . ASP E  1 119 ? 24.545  -24.957  18.930  1.00 38.88  ? 119  ASP E C   1 
ATOM   7654  O O   . ASP E  1 119 ? 25.717  -24.631  19.111  1.00 41.09  ? 119  ASP E O   1 
ATOM   7655  C CB  . ASP E  1 119 ? 24.113  -27.414  18.704  1.00 43.88  ? 119  ASP E CB  1 
ATOM   7656  C CG  . ASP E  1 119 ? 23.778  -28.710  19.416  1.00 51.27  ? 119  ASP E CG  1 
ATOM   7657  O OD1 . ASP E  1 119 ? 23.180  -28.650  20.511  1.00 49.87  ? 119  ASP E OD1 1 
ATOM   7658  O OD2 . ASP E  1 119 ? 24.106  -29.788  18.877  1.00 58.15  ? 119  ASP E OD2 1 
ATOM   7659  N N   . TRP E  1 120 ? 23.714  -24.274  18.151  1.00 36.01  ? 120  TRP E N   1 
ATOM   7660  C CA  . TRP E  1 120 ? 24.131  -23.056  17.470  1.00 36.96  ? 120  TRP E CA  1 
ATOM   7661  C C   . TRP E  1 120 ? 24.146  -21.860  18.416  1.00 37.06  ? 120  TRP E C   1 
ATOM   7662  O O   . TRP E  1 120 ? 25.077  -21.056  18.398  1.00 37.01  ? 120  TRP E O   1 
ATOM   7663  C CB  . TRP E  1 120 ? 23.210  -22.767  16.280  1.00 34.04  ? 120  TRP E CB  1 
ATOM   7664  C CG  . TRP E  1 120 ? 23.378  -21.387  15.712  1.00 34.89  ? 120  TRP E CG  1 
ATOM   7665  C CD1 . TRP E  1 120 ? 22.697  -20.261  16.077  1.00 39.15  ? 120  TRP E CD1 1 
ATOM   7666  C CD2 . TRP E  1 120 ? 24.288  -20.987  14.681  1.00 32.19  ? 120  TRP E CD2 1 
ATOM   7667  N NE1 . TRP E  1 120 ? 23.127  -19.186  15.338  1.00 38.34  ? 120  TRP E NE1 1 
ATOM   7668  C CE2 . TRP E  1 120 ? 24.105  -19.605  14.473  1.00 35.70  ? 120  TRP E CE2 1 
ATOM   7669  C CE3 . TRP E  1 120 ? 25.241  -21.663  13.912  1.00 35.84  ? 120  TRP E CE3 1 
ATOM   7670  C CZ2 . TRP E  1 120 ? 24.836  -18.887  13.530  1.00 36.36  ? 120  TRP E CZ2 1 
ATOM   7671  C CZ3 . TRP E  1 120 ? 25.967  -20.948  12.976  1.00 36.79  ? 120  TRP E CZ3 1 
ATOM   7672  C CH2 . TRP E  1 120 ? 25.760  -19.575  12.794  1.00 38.62  ? 120  TRP E CH2 1 
ATOM   7673  N N   . ASP E  1 121 ? 23.113  -21.753  19.245  1.00 38.28  ? 121  ASP E N   1 
ATOM   7674  C CA  . ASP E  1 121 ? 22.907  -20.567  20.070  1.00 36.12  ? 121  ASP E CA  1 
ATOM   7675  C C   . ASP E  1 121 ? 23.969  -20.355  21.145  1.00 42.95  ? 121  ASP E C   1 
ATOM   7676  O O   . ASP E  1 121 ? 24.354  -19.219  21.415  1.00 50.38  ? 121  ASP E O   1 
ATOM   7677  C CB  . ASP E  1 121 ? 21.527  -20.619  20.729  1.00 34.03  ? 121  ASP E CB  1 
ATOM   7678  C CG  . ASP E  1 121 ? 20.413  -20.239  19.775  1.00 33.38  ? 121  ASP E CG  1 
ATOM   7679  O OD1 . ASP E  1 121 ? 20.681  -19.477  18.823  1.00 34.67  ? 121  ASP E OD1 1 
ATOM   7680  O OD2 . ASP E  1 121 ? 19.271  -20.700  19.977  1.00 35.90  ? 121  ASP E OD2 1 
ATOM   7681  N N   . LYS E  1 122 ? 24.443  -21.434  21.761  1.00 42.18  ? 122  LYS E N   1 
ATOM   7682  C CA  . LYS E  1 122 ? 25.374  -21.296  22.878  1.00 45.57  ? 122  LYS E CA  1 
ATOM   7683  C C   . LYS E  1 122 ? 26.828  -21.181  22.424  1.00 40.42  ? 122  LYS E C   1 
ATOM   7684  O O   . LYS E  1 122 ? 27.646  -20.571  23.111  1.00 38.67  ? 122  LYS E O   1 
ATOM   7685  C CB  . LYS E  1 122 ? 25.220  -22.464  23.856  1.00 52.66  ? 122  LYS E CB  1 
ATOM   7686  C CG  . LYS E  1 122 ? 25.538  -23.831  23.281  1.00 57.90  ? 122  LYS E CG  1 
ATOM   7687  C CD  . LYS E  1 122 ? 25.321  -24.908  24.330  1.00 62.15  ? 122  LYS E CD  1 
ATOM   7688  C CE  . LYS E  1 122 ? 25.556  -26.294  23.763  1.00 64.64  ? 122  LYS E CE  1 
ATOM   7689  N NZ  . LYS E  1 122 ? 25.339  -27.353  24.786  1.00 68.03  ? 122  LYS E NZ  1 
ATOM   7690  N N   . VAL E  1 123 ? 27.152  -21.763  21.275  1.00 38.31  ? 123  VAL E N   1 
ATOM   7691  C CA  . VAL E  1 123 ? 28.494  -21.622  20.720  1.00 36.16  ? 123  VAL E CA  1 
ATOM   7692  C C   . VAL E  1 123 ? 28.713  -20.177  20.279  1.00 35.53  ? 123  VAL E C   1 
ATOM   7693  O O   . VAL E  1 123 ? 29.770  -19.595  20.518  1.00 40.82  ? 123  VAL E O   1 
ATOM   7694  C CB  . VAL E  1 123 ? 28.728  -22.578  19.535  1.00 35.13  ? 123  VAL E CB  1 
ATOM   7695  C CG1 . VAL E  1 123 ? 30.029  -22.241  18.820  1.00 37.06  ? 123  VAL E CG1 1 
ATOM   7696  C CG2 . VAL E  1 123 ? 28.740  -24.019  20.017  1.00 32.75  ? 123  VAL E CG2 1 
ATOM   7697  N N   . ILE E  1 124 ? 27.696  -19.601  19.649  1.00 34.28  ? 124  ILE E N   1 
ATOM   7698  C CA  . ILE E  1 124 ? 27.738  -18.203  19.237  1.00 35.13  ? 124  ILE E CA  1 
ATOM   7699  C C   . ILE E  1 124 ? 27.760  -17.273  20.449  1.00 36.25  ? 124  ILE E C   1 
ATOM   7700  O O   . ILE E  1 124 ? 28.520  -16.306  20.486  1.00 39.39  ? 124  ILE E O   1 
ATOM   7701  C CB  . ILE E  1 124 ? 26.536  -17.849  18.338  1.00 34.53  ? 124  ILE E CB  1 
ATOM   7702  C CG1 . ILE E  1 124 ? 26.627  -18.604  17.010  1.00 35.37  ? 124  ILE E CG1 1 
ATOM   7703  C CG2 . ILE E  1 124 ? 26.471  -16.352  18.085  1.00 33.94  ? 124  ILE E CG2 1 
ATOM   7704  C CD1 . ILE E  1 124 ? 27.863  -18.272  16.203  1.00 32.53  ? 124  ILE E CD1 1 
ATOM   7705  N N   . ALA E  1 125 ? 26.933  -17.580  21.443  1.00 39.83  ? 125  ALA E N   1 
ATOM   7706  C CA  . ALA E  1 125 ? 26.814  -16.742  22.633  1.00 41.04  ? 125  ALA E CA  1 
ATOM   7707  C C   . ALA E  1 125 ? 28.120  -16.664  23.417  1.00 38.87  ? 125  ALA E C   1 
ATOM   7708  O O   . ALA E  1 125 ? 28.486  -15.603  23.923  1.00 40.10  ? 125  ALA E O   1 
ATOM   7709  C CB  . ALA E  1 125 ? 25.697  -17.255  23.529  1.00 42.07  ? 125  ALA E CB  1 
ATOM   7710  N N   . VAL E  1 126 ? 28.821  -17.789  23.514  1.00 38.52  ? 126  VAL E N   1 
ATOM   7711  C CA  . VAL E  1 126 ? 30.062  -17.850  24.278  1.00 37.28  ? 126  VAL E CA  1 
ATOM   7712  C C   . VAL E  1 126 ? 31.255  -17.337  23.478  1.00 37.36  ? 126  VAL E C   1 
ATOM   7713  O O   . VAL E  1 126 ? 31.979  -16.448  23.927  1.00 38.27  ? 126  VAL E O   1 
ATOM   7714  C CB  . VAL E  1 126 ? 30.361  -19.288  24.751  1.00 35.77  ? 126  VAL E CB  1 
ATOM   7715  C CG1 . VAL E  1 126 ? 31.744  -19.365  25.380  1.00 33.10  ? 126  VAL E CG1 1 
ATOM   7716  C CG2 . VAL E  1 126 ? 29.296  -19.756  25.731  1.00 38.07  ? 126  VAL E CG2 1 
ATOM   7717  N N   . ASN E  1 127 ? 31.453  -17.900  22.291  1.00 37.87  ? 127  ASN E N   1 
ATOM   7718  C CA  . ASN E  1 127 ? 32.629  -17.592  21.484  1.00 38.18  ? 127  ASN E CA  1 
ATOM   7719  C C   . ASN E  1 127 ? 32.566  -16.223  20.813  1.00 40.50  ? 127  ASN E C   1 
ATOM   7720  O O   . ASN E  1 127 ? 33.569  -15.513  20.745  1.00 44.69  ? 127  ASN E O   1 
ATOM   7721  C CB  . ASN E  1 127 ? 32.832  -18.675  20.422  1.00 36.48  ? 127  ASN E CB  1 
ATOM   7722  C CG  . ASN E  1 127 ? 32.996  -20.058  21.022  1.00 35.72  ? 127  ASN E CG  1 
ATOM   7723  O OD1 . ASN E  1 127 ? 32.813  -20.253  22.223  1.00 35.48  ? 127  ASN E OD1 1 
ATOM   7724  N ND2 . ASN E  1 127 ? 33.338  -21.030  20.183  1.00 37.76  ? 127  ASN E ND2 1 
ATOM   7725  N N   . LEU E  1 128 ? 31.389  -15.853  20.318  1.00 41.09  ? 128  LEU E N   1 
ATOM   7726  C CA  . LEU E  1 128 ? 31.241  -14.602  19.579  1.00 40.71  ? 128  LEU E CA  1 
ATOM   7727  C C   . LEU E  1 128 ? 30.704  -13.471  20.453  1.00 40.14  ? 128  LEU E C   1 
ATOM   7728  O O   . LEU E  1 128 ? 31.378  -12.460  20.650  1.00 39.18  ? 128  LEU E O   1 
ATOM   7729  C CB  . LEU E  1 128 ? 30.330  -14.807  18.367  1.00 40.92  ? 128  LEU E CB  1 
ATOM   7730  C CG  . LEU E  1 128 ? 30.070  -13.576  17.497  1.00 39.84  ? 128  LEU E CG  1 
ATOM   7731  C CD1 . LEU E  1 128 ? 31.379  -12.928  17.080  1.00 39.85  ? 128  LEU E CD1 1 
ATOM   7732  C CD2 . LEU E  1 128 ? 29.240  -13.947  16.278  1.00 37.09  ? 128  LEU E CD2 1 
ATOM   7733  N N   . LYS E  1 129 ? 29.490  -13.641  20.971  1.00 40.42  ? 129  LYS E N   1 
ATOM   7734  C CA  . LYS E  1 129 ? 28.875  -12.620  21.814  1.00 37.71  ? 129  LYS E CA  1 
ATOM   7735  C C   . LYS E  1 129 ? 29.664  -12.422  23.104  1.00 36.43  ? 129  LYS E C   1 
ATOM   7736  O O   . LYS E  1 129 ? 29.790  -11.302  23.600  1.00 33.84  ? 129  LYS E O   1 
ATOM   7737  C CB  . LYS E  1 129 ? 27.426  -12.985  22.138  1.00 34.80  ? 129  LYS E CB  1 
ATOM   7738  C CG  . LYS E  1 129 ? 26.716  -11.954  23.004  1.00 35.57  ? 129  LYS E CG  1 
ATOM   7739  C CD  . LYS E  1 129 ? 25.283  -12.357  23.300  1.00 35.87  ? 129  LYS E CD  1 
ATOM   7740  C CE  . LYS E  1 129 ? 24.585  -11.309  24.152  1.00 34.54  ? 129  LYS E CE  1 
ATOM   7741  N NZ  . LYS E  1 129 ? 23.164  -11.664  24.412  1.00 36.65  ? 129  LYS E NZ  1 
ATOM   7742  N N   . GLY E  1 130 ? 30.195  -13.517  23.639  1.00 33.45  ? 130  GLY E N   1 
ATOM   7743  C CA  . GLY E  1 130 ? 31.006  -13.463  24.841  1.00 33.87  ? 130  GLY E CA  1 
ATOM   7744  C C   . GLY E  1 130 ? 32.254  -12.627  24.641  1.00 37.25  ? 130  GLY E C   1 
ATOM   7745  O O   . GLY E  1 130 ? 32.601  -11.801  25.485  1.00 42.61  ? 130  GLY E O   1 
ATOM   7746  N N   . THR E  1 131 ? 32.925  -12.842  23.515  1.00 37.74  ? 131  THR E N   1 
ATOM   7747  C CA  . THR E  1 131 ? 34.121  -12.082  23.171  1.00 42.32  ? 131  THR E CA  1 
ATOM   7748  C C   . THR E  1 131 ? 33.784  -10.605  22.976  1.00 46.57  ? 131  THR E C   1 
ATOM   7749  O O   . THR E  1 131 ? 34.548  -9.726   23.376  1.00 51.30  ? 131  THR E O   1 
ATOM   7750  C CB  . THR E  1 131 ? 34.788  -12.635  21.895  1.00 43.81  ? 131  THR E CB  1 
ATOM   7751  O OG1 . THR E  1 131 ? 35.158  -14.004  22.103  1.00 47.49  ? 131  THR E OG1 1 
ATOM   7752  C CG2 . THR E  1 131 ? 36.030  -11.831  21.541  1.00 40.02  ? 131  THR E CG2 1 
ATOM   7753  N N   . PHE E  1 132 ? 32.631  -10.344  22.368  1.00 41.98  ? 132  PHE E N   1 
ATOM   7754  C CA  . PHE E  1 132 ? 32.156  -8.981   22.147  1.00 38.16  ? 132  PHE E CA  1 
ATOM   7755  C C   . PHE E  1 132 ? 31.969  -8.221   23.456  1.00 34.13  ? 132  PHE E C   1 
ATOM   7756  O O   . PHE E  1 132 ? 32.449  -7.097   23.606  1.00 38.36  ? 132  PHE E O   1 
ATOM   7757  C CB  . PHE E  1 132 ? 30.838  -8.997   21.367  1.00 38.00  ? 132  PHE E CB  1 
ATOM   7758  C CG  . PHE E  1 132 ? 30.042  -7.728   21.492  1.00 31.27  ? 132  PHE E CG  1 
ATOM   7759  C CD1 . PHE E  1 132 ? 30.436  -6.577   20.831  1.00 28.02  ? 132  PHE E CD1 1 
ATOM   7760  C CD2 . PHE E  1 132 ? 28.894  -7.690   22.267  1.00 29.31  ? 132  PHE E CD2 1 
ATOM   7761  C CE1 . PHE E  1 132 ? 29.704  -5.409   20.945  1.00 25.00  ? 132  PHE E CE1 1 
ATOM   7762  C CE2 . PHE E  1 132 ? 28.158  -6.526   22.386  1.00 29.86  ? 132  PHE E CE2 1 
ATOM   7763  C CZ  . PHE E  1 132 ? 28.564  -5.384   21.723  1.00 26.74  ? 132  PHE E CZ  1 
ATOM   7764  N N   . LEU E  1 133 ? 31.265  -8.841   24.396  1.00 28.93  ? 133  LEU E N   1 
ATOM   7765  C CA  . LEU E  1 133 ? 30.953  -8.206   25.669  1.00 37.25  ? 133  LEU E CA  1 
ATOM   7766  C C   . LEU E  1 133 ? 32.209  -7.931   26.492  1.00 39.84  ? 133  LEU E C   1 
ATOM   7767  O O   . LEU E  1 133 ? 32.319  -6.890   27.139  1.00 44.75  ? 133  LEU E O   1 
ATOM   7768  C CB  . LEU E  1 133 ? 29.979  -9.075   26.465  1.00 43.71  ? 133  LEU E CB  1 
ATOM   7769  C CG  . LEU E  1 133 ? 28.595  -9.267   25.840  1.00 43.07  ? 133  LEU E CG  1 
ATOM   7770  C CD1 . LEU E  1 133 ? 27.788  -10.292  26.621  1.00 40.01  ? 133  LEU E CD1 1 
ATOM   7771  C CD2 . LEU E  1 133 ? 27.853  -7.940   25.763  1.00 41.64  ? 133  LEU E CD2 1 
ATOM   7772  N N   . VAL E  1 134 ? 33.153  -8.868   26.464  1.00 37.27  ? 134  VAL E N   1 
ATOM   7773  C CA  . VAL E  1 134 ? 34.418  -8.695   27.169  1.00 37.39  ? 134  VAL E CA  1 
ATOM   7774  C C   . VAL E  1 134 ? 35.238  -7.580   26.528  1.00 37.35  ? 134  VAL E C   1 
ATOM   7775  O O   . VAL E  1 134 ? 35.793  -6.728   27.222  1.00 34.57  ? 134  VAL E O   1 
ATOM   7776  C CB  . VAL E  1 134 ? 35.244  -9.998   27.185  1.00 33.23  ? 134  VAL E CB  1 
ATOM   7777  C CG1 . VAL E  1 134 ? 36.626  -9.751   27.772  1.00 33.65  ? 134  VAL E CG1 1 
ATOM   7778  C CG2 . VAL E  1 134 ? 34.515  -11.075  27.970  1.00 31.54  ? 134  VAL E CG2 1 
ATOM   7779  N N   . THR E  1 135 ? 35.299  -7.587   25.200  1.00 37.46  ? 135  THR E N   1 
ATOM   7780  C CA  . THR E  1 135 ? 36.039  -6.577   24.451  1.00 39.40  ? 135  THR E CA  1 
ATOM   7781  C C   . THR E  1 135 ? 35.453  -5.182   24.660  1.00 41.41  ? 135  THR E C   1 
ATOM   7782  O O   . THR E  1 135 ? 36.188  -4.206   24.813  1.00 41.01  ? 135  THR E O   1 
ATOM   7783  C CB  . THR E  1 135 ? 36.055  -6.896   22.943  1.00 39.92  ? 135  THR E CB  1 
ATOM   7784  O OG1 . THR E  1 135 ? 36.562  -8.219   22.738  1.00 41.44  ? 135  THR E OG1 1 
ATOM   7785  C CG2 . THR E  1 135 ? 36.926  -5.902   22.190  1.00 42.42  ? 135  THR E CG2 1 
ATOM   7786  N N   . GLN E  1 136 ? 34.126  -5.097   24.670  1.00 42.46  ? 136  GLN E N   1 
ATOM   7787  C CA  . GLN E  1 136 ? 33.445  -3.821   24.862  1.00 39.29  ? 136  GLN E CA  1 
ATOM   7788  C C   . GLN E  1 136 ? 33.692  -3.260   26.256  1.00 38.49  ? 136  GLN E C   1 
ATOM   7789  O O   . GLN E  1 136 ? 34.075  -2.100   26.408  1.00 41.02  ? 136  GLN E O   1 
ATOM   7790  C CB  . GLN E  1 136 ? 31.942  -3.970   24.626  1.00 36.17  ? 136  GLN E CB  1 
ATOM   7791  C CG  . GLN E  1 136 ? 31.165  -2.684   24.847  1.00 35.73  ? 136  GLN E CG  1 
ATOM   7792  C CD  . GLN E  1 136 ? 29.671  -2.864   24.676  1.00 37.83  ? 136  GLN E CD  1 
ATOM   7793  O OE1 . GLN E  1 136 ? 29.070  -3.758   25.271  1.00 40.32  ? 136  GLN E OE1 1 
ATOM   7794  N NE2 . GLN E  1 136 ? 29.063  -2.015   23.855  1.00 38.56  ? 136  GLN E NE2 1 
ATOM   7795  N N   . ALA E  1 137 ? 33.470  -4.090   27.270  1.00 35.28  ? 137  ALA E N   1 
ATOM   7796  C CA  . ALA E  1 137 ? 33.643  -3.677   28.657  1.00 40.56  ? 137  ALA E CA  1 
ATOM   7797  C C   . ALA E  1 137 ? 35.094  -3.312   28.951  1.00 42.46  ? 137  ALA E C   1 
ATOM   7798  O O   . ALA E  1 137 ? 35.370  -2.428   29.762  1.00 45.62  ? 137  ALA E O   1 
ATOM   7799  C CB  . ALA E  1 137 ? 33.171  -4.775   29.597  1.00 43.22  ? 137  ALA E CB  1 
ATOM   7800  N N   . ALA E  1 138 ? 36.018  -3.998   28.287  1.00 42.47  ? 138  ALA E N   1 
ATOM   7801  C CA  . ALA E  1 138 ? 37.439  -3.718   28.445  1.00 36.51  ? 138  ALA E CA  1 
ATOM   7802  C C   . ALA E  1 138 ? 37.792  -2.372   27.828  1.00 32.02  ? 138  ALA E C   1 
ATOM   7803  O O   . ALA E  1 138 ? 38.512  -1.574   28.425  1.00 34.84  ? 138  ALA E O   1 
ATOM   7804  C CB  . ALA E  1 138 ? 38.270  -4.821   27.820  1.00 33.29  ? 138  ALA E CB  1 
ATOM   7805  N N   . ALA E  1 139 ? 37.277  -2.129   26.627  1.00 28.32  ? 139  ALA E N   1 
ATOM   7806  C CA  . ALA E  1 139 ? 37.519  -0.877   25.923  1.00 28.28  ? 139  ALA E CA  1 
ATOM   7807  C C   . ALA E  1 139 ? 36.933  0.302    26.689  1.00 31.25  ? 139  ALA E C   1 
ATOM   7808  O O   . ALA E  1 139 ? 37.564  1.352    26.806  1.00 31.99  ? 139  ALA E O   1 
ATOM   7809  C CB  . ALA E  1 139 ? 36.940  -0.939   24.521  1.00 32.17  ? 139  ALA E CB  1 
ATOM   7810  N N   . GLN E  1 140 ? 35.723  0.120    27.210  1.00 32.47  ? 140  GLN E N   1 
ATOM   7811  C CA  . GLN E  1 140 ? 35.055  1.154    27.992  1.00 32.87  ? 140  GLN E CA  1 
ATOM   7812  C C   . GLN E  1 140 ? 35.855  1.511    29.240  1.00 32.95  ? 140  GLN E C   1 
ATOM   7813  O O   . GLN E  1 140 ? 35.985  2.684    29.589  1.00 36.23  ? 140  GLN E O   1 
ATOM   7814  C CB  . GLN E  1 140 ? 33.648  0.703    28.386  1.00 34.42  ? 140  GLN E CB  1 
ATOM   7815  C CG  . GLN E  1 140 ? 32.660  0.660    27.231  1.00 39.76  ? 140  GLN E CG  1 
ATOM   7816  C CD  . GLN E  1 140 ? 31.322  0.070    27.632  1.00 43.06  ? 140  GLN E CD  1 
ATOM   7817  O OE1 . GLN E  1 140 ? 31.228  -0.686   28.599  1.00 42.40  ? 140  GLN E OE1 1 
ATOM   7818  N NE2 . GLN E  1 140 ? 30.276  0.416    26.890  1.00 47.35  ? 140  GLN E NE2 1 
ATOM   7819  N N   . ALA E  1 141 ? 36.390  0.492    29.905  1.00 32.76  ? 141  ALA E N   1 
ATOM   7820  C CA  . ALA E  1 141 ? 37.172  0.694    31.119  1.00 37.00  ? 141  ALA E CA  1 
ATOM   7821  C C   . ALA E  1 141 ? 38.480  1.422    30.826  1.00 37.00  ? 141  ALA E C   1 
ATOM   7822  O O   . ALA E  1 141 ? 38.934  2.244    31.622  1.00 42.32  ? 141  ALA E O   1 
ATOM   7823  C CB  . ALA E  1 141 ? 37.449  -0.640   31.795  1.00 37.33  ? 141  ALA E CB  1 
ATOM   7824  N N   . LEU E  1 142 ? 39.079  1.117    29.679  1.00 35.17  ? 142  LEU E N   1 
ATOM   7825  C CA  . LEU E  1 142 ? 40.347  1.726    29.292  1.00 40.50  ? 142  LEU E CA  1 
ATOM   7826  C C   . LEU E  1 142 ? 40.165  3.169    28.830  1.00 42.27  ? 142  LEU E C   1 
ATOM   7827  O O   . LEU E  1 142 ? 40.922  4.055    29.229  1.00 39.78  ? 142  LEU E O   1 
ATOM   7828  C CB  . LEU E  1 142 ? 41.019  0.907    28.187  1.00 39.63  ? 142  LEU E CB  1 
ATOM   7829  C CG  . LEU E  1 142 ? 41.547  -0.478   28.571  1.00 39.16  ? 142  LEU E CG  1 
ATOM   7830  C CD1 . LEU E  1 142 ? 42.072  -1.211   27.344  1.00 37.88  ? 142  LEU E CD1 1 
ATOM   7831  C CD2 . LEU E  1 142 ? 42.628  -0.368   29.637  1.00 39.68  ? 142  LEU E CD2 1 
ATOM   7832  N N   . VAL E  1 143 ? 39.162  3.399    27.989  1.00 41.93  ? 143  VAL E N   1 
ATOM   7833  C CA  . VAL E  1 143 ? 38.893  4.732    27.459  1.00 40.27  ? 143  VAL E CA  1 
ATOM   7834  C C   . VAL E  1 143 ? 38.496  5.699    28.573  1.00 39.46  ? 143  VAL E C   1 
ATOM   7835  O O   . VAL E  1 143 ? 38.929  6.852    28.589  1.00 43.11  ? 143  VAL E O   1 
ATOM   7836  C CB  . VAL E  1 143 ? 37.786  4.695    26.381  1.00 35.52  ? 143  VAL E CB  1 
ATOM   7837  C CG1 . VAL E  1 143 ? 37.337  6.101    26.016  1.00 37.17  ? 143  VAL E CG1 1 
ATOM   7838  C CG2 . VAL E  1 143 ? 38.277  3.957    25.145  1.00 33.84  ? 143  VAL E CG2 1 
ATOM   7839  N N   . SER E  1 144 ? 37.684  5.219    29.510  1.00 39.17  ? 144  SER E N   1 
ATOM   7840  C CA  . SER E  1 144 ? 37.245  6.038    30.637  1.00 44.14  ? 144  SER E CA  1 
ATOM   7841  C C   . SER E  1 144 ? 38.423  6.482    31.499  1.00 47.34  ? 144  SER E C   1 
ATOM   7842  O O   . SER E  1 144 ? 38.470  7.622    31.962  1.00 47.39  ? 144  SER E O   1 
ATOM   7843  C CB  . SER E  1 144 ? 36.233  5.275    31.494  1.00 47.38  ? 144  SER E CB  1 
ATOM   7844  O OG  . SER E  1 144 ? 35.078  4.941    30.744  1.00 51.68  ? 144  SER E OG  1 
ATOM   7845  N N   . ASN E  1 145 ? 39.373  5.577    31.707  1.00 47.91  ? 145  ASN E N   1 
ATOM   7846  C CA  . ASN E  1 145 ? 40.545  5.870    32.523  1.00 50.55  ? 145  ASN E CA  1 
ATOM   7847  C C   . ASN E  1 145 ? 41.699  6.431    31.697  1.00 48.93  ? 145  ASN E C   1 
ATOM   7848  O O   . ASN E  1 145 ? 42.727  6.831    32.242  1.00 49.81  ? 145  ASN E O   1 
ATOM   7849  C CB  . ASN E  1 145 ? 40.993  4.614    33.271  1.00 55.04  ? 145  ASN E CB  1 
ATOM   7850  C CG  . ASN E  1 145 ? 40.002  4.190    34.339  1.00 60.26  ? 145  ASN E CG  1 
ATOM   7851  O OD1 . ASN E  1 145 ? 39.554  5.006    35.145  1.00 61.71  ? 145  ASN E OD1 1 
ATOM   7852  N ND2 . ASN E  1 145 ? 39.646  2.911    34.343  1.00 59.88  ? 145  ASN E ND2 1 
ATOM   7853  N N   . GLY E  1 146 ? 41.518  6.457    30.380  1.00 50.05  ? 146  GLY E N   1 
ATOM   7854  C CA  . GLY E  1 146 ? 42.507  7.019    29.477  1.00 56.25  ? 146  GLY E CA  1 
ATOM   7855  C C   . GLY E  1 146 ? 43.806  6.238    29.427  1.00 56.61  ? 146  GLY E C   1 
ATOM   7856  O O   . GLY E  1 146 ? 44.869  6.803    29.165  1.00 48.06  ? 146  GLY E O   1 
ATOM   7857  N N   . CYS E  1 147 ? 43.722  4.935    29.672  1.00 55.11  ? 147  CYS E N   1 
ATOM   7858  C CA  A CYS E  1 147 ? 44.903  4.081    29.664  0.50 54.34  ? 147  CYS E CA  1 
ATOM   7859  C CA  B CYS E  1 147 ? 44.897  4.070    29.668  0.50 54.32  ? 147  CYS E CA  1 
ATOM   7860  C C   . CYS E  1 147 ? 45.039  3.335    28.340  1.00 54.80  ? 147  CYS E C   1 
ATOM   7861  O O   . CYS E  1 147 ? 44.045  2.913    27.748  1.00 55.16  ? 147  CYS E O   1 
ATOM   7862  C CB  A CYS E  1 147 ? 44.851  3.088    30.827  0.50 52.88  ? 147  CYS E CB  1 
ATOM   7863  C CB  B CYS E  1 147 ? 44.821  3.056    30.813  0.50 52.78  ? 147  CYS E CB  1 
ATOM   7864  S SG  A CYS E  1 147 ? 46.319  2.047    30.993  0.50 53.52  ? 147  CYS E SG  1 
ATOM   7865  S SG  B CYS E  1 147 ? 44.473  3.768    32.437  0.50 49.77  ? 147  CYS E SG  1 
ATOM   7866  N N   . ARG E  1 148 ? 46.275  3.182    27.874  1.00 53.27  ? 148  ARG E N   1 
ATOM   7867  C CA  . ARG E  1 148 ? 46.532  2.420    26.657  1.00 49.95  ? 148  ARG E CA  1 
ATOM   7868  C C   . ARG E  1 148 ? 46.400  0.932    26.957  1.00 47.31  ? 148  ARG E C   1 
ATOM   7869  O O   . ARG E  1 148 ? 46.526  0.512    28.107  1.00 47.99  ? 148  ARG E O   1 
ATOM   7870  C CB  . ARG E  1 148 ? 47.919  2.729    26.090  1.00 50.05  ? 148  ARG E CB  1 
ATOM   7871  C CG  . ARG E  1 148 ? 48.109  4.166    25.635  1.00 53.57  ? 148  ARG E CG  1 
ATOM   7872  C CD  . ARG E  1 148 ? 49.341  4.302    24.751  1.00 53.38  ? 148  ARG E CD  1 
ATOM   7873  N NE  . ARG E  1 148 ? 50.539  3.761    25.386  1.00 51.55  ? 148  ARG E NE  1 
ATOM   7874  N N   . GLY E  1 149 ? 46.147  0.134    25.926  1.00 44.59  ? 149  GLY E N   1 
ATOM   7875  C CA  . GLY E  1 149 ? 45.958  -1.290   26.124  1.00 39.60  ? 149  GLY E CA  1 
ATOM   7876  C C   . GLY E  1 149 ? 46.153  -2.144   24.888  1.00 38.89  ? 149  GLY E C   1 
ATOM   7877  O O   . GLY E  1 149 ? 46.430  -1.641   23.799  1.00 35.97  ? 149  GLY E O   1 
ATOM   7878  N N   . SER E  1 150 ? 46.006  -3.452   25.071  1.00 35.98  ? 150  SER E N   1 
ATOM   7879  C CA  . SER E  1 150 ? 46.140  -4.410   23.983  1.00 33.43  ? 150  SER E CA  1 
ATOM   7880  C C   . SER E  1 150 ? 45.105  -5.520   24.119  1.00 38.30  ? 150  SER E C   1 
ATOM   7881  O O   . SER E  1 150 ? 45.246  -6.409   24.958  1.00 43.30  ? 150  SER E O   1 
ATOM   7882  C CB  . SER E  1 150 ? 47.550  -5.002   23.958  1.00 26.52  ? 150  SER E CB  1 
ATOM   7883  O OG  . SER E  1 150 ? 47.652  -6.031   22.990  1.00 24.96  ? 150  SER E OG  1 
ATOM   7884  N N   . ILE E  1 151 ? 44.064  -5.461   23.295  1.00 38.73  ? 151  ILE E N   1 
ATOM   7885  C CA  . ILE E  1 151 ? 43.011  -6.470   23.325  1.00 34.18  ? 151  ILE E CA  1 
ATOM   7886  C C   . ILE E  1 151 ? 43.353  -7.632   22.398  1.00 30.42  ? 151  ILE E C   1 
ATOM   7887  O O   . ILE E  1 151 ? 43.485  -7.457   21.188  1.00 30.91  ? 151  ILE E O   1 
ATOM   7888  C CB  . ILE E  1 151 ? 41.648  -5.879   22.927  1.00 37.88  ? 151  ILE E CB  1 
ATOM   7889  C CG1 . ILE E  1 151 ? 41.309  -4.684   23.821  1.00 42.20  ? 151  ILE E CG1 1 
ATOM   7890  C CG2 . ILE E  1 151 ? 40.562  -6.940   23.016  1.00 39.98  ? 151  ILE E CG2 1 
ATOM   7891  C CD1 . ILE E  1 151 ? 39.996  -4.015   23.477  1.00 46.45  ? 151  ILE E CD1 1 
ATOM   7892  N N   . ILE E  1 152 ? 43.498  -8.818   22.978  1.00 28.85  ? 152  ILE E N   1 
ATOM   7893  C CA  . ILE E  1 152 ? 43.918  -9.994   22.228  1.00 28.11  ? 152  ILE E CA  1 
ATOM   7894  C C   . ILE E  1 152 ? 42.846  -11.078  22.243  1.00 34.35  ? 152  ILE E C   1 
ATOM   7895  O O   . ILE E  1 152 ? 42.642  -11.746  23.256  1.00 39.63  ? 152  ILE E O   1 
ATOM   7896  C CB  . ILE E  1 152 ? 45.226  -10.574  22.795  1.00 30.81  ? 152  ILE E CB  1 
ATOM   7897  C CG1 . ILE E  1 152 ? 46.253  -9.459   23.008  1.00 27.04  ? 152  ILE E CG1 1 
ATOM   7898  C CG2 . ILE E  1 152 ? 45.768  -11.662  21.880  1.00 31.51  ? 152  ILE E CG2 1 
ATOM   7899  C CD1 . ILE E  1 152 ? 47.460  -9.886   23.809  1.00 22.60  ? 152  ILE E CD1 1 
ATOM   7900  N N   . ASN E  1 153 ? 42.165  -11.253  21.117  1.00 34.63  ? 153  ASN E N   1 
ATOM   7901  C CA  . ASN E  1 153 ? 41.113  -12.256  21.017  1.00 32.67  ? 153  ASN E CA  1 
ATOM   7902  C C   . ASN E  1 153 ? 41.603  -13.535  20.351  1.00 36.09  ? 153  ASN E C   1 
ATOM   7903  O O   . ASN E  1 153 ? 42.241  -13.495  19.299  1.00 37.73  ? 153  ASN E O   1 
ATOM   7904  C CB  . ASN E  1 153 ? 39.914  -11.693  20.254  1.00 32.06  ? 153  ASN E CB  1 
ATOM   7905  C CG  . ASN E  1 153 ? 39.241  -10.552  20.989  1.00 29.23  ? 153  ASN E CG  1 
ATOM   7906  O OD1 . ASN E  1 153 ? 39.236  -10.509  22.220  1.00 31.42  ? 153  ASN E OD1 1 
ATOM   7907  N ND2 . ASN E  1 153 ? 38.667  -9.620   20.238  1.00 25.94  ? 153  ASN E ND2 1 
ATOM   7908  N N   . ILE E  1 154 ? 41.302  -14.671  20.971  1.00 32.89  ? 154  ILE E N   1 
ATOM   7909  C CA  . ILE E  1 154 ? 41.719  -15.961  20.436  1.00 34.14  ? 154  ILE E CA  1 
ATOM   7910  C C   . ILE E  1 154 ? 40.665  -16.534  19.495  1.00 39.23  ? 154  ILE E C   1 
ATOM   7911  O O   . ILE E  1 154 ? 39.665  -17.100  19.938  1.00 42.76  ? 154  ILE E O   1 
ATOM   7912  C CB  . ILE E  1 154 ? 41.992  -16.978  21.558  1.00 33.08  ? 154  ILE E CB  1 
ATOM   7913  C CG1 . ILE E  1 154 ? 42.941  -16.383  22.599  1.00 34.03  ? 154  ILE E CG1 1 
ATOM   7914  C CG2 . ILE E  1 154 ? 42.563  -18.264  20.980  1.00 29.16  ? 154  ILE E CG2 1 
ATOM   7915  C CD1 . ILE E  1 154 ? 44.306  -16.034  22.056  1.00 37.05  ? 154  ILE E CD1 1 
ATOM   7916  N N   . SER E  1 155 ? 40.893  -16.380  18.195  1.00 36.38  ? 155  SER E N   1 
ATOM   7917  C CA  . SER E  1 155 ? 40.008  -16.958  17.193  1.00 30.26  ? 155  SER E CA  1 
ATOM   7918  C C   . SER E  1 155 ? 40.414  -18.401  16.914  1.00 30.02  ? 155  SER E C   1 
ATOM   7919  O O   . SER E  1 155 ? 40.677  -19.168  17.840  1.00 28.95  ? 155  SER E O   1 
ATOM   7920  C CB  . SER E  1 155 ? 40.037  -16.134  15.904  1.00 30.78  ? 155  SER E CB  1 
ATOM   7921  O OG  . SER E  1 155 ? 39.157  -16.672  14.932  1.00 34.08  ? 155  SER E OG  1 
ATOM   7922  N N   . SER E  1 156 ? 40.466  -18.761  15.636  1.00 28.64  ? 156  SER E N   1 
ATOM   7923  C CA  . SER E  1 156 ? 40.889  -20.096  15.226  1.00 30.67  ? 156  SER E CA  1 
ATOM   7924  C C   . SER E  1 156 ? 41.185  -20.124  13.734  1.00 37.87  ? 156  SER E C   1 
ATOM   7925  O O   . SER E  1 156 ? 40.706  -19.274  12.983  1.00 44.75  ? 156  SER E O   1 
ATOM   7926  C CB  . SER E  1 156 ? 39.820  -21.136  15.568  1.00 35.81  ? 156  SER E CB  1 
ATOM   7927  O OG  . SER E  1 156 ? 40.231  -22.439  15.186  1.00 34.33  ? 156  SER E OG  1 
ATOM   7928  N N   . ILE E  1 157 ? 41.972  -21.106  13.306  1.00 38.81  ? 157  ILE E N   1 
ATOM   7929  C CA  . ILE E  1 157 ? 42.244  -21.296  11.886  1.00 38.21  ? 157  ILE E CA  1 
ATOM   7930  C C   . ILE E  1 157 ? 40.962  -21.741  11.185  1.00 43.16  ? 157  ILE E C   1 
ATOM   7931  O O   . ILE E  1 157 ? 40.795  -21.551  9.979   1.00 45.37  ? 157  ILE E O   1 
ATOM   7932  C CB  . ILE E  1 157 ? 43.373  -22.326  11.655  1.00 35.60  ? 157  ILE E CB  1 
ATOM   7933  C CG1 . ILE E  1 157 ? 43.815  -22.326  10.189  1.00 43.82  ? 157  ILE E CG1 1 
ATOM   7934  C CG2 . ILE E  1 157 ? 42.946  -23.718  12.106  1.00 31.24  ? 157  ILE E CG2 1 
ATOM   7935  C CD1 . ILE E  1 157 ? 44.319  -20.984  9.706   1.00 45.24  ? 157  ILE E CD1 1 
ATOM   7936  N N   . VAL E  1 158 ? 40.053  -22.323  11.963  1.00 44.32  ? 158  VAL E N   1 
ATOM   7937  C CA  . VAL E  1 158 ? 38.738  -22.720  11.480  1.00 45.33  ? 158  VAL E CA  1 
ATOM   7938  C C   . VAL E  1 158 ? 37.951  -21.497  11.012  1.00 40.18  ? 158  VAL E C   1 
ATOM   7939  O O   . VAL E  1 158 ? 37.188  -21.564  10.048  1.00 39.69  ? 158  VAL E O   1 
ATOM   7940  C CB  . VAL E  1 158 ? 37.951  -23.469  12.579  1.00 48.87  ? 158  VAL E CB  1 
ATOM   7941  C CG1 . VAL E  1 158 ? 36.524  -23.744  12.140  1.00 53.11  ? 158  VAL E CG1 1 
ATOM   7942  C CG2 . VAL E  1 158 ? 38.659  -24.764  12.946  1.00 49.50  ? 158  VAL E CG2 1 
ATOM   7943  N N   . GLY E  1 159 ? 38.165  -20.371  11.684  1.00 36.94  ? 159  GLY E N   1 
ATOM   7944  C CA  . GLY E  1 159 ? 37.471  -19.138  11.356  1.00 34.47  ? 159  GLY E CA  1 
ATOM   7945  C C   . GLY E  1 159 ? 37.890  -18.512  10.037  1.00 36.11  ? 159  GLY E C   1 
ATOM   7946  O O   . GLY E  1 159 ? 37.398  -17.446  9.669   1.00 42.18  ? 159  GLY E O   1 
ATOM   7947  N N   . LYS E  1 160 ? 38.796  -19.171  9.322   1.00 40.33  ? 160  LYS E N   1 
ATOM   7948  C CA  . LYS E  1 160 ? 39.262  -18.669  8.035   1.00 36.66  ? 160  LYS E CA  1 
ATOM   7949  C C   . LYS E  1 160 ? 38.878  -19.603  6.890   1.00 33.95  ? 160  LYS E C   1 
ATOM   7950  O O   . LYS E  1 160 ? 38.650  -19.155  5.766   1.00 35.84  ? 160  LYS E O   1 
ATOM   7951  C CB  . LYS E  1 160 ? 40.780  -18.472  8.055   1.00 40.05  ? 160  LYS E CB  1 
ATOM   7952  C CG  . LYS E  1 160 ? 41.330  -17.765  6.825   1.00 42.91  ? 160  LYS E CG  1 
ATOM   7953  C CD  . LYS E  1 160 ? 42.850  -17.785  6.803   1.00 41.27  ? 160  LYS E CD  1 
ATOM   7954  C CE  . LYS E  1 160 ? 43.379  -19.200  6.645   1.00 45.31  ? 160  LYS E CE  1 
ATOM   7955  N NZ  . LYS E  1 160 ? 44.867  -19.235  6.589   1.00 52.00  ? 160  LYS E NZ  1 
ATOM   7956  N N   . VAL E  1 161 ? 38.805  -20.900  7.177   1.00 34.22  ? 161  VAL E N   1 
ATOM   7957  C CA  . VAL E  1 161 ? 38.546  -21.894  6.139   1.00 37.00  ? 161  VAL E CA  1 
ATOM   7958  C C   . VAL E  1 161 ? 37.390  -22.835  6.475   1.00 41.02  ? 161  VAL E C   1 
ATOM   7959  O O   . VAL E  1 161 ? 37.069  -23.731  5.696   1.00 43.33  ? 161  VAL E O   1 
ATOM   7960  C CB  . VAL E  1 161 ? 39.798  -22.751  5.866   1.00 37.94  ? 161  VAL E CB  1 
ATOM   7961  C CG1 . VAL E  1 161 ? 40.909  -21.900  5.267   1.00 39.91  ? 161  VAL E CG1 1 
ATOM   7962  C CG2 . VAL E  1 161 ? 40.263  -23.432  7.144   1.00 32.94  ? 161  VAL E CG2 1 
ATOM   7963  N N   . GLY E  1 162 ? 36.771  -22.637  7.635   1.00 38.51  ? 162  GLY E N   1 
ATOM   7964  C CA  . GLY E  1 162 ? 35.683  -23.498  8.066   1.00 36.78  ? 162  GLY E CA  1 
ATOM   7965  C C   . GLY E  1 162 ? 36.166  -24.884  8.452   1.00 43.60  ? 162  GLY E C   1 
ATOM   7966  O O   . GLY E  1 162 ? 37.338  -25.215  8.269   1.00 52.45  ? 162  GLY E O   1 
ATOM   7967  N N   . ASN E  1 163 ? 35.263  -25.698  8.987   1.00 44.02  ? 163  ASN E N   1 
ATOM   7968  C CA  . ASN E  1 163 ? 35.612  -27.054  9.397   1.00 48.37  ? 163  ASN E CA  1 
ATOM   7969  C C   . ASN E  1 163 ? 34.386  -27.954  9.498   1.00 52.51  ? 163  ASN E C   1 
ATOM   7970  O O   . ASN E  1 163 ? 33.329  -27.522  9.954   1.00 56.09  ? 163  ASN E O   1 
ATOM   7971  C CB  . ASN E  1 163 ? 36.353  -27.032  10.735  1.00 46.89  ? 163  ASN E CB  1 
ATOM   7972  C CG  . ASN E  1 163 ? 36.944  -28.380  11.096  1.00 48.74  ? 163  ASN E CG  1 
ATOM   7973  O OD1 . ASN E  1 163 ? 37.279  -29.178  10.222  1.00 51.49  ? 163  ASN E OD1 1 
ATOM   7974  N ND2 . ASN E  1 163 ? 37.075  -28.640  12.392  1.00 48.83  ? 163  ASN E ND2 1 
ATOM   7975  N N   . VAL E  1 164 ? 34.539  -29.205  9.075   1.00 54.24  ? 164  VAL E N   1 
ATOM   7976  C CA  . VAL E  1 164 ? 33.445  -30.171  9.098   1.00 58.15  ? 164  VAL E CA  1 
ATOM   7977  C C   . VAL E  1 164 ? 32.922  -30.407  10.512  1.00 59.89  ? 164  VAL E C   1 
ATOM   7978  O O   . VAL E  1 164 ? 33.674  -30.787  11.409  1.00 59.52  ? 164  VAL E O   1 
ATOM   7979  C CB  . VAL E  1 164 ? 33.875  -31.522  8.494   1.00 64.15  ? 164  VAL E CB  1 
ATOM   7980  C CG1 . VAL E  1 164 ? 32.807  -32.579  8.735   1.00 67.40  ? 164  VAL E CG1 1 
ATOM   7981  C CG2 . VAL E  1 164 ? 34.160  -31.371  7.009   1.00 69.62  ? 164  VAL E CG2 1 
ATOM   7982  N N   . GLY E  1 165 ? 31.627  -30.176  10.700  1.00 56.57  ? 165  GLY E N   1 
ATOM   7983  C CA  . GLY E  1 165 ? 30.991  -30.391  11.985  1.00 54.37  ? 165  GLY E CA  1 
ATOM   7984  C C   . GLY E  1 165 ? 31.086  -29.187  12.899  1.00 38.17  ? 165  GLY E C   1 
ATOM   7985  O O   . GLY E  1 165 ? 30.621  -29.226  14.035  1.00 37.83  ? 165  GLY E O   1 
ATOM   7986  N N   . GLN E  1 166 ? 31.684  -28.110  12.401  1.00 36.30  ? 166  GLN E N   1 
ATOM   7987  C CA  . GLN E  1 166 ? 31.872  -26.907  13.204  1.00 34.40  ? 166  GLN E CA  1 
ATOM   7988  C C   . GLN E  1 166 ? 31.243  -25.673  12.565  1.00 38.10  ? 166  GLN E C   1 
ATOM   7989  O O   . GLN E  1 166 ? 31.864  -24.613  12.517  1.00 37.60  ? 166  GLN E O   1 
ATOM   7990  C CB  . GLN E  1 166 ? 33.362  -26.658  13.444  1.00 31.91  ? 166  GLN E CB  1 
ATOM   7991  C CG  . GLN E  1 166 ? 34.012  -27.652  14.387  1.00 41.47  ? 166  GLN E CG  1 
ATOM   7992  C CD  . GLN E  1 166 ? 35.414  -27.242  14.794  1.00 38.53  ? 166  GLN E CD  1 
ATOM   7993  O OE1 . GLN E  1 166 ? 36.173  -26.701  13.991  1.00 36.70  ? 166  GLN E OE1 1 
ATOM   7994  N NE2 . GLN E  1 166 ? 35.761  -27.491  16.051  1.00 40.19  ? 166  GLN E NE2 1 
ATOM   7995  N N   . THR E  1 167 ? 30.012  -25.815  12.082  1.00 43.88  ? 167  THR E N   1 
ATOM   7996  C CA  . THR E  1 167 ? 29.295  -24.701  11.466  1.00 45.61  ? 167  THR E CA  1 
ATOM   7997  C C   . THR E  1 167 ? 29.132  -23.545  12.447  1.00 47.03  ? 167  THR E C   1 
ATOM   7998  O O   . THR E  1 167 ? 29.434  -22.396  12.124  1.00 44.59  ? 167  THR E O   1 
ATOM   7999  C CB  . THR E  1 167 ? 27.905  -25.130  10.959  1.00 47.24  ? 167  THR E CB  1 
ATOM   8000  O OG1 . THR E  1 167 ? 28.035  -26.256  10.082  1.00 51.12  ? 167  THR E OG1 1 
ATOM   8001  C CG2 . THR E  1 167 ? 27.231  -23.986  10.216  1.00 40.52  ? 167  THR E CG2 1 
ATOM   8002  N N   . ASN E  1 168 ? 28.657  -23.862  13.647  1.00 50.82  ? 168  ASN E N   1 
ATOM   8003  C CA  . ASN E  1 168 ? 28.497  -22.867  14.699  1.00 46.09  ? 168  ASN E CA  1 
ATOM   8004  C C   . ASN E  1 168 ? 29.840  -22.336  15.185  1.00 45.46  ? 168  ASN E C   1 
ATOM   8005  O O   . ASN E  1 168 ? 29.980  -21.152  15.490  1.00 49.55  ? 168  ASN E O   1 
ATOM   8006  C CB  . ASN E  1 168 ? 27.711  -23.456  15.874  1.00 44.73  ? 168  ASN E CB  1 
ATOM   8007  C CG  . ASN E  1 168 ? 28.235  -24.814  16.306  1.00 39.82  ? 168  ASN E CG  1 
ATOM   8008  O OD1 . ASN E  1 168 ? 29.296  -25.255  15.863  1.00 39.66  ? 168  ASN E OD1 1 
ATOM   8009  N ND2 . ASN E  1 168 ? 27.491  -25.484  17.178  1.00 42.35  ? 168  ASN E ND2 1 
ATOM   8010  N N   . TYR E  1 169 ? 30.825  -23.225  15.248  1.00 40.58  ? 169  TYR E N   1 
ATOM   8011  C CA  . TYR E  1 169 ? 32.156  -22.872  15.721  1.00 36.42  ? 169  TYR E CA  1 
ATOM   8012  C C   . TYR E  1 169 ? 32.876  -21.965  14.728  1.00 35.90  ? 169  TYR E C   1 
ATOM   8013  O O   . TYR E  1 169 ? 33.470  -20.959  15.114  1.00 33.13  ? 169  TYR E O   1 
ATOM   8014  C CB  . TYR E  1 169 ? 32.975  -24.138  15.976  1.00 37.34  ? 169  TYR E CB  1 
ATOM   8015  C CG  . TYR E  1 169 ? 34.351  -23.888  16.548  1.00 42.17  ? 169  TYR E CG  1 
ATOM   8016  C CD1 . TYR E  1 169 ? 34.530  -23.676  17.908  1.00 41.78  ? 169  TYR E CD1 1 
ATOM   8017  C CD2 . TYR E  1 169 ? 35.473  -23.877  15.729  1.00 40.03  ? 169  TYR E CD2 1 
ATOM   8018  C CE1 . TYR E  1 169 ? 35.786  -23.453  18.437  1.00 42.67  ? 169  TYR E CE1 1 
ATOM   8019  C CE2 . TYR E  1 169 ? 36.733  -23.655  16.249  1.00 35.51  ? 169  TYR E CE2 1 
ATOM   8020  C CZ  . TYR E  1 169 ? 36.883  -23.443  17.603  1.00 35.97  ? 169  TYR E CZ  1 
ATOM   8021  O OH  . TYR E  1 169 ? 38.135  -23.221  18.127  1.00 36.19  ? 169  TYR E OH  1 
ATOM   8022  N N   . ALA E  1 170 ? 32.817  -22.325  13.448  1.00 35.38  ? 170  ALA E N   1 
ATOM   8023  C CA  . ALA E  1 170 ? 33.475  -21.548  12.402  1.00 35.67  ? 170  ALA E CA  1 
ATOM   8024  C C   . ALA E  1 170 ? 32.864  -20.159  12.274  1.00 36.91  ? 170  ALA E C   1 
ATOM   8025  O O   . ALA E  1 170 ? 33.578  -19.173  12.099  1.00 35.93  ? 170  ALA E O   1 
ATOM   8026  C CB  . ALA E  1 170 ? 33.402  -22.278  11.070  1.00 31.69  ? 170  ALA E CB  1 
ATOM   8027  N N   . ALA E  1 171 ? 31.539  -20.091  12.362  1.00 36.34  ? 171  ALA E N   1 
ATOM   8028  C CA  . ALA E  1 171 ? 30.827  -18.824  12.246  1.00 36.68  ? 171  ALA E CA  1 
ATOM   8029  C C   . ALA E  1 171 ? 31.195  -17.886  13.388  1.00 38.03  ? 171  ALA E C   1 
ATOM   8030  O O   . ALA E  1 171 ? 31.359  -16.683  13.188  1.00 40.62  ? 171  ALA E O   1 
ATOM   8031  C CB  . ALA E  1 171 ? 29.326  -19.060  12.216  1.00 29.76  ? 171  ALA E CB  1 
ATOM   8032  N N   . SER E  1 172 ? 31.327  -18.446  14.585  1.00 39.38  ? 172  SER E N   1 
ATOM   8033  C CA  . SER E  1 172 ? 31.690  -17.663  15.758  1.00 35.39  ? 172  SER E CA  1 
ATOM   8034  C C   . SER E  1 172 ? 33.127  -17.168  15.654  1.00 30.01  ? 172  SER E C   1 
ATOM   8035  O O   . SER E  1 172 ? 33.411  -16.002  15.928  1.00 27.50  ? 172  SER E O   1 
ATOM   8036  C CB  . SER E  1 172 ? 31.508  -18.487  17.033  1.00 37.52  ? 172  SER E CB  1 
ATOM   8037  O OG  . SER E  1 172 ? 32.360  -19.619  17.035  1.00 39.35  ? 172  SER E OG  1 
ATOM   8038  N N   . LYS E  1 173 ? 34.027  -18.060  15.249  1.00 31.37  ? 173  LYS E N   1 
ATOM   8039  C CA  . LYS E  1 173 ? 35.443  -17.727  15.132  1.00 31.56  ? 173  LYS E CA  1 
ATOM   8040  C C   . LYS E  1 173 ? 35.694  -16.724  14.016  1.00 33.04  ? 173  LYS E C   1 
ATOM   8041  O O   . LYS E  1 173 ? 36.556  -15.852  14.135  1.00 32.34  ? 173  LYS E O   1 
ATOM   8042  C CB  . LYS E  1 173 ? 36.271  -18.990  14.900  1.00 30.11  ? 173  LYS E CB  1 
ATOM   8043  C CG  . LYS E  1 173 ? 36.317  -19.904  16.106  1.00 28.89  ? 173  LYS E CG  1 
ATOM   8044  C CD  . LYS E  1 173 ? 36.764  -19.135  17.335  1.00 28.30  ? 173  LYS E CD  1 
ATOM   8045  C CE  . LYS E  1 173 ? 36.515  -19.929  18.598  1.00 30.24  ? 173  LYS E CE  1 
ATOM   8046  N NZ  . LYS E  1 173 ? 37.001  -19.207  19.807  1.00 37.29  ? 173  LYS E NZ  1 
ATOM   8047  N N   . ALA E  1 174 ? 34.943  -16.855  12.928  1.00 32.45  ? 174  ALA E N   1 
ATOM   8048  C CA  . ALA E  1 174 ? 35.016  -15.892  11.838  1.00 29.58  ? 174  ALA E CA  1 
ATOM   8049  C C   . ALA E  1 174 ? 34.460  -14.554  12.304  1.00 29.65  ? 174  ALA E C   1 
ATOM   8050  O O   . ALA E  1 174 ? 34.961  -13.495  11.928  1.00 33.06  ? 174  ALA E O   1 
ATOM   8051  C CB  . ALA E  1 174 ? 34.257  -16.397  10.624  1.00 25.55  ? 174  ALA E CB  1 
ATOM   8052  N N   . GLY E  1 175 ? 33.423  -14.614  13.134  1.00 31.52  ? 175  GLY E N   1 
ATOM   8053  C CA  . GLY E  1 175 ? 32.818  -13.420  13.690  1.00 34.27  ? 175  GLY E CA  1 
ATOM   8054  C C   . GLY E  1 175 ? 33.765  -12.685  14.617  1.00 33.53  ? 175  GLY E C   1 
ATOM   8055  O O   . GLY E  1 175 ? 33.762  -11.456  14.666  1.00 33.27  ? 175  GLY E O   1 
ATOM   8056  N N   . VAL E  1 176 ? 34.572  -13.442  15.355  1.00 35.36  ? 176  VAL E N   1 
ATOM   8057  C CA  . VAL E  1 176 ? 35.555  -12.870  16.271  1.00 29.75  ? 176  VAL E CA  1 
ATOM   8058  C C   . VAL E  1 176 ? 36.561  -11.996  15.528  1.00 28.97  ? 176  VAL E C   1 
ATOM   8059  O O   . VAL E  1 176 ? 36.908  -10.904  15.984  1.00 30.49  ? 176  VAL E O   1 
ATOM   8060  C CB  . VAL E  1 176 ? 36.309  -13.973  17.047  1.00 26.53  ? 176  VAL E CB  1 
ATOM   8061  C CG1 . VAL E  1 176 ? 37.527  -13.401  17.756  1.00 30.41  ? 176  VAL E CG1 1 
ATOM   8062  C CG2 . VAL E  1 176 ? 35.382  -14.653  18.041  1.00 26.22  ? 176  VAL E CG2 1 
ATOM   8063  N N   . ILE E  1 177 ? 37.015  -12.478  14.376  1.00 27.32  ? 177  ILE E N   1 
ATOM   8064  C CA  . ILE E  1 177 ? 37.993  -11.757  13.569  1.00 32.85  ? 177  ILE E CA  1 
ATOM   8065  C C   . ILE E  1 177 ? 37.467  -10.396  13.121  1.00 36.14  ? 177  ILE E C   1 
ATOM   8066  O O   . ILE E  1 177 ? 38.089  -9.367   13.385  1.00 39.32  ? 177  ILE E O   1 
ATOM   8067  C CB  . ILE E  1 177 ? 38.403  -12.569  12.328  1.00 37.03  ? 177  ILE E CB  1 
ATOM   8068  C CG1 . ILE E  1 177 ? 38.957  -13.932  12.745  1.00 35.32  ? 177  ILE E CG1 1 
ATOM   8069  C CG2 . ILE E  1 177 ? 39.428  -11.802  11.504  1.00 36.75  ? 177  ILE E CG2 1 
ATOM   8070  C CD1 . ILE E  1 177 ? 39.370  -14.804  11.581  1.00 34.87  ? 177  ILE E CD1 1 
ATOM   8071  N N   . GLY E  1 178 ? 36.319  -10.397  12.449  1.00 37.69  ? 178  GLY E N   1 
ATOM   8072  C CA  . GLY E  1 178 ? 35.703  -9.167   11.979  1.00 37.08  ? 178  GLY E CA  1 
ATOM   8073  C C   . GLY E  1 178 ? 35.342  -8.238   13.121  1.00 36.19  ? 178  GLY E C   1 
ATOM   8074  O O   . GLY E  1 178 ? 35.289  -7.019   12.957  1.00 32.85  ? 178  GLY E O   1 
ATOM   8075  N N   . LEU E  1 179 ? 35.090  -8.828   14.284  1.00 43.18  ? 179  LEU E N   1 
ATOM   8076  C CA  . LEU E  1 179 ? 34.818  -8.075   15.500  1.00 41.40  ? 179  LEU E CA  1 
ATOM   8077  C C   . LEU E  1 179 ? 36.076  -7.344   15.955  1.00 35.06  ? 179  LEU E C   1 
ATOM   8078  O O   . LEU E  1 179 ? 36.028  -6.174   16.332  1.00 31.50  ? 179  LEU E O   1 
ATOM   8079  C CB  . LEU E  1 179 ? 34.314  -9.016   16.598  1.00 44.46  ? 179  LEU E CB  1 
ATOM   8080  C CG  . LEU E  1 179 ? 33.670  -8.484   17.879  1.00 45.38  ? 179  LEU E CG  1 
ATOM   8081  C CD1 . LEU E  1 179 ? 32.819  -9.583   18.478  1.00 49.03  ? 179  LEU E CD1 1 
ATOM   8082  C CD2 . LEU E  1 179 ? 34.708  -8.021   18.889  1.00 42.22  ? 179  LEU E CD2 1 
ATOM   8083  N N   . THR E  1 180 ? 37.202  -8.049   15.913  1.00 33.83  ? 180  THR E N   1 
ATOM   8084  C CA  . THR E  1 180 ? 38.476  -7.498   16.355  1.00 39.93  ? 180  THR E CA  1 
ATOM   8085  C C   . THR E  1 180 ? 38.984  -6.438   15.381  1.00 39.82  ? 180  THR E C   1 
ATOM   8086  O O   . THR E  1 180 ? 39.638  -5.474   15.782  1.00 35.67  ? 180  THR E O   1 
ATOM   8087  C CB  . THR E  1 180 ? 39.539  -8.603   16.511  1.00 40.07  ? 180  THR E CB  1 
ATOM   8088  O OG1 . THR E  1 180 ? 38.990  -9.697   17.257  1.00 40.94  ? 180  THR E OG1 1 
ATOM   8089  C CG2 . THR E  1 180 ? 40.765  -8.071   17.233  1.00 38.93  ? 180  THR E CG2 1 
ATOM   8090  N N   . GLN E  1 181 ? 38.677  -6.621   14.100  1.00 37.00  ? 181  GLN E N   1 
ATOM   8091  C CA  . GLN E  1 181 ? 39.064  -5.662   13.073  1.00 34.57  ? 181  GLN E CA  1 
ATOM   8092  C C   . GLN E  1 181 ? 38.366  -4.323   13.281  1.00 36.36  ? 181  GLN E C   1 
ATOM   8093  O O   . GLN E  1 181 ? 38.999  -3.268   13.236  1.00 40.53  ? 181  GLN E O   1 
ATOM   8094  C CB  . GLN E  1 181 ? 38.743  -6.206   11.679  1.00 33.90  ? 181  GLN E CB  1 
ATOM   8095  C CG  . GLN E  1 181 ? 39.606  -7.381   11.252  1.00 36.62  ? 181  GLN E CG  1 
ATOM   8096  C CD  . GLN E  1 181 ? 39.182  -7.954   9.914   1.00 42.30  ? 181  GLN E CD  1 
ATOM   8097  O OE1 . GLN E  1 181 ? 38.012  -7.882   9.538   1.00 45.01  ? 181  GLN E OE1 1 
ATOM   8098  N NE2 . GLN E  1 181 ? 40.134  -8.524   9.185   1.00 42.60  ? 181  GLN E NE2 1 
ATOM   8099  N N   . THR E  1 182 ? 37.059  -4.379   13.508  1.00 30.90  ? 182  THR E N   1 
ATOM   8100  C CA  . THR E  1 182 ? 36.259  -3.181   13.727  1.00 32.42  ? 182  THR E CA  1 
ATOM   8101  C C   . THR E  1 182 ? 36.712  -2.438   14.980  1.00 36.09  ? 182  THR E C   1 
ATOM   8102  O O   . THR E  1 182 ? 36.847  -1.214   14.975  1.00 41.30  ? 182  THR E O   1 
ATOM   8103  C CB  . THR E  1 182 ? 34.762  -3.524   13.848  1.00 30.64  ? 182  THR E CB  1 
ATOM   8104  O OG1 . THR E  1 182 ? 34.303  -4.103   12.620  1.00 29.38  ? 182  THR E OG1 1 
ATOM   8105  C CG2 . THR E  1 182 ? 33.946  -2.278   14.154  1.00 30.20  ? 182  THR E CG2 1 
ATOM   8106  N N   . ALA E  1 183 ? 36.950  -3.190   16.049  1.00 30.73  ? 183  ALA E N   1 
ATOM   8107  C CA  . ALA E  1 183 ? 37.401  -2.615   17.311  1.00 32.21  ? 183  ALA E CA  1 
ATOM   8108  C C   . ALA E  1 183 ? 38.762  -1.941   17.160  1.00 33.75  ? 183  ALA E C   1 
ATOM   8109  O O   . ALA E  1 183 ? 38.999  -0.871   17.719  1.00 37.35  ? 183  ALA E O   1 
ATOM   8110  C CB  . ALA E  1 183 ? 37.459  -3.686   18.387  1.00 27.94  ? 183  ALA E CB  1 
ATOM   8111  N N   . ALA E  1 184 ? 39.649  -2.573   16.397  1.00 32.22  ? 184  ALA E N   1 
ATOM   8112  C CA  . ALA E  1 184 ? 40.999  -2.059   16.194  1.00 33.96  ? 184  ALA E CA  1 
ATOM   8113  C C   . ALA E  1 184 ? 40.989  -0.701   15.500  1.00 38.28  ? 184  ALA E C   1 
ATOM   8114  O O   . ALA E  1 184 ? 41.826  0.157    15.782  1.00 40.44  ? 184  ALA E O   1 
ATOM   8115  C CB  . ALA E  1 184 ? 41.822  -3.050   15.393  1.00 30.63  ? 184  ALA E CB  1 
ATOM   8116  N N   . ARG E  1 185 ? 40.036  -0.511   14.594  1.00 37.87  ? 185  ARG E N   1 
ATOM   8117  C CA  . ARG E  1 185 ? 39.934  0.734    13.844  1.00 42.53  ? 185  ARG E CA  1 
ATOM   8118  C C   . ARG E  1 185 ? 39.307  1.842    14.686  1.00 42.10  ? 185  ARG E C   1 
ATOM   8119  O O   . ARG E  1 185 ? 39.632  3.019    14.519  1.00 41.84  ? 185  ARG E O   1 
ATOM   8120  C CB  . ARG E  1 185 ? 39.125  0.517    12.562  1.00 51.78  ? 185  ARG E CB  1 
ATOM   8121  C CG  . ARG E  1 185 ? 39.048  1.739    11.659  1.00 60.49  ? 185  ARG E CG  1 
ATOM   8122  C CD  . ARG E  1 185 ? 38.375  1.415    10.334  1.00 64.39  ? 185  ARG E CD  1 
ATOM   8123  N NE  . ARG E  1 185 ? 38.181  2.612    9.520   1.00 71.02  ? 185  ARG E NE  1 
ATOM   8124  C CZ  . ARG E  1 185 ? 37.673  2.608    8.292   1.00 76.07  ? 185  ARG E CZ  1 
ATOM   8125  N NH1 . ARG E  1 185 ? 37.307  1.465    7.727   1.00 75.37  ? 185  ARG E NH1 1 
ATOM   8126  N NH2 . ARG E  1 185 ? 37.533  3.747    7.627   1.00 80.37  ? 185  ARG E NH2 1 
ATOM   8127  N N   . GLU E  1 186 ? 38.414  1.462    15.595  1.00 42.31  ? 186  GLU E N   1 
ATOM   8128  C CA  . GLU E  1 186 ? 37.727  2.433    16.442  1.00 43.75  ? 186  GLU E CA  1 
ATOM   8129  C C   . GLU E  1 186 ? 38.569  2.843    17.647  1.00 40.74  ? 186  GLU E C   1 
ATOM   8130  O O   . GLU E  1 186 ? 38.503  3.985    18.101  1.00 41.35  ? 186  GLU E O   1 
ATOM   8131  C CB  . GLU E  1 186 ? 36.385  1.875    16.922  1.00 43.96  ? 186  GLU E CB  1 
ATOM   8132  C CG  . GLU E  1 186 ? 35.380  1.606    15.814  1.00 52.55  ? 186  GLU E CG  1 
ATOM   8133  C CD  . GLU E  1 186 ? 33.999  1.278    16.349  1.00 59.36  ? 186  GLU E CD  1 
ATOM   8134  O OE1 . GLU E  1 186 ? 33.712  1.630    17.513  1.00 61.12  ? 186  GLU E OE1 1 
ATOM   8135  O OE2 . GLU E  1 186 ? 33.199  0.668    15.609  1.00 63.55  ? 186  GLU E OE2 1 
ATOM   8136  N N   . LEU E  1 187 ? 39.359  1.906    18.160  1.00 39.55  ? 187  LEU E N   1 
ATOM   8137  C CA  . LEU E  1 187 ? 40.119  2.132    19.384  1.00 39.00  ? 187  LEU E CA  1 
ATOM   8138  C C   . LEU E  1 187 ? 41.571  2.513    19.115  1.00 42.75  ? 187  LEU E C   1 
ATOM   8139  O O   . LEU E  1 187 ? 42.343  2.738    20.049  1.00 49.77  ? 187  LEU E O   1 
ATOM   8140  C CB  . LEU E  1 187 ? 40.069  0.886    20.268  1.00 35.81  ? 187  LEU E CB  1 
ATOM   8141  C CG  . LEU E  1 187 ? 38.676  0.422    20.691  1.00 39.37  ? 187  LEU E CG  1 
ATOM   8142  C CD1 . LEU E  1 187 ? 38.752  -0.936   21.367  1.00 40.92  ? 187  LEU E CD1 1 
ATOM   8143  C CD2 . LEU E  1 187 ? 38.025  1.447    21.607  1.00 43.81  ? 187  LEU E CD2 1 
ATOM   8144  N N   . GLY E  1 188 ? 41.940  2.582    17.840  1.00 41.65  ? 188  GLY E N   1 
ATOM   8145  C CA  . GLY E  1 188 ? 43.296  2.928    17.457  1.00 36.17  ? 188  GLY E CA  1 
ATOM   8146  C C   . GLY E  1 188 ? 43.697  4.315    17.920  1.00 41.56  ? 188  GLY E C   1 
ATOM   8147  O O   . GLY E  1 188 ? 44.836  4.539    18.327  1.00 48.71  ? 188  GLY E O   1 
ATOM   8148  N N   . ARG E  1 189 ? 42.753  5.250    17.861  1.00 42.32  ? 189  ARG E N   1 
ATOM   8149  C CA  . ARG E  1 189 ? 43.011  6.625    18.270  1.00 44.87  ? 189  ARG E CA  1 
ATOM   8150  C C   . ARG E  1 189 ? 42.973  6.771    19.788  1.00 44.75  ? 189  ARG E C   1 
ATOM   8151  O O   . ARG E  1 189 ? 43.293  7.830    20.328  1.00 46.83  ? 189  ARG E O   1 
ATOM   8152  C CB  . ARG E  1 189 ? 41.999  7.573    17.628  1.00 52.52  ? 189  ARG E CB  1 
ATOM   8153  C CG  . ARG E  1 189 ? 40.553  7.271    17.984  1.00 57.94  ? 189  ARG E CG  1 
ATOM   8154  C CD  . ARG E  1 189 ? 39.638  8.385    17.510  1.00 67.73  ? 189  ARG E CD  1 
ATOM   8155  N NE  . ARG E  1 189 ? 40.039  9.676    18.062  1.00 75.65  ? 189  ARG E NE  1 
ATOM   8156  C CZ  . ARG E  1 189 ? 39.198  10.558   18.591  1.00 81.85  ? 189  ARG E CZ  1 
ATOM   8157  N NH1 . ARG E  1 189 ? 37.899  10.292   18.639  1.00 83.33  ? 189  ARG E NH1 1 
ATOM   8158  N NH2 . ARG E  1 189 ? 39.654  11.707   19.070  1.00 85.64  ? 189  ARG E NH2 1 
ATOM   8159  N N   . HIS E  1 190 ? 42.575  5.701    20.469  1.00 39.69  ? 190  HIS E N   1 
ATOM   8160  C CA  . HIS E  1 190 ? 42.522  5.694    21.926  1.00 37.44  ? 190  HIS E CA  1 
ATOM   8161  C C   . HIS E  1 190 ? 43.720  4.959    22.514  1.00 36.47  ? 190  HIS E C   1 
ATOM   8162  O O   . HIS E  1 190 ? 43.771  4.698    23.716  1.00 37.56  ? 190  HIS E O   1 
ATOM   8163  C CB  . HIS E  1 190 ? 41.220  5.054    22.411  1.00 39.93  ? 190  HIS E CB  1 
ATOM   8164  C CG  . HIS E  1 190 ? 40.002  5.878    22.134  1.00 48.24  ? 190  HIS E CG  1 
ATOM   8165  N ND1 . HIS E  1 190 ? 38.760  5.322    21.913  1.00 52.65  ? 190  HIS E ND1 1 
ATOM   8166  C CD2 . HIS E  1 190 ? 39.833  7.219    22.049  1.00 52.02  ? 190  HIS E CD2 1 
ATOM   8167  C CE1 . HIS E  1 190 ? 37.880  6.284    21.700  1.00 57.95  ? 190  HIS E CE1 1 
ATOM   8168  N NE2 . HIS E  1 190 ? 38.506  7.445    21.777  1.00 56.48  ? 190  HIS E NE2 1 
ATOM   8169  N N   . GLY E  1 191 ? 44.682  4.626    21.659  1.00 30.95  ? 191  GLY E N   1 
ATOM   8170  C CA  . GLY E  1 191 ? 45.885  3.939    22.092  1.00 34.86  ? 191  GLY E CA  1 
ATOM   8171  C C   . GLY E  1 191 ? 45.640  2.488    22.458  1.00 34.14  ? 191  GLY E C   1 
ATOM   8172  O O   . GLY E  1 191 ? 46.425  1.881    23.187  1.00 33.23  ? 191  GLY E O   1 
ATOM   8173  N N   . ILE E  1 192 ? 44.546  1.930    21.949  1.00 32.86  ? 192  ILE E N   1 
ATOM   8174  C CA  . ILE E  1 192 ? 44.193  0.544    22.232  1.00 35.87  ? 192  ILE E CA  1 
ATOM   8175  C C   . ILE E  1 192 ? 44.371  -0.332   20.997  1.00 38.29  ? 192  ILE E C   1 
ATOM   8176  O O   . ILE E  1 192 ? 43.752  -0.091   19.961  1.00 39.52  ? 192  ILE E O   1 
ATOM   8177  C CB  . ILE E  1 192 ? 42.742  0.420    22.730  1.00 34.74  ? 192  ILE E CB  1 
ATOM   8178  C CG1 . ILE E  1 192 ? 42.517  1.316    23.950  1.00 32.91  ? 192  ILE E CG1 1 
ATOM   8179  C CG2 . ILE E  1 192 ? 42.413  -1.029   23.056  1.00 30.39  ? 192  ILE E CG2 1 
ATOM   8180  C CD1 . ILE E  1 192 ? 41.104  1.274    24.483  1.00 28.83  ? 192  ILE E CD1 1 
ATOM   8181  N N   . ARG E  1 193 ? 45.219  -1.348   21.114  1.00 42.75  ? 193  ARG E N   1 
ATOM   8182  C CA  . ARG E  1 193 ? 45.466  -2.268   20.010  1.00 42.16  ? 193  ARG E CA  1 
ATOM   8183  C C   . ARG E  1 193 ? 44.577  -3.504   20.116  1.00 41.50  ? 193  ARG E C   1 
ATOM   8184  O O   . ARG E  1 193 ? 44.289  -3.983   21.213  1.00 37.04  ? 193  ARG E O   1 
ATOM   8185  C CB  . ARG E  1 193 ? 46.941  -2.676   19.971  1.00 41.42  ? 193  ARG E CB  1 
ATOM   8186  C CG  . ARG E  1 193 ? 47.894  -1.521   19.699  1.00 39.22  ? 193  ARG E CG  1 
ATOM   8187  C CD  . ARG E  1 193 ? 49.339  -1.986   19.576  1.00 37.09  ? 193  ARG E CD  1 
ATOM   8188  N NE  . ARG E  1 193 ? 49.893  -2.447   20.847  1.00 40.63  ? 193  ARG E NE  1 
ATOM   8189  C CZ  . ARG E  1 193 ? 50.075  -3.725   21.167  1.00 39.45  ? 193  ARG E CZ  1 
ATOM   8190  N NH1 . ARG E  1 193 ? 49.750  -4.680   20.306  1.00 39.33  ? 193  ARG E NH1 1 
ATOM   8191  N NH2 . ARG E  1 193 ? 50.587  -4.049   22.346  1.00 36.61  ? 193  ARG E NH2 1 
ATOM   8192  N N   . CYS E  1 194 ? 44.138  -4.011   18.968  1.00 38.12  ? 194  CYS E N   1 
ATOM   8193  C CA  . CYS E  1 194 ? 43.270  -5.181   18.932  1.00 40.64  ? 194  CYS E CA  1 
ATOM   8194  C C   . CYS E  1 194 ? 43.709  -6.159   17.847  1.00 40.34  ? 194  CYS E C   1 
ATOM   8195  O O   . CYS E  1 194 ? 43.802  -5.798   16.674  1.00 41.22  ? 194  CYS E O   1 
ATOM   8196  C CB  . CYS E  1 194 ? 41.816  -4.760   18.706  1.00 42.52  ? 194  CYS E CB  1 
ATOM   8197  S SG  . CYS E  1 194 ? 41.181  -3.589   19.929  1.00 67.66  ? 194  CYS E SG  1 
ATOM   8198  N N   . ASN E  1 195 ? 43.980  -7.399   18.244  1.00 36.77  ? 195  ASN E N   1 
ATOM   8199  C CA  . ASN E  1 195 ? 44.447  -8.417   17.309  1.00 34.72  ? 195  ASN E CA  1 
ATOM   8200  C C   . ASN E  1 195 ? 43.821  -9.782   17.560  1.00 33.97  ? 195  ASN E C   1 
ATOM   8201  O O   . ASN E  1 195 ? 43.311  -10.054  18.646  1.00 30.26  ? 195  ASN E O   1 
ATOM   8202  C CB  . ASN E  1 195 ? 45.969  -8.536   17.371  1.00 35.37  ? 195  ASN E CB  1 
ATOM   8203  C CG  . ASN E  1 195 ? 46.668  -7.263   16.953  1.00 39.77  ? 195  ASN E CG  1 
ATOM   8204  O OD1 . ASN E  1 195 ? 46.854  -7.009   15.765  1.00 43.40  ? 195  ASN E OD1 1 
ATOM   8205  N ND2 . ASN E  1 195 ? 47.060  -6.453   17.930  1.00 42.04  ? 195  ASN E ND2 1 
ATOM   8206  N N   . SER E  1 196 ? 43.869  -10.639  16.545  1.00 36.51  ? 196  SER E N   1 
ATOM   8207  C CA  . SER E  1 196 ? 43.319  -11.983  16.656  1.00 33.95  ? 196  SER E CA  1 
ATOM   8208  C C   . SER E  1 196 ? 44.407  -13.042  16.541  1.00 25.70  ? 196  SER E C   1 
ATOM   8209  O O   . SER E  1 196 ? 45.313  -12.934  15.716  1.00 25.83  ? 196  SER E O   1 
ATOM   8210  C CB  . SER E  1 196 ? 42.251  -12.220  15.585  1.00 33.31  ? 196  SER E CB  1 
ATOM   8211  O OG  . SER E  1 196 ? 41.128  -11.381  15.782  1.00 32.22  ? 196  SER E OG  1 
ATOM   8212  N N   . VAL E  1 197 ? 44.311  -14.064  17.384  1.00 27.78  ? 197  VAL E N   1 
ATOM   8213  C CA  . VAL E  1 197 ? 45.194  -15.216  17.290  1.00 34.74  ? 197  VAL E CA  1 
ATOM   8214  C C   . VAL E  1 197 ? 44.419  -16.375  16.683  1.00 31.65  ? 197  VAL E C   1 
ATOM   8215  O O   . VAL E  1 197 ? 43.307  -16.677  17.115  1.00 29.70  ? 197  VAL E O   1 
ATOM   8216  C CB  . VAL E  1 197 ? 45.760  -15.622  18.664  1.00 39.35  ? 197  VAL E CB  1 
ATOM   8217  C CG1 . VAL E  1 197 ? 46.679  -16.826  18.527  1.00 25.36  ? 197  VAL E CG1 1 
ATOM   8218  C CG2 . VAL E  1 197 ? 46.500  -14.455  19.298  1.00 25.57  ? 197  VAL E CG2 1 
ATOM   8219  N N   . LEU E  1 198 ? 44.997  -17.010  15.670  1.00 25.28  ? 198  LEU E N   1 
ATOM   8220  C CA  . LEU E  1 198 ? 44.325  -18.099  14.970  1.00 31.41  ? 198  LEU E CA  1 
ATOM   8221  C C   . LEU E  1 198 ? 45.093  -19.406  15.116  1.00 28.63  ? 198  LEU E C   1 
ATOM   8222  O O   . LEU E  1 198 ? 45.849  -19.786  14.224  1.00 33.23  ? 198  LEU E O   1 
ATOM   8223  C CB  . LEU E  1 198 ? 44.147  -17.759  13.486  1.00 37.07  ? 198  LEU E CB  1 
ATOM   8224  C CG  . LEU E  1 198 ? 42.965  -16.877  13.071  1.00 39.74  ? 198  LEU E CG  1 
ATOM   8225  C CD1 . LEU E  1 198 ? 43.085  -15.461  13.617  1.00 44.39  ? 198  LEU E CD1 1 
ATOM   8226  C CD2 . LEU E  1 198 ? 42.828  -16.854  11.555  1.00 36.98  ? 198  LEU E CD2 1 
ATOM   8227  N N   . PRO E  1 199 ? 44.898  -20.101  16.246  1.00 25.11  ? 199  PRO E N   1 
ATOM   8228  C CA  . PRO E  1 199 ? 45.611  -21.354  16.507  1.00 38.23  ? 199  PRO E CA  1 
ATOM   8229  C C   . PRO E  1 199 ? 45.111  -22.492  15.626  1.00 25.12  ? 199  PRO E C   1 
ATOM   8230  O O   . PRO E  1 199 ? 43.942  -22.502  15.247  1.00 36.83  ? 199  PRO E O   1 
ATOM   8231  C CB  . PRO E  1 199 ? 45.303  -21.640  17.986  1.00 36.21  ? 199  PRO E CB  1 
ATOM   8232  C CG  . PRO E  1 199 ? 44.688  -20.377  18.527  1.00 31.02  ? 199  PRO E CG  1 
ATOM   8233  C CD  . PRO E  1 199 ? 44.012  -19.738  17.362  1.00 25.20  ? 199  PRO E CD  1 
ATOM   8234  N N   . GLY E  1 200 ? 45.992  -23.432  15.302  1.00 36.02  ? 200  GLY E N   1 
ATOM   8235  C CA  . GLY E  1 200 ? 45.599  -24.631  14.586  1.00 33.18  ? 200  GLY E CA  1 
ATOM   8236  C C   . GLY E  1 200 ? 45.041  -25.638  15.570  1.00 31.03  ? 200  GLY E C   1 
ATOM   8237  O O   . GLY E  1 200 ? 44.073  -25.353  16.268  1.00 36.84  ? 200  GLY E O   1 
ATOM   8238  N N   . PHE E  1 201 ? 45.653  -26.816  15.635  1.00 30.87  ? 201  PHE E N   1 
ATOM   8239  C CA  . PHE E  1 201 ? 45.269  -27.814  16.627  1.00 29.74  ? 201  PHE E CA  1 
ATOM   8240  C C   . PHE E  1 201 ? 46.304  -27.882  17.744  1.00 34.46  ? 201  PHE E C   1 
ATOM   8241  O O   . PHE E  1 201 ? 47.478  -28.169  17.509  1.00 34.21  ? 201  PHE E O   1 
ATOM   8242  C CB  . PHE E  1 201 ? 45.081  -29.186  15.979  1.00 29.41  ? 201  PHE E CB  1 
ATOM   8243  C CG  . PHE E  1 201 ? 43.787  -29.324  15.229  1.00 36.66  ? 201  PHE E CG  1 
ATOM   8244  C CD1 . PHE E  1 201 ? 42.632  -29.724  15.882  1.00 39.55  ? 201  PHE E CD1 1 
ATOM   8245  C CD2 . PHE E  1 201 ? 43.722  -29.046  13.874  1.00 36.19  ? 201  PHE E CD2 1 
ATOM   8246  C CE1 . PHE E  1 201 ? 41.438  -29.848  15.197  1.00 40.68  ? 201  PHE E CE1 1 
ATOM   8247  C CE2 . PHE E  1 201 ? 42.531  -29.170  13.183  1.00 39.80  ? 201  PHE E CE2 1 
ATOM   8248  C CZ  . PHE E  1 201 ? 41.387  -29.571  13.845  1.00 39.81  ? 201  PHE E CZ  1 
ATOM   8249  N N   . ILE E  1 202 ? 45.850  -27.616  18.963  1.00 35.87  ? 202  ILE E N   1 
ATOM   8250  C CA  . ILE E  1 202 ? 46.730  -27.482  20.116  1.00 33.57  ? 202  ILE E CA  1 
ATOM   8251  C C   . ILE E  1 202 ? 46.474  -28.590  21.137  1.00 36.59  ? 202  ILE E C   1 
ATOM   8252  O O   . ILE E  1 202 ? 45.343  -29.047  21.284  1.00 44.38  ? 202  ILE E O   1 
ATOM   8253  C CB  . ILE E  1 202 ? 46.535  -26.107  20.790  1.00 29.72  ? 202  ILE E CB  1 
ATOM   8254  C CG1 . ILE E  1 202 ? 46.344  -25.013  19.735  1.00 25.61  ? 202  ILE E CG1 1 
ATOM   8255  C CG2 . ILE E  1 202 ? 47.694  -25.781  21.714  1.00 31.23  ? 202  ILE E CG2 1 
ATOM   8256  C CD1 . ILE E  1 202 ? 47.554  -24.779  18.857  1.00 25.57  ? 202  ILE E CD1 1 
ATOM   8257  N N   . ALA E  1 203 ? 47.516  -29.016  21.845  1.00 38.46  ? 203  ALA E N   1 
ATOM   8258  C CA  . ALA E  1 203 ? 47.368  -30.044  22.871  1.00 43.31  ? 203  ALA E CA  1 
ATOM   8259  C C   . ALA E  1 203 ? 46.640  -29.500  24.102  1.00 46.43  ? 203  ALA E C   1 
ATOM   8260  O O   . ALA E  1 203 ? 47.246  -29.295  25.155  1.00 50.11  ? 203  ALA E O   1 
ATOM   8261  C CB  . ALA E  1 203 ? 48.729  -30.604  23.265  1.00 43.75  ? 203  ALA E CB  1 
ATOM   8262  N N   . THR E  1 204 ? 45.338  -29.268  23.957  1.00 47.40  ? 204  THR E N   1 
ATOM   8263  C CA  . THR E  1 204 ? 44.508  -28.745  25.039  1.00 48.29  ? 204  THR E CA  1 
ATOM   8264  C C   . THR E  1 204 ? 43.335  -29.692  25.320  1.00 48.67  ? 204  THR E C   1 
ATOM   8265  O O   . THR E  1 204 ? 43.005  -30.529  24.479  1.00 54.88  ? 204  THR E O   1 
ATOM   8266  C CB  . THR E  1 204 ? 43.963  -27.336  24.699  1.00 49.87  ? 204  THR E CB  1 
ATOM   8267  O OG1 . THR E  1 204 ? 42.919  -27.439  23.720  1.00 55.54  ? 204  THR E OG1 1 
ATOM   8268  C CG2 . THR E  1 204 ? 45.073  -26.437  24.171  1.00 46.17  ? 204  THR E CG2 1 
ATOM   8269  N N   . PRO E  1 205 ? 42.710  -29.578  26.510  1.00 43.47  ? 205  PRO E N   1 
ATOM   8270  C CA  . PRO E  1 205 ? 41.530  -30.388  26.845  1.00 43.14  ? 205  PRO E CA  1 
ATOM   8271  C C   . PRO E  1 205 ? 40.416  -30.355  25.796  1.00 45.66  ? 205  PRO E C   1 
ATOM   8272  O O   . PRO E  1 205 ? 39.634  -31.302  25.712  1.00 50.79  ? 205  PRO E O   1 
ATOM   8273  C CB  . PRO E  1 205 ? 41.047  -29.760  28.151  1.00 39.67  ? 205  PRO E CB  1 
ATOM   8274  C CG  . PRO E  1 205 ? 42.293  -29.297  28.800  1.00 38.74  ? 205  PRO E CG  1 
ATOM   8275  C CD  . PRO E  1 205 ? 43.196  -28.829  27.684  1.00 41.70  ? 205  PRO E CD  1 
ATOM   8276  N N   . MET E  1 206 ? 40.346  -29.284  25.013  1.00 43.25  ? 206  MET E N   1 
ATOM   8277  C CA  . MET E  1 206 ? 39.342  -29.178  23.963  1.00 45.92  ? 206  MET E CA  1 
ATOM   8278  C C   . MET E  1 206 ? 39.646  -30.148  22.824  1.00 46.59  ? 206  MET E C   1 
ATOM   8279  O O   . MET E  1 206 ? 38.735  -30.666  22.178  1.00 45.17  ? 206  MET E O   1 
ATOM   8280  C CB  . MET E  1 206 ? 39.267  -27.746  23.432  1.00 48.65  ? 206  MET E CB  1 
ATOM   8281  C CG  . MET E  1 206 ? 37.942  -27.399  22.774  1.00 50.78  ? 206  MET E CG  1 
ATOM   8282  S SD  . MET E  1 206 ? 37.929  -25.743  22.063  1.00 47.52  ? 206  MET E SD  1 
ATOM   8283  C CE  . MET E  1 206 ? 38.939  -26.002  20.608  1.00 70.54  ? 206  MET E CE  1 
ATOM   8284  N N   . THR E  1 207 ? 40.932  -30.391  22.587  1.00 46.33  ? 207  THR E N   1 
ATOM   8285  C CA  . THR E  1 207 ? 41.362  -31.304  21.534  1.00 49.41  ? 207  THR E CA  1 
ATOM   8286  C C   . THR E  1 207 ? 41.327  -32.747  22.036  1.00 50.18  ? 207  THR E C   1 
ATOM   8287  O O   . THR E  1 207 ? 41.397  -33.694  21.253  1.00 50.84  ? 207  THR E O   1 
ATOM   8288  C CB  . THR E  1 207 ? 42.780  -30.958  21.031  1.00 47.83  ? 207  THR E CB  1 
ATOM   8289  O OG1 . THR E  1 207 ? 42.897  -29.539  20.870  1.00 47.40  ? 207  THR E OG1 1 
ATOM   8290  C CG2 . THR E  1 207 ? 43.069  -31.636  19.697  1.00 46.73  ? 207  THR E CG2 1 
ATOM   8291  N N   . GLN E  1 208 ? 41.208  -32.909  23.349  1.00 51.60  ? 208  GLN E N   1 
ATOM   8292  C CA  . GLN E  1 208 ? 41.068  -34.234  23.940  1.00 49.82  ? 208  GLN E CA  1 
ATOM   8293  C C   . GLN E  1 208 ? 39.681  -34.797  23.649  1.00 47.11  ? 208  GLN E C   1 
ATOM   8294  O O   . GLN E  1 208 ? 39.432  -35.990  23.823  1.00 49.25  ? 208  GLN E O   1 
ATOM   8295  C CB  . GLN E  1 208 ? 41.318  -34.185  25.447  1.00 53.38  ? 208  GLN E CB  1 
ATOM   8296  C CG  . GLN E  1 208 ? 42.718  -33.730  25.821  1.00 59.02  ? 208  GLN E CG  1 
ATOM   8297  C CD  . GLN E  1 208 ? 42.959  -33.761  27.316  1.00 63.75  ? 208  GLN E CD  1 
ATOM   8298  O OE1 . GLN E  1 208 ? 42.198  -34.372  28.066  1.00 66.39  ? 208  GLN E OE1 1 
ATOM   8299  N NE2 . GLN E  1 208 ? 44.021  -33.097  27.758  1.00 64.16  ? 208  GLN E NE2 1 
ATOM   8300  N N   . LYS E  1 209 ? 38.783  -33.925  23.202  1.00 41.63  ? 209  LYS E N   1 
ATOM   8301  C CA  . LYS E  1 209 ? 37.448  -34.333  22.786  1.00 43.04  ? 209  LYS E CA  1 
ATOM   8302  C C   . LYS E  1 209 ? 37.471  -34.831  21.345  1.00 38.77  ? 209  LYS E C   1 
ATOM   8303  O O   . LYS E  1 209 ? 36.442  -35.210  20.791  1.00 39.55  ? 209  LYS E O   1 
ATOM   8304  C CB  . LYS E  1 209 ? 36.459  -33.176  22.934  1.00 42.02  ? 209  LYS E CB  1 
ATOM   8305  N N   . VAL E  1 210 ? 38.655  -34.815  20.742  1.00 43.46  ? 210  VAL E N   1 
ATOM   8306  C CA  . VAL E  1 210 ? 38.851  -35.344  19.398  1.00 45.31  ? 210  VAL E CA  1 
ATOM   8307  C C   . VAL E  1 210 ? 39.459  -36.739  19.487  1.00 48.41  ? 210  VAL E C   1 
ATOM   8308  O O   . VAL E  1 210 ? 40.471  -36.928  20.162  1.00 53.31  ? 210  VAL E O   1 
ATOM   8309  C CB  . VAL E  1 210 ? 39.767  -34.430  18.556  1.00 43.65  ? 210  VAL E CB  1 
ATOM   8310  C CG1 . VAL E  1 210 ? 39.954  -34.996  17.158  1.00 43.30  ? 210  VAL E CG1 1 
ATOM   8311  C CG2 . VAL E  1 210 ? 39.200  -33.021  18.493  1.00 44.01  ? 210  VAL E CG2 1 
ATOM   8312  N N   . PRO E  1 211 ? 38.835  -37.724  18.818  1.00 42.71  ? 211  PRO E N   1 
ATOM   8313  C CA  . PRO E  1 211 ? 39.316  -39.111  18.819  1.00 41.47  ? 211  PRO E CA  1 
ATOM   8314  C C   . PRO E  1 211 ? 40.791  -39.215  18.442  1.00 42.97  ? 211  PRO E C   1 
ATOM   8315  O O   . PRO E  1 211 ? 41.241  -38.503  17.543  1.00 45.95  ? 211  PRO E O   1 
ATOM   8316  C CB  . PRO E  1 211 ? 38.433  -39.787  17.768  1.00 36.93  ? 211  PRO E CB  1 
ATOM   8317  C CG  . PRO E  1 211 ? 37.175  -38.992  17.780  1.00 35.92  ? 211  PRO E CG  1 
ATOM   8318  C CD  . PRO E  1 211 ? 37.594  -37.572  18.036  1.00 39.57  ? 211  PRO E CD  1 
ATOM   8319  N N   . GLN E  1 212 ? 41.525  -40.086  19.130  1.00 51.40  ? 212  GLN E N   1 
ATOM   8320  C CA  . GLN E  1 212 ? 42.958  -40.259  18.900  1.00 57.53  ? 212  GLN E CA  1 
ATOM   8321  C C   . GLN E  1 212 ? 43.247  -40.586  17.438  1.00 61.57  ? 212  GLN E C   1 
ATOM   8322  O O   . GLN E  1 212 ? 44.287  -40.209  16.898  1.00 64.20  ? 212  GLN E O   1 
ATOM   8323  C CB  . GLN E  1 212 ? 43.517  -41.357  19.808  1.00 60.72  ? 212  GLN E CB  1 
ATOM   8324  C CG  . GLN E  1 212 ? 45.026  -41.519  19.730  1.00 65.85  ? 212  GLN E CG  1 
ATOM   8325  C CD  . GLN E  1 212 ? 45.766  -40.304  20.251  1.00 73.19  ? 212  GLN E CD  1 
ATOM   8326  O OE1 . GLN E  1 212 ? 45.515  -39.841  21.363  1.00 77.82  ? 212  GLN E OE1 1 
ATOM   8327  N NE2 . GLN E  1 212 ? 46.679  -39.775  19.444  1.00 74.70  ? 212  GLN E NE2 1 
ATOM   8328  N N   . LYS E  1 213 ? 42.312  -41.287  16.807  1.00 64.29  ? 213  LYS E N   1 
ATOM   8329  C CA  . LYS E  1 213 ? 42.379  -41.567  15.379  1.00 67.18  ? 213  LYS E CA  1 
ATOM   8330  C C   . LYS E  1 213 ? 42.397  -40.287  14.555  1.00 63.71  ? 213  LYS E C   1 
ATOM   8331  O O   . LYS E  1 213 ? 43.296  -40.071  13.739  1.00 68.63  ? 213  LYS E O   1 
ATOM   8332  C CB  . LYS E  1 213 ? 41.195  -42.431  14.954  1.00 76.07  ? 213  LYS E CB  1 
ATOM   8333  C CG  . LYS E  1 213 ? 41.443  -43.916  15.092  1.00 82.36  ? 213  LYS E CG  1 
ATOM   8334  C CD  . LYS E  1 213 ? 42.587  -44.343  14.188  1.00 88.54  ? 213  LYS E CD  1 
ATOM   8335  C CE  . LYS E  1 213 ? 42.825  -45.843  14.249  1.00 95.88  ? 213  LYS E CE  1 
ATOM   8336  N NZ  . LYS E  1 213 ? 43.935  -46.275  13.351  1.00 100.38 ? 213  LYS E NZ  1 
ATOM   8337  N N   . VAL E  1 214 ? 41.388  -39.450  14.772  1.00 58.69  ? 214  VAL E N   1 
ATOM   8338  C CA  . VAL E  1 214 ? 41.259  -38.189  14.057  1.00 56.09  ? 214  VAL E CA  1 
ATOM   8339  C C   . VAL E  1 214 ? 42.455  -37.290  14.344  1.00 52.00  ? 214  VAL E C   1 
ATOM   8340  O O   . VAL E  1 214 ? 42.955  -36.607  13.451  1.00 54.01  ? 214  VAL E O   1 
ATOM   8341  C CB  . VAL E  1 214 ? 39.957  -37.457  14.437  1.00 54.58  ? 214  VAL E CB  1 
ATOM   8342  C CG1 . VAL E  1 214 ? 39.801  -36.190  13.612  1.00 52.30  ? 214  VAL E CG1 1 
ATOM   8343  C CG2 . VAL E  1 214 ? 38.756  -38.373  14.245  1.00 57.63  ? 214  VAL E CG2 1 
ATOM   8344  N N   . VAL E  1 215 ? 42.915  -37.306  15.591  1.00 46.68  ? 215  VAL E N   1 
ATOM   8345  C CA  . VAL E  1 215 ? 44.096  -36.545  15.987  1.00 44.51  ? 215  VAL E CA  1 
ATOM   8346  C C   . VAL E  1 215 ? 45.319  -36.976  15.180  1.00 46.53  ? 215  VAL E C   1 
ATOM   8347  O O   . VAL E  1 215 ? 46.064  -36.138  14.669  1.00 49.97  ? 215  VAL E O   1 
ATOM   8348  C CB  . VAL E  1 215 ? 44.395  -36.708  17.491  1.00 43.30  ? 215  VAL E CB  1 
ATOM   8349  C CG1 . VAL E  1 215 ? 45.752  -36.111  17.838  1.00 47.18  ? 215  VAL E CG1 1 
ATOM   8350  C CG2 . VAL E  1 215 ? 43.295  -36.066  18.323  1.00 38.92  ? 215  VAL E CG2 1 
ATOM   8351  N N   . ASP E  1 216 ? 45.512  -38.287  15.063  1.00 44.12  ? 216  ASP E N   1 
ATOM   8352  C CA  . ASP E  1 216 ? 46.631  -38.832  14.301  1.00 44.42  ? 216  ASP E CA  1 
ATOM   8353  C C   . ASP E  1 216 ? 46.510  -38.498  12.821  1.00 41.57  ? 216  ASP E C   1 
ATOM   8354  O O   . ASP E  1 216 ? 47.514  -38.311  12.136  1.00 39.71  ? 216  ASP E O   1 
ATOM   8355  C CB  . ASP E  1 216 ? 46.723  -40.346  14.488  1.00 52.41  ? 216  ASP E CB  1 
ATOM   8356  C CG  . ASP E  1 216 ? 47.174  -40.733  15.880  1.00 60.78  ? 216  ASP E CG  1 
ATOM   8357  O OD1 . ASP E  1 216 ? 47.890  -39.931  16.519  1.00 58.47  ? 216  ASP E OD1 1 
ATOM   8358  O OD2 . ASP E  1 216 ? 46.815  -41.839  16.336  1.00 66.91  ? 216  ASP E OD2 1 
ATOM   8359  N N   . LYS E  1 217 ? 45.278  -38.426  12.331  1.00 40.05  ? 217  LYS E N   1 
ATOM   8360  C CA  . LYS E  1 217 ? 45.037  -38.038  10.948  1.00 45.77  ? 217  LYS E CA  1 
ATOM   8361  C C   . LYS E  1 217 ? 45.331  -36.550  10.767  1.00 46.23  ? 217  LYS E C   1 
ATOM   8362  O O   . LYS E  1 217 ? 45.888  -36.134  9.748   1.00 48.60  ? 217  LYS E O   1 
ATOM   8363  C CB  . LYS E  1 217 ? 43.598  -38.354  10.541  1.00 48.31  ? 217  LYS E CB  1 
ATOM   8364  N N   . ILE E  1 218 ? 44.964  -35.753  11.768  1.00 46.28  ? 218  ILE E N   1 
ATOM   8365  C CA  . ILE E  1 218 ? 45.248  -34.316  11.762  1.00 44.63  ? 218  ILE E CA  1 
ATOM   8366  C C   . ILE E  1 218 ? 46.761  -34.049  11.820  1.00 45.81  ? 218  ILE E C   1 
ATOM   8367  O O   . ILE E  1 218 ? 47.278  -33.194  11.103  1.00 50.50  ? 218  ILE E O   1 
ATOM   8368  C CB  . ILE E  1 218 ? 44.549  -33.604  12.946  1.00 42.11  ? 218  ILE E CB  1 
ATOM   8369  C CG1 . ILE E  1 218 ? 43.038  -33.538  12.724  1.00 43.39  ? 218  ILE E CG1 1 
ATOM   8370  C CG2 . ILE E  1 218 ? 45.100  -32.204  13.141  1.00 40.35  ? 218  ILE E CG2 1 
ATOM   8371  C CD1 . ILE E  1 218 ? 42.256  -33.049  13.931  1.00 44.89  ? 218  ILE E CD1 1 
ATOM   8372  N N   . THR E  1 219 ? 47.460  -34.796  12.674  1.00 45.10  ? 219  THR E N   1 
ATOM   8373  C CA  . THR E  1 219 ? 48.916  -34.699  12.835  1.00 50.39  ? 219  THR E CA  1 
ATOM   8374  C C   . THR E  1 219 ? 49.649  -34.904  11.513  1.00 55.18  ? 219  THR E C   1 
ATOM   8375  O O   . THR E  1 219 ? 50.661  -34.243  11.230  1.00 56.51  ? 219  THR E O   1 
ATOM   8376  C CB  . THR E  1 219 ? 49.421  -35.733  13.871  1.00 54.89  ? 219  THR E CB  1 
ATOM   8377  O OG1 . THR E  1 219 ? 49.143  -35.253  15.192  1.00 52.17  ? 219  THR E OG1 1 
ATOM   8378  C CG2 . THR E  1 219 ? 50.916  -35.983  13.729  1.00 60.98  ? 219  THR E CG2 1 
ATOM   8379  N N   . GLU E  1 220 ? 49.130  -35.842  10.722  1.00 58.02  ? 220  GLU E N   1 
ATOM   8380  C CA  . GLU E  1 220 ? 49.644  -36.128  9.386   1.00 60.56  ? 220  GLU E CA  1 
ATOM   8381  C C   . GLU E  1 220 ? 49.378  -34.953  8.441   1.00 56.99  ? 220  GLU E C   1 
ATOM   8382  O O   . GLU E  1 220 ? 50.142  -34.692  7.517   1.00 58.71  ? 220  GLU E O   1 
ATOM   8383  C CB  . GLU E  1 220 ? 49.015  -37.411  8.836   1.00 67.84  ? 220  GLU E CB  1 
ATOM   8384  C CG  . GLU E  1 220 ? 49.432  -38.692  9.587   1.00 76.97  ? 220  GLU E CG  1 
ATOM   8385  C CD  . GLU E  1 220 ? 48.932  -39.953  8.897   1.00 87.34  ? 220  GLU E CD  1 
ATOM   8386  O OE1 . GLU E  1 220 ? 49.220  -40.123  7.691   1.00 94.90  ? 220  GLU E OE1 1 
ATOM   8387  O OE2 . GLU E  1 220 ? 48.276  -40.785  9.560   1.00 88.26  ? 220  GLU E OE2 1 
ATOM   8388  N N   . MET E  1 221 ? 48.281  -34.246  8.686   1.00 51.72  ? 221  MET E N   1 
ATOM   8389  C CA  . MET E  1 221 ? 47.891  -33.105  7.858   1.00 48.75  ? 221  MET E CA  1 
ATOM   8390  C C   . MET E  1 221 ? 48.742  -31.876  8.166   1.00 48.16  ? 221  MET E C   1 
ATOM   8391  O O   . MET E  1 221 ? 49.151  -31.150  7.258   1.00 52.57  ? 221  MET E O   1 
ATOM   8392  C CB  . MET E  1 221 ? 46.404  -32.779  8.052   1.00 44.36  ? 221  MET E CB  1 
ATOM   8393  C CG  . MET E  1 221 ? 45.453  -33.823  7.483   1.00 43.18  ? 221  MET E CG  1 
ATOM   8394  S SD  . MET E  1 221 ? 43.721  -33.375  7.709   1.00 77.90  ? 221  MET E SD  1 
ATOM   8395  C CE  . MET E  1 221 ? 43.681  -31.787  6.880   1.00 44.52  ? 221  MET E CE  1 
ATOM   8396  N N   . ILE E  1 222 ? 49.002  -31.644  9.448   1.00 44.31  ? 222  ILE E N   1 
ATOM   8397  C CA  . ILE E  1 222 ? 49.830  -30.520  9.868   1.00 40.93  ? 222  ILE E CA  1 
ATOM   8398  C C   . ILE E  1 222 ? 51.243  -30.660  9.307   1.00 43.44  ? 222  ILE E C   1 
ATOM   8399  O O   . ILE E  1 222 ? 51.905  -31.672  9.536   1.00 46.94  ? 222  ILE E O   1 
ATOM   8400  C CB  . ILE E  1 222 ? 49.900  -30.409  11.404  1.00 38.55  ? 222  ILE E CB  1 
ATOM   8401  C CG1 . ILE E  1 222 ? 48.495  -30.363  12.005  1.00 29.01  ? 222  ILE E CG1 1 
ATOM   8402  C CG2 . ILE E  1 222 ? 50.707  -29.185  11.816  1.00 41.50  ? 222  ILE E CG2 1 
ATOM   8403  C CD1 . ILE E  1 222 ? 48.479  -30.476  13.515  1.00 27.70  ? 222  ILE E CD1 1 
ATOM   8404  N N   . PRO E  1 223 ? 51.703  -29.645  8.561   1.00 40.13  ? 223  PRO E N   1 
ATOM   8405  C CA  . PRO E  1 223 ? 53.033  -29.642  7.938   1.00 40.74  ? 223  PRO E CA  1 
ATOM   8406  C C   . PRO E  1 223 ? 54.173  -29.874  8.927   1.00 38.19  ? 223  PRO E C   1 
ATOM   8407  O O   . PRO E  1 223 ? 55.186  -30.462  8.551   1.00 37.56  ? 223  PRO E O   1 
ATOM   8408  C CB  . PRO E  1 223 ? 53.126  -28.242  7.329   1.00 38.31  ? 223  PRO E CB  1 
ATOM   8409  C CG  . PRO E  1 223 ? 51.713  -27.870  7.056   1.00 37.06  ? 223  PRO E CG  1 
ATOM   8410  C CD  . PRO E  1 223 ? 50.921  -28.453  8.189   1.00 33.92  ? 223  PRO E CD  1 
ATOM   8411  N N   . MET E  1 224 ? 54.012  -29.423  10.167  1.00 37.90  ? 224  MET E N   1 
ATOM   8412  C CA  . MET E  1 224 ? 55.040  -29.623  11.184  1.00 37.89  ? 224  MET E CA  1 
ATOM   8413  C C   . MET E  1 224 ? 54.918  -31.005  11.823  1.00 36.95  ? 224  MET E C   1 
ATOM   8414  O O   . MET E  1 224 ? 55.788  -31.426  12.584  1.00 39.22  ? 224  MET E O   1 
ATOM   8415  C CB  . MET E  1 224 ? 54.966  -28.529  12.250  1.00 37.67  ? 224  MET E CB  1 
ATOM   8416  C CG  . MET E  1 224 ? 55.253  -27.135  11.709  1.00 40.40  ? 224  MET E CG  1 
ATOM   8417  S SD  . MET E  1 224 ? 55.629  -25.928  12.994  1.00 58.25  ? 224  MET E SD  1 
ATOM   8418  C CE  . MET E  1 224 ? 57.186  -26.567  13.607  1.00 81.73  ? 224  MET E CE  1 
ATOM   8419  N N   . GLY E  1 225 ? 53.832  -31.703  11.508  1.00 40.71  ? 225  GLY E N   1 
ATOM   8420  C CA  . GLY E  1 225 ? 53.667  -33.089  11.905  1.00 43.32  ? 225  GLY E CA  1 
ATOM   8421  C C   . GLY E  1 225 ? 53.421  -33.341  13.380  1.00 46.75  ? 225  GLY E C   1 
ATOM   8422  O O   . GLY E  1 225 ? 53.738  -34.418  13.887  1.00 51.13  ? 225  GLY E O   1 
ATOM   8423  N N   . HIS E  1 226 ? 52.853  -32.358  14.073  1.00 45.05  ? 226  HIS E N   1 
ATOM   8424  C CA  . HIS E  1 226 ? 52.515  -32.522  15.483  1.00 43.43  ? 226  HIS E CA  1 
ATOM   8425  C C   . HIS E  1 226 ? 51.520  -31.470  15.956  1.00 40.33  ? 226  HIS E C   1 
ATOM   8426  O O   . HIS E  1 226 ? 51.380  -30.411  15.343  1.00 40.65  ? 226  HIS E O   1 
ATOM   8427  C CB  . HIS E  1 226 ? 53.777  -32.472  16.352  1.00 46.61  ? 226  HIS E CB  1 
ATOM   8428  C CG  . HIS E  1 226 ? 54.554  -31.199  16.223  1.00 49.57  ? 226  HIS E CG  1 
ATOM   8429  N ND1 . HIS E  1 226 ? 54.112  -30.000  16.738  1.00 50.83  ? 226  HIS E ND1 1 
ATOM   8430  C CD2 . HIS E  1 226 ? 55.751  -30.941  15.645  1.00 50.29  ? 226  HIS E CD2 1 
ATOM   8431  C CE1 . HIS E  1 226 ? 55.000  -29.057  16.479  1.00 51.81  ? 226  HIS E CE1 1 
ATOM   8432  N NE2 . HIS E  1 226 ? 56.004  -29.601  15.816  1.00 51.13  ? 226  HIS E NE2 1 
ATOM   8433  N N   . LEU E  1 227 ? 50.827  -31.773  17.049  1.00 42.49  ? 227  LEU E N   1 
ATOM   8434  C CA  . LEU E  1 227 ? 49.926  -30.813  17.670  1.00 41.93  ? 227  LEU E CA  1 
ATOM   8435  C C   . LEU E  1 227 ? 50.723  -29.663  18.265  1.00 45.33  ? 227  LEU E C   1 
ATOM   8436  O O   . LEU E  1 227 ? 51.878  -29.835  18.655  1.00 51.19  ? 227  LEU E O   1 
ATOM   8437  C CB  . LEU E  1 227 ? 49.078  -31.477  18.759  1.00 41.25  ? 227  LEU E CB  1 
ATOM   8438  C CG  . LEU E  1 227 ? 48.042  -32.519  18.337  1.00 40.03  ? 227  LEU E CG  1 
ATOM   8439  C CD1 . LEU E  1 227 ? 47.272  -33.016  19.552  1.00 43.64  ? 227  LEU E CD1 1 
ATOM   8440  C CD2 . LEU E  1 227 ? 47.094  -31.950  17.294  1.00 38.51  ? 227  LEU E CD2 1 
ATOM   8441  N N   . GLY E  1 228 ? 50.108  -28.490  18.332  1.00 41.58  ? 228  GLY E N   1 
ATOM   8442  C CA  . GLY E  1 228 ? 50.741  -27.355  18.971  1.00 43.53  ? 228  GLY E CA  1 
ATOM   8443  C C   . GLY E  1 228 ? 50.656  -27.481  20.478  1.00 47.76  ? 228  GLY E C   1 
ATOM   8444  O O   . GLY E  1 228 ? 49.820  -28.216  21.002  1.00 51.78  ? 228  GLY E O   1 
ATOM   8445  N N   . ASP E  1 229 ? 51.535  -26.775  21.177  1.00 48.19  ? 229  ASP E N   1 
ATOM   8446  C CA  . ASP E  1 229 ? 51.473  -26.716  22.629  1.00 51.79  ? 229  ASP E CA  1 
ATOM   8447  C C   . ASP E  1 229 ? 50.840  -25.400  23.055  1.00 51.71  ? 229  ASP E C   1 
ATOM   8448  O O   . ASP E  1 229 ? 51.018  -24.381  22.388  1.00 44.20  ? 229  ASP E O   1 
ATOM   8449  C CB  . ASP E  1 229 ? 52.866  -26.876  23.242  1.00 62.20  ? 229  ASP E CB  1 
ATOM   8450  C CG  . ASP E  1 229 ? 53.158  -28.306  23.655  1.00 69.14  ? 229  ASP E CG  1 
ATOM   8451  O OD1 . ASP E  1 229 ? 52.405  -29.213  23.239  1.00 73.15  ? 229  ASP E OD1 1 
ATOM   8452  O OD2 . ASP E  1 229 ? 54.141  -28.524  24.395  1.00 68.78  ? 229  ASP E OD2 1 
ATOM   8453  N N   . PRO E  1 230 ? 50.081  -25.421  24.161  1.00 38.36  ? 230  PRO E N   1 
ATOM   8454  C CA  . PRO E  1 230 ? 49.427  -24.222  24.695  1.00 37.48  ? 230  PRO E CA  1 
ATOM   8455  C C   . PRO E  1 230 ? 50.408  -23.074  24.930  1.00 37.77  ? 230  PRO E C   1 
ATOM   8456  O O   . PRO E  1 230 ? 50.017  -21.908  24.880  1.00 36.66  ? 230  PRO E O   1 
ATOM   8457  C CB  . PRO E  1 230 ? 48.831  -24.712  26.016  1.00 35.55  ? 230  PRO E CB  1 
ATOM   8458  C CG  . PRO E  1 230 ? 48.603  -26.166  25.801  1.00 39.22  ? 230  PRO E CG  1 
ATOM   8459  C CD  . PRO E  1 230 ? 49.741  -26.626  24.937  1.00 39.41  ? 230  PRO E CD  1 
ATOM   8460  N N   . GLU E  1 231 ? 51.671  -23.412  25.176  1.00 36.16  ? 231  GLU E N   1 
ATOM   8461  C CA  . GLU E  1 231 ? 52.711  -22.412  25.381  1.00 38.58  ? 231  GLU E CA  1 
ATOM   8462  C C   . GLU E  1 231 ? 53.020  -21.660  24.090  1.00 44.64  ? 231  GLU E C   1 
ATOM   8463  O O   . GLU E  1 231 ? 53.405  -20.491  24.124  1.00 46.11  ? 231  GLU E O   1 
ATOM   8464  C CB  . GLU E  1 231 ? 53.982  -23.068  25.924  1.00 40.71  ? 231  GLU E CB  1 
ATOM   8465  N N   . ASP E  1 232 ? 52.854  -22.334  22.955  1.00 51.07  ? 232  ASP E N   1 
ATOM   8466  C CA  . ASP E  1 232 ? 53.087  -21.712  21.655  1.00 51.01  ? 232  ASP E CA  1 
ATOM   8467  C C   . ASP E  1 232 ? 52.088  -20.591  21.406  1.00 43.49  ? 232  ASP E C   1 
ATOM   8468  O O   . ASP E  1 232 ? 52.411  -19.587  20.773  1.00 40.52  ? 232  ASP E O   1 
ATOM   8469  C CB  . ASP E  1 232 ? 53.003  -22.747  20.531  1.00 61.70  ? 232  ASP E CB  1 
ATOM   8470  C CG  . ASP E  1 232 ? 54.085  -23.803  20.627  1.00 75.13  ? 232  ASP E CG  1 
ATOM   8471  O OD1 . ASP E  1 232 ? 55.143  -23.519  21.226  1.00 80.34  ? 232  ASP E OD1 1 
ATOM   8472  O OD2 . ASP E  1 232 ? 53.878  -24.917  20.100  1.00 79.97  ? 232  ASP E OD2 1 
ATOM   8473  N N   . VAL E  1 233 ? 50.870  -20.772  21.907  1.00 39.35  ? 233  VAL E N   1 
ATOM   8474  C CA  . VAL E  1 233 ? 49.837  -19.755  21.781  1.00 39.83  ? 233  VAL E CA  1 
ATOM   8475  C C   . VAL E  1 233 ? 50.079  -18.643  22.795  1.00 37.43  ? 233  VAL E C   1 
ATOM   8476  O O   . VAL E  1 233 ? 49.833  -17.469  22.520  1.00 38.47  ? 233  VAL E O   1 
ATOM   8477  C CB  . VAL E  1 233 ? 48.430  -20.346  21.985  1.00 41.74  ? 233  VAL E CB  1 
ATOM   8478  C CG1 . VAL E  1 233 ? 47.368  -19.338  21.571  1.00 43.78  ? 233  VAL E CG1 1 
ATOM   8479  C CG2 . VAL E  1 233 ? 48.277  -21.634  21.191  1.00 39.85  ? 233  VAL E CG2 1 
ATOM   8480  N N   . ALA E  1 234 ? 50.573  -19.025  23.968  1.00 33.98  ? 234  ALA E N   1 
ATOM   8481  C CA  . ALA E  1 234 ? 50.879  -18.068  25.023  1.00 29.12  ? 234  ALA E CA  1 
ATOM   8482  C C   . ALA E  1 234 ? 52.018  -17.141  24.614  1.00 33.97  ? 234  ALA E C   1 
ATOM   8483  O O   . ALA E  1 234 ? 52.051  -15.974  25.003  1.00 35.35  ? 234  ALA E O   1 
ATOM   8484  C CB  . ALA E  1 234 ? 51.225  -18.796  26.310  1.00 29.61  ? 234  ALA E CB  1 
ATOM   8485  N N   . ASP E  1 235 ? 52.951  -17.669  23.827  1.00 36.93  ? 235  ASP E N   1 
ATOM   8486  C CA  . ASP E  1 235 ? 54.083  -16.886  23.343  1.00 42.63  ? 235  ASP E CA  1 
ATOM   8487  C C   . ASP E  1 235 ? 53.619  -15.764  22.422  1.00 40.35  ? 235  ASP E C   1 
ATOM   8488  O O   . ASP E  1 235 ? 54.155  -14.657  22.454  1.00 41.78  ? 235  ASP E O   1 
ATOM   8489  C CB  . ASP E  1 235 ? 55.082  -17.784  22.611  1.00 56.08  ? 235  ASP E CB  1 
ATOM   8490  C CG  . ASP E  1 235 ? 56.293  -17.020  22.111  1.00 71.77  ? 235  ASP E CG  1 
ATOM   8491  O OD1 . ASP E  1 235 ? 56.850  -16.213  22.886  1.00 77.54  ? 235  ASP E OD1 1 
ATOM   8492  O OD2 . ASP E  1 235 ? 56.684  -17.221  20.942  1.00 77.40  ? 235  ASP E OD2 1 
ATOM   8493  N N   . VAL E  1 236 ? 52.620  -16.063  21.600  1.00 37.94  ? 236  VAL E N   1 
ATOM   8494  C CA  . VAL E  1 236 ? 52.066  -15.085  20.675  1.00 39.89  ? 236  VAL E CA  1 
ATOM   8495  C C   . VAL E  1 236 ? 51.302  -14.001  21.425  1.00 40.42  ? 236  VAL E C   1 
ATOM   8496  O O   . VAL E  1 236 ? 51.473  -12.811  21.161  1.00 41.85  ? 236  VAL E O   1 
ATOM   8497  C CB  . VAL E  1 236 ? 51.137  -15.753  19.650  1.00 43.31  ? 236  VAL E CB  1 
ATOM   8498  C CG1 . VAL E  1 236 ? 50.546  -14.716  18.709  1.00 44.66  ? 236  VAL E CG1 1 
ATOM   8499  C CG2 . VAL E  1 236 ? 51.897  -16.812  18.873  1.00 47.99  ? 236  VAL E CG2 1 
ATOM   8500  N N   . VAL E  1 237 ? 50.461  -14.427  22.363  1.00 39.15  ? 237  VAL E N   1 
ATOM   8501  C CA  . VAL E  1 237 ? 49.701  -13.506  23.199  1.00 33.82  ? 237  VAL E CA  1 
ATOM   8502  C C   . VAL E  1 237 ? 50.641  -12.593  23.980  1.00 31.21  ? 237  VAL E C   1 
ATOM   8503  O O   . VAL E  1 237 ? 50.379  -11.400  24.136  1.00 33.68  ? 237  VAL E O   1 
ATOM   8504  C CB  . VAL E  1 237 ? 48.783  -14.266  24.178  1.00 37.77  ? 237  VAL E CB  1 
ATOM   8505  C CG1 . VAL E  1 237 ? 48.061  -13.300  25.102  1.00 39.68  ? 237  VAL E CG1 1 
ATOM   8506  C CG2 . VAL E  1 237 ? 47.783  -15.116  23.411  1.00 35.48  ? 237  VAL E CG2 1 
ATOM   8507  N N   . ALA E  1 238 ? 51.746  -13.162  24.454  1.00 30.25  ? 238  ALA E N   1 
ATOM   8508  C CA  . ALA E  1 238 ? 52.753  -12.401  25.184  1.00 30.09  ? 238  ALA E CA  1 
ATOM   8509  C C   . ALA E  1 238 ? 53.354  -11.308  24.308  1.00 32.03  ? 238  ALA E C   1 
ATOM   8510  O O   . ALA E  1 238 ? 53.582  -10.187  24.764  1.00 31.42  ? 238  ALA E O   1 
ATOM   8511  C CB  . ALA E  1 238 ? 53.843  -13.325  25.700  1.00 29.97  ? 238  ALA E CB  1 
ATOM   8512  N N   . PHE E  1 239 ? 53.606  -11.642  23.047  1.00 30.92  ? 239  PHE E N   1 
ATOM   8513  C CA  . PHE E  1 239 ? 54.164  -10.686  22.100  1.00 32.80  ? 239  PHE E CA  1 
ATOM   8514  C C   . PHE E  1 239 ? 53.160  -9.587   21.771  1.00 34.45  ? 239  PHE E C   1 
ATOM   8515  O O   . PHE E  1 239 ? 53.516  -8.412   21.698  1.00 36.05  ? 239  PHE E O   1 
ATOM   8516  C CB  . PHE E  1 239 ? 54.609  -11.397  20.822  1.00 32.08  ? 239  PHE E CB  1 
ATOM   8517  C CG  . PHE E  1 239 ? 54.995  -10.463  19.711  1.00 30.67  ? 239  PHE E CG  1 
ATOM   8518  C CD1 . PHE E  1 239 ? 56.176  -9.744   19.771  1.00 32.47  ? 239  PHE E CD1 1 
ATOM   8519  C CD2 . PHE E  1 239 ? 54.179  -10.310  18.602  1.00 28.85  ? 239  PHE E CD2 1 
ATOM   8520  C CE1 . PHE E  1 239 ? 56.533  -8.885   18.749  1.00 30.80  ? 239  PHE E CE1 1 
ATOM   8521  C CE2 . PHE E  1 239 ? 54.530  -9.454   17.577  1.00 34.15  ? 239  PHE E CE2 1 
ATOM   8522  C CZ  . PHE E  1 239 ? 55.709  -8.740   17.651  1.00 29.85  ? 239  PHE E CZ  1 
ATOM   8523  N N   . LEU E  1 240 ? 51.904  -9.977   21.577  1.00 34.41  ? 240  LEU E N   1 
ATOM   8524  C CA  . LEU E  1 240 ? 50.848  -9.023   21.260  1.00 35.69  ? 240  LEU E CA  1 
ATOM   8525  C C   . LEU E  1 240 ? 50.537  -8.115   22.444  1.00 38.78  ? 240  LEU E C   1 
ATOM   8526  O O   . LEU E  1 240 ? 50.170  -6.954   22.266  1.00 43.30  ? 240  LEU E O   1 
ATOM   8527  C CB  . LEU E  1 240 ? 49.582  -9.753   20.813  1.00 34.53  ? 240  LEU E CB  1 
ATOM   8528  C CG  . LEU E  1 240 ? 49.669  -10.488  19.475  1.00 33.57  ? 240  LEU E CG  1 
ATOM   8529  C CD1 . LEU E  1 240 ? 48.327  -11.109  19.117  1.00 31.01  ? 240  LEU E CD1 1 
ATOM   8530  C CD2 . LEU E  1 240 ? 50.141  -9.544   18.380  1.00 27.52  ? 240  LEU E CD2 1 
ATOM   8531  N N   . ALA E  1 241 ? 50.686  -8.649   23.652  1.00 34.21  ? 241  ALA E N   1 
ATOM   8532  C CA  . ALA E  1 241 ? 50.443  -7.875   24.862  1.00 34.62  ? 241  ALA E CA  1 
ATOM   8533  C C   . ALA E  1 241 ? 51.576  -6.887   25.108  1.00 40.49  ? 241  ALA E C   1 
ATOM   8534  O O   . ALA E  1 241 ? 51.356  -5.784   25.608  1.00 41.71  ? 241  ALA E O   1 
ATOM   8535  C CB  . ALA E  1 241 ? 50.274  -8.797   26.058  1.00 34.92  ? 241  ALA E CB  1 
ATOM   8536  N N   . SER E  1 242 ? 52.790  -7.292   24.748  1.00 43.61  ? 242  SER E N   1 
ATOM   8537  C CA  . SER E  1 242 ? 53.968  -6.458   24.947  1.00 43.55  ? 242  SER E CA  1 
ATOM   8538  C C   . SER E  1 242 ? 53.964  -5.255   24.015  1.00 39.20  ? 242  SER E C   1 
ATOM   8539  O O   . SER E  1 242 ? 53.156  -5.174   23.090  1.00 39.40  ? 242  SER E O   1 
ATOM   8540  C CB  . SER E  1 242 ? 55.242  -7.276   24.734  1.00 49.82  ? 242  SER E CB  1 
ATOM   8541  O OG  . SER E  1 242 ? 55.334  -7.731   23.395  1.00 50.18  ? 242  SER E OG  1 
ATOM   8542  N N   . GLU E  1 243 ? 54.875  -4.320   24.261  1.00 43.69  ? 243  GLU E N   1 
ATOM   8543  C CA  . GLU E  1 243 ? 54.994  -3.145   23.412  1.00 49.12  ? 243  GLU E CA  1 
ATOM   8544  C C   . GLU E  1 243 ? 56.016  -3.397   22.308  1.00 48.49  ? 243  GLU E C   1 
ATOM   8545  O O   . GLU E  1 243 ? 56.427  -2.475   21.603  1.00 49.56  ? 243  GLU E O   1 
ATOM   8546  C CB  . GLU E  1 243 ? 55.376  -1.916   24.237  1.00 58.47  ? 243  GLU E CB  1 
ATOM   8547  C CG  . GLU E  1 243 ? 54.735  -0.619   23.755  1.00 68.93  ? 243  GLU E CG  1 
ATOM   8548  C CD  . GLU E  1 243 ? 53.233  -0.570   23.997  1.00 76.84  ? 243  GLU E CD  1 
ATOM   8549  O OE1 . GLU E  1 243 ? 52.702  -1.458   24.699  1.00 79.64  ? 243  GLU E OE1 1 
ATOM   8550  O OE2 . GLU E  1 243 ? 52.580  0.364    23.485  1.00 80.38  ? 243  GLU E OE2 1 
ATOM   8551  N N   . ASP E  1 244 ? 56.423  -4.656   22.171  1.00 43.78  ? 244  ASP E N   1 
ATOM   8552  C CA  . ASP E  1 244 ? 57.249  -5.079   21.047  1.00 42.91  ? 244  ASP E CA  1 
ATOM   8553  C C   . ASP E  1 244 ? 56.381  -5.179   19.798  1.00 38.85  ? 244  ASP E C   1 
ATOM   8554  O O   . ASP E  1 244 ? 56.882  -5.199   18.674  1.00 40.98  ? 244  ASP E O   1 
ATOM   8555  C CB  . ASP E  1 244 ? 57.927  -6.420   21.336  1.00 46.54  ? 244  ASP E CB  1 
ATOM   8556  C CG  . ASP E  1 244 ? 58.886  -6.350   22.510  1.00 49.98  ? 244  ASP E CG  1 
ATOM   8557  O OD1 . ASP E  1 244 ? 59.260  -5.228   22.910  1.00 50.29  ? 244  ASP E OD1 1 
ATOM   8558  O OD2 . ASP E  1 244 ? 59.271  -7.420   23.026  1.00 51.89  ? 244  ASP E OD2 1 
ATOM   8559  N N   . SER E  1 245 ? 55.071  -5.245   20.011  1.00 35.78  ? 245  SER E N   1 
ATOM   8560  C CA  . SER E  1 245 ? 54.106  -5.264   18.921  1.00 33.87  ? 245  SER E CA  1 
ATOM   8561  C C   . SER E  1 245 ? 53.321  -3.958   18.895  1.00 35.13  ? 245  SER E C   1 
ATOM   8562  O O   . SER E  1 245 ? 52.139  -3.939   18.552  1.00 38.89  ? 245  SER E O   1 
ATOM   8563  C CB  . SER E  1 245 ? 53.157  -6.453   19.065  1.00 33.10  ? 245  SER E CB  1 
ATOM   8564  O OG  . SER E  1 245 ? 52.488  -6.414   20.314  1.00 40.32  ? 245  SER E OG  1 
ATOM   8565  N N   . GLY E  1 246 ? 53.994  -2.869   19.256  1.00 35.77  ? 246  GLY E N   1 
ATOM   8566  C CA  . GLY E  1 246 ? 53.360  -1.569   19.389  1.00 36.76  ? 246  GLY E CA  1 
ATOM   8567  C C   . GLY E  1 246 ? 52.734  -1.012   18.124  1.00 41.31  ? 246  GLY E C   1 
ATOM   8568  O O   . GLY E  1 246 ? 51.865  -0.144   18.192  1.00 48.55  ? 246  GLY E O   1 
ATOM   8569  N N   . TYR E  1 247 ? 53.169  -1.504   16.969  1.00 39.90  ? 247  TYR E N   1 
ATOM   8570  C CA  . TYR E  1 247 ? 52.636  -1.029   15.697  1.00 39.26  ? 247  TYR E CA  1 
ATOM   8571  C C   . TYR E  1 247 ? 51.782  -2.107   15.030  1.00 39.88  ? 247  TYR E C   1 
ATOM   8572  O O   . TYR E  1 247 ? 51.584  -2.100   13.815  1.00 43.08  ? 247  TYR E O   1 
ATOM   8573  C CB  . TYR E  1 247 ? 53.775  -0.590   14.771  1.00 36.90  ? 247  TYR E CB  1 
ATOM   8574  C CG  . TYR E  1 247 ? 53.327  0.228    13.579  1.00 36.30  ? 247  TYR E CG  1 
ATOM   8575  C CD1 . TYR E  1 247 ? 52.655  1.431    13.751  1.00 35.85  ? 247  TYR E CD1 1 
ATOM   8576  C CD2 . TYR E  1 247 ? 53.585  -0.199   12.282  1.00 33.36  ? 247  TYR E CD2 1 
ATOM   8577  C CE1 . TYR E  1 247 ? 52.244  2.183    12.666  1.00 34.89  ? 247  TYR E CE1 1 
ATOM   8578  C CE2 . TYR E  1 247 ? 53.180  0.546    11.191  1.00 34.11  ? 247  TYR E CE2 1 
ATOM   8579  C CZ  . TYR E  1 247 ? 52.510  1.736    11.388  1.00 39.65  ? 247  TYR E CZ  1 
ATOM   8580  O OH  . TYR E  1 247 ? 52.105  2.482    10.305  1.00 31.85  ? 247  TYR E OH  1 
ATOM   8581  N N   . ILE E  1 248 ? 51.269  -3.030   15.836  1.00 39.42  ? 248  ILE E N   1 
ATOM   8582  C CA  . ILE E  1 248 ? 50.450  -4.120   15.320  1.00 38.35  ? 248  ILE E CA  1 
ATOM   8583  C C   . ILE E  1 248 ? 49.025  -4.060   15.862  1.00 39.62  ? 248  ILE E C   1 
ATOM   8584  O O   . ILE E  1 248 ? 48.803  -4.192   17.065  1.00 44.45  ? 248  ILE E O   1 
ATOM   8585  C CB  . ILE E  1 248 ? 51.059  -5.492   15.668  1.00 35.18  ? 248  ILE E CB  1 
ATOM   8586  C CG1 . ILE E  1 248 ? 52.494  -5.587   15.146  1.00 36.17  ? 248  ILE E CG1 1 
ATOM   8587  C CG2 . ILE E  1 248 ? 50.204  -6.616   15.102  1.00 32.79  ? 248  ILE E CG2 1 
ATOM   8588  C CD1 . ILE E  1 248 ? 53.162  -6.915   15.429  1.00 35.48  ? 248  ILE E CD1 1 
ATOM   8589  N N   . THR E  1 249 ? 48.062  -3.855   14.968  1.00 39.04  ? 249  THR E N   1 
ATOM   8590  C CA  . THR E  1 249 ? 46.653  -3.858   15.348  1.00 40.77  ? 249  THR E CA  1 
ATOM   8591  C C   . THR E  1 249 ? 45.786  -4.305   14.172  1.00 37.16  ? 249  THR E C   1 
ATOM   8592  O O   . THR E  1 249 ? 46.155  -4.119   13.011  1.00 35.75  ? 249  THR E O   1 
ATOM   8593  C CB  . THR E  1 249 ? 46.190  -2.470   15.848  1.00 39.72  ? 249  THR E CB  1 
ATOM   8594  O OG1 . THR E  1 249 ? 44.886  -2.578   16.434  1.00 42.27  ? 249  THR E OG1 1 
ATOM   8595  C CG2 . THR E  1 249 ? 46.150  -1.464   14.709  1.00 36.55  ? 249  THR E CG2 1 
ATOM   8596  N N   . GLY E  1 250 ? 44.642  -4.909   14.481  1.00 32.82  ? 250  GLY E N   1 
ATOM   8597  C CA  . GLY E  1 250 ? 43.744  -5.421   13.460  1.00 36.90  ? 250  GLY E CA  1 
ATOM   8598  C C   . GLY E  1 250 ? 44.369  -6.550   12.664  1.00 39.33  ? 250  GLY E C   1 
ATOM   8599  O O   . GLY E  1 250 ? 44.037  -6.761   11.497  1.00 45.02  ? 250  GLY E O   1 
ATOM   8600  N N   . THR E  1 251 ? 45.273  -7.283   13.305  1.00 34.69  ? 251  THR E N   1 
ATOM   8601  C CA  . THR E  1 251 ? 46.041  -8.324   12.634  1.00 40.75  ? 251  THR E CA  1 
ATOM   8602  C C   . THR E  1 251 ? 45.661  -9.717   13.129  1.00 43.17  ? 251  THR E C   1 
ATOM   8603  O O   . THR E  1 251 ? 45.482  -9.935   14.328  1.00 46.74  ? 251  THR E O   1 
ATOM   8604  C CB  . THR E  1 251 ? 47.559  -8.101   12.833  1.00 44.21  ? 251  THR E CB  1 
ATOM   8605  O OG1 . THR E  1 251 ? 47.965  -6.921   12.129  1.00 46.47  ? 251  THR E OG1 1 
ATOM   8606  C CG2 . THR E  1 251 ? 48.364  -9.287   12.325  1.00 44.66  ? 251  THR E CG2 1 
ATOM   8607  N N   . SER E  1 252 ? 45.525  -10.651  12.193  1.00 44.83  ? 252  SER E N   1 
ATOM   8608  C CA  . SER E  1 252 ? 45.285  -12.048  12.527  1.00 42.69  ? 252  SER E CA  1 
ATOM   8609  C C   . SER E  1 252 ? 46.591  -12.836  12.499  1.00 36.69  ? 252  SER E C   1 
ATOM   8610  O O   . SER E  1 252 ? 47.181  -13.036  11.438  1.00 38.09  ? 252  SER E O   1 
ATOM   8611  C CB  . SER E  1 252 ? 44.275  -12.668  11.559  1.00 45.06  ? 252  SER E CB  1 
ATOM   8612  O OG  . SER E  1 252 ? 43.038  -11.979  11.599  1.00 47.51  ? 252  SER E OG  1 
ATOM   8613  N N   . VAL E  1 253 ? 47.043  -13.274  13.669  1.00 37.41  ? 253  VAL E N   1 
ATOM   8614  C CA  . VAL E  1 253 ? 48.258  -14.073  13.763  1.00 35.14  ? 253  VAL E CA  1 
ATOM   8615  C C   . VAL E  1 253 ? 47.912  -15.557  13.811  1.00 36.99  ? 253  VAL E C   1 
ATOM   8616  O O   . VAL E  1 253 ? 47.097  -15.986  14.628  1.00 43.88  ? 253  VAL E O   1 
ATOM   8617  C CB  . VAL E  1 253 ? 49.089  -13.697  15.001  1.00 34.14  ? 253  VAL E CB  1 
ATOM   8618  C CG1 . VAL E  1 253 ? 50.367  -14.518  15.048  1.00 35.89  ? 253  VAL E CG1 1 
ATOM   8619  C CG2 . VAL E  1 253 ? 49.406  -12.210  14.991  1.00 33.18  ? 253  VAL E CG2 1 
ATOM   8620  N N   . GLU E  1 254 ? 48.533  -16.337  12.934  1.00 34.41  ? 254  GLU E N   1 
ATOM   8621  C CA  . GLU E  1 254 ? 48.205  -17.752  12.813  1.00 38.07  ? 254  GLU E CA  1 
ATOM   8622  C C   . GLU E  1 254 ? 49.278  -18.650  13.420  1.00 39.06  ? 254  GLU E C   1 
ATOM   8623  O O   . GLU E  1 254 ? 50.436  -18.625  13.003  1.00 44.24  ? 254  GLU E O   1 
ATOM   8624  C CB  . GLU E  1 254 ? 47.989  -18.121  11.344  1.00 41.85  ? 254  GLU E CB  1 
ATOM   8625  C CG  . GLU E  1 254 ? 46.931  -17.282  10.647  1.00 43.94  ? 254  GLU E CG  1 
ATOM   8626  C CD  . GLU E  1 254 ? 46.646  -17.755  9.236   1.00 47.24  ? 254  GLU E CD  1 
ATOM   8627  O OE1 . GLU E  1 254 ? 47.073  -18.876  8.886   1.00 46.07  ? 254  GLU E OE1 1 
ATOM   8628  O OE2 . GLU E  1 254 ? 45.995  -17.007  8.477   1.00 50.40  ? 254  GLU E OE2 1 
ATOM   8629  N N   . VAL E  1 255 ? 48.879  -19.442  14.410  1.00 38.28  ? 255  VAL E N   1 
ATOM   8630  C CA  . VAL E  1 255 ? 49.762  -20.426  15.023  1.00 39.41  ? 255  VAL E CA  1 
ATOM   8631  C C   . VAL E  1 255 ? 49.224  -21.820  14.740  1.00 36.37  ? 255  VAL E C   1 
ATOM   8632  O O   . VAL E  1 255 ? 48.644  -22.462  15.616  1.00 38.70  ? 255  VAL E O   1 
ATOM   8633  C CB  . VAL E  1 255 ? 49.880  -20.226  16.542  1.00 41.08  ? 255  VAL E CB  1 
ATOM   8634  C CG1 . VAL E  1 255 ? 51.227  -20.728  17.040  1.00 39.16  ? 255  VAL E CG1 1 
ATOM   8635  C CG2 . VAL E  1 255 ? 49.687  -18.764  16.895  1.00 44.11  ? 255  VAL E CG2 1 
ATOM   8636  N N   . THR E  1 256 ? 49.413  -22.282  13.511  1.00 34.36  ? 256  THR E N   1 
ATOM   8637  C CA  . THR E  1 256 ? 48.765  -23.503  13.054  1.00 36.10  ? 256  THR E CA  1 
ATOM   8638  C C   . THR E  1 256 ? 49.756  -24.611  12.728  1.00 40.11  ? 256  THR E C   1 
ATOM   8639  O O   . THR E  1 256 ? 49.362  -25.745  12.454  1.00 46.69  ? 256  THR E O   1 
ATOM   8640  C CB  . THR E  1 256 ? 47.907  -23.230  11.809  1.00 37.10  ? 256  THR E CB  1 
ATOM   8641  O OG1 . THR E  1 256 ? 48.761  -22.928  10.698  1.00 42.33  ? 256  THR E OG1 1 
ATOM   8642  C CG2 . THR E  1 256 ? 46.978  -22.055  12.057  1.00 30.29  ? 256  THR E CG2 1 
ATOM   8643  N N   . GLY E  1 257 ? 51.043  -24.283  12.758  1.00 34.68  ? 257  GLY E N   1 
ATOM   8644  C CA  . GLY E  1 257 ? 52.067  -25.228  12.358  1.00 33.20  ? 257  GLY E CA  1 
ATOM   8645  C C   . GLY E  1 257 ? 52.028  -25.427  10.857  1.00 37.22  ? 257  GLY E C   1 
ATOM   8646  O O   . GLY E  1 257 ? 52.452  -26.460  10.341  1.00 38.73  ? 257  GLY E O   1 
ATOM   8647  N N   . GLY E  1 258 ? 51.503  -24.428  10.155  1.00 32.20  ? 258  GLY E N   1 
ATOM   8648  C CA  . GLY E  1 258 ? 51.420  -24.472  8.708   1.00 42.24  ? 258  GLY E CA  1 
ATOM   8649  C C   . GLY E  1 258 ? 50.109  -25.027  8.186   1.00 34.10  ? 258  GLY E C   1 
ATOM   8650  O O   . GLY E  1 258 ? 49.869  -25.036  6.979   1.00 43.62  ? 258  GLY E O   1 
ATOM   8651  N N   . LEU E  1 259 ? 49.258  -25.492  9.095   1.00 36.72  ? 259  LEU E N   1 
ATOM   8652  C CA  . LEU E  1 259 ? 47.981  -26.081  8.709   1.00 38.82  ? 259  LEU E CA  1 
ATOM   8653  C C   . LEU E  1 259 ? 47.023  -25.019  8.178   1.00 40.01  ? 259  LEU E C   1 
ATOM   8654  O O   . LEU E  1 259 ? 46.783  -24.005  8.834   1.00 37.73  ? 259  LEU E O   1 
ATOM   8655  C CB  . LEU E  1 259 ? 47.348  -26.814  9.893   1.00 38.22  ? 259  LEU E CB  1 
ATOM   8656  C CG  . LEU E  1 259 ? 46.134  -27.679  9.555   1.00 39.84  ? 259  LEU E CG  1 
ATOM   8657  C CD1 . LEU E  1 259 ? 46.521  -28.770  8.567   1.00 39.16  ? 259  LEU E CD1 1 
ATOM   8658  C CD2 . LEU E  1 259 ? 45.531  -28.279  10.816  1.00 36.57  ? 259  LEU E CD2 1 
ATOM   8659  N N   . PHE E  1 260 ? 46.484  -25.267  6.986   1.00 45.95  ? 260  PHE E N   1 
ATOM   8660  C CA  . PHE E  1 260 ? 45.559  -24.347  6.326   1.00 50.87  ? 260  PHE E CA  1 
ATOM   8661  C C   . PHE E  1 260 ? 46.170  -22.956  6.169   1.00 58.72  ? 260  PHE E C   1 
ATOM   8662  O O   . PHE E  1 260 ? 45.533  -21.951  6.482   1.00 61.40  ? 260  PHE E O   1 
ATOM   8663  C CB  . PHE E  1 260 ? 44.239  -24.256  7.099   1.00 47.50  ? 260  PHE E CB  1 
ATOM   8664  C CG  . PHE E  1 260 ? 43.534  -25.574  7.261   1.00 49.37  ? 260  PHE E CG  1 
ATOM   8665  C CD1 . PHE E  1 260 ? 43.683  -26.580  6.319   1.00 55.71  ? 260  PHE E CD1 1 
ATOM   8666  C CD2 . PHE E  1 260 ? 42.721  -25.808  8.357   1.00 42.58  ? 260  PHE E CD2 1 
ATOM   8667  C CE1 . PHE E  1 260 ? 43.035  -27.792  6.468   1.00 54.88  ? 260  PHE E CE1 1 
ATOM   8668  C CE2 . PHE E  1 260 ? 42.070  -27.017  8.512   1.00 41.95  ? 260  PHE E CE2 1 
ATOM   8669  C CZ  . PHE E  1 260 ? 42.227  -28.010  7.566   1.00 47.02  ? 260  PHE E CZ  1 
ATOM   8670  N N   . MET E  1 261 ? 47.408  -22.907  5.685   1.00 61.14  ? 261  MET E N   1 
ATOM   8671  C CA  . MET E  1 261 ? 48.111  -21.639  5.517   1.00 62.28  ? 261  MET E CA  1 
ATOM   8672  C C   . MET E  1 261 ? 47.662  -20.913  4.252   1.00 67.08  ? 261  MET E C   1 
ATOM   8673  O O   . MET E  1 261 ? 47.282  -21.541  3.262   1.00 72.71  ? 261  MET E O   1 
ATOM   8674  C CB  . MET E  1 261 ? 49.625  -21.864  5.481   1.00 61.42  ? 261  MET E CB  1 
ATOM   8675  C CG  . MET E  1 261 ? 50.105  -22.673  4.287   1.00 62.54  ? 261  MET E CG  1 
ATOM   8676  S SD  . MET E  1 261 ? 51.895  -22.638  4.060   1.00 60.48  ? 261  MET E SD  1 
ATOM   8677  C CE  . MET E  1 261 ? 52.451  -23.660  5.419   1.00 39.47  ? 261  MET E CE  1 
ATOM   8678  N N   . HIS F  2 4   ? 75.038  -16.822  27.313  1.00 101.44 ? -3   HIS F N   1 
ATOM   8679  C CA  . HIS F  2 4   ? 75.801  -15.555  27.340  1.00 100.32 ? -3   HIS F CA  1 
ATOM   8680  C C   . HIS F  2 4   ? 77.304  -15.830  27.173  1.00 98.24  ? -3   HIS F C   1 
ATOM   8681  O O   . HIS F  2 4   ? 78.051  -14.975  26.673  1.00 98.76  ? -3   HIS F O   1 
ATOM   8682  C CB  . HIS F  2 4   ? 75.510  -14.734  28.628  1.00 120.71 ? -3   HIS F CB  1 
ATOM   8683  C CG  . HIS F  2 4   ? 75.821  -15.447  29.915  1.00 123.86 ? -3   HIS F CG  1 
ATOM   8684  N ND1 . HIS F  2 4   ? 77.062  -15.989  30.189  1.00 124.27 ? -3   HIS F ND1 1 
ATOM   8685  C CD2 . HIS F  2 4   ? 75.057  -15.710  31.000  1.00 125.74 ? -3   HIS F CD2 1 
ATOM   8686  C CE1 . HIS F  2 4   ? 77.038  -16.569  31.374  1.00 126.50 ? -3   HIS F CE1 1 
ATOM   8687  N NE2 . HIS F  2 4   ? 75.832  -16.418  31.890  1.00 127.82 ? -3   HIS F NE2 1 
ATOM   8688  N N   . HIS F  2 5   ? 77.719  -17.042  27.547  1.00 96.49  ? -2   HIS F N   1 
ATOM   8689  C CA  . HIS F  2 5   ? 79.093  -17.486  27.338  1.00 91.98  ? -2   HIS F CA  1 
ATOM   8690  C C   . HIS F  2 5   ? 79.227  -18.923  26.819  1.00 80.56  ? -2   HIS F C   1 
ATOM   8691  O O   . HIS F  2 5   ? 80.129  -19.645  27.223  1.00 78.17  ? -2   HIS F O   1 
ATOM   8692  C CB  . HIS F  2 5   ? 79.882  -17.366  28.634  1.00 102.53 ? -2   HIS F CB  1 
ATOM   8693  C CG  . HIS F  2 5   ? 80.311  -15.975  28.952  1.00 108.27 ? -2   HIS F CG  1 
ATOM   8694  N ND1 . HIS F  2 5   ? 80.237  -14.945  28.039  1.00 107.10 ? -2   HIS F ND1 1 
ATOM   8695  C CD2 . HIS F  2 5   ? 80.835  -15.442  30.079  1.00 113.49 ? -2   HIS F CD2 1 
ATOM   8696  C CE1 . HIS F  2 5   ? 80.695  -13.837  28.589  1.00 110.41 ? -2   HIS F CE1 1 
ATOM   8697  N NE2 . HIS F  2 5   ? 81.063  -14.111  29.829  1.00 114.59 ? -2   HIS F NE2 1 
ATOM   8698  N N   . HIS F  2 6   ? 78.344  -19.346  25.927  1.00 70.83  ? -1   HIS F N   1 
ATOM   8699  C CA  . HIS F  2 6   ? 78.426  -20.695  25.370  1.00 62.11  ? -1   HIS F CA  1 
ATOM   8700  C C   . HIS F  2 6   ? 78.602  -20.570  23.874  1.00 54.16  ? -1   HIS F C   1 
ATOM   8701  O O   . HIS F  2 6   ? 78.732  -19.461  23.364  1.00 54.70  ? -1   HIS F O   1 
ATOM   8702  C CB  . HIS F  2 6   ? 77.177  -21.502  25.705  1.00 62.27  ? -1   HIS F CB  1 
ATOM   8703  C CG  . HIS F  2 6   ? 75.901  -20.763  25.447  1.00 61.34  ? -1   HIS F CG  1 
ATOM   8704  N ND1 . HIS F  2 6   ? 75.046  -20.377  26.458  1.00 61.73  ? -1   HIS F ND1 1 
ATOM   8705  C CD2 . HIS F  2 6   ? 75.331  -20.343  24.293  1.00 55.74  ? -1   HIS F CD2 1 
ATOM   8706  C CE1 . HIS F  2 6   ? 74.004  -19.754  25.936  1.00 57.68  ? -1   HIS F CE1 1 
ATOM   8707  N NE2 . HIS F  2 6   ? 74.153  -19.720  24.625  1.00 54.37  ? -1   HIS F NE2 1 
ATOM   8708  N N   . HIS F  2 7   ? 78.604  -21.699  23.175  1.00 48.74  ? 0    HIS F N   1 
ATOM   8709  C CA  . HIS F  2 7   ? 78.784  -21.702  21.732  1.00 45.85  ? 0    HIS F CA  1 
ATOM   8710  C C   . HIS F  2 7   ? 77.659  -20.952  21.035  1.00 45.22  ? 0    HIS F C   1 
ATOM   8711  O O   . HIS F  2 7   ? 76.486  -21.301  21.173  1.00 52.93  ? 0    HIS F O   1 
ATOM   8712  C CB  . HIS F  2 7   ? 78.856  -23.134  21.208  1.00 45.44  ? 0    HIS F CB  1 
ATOM   8713  C CG  . HIS F  2 7   ? 80.060  -23.892  21.673  1.00 45.42  ? 0    HIS F CG  1 
ATOM   8714  N ND1 . HIS F  2 7   ? 80.236  -24.289  22.982  1.00 45.12  ? 0    HIS F ND1 1 
ATOM   8715  C CD2 . HIS F  2 7   ? 81.140  -24.343  20.994  1.00 44.70  ? 0    HIS F CD2 1 
ATOM   8716  C CE1 . HIS F  2 7   ? 81.377  -24.947  23.089  1.00 48.70  ? 0    HIS F CE1 1 
ATOM   8717  N NE2 . HIS F  2 7   ? 81.945  -24.994  21.897  1.00 46.21  ? 0    HIS F NE2 1 
ATOM   8718  N N   . MET F  2 8   ? 78.023  -19.913  20.292  1.00 34.08  ? 1    MET F N   1 
ATOM   8719  C CA  . MET F  2 8   ? 77.048  -19.149  19.530  1.00 32.34  ? 1    MET F CA  1 
ATOM   8720  C C   . MET F  2 8   ? 76.469  -20.005  18.408  1.00 36.12  ? 1    MET F C   1 
ATOM   8721  O O   . MET F  2 8   ? 76.820  -19.842  17.239  1.00 38.01  ? 1    MET F O   1 
ATOM   8722  C CB  . MET F  2 8   ? 77.682  -17.874  18.971  1.00 33.28  ? 1    MET F CB  1 
ATOM   8723  C CG  . MET F  2 8   ? 78.037  -16.842  20.036  1.00 32.74  ? 1    MET F CG  1 
ATOM   8724  S SD  . MET F  2 8   ? 78.910  -15.405  19.384  1.00 57.62  ? 1    MET F SD  1 
ATOM   8725  C CE  . MET F  2 8   ? 80.492  -16.133  18.962  1.00 33.32  ? 1    MET F CE  1 
ATOM   8726  N N   . ASP F  2 9   ? 75.574  -20.916  18.780  1.00 34.96  ? 2    ASP F N   1 
ATOM   8727  C CA  . ASP F  2 9   ? 74.993  -21.864  17.837  1.00 40.26  ? 2    ASP F CA  1 
ATOM   8728  C C   . ASP F  2 9   ? 73.767  -21.278  17.146  1.00 38.42  ? 2    ASP F C   1 
ATOM   8729  O O   . ASP F  2 9   ? 73.128  -21.938  16.325  1.00 39.83  ? 2    ASP F O   1 
ATOM   8730  C CB  . ASP F  2 9   ? 74.625  -23.164  18.554  1.00 34.61  ? 2    ASP F CB  1 
ATOM   8731  C CG  . ASP F  2 9   ? 75.800  -23.775  19.290  1.00 38.42  ? 2    ASP F CG  1 
ATOM   8732  O OD1 . ASP F  2 9   ? 76.916  -23.785  18.729  1.00 35.96  ? 2    ASP F OD1 1 
ATOM   8733  O OD2 . ASP F  2 9   ? 75.611  -24.242  20.432  1.00 40.79  ? 2    ASP F OD2 1 
ATOM   8734  N N   . LYS F  2 10  ? 73.442  -20.037  17.490  1.00 36.69  ? 3    LYS F N   1 
ATOM   8735  C CA  . LYS F  2 10  ? 72.349  -19.325  16.843  1.00 34.92  ? 3    LYS F CA  1 
ATOM   8736  C C   . LYS F  2 10  ? 72.908  -18.270  15.897  1.00 35.41  ? 3    LYS F C   1 
ATOM   8737  O O   . LYS F  2 10  ? 73.121  -17.122  16.287  1.00 37.48  ? 3    LYS F O   1 
ATOM   8738  C CB  . LYS F  2 10  ? 71.430  -18.679  17.882  1.00 31.02  ? 3    LYS F CB  1 
ATOM   8739  N N   . VAL F  2 11  ? 73.152  -18.670  14.654  1.00 38.85  ? 4    VAL F N   1 
ATOM   8740  C CA  . VAL F  2 11  ? 73.730  -17.775  13.658  1.00 37.71  ? 4    VAL F CA  1 
ATOM   8741  C C   . VAL F  2 11  ? 72.668  -17.270  12.688  1.00 40.86  ? 4    VAL F C   1 
ATOM   8742  O O   . VAL F  2 11  ? 71.916  -18.057  12.112  1.00 42.47  ? 4    VAL F O   1 
ATOM   8743  C CB  . VAL F  2 11  ? 74.851  -18.471  12.865  1.00 38.17  ? 4    VAL F CB  1 
ATOM   8744  C CG1 . VAL F  2 11  ? 75.459  -17.513  11.852  1.00 36.66  ? 4    VAL F CG1 1 
ATOM   8745  C CG2 . VAL F  2 11  ? 75.916  -19.002  13.811  1.00 39.56  ? 4    VAL F CG2 1 
ATOM   8746  N N   . CYS F  2 12  ? 72.609  -15.953  12.512  1.00 40.49  ? 5    CYS F N   1 
ATOM   8747  C CA  . CYS F  2 12  ? 71.632  -15.352  11.614  1.00 40.02  ? 5    CYS F CA  1 
ATOM   8748  C C   . CYS F  2 12  ? 72.291  -14.542  10.504  1.00 40.72  ? 5    CYS F C   1 
ATOM   8749  O O   . CYS F  2 12  ? 73.173  -13.722  10.757  1.00 43.91  ? 5    CYS F O   1 
ATOM   8750  C CB  . CYS F  2 12  ? 70.666  -14.460  12.393  1.00 40.91  ? 5    CYS F CB  1 
ATOM   8751  S SG  . CYS F  2 12  ? 69.425  -13.653  11.356  1.00 52.25  ? 5    CYS F SG  1 
ATOM   8752  N N   . ALA F  2 13  ? 71.850  -14.777  9.273   1.00 41.21  ? 6    ALA F N   1 
ATOM   8753  C CA  . ALA F  2 13  ? 72.333  -14.021  8.126   1.00 37.03  ? 6    ALA F CA  1 
ATOM   8754  C C   . ALA F  2 13  ? 71.274  -13.026  7.666   1.00 37.71  ? 6    ALA F C   1 
ATOM   8755  O O   . ALA F  2 13  ? 70.224  -13.417  7.156   1.00 35.94  ? 6    ALA F O   1 
ATOM   8756  C CB  . ALA F  2 13  ? 72.713  -14.957  6.992   1.00 39.27  ? 6    ALA F CB  1 
ATOM   8757  N N   . VAL F  2 14  ? 71.550  -11.739  7.855   1.00 36.91  ? 7    VAL F N   1 
ATOM   8758  C CA  . VAL F  2 14  ? 70.612  -10.695  7.461   1.00 35.36  ? 7    VAL F CA  1 
ATOM   8759  C C   . VAL F  2 14  ? 71.080  -9.982   6.198   1.00 34.67  ? 7    VAL F C   1 
ATOM   8760  O O   . VAL F  2 14  ? 71.977  -9.141   6.243   1.00 33.31  ? 7    VAL F O   1 
ATOM   8761  C CB  . VAL F  2 14  ? 70.412  -9.657   8.583   1.00 34.99  ? 7    VAL F CB  1 
ATOM   8762  C CG1 . VAL F  2 14  ? 69.428  -8.583   8.143   1.00 32.21  ? 7    VAL F CG1 1 
ATOM   8763  C CG2 . VAL F  2 14  ? 69.924  -10.336  9.850   1.00 34.45  ? 7    VAL F CG2 1 
ATOM   8764  N N   . PHE F  2 15  ? 70.469  -10.331  5.072   1.00 36.43  ? 8    PHE F N   1 
ATOM   8765  C CA  . PHE F  2 15  ? 70.769  -9.680   3.803   1.00 36.02  ? 8    PHE F CA  1 
ATOM   8766  C C   . PHE F  2 15  ? 70.105  -8.311   3.749   1.00 38.12  ? 8    PHE F C   1 
ATOM   8767  O O   . PHE F  2 15  ? 68.881  -8.201   3.824   1.00 39.23  ? 8    PHE F O   1 
ATOM   8768  C CB  . PHE F  2 15  ? 70.311  -10.549  2.630   1.00 35.56  ? 8    PHE F CB  1 
ATOM   8769  C CG  . PHE F  2 15  ? 71.132  -11.792  2.442   1.00 37.40  ? 8    PHE F CG  1 
ATOM   8770  C CD1 . PHE F  2 15  ? 70.933  -12.900  3.250   1.00 35.54  ? 8    PHE F CD1 1 
ATOM   8771  C CD2 . PHE F  2 15  ? 72.109  -11.850  1.463   1.00 42.30  ? 8    PHE F CD2 1 
ATOM   8772  C CE1 . PHE F  2 15  ? 71.692  -14.042  3.082   1.00 35.99  ? 8    PHE F CE1 1 
ATOM   8773  C CE2 . PHE F  2 15  ? 72.869  -12.991  1.288   1.00 45.59  ? 8    PHE F CE2 1 
ATOM   8774  C CZ  . PHE F  2 15  ? 72.659  -14.089  2.098   1.00 43.35  ? 8    PHE F CZ  1 
ATOM   8775  N N   . GLY F  2 16  ? 70.919  -7.270   3.622   1.00 39.39  ? 9    GLY F N   1 
ATOM   8776  C CA  . GLY F  2 16  ? 70.425  -5.908   3.673   1.00 36.87  ? 9    GLY F CA  1 
ATOM   8777  C C   . GLY F  2 16  ? 70.401  -5.406   5.102   1.00 35.39  ? 9    GLY F C   1 
ATOM   8778  O O   . GLY F  2 16  ? 69.535  -4.619   5.483   1.00 39.54  ? 9    GLY F O   1 
ATOM   8779  N N   . GLY F  2 17  ? 71.363  -5.867   5.895   1.00 29.52  ? 10   GLY F N   1 
ATOM   8780  C CA  . GLY F  2 17  ? 71.412  -5.536   7.307   1.00 34.14  ? 10   GLY F CA  1 
ATOM   8781  C C   . GLY F  2 17  ? 72.264  -4.325   7.631   1.00 36.55  ? 10   GLY F C   1 
ATOM   8782  O O   . GLY F  2 17  ? 72.648  -4.120   8.782   1.00 37.40  ? 10   GLY F O   1 
ATOM   8783  N N   . SER F  2 18  ? 72.561  -3.519   6.618   1.00 39.56  ? 11   SER F N   1 
ATOM   8784  C CA  . SER F  2 18  ? 73.389  -2.334   6.811   1.00 45.62  ? 11   SER F CA  1 
ATOM   8785  C C   . SER F  2 18  ? 72.539  -1.072   6.885   1.00 45.69  ? 11   SER F C   1 
ATOM   8786  O O   . SER F  2 18  ? 73.019  -0.011   7.285   1.00 46.87  ? 11   SER F O   1 
ATOM   8787  C CB  . SER F  2 18  ? 74.418  -2.210   5.686   1.00 51.82  ? 11   SER F CB  1 
ATOM   8788  O OG  . SER F  2 18  ? 73.785  -2.051   4.428   1.00 53.79  ? 11   SER F OG  1 
ATOM   8789  N N   . ARG F  2 19  ? 71.274  -1.195   6.499   1.00 45.06  ? 12   ARG F N   1 
ATOM   8790  C CA  . ARG F  2 19  ? 70.367  -0.055   6.485   1.00 42.75  ? 12   ARG F CA  1 
ATOM   8791  C C   . ARG F  2 19  ? 68.919  -0.479   6.698   1.00 42.40  ? 12   ARG F C   1 
ATOM   8792  O O   . ARG F  2 19  ? 68.545  -1.616   6.411   1.00 45.40  ? 12   ARG F O   1 
ATOM   8793  C CB  . ARG F  2 19  ? 70.496  0.709    5.166   1.00 38.32  ? 12   ARG F CB  1 
ATOM   8794  C CG  . ARG F  2 19  ? 71.294  1.997    5.267   1.00 44.68  ? 12   ARG F CG  1 
ATOM   8795  C CD  . ARG F  2 19  ? 71.470  2.647    3.904   1.00 54.82  ? 12   ARG F CD  1 
ATOM   8796  N NE  . ARG F  2 19  ? 70.262  2.551    3.088   1.00 56.85  ? 12   ARG F NE  1 
ATOM   8797  C CZ  . ARG F  2 19  ? 70.188  1.882    1.941   1.00 57.85  ? 12   ARG F CZ  1 
ATOM   8798  N NH1 . ARG F  2 19  ? 71.256  1.256    1.467   1.00 59.56  ? 12   ARG F NH1 1 
ATOM   8799  N NH2 . ARG F  2 19  ? 69.048  1.844    1.265   1.00 54.19  ? 12   ARG F NH2 1 
ATOM   8800  N N   . GLY F  2 20  ? 68.113  0.445    7.211   1.00 39.88  ? 13   GLY F N   1 
ATOM   8801  C CA  . GLY F  2 20  ? 66.688  0.226    7.372   1.00 46.11  ? 13   GLY F CA  1 
ATOM   8802  C C   . GLY F  2 20  ? 66.307  -0.939   8.266   1.00 45.20  ? 13   GLY F C   1 
ATOM   8803  O O   . GLY F  2 20  ? 66.879  -1.125   9.340   1.00 47.47  ? 13   GLY F O   1 
ATOM   8804  N N   . ILE F  2 21  ? 65.331  -1.722   7.813   1.00 43.16  ? 14   ILE F N   1 
ATOM   8805  C CA  . ILE F  2 21  ? 64.779  -2.825   8.595   1.00 41.78  ? 14   ILE F CA  1 
ATOM   8806  C C   . ILE F  2 21  ? 65.829  -3.878   8.943   1.00 45.40  ? 14   ILE F C   1 
ATOM   8807  O O   . ILE F  2 21  ? 65.928  -4.302   10.095  1.00 46.37  ? 14   ILE F O   1 
ATOM   8808  C CB  . ILE F  2 21  ? 63.604  -3.493   7.849   1.00 37.50  ? 14   ILE F CB  1 
ATOM   8809  C CG1 . ILE F  2 21  ? 62.436  -2.511   7.731   1.00 37.03  ? 14   ILE F CG1 1 
ATOM   8810  C CG2 . ILE F  2 21  ? 63.159  -4.759   8.564   1.00 33.67  ? 14   ILE F CG2 1 
ATOM   8811  C CD1 . ILE F  2 21  ? 61.215  -3.081   7.050   1.00 39.66  ? 14   ILE F CD1 1 
ATOM   8812  N N   . GLY F  2 22  ? 66.616  -4.285   7.952   1.00 41.40  ? 15   GLY F N   1 
ATOM   8813  C CA  . GLY F  2 22  ? 67.670  -5.261   8.167   1.00 38.20  ? 15   GLY F CA  1 
ATOM   8814  C C   . GLY F  2 22  ? 68.698  -4.795   9.181   1.00 34.75  ? 15   GLY F C   1 
ATOM   8815  O O   . GLY F  2 22  ? 69.291  -5.605   9.896   1.00 27.96  ? 15   GLY F O   1 
ATOM   8816  N N   . ARG F  2 23  ? 68.909  -3.484   9.237   1.00 37.22  ? 16   ARG F N   1 
ATOM   8817  C CA  . ARG F  2 23  ? 69.833  -2.886   10.195  1.00 38.85  ? 16   ARG F CA  1 
ATOM   8818  C C   . ARG F  2 23  ? 69.330  -3.058   11.623  1.00 36.66  ? 16   ARG F C   1 
ATOM   8819  O O   . ARG F  2 23  ? 70.083  -3.453   12.513  1.00 36.89  ? 16   ARG F O   1 
ATOM   8820  C CB  . ARG F  2 23  ? 70.036  -1.401   9.887   1.00 46.17  ? 16   ARG F CB  1 
ATOM   8821  C CG  . ARG F  2 23  ? 70.908  -0.660   10.888  1.00 53.60  ? 16   ARG F CG  1 
ATOM   8822  C CD  . ARG F  2 23  ? 72.348  -1.135   10.826  1.00 60.73  ? 16   ARG F CD  1 
ATOM   8823  N NE  . ARG F  2 23  ? 72.766  -1.772   12.071  1.00 70.09  ? 16   ARG F NE  1 
ATOM   8824  C CZ  . ARG F  2 23  ? 73.360  -1.134   13.074  1.00 77.98  ? 16   ARG F CZ  1 
ATOM   8825  N NH1 . ARG F  2 23  ? 73.610  0.166    12.982  1.00 81.09  ? 16   ARG F NH1 1 
ATOM   8826  N NH2 . ARG F  2 23  ? 73.706  -1.794   14.171  1.00 81.04  ? 16   ARG F NH2 1 
ATOM   8827  N N   . ALA F  2 24  ? 68.053  -2.756   11.833  1.00 28.60  ? 17   ALA F N   1 
ATOM   8828  C CA  . ALA F  2 24  ? 67.447  -2.860   13.155  1.00 29.08  ? 17   ALA F CA  1 
ATOM   8829  C C   . ALA F  2 24  ? 67.278  -4.316   13.572  1.00 30.75  ? 17   ALA F C   1 
ATOM   8830  O O   . ALA F  2 24  ? 67.390  -4.646   14.753  1.00 33.37  ? 17   ALA F O   1 
ATOM   8831  C CB  . ALA F  2 24  ? 66.110  -2.146   13.182  1.00 30.39  ? 17   ALA F CB  1 
ATOM   8832  N N   . VAL F  2 25  ? 66.995  -5.179   12.601  1.00 29.25  ? 18   VAL F N   1 
ATOM   8833  C CA  . VAL F  2 25  ? 66.908  -6.612   12.857  1.00 28.70  ? 18   VAL F CA  1 
ATOM   8834  C C   . VAL F  2 25  ? 68.243  -7.120   13.387  1.00 36.41  ? 18   VAL F C   1 
ATOM   8835  O O   . VAL F  2 25  ? 68.293  -7.837   14.386  1.00 35.06  ? 18   VAL F O   1 
ATOM   8836  C CB  . VAL F  2 25  ? 66.516  -7.400   11.588  1.00 29.27  ? 18   VAL F CB  1 
ATOM   8837  C CG1 . VAL F  2 25  ? 66.781  -8.887   11.775  1.00 32.64  ? 18   VAL F CG1 1 
ATOM   8838  C CG2 . VAL F  2 25  ? 65.056  -7.157   11.241  1.00 30.55  ? 18   VAL F CG2 1 
ATOM   8839  N N   . ALA F  2 26  ? 69.323  -6.723   12.722  1.00 40.01  ? 19   ALA F N   1 
ATOM   8840  C CA  . ALA F  2 26  ? 70.668  -7.096   13.142  1.00 39.54  ? 19   ALA F CA  1 
ATOM   8841  C C   . ALA F  2 26  ? 70.984  -6.548   14.531  1.00 43.77  ? 19   ALA F C   1 
ATOM   8842  O O   . ALA F  2 26  ? 71.669  -7.194   15.321  1.00 46.78  ? 19   ALA F O   1 
ATOM   8843  C CB  . ALA F  2 26  ? 71.692  -6.603   12.133  1.00 26.59  ? 19   ALA F CB  1 
ATOM   8844  N N   . GLN F  2 27  ? 70.480  -5.355   14.825  1.00 45.81  ? 20   GLN F N   1 
ATOM   8845  C CA  . GLN F  2 27  ? 70.718  -4.726   16.119  1.00 47.62  ? 20   GLN F CA  1 
ATOM   8846  C C   . GLN F  2 27  ? 70.020  -5.485   17.243  1.00 46.21  ? 20   GLN F C   1 
ATOM   8847  O O   . GLN F  2 27  ? 70.623  -5.780   18.274  1.00 48.95  ? 20   GLN F O   1 
ATOM   8848  C CB  . GLN F  2 27  ? 70.248  -3.269   16.102  1.00 51.48  ? 20   GLN F CB  1 
ATOM   8849  C CG  . GLN F  2 27  ? 70.532  -2.508   17.388  1.00 59.96  ? 20   GLN F CG  1 
ATOM   8850  C CD  . GLN F  2 27  ? 72.007  -2.217   17.580  1.00 70.92  ? 20   GLN F CD  1 
ATOM   8851  O OE1 . GLN F  2 27  ? 72.767  -2.134   16.615  1.00 75.26  ? 20   GLN F OE1 1 
ATOM   8852  N NE2 . GLN F  2 27  ? 72.422  -2.060   18.832  1.00 75.98  ? 20   GLN F NE2 1 
ATOM   8853  N N   . LEU F  2 28  ? 68.748  -5.805   17.029  1.00 43.23  ? 21   LEU F N   1 
ATOM   8854  C CA  . LEU F  2 28  ? 67.927  -6.442   18.053  1.00 42.74  ? 21   LEU F CA  1 
ATOM   8855  C C   . LEU F  2 28  ? 68.367  -7.874   18.348  1.00 41.83  ? 21   LEU F C   1 
ATOM   8856  O O   . LEU F  2 28  ? 68.349  -8.310   19.500  1.00 48.73  ? 21   LEU F O   1 
ATOM   8857  C CB  . LEU F  2 28  ? 66.456  -6.423   17.633  1.00 44.60  ? 21   LEU F CB  1 
ATOM   8858  C CG  . LEU F  2 28  ? 65.442  -7.028   18.605  1.00 46.29  ? 21   LEU F CG  1 
ATOM   8859  C CD1 . LEU F  2 28  ? 65.582  -6.412   19.989  1.00 46.26  ? 21   LEU F CD1 1 
ATOM   8860  C CD2 . LEU F  2 28  ? 64.030  -6.839   18.075  1.00 45.67  ? 21   LEU F CD2 1 
ATOM   8861  N N   . MET F  2 29  ? 68.760  -8.604   17.310  1.00 35.32  ? 22   MET F N   1 
ATOM   8862  C CA  . MET F  2 29  ? 69.171  -9.994   17.475  1.00 35.20  ? 22   MET F CA  1 
ATOM   8863  C C   . MET F  2 29  ? 70.549  -10.098  18.122  1.00 38.50  ? 22   MET F C   1 
ATOM   8864  O O   . MET F  2 29  ? 70.848  -11.075  18.808  1.00 43.49  ? 22   MET F O   1 
ATOM   8865  C CB  . MET F  2 29  ? 69.165  -10.721  16.129  1.00 38.51  ? 22   MET F CB  1 
ATOM   8866  C CG  . MET F  2 29  ? 67.805  -10.757  15.454  1.00 44.57  ? 22   MET F CG  1 
ATOM   8867  S SD  . MET F  2 29  ? 67.789  -11.757  13.955  1.00 45.32  ? 22   MET F SD  1 
ATOM   8868  C CE  . MET F  2 29  ? 67.977  -13.398  14.649  1.00 53.62  ? 22   MET F CE  1 
ATOM   8869  N N   . ALA F  2 30  ? 71.385  -9.087   17.903  1.00 35.95  ? 23   ALA F N   1 
ATOM   8870  C CA  . ALA F  2 30  ? 72.716  -9.057   18.500  1.00 36.25  ? 23   ALA F CA  1 
ATOM   8871  C C   . ALA F  2 30  ? 72.616  -8.906   20.013  1.00 35.35  ? 23   ALA F C   1 
ATOM   8872  O O   . ALA F  2 30  ? 73.474  -9.383   20.756  1.00 35.99  ? 23   ALA F O   1 
ATOM   8873  C CB  . ALA F  2 30  ? 73.543  -7.928   17.905  1.00 41.24  ? 23   ALA F CB  1 
ATOM   8874  N N   . ARG F  2 31  ? 71.557  -8.239   20.460  1.00 32.93  ? 24   ARG F N   1 
ATOM   8875  C CA  . ARG F  2 31  ? 71.304  -8.051   21.882  1.00 35.55  ? 24   ARG F CA  1 
ATOM   8876  C C   . ARG F  2 31  ? 70.737  -9.327   22.502  1.00 35.97  ? 24   ARG F C   1 
ATOM   8877  O O   . ARG F  2 31  ? 70.876  -9.563   23.702  1.00 58.80  ? 24   ARG F O   1 
ATOM   8878  C CB  . ARG F  2 31  ? 70.348  -6.873   22.099  1.00 38.86  ? 24   ARG F CB  1 
ATOM   8879  C CG  . ARG F  2 31  ? 70.023  -6.582   23.555  1.00 51.47  ? 24   ARG F CG  1 
ATOM   8880  C CD  . ARG F  2 31  ? 69.297  -5.255   23.712  1.00 60.40  ? 24   ARG F CD  1 
ATOM   8881  N NE  . ARG F  2 31  ? 68.890  -5.023   25.095  1.00 65.21  ? 24   ARG F NE  1 
ATOM   8882  C CZ  . ARG F  2 31  ? 68.466  -3.854   25.566  1.00 64.17  ? 24   ARG F CZ  1 
ATOM   8883  N NH1 . ARG F  2 31  ? 68.396  -2.799   24.766  1.00 63.81  ? 24   ARG F NH1 1 
ATOM   8884  N NH2 . ARG F  2 31  ? 68.117  -3.740   26.839  1.00 62.64  ? 24   ARG F NH2 1 
ATOM   8885  N N   . LYS F  2 32  ? 70.111  -10.154  21.671  1.00 34.91  ? 25   LYS F N   1 
ATOM   8886  C CA  . LYS F  2 32  ? 69.459  -11.368  22.149  1.00 34.85  ? 25   LYS F CA  1 
ATOM   8887  C C   . LYS F  2 32  ? 70.368  -12.594  22.074  1.00 36.35  ? 25   LYS F C   1 
ATOM   8888  O O   . LYS F  2 32  ? 69.909  -13.725  22.236  1.00 37.34  ? 25   LYS F O   1 
ATOM   8889  C CB  . LYS F  2 32  ? 68.175  -11.620  21.357  1.00 35.82  ? 25   LYS F CB  1 
ATOM   8890  C CG  . LYS F  2 32  ? 67.095  -10.578  21.598  1.00 40.87  ? 25   LYS F CG  1 
ATOM   8891  C CD  . LYS F  2 32  ? 65.857  -10.858  20.763  1.00 46.47  ? 25   LYS F CD  1 
ATOM   8892  C CE  . LYS F  2 32  ? 64.722  -9.911   21.124  1.00 48.53  ? 25   LYS F CE  1 
ATOM   8893  N NZ  . LYS F  2 32  ? 64.279  -10.086  22.536  1.00 48.54  ? 25   LYS F NZ  1 
ATOM   8894  N N   . GLY F  2 33  ? 71.654  -12.366  21.828  1.00 37.69  ? 26   GLY F N   1 
ATOM   8895  C CA  . GLY F  2 33  ? 72.634  -13.437  21.864  1.00 42.64  ? 26   GLY F CA  1 
ATOM   8896  C C   . GLY F  2 33  ? 72.926  -14.097  20.529  1.00 45.21  ? 26   GLY F C   1 
ATOM   8897  O O   . GLY F  2 33  ? 73.765  -14.995  20.448  1.00 45.51  ? 26   GLY F O   1 
ATOM   8898  N N   . TYR F  2 34  ? 72.236  -13.659  19.481  1.00 45.05  ? 27   TYR F N   1 
ATOM   8899  C CA  . TYR F  2 34  ? 72.458  -14.203  18.145  1.00 43.99  ? 27   TYR F CA  1 
ATOM   8900  C C   . TYR F  2 34  ? 73.782  -13.725  17.560  1.00 48.88  ? 27   TYR F C   1 
ATOM   8901  O O   . TYR F  2 34  ? 74.130  -12.549  17.674  1.00 54.48  ? 27   TYR F O   1 
ATOM   8902  C CB  . TYR F  2 34  ? 71.317  -13.811  17.202  1.00 41.01  ? 27   TYR F CB  1 
ATOM   8903  C CG  . TYR F  2 34  ? 69.998  -14.492  17.485  1.00 40.13  ? 27   TYR F CG  1 
ATOM   8904  C CD1 . TYR F  2 34  ? 69.082  -13.936  18.369  1.00 38.09  ? 27   TYR F CD1 1 
ATOM   8905  C CD2 . TYR F  2 34  ? 69.663  -15.684  16.858  1.00 42.74  ? 27   TYR F CD2 1 
ATOM   8906  C CE1 . TYR F  2 34  ? 67.873  -14.554  18.626  1.00 36.88  ? 27   TYR F CE1 1 
ATOM   8907  C CE2 . TYR F  2 34  ? 68.457  -16.308  17.107  1.00 42.51  ? 27   TYR F CE2 1 
ATOM   8908  C CZ  . TYR F  2 34  ? 67.566  -15.739  17.992  1.00 41.40  ? 27   TYR F CZ  1 
ATOM   8909  O OH  . TYR F  2 34  ? 66.364  -16.359  18.242  1.00 45.62  ? 27   TYR F OH  1 
ATOM   8910  N N   . ARG F  2 35  ? 74.520  -14.638  16.937  1.00 47.69  ? 28   ARG F N   1 
ATOM   8911  C CA  . ARG F  2 35  ? 75.689  -14.256  16.156  1.00 47.44  ? 28   ARG F CA  1 
ATOM   8912  C C   . ARG F  2 35  ? 75.213  -13.872  14.762  1.00 50.01  ? 28   ARG F C   1 
ATOM   8913  O O   . ARG F  2 35  ? 74.427  -14.594  14.150  1.00 50.04  ? 28   ARG F O   1 
ATOM   8914  C CB  . ARG F  2 35  ? 76.715  -15.387  16.091  1.00 44.14  ? 28   ARG F CB  1 
ATOM   8915  C CG  . ARG F  2 35  ? 78.086  -14.938  15.613  1.00 44.83  ? 28   ARG F CG  1 
ATOM   8916  C CD  . ARG F  2 35  ? 79.076  -16.090  15.591  1.00 50.02  ? 28   ARG F CD  1 
ATOM   8917  N NE  . ARG F  2 35  ? 80.451  -15.621  15.447  1.00 51.57  ? 28   ARG F NE  1 
ATOM   8918  C CZ  . ARG F  2 35  ? 81.507  -16.420  15.338  1.00 60.62  ? 28   ARG F CZ  1 
ATOM   8919  N NH1 . ARG F  2 35  ? 81.349  -17.737  15.352  1.00 65.24  ? 28   ARG F NH1 1 
ATOM   8920  N NH2 . ARG F  2 35  ? 82.723  -15.904  15.213  1.00 65.20  ? 28   ARG F NH2 1 
ATOM   8921  N N   . LEU F  2 36  ? 75.681  -12.735  14.259  1.00 49.09  ? 29   LEU F N   1 
ATOM   8922  C CA  . LEU F  2 36  ? 75.099  -12.175  13.045  1.00 45.87  ? 29   LEU F CA  1 
ATOM   8923  C C   . LEU F  2 36  ? 76.093  -11.866  11.935  1.00 42.86  ? 29   LEU F C   1 
ATOM   8924  O O   . LEU F  2 36  ? 77.241  -11.496  12.181  1.00 41.85  ? 29   LEU F O   1 
ATOM   8925  C CB  . LEU F  2 36  ? 74.323  -10.906  13.390  1.00 43.74  ? 29   LEU F CB  1 
ATOM   8926  C CG  . LEU F  2 36  ? 72.915  -11.158  13.922  1.00 45.02  ? 29   LEU F CG  1 
ATOM   8927  C CD1 . LEU F  2 36  ? 72.578  -10.154  14.995  1.00 50.74  ? 29   LEU F CD1 1 
ATOM   8928  C CD2 . LEU F  2 36  ? 71.910  -11.085  12.789  1.00 41.52  ? 29   LEU F CD2 1 
ATOM   8929  N N   . ALA F  2 37  ? 75.619  -12.022  10.704  1.00 43.17  ? 30   ALA F N   1 
ATOM   8930  C CA  . ALA F  2 37  ? 76.366  -11.639  9.518   1.00 41.60  ? 30   ALA F CA  1 
ATOM   8931  C C   . ALA F  2 37  ? 75.609  -10.543  8.776   1.00 42.68  ? 30   ALA F C   1 
ATOM   8932  O O   . ALA F  2 37  ? 74.490  -10.759  8.310   1.00 47.16  ? 30   ALA F O   1 
ATOM   8933  C CB  . ALA F  2 37  ? 76.594  -12.841  8.617   1.00 40.76  ? 30   ALA F CB  1 
ATOM   8934  N N   . VAL F  2 38  ? 76.217  -9.366   8.680   1.00 43.11  ? 31   VAL F N   1 
ATOM   8935  C CA  . VAL F  2 38  ? 75.595  -8.235   8.000   1.00 41.73  ? 31   VAL F CA  1 
ATOM   8936  C C   . VAL F  2 38  ? 75.967  -8.229   6.519   1.00 40.96  ? 31   VAL F C   1 
ATOM   8937  O O   . VAL F  2 38  ? 77.136  -8.078   6.166   1.00 44.22  ? 31   VAL F O   1 
ATOM   8938  C CB  . VAL F  2 38  ? 76.008  -6.899   8.644   1.00 42.15  ? 31   VAL F CB  1 
ATOM   8939  C CG1 . VAL F  2 38  ? 75.395  -5.734   7.888   1.00 44.29  ? 31   VAL F CG1 1 
ATOM   8940  C CG2 . VAL F  2 38  ? 75.595  -6.870   10.108  1.00 39.93  ? 31   VAL F CG2 1 
ATOM   8941  N N   . ILE F  2 39  ? 74.968  -8.393   5.657   1.00 40.03  ? 32   ILE F N   1 
ATOM   8942  C CA  . ILE F  2 39  ? 75.216  -8.564   4.228   1.00 40.29  ? 32   ILE F CA  1 
ATOM   8943  C C   . ILE F  2 39  ? 74.524  -7.507   3.367   1.00 43.06  ? 32   ILE F C   1 
ATOM   8944  O O   . ILE F  2 39  ? 73.332  -7.246   3.523   1.00 45.09  ? 32   ILE F O   1 
ATOM   8945  C CB  . ILE F  2 39  ? 74.762  -9.960   3.756   1.00 38.14  ? 32   ILE F CB  1 
ATOM   8946  C CG1 . ILE F  2 39  ? 75.279  -11.040  4.709   1.00 39.57  ? 32   ILE F CG1 1 
ATOM   8947  C CG2 . ILE F  2 39  ? 75.232  -10.224  2.335   1.00 37.73  ? 32   ILE F CG2 1 
ATOM   8948  C CD1 . ILE F  2 39  ? 74.810  -12.433  4.366   1.00 33.97  ? 32   ILE F CD1 1 
ATOM   8949  N N   . ALA F  2 40  ? 75.289  -6.913   2.454   1.00 44.59  ? 33   ALA F N   1 
ATOM   8950  C CA  . ALA F  2 40  ? 74.775  -5.931   1.503   1.00 42.28  ? 33   ALA F CA  1 
ATOM   8951  C C   . ALA F  2 40  ? 75.774  -5.759   0.360   1.00 49.61  ? 33   ALA F C   1 
ATOM   8952  O O   . ALA F  2 40  ? 76.856  -6.340   0.393   1.00 53.96  ? 33   ALA F O   1 
ATOM   8953  C CB  . ALA F  2 40  ? 74.510  -4.601   2.190   1.00 37.96  ? 33   ALA F CB  1 
ATOM   8954  N N   . ARG F  2 41  ? 75.418  -4.969   -0.648  1.00 48.31  ? 34   ARG F N   1 
ATOM   8955  C CA  . ARG F  2 41  ? 76.340  -4.705   -1.751  1.00 48.68  ? 34   ARG F CA  1 
ATOM   8956  C C   . ARG F  2 41  ? 77.497  -3.832   -1.273  1.00 50.25  ? 34   ARG F C   1 
ATOM   8957  O O   . ARG F  2 41  ? 78.660  -4.118   -1.555  1.00 56.77  ? 34   ARG F O   1 
ATOM   8958  C CB  . ARG F  2 41  ? 75.617  -4.035   -2.923  1.00 47.85  ? 34   ARG F CB  1 
ATOM   8959  C CG  . ARG F  2 41  ? 74.438  -4.829   -3.461  1.00 44.13  ? 34   ARG F CG  1 
ATOM   8960  C CD  . ARG F  2 41  ? 73.623  -4.013   -4.454  1.00 46.08  ? 34   ARG F CD  1 
ATOM   8961  N NE  . ARG F  2 41  ? 73.132  -2.771   -3.864  1.00 53.02  ? 34   ARG F NE  1 
ATOM   8962  C CZ  . ARG F  2 41  ? 72.058  -2.113   -4.290  1.00 55.70  ? 34   ARG F CZ  1 
ATOM   8963  N NH1 . ARG F  2 41  ? 71.351  -2.583   -5.309  1.00 60.35  ? 34   ARG F NH1 1 
ATOM   8964  N NH2 . ARG F  2 41  ? 71.685  -0.989   -3.692  1.00 53.16  ? 34   ARG F NH2 1 
ATOM   8965  N N   . ASN F  2 42  ? 77.169  -2.770   -0.544  1.00 43.94  ? 35   ASN F N   1 
ATOM   8966  C CA  . ASN F  2 42  ? 78.181  -1.885   0.020   1.00 44.91  ? 35   ASN F CA  1 
ATOM   8967  C C   . ASN F  2 42  ? 78.867  -2.539   1.216   1.00 43.55  ? 35   ASN F C   1 
ATOM   8968  O O   . ASN F  2 42  ? 78.305  -2.596   2.310   1.00 46.27  ? 35   ASN F O   1 
ATOM   8969  C CB  . ASN F  2 42  ? 77.556  -0.548   0.428   1.00 47.09  ? 35   ASN F CB  1 
ATOM   8970  C CG  . ASN F  2 42  ? 78.592  0.540    0.661   1.00 54.81  ? 35   ASN F CG  1 
ATOM   8971  O OD1 . ASN F  2 42  ? 79.748  0.261    0.980   1.00 62.09  ? 35   ASN F OD1 1 
ATOM   8972  N ND2 . ASN F  2 42  ? 78.177  1.792    0.503   1.00 55.79  ? 35   ASN F ND2 1 
ATOM   8973  N N   . LEU F  2 43  ? 80.083  -3.030   0.999   1.00 44.86  ? 36   LEU F N   1 
ATOM   8974  C CA  . LEU F  2 43  ? 80.840  -3.707   2.047   1.00 49.80  ? 36   LEU F CA  1 
ATOM   8975  C C   . LEU F  2 43  ? 81.158  -2.769   3.207   1.00 53.22  ? 36   LEU F C   1 
ATOM   8976  O O   . LEU F  2 43  ? 81.113  -3.170   4.369   1.00 53.10  ? 36   LEU F O   1 
ATOM   8977  C CB  . LEU F  2 43  ? 82.133  -4.292   1.478   1.00 48.74  ? 36   LEU F CB  1 
ATOM   8978  C CG  . LEU F  2 43  ? 83.003  -5.088   2.452   1.00 45.81  ? 36   LEU F CG  1 
ATOM   8979  C CD1 . LEU F  2 43  ? 82.213  -6.236   3.063   1.00 43.70  ? 36   LEU F CD1 1 
ATOM   8980  C CD2 . LEU F  2 43  ? 84.251  -5.603   1.755   1.00 47.72  ? 36   LEU F CD2 1 
ATOM   8981  N N   . GLU F  2 44  ? 81.481  -1.520   2.882   1.00 50.80  ? 37   GLU F N   1 
ATOM   8982  C CA  A GLU F  2 44  ? 81.791  -0.526   3.902   0.50 52.08  ? 37   GLU F CA  1 
ATOM   8983  C CA  B GLU F  2 44  ? 81.790  -0.514   3.892   0.50 52.09  ? 37   GLU F CA  1 
ATOM   8984  C C   . GLU F  2 44  ? 80.572  -0.222   4.763   1.00 49.52  ? 37   GLU F C   1 
ATOM   8985  O O   . GLU F  2 44  ? 80.691  -0.016   5.971   1.00 43.42  ? 37   GLU F O   1 
ATOM   8986  C CB  A GLU F  2 44  ? 82.320  0.758    3.260   0.50 46.61  ? 37   GLU F CB  1 
ATOM   8987  C CB  B GLU F  2 44  ? 82.287  0.772    3.229   0.50 46.58  ? 37   GLU F CB  1 
ATOM   8988  C CG  A GLU F  2 44  ? 83.772  0.672    2.822   0.50 54.24  ? 37   GLU F CG  1 
ATOM   8989  C CG  B GLU F  2 44  ? 82.690  1.865    4.206   0.50 47.71  ? 37   GLU F CG  1 
ATOM   8990  C CD  A GLU F  2 44  ? 84.720  0.477    3.991   0.50 49.91  ? 37   GLU F CD  1 
ATOM   8991  C CD  B GLU F  2 44  ? 83.177  3.119    3.506   0.50 64.05  ? 37   GLU F CD  1 
ATOM   8992  O OE1 A GLU F  2 44  ? 84.427  0.995    5.089   0.50 49.61  ? 37   GLU F OE1 1 
ATOM   8993  O OE1 B GLU F  2 44  ? 83.050  3.196    2.266   0.50 63.03  ? 37   GLU F OE1 1 
ATOM   8994  O OE2 A GLU F  2 44  ? 85.760  -0.191   3.811   0.50 51.26  ? 37   GLU F OE2 1 
ATOM   8995  O OE2 B GLU F  2 44  ? 83.690  4.026    4.195   0.50 50.92  ? 37   GLU F OE2 1 
ATOM   8996  N N   . GLY F  2 45  ? 79.399  -0.202   4.138   1.00 47.31  ? 38   GLY F N   1 
ATOM   8997  C CA  . GLY F  2 45  ? 78.162  0.025    4.859   1.00 49.43  ? 38   GLY F CA  1 
ATOM   8998  C C   . GLY F  2 45  ? 77.829  -1.162   5.740   1.00 54.70  ? 38   GLY F C   1 
ATOM   8999  O O   . GLY F  2 45  ? 77.260  -1.009   6.821   1.00 58.39  ? 38   GLY F O   1 
ATOM   9000  N N   . ALA F  2 46  ? 78.194  -2.352   5.274   1.00 55.14  ? 39   ALA F N   1 
ATOM   9001  C CA  . ALA F  2 46  ? 77.955  -3.579   6.023   1.00 50.14  ? 39   ALA F CA  1 
ATOM   9002  C C   . ALA F  2 46  ? 78.912  -3.697   7.204   1.00 51.30  ? 39   ALA F C   1 
ATOM   9003  O O   . ALA F  2 46  ? 78.521  -4.128   8.289   1.00 47.57  ? 39   ALA F O   1 
ATOM   9004  C CB  . ALA F  2 46  ? 78.085  -4.790   5.111   1.00 47.91  ? 39   ALA F CB  1 
ATOM   9005  N N   . LYS F  2 47  ? 80.168  -3.317   6.989   1.00 49.76  ? 40   LYS F N   1 
ATOM   9006  C CA  . LYS F  2 47  ? 81.178  -3.392   8.039   1.00 54.50  ? 40   LYS F CA  1 
ATOM   9007  C C   . LYS F  2 47  ? 80.931  -2.349   9.123   1.00 54.90  ? 40   LYS F C   1 
ATOM   9008  O O   . LYS F  2 47  ? 81.272  -2.560   10.287  1.00 59.12  ? 40   LYS F O   1 
ATOM   9009  C CB  . LYS F  2 47  ? 82.582  -3.223   7.451   1.00 55.78  ? 40   LYS F CB  1 
ATOM   9010  C CG  . LYS F  2 47  ? 83.059  -4.421   6.642   1.00 53.94  ? 40   LYS F CG  1 
ATOM   9011  C CD  . LYS F  2 47  ? 84.521  -4.286   6.244   1.00 53.00  ? 40   LYS F CD  1 
ATOM   9012  C CE  . LYS F  2 47  ? 84.743  -3.093   5.329   1.00 52.50  ? 40   LYS F CE  1 
ATOM   9013  N NZ  . LYS F  2 47  ? 86.163  -2.991   4.892   1.00 56.53  ? 40   LYS F NZ  1 
ATOM   9014  N N   . ALA F  2 48  ? 80.335  -1.227   8.734   1.00 50.82  ? 41   ALA F N   1 
ATOM   9015  C CA  . ALA F  2 48  ? 79.996  -0.178   9.686   1.00 50.93  ? 41   ALA F CA  1 
ATOM   9016  C C   . ALA F  2 48  ? 78.902  -0.653   10.636  1.00 56.23  ? 41   ALA F C   1 
ATOM   9017  O O   . ALA F  2 48  ? 78.900  -0.312   11.819  1.00 58.90  ? 41   ALA F O   1 
ATOM   9018  C CB  . ALA F  2 48  ? 79.560  1.081    8.957   1.00 48.23  ? 41   ALA F CB  1 
ATOM   9019  N N   . ALA F  2 49  ? 77.975  -1.446   10.110  1.00 55.18  ? 42   ALA F N   1 
ATOM   9020  C CA  . ALA F  2 49  ? 76.883  -1.985   10.911  1.00 51.98  ? 42   ALA F CA  1 
ATOM   9021  C C   . ALA F  2 49  ? 77.365  -3.129   11.798  1.00 55.01  ? 42   ALA F C   1 
ATOM   9022  O O   . ALA F  2 49  ? 76.977  -3.226   12.962  1.00 62.59  ? 42   ALA F O   1 
ATOM   9023  C CB  . ALA F  2 49  ? 75.748  -2.451   10.013  1.00 36.20  ? 42   ALA F CB  1 
ATOM   9024  N N   . ALA F  2 50  ? 78.213  -3.990   11.244  1.00 54.06  ? 43   ALA F N   1 
ATOM   9025  C CA  . ALA F  2 50  ? 78.738  -5.133   11.983  1.00 53.34  ? 43   ALA F CA  1 
ATOM   9026  C C   . ALA F  2 50  ? 79.712  -4.692   13.071  1.00 57.42  ? 43   ALA F C   1 
ATOM   9027  O O   . ALA F  2 50  ? 79.737  -5.263   14.161  1.00 59.41  ? 43   ALA F O   1 
ATOM   9028  C CB  . ALA F  2 50  ? 79.413  -6.112   11.036  1.00 53.08  ? 43   ALA F CB  1 
ATOM   9029  N N   . GLY F  2 51  ? 80.512  -3.674   12.768  1.00 62.41  ? 44   GLY F N   1 
ATOM   9030  C CA  . GLY F  2 51  ? 81.462  -3.137   13.726  1.00 64.07  ? 44   GLY F CA  1 
ATOM   9031  C C   . GLY F  2 51  ? 80.763  -2.490   14.906  1.00 66.03  ? 44   GLY F C   1 
ATOM   9032  O O   . GLY F  2 51  ? 81.341  -2.344   15.983  1.00 70.25  ? 44   GLY F O   1 
ATOM   9033  N N   . ASP F  2 52  ? 79.510  -2.103   14.695  1.00 62.17  ? 45   ASP F N   1 
ATOM   9034  C CA  . ASP F  2 52  ? 78.685  -1.521   15.746  1.00 63.02  ? 45   ASP F CA  1 
ATOM   9035  C C   . ASP F  2 52  ? 78.123  -2.601   16.666  1.00 57.96  ? 45   ASP F C   1 
ATOM   9036  O O   . ASP F  2 52  ? 78.055  -2.420   17.882  1.00 56.74  ? 45   ASP F O   1 
ATOM   9037  C CB  . ASP F  2 52  ? 77.546  -0.703   15.132  1.00 66.45  ? 45   ASP F CB  1 
ATOM   9038  C CG  . ASP F  2 52  ? 76.501  -0.295   16.152  1.00 74.46  ? 45   ASP F CG  1 
ATOM   9039  O OD1 . ASP F  2 52  ? 76.875  0.042    17.296  1.00 79.95  ? 45   ASP F OD1 1 
ATOM   9040  O OD2 . ASP F  2 52  ? 75.300  -0.313   15.808  1.00 74.78  ? 45   ASP F OD2 1 
ATOM   9041  N N   . LEU F  2 53  ? 77.722  -3.723   16.078  1.00 51.40  ? 46   LEU F N   1 
ATOM   9042  C CA  . LEU F  2 53  ? 77.138  -4.824   16.835  1.00 50.42  ? 46   LEU F CA  1 
ATOM   9043  C C   . LEU F  2 53  ? 78.134  -5.424   17.822  1.00 56.35  ? 46   LEU F C   1 
ATOM   9044  O O   . LEU F  2 53  ? 77.850  -5.534   19.015  1.00 60.42  ? 46   LEU F O   1 
ATOM   9045  C CB  . LEU F  2 53  ? 76.625  -5.910   15.888  1.00 45.20  ? 46   LEU F CB  1 
ATOM   9046  C CG  . LEU F  2 53  ? 75.539  -5.477   14.902  1.00 43.51  ? 46   LEU F CG  1 
ATOM   9047  C CD1 . LEU F  2 53  ? 75.057  -6.659   14.076  1.00 44.64  ? 46   LEU F CD1 1 
ATOM   9048  C CD2 . LEU F  2 53  ? 74.382  -4.823   15.637  1.00 43.70  ? 46   LEU F CD2 1 
ATOM   9049  N N   . GLY F  2 54  ? 79.300  -5.811   17.318  1.00 60.25  ? 47   GLY F N   1 
ATOM   9050  C CA  . GLY F  2 54  ? 80.332  -6.400   18.151  1.00 63.15  ? 47   GLY F CA  1 
ATOM   9051  C C   . GLY F  2 54  ? 81.505  -6.913   17.339  1.00 68.39  ? 47   GLY F C   1 
ATOM   9052  O O   . GLY F  2 54  ? 81.577  -6.696   16.130  1.00 68.26  ? 47   GLY F O   1 
ATOM   9053  N N   . GLY F  2 55  ? 82.428  -7.596   18.009  1.00 73.37  ? 48   GLY F N   1 
ATOM   9054  C CA  . GLY F  2 55  ? 83.604  -8.134   17.351  1.00 77.89  ? 48   GLY F CA  1 
ATOM   9055  C C   . GLY F  2 55  ? 83.351  -9.491   16.724  1.00 77.40  ? 48   GLY F C   1 
ATOM   9056  O O   . GLY F  2 55  ? 83.927  -9.825   15.689  1.00 78.47  ? 48   GLY F O   1 
ATOM   9057  N N   . ASP F  2 56  ? 82.481  -10.275  17.355  1.00 77.85  ? 49   ASP F N   1 
ATOM   9058  C CA  . ASP F  2 56  ? 82.154  -11.609  16.866  1.00 78.02  ? 49   ASP F CA  1 
ATOM   9059  C C   . ASP F  2 56  ? 81.186  -11.550  15.687  1.00 71.23  ? 49   ASP F C   1 
ATOM   9060  O O   . ASP F  2 56  ? 80.950  -12.554  15.014  1.00 70.60  ? 49   ASP F O   1 
ATOM   9061  C CB  . ASP F  2 56  ? 81.564  -12.458  17.995  1.00 83.03  ? 49   ASP F CB  1 
ATOM   9062  C CG  . ASP F  2 56  ? 82.579  -12.774  19.077  1.00 88.92  ? 49   ASP F CG  1 
ATOM   9063  O OD1 . ASP F  2 56  ? 83.707  -13.190  18.734  1.00 90.53  ? 49   ASP F OD1 1 
ATOM   9064  O OD2 . ASP F  2 56  ? 82.254  -12.602  20.271  1.00 90.01  ? 49   ASP F OD2 1 
ATOM   9065  N N   . HIS F  2 57  ? 80.629  -10.368  15.443  1.00 63.95  ? 50   HIS F N   1 
ATOM   9066  C CA  . HIS F  2 57  ? 79.736  -10.160  14.309  1.00 56.16  ? 50   HIS F CA  1 
ATOM   9067  C C   . HIS F  2 57  ? 80.524  -9.656   13.105  1.00 57.37  ? 50   HIS F C   1 
ATOM   9068  O O   . HIS F  2 57  ? 81.251  -8.667   13.200  1.00 61.19  ? 50   HIS F O   1 
ATOM   9069  C CB  . HIS F  2 57  ? 78.626  -9.173   14.671  1.00 46.17  ? 50   HIS F CB  1 
ATOM   9070  C CG  . HIS F  2 57  ? 77.924  -9.496   15.953  1.00 44.44  ? 50   HIS F CG  1 
ATOM   9071  N ND1 . HIS F  2 57  ? 77.005  -10.517  16.062  1.00 38.49  ? 50   HIS F ND1 1 
ATOM   9072  C CD2 . HIS F  2 57  ? 78.007  -8.933   17.181  1.00 42.50  ? 50   HIS F CD2 1 
ATOM   9073  C CE1 . HIS F  2 57  ? 76.552  -10.569  17.302  1.00 44.19  ? 50   HIS F CE1 1 
ATOM   9074  N NE2 . HIS F  2 57  ? 77.145  -9.618   18.002  1.00 42.69  ? 50   HIS F NE2 1 
ATOM   9075  N N   . LEU F  2 58  ? 80.379  -10.339  11.975  1.00 56.50  ? 51   LEU F N   1 
ATOM   9076  C CA  . LEU F  2 58  ? 81.128  -9.988   10.773  1.00 59.43  ? 51   LEU F CA  1 
ATOM   9077  C C   . LEU F  2 58  ? 80.230  -9.406   9.686   1.00 53.60  ? 51   LEU F C   1 
ATOM   9078  O O   . LEU F  2 58  ? 79.006  -9.398   9.813   1.00 49.15  ? 51   LEU F O   1 
ATOM   9079  C CB  . LEU F  2 58  ? 81.872  -11.212  10.235  1.00 69.28  ? 51   LEU F CB  1 
ATOM   9080  C CG  . LEU F  2 58  ? 82.985  -11.763  11.128  1.00 78.12  ? 51   LEU F CG  1 
ATOM   9081  C CD1 . LEU F  2 58  ? 82.720  -13.214  11.495  1.00 78.35  ? 51   LEU F CD1 1 
ATOM   9082  C CD2 . LEU F  2 58  ? 84.339  -11.618  10.449  1.00 83.03  ? 51   LEU F CD2 1 
ATOM   9083  N N   . ALA F  2 59  ? 80.853  -8.919   8.617   1.00 52.76  ? 52   ALA F N   1 
ATOM   9084  C CA  . ALA F  2 59  ? 80.125  -8.319   7.507   1.00 47.28  ? 52   ALA F CA  1 
ATOM   9085  C C   . ALA F  2 59  ? 80.605  -8.876   6.173   1.00 47.30  ? 52   ALA F C   1 
ATOM   9086  O O   . ALA F  2 59  ? 81.779  -9.211   6.015   1.00 42.53  ? 52   ALA F O   1 
ATOM   9087  C CB  . ALA F  2 59  ? 80.273  -6.817   7.531   1.00 47.19  ? 52   ALA F CB  1 
ATOM   9088  N N   . PHE F  2 60  ? 79.691  -8.973   5.214   1.00 48.26  ? 53   PHE F N   1 
ATOM   9089  C CA  . PHE F  2 60  ? 80.000  -9.583   3.927   1.00 52.09  ? 53   PHE F CA  1 
ATOM   9090  C C   . PHE F  2 60  ? 79.330  -8.833   2.780   1.00 51.26  ? 53   PHE F C   1 
ATOM   9091  O O   . PHE F  2 60  ? 78.169  -8.441   2.878   1.00 50.82  ? 53   PHE F O   1 
ATOM   9092  C CB  . PHE F  2 60  ? 79.569  -11.052  3.919   1.00 52.23  ? 53   PHE F CB  1 
ATOM   9093  C CG  . PHE F  2 60  ? 80.104  -11.849  5.077   1.00 49.79  ? 53   PHE F CG  1 
ATOM   9094  C CD1 . PHE F  2 60  ? 79.407  -11.915  6.274   1.00 39.44  ? 53   PHE F CD1 1 
ATOM   9095  C CD2 . PHE F  2 60  ? 81.304  -12.533  4.969   1.00 54.22  ? 53   PHE F CD2 1 
ATOM   9096  C CE1 . PHE F  2 60  ? 79.896  -12.645  7.339   1.00 40.35  ? 53   PHE F CE1 1 
ATOM   9097  C CE2 . PHE F  2 60  ? 81.797  -13.267  6.033   1.00 56.09  ? 53   PHE F CE2 1 
ATOM   9098  C CZ  . PHE F  2 60  ? 81.092  -13.322  7.219   1.00 51.56  ? 53   PHE F CZ  1 
ATOM   9099  N N   . SER F  2 61  ? 80.069  -8.636   1.694   1.00 58.00  ? 54   SER F N   1 
ATOM   9100  C CA  . SER F  2 61  ? 79.533  -7.956   0.522   1.00 58.54  ? 54   SER F CA  1 
ATOM   9101  C C   . SER F  2 61  ? 78.898  -8.952   -0.440  1.00 56.30  ? 54   SER F C   1 
ATOM   9102  O O   . SER F  2 61  ? 79.505  -9.969   -0.776  1.00 58.77  ? 54   SER F O   1 
ATOM   9103  C CB  . SER F  2 61  ? 80.629  -7.162   -0.190  1.00 66.47  ? 54   SER F CB  1 
ATOM   9104  O OG  . SER F  2 61  ? 80.108  -6.469   -1.311  1.00 73.26  ? 54   SER F OG  1 
ATOM   9105  N N   . CYS F  2 62  ? 77.679  -8.657   -0.883  1.00 51.98  ? 55   CYS F N   1 
ATOM   9106  C CA  . CYS F  2 62  ? 76.972  -9.545   -1.799  1.00 53.31  ? 55   CYS F CA  1 
ATOM   9107  C C   . CYS F  2 62  ? 75.797  -8.869   -2.498  1.00 49.54  ? 55   CYS F C   1 
ATOM   9108  O O   . CYS F  2 62  ? 75.183  -7.945   -1.964  1.00 46.25  ? 55   CYS F O   1 
ATOM   9109  C CB  . CYS F  2 62  ? 76.471  -10.785  -1.055  1.00 54.94  ? 55   CYS F CB  1 
ATOM   9110  S SG  . CYS F  2 62  ? 75.520  -11.933  -2.079  1.00 52.16  ? 55   CYS F SG  1 
ATOM   9111  N N   . ASP F  2 63  ? 75.498  -9.345   -3.703  1.00 47.22  ? 56   ASP F N   1 
ATOM   9112  C CA  . ASP F  2 63  ? 74.314  -8.926   -4.440  1.00 47.19  ? 56   ASP F CA  1 
ATOM   9113  C C   . ASP F  2 63  ? 73.367  -10.115  -4.542  1.00 49.43  ? 56   ASP F C   1 
ATOM   9114  O O   . ASP F  2 63  ? 73.685  -11.114  -5.187  1.00 50.12  ? 56   ASP F O   1 
ATOM   9115  C CB  . ASP F  2 63  ? 74.691  -8.410   -5.831  1.00 54.94  ? 56   ASP F CB  1 
ATOM   9116  C CG  . ASP F  2 63  ? 73.546  -7.688   -6.525  1.00 58.49  ? 56   ASP F CG  1 
ATOM   9117  O OD1 . ASP F  2 63  ? 72.374  -7.899   -6.147  1.00 57.57  ? 56   ASP F OD1 1 
ATOM   9118  O OD2 . ASP F  2 63  ? 73.822  -6.906   -7.460  1.00 60.77  ? 56   ASP F OD2 1 
ATOM   9119  N N   . VAL F  2 64  ? 72.207  -10.001  -3.903  1.00 48.08  ? 57   VAL F N   1 
ATOM   9120  C CA  . VAL F  2 64  ? 71.252  -11.103  -3.838  1.00 50.07  ? 57   VAL F CA  1 
ATOM   9121  C C   . VAL F  2 64  ? 70.723  -11.499  -5.216  1.00 50.42  ? 57   VAL F C   1 
ATOM   9122  O O   . VAL F  2 64  ? 70.282  -12.631  -5.416  1.00 49.02  ? 57   VAL F O   1 
ATOM   9123  C CB  . VAL F  2 64  ? 70.062  -10.755  -2.921  1.00 53.68  ? 57   VAL F CB  1 
ATOM   9124  C CG1 . VAL F  2 64  ? 70.534  -10.579  -1.487  1.00 49.70  ? 57   VAL F CG1 1 
ATOM   9125  C CG2 . VAL F  2 64  ? 69.356  -9.500   -3.411  1.00 58.03  ? 57   VAL F CG2 1 
ATOM   9126  N N   . ALA F  2 65  ? 70.777  -10.569  -6.163  1.00 59.65  ? 58   ALA F N   1 
ATOM   9127  C CA  . ALA F  2 65  ? 70.321  -10.834  -7.522  1.00 64.75  ? 58   ALA F CA  1 
ATOM   9128  C C   . ALA F  2 65  ? 71.283  -11.766  -8.253  1.00 68.70  ? 58   ALA F C   1 
ATOM   9129  O O   . ALA F  2 65  ? 70.863  -12.610  -9.045  1.00 73.09  ? 58   ALA F O   1 
ATOM   9130  C CB  . ALA F  2 65  ? 70.158  -9.531   -8.290  1.00 63.99  ? 58   ALA F CB  1 
ATOM   9131  N N   . LYS F  2 66  ? 72.575  -11.609  -7.981  1.00 60.63  ? 59   LYS F N   1 
ATOM   9132  C CA  . LYS F  2 66  ? 73.597  -12.434  -8.614  1.00 53.82  ? 59   LYS F CA  1 
ATOM   9133  C C   . LYS F  2 66  ? 73.713  -13.784  -7.913  1.00 52.56  ? 59   LYS F C   1 
ATOM   9134  O O   . LYS F  2 66  ? 73.978  -13.844  -6.713  1.00 39.73  ? 59   LYS F O   1 
ATOM   9135  C CB  . LYS F  2 66  ? 74.947  -11.716  -8.604  1.00 60.12  ? 59   LYS F CB  1 
ATOM   9136  C CG  . LYS F  2 66  ? 74.883  -10.254  -9.027  1.00 61.73  ? 59   LYS F CG  1 
ATOM   9137  C CD  . LYS F  2 66  ? 76.272  -9.719   -9.346  1.00 69.69  ? 59   LYS F CD  1 
ATOM   9138  C CE  . LYS F  2 66  ? 76.265  -8.216   -9.587  1.00 74.46  ? 59   LYS F CE  1 
ATOM   9139  N NZ  . LYS F  2 66  ? 76.522  -7.443   -8.338  1.00 75.25  ? 59   LYS F NZ  1 
ATOM   9140  N N   . GLU F  2 67  ? 73.517  -14.863  -8.666  1.00 52.00  ? 60   GLU F N   1 
ATOM   9141  C CA  . GLU F  2 67  ? 73.528  -16.210  -8.100  1.00 56.20  ? 60   GLU F CA  1 
ATOM   9142  C C   . GLU F  2 67  ? 74.879  -16.597  -7.505  1.00 63.25  ? 60   GLU F C   1 
ATOM   9143  O O   . GLU F  2 67  ? 74.955  -17.025  -6.353  1.00 65.21  ? 60   GLU F O   1 
ATOM   9144  C CB  . GLU F  2 67  ? 73.132  -17.238  -9.160  1.00 58.47  ? 60   GLU F CB  1 
ATOM   9145  C CG  . GLU F  2 67  ? 73.220  -18.676  -8.673  1.00 64.72  ? 60   GLU F CG  1 
ATOM   9146  C CD  . GLU F  2 67  ? 73.150  -19.681  -9.804  1.00 74.75  ? 60   GLU F CD  1 
ATOM   9147  O OE1 . GLU F  2 67  ? 73.237  -19.264  -10.978 1.00 80.42  ? 60   GLU F OE1 1 
ATOM   9148  O OE2 . GLU F  2 67  ? 73.012  -20.890  -9.519  1.00 75.93  ? 60   GLU F OE2 1 
ATOM   9149  N N   . HIS F  2 68  ? 75.937  -16.452  -8.298  1.00 70.02  ? 61   HIS F N   1 
ATOM   9150  C CA  . HIS F  2 68  ? 77.280  -16.837  -7.872  1.00 72.44  ? 61   HIS F CA  1 
ATOM   9151  C C   . HIS F  2 68  ? 77.739  -16.068  -6.640  1.00 68.65  ? 61   HIS F C   1 
ATOM   9152  O O   . HIS F  2 68  ? 78.505  -16.585  -5.829  1.00 67.18  ? 61   HIS F O   1 
ATOM   9153  C CB  . HIS F  2 68  ? 78.279  -16.631  -9.011  1.00 82.06  ? 61   HIS F CB  1 
ATOM   9154  C CG  . HIS F  2 68  ? 78.297  -17.747  -10.007 1.00 92.06  ? 61   HIS F CG  1 
ATOM   9155  N ND1 . HIS F  2 68  ? 78.536  -17.543  -11.349 1.00 96.33  ? 61   HIS F ND1 1 
ATOM   9156  C CD2 . HIS F  2 68  ? 78.117  -19.081  -9.855  1.00 95.16  ? 61   HIS F CD2 1 
ATOM   9157  C CE1 . HIS F  2 68  ? 78.496  -18.701  -11.982 1.00 99.27  ? 61   HIS F CE1 1 
ATOM   9158  N NE2 . HIS F  2 68  ? 78.244  -19.651  -11.099 1.00 98.87  ? 61   HIS F NE2 1 
ATOM   9159  N N   . ASP F  2 69  ? 77.270  -14.832  -6.504  1.00 69.33  ? 62   ASP F N   1 
ATOM   9160  C CA  . ASP F  2 69  ? 77.600  -14.023  -5.339  1.00 71.60  ? 62   ASP F CA  1 
ATOM   9161  C C   . ASP F  2 69  ? 76.947  -14.589  -4.084  1.00 70.82  ? 62   ASP F C   1 
ATOM   9162  O O   . ASP F  2 69  ? 77.551  -14.596  -3.015  1.00 79.72  ? 62   ASP F O   1 
ATOM   9163  C CB  . ASP F  2 69  ? 77.170  -12.570  -5.552  1.00 76.31  ? 62   ASP F CB  1 
ATOM   9164  C CG  . ASP F  2 69  ? 77.996  -11.868  -6.611  1.00 83.88  ? 62   ASP F CG  1 
ATOM   9165  O OD1 . ASP F  2 69  ? 78.538  -12.560  -7.499  1.00 89.36  ? 62   ASP F OD1 1 
ATOM   9166  O OD2 . ASP F  2 69  ? 78.105  -10.625  -6.555  1.00 83.18  ? 62   ASP F OD2 1 
ATOM   9167  N N   . VAL F  2 70  ? 75.717  -15.074  -4.224  1.00 62.88  ? 63   VAL F N   1 
ATOM   9168  C CA  . VAL F  2 70  ? 74.973  -15.629  -3.098  1.00 58.19  ? 63   VAL F CA  1 
ATOM   9169  C C   . VAL F  2 70  ? 75.572  -16.943  -2.602  1.00 53.84  ? 63   VAL F C   1 
ATOM   9170  O O   . VAL F  2 70  ? 75.878  -17.087  -1.418  1.00 52.10  ? 63   VAL F O   1 
ATOM   9171  C CB  . VAL F  2 70  ? 73.493  -15.866  -3.465  1.00 54.47  ? 63   VAL F CB  1 
ATOM   9172  C CG1 . VAL F  2 70  ? 72.775  -16.602  -2.342  1.00 49.22  ? 63   VAL F CG1 1 
ATOM   9173  C CG2 . VAL F  2 70  ? 72.802  -14.548  -3.771  1.00 52.26  ? 63   VAL F CG2 1 
ATOM   9174  N N   . GLN F  2 71  ? 75.737  -17.895  -3.516  1.00 56.97  ? 64   GLN F N   1 
ATOM   9175  C CA  . GLN F  2 71  ? 76.217  -19.229  -3.168  1.00 59.93  ? 64   GLN F CA  1 
ATOM   9176  C C   . GLN F  2 71  ? 77.639  -19.211  -2.616  1.00 64.38  ? 64   GLN F C   1 
ATOM   9177  O O   . GLN F  2 71  ? 78.016  -20.074  -1.822  1.00 65.68  ? 64   GLN F O   1 
ATOM   9178  C CB  . GLN F  2 71  ? 76.148  -20.150  -4.388  1.00 61.73  ? 64   GLN F CB  1 
ATOM   9179  N N   . ASN F  2 72  ? 78.428  -18.228  -3.038  1.00 64.23  ? 65   ASN F N   1 
ATOM   9180  C CA  . ASN F  2 72  ? 79.803  -18.115  -2.571  1.00 65.42  ? 65   ASN F CA  1 
ATOM   9181  C C   . ASN F  2 72  ? 79.906  -17.248  -1.320  1.00 59.43  ? 65   ASN F C   1 
ATOM   9182  O O   . ASN F  2 72  ? 80.877  -17.340  -0.571  1.00 59.03  ? 65   ASN F O   1 
ATOM   9183  C CB  . ASN F  2 72  ? 80.702  -17.557  -3.675  1.00 71.94  ? 65   ASN F CB  1 
ATOM   9184  C CG  . ASN F  2 72  ? 81.994  -18.339  -3.823  1.00 81.08  ? 65   ASN F CG  1 
ATOM   9185  O OD1 . ASN F  2 72  ? 82.969  -18.091  -3.113  1.00 85.95  ? 65   ASN F OD1 1 
ATOM   9186  N ND2 . ASN F  2 72  ? 82.006  -19.291  -4.750  1.00 82.82  ? 65   ASN F ND2 1 
ATOM   9187  N N   . THR F  2 73  ? 78.905  -16.402  -1.101  1.00 58.02  ? 66   THR F N   1 
ATOM   9188  C CA  . THR F  2 73  ? 78.820  -15.650  0.143   1.00 57.76  ? 66   THR F CA  1 
ATOM   9189  C C   . THR F  2 73  ? 78.522  -16.628  1.268   1.00 56.02  ? 66   THR F C   1 
ATOM   9190  O O   . THR F  2 73  ? 79.196  -16.638  2.296   1.00 56.87  ? 66   THR F O   1 
ATOM   9191  C CB  . THR F  2 73  ? 77.732  -14.560  0.094   1.00 56.50  ? 66   THR F CB  1 
ATOM   9192  O OG1 . THR F  2 73  ? 77.968  -13.696  -1.024  1.00 63.44  ? 66   THR F OG1 1 
ATOM   9193  C CG2 . THR F  2 73  ? 77.740  -13.735  1.367   1.00 51.88  ? 66   THR F CG2 1 
ATOM   9194  N N   . PHE F  2 74  ? 77.514  -17.466  1.042   1.00 58.24  ? 67   PHE F N   1 
ATOM   9195  C CA  . PHE F  2 74  ? 77.118  -18.500  1.991   1.00 60.12  ? 67   PHE F CA  1 
ATOM   9196  C C   . PHE F  2 74  ? 78.273  -19.434  2.341   1.00 57.84  ? 67   PHE F C   1 
ATOM   9197  O O   . PHE F  2 74  ? 78.360  -19.927  3.465   1.00 54.11  ? 67   PHE F O   1 
ATOM   9198  C CB  . PHE F  2 74  ? 75.946  -19.311  1.430   1.00 62.21  ? 67   PHE F CB  1 
ATOM   9199  C CG  . PHE F  2 74  ? 74.609  -18.919  1.994   1.00 61.62  ? 67   PHE F CG  1 
ATOM   9200  C CD1 . PHE F  2 74  ? 73.896  -17.858  1.459   1.00 61.07  ? 67   PHE F CD1 1 
ATOM   9201  C CD2 . PHE F  2 74  ? 74.067  -19.614  3.062   1.00 62.27  ? 67   PHE F CD2 1 
ATOM   9202  C CE1 . PHE F  2 74  ? 72.665  -17.500  1.979   1.00 58.51  ? 67   PHE F CE1 1 
ATOM   9203  C CE2 . PHE F  2 74  ? 72.838  -19.260  3.586   1.00 62.80  ? 67   PHE F CE2 1 
ATOM   9204  C CZ  . PHE F  2 74  ? 72.136  -18.202  3.045   1.00 59.98  ? 67   PHE F CZ  1 
ATOM   9205  N N   . GLU F  2 75  ? 79.158  -19.672  1.377   1.00 60.34  ? 68   GLU F N   1 
ATOM   9206  C CA  . GLU F  2 75  ? 80.307  -20.541  1.607   1.00 66.06  ? 68   GLU F CA  1 
ATOM   9207  C C   . GLU F  2 75  ? 81.353  -19.835  2.466   1.00 64.28  ? 68   GLU F C   1 
ATOM   9208  O O   . GLU F  2 75  ? 82.091  -20.481  3.209   1.00 63.47  ? 68   GLU F O   1 
ATOM   9209  C CB  . GLU F  2 75  ? 80.924  -20.999  0.280   1.00 74.09  ? 68   GLU F CB  1 
ATOM   9210  C CG  . GLU F  2 75  ? 82.298  -20.410  -0.030  1.00 82.94  ? 68   GLU F CG  1 
ATOM   9211  C CD  . GLU F  2 75  ? 83.036  -21.178  -1.111  1.00 89.62  ? 68   GLU F CD  1 
ATOM   9212  O OE1 . GLU F  2 75  ? 82.686  -22.353  -1.348  1.00 92.68  ? 68   GLU F OE1 1 
ATOM   9213  O OE2 . GLU F  2 75  ? 83.965  -20.608  -1.723  1.00 90.91  ? 68   GLU F OE2 1 
ATOM   9214  N N   . GLU F  2 76  ? 81.408  -18.510  2.368   1.00 67.88  ? 69   GLU F N   1 
ATOM   9215  C CA  . GLU F  2 76  ? 82.354  -17.730  3.161   1.00 71.39  ? 69   GLU F CA  1 
ATOM   9216  C C   . GLU F  2 76  ? 81.810  -17.486  4.563   1.00 71.90  ? 69   GLU F C   1 
ATOM   9217  O O   . GLU F  2 76  ? 82.572  -17.366  5.522   1.00 75.91  ? 69   GLU F O   1 
ATOM   9218  C CB  . GLU F  2 76  ? 82.675  -16.403  2.471   1.00 72.66  ? 69   GLU F CB  1 
ATOM   9219  C CG  . GLU F  2 76  ? 83.571  -16.549  1.251   1.00 78.56  ? 69   GLU F CG  1 
ATOM   9220  C CD  . GLU F  2 76  ? 83.962  -15.215  0.646   1.00 86.21  ? 69   GLU F CD  1 
ATOM   9221  O OE1 . GLU F  2 76  ? 83.058  -14.410  0.339   1.00 85.55  ? 69   GLU F OE1 1 
ATOM   9222  O OE2 . GLU F  2 76  ? 85.177  -14.970  0.482   1.00 92.31  ? 69   GLU F OE2 1 
ATOM   9223  N N   . LEU F  2 77  ? 80.488  -17.409  4.676   1.00 70.38  ? 70   LEU F N   1 
ATOM   9224  C CA  . LEU F  2 77  ? 79.832  -17.349  5.978   1.00 70.12  ? 70   LEU F CA  1 
ATOM   9225  C C   . LEU F  2 77  ? 80.028  -18.670  6.707   1.00 68.36  ? 70   LEU F C   1 
ATOM   9226  O O   . LEU F  2 77  ? 80.155  -18.711  7.931   1.00 68.31  ? 70   LEU F O   1 
ATOM   9227  C CB  . LEU F  2 77  ? 78.339  -17.051  5.827   1.00 70.91  ? 70   LEU F CB  1 
ATOM   9228  C CG  . LEU F  2 77  ? 77.874  -15.593  5.815   1.00 69.72  ? 70   LEU F CG  1 
ATOM   9229  C CD1 . LEU F  2 77  ? 78.523  -14.820  4.689   1.00 72.40  ? 70   LEU F CD1 1 
ATOM   9230  C CD2 . LEU F  2 77  ? 76.359  -15.527  5.704   1.00 63.24  ? 70   LEU F CD2 1 
ATOM   9231  N N   . GLU F  2 78  ? 80.048  -19.747  5.930   1.00 70.13  ? 71   GLU F N   1 
ATOM   9232  C CA  . GLU F  2 78  ? 80.200  -21.098  6.454   1.00 73.63  ? 71   GLU F CA  1 
ATOM   9233  C C   . GLU F  2 78  ? 81.554  -21.294  7.130   1.00 79.21  ? 71   GLU F C   1 
ATOM   9234  O O   . GLU F  2 78  ? 81.653  -21.959  8.160   1.00 83.18  ? 71   GLU F O   1 
ATOM   9235  C CB  . GLU F  2 78  ? 80.017  -22.116  5.325   1.00 80.47  ? 71   GLU F CB  1 
ATOM   9236  C CG  . GLU F  2 78  ? 80.295  -23.556  5.716   1.00 87.88  ? 71   GLU F CG  1 
ATOM   9237  C CD  . GLU F  2 78  ? 80.170  -24.508  4.542   1.00 94.10  ? 71   GLU F CD  1 
ATOM   9238  O OE1 . GLU F  2 78  ? 79.408  -24.197  3.601   1.00 91.13  ? 71   GLU F OE1 1 
ATOM   9239  O OE2 . GLU F  2 78  ? 80.840  -25.562  4.556   1.00 101.10 ? 71   GLU F OE2 1 
ATOM   9240  N N   . LYS F  2 79  ? 82.594  -20.705  6.548   1.00 77.90  ? 72   LYS F N   1 
ATOM   9241  C CA  . LYS F  2 79  ? 83.944  -20.837  7.083   1.00 76.97  ? 72   LYS F CA  1 
ATOM   9242  C C   . LYS F  2 79  ? 84.176  -19.940  8.296   1.00 75.65  ? 72   LYS F C   1 
ATOM   9243  O O   . LYS F  2 79  ? 85.067  -20.201  9.106   1.00 78.99  ? 72   LYS F O   1 
ATOM   9244  C CB  . LYS F  2 79  ? 84.978  -20.521  6.001   1.00 75.16  ? 72   LYS F CB  1 
ATOM   9245  C CG  . LYS F  2 79  ? 84.987  -21.512  4.850   1.00 77.13  ? 72   LYS F CG  1 
ATOM   9246  C CD  . LYS F  2 79  ? 85.873  -21.034  3.714   1.00 77.76  ? 72   LYS F CD  1 
ATOM   9247  C CE  . LYS F  2 79  ? 85.872  -22.025  2.561   1.00 77.88  ? 72   LYS F CE  1 
ATOM   9248  N NZ  . LYS F  2 79  ? 86.573  -21.484  1.363   1.00 76.34  ? 72   LYS F NZ  1 
ATOM   9249  N N   . HIS F  2 80  ? 83.375  -18.887  8.422   1.00 70.46  ? 73   HIS F N   1 
ATOM   9250  C CA  . HIS F  2 80  ? 83.550  -17.925  9.507   1.00 69.02  ? 73   HIS F CA  1 
ATOM   9251  C C   . HIS F  2 80  ? 82.598  -18.171  10.673  1.00 69.37  ? 73   HIS F C   1 
ATOM   9252  O O   . HIS F  2 80  ? 83.018  -18.188  11.830  1.00 71.47  ? 73   HIS F O   1 
ATOM   9253  C CB  . HIS F  2 80  ? 83.365  -16.498  8.988   1.00 67.66  ? 73   HIS F CB  1 
ATOM   9254  C CG  . HIS F  2 80  ? 84.444  -16.048  8.053   1.00 71.45  ? 73   HIS F CG  1 
ATOM   9255  N ND1 . HIS F  2 80  ? 85.508  -16.850  7.700   1.00 75.65  ? 73   HIS F ND1 1 
ATOM   9256  C CD2 . HIS F  2 80  ? 84.624  -14.876  7.399   1.00 70.16  ? 73   HIS F CD2 1 
ATOM   9257  C CE1 . HIS F  2 80  ? 86.296  -16.192  6.868   1.00 73.42  ? 73   HIS F CE1 1 
ATOM   9258  N NE2 . HIS F  2 80  ? 85.782  -14.992  6.669   1.00 70.20  ? 73   HIS F NE2 1 
ATOM   9259  N N   . LEU F  2 81  ? 81.317  -18.352  10.369  1.00 68.60  ? 74   LEU F N   1 
ATOM   9260  C CA  . LEU F  2 81  ? 80.306  -18.534  11.407  1.00 65.86  ? 74   LEU F CA  1 
ATOM   9261  C C   . LEU F  2 81  ? 80.001  -20.005  11.666  1.00 68.40  ? 74   LEU F C   1 
ATOM   9262  O O   . LEU F  2 81  ? 79.875  -20.431  12.814  1.00 73.81  ? 74   LEU F O   1 
ATOM   9263  C CB  . LEU F  2 81  ? 79.012  -17.806  11.034  1.00 60.17  ? 74   LEU F CB  1 
ATOM   9264  C CG  . LEU F  2 81  ? 78.954  -16.278  11.131  1.00 57.45  ? 74   LEU F CG  1 
ATOM   9265  C CD1 . LEU F  2 81  ? 80.140  -15.715  11.909  1.00 57.08  ? 74   LEU F CD1 1 
ATOM   9266  C CD2 . LEU F  2 81  ? 78.859  -15.648  9.747   1.00 59.98  ? 74   LEU F CD2 1 
ATOM   9267  N N   . GLY F  2 82  ? 79.876  -20.774  10.590  1.00 71.96  ? 75   GLY F N   1 
ATOM   9268  C CA  . GLY F  2 82  ? 79.500  -22.170  10.692  1.00 73.02  ? 75   GLY F CA  1 
ATOM   9269  C C   . GLY F  2 82  ? 78.095  -22.389  10.171  1.00 72.29  ? 75   GLY F C   1 
ATOM   9270  O O   . GLY F  2 82  ? 77.684  -21.765  9.193   1.00 74.28  ? 75   GLY F O   1 
ATOM   9271  N N   . ARG F  2 83  ? 77.355  -23.273  10.831  1.00 65.71  ? 76   ARG F N   1 
ATOM   9272  C CA  . ARG F  2 83  ? 75.992  -23.594  10.423  1.00 60.53  ? 76   ARG F CA  1 
ATOM   9273  C C   . ARG F  2 83  ? 75.049  -22.410  10.618  1.00 58.00  ? 76   ARG F C   1 
ATOM   9274  O O   . ARG F  2 83  ? 74.928  -21.875  11.720  1.00 58.92  ? 76   ARG F O   1 
ATOM   9275  C CB  . ARG F  2 83  ? 75.482  -24.806  11.204  1.00 62.34  ? 76   ARG F CB  1 
ATOM   9276  C CG  . ARG F  2 83  ? 76.205  -26.105  10.880  1.00 68.81  ? 76   ARG F CG  1 
ATOM   9277  C CD  . ARG F  2 83  ? 76.015  -27.144  11.980  1.00 75.26  ? 76   ARG F CD  1 
ATOM   9278  N NE  . ARG F  2 83  ? 74.764  -26.957  12.712  1.00 75.55  ? 76   ARG F NE  1 
ATOM   9279  C CZ  . ARG F  2 83  ? 74.694  -26.576  13.985  1.00 71.64  ? 76   ARG F CZ  1 
ATOM   9280  N NH1 . ARG F  2 83  ? 75.805  -26.348  14.672  1.00 75.00  ? 76   ARG F NH1 1 
ATOM   9281  N NH2 . ARG F  2 83  ? 73.514  -26.427  14.572  1.00 65.54  ? 76   ARG F NH2 1 
ATOM   9282  N N   . VAL F  2 84  ? 74.384  -22.003  9.540   1.00 53.44  ? 77   VAL F N   1 
ATOM   9283  C CA  . VAL F  2 84  ? 73.418  -20.912  9.602   1.00 47.89  ? 77   VAL F CA  1 
ATOM   9284  C C   . VAL F  2 84  ? 71.997  -21.459  9.682   1.00 43.74  ? 77   VAL F C   1 
ATOM   9285  O O   . VAL F  2 84  ? 71.509  -22.086  8.743   1.00 46.03  ? 77   VAL F O   1 
ATOM   9286  C CB  . VAL F  2 84  ? 73.535  -19.977  8.385   1.00 45.73  ? 77   VAL F CB  1 
ATOM   9287  C CG1 . VAL F  2 84  ? 72.521  -18.848  8.485   1.00 34.08  ? 77   VAL F CG1 1 
ATOM   9288  C CG2 . VAL F  2 84  ? 74.946  -19.423  8.276   1.00 51.53  ? 77   VAL F CG2 1 
ATOM   9289  N N   . ASN F  2 85  ? 71.340  -21.217  10.811  1.00 41.35  ? 78   ASN F N   1 
ATOM   9290  C CA  . ASN F  2 85  ? 69.992  -21.722  11.034  1.00 38.49  ? 78   ASN F CA  1 
ATOM   9291  C C   . ASN F  2 85  ? 68.953  -20.608  11.103  1.00 34.74  ? 78   ASN F C   1 
ATOM   9292  O O   . ASN F  2 85  ? 67.761  -20.869  11.257  1.00 36.74  ? 78   ASN F O   1 
ATOM   9293  C CB  . ASN F  2 85  ? 69.949  -22.561  12.312  1.00 41.50  ? 78   ASN F CB  1 
ATOM   9294  C CG  . ASN F  2 85  ? 70.801  -21.976  13.421  1.00 42.14  ? 78   ASN F CG  1 
ATOM   9295  O OD1 . ASN F  2 85  ? 71.191  -20.809  13.372  1.00 43.40  ? 78   ASN F OD1 1 
ATOM   9296  N ND2 . ASN F  2 85  ? 71.097  -22.787  14.429  1.00 40.31  ? 78   ASN F ND2 1 
ATOM   9297  N N   . PHE F  2 86  ? 69.410  -19.365  10.991  1.00 37.51  ? 79   PHE F N   1 
ATOM   9298  C CA  . PHE F  2 86  ? 68.505  -18.221  10.951  1.00 41.71  ? 79   PHE F CA  1 
ATOM   9299  C C   . PHE F  2 86  ? 68.785  -17.355  9.728   1.00 44.00  ? 79   PHE F C   1 
ATOM   9300  O O   . PHE F  2 86  ? 69.938  -17.056  9.416   1.00 41.00  ? 79   PHE F O   1 
ATOM   9301  C CB  . PHE F  2 86  ? 68.624  -17.390  12.229  1.00 40.66  ? 79   PHE F CB  1 
ATOM   9302  C CG  . PHE F  2 86  ? 68.096  -18.081  13.453  1.00 41.40  ? 79   PHE F CG  1 
ATOM   9303  C CD1 . PHE F  2 86  ? 66.745  -18.044  13.756  1.00 39.24  ? 79   PHE F CD1 1 
ATOM   9304  C CD2 . PHE F  2 86  ? 68.950  -18.764  14.302  1.00 40.75  ? 79   PHE F CD2 1 
ATOM   9305  C CE1 . PHE F  2 86  ? 66.255  -18.678  14.882  1.00 38.77  ? 79   PHE F CE1 1 
ATOM   9306  C CE2 . PHE F  2 86  ? 68.467  -19.401  15.430  1.00 41.83  ? 79   PHE F CE2 1 
ATOM   9307  C CZ  . PHE F  2 86  ? 67.117  -19.357  15.720  1.00 41.11  ? 79   PHE F CZ  1 
ATOM   9308  N N   . LEU F  2 87  ? 67.722  -16.953  9.039   1.00 47.60  ? 80   LEU F N   1 
ATOM   9309  C CA  . LEU F  2 87  ? 67.860  -16.195  7.802   1.00 50.54  ? 80   LEU F CA  1 
ATOM   9310  C C   . LEU F  2 87  ? 66.877  -15.031  7.736   1.00 52.34  ? 80   LEU F C   1 
ATOM   9311  O O   . LEU F  2 87  ? 65.693  -15.187  8.034   1.00 58.47  ? 80   LEU F O   1 
ATOM   9312  C CB  . LEU F  2 87  ? 67.660  -17.116  6.598   1.00 56.68  ? 80   LEU F CB  1 
ATOM   9313  C CG  . LEU F  2 87  ? 67.841  -16.481  5.221   1.00 63.32  ? 80   LEU F CG  1 
ATOM   9314  C CD1 . LEU F  2 87  ? 69.255  -15.944  5.072   1.00 66.68  ? 80   LEU F CD1 1 
ATOM   9315  C CD2 . LEU F  2 87  ? 67.520  -17.488  4.128   1.00 65.26  ? 80   LEU F CD2 1 
ATOM   9316  N N   . VAL F  2 88  ? 67.377  -13.862  7.345   1.00 48.77  ? 81   VAL F N   1 
ATOM   9317  C CA  . VAL F  2 88  ? 66.538  -12.676  7.209   1.00 46.68  ? 81   VAL F CA  1 
ATOM   9318  C C   . VAL F  2 88  ? 66.755  -11.998  5.858   1.00 45.39  ? 81   VAL F C   1 
ATOM   9319  O O   . VAL F  2 88  ? 67.838  -11.482  5.578   1.00 45.26  ? 81   VAL F O   1 
ATOM   9320  C CB  . VAL F  2 88  ? 66.809  -11.657  8.335   1.00 47.06  ? 81   VAL F CB  1 
ATOM   9321  C CG1 . VAL F  2 88  ? 66.035  -10.372  8.085   1.00 49.42  ? 81   VAL F CG1 1 
ATOM   9322  C CG2 . VAL F  2 88  ? 66.447  -12.247  9.690   1.00 43.53  ? 81   VAL F CG2 1 
ATOM   9323  N N   . ASN F  2 89  ? 65.719  -12.006  5.024   1.00 39.93  ? 82   ASN F N   1 
ATOM   9324  C CA  . ASN F  2 89  ? 65.779  -11.372  3.711   1.00 35.63  ? 82   ASN F CA  1 
ATOM   9325  C C   . ASN F  2 89  ? 65.181  -9.970   3.718   1.00 40.51  ? 82   ASN F C   1 
ATOM   9326  O O   . ASN F  2 89  ? 63.993  -9.792   3.451   1.00 42.87  ? 82   ASN F O   1 
ATOM   9327  C CB  . ASN F  2 89  ? 65.059  -12.233  2.672   1.00 31.18  ? 82   ASN F CB  1 
ATOM   9328  C CG  . ASN F  2 89  ? 65.981  -13.232  2.006   1.00 36.37  ? 82   ASN F CG  1 
ATOM   9329  O OD1 . ASN F  2 89  ? 67.110  -12.905  1.644   1.00 40.56  ? 82   ASN F OD1 1 
ATOM   9330  N ND2 . ASN F  2 89  ? 65.503  -14.461  1.841   1.00 34.85  ? 82   ASN F ND2 1 
ATOM   9331  N N   . ALA F  2 90  ? 66.013  -8.976   4.017   1.00 37.63  ? 83   ALA F N   1 
ATOM   9332  C CA  . ALA F  2 90  ? 65.562  -7.590   4.072   1.00 35.89  ? 83   ALA F CA  1 
ATOM   9333  C C   . ALA F  2 90  ? 66.207  -6.754   2.973   1.00 35.48  ? 83   ALA F C   1 
ATOM   9334  O O   . ALA F  2 90  ? 66.100  -5.528   2.969   1.00 40.96  ? 83   ALA F O   1 
ATOM   9335  C CB  . ALA F  2 90  ? 65.861  -6.991   5.436   1.00 38.37  ? 83   ALA F CB  1 
ATOM   9336  N N   . ALA F  2 91  ? 66.880  -7.423   2.043   1.00 35.59  ? 84   ALA F N   1 
ATOM   9337  C CA  . ALA F  2 91  ? 67.518  -6.742   0.923   1.00 40.77  ? 84   ALA F CA  1 
ATOM   9338  C C   . ALA F  2 91  ? 66.507  -6.475   -0.185  1.00 41.88  ? 84   ALA F C   1 
ATOM   9339  O O   . ALA F  2 91  ? 65.959  -7.407   -0.773  1.00 43.20  ? 84   ALA F O   1 
ATOM   9340  C CB  . ALA F  2 91  ? 68.683  -7.563   0.396   1.00 30.20  ? 84   ALA F CB  1 
ATOM   9341  N N   . GLY F  2 92  ? 66.258  -5.199   -0.466  1.00 42.79  ? 85   GLY F N   1 
ATOM   9342  C CA  . GLY F  2 92  ? 65.287  -4.833   -1.479  1.00 42.15  ? 85   GLY F CA  1 
ATOM   9343  C C   . GLY F  2 92  ? 65.378  -3.397   -1.957  1.00 44.29  ? 85   GLY F C   1 
ATOM   9344  O O   . GLY F  2 92  ? 65.948  -2.536   -1.285  1.00 41.46  ? 85   GLY F O   1 
ATOM   9345  N N   . ILE F  2 93  ? 64.811  -3.148   -3.133  1.00 47.59  ? 86   ILE F N   1 
ATOM   9346  C CA  . ILE F  2 93  ? 64.756  -1.809   -3.709  1.00 48.53  ? 86   ILE F CA  1 
ATOM   9347  C C   . ILE F  2 93  ? 63.328  -1.476   -4.133  1.00 49.04  ? 86   ILE F C   1 
ATOM   9348  O O   . ILE F  2 93  ? 62.499  -2.371   -4.301  1.00 46.19  ? 86   ILE F O   1 
ATOM   9349  C CB  . ILE F  2 93  ? 65.694  -1.674   -4.924  1.00 46.93  ? 86   ILE F CB  1 
ATOM   9350  C CG1 . ILE F  2 93  ? 65.360  -2.735   -5.975  1.00 41.15  ? 86   ILE F CG1 1 
ATOM   9351  C CG2 . ILE F  2 93  ? 67.149  -1.788   -4.494  1.00 50.07  ? 86   ILE F CG2 1 
ATOM   9352  C CD1 . ILE F  2 93  ? 66.240  -2.679   -7.202  1.00 37.22  ? 86   ILE F CD1 1 
ATOM   9353  N N   . ASN F  2 94  ? 63.044  -0.189   -4.305  1.00 50.87  ? 87   ASN F N   1 
ATOM   9354  C CA  . ASN F  2 94  ? 61.710  0.249    -4.700  1.00 52.62  ? 87   ASN F CA  1 
ATOM   9355  C C   . ASN F  2 94  ? 61.761  1.406    -5.690  1.00 56.56  ? 87   ASN F C   1 
ATOM   9356  O O   . ASN F  2 94  ? 62.466  2.390    -5.473  1.00 58.61  ? 87   ASN F O   1 
ATOM   9357  C CB  . ASN F  2 94  ? 60.897  0.654    -3.467  1.00 57.28  ? 87   ASN F CB  1 
ATOM   9358  C CG  . ASN F  2 94  ? 59.404  0.735    -3.747  1.00 63.32  ? 87   ASN F CG  1 
ATOM   9359  O OD1 . ASN F  2 94  ? 58.975  0.821    -4.898  1.00 62.86  ? 87   ASN F OD1 1 
ATOM   9360  N ND2 . ASN F  2 94  ? 58.604  0.708    -2.686  1.00 66.74  ? 87   ASN F ND2 1 
ATOM   9361  N N   . ARG F  2 95  ? 61.007  1.282    -6.777  1.00 61.25  ? 88   ARG F N   1 
ATOM   9362  C CA  . ARG F  2 95  ? 60.907  2.351    -7.762  1.00 67.66  ? 88   ARG F CA  1 
ATOM   9363  C C   . ARG F  2 95  ? 59.447  2.666    -8.065  1.00 74.63  ? 88   ARG F C   1 
ATOM   9364  O O   . ARG F  2 95  ? 58.780  1.930    -8.793  1.00 79.42  ? 88   ARG F O   1 
ATOM   9365  C CB  . ARG F  2 95  ? 61.648  1.974    -9.047  1.00 65.98  ? 88   ARG F CB  1 
ATOM   9366  N N   . ASP F  2 96  ? 58.954  3.761    -7.494  1.00 81.12  ? 89   ASP F N   1 
ATOM   9367  C CA  . ASP F  2 96  ? 57.579  4.191    -7.718  1.00 82.54  ? 89   ASP F CA  1 
ATOM   9368  C C   . ASP F  2 96  ? 57.392  4.756    -9.120  1.00 79.81  ? 89   ASP F C   1 
ATOM   9369  O O   . ASP F  2 96  ? 58.105  5.669    -9.537  1.00 80.72  ? 89   ASP F O   1 
ATOM   9370  C CB  . ASP F  2 96  ? 57.165  5.233    -6.677  1.00 88.86  ? 89   ASP F CB  1 
ATOM   9371  C CG  . ASP F  2 96  ? 56.554  4.608    -5.439  1.00 94.42  ? 89   ASP F CG  1 
ATOM   9372  O OD1 . ASP F  2 96  ? 56.800  3.408    -5.191  1.00 96.35  ? 89   ASP F OD1 1 
ATOM   9373  O OD2 . ASP F  2 96  ? 55.825  5.317    -4.713  1.00 95.51  ? 89   ASP F OD2 1 
ATOM   9374  N N   . GLY F  2 97  ? 56.422  4.206    -9.842  1.00 76.35  ? 90   GLY F N   1 
ATOM   9375  C CA  . GLY F  2 97  ? 56.120  4.658    -11.186 1.00 78.00  ? 90   GLY F CA  1 
ATOM   9376  C C   . GLY F  2 97  ? 54.916  3.943    -11.764 1.00 75.76  ? 90   GLY F C   1 
ATOM   9377  O O   . GLY F  2 97  ? 54.606  2.816    -11.378 1.00 77.75  ? 90   GLY F O   1 
ATOM   9378  N N   . LEU F  2 98  ? 54.231  4.607    -12.689 1.00 77.21  ? 91   LEU F N   1 
ATOM   9379  C CA  . LEU F  2 98  ? 53.084  4.013    -13.361 1.00 76.74  ? 91   LEU F CA  1 
ATOM   9380  C C   . LEU F  2 98  ? 53.536  2.880    -14.273 1.00 76.72  ? 91   LEU F C   1 
ATOM   9381  O O   . LEU F  2 98  ? 54.657  2.897    -14.783 1.00 78.21  ? 91   LEU F O   1 
ATOM   9382  C CB  . LEU F  2 98  ? 52.321  5.072    -14.159 1.00 77.96  ? 91   LEU F CB  1 
ATOM   9383  C CG  . LEU F  2 98  ? 51.723  6.218    -13.341 1.00 77.83  ? 91   LEU F CG  1 
ATOM   9384  C CD1 . LEU F  2 98  ? 51.046  7.233    -14.250 1.00 79.20  ? 91   LEU F CD1 1 
ATOM   9385  C CD2 . LEU F  2 98  ? 50.745  5.685    -12.303 1.00 78.16  ? 91   LEU F CD2 1 
ATOM   9386  N N   . LEU F  2 99  ? 52.662  1.897    -14.470 1.00 79.01  ? 92   LEU F N   1 
ATOM   9387  C CA  . LEU F  2 99  ? 52.981  0.732    -15.289 1.00 78.80  ? 92   LEU F CA  1 
ATOM   9388  C C   . LEU F  2 99  ? 53.369  1.129    -16.709 1.00 81.78  ? 92   LEU F C   1 
ATOM   9389  O O   . LEU F  2 99  ? 54.305  0.574    -17.282 1.00 80.51  ? 92   LEU F O   1 
ATOM   9390  C CB  . LEU F  2 99  ? 51.798  -0.238   -15.325 1.00 79.91  ? 92   LEU F CB  1 
ATOM   9391  C CG  . LEU F  2 99  ? 51.983  -1.477   -16.205 1.00 80.93  ? 92   LEU F CG  1 
ATOM   9392  C CD1 . LEU F  2 99  ? 53.174  -2.297   -15.734 1.00 78.09  ? 92   LEU F CD1 1 
ATOM   9393  C CD2 . LEU F  2 99  ? 50.721  -2.323   -16.224 1.00 81.81  ? 92   LEU F CD2 1 
ATOM   9394  N N   . VAL F  2 100 ? 52.652  2.099    -17.265 1.00 81.44  ? 93   VAL F N   1 
ATOM   9395  C CA  . VAL F  2 100 ? 52.917  2.562    -18.622 1.00 81.46  ? 93   VAL F CA  1 
ATOM   9396  C C   . VAL F  2 100 ? 54.193  3.399    -18.695 1.00 81.99  ? 93   VAL F C   1 
ATOM   9397  O O   . VAL F  2 100 ? 54.699  3.676    -19.782 1.00 84.96  ? 93   VAL F O   1 
ATOM   9398  C CB  . VAL F  2 100 ? 51.740  3.389    -19.175 1.00 78.81  ? 93   VAL F CB  1 
ATOM   9399  C CG1 . VAL F  2 100 ? 50.490  2.529    -19.276 1.00 76.76  ? 93   VAL F CG1 1 
ATOM   9400  C CG2 . VAL F  2 100 ? 51.485  4.605    -18.299 1.00 79.37  ? 93   VAL F CG2 1 
ATOM   9401  N N   . ARG F  2 101 ? 54.712  3.797    -17.537 1.00 76.91  ? 94   ARG F N   1 
ATOM   9402  C CA  . ARG F  2 101 ? 55.919  4.614    -17.486 1.00 75.67  ? 94   ARG F CA  1 
ATOM   9403  C C   . ARG F  2 101 ? 57.057  3.880    -16.783 1.00 77.01  ? 94   ARG F C   1 
ATOM   9404  O O   . ARG F  2 101 ? 58.019  4.498    -16.326 1.00 77.89  ? 94   ARG F O   1 
ATOM   9405  C CB  . ARG F  2 101 ? 55.638  5.943    -16.784 1.00 69.91  ? 94   ARG F CB  1 
ATOM   9406  C CG  . ARG F  2 101 ? 54.350  6.614    -17.231 1.00 72.45  ? 94   ARG F CG  1 
ATOM   9407  C CD  . ARG F  2 101 ? 54.299  8.071    -16.805 1.00 75.61  ? 94   ARG F CD  1 
ATOM   9408  N NE  . ARG F  2 101 ? 55.084  8.925    -17.692 1.00 80.90  ? 94   ARG F NE  1 
ATOM   9409  C CZ  . ARG F  2 101 ? 54.592  9.542    -18.761 1.00 89.08  ? 94   ARG F CZ  1 
ATOM   9410  N NH1 . ARG F  2 101 ? 53.311  9.403    -19.077 1.00 91.34  ? 94   ARG F NH1 1 
ATOM   9411  N NH2 . ARG F  2 101 ? 55.377  10.299   -19.514 1.00 92.01  ? 94   ARG F NH2 1 
ATOM   9412  N N   . THR F  2 102 ? 56.940  2.559    -16.701 1.00 80.68  ? 95   THR F N   1 
ATOM   9413  C CA  . THR F  2 102 ? 57.964  1.741    -16.065 1.00 78.84  ? 95   THR F CA  1 
ATOM   9414  C C   . THR F  2 102 ? 58.722  0.920    -17.100 1.00 78.17  ? 95   THR F C   1 
ATOM   9415  O O   . THR F  2 102 ? 58.139  0.095    -17.802 1.00 79.40  ? 95   THR F O   1 
ATOM   9416  C CB  . THR F  2 102 ? 57.360  0.799    -15.010 1.00 79.68  ? 95   THR F CB  1 
ATOM   9417  O OG1 . THR F  2 102 ? 56.721  1.573    -13.988 1.00 82.75  ? 95   THR F OG1 1 
ATOM   9418  C CG2 . THR F  2 102 ? 58.445  -0.061   -14.382 1.00 79.34  ? 95   THR F CG2 1 
ATOM   9419  N N   . LYS F  2 103 ? 60.026  1.154    -17.186 1.00 77.01  ? 96   LYS F N   1 
ATOM   9420  C CA  . LYS F  2 103 ? 60.867  0.473    -18.162 1.00 75.44  ? 96   LYS F CA  1 
ATOM   9421  C C   . LYS F  2 103 ? 61.033  -0.996   -17.783 1.00 71.25  ? 96   LYS F C   1 
ATOM   9422  O O   . LYS F  2 103 ? 61.085  -1.338   -16.602 1.00 70.43  ? 96   LYS F O   1 
ATOM   9423  C CB  . LYS F  2 103 ? 62.230  1.159    -18.266 1.00 78.22  ? 96   LYS F CB  1 
ATOM   9424  C CG  . LYS F  2 103 ? 62.260  2.583    -17.713 1.00 82.44  ? 96   LYS F CG  1 
ATOM   9425  C CD  . LYS F  2 103 ? 61.505  3.580    -18.590 1.00 86.31  ? 96   LYS F CD  1 
ATOM   9426  C CE  . LYS F  2 103 ? 61.359  4.922    -17.879 1.00 84.71  ? 96   LYS F CE  1 
ATOM   9427  N NZ  . LYS F  2 103 ? 60.492  5.884    -18.618 1.00 85.04  ? 96   LYS F NZ  1 
ATOM   9428  N N   . THR F  2 104 ? 61.118  -1.860   -18.791 1.00 69.90  ? 97   THR F N   1 
ATOM   9429  C CA  . THR F  2 104 ? 61.154  -3.302   -18.565 1.00 72.90  ? 97   THR F CA  1 
ATOM   9430  C C   . THR F  2 104 ? 62.390  -3.749   -17.787 1.00 70.61  ? 97   THR F C   1 
ATOM   9431  O O   . THR F  2 104 ? 62.347  -4.750   -17.073 1.00 68.09  ? 97   THR F O   1 
ATOM   9432  C CB  . THR F  2 104 ? 61.096  -4.082   -19.895 1.00 76.36  ? 97   THR F CB  1 
ATOM   9433  O OG1 . THR F  2 104 ? 61.195  -5.487   -19.631 1.00 72.73  ? 97   THR F OG1 1 
ATOM   9434  C CG2 . THR F  2 104 ? 62.231  -3.663   -20.818 1.00 82.58  ? 97   THR F CG2 1 
ATOM   9435  N N   . GLU F  2 105 ? 63.485  -3.007   -17.920 1.00 73.24  ? 98   GLU F N   1 
ATOM   9436  C CA  . GLU F  2 105 ? 64.715  -3.349   -17.218 1.00 75.58  ? 98   GLU F CA  1 
ATOM   9437  C C   . GLU F  2 105 ? 64.621  -2.951   -15.752 1.00 74.60  ? 98   GLU F C   1 
ATOM   9438  O O   . GLU F  2 105 ? 65.318  -3.504   -14.901 1.00 73.82  ? 98   GLU F O   1 
ATOM   9439  C CB  . GLU F  2 105 ? 65.921  -2.679   -17.881 1.00 81.56  ? 98   GLU F CB  1 
ATOM   9440  C CG  . GLU F  2 105 ? 66.163  -3.137   -19.311 1.00 88.25  ? 98   GLU F CG  1 
ATOM   9441  C CD  . GLU F  2 105 ? 66.254  -4.648   -19.431 1.00 90.03  ? 98   GLU F CD  1 
ATOM   9442  O OE1 . GLU F  2 105 ? 66.917  -5.279   -18.580 1.00 91.75  ? 98   GLU F OE1 1 
ATOM   9443  O OE2 . GLU F  2 105 ? 65.654  -5.207   -20.373 1.00 88.58  ? 98   GLU F OE2 1 
ATOM   9444  N N   . ASP F  2 106 ? 63.750  -1.990   -15.463 1.00 73.21  ? 99   ASP F N   1 
ATOM   9445  C CA  . ASP F  2 106 ? 63.486  -1.590   -14.089 1.00 73.37  ? 99   ASP F CA  1 
ATOM   9446  C C   . ASP F  2 106 ? 62.485  -2.551   -13.460 1.00 72.61  ? 99   ASP F C   1 
ATOM   9447  O O   . ASP F  2 106 ? 62.370  -2.633   -12.238 1.00 73.90  ? 99   ASP F O   1 
ATOM   9448  C CB  . ASP F  2 106 ? 62.968  -0.153   -14.031 1.00 78.77  ? 99   ASP F CB  1 
ATOM   9449  C CG  . ASP F  2 106 ? 63.984  0.851    -14.537 1.00 83.88  ? 99   ASP F CG  1 
ATOM   9450  O OD1 . ASP F  2 106 ? 65.188  0.519    -14.561 1.00 88.38  ? 99   ASP F OD1 1 
ATOM   9451  O OD2 . ASP F  2 106 ? 63.581  1.973    -14.906 1.00 82.93  ? 99   ASP F OD2 1 
ATOM   9452  N N   . MET F  2 107 ? 61.762  -3.277   -14.309 1.00 68.05  ? 100  MET F N   1 
ATOM   9453  C CA  . MET F  2 107 ? 60.883  -4.342   -13.846 1.00 60.76  ? 100  MET F CA  1 
ATOM   9454  C C   . MET F  2 107 ? 61.718  -5.552   -13.452 1.00 57.93  ? 100  MET F C   1 
ATOM   9455  O O   . MET F  2 107 ? 61.569  -6.096   -12.359 1.00 55.50  ? 100  MET F O   1 
ATOM   9456  C CB  . MET F  2 107 ? 59.870  -4.730   -14.925 1.00 58.82  ? 100  MET F CB  1 
ATOM   9457  C CG  . MET F  2 107 ? 58.892  -3.632   -15.301 1.00 59.01  ? 100  MET F CG  1 
ATOM   9458  S SD  . MET F  2 107 ? 57.672  -4.199   -16.503 1.00 67.63  ? 100  MET F SD  1 
ATOM   9459  C CE  . MET F  2 107 ? 56.706  -2.710   -16.736 1.00 85.29  ? 100  MET F CE  1 
ATOM   9460  N N   . VAL F  2 108 ? 62.601  -5.960   -14.359 1.00 59.62  ? 101  VAL F N   1 
ATOM   9461  C CA  . VAL F  2 108 ? 63.508  -7.078   -14.128 1.00 54.55  ? 101  VAL F CA  1 
ATOM   9462  C C   . VAL F  2 108 ? 64.430  -6.792   -12.942 1.00 53.77  ? 101  VAL F C   1 
ATOM   9463  O O   . VAL F  2 108 ? 64.816  -7.702   -12.206 1.00 55.53  ? 101  VAL F O   1 
ATOM   9464  C CB  . VAL F  2 108 ? 64.347  -7.376   -15.391 1.00 52.58  ? 101  VAL F CB  1 
ATOM   9465  C CG1 . VAL F  2 108 ? 65.333  -8.502   -15.139 1.00 55.05  ? 101  VAL F CG1 1 
ATOM   9466  C CG2 . VAL F  2 108 ? 63.435  -7.723   -16.558 1.00 49.15  ? 101  VAL F CG2 1 
ATOM   9467  N N   . SER F  2 109 ? 64.762  -5.518   -12.755 1.00 52.86  ? 102  SER F N   1 
ATOM   9468  C CA  . SER F  2 109 ? 65.608  -5.089   -11.646 1.00 52.67  ? 102  SER F CA  1 
ATOM   9469  C C   . SER F  2 109 ? 65.008  -5.448   -10.288 1.00 50.75  ? 102  SER F C   1 
ATOM   9470  O O   . SER F  2 109 ? 65.648  -6.114   -9.474  1.00 50.50  ? 102  SER F O   1 
ATOM   9471  C CB  . SER F  2 109 ? 65.853  -3.581   -11.719 1.00 60.39  ? 102  SER F CB  1 
ATOM   9472  O OG  . SER F  2 109 ? 66.543  -3.120   -10.571 1.00 67.16  ? 102  SER F OG  1 
ATOM   9473  N N   . GLN F  2 110 ? 63.777  -5.005   -10.050 1.00 47.98  ? 103  GLN F N   1 
ATOM   9474  C CA  . GLN F  2 110 ? 63.116  -5.240   -8.771  1.00 40.15  ? 103  GLN F CA  1 
ATOM   9475  C C   . GLN F  2 110 ? 62.732  -6.703   -8.581  1.00 38.48  ? 103  GLN F C   1 
ATOM   9476  O O   . GLN F  2 110 ? 62.839  -7.241   -7.479  1.00 41.73  ? 103  GLN F O   1 
ATOM   9477  C CB  . GLN F  2 110 ? 61.872  -4.362   -8.642  1.00 40.11  ? 103  GLN F CB  1 
ATOM   9478  C CG  . GLN F  2 110 ? 62.153  -2.873   -8.666  1.00 46.24  ? 103  GLN F CG  1 
ATOM   9479  C CD  . GLN F  2 110 ? 60.920  -2.048   -8.361  1.00 55.67  ? 103  GLN F CD  1 
ATOM   9480  O OE1 . GLN F  2 110 ? 60.283  -2.223   -7.322  1.00 56.68  ? 103  GLN F OE1 1 
ATOM   9481  N NE2 . GLN F  2 110 ? 60.571  -1.149   -9.273  1.00 59.28  ? 103  GLN F NE2 1 
ATOM   9482  N N   . LEU F  2 111 ? 62.281  -7.341   -9.657  1.00 37.39  ? 104  LEU F N   1 
ATOM   9483  C CA  . LEU F  2 111 ? 61.848  -8.733   -9.597  1.00 38.30  ? 104  LEU F CA  1 
ATOM   9484  C C   . LEU F  2 111 ? 62.995  -9.669   -9.229  1.00 36.65  ? 104  LEU F C   1 
ATOM   9485  O O   . LEU F  2 111 ? 62.785  -10.701  -8.593  1.00 36.29  ? 104  LEU F O   1 
ATOM   9486  C CB  . LEU F  2 111 ? 61.232  -9.162   -10.931 1.00 42.27  ? 104  LEU F CB  1 
ATOM   9487  C CG  . LEU F  2 111 ? 59.870  -8.560   -11.285 1.00 44.78  ? 104  LEU F CG  1 
ATOM   9488  C CD1 . LEU F  2 111 ? 59.401  -9.060   -12.643 1.00 47.75  ? 104  LEU F CD1 1 
ATOM   9489  C CD2 . LEU F  2 111 ? 58.842  -8.872   -10.208 1.00 43.74  ? 104  LEU F CD2 1 
ATOM   9490  N N   . HIS F  2 112 ? 64.208  -9.307   -9.631  1.00 40.47  ? 105  HIS F N   1 
ATOM   9491  C CA  . HIS F  2 112 ? 65.382  -10.105  -9.302  1.00 36.49  ? 105  HIS F CA  1 
ATOM   9492  C C   . HIS F  2 112 ? 65.876  -9.795   -7.895  1.00 43.03  ? 105  HIS F C   1 
ATOM   9493  O O   . HIS F  2 112 ? 66.279  -10.693  -7.156  1.00 47.93  ? 105  HIS F O   1 
ATOM   9494  C CB  . HIS F  2 112 ? 66.499  -9.865   -10.317 1.00 38.14  ? 105  HIS F CB  1 
ATOM   9495  C CG  . HIS F  2 112 ? 66.241  -10.484  -11.654 1.00 45.58  ? 105  HIS F CG  1 
ATOM   9496  N ND1 . HIS F  2 112 ? 67.247  -10.746  -12.559 1.00 48.34  ? 105  HIS F ND1 1 
ATOM   9497  C CD2 . HIS F  2 112 ? 65.092  -10.896  -12.240 1.00 48.42  ? 105  HIS F CD2 1 
ATOM   9498  C CE1 . HIS F  2 112 ? 66.730  -11.292  -13.645 1.00 51.56  ? 105  HIS F CE1 1 
ATOM   9499  N NE2 . HIS F  2 112 ? 65.423  -11.394  -13.477 1.00 50.40  ? 105  HIS F NE2 1 
ATOM   9500  N N   . THR F  2 113 ? 65.837  -8.518   -7.531  1.00 43.95  ? 106  THR F N   1 
ATOM   9501  C CA  . THR F  2 113 ? 66.310  -8.074   -6.226  1.00 42.81  ? 106  THR F CA  1 
ATOM   9502  C C   . THR F  2 113 ? 65.384  -8.515   -5.098  1.00 44.29  ? 106  THR F C   1 
ATOM   9503  O O   . THR F  2 113 ? 65.818  -9.149   -4.137  1.00 49.73  ? 106  THR F O   1 
ATOM   9504  C CB  . THR F  2 113 ? 66.450  -6.542   -6.175  1.00 42.22  ? 106  THR F CB  1 
ATOM   9505  O OG1 . THR F  2 113 ? 67.361  -6.108   -7.192  1.00 49.40  ? 106  THR F OG1 1 
ATOM   9506  C CG2 . THR F  2 113 ? 66.960  -6.097   -4.813  1.00 35.66  ? 106  THR F CG2 1 
ATOM   9507  N N   . ASN F  2 114 ? 64.106  -8.175   -5.225  1.00 42.24  ? 107  ASN F N   1 
ATOM   9508  C CA  . ASN F  2 114 ? 63.141  -8.397   -4.156  1.00 36.06  ? 107  ASN F CA  1 
ATOM   9509  C C   . ASN F  2 114 ? 62.614  -9.826   -4.088  1.00 36.54  ? 107  ASN F C   1 
ATOM   9510  O O   . ASN F  2 114 ? 62.375  -10.354  -3.003  1.00 41.77  ? 107  ASN F O   1 
ATOM   9511  C CB  . ASN F  2 114 ? 61.964  -7.432   -4.307  1.00 36.14  ? 107  ASN F CB  1 
ATOM   9512  C CG  . ASN F  2 114 ? 62.405  -5.988   -4.417  1.00 36.52  ? 107  ASN F CG  1 
ATOM   9513  O OD1 . ASN F  2 114 ? 63.516  -5.636   -4.024  1.00 38.86  ? 107  ASN F OD1 1 
ATOM   9514  N ND2 . ASN F  2 114 ? 61.532  -5.141   -4.951  1.00 35.93  ? 107  ASN F ND2 1 
ATOM   9515  N N   . LEU F  2 115 ? 62.428  -10.449  -5.247  1.00 36.22  ? 108  LEU F N   1 
ATOM   9516  C CA  . LEU F  2 115 ? 61.827  -11.777  -5.296  1.00 43.76  ? 108  LEU F CA  1 
ATOM   9517  C C   . LEU F  2 115 ? 62.864  -12.874  -5.522  1.00 47.25  ? 108  LEU F C   1 
ATOM   9518  O O   . LEU F  2 115 ? 63.054  -13.739  -4.667  1.00 42.45  ? 108  LEU F O   1 
ATOM   9519  C CB  . LEU F  2 115 ? 60.758  -11.833  -6.389  1.00 47.94  ? 108  LEU F CB  1 
ATOM   9520  C CG  . LEU F  2 115 ? 59.955  -13.131  -6.485  1.00 47.85  ? 108  LEU F CG  1 
ATOM   9521  C CD1 . LEU F  2 115 ? 59.356  -13.484  -5.135  1.00 43.51  ? 108  LEU F CD1 1 
ATOM   9522  C CD2 . LEU F  2 115 ? 58.867  -13.007  -7.538  1.00 50.91  ? 108  LEU F CD2 1 
ATOM   9523  N N   . LEU F  2 116 ? 63.529  -12.833  -6.673  1.00 52.17  ? 109  LEU F N   1 
ATOM   9524  C CA  . LEU F  2 116 ? 64.508  -13.854  -7.033  1.00 47.72  ? 109  LEU F CA  1 
ATOM   9525  C C   . LEU F  2 116 ? 65.694  -13.862  -6.074  1.00 43.73  ? 109  LEU F C   1 
ATOM   9526  O O   . LEU F  2 116 ? 66.277  -14.913  -5.803  1.00 38.23  ? 109  LEU F O   1 
ATOM   9527  C CB  . LEU F  2 116 ? 64.996  -13.642  -8.468  1.00 43.01  ? 109  LEU F CB  1 
ATOM   9528  C CG  . LEU F  2 116 ? 65.965  -14.688  -9.020  1.00 44.19  ? 109  LEU F CG  1 
ATOM   9529  C CD1 . LEU F  2 116 ? 65.328  -16.070  -9.017  1.00 41.84  ? 109  LEU F CD1 1 
ATOM   9530  C CD2 . LEU F  2 116 ? 66.421  -14.307  -10.419 1.00 49.45  ? 109  LEU F CD2 1 
ATOM   9531  N N   . GLY F  2 117 ? 66.043  -12.686  -5.561  1.00 42.87  ? 110  GLY F N   1 
ATOM   9532  C CA  . GLY F  2 117 ? 67.137  -12.557  -4.617  1.00 46.74  ? 110  GLY F CA  1 
ATOM   9533  C C   . GLY F  2 117 ? 66.901  -13.359  -3.352  1.00 46.34  ? 110  GLY F C   1 
ATOM   9534  O O   . GLY F  2 117 ? 67.800  -14.040  -2.861  1.00 46.94  ? 110  GLY F O   1 
ATOM   9535  N N   . SER F  2 118 ? 65.683  -13.279  -2.828  1.00 51.20  ? 111  SER F N   1 
ATOM   9536  C CA  . SER F  2 118 ? 65.314  -14.022  -1.630  1.00 51.70  ? 111  SER F CA  1 
ATOM   9537  C C   . SER F  2 118 ? 65.201  -15.514  -1.924  1.00 55.00  ? 111  SER F C   1 
ATOM   9538  O O   . SER F  2 118 ? 65.501  -16.347  -1.069  1.00 56.59  ? 111  SER F O   1 
ATOM   9539  C CB  . SER F  2 118 ? 63.997  -13.496  -1.056  1.00 50.63  ? 111  SER F CB  1 
ATOM   9540  O OG  . SER F  2 118 ? 64.111  -12.134  -0.686  1.00 52.38  ? 111  SER F OG  1 
ATOM   9541  N N   . MET F  2 119 ? 64.768  -15.844  -3.137  1.00 53.53  ? 112  MET F N   1 
ATOM   9542  C CA  . MET F  2 119 ? 64.641  -17.236  -3.554  1.00 50.00  ? 112  MET F CA  1 
ATOM   9543  C C   . MET F  2 119 ? 66.003  -17.918  -3.608  1.00 51.08  ? 112  MET F C   1 
ATOM   9544  O O   . MET F  2 119 ? 66.166  -19.033  -3.116  1.00 49.49  ? 112  MET F O   1 
ATOM   9545  C CB  . MET F  2 119 ? 63.951  -17.332  -4.916  1.00 46.96  ? 112  MET F CB  1 
ATOM   9546  C CG  . MET F  2 119 ? 62.494  -16.899  -4.906  1.00 42.28  ? 112  MET F CG  1 
ATOM   9547  S SD  . MET F  2 119 ? 61.726  -17.001  -6.533  1.00 67.07  ? 112  MET F SD  1 
ATOM   9548  C CE  . MET F  2 119 ? 61.911  -18.748  -6.886  1.00 36.37  ? 112  MET F CE  1 
ATOM   9549  N N   . LEU F  2 120 ? 66.977  -17.241  -4.209  1.00 53.70  ? 113  LEU F N   1 
ATOM   9550  C CA  . LEU F  2 120 ? 68.346  -17.743  -4.250  1.00 52.91  ? 113  LEU F CA  1 
ATOM   9551  C C   . LEU F  2 120 ? 68.922  -17.826  -2.843  1.00 53.35  ? 113  LEU F C   1 
ATOM   9552  O O   . LEU F  2 120 ? 69.646  -18.764  -2.507  1.00 56.26  ? 113  LEU F O   1 
ATOM   9553  C CB  . LEU F  2 120 ? 69.226  -16.851  -5.129  1.00 48.32  ? 113  LEU F CB  1 
ATOM   9554  C CG  . LEU F  2 120 ? 68.945  -16.853  -6.632  1.00 42.65  ? 113  LEU F CG  1 
ATOM   9555  C CD1 . LEU F  2 120 ? 69.817  -15.826  -7.336  1.00 40.26  ? 113  LEU F CD1 1 
ATOM   9556  C CD2 . LEU F  2 120 ? 69.170  -18.240  -7.215  1.00 38.50  ? 113  LEU F CD2 1 
ATOM   9557  N N   . THR F  2 121 ? 68.591  -16.833  -2.025  1.00 51.91  ? 114  THR F N   1 
ATOM   9558  C CA  . THR F  2 121 ? 69.051  -16.783  -0.644  1.00 52.28  ? 114  THR F CA  1 
ATOM   9559  C C   . THR F  2 121 ? 68.474  -17.935  0.175   1.00 50.94  ? 114  THR F C   1 
ATOM   9560  O O   . THR F  2 121 ? 69.203  -18.620  0.895   1.00 51.90  ? 114  THR F O   1 
ATOM   9561  C CB  . THR F  2 121 ? 68.674  -15.445  0.018   1.00 51.55  ? 114  THR F CB  1 
ATOM   9562  O OG1 . THR F  2 121 ? 69.421  -14.384  -0.590  1.00 49.75  ? 114  THR F OG1 1 
ATOM   9563  C CG2 . THR F  2 121 ? 68.985  -15.483  1.497   1.00 53.36  ? 114  THR F CG2 1 
ATOM   9564  N N   . CYS F  2 122 ? 67.166  -18.145  0.060   1.00 46.31  ? 115  CYS F N   1 
ATOM   9565  C CA  . CYS F  2 122 ? 66.505  -19.246  0.753   1.00 44.76  ? 115  CYS F CA  1 
ATOM   9566  C C   . CYS F  2 122 ? 67.006  -20.592  0.242   1.00 50.92  ? 115  CYS F C   1 
ATOM   9567  O O   . CYS F  2 122 ? 67.157  -21.538  1.013   1.00 51.40  ? 115  CYS F O   1 
ATOM   9568  C CB  . CYS F  2 122 ? 64.986  -19.156  0.592   1.00 38.40  ? 115  CYS F CB  1 
ATOM   9569  S SG  . CYS F  2 122 ? 64.215  -17.802  1.504   1.00 42.22  ? 115  CYS F SG  1 
ATOM   9570  N N   . LYS F  2 123 ? 67.265  -20.667  -1.060  1.00 50.38  ? 116  LYS F N   1 
ATOM   9571  C CA  . LYS F  2 123 ? 67.789  -21.882  -1.677  1.00 47.92  ? 116  LYS F CA  1 
ATOM   9572  C C   . LYS F  2 123 ? 69.160  -22.237  -1.116  1.00 48.64  ? 116  LYS F C   1 
ATOM   9573  O O   . LYS F  2 123 ? 69.446  -23.402  -0.837  1.00 51.77  ? 116  LYS F O   1 
ATOM   9574  C CB  . LYS F  2 123 ? 67.874  -21.718  -3.197  1.00 44.95  ? 116  LYS F CB  1 
ATOM   9575  C CG  . LYS F  2 123 ? 68.601  -22.848  -3.908  1.00 37.99  ? 116  LYS F CG  1 
ATOM   9576  C CD  . LYS F  2 123 ? 68.832  -22.517  -5.375  1.00 48.02  ? 116  LYS F CD  1 
ATOM   9577  C CE  . LYS F  2 123 ? 69.645  -23.601  -6.066  1.00 49.24  ? 116  LYS F CE  1 
ATOM   9578  N NZ  . LYS F  2 123 ? 69.901  -23.277  -7.497  1.00 42.58  ? 116  LYS F NZ  1 
ATOM   9579  N N   . ALA F  2 124 ? 70.003  -21.223  -0.952  1.00 48.82  ? 117  ALA F N   1 
ATOM   9580  C CA  . ALA F  2 124 ? 71.355  -21.418  -0.443  1.00 52.25  ? 117  ALA F CA  1 
ATOM   9581  C C   . ALA F  2 124 ? 71.339  -21.847  1.021   1.00 52.04  ? 117  ALA F C   1 
ATOM   9582  O O   . ALA F  2 124 ? 72.223  -22.574  1.475   1.00 52.34  ? 117  ALA F O   1 
ATOM   9583  C CB  . ALA F  2 124 ? 72.172  -20.149  -0.614  1.00 54.62  ? 117  ALA F CB  1 
ATOM   9584  N N   . ALA F  2 125 ? 70.329  -21.392  1.755   1.00 51.53  ? 118  ALA F N   1 
ATOM   9585  C CA  . ALA F  2 125 ? 70.185  -21.750  3.160   1.00 50.96  ? 118  ALA F CA  1 
ATOM   9586  C C   . ALA F  2 125 ? 69.693  -23.186  3.306   1.00 56.23  ? 118  ALA F C   1 
ATOM   9587  O O   . ALA F  2 125 ? 69.986  -23.855  4.298   1.00 55.91  ? 118  ALA F O   1 
ATOM   9588  C CB  . ALA F  2 125 ? 69.237  -20.789  3.858   1.00 45.65  ? 118  ALA F CB  1 
ATOM   9589  N N   . MET F  2 126 ? 68.949  -23.657  2.310   1.00 59.15  ? 119  MET F N   1 
ATOM   9590  C CA  . MET F  2 126 ? 68.416  -25.014  2.325   1.00 61.65  ? 119  MET F CA  1 
ATOM   9591  C C   . MET F  2 126 ? 69.515  -26.057  2.149   1.00 76.17  ? 119  MET F C   1 
ATOM   9592  O O   . MET F  2 126 ? 69.341  -27.218  2.512   1.00 79.49  ? 119  MET F O   1 
ATOM   9593  C CB  . MET F  2 126 ? 67.353  -25.186  1.238   1.00 53.53  ? 119  MET F CB  1 
ATOM   9594  C CG  . MET F  2 126 ? 66.066  -24.435  1.513   1.00 46.83  ? 119  MET F CG  1 
ATOM   9595  S SD  . MET F  2 126 ? 65.326  -24.916  3.082   1.00 61.63  ? 119  MET F SD  1 
ATOM   9596  C CE  . MET F  2 126 ? 64.086  -23.641  3.280   1.00 106.51 ? 119  MET F CE  1 
ATOM   9597  N N   . ARG F  2 127 ? 70.650  -25.640  1.595   1.00 91.45  ? 120  ARG F N   1 
ATOM   9598  C CA  . ARG F  2 127 ? 71.775  -26.548  1.405   1.00 97.76  ? 120  ARG F CA  1 
ATOM   9599  C C   . ARG F  2 127 ? 72.431  -26.885  2.740   1.00 96.12  ? 120  ARG F C   1 
ATOM   9600  O O   . ARG F  2 127 ? 73.246  -27.803  2.830   1.00 100.49 ? 120  ARG F O   1 
ATOM   9601  C CB  . ARG F  2 127 ? 72.811  -25.941  0.454   1.00 101.47 ? 120  ARG F CB  1 
ATOM   9602  C CG  . ARG F  2 127 ? 72.230  -25.318  -0.806  1.00 107.26 ? 120  ARG F CG  1 
ATOM   9603  C CD  . ARG F  2 127 ? 73.307  -25.131  -1.867  1.00 113.61 ? 120  ARG F CD  1 
ATOM   9604  N NE  . ARG F  2 127 ? 74.617  -24.865  -1.278  1.00 118.59 ? 120  ARG F NE  1 
ATOM   9605  C CZ  . ARG F  2 127 ? 75.171  -23.660  -1.180  1.00 120.78 ? 120  ARG F CZ  1 
ATOM   9606  N NH1 . ARG F  2 127 ? 74.535  -22.591  -1.640  1.00 120.59 ? 120  ARG F NH1 1 
ATOM   9607  N NH2 . ARG F  2 127 ? 76.369  -23.525  -0.626  1.00 122.40 ? 120  ARG F NH2 1 
ATOM   9608  N N   . THR F  2 128 ? 72.071  -26.133  3.775   1.00 82.25  ? 121  THR F N   1 
ATOM   9609  C CA  . THR F  2 128 ? 72.646  -26.317  5.100   1.00 77.38  ? 121  THR F CA  1 
ATOM   9610  C C   . THR F  2 128 ? 71.586  -26.735  6.112   1.00 73.57  ? 121  THR F C   1 
ATOM   9611  O O   . THR F  2 128 ? 71.809  -27.625  6.933   1.00 78.39  ? 121  THR F O   1 
ATOM   9612  C CB  . THR F  2 128 ? 73.326  -25.029  5.603   1.00 78.79  ? 121  THR F CB  1 
ATOM   9613  O OG1 . THR F  2 128 ? 72.339  -24.150  6.158   1.00 77.93  ? 121  THR F OG1 1 
ATOM   9614  C CG2 . THR F  2 128 ? 74.050  -24.325  4.464   1.00 79.75  ? 121  THR F CG2 1 
ATOM   9615  N N   . MET F  2 129 ? 70.431  -26.083  6.047   1.00 63.72  ? 122  MET F N   1 
ATOM   9616  C CA  . MET F  2 129 ? 69.367  -26.306  7.017   1.00 54.71  ? 122  MET F CA  1 
ATOM   9617  C C   . MET F  2 129 ? 68.692  -27.664  6.838   1.00 57.27  ? 122  MET F C   1 
ATOM   9618  O O   . MET F  2 129 ? 68.297  -28.297  7.815   1.00 60.06  ? 122  MET F O   1 
ATOM   9619  C CB  . MET F  2 129 ? 68.325  -25.190  6.926   1.00 40.30  ? 122  MET F CB  1 
ATOM   9620  C CG  . MET F  2 129 ? 68.840  -23.814  7.312   1.00 35.56  ? 122  MET F CG  1 
ATOM   9621  S SD  . MET F  2 129 ? 67.576  -22.540  7.125   1.00 41.41  ? 122  MET F SD  1 
ATOM   9622  C CE  . MET F  2 129 ? 68.486  -21.076  7.609   1.00 31.86  ? 122  MET F CE  1 
ATOM   9623  N N   . ILE F  2 130 ? 68.558  -28.108  5.592   1.00 59.96  ? 123  ILE F N   1 
ATOM   9624  C CA  . ILE F  2 130 ? 67.871  -29.364  5.304   1.00 64.66  ? 123  ILE F CA  1 
ATOM   9625  C C   . ILE F  2 130 ? 68.649  -30.572  5.816   1.00 68.28  ? 123  ILE F C   1 
ATOM   9626  O O   . ILE F  2 130 ? 68.074  -31.482  6.412   1.00 68.97  ? 123  ILE F O   1 
ATOM   9627  C CB  . ILE F  2 130 ? 67.620  -29.541  3.795   1.00 65.80  ? 123  ILE F CB  1 
ATOM   9628  N N   . GLN F  2 131 ? 69.957  -30.578  5.580   1.00 72.68  ? 124  GLN F N   1 
ATOM   9629  C CA  . GLN F  2 131 ? 70.799  -31.684  6.018   1.00 76.49  ? 124  GLN F CA  1 
ATOM   9630  C C   . GLN F  2 131 ? 70.952  -31.689  7.536   1.00 79.47  ? 124  GLN F C   1 
ATOM   9631  O O   . GLN F  2 131 ? 71.121  -32.744  8.148   1.00 85.64  ? 124  GLN F O   1 
ATOM   9632  C CB  . GLN F  2 131 ? 72.172  -31.618  5.338   1.00 74.81  ? 124  GLN F CB  1 
ATOM   9633  C CG  . GLN F  2 131 ? 72.903  -30.298  5.516   1.00 72.82  ? 124  GLN F CG  1 
ATOM   9634  C CD  . GLN F  2 131 ? 74.201  -30.244  4.733   1.00 71.65  ? 124  GLN F CD  1 
ATOM   9635  O OE1 . GLN F  2 131 ? 74.386  -30.982  3.765   1.00 72.53  ? 124  GLN F OE1 1 
ATOM   9636  N NE2 . GLN F  2 131 ? 75.111  -29.371  5.151   1.00 68.82  ? 124  GLN F NE2 1 
ATOM   9637  N N   . GLN F  2 132 ? 70.881  -30.506  8.139   1.00 75.58  ? 125  GLN F N   1 
ATOM   9638  C CA  . GLN F  2 132 ? 70.984  -30.385  9.588   1.00 77.52  ? 125  GLN F CA  1 
ATOM   9639  C C   . GLN F  2 132 ? 69.605  -30.501  10.229  1.00 72.36  ? 125  GLN F C   1 
ATOM   9640  O O   . GLN F  2 132 ? 69.486  -30.654  11.447  1.00 70.23  ? 125  GLN F O   1 
ATOM   9641  C CB  . GLN F  2 132 ? 71.643  -29.060  9.976   1.00 81.23  ? 125  GLN F CB  1 
ATOM   9642  C CG  . GLN F  2 132 ? 72.244  -29.064  11.372  1.00 88.37  ? 125  GLN F CG  1 
ATOM   9643  C CD  . GLN F  2 132 ? 73.258  -30.179  11.559  1.00 96.38  ? 125  GLN F CD  1 
ATOM   9644  O OE1 . GLN F  2 132 ? 73.078  -31.065  12.396  1.00 98.39  ? 125  GLN F OE1 1 
ATOM   9645  N NE2 . GLN F  2 132 ? 74.331  -30.139  10.778  1.00 99.62  ? 125  GLN F NE2 1 
ATOM   9646  N N   . GLN F  2 133 ? 68.573  -30.428  9.392   1.00 66.90  ? 126  GLN F N   1 
ATOM   9647  C CA  . GLN F  2 133 ? 67.183  -30.561  9.822   1.00 60.10  ? 126  GLN F CA  1 
ATOM   9648  C C   . GLN F  2 133 ? 66.822  -29.573  10.928  1.00 56.34  ? 126  GLN F C   1 
ATOM   9649  O O   . GLN F  2 133 ? 66.450  -29.968  12.033  1.00 59.84  ? 126  GLN F O   1 
ATOM   9650  C CB  . GLN F  2 133 ? 66.904  -31.995  10.279  1.00 65.31  ? 126  GLN F CB  1 
ATOM   9651  C CG  . GLN F  2 133 ? 67.011  -33.020  9.161   1.00 72.99  ? 126  GLN F CG  1 
ATOM   9652  C CD  . GLN F  2 133 ? 66.772  -34.437  9.641   1.00 81.25  ? 126  GLN F CD  1 
ATOM   9653  O OE1 . GLN F  2 133 ? 67.437  -34.913  10.561  1.00 83.15  ? 126  GLN F OE1 1 
ATOM   9654  N NE2 . GLN F  2 133 ? 65.814  -35.117  9.021   1.00 85.48  ? 126  GLN F NE2 1 
ATOM   9655  N N   . GLY F  2 134 ? 66.933  -28.286  10.617  1.00 48.22  ? 127  GLY F N   1 
ATOM   9656  C CA  . GLY F  2 134 ? 66.611  -27.236  11.565  1.00 38.76  ? 127  GLY F CA  1 
ATOM   9657  C C   . GLY F  2 134 ? 66.928  -25.862  11.011  1.00 38.98  ? 127  GLY F C   1 
ATOM   9658  O O   . GLY F  2 134 ? 68.003  -25.643  10.453  1.00 46.93  ? 127  GLY F O   1 
ATOM   9659  N N   . GLY F  2 135 ? 65.989  -24.934  11.163  1.00 36.36  ? 128  GLY F N   1 
ATOM   9660  C CA  . GLY F  2 135 ? 66.176  -23.580  10.676  1.00 32.48  ? 128  GLY F CA  1 
ATOM   9661  C C   . GLY F  2 135 ? 64.915  -22.738  10.724  1.00 37.04  ? 128  GLY F C   1 
ATOM   9662  O O   . GLY F  2 135 ? 63.811  -23.259  10.879  1.00 40.37  ? 128  GLY F O   1 
ATOM   9663  N N   . SER F  2 136 ? 65.085  -21.426  10.593  1.00 34.76  ? 129  SER F N   1 
ATOM   9664  C CA  . SER F  2 136 ? 63.959  -20.498  10.589  1.00 35.97  ? 129  SER F CA  1 
ATOM   9665  C C   . SER F  2 136 ? 64.244  -19.323  9.658   1.00 36.25  ? 129  SER F C   1 
ATOM   9666  O O   . SER F  2 136 ? 65.285  -18.676  9.764   1.00 36.80  ? 129  SER F O   1 
ATOM   9667  C CB  . SER F  2 136 ? 63.667  -19.998  12.005  1.00 39.88  ? 129  SER F CB  1 
ATOM   9668  O OG  . SER F  2 136 ? 62.530  -19.152  12.023  1.00 44.10  ? 129  SER F OG  1 
ATOM   9669  N N   . ILE F  2 137 ? 63.314  -19.053  8.746   1.00 39.69  ? 130  ILE F N   1 
ATOM   9670  C CA  . ILE F  2 137 ? 63.509  -18.017  7.738   1.00 37.23  ? 130  ILE F CA  1 
ATOM   9671  C C   . ILE F  2 137 ? 62.395  -16.972  7.764   1.00 35.32  ? 130  ILE F C   1 
ATOM   9672  O O   . ILE F  2 137 ? 61.218  -17.308  7.900   1.00 33.40  ? 130  ILE F O   1 
ATOM   9673  C CB  . ILE F  2 137 ? 63.587  -18.627  6.321   1.00 36.95  ? 130  ILE F CB  1 
ATOM   9674  C CG1 . ILE F  2 137 ? 64.645  -19.731  6.270   1.00 40.38  ? 130  ILE F CG1 1 
ATOM   9675  C CG2 . ILE F  2 137 ? 63.885  -17.555  5.282   1.00 35.73  ? 130  ILE F CG2 1 
ATOM   9676  C CD1 . ILE F  2 137 ? 64.826  -20.338  4.896   1.00 41.73  ? 130  ILE F CD1 1 
ATOM   9677  N N   . VAL F  2 138 ? 62.775  -15.703  7.639   1.00 30.88  ? 131  VAL F N   1 
ATOM   9678  C CA  . VAL F  2 138 ? 61.806  -14.619  7.526   1.00 29.31  ? 131  VAL F CA  1 
ATOM   9679  C C   . VAL F  2 138 ? 62.080  -13.763  6.294   1.00 34.59  ? 131  VAL F C   1 
ATOM   9680  O O   . VAL F  2 138 ? 63.130  -13.127  6.187   1.00 37.51  ? 131  VAL F O   1 
ATOM   9681  C CB  . VAL F  2 138 ? 61.808  -13.718  8.775   1.00 27.56  ? 131  VAL F CB  1 
ATOM   9682  C CG1 . VAL F  2 138 ? 61.044  -12.430  8.504   1.00 24.37  ? 131  VAL F CG1 1 
ATOM   9683  C CG2 . VAL F  2 138 ? 61.208  -14.455  9.958   1.00 29.21  ? 131  VAL F CG2 1 
ATOM   9684  N N   . ASN F  2 139 ? 61.133  -13.763  5.363   1.00 30.38  ? 132  ASN F N   1 
ATOM   9685  C CA  . ASN F  2 139 ? 61.205  -12.899  4.192   1.00 29.50  ? 132  ASN F CA  1 
ATOM   9686  C C   . ASN F  2 139 ? 60.449  -11.601  4.443   1.00 29.14  ? 132  ASN F C   1 
ATOM   9687  O O   . ASN F  2 139 ? 59.317  -11.618  4.924   1.00 34.65  ? 132  ASN F O   1 
ATOM   9688  C CB  . ASN F  2 139 ? 60.642  -13.611  2.961   1.00 30.25  ? 132  ASN F CB  1 
ATOM   9689  C CG  . ASN F  2 139 ? 61.475  -14.809  2.547   1.00 33.61  ? 132  ASN F CG  1 
ATOM   9690  O OD1 . ASN F  2 139 ? 62.700  -14.726  2.454   1.00 34.50  ? 132  ASN F OD1 1 
ATOM   9691  N ND2 . ASN F  2 139 ? 60.814  -15.933  2.301   1.00 36.08  ? 132  ASN F ND2 1 
ATOM   9692  N N   . VAL F  2 140 ? 61.077  -10.475  4.123   1.00 29.03  ? 133  VAL F N   1 
ATOM   9693  C CA  . VAL F  2 140 ? 60.458  -9.177   4.362   1.00 32.79  ? 133  VAL F CA  1 
ATOM   9694  C C   . VAL F  2 140 ? 59.748  -8.663   3.115   1.00 42.35  ? 133  VAL F C   1 
ATOM   9695  O O   . VAL F  2 140 ? 60.387  -8.209   2.165   1.00 45.52  ? 133  VAL F O   1 
ATOM   9696  C CB  . VAL F  2 140 ? 61.492  -8.136   4.823   1.00 30.59  ? 133  VAL F CB  1 
ATOM   9697  C CG1 . VAL F  2 140 ? 60.797  -6.843   5.200   1.00 32.99  ? 133  VAL F CG1 1 
ATOM   9698  C CG2 . VAL F  2 140 ? 62.290  -8.672   6.001   1.00 34.88  ? 133  VAL F CG2 1 
ATOM   9699  N N   . GLY F  2 141 ? 58.420  -8.742   3.125   1.00 41.11  ? 134  GLY F N   1 
ATOM   9700  C CA  . GLY F  2 141 ? 57.616  -8.274   2.012   1.00 41.92  ? 134  GLY F CA  1 
ATOM   9701  C C   . GLY F  2 141 ? 56.895  -6.981   2.339   1.00 42.35  ? 134  GLY F C   1 
ATOM   9702  O O   . GLY F  2 141 ? 57.468  -6.085   2.956   1.00 40.94  ? 134  GLY F O   1 
ATOM   9703  N N   . SER F  2 142 ? 55.635  -6.888   1.926   1.00 49.66  ? 135  SER F N   1 
ATOM   9704  C CA  . SER F  2 142 ? 54.819  -5.708   2.192   1.00 51.25  ? 135  SER F CA  1 
ATOM   9705  C C   . SER F  2 142 ? 53.340  -6.019   1.990   1.00 54.49  ? 135  SER F C   1 
ATOM   9706  O O   . SER F  2 142 ? 52.991  -6.958   1.275   1.00 58.60  ? 135  SER F O   1 
ATOM   9707  C CB  . SER F  2 142 ? 55.242  -4.546   1.289   1.00 54.79  ? 135  SER F CB  1 
ATOM   9708  O OG  . SER F  2 142 ? 54.505  -3.371   1.585   1.00 58.75  ? 135  SER F OG  1 
ATOM   9709  N N   . ILE F  2 143 ? 52.474  -5.231   2.620   1.00 54.23  ? 136  ILE F N   1 
ATOM   9710  C CA  . ILE F  2 143 ? 51.034  -5.394   2.445   1.00 52.99  ? 136  ILE F CA  1 
ATOM   9711  C C   . ILE F  2 143 ? 50.619  -4.942   1.050   1.00 52.15  ? 136  ILE F C   1 
ATOM   9712  O O   . ILE F  2 143 ? 49.544  -5.293   0.566   1.00 53.10  ? 136  ILE F O   1 
ATOM   9713  C CB  . ILE F  2 143 ? 50.233  -4.606   3.498   1.00 51.39  ? 136  ILE F CB  1 
ATOM   9714  C CG1 . ILE F  2 143 ? 50.558  -3.114   3.414   1.00 53.92  ? 136  ILE F CG1 1 
ATOM   9715  C CG2 . ILE F  2 143 ? 50.518  -5.140   4.891   1.00 49.57  ? 136  ILE F CG2 1 
ATOM   9716  C CD1 . ILE F  2 143 ? 49.773  -2.266   4.390   1.00 58.65  ? 136  ILE F CD1 1 
ATOM   9717  N N   . VAL F  2 144 ? 51.483  -4.158   0.415   1.00 52.62  ? 137  VAL F N   1 
ATOM   9718  C CA  . VAL F  2 144 ? 51.286  -3.750   -0.969  1.00 55.28  ? 137  VAL F CA  1 
ATOM   9719  C C   . VAL F  2 144 ? 51.517  -4.955   -1.880  1.00 56.33  ? 137  VAL F C   1 
ATOM   9720  O O   . VAL F  2 144 ? 50.968  -5.039   -2.977  1.00 61.80  ? 137  VAL F O   1 
ATOM   9721  C CB  . VAL F  2 144 ? 52.228  -2.590   -1.353  1.00 54.38  ? 137  VAL F CB  1 
ATOM   9722  C CG1 . VAL F  2 144 ? 51.949  -2.110   -2.767  1.00 61.02  ? 137  VAL F CG1 1 
ATOM   9723  C CG2 . VAL F  2 144 ? 52.074  -1.442   -0.367  1.00 49.27  ? 137  VAL F CG2 1 
ATOM   9724  N N   . GLY F  2 145 ? 52.326  -5.898   -1.412  1.00 58.83  ? 138  GLY F N   1 
ATOM   9725  C CA  . GLY F  2 145 ? 52.502  -7.152   -2.119  1.00 59.07  ? 138  GLY F CA  1 
ATOM   9726  C C   . GLY F  2 145 ? 51.228  -7.969   -2.043  1.00 61.79  ? 138  GLY F C   1 
ATOM   9727  O O   . GLY F  2 145 ? 50.949  -8.798   -2.908  1.00 64.62  ? 138  GLY F O   1 
ATOM   9728  N N   . LEU F  2 146 ? 50.447  -7.721   -0.997  1.00 59.01  ? 139  LEU F N   1 
ATOM   9729  C CA  . LEU F  2 146 ? 49.187  -8.420   -0.788  1.00 55.71  ? 139  LEU F CA  1 
ATOM   9730  C C   . LEU F  2 146 ? 48.010  -7.657   -1.389  1.00 55.61  ? 139  LEU F C   1 
ATOM   9731  O O   . LEU F  2 146 ? 47.336  -8.150   -2.294  1.00 53.55  ? 139  LEU F O   1 
ATOM   9732  C CB  . LEU F  2 146 ? 48.949  -8.645   0.707   1.00 50.98  ? 139  LEU F CB  1 
ATOM   9733  C CG  . LEU F  2 146 ? 49.960  -9.522   1.447   1.00 47.85  ? 139  LEU F CG  1 
ATOM   9734  C CD1 . LEU F  2 146 ? 49.828  -9.331   2.948   1.00 46.36  ? 139  LEU F CD1 1 
ATOM   9735  C CD2 . LEU F  2 146 ? 49.764  -10.981  1.075   1.00 46.23  ? 139  LEU F CD2 1 
ATOM   9736  N N   . LYS F  2 147 ? 47.772  -6.451   -0.883  1.00 52.17  ? 140  LYS F N   1 
ATOM   9737  C CA  . LYS F  2 147 ? 46.588  -5.688   -1.261  1.00 46.50  ? 140  LYS F CA  1 
ATOM   9738  C C   . LYS F  2 147 ? 46.847  -4.734   -2.424  1.00 45.59  ? 140  LYS F C   1 
ATOM   9739  O O   . LYS F  2 147 ? 45.917  -4.338   -3.125  1.00 51.66  ? 140  LYS F O   1 
ATOM   9740  C CB  . LYS F  2 147 ? 46.060  -4.905   -0.058  1.00 46.83  ? 140  LYS F CB  1 
ATOM   9741  C CG  . LYS F  2 147 ? 45.980  -5.719   1.226   1.00 46.78  ? 140  LYS F CG  1 
ATOM   9742  C CD  . LYS F  2 147 ? 44.908  -5.176   2.158   1.00 50.75  ? 140  LYS F CD  1 
ATOM   9743  C CE  . LYS F  2 147 ? 43.515  -5.492   1.632   1.00 53.51  ? 140  LYS F CE  1 
ATOM   9744  N NZ  . LYS F  2 147 ? 42.452  -4.715   2.333   1.00 57.04  ? 140  LYS F NZ  1 
ATOM   9745  N N   . GLY F  2 148 ? 48.106  -4.363   -2.625  1.00 40.75  ? 141  GLY F N   1 
ATOM   9746  C CA  . GLY F  2 148 ? 48.464  -3.477   -3.719  1.00 45.61  ? 141  GLY F CA  1 
ATOM   9747  C C   . GLY F  2 148 ? 48.331  -2.005   -3.383  1.00 48.11  ? 141  GLY F C   1 
ATOM   9748  O O   . GLY F  2 148 ? 47.716  -1.636   -2.382  1.00 39.09  ? 141  GLY F O   1 
ATOM   9749  N N   . ASN F  2 149 ? 48.918  -1.164   -4.228  1.00 52.40  ? 142  ASN F N   1 
ATOM   9750  C CA  . ASN F  2 149 ? 48.821  0.283    -4.085  1.00 54.79  ? 142  ASN F CA  1 
ATOM   9751  C C   . ASN F  2 149 ? 49.152  0.978    -5.402  1.00 56.74  ? 142  ASN F C   1 
ATOM   9752  O O   . ASN F  2 149 ? 50.101  0.602    -6.091  1.00 52.67  ? 142  ASN F O   1 
ATOM   9753  C CB  . ASN F  2 149 ? 49.746  0.781    -2.972  1.00 53.26  ? 142  ASN F CB  1 
ATOM   9754  C CG  . ASN F  2 149 ? 49.645  2.280    -2.754  1.00 54.03  ? 142  ASN F CG  1 
ATOM   9755  O OD1 . ASN F  2 149 ? 50.545  3.034    -3.123  1.00 55.98  ? 142  ASN F OD1 1 
ATOM   9756  N ND2 . ASN F  2 149 ? 48.545  2.718    -2.154  1.00 49.61  ? 142  ASN F ND2 1 
ATOM   9757  N N   . SER F  2 150 ? 48.358  1.985    -5.749  1.00 61.07  ? 143  SER F N   1 
ATOM   9758  C CA  . SER F  2 150 ? 48.544  2.729    -6.990  1.00 60.82  ? 143  SER F CA  1 
ATOM   9759  C C   . SER F  2 150 ? 49.846  3.525    -6.981  1.00 63.12  ? 143  SER F C   1 
ATOM   9760  O O   . SER F  2 150 ? 49.965  4.529    -6.277  1.00 66.00  ? 143  SER F O   1 
ATOM   9761  C CB  . SER F  2 150 ? 47.361  3.670    -7.225  1.00 58.54  ? 143  SER F CB  1 
ATOM   9762  O OG  . SER F  2 150 ? 47.551  4.460    -8.386  1.00 60.61  ? 143  SER F OG  1 
ATOM   9763  N N   . GLY F  2 151 ? 50.818  3.075    -7.769  1.00 65.75  ? 144  GLY F N   1 
ATOM   9764  C CA  . GLY F  2 151 ? 52.097  3.756    -7.863  1.00 65.28  ? 144  GLY F CA  1 
ATOM   9765  C C   . GLY F  2 151 ? 53.279  2.805    -7.822  1.00 66.50  ? 144  GLY F C   1 
ATOM   9766  O O   . GLY F  2 151 ? 54.383  3.147    -8.252  1.00 68.29  ? 144  GLY F O   1 
ATOM   9767  N N   . GLN F  2 152 ? 53.046  1.607    -7.297  1.00 64.77  ? 145  GLN F N   1 
ATOM   9768  C CA  . GLN F  2 152 ? 54.090  0.596    -7.196  1.00 62.57  ? 145  GLN F CA  1 
ATOM   9769  C C   . GLN F  2 152 ? 53.565  -0.769   -7.640  1.00 56.21  ? 145  GLN F C   1 
ATOM   9770  O O   . GLN F  2 152 ? 53.548  -1.723   -6.863  1.00 51.45  ? 145  GLN F O   1 
ATOM   9771  C CB  . GLN F  2 152 ? 54.636  0.536    -5.765  1.00 67.99  ? 145  GLN F CB  1 
ATOM   9772  C CG  . GLN F  2 152 ? 53.770  1.262    -4.737  1.00 74.03  ? 145  GLN F CG  1 
ATOM   9773  C CD  . GLN F  2 152 ? 54.484  1.486    -3.408  1.00 79.35  ? 145  GLN F CD  1 
ATOM   9774  O OE1 . GLN F  2 152 ? 54.824  2.616    -3.058  1.00 82.18  ? 145  GLN F OE1 1 
ATOM   9775  N NE2 . GLN F  2 152 ? 54.700  0.412    -2.659  1.00 81.72  ? 145  GLN F NE2 1 
ATOM   9776  N N   . SER F  2 153 ? 53.151  -0.848   -8.903  1.00 55.20  ? 146  SER F N   1 
ATOM   9777  C CA  . SER F  2 153 ? 52.637  -2.081   -9.490  1.00 57.53  ? 146  SER F CA  1 
ATOM   9778  C C   . SER F  2 153 ? 53.685  -3.196   -9.551  1.00 57.18  ? 146  SER F C   1 
ATOM   9779  O O   . SER F  2 153 ? 53.396  -4.342   -9.211  1.00 57.64  ? 146  SER F O   1 
ATOM   9780  C CB  . SER F  2 153 ? 52.095  -1.807   -10.893 1.00 61.59  ? 146  SER F CB  1 
ATOM   9781  O OG  . SER F  2 153 ? 53.080  -1.204   -11.713 1.00 64.86  ? 146  SER F OG  1 
ATOM   9782  N N   . VAL F  2 154 ? 54.897  -2.867   -9.991  1.00 58.45  ? 147  VAL F N   1 
ATOM   9783  C CA  . VAL F  2 154 ? 55.959  -3.868   -10.071 1.00 54.99  ? 147  VAL F CA  1 
ATOM   9784  C C   . VAL F  2 154 ? 56.445  -4.273   -8.678  1.00 51.75  ? 147  VAL F C   1 
ATOM   9785  O O   . VAL F  2 154 ? 56.746  -5.442   -8.427  1.00 49.98  ? 147  VAL F O   1 
ATOM   9786  C CB  . VAL F  2 154 ? 57.151  -3.365   -10.922 1.00 58.36  ? 147  VAL F CB  1 
ATOM   9787  C CG1 . VAL F  2 154 ? 57.570  -1.954   -10.509 1.00 63.50  ? 147  VAL F CG1 1 
ATOM   9788  C CG2 . VAL F  2 154 ? 58.324  -4.351   -10.856 1.00 57.53  ? 147  VAL F CG2 1 
ATOM   9789  N N   . TYR F  2 155 ? 56.507  -3.302   -7.773  1.00 48.91  ? 148  TYR F N   1 
ATOM   9790  C CA  . TYR F  2 155 ? 56.917  -3.561   -6.400  1.00 46.35  ? 148  TYR F CA  1 
ATOM   9791  C C   . TYR F  2 155 ? 55.909  -4.476   -5.722  1.00 46.99  ? 148  TYR F C   1 
ATOM   9792  O O   . TYR F  2 155 ? 56.262  -5.277   -4.857  1.00 45.63  ? 148  TYR F O   1 
ATOM   9793  C CB  . TYR F  2 155 ? 57.056  -2.250   -5.626  1.00 47.16  ? 148  TYR F CB  1 
ATOM   9794  C CG  . TYR F  2 155 ? 57.493  -2.416   -4.189  1.00 44.62  ? 148  TYR F CG  1 
ATOM   9795  C CD1 . TYR F  2 155 ? 58.830  -2.604   -3.868  1.00 46.02  ? 148  TYR F CD1 1 
ATOM   9796  C CD2 . TYR F  2 155 ? 56.570  -2.372   -3.152  1.00 41.93  ? 148  TYR F CD2 1 
ATOM   9797  C CE1 . TYR F  2 155 ? 59.236  -2.750   -2.556  1.00 43.57  ? 148  TYR F CE1 1 
ATOM   9798  C CE2 . TYR F  2 155 ? 56.967  -2.518   -1.835  1.00 40.51  ? 148  TYR F CE2 1 
ATOM   9799  C CZ  . TYR F  2 155 ? 58.302  -2.706   -1.544  1.00 41.21  ? 148  TYR F CZ  1 
ATOM   9800  O OH  . TYR F  2 155 ? 58.708  -2.851   -0.239  1.00 42.18  ? 148  TYR F OH  1 
ATOM   9801  N N   . SER F  2 156 ? 54.651  -4.351   -6.131  1.00 46.49  ? 149  SER F N   1 
ATOM   9802  C CA  . SER F  2 156 ? 53.584  -5.196   -5.614  1.00 44.77  ? 149  SER F CA  1 
ATOM   9803  C C   . SER F  2 156 ? 53.771  -6.632   -6.084  1.00 43.97  ? 149  SER F C   1 
ATOM   9804  O O   . SER F  2 156 ? 53.553  -7.578   -5.328  1.00 42.52  ? 149  SER F O   1 
ATOM   9805  C CB  . SER F  2 156 ? 52.221  -4.666   -6.057  1.00 49.10  ? 149  SER F CB  1 
ATOM   9806  O OG  . SER F  2 156 ? 52.099  -3.285   -5.766  1.00 54.34  ? 149  SER F OG  1 
ATOM   9807  N N   . ALA F  2 157 ? 54.180  -6.783   -7.340  1.00 48.63  ? 150  ALA F N   1 
ATOM   9808  C CA  . ALA F  2 157 ? 54.444  -8.096   -7.913  1.00 52.82  ? 150  ALA F CA  1 
ATOM   9809  C C   . ALA F  2 157 ? 55.642  -8.752   -7.240  1.00 51.36  ? 150  ALA F C   1 
ATOM   9810  O O   . ALA F  2 157 ? 55.688  -9.972   -7.080  1.00 54.65  ? 150  ALA F O   1 
ATOM   9811  C CB  . ALA F  2 157 ? 54.674  -7.984   -9.411  1.00 58.75  ? 150  ALA F CB  1 
ATOM   9812  N N   . SER F  2 158 ? 56.610  -7.931   -6.849  1.00 53.50  ? 151  SER F N   1 
ATOM   9813  C CA  . SER F  2 158 ? 57.825  -8.416   -6.205  1.00 56.12  ? 151  SER F CA  1 
ATOM   9814  C C   . SER F  2 158 ? 57.532  -9.031   -4.841  1.00 53.19  ? 151  SER F C   1 
ATOM   9815  O O   . SER F  2 158 ? 57.971  -10.141  -4.542  1.00 51.77  ? 151  SER F O   1 
ATOM   9816  C CB  . SER F  2 158 ? 58.837  -7.279   -6.056  1.00 59.70  ? 151  SER F CB  1 
ATOM   9817  O OG  . SER F  2 158 ? 59.136  -6.689   -7.308  1.00 66.00  ? 151  SER F OG  1 
ATOM   9818  N N   . LYS F  2 159 ? 56.785  -8.302   -4.017  1.00 47.58  ? 152  LYS F N   1 
ATOM   9819  C CA  . LYS F  2 159 ? 56.493  -8.740   -2.657  1.00 51.08  ? 152  LYS F CA  1 
ATOM   9820  C C   . LYS F  2 159 ? 55.380  -9.778   -2.613  1.00 53.79  ? 152  LYS F C   1 
ATOM   9821  O O   . LYS F  2 159 ? 55.321  -10.595  -1.695  1.00 55.61  ? 152  LYS F O   1 
ATOM   9822  C CB  . LYS F  2 159 ? 56.119  -7.541   -1.786  1.00 52.06  ? 152  LYS F CB  1 
ATOM   9823  C CG  . LYS F  2 159 ? 57.195  -6.479   -1.737  1.00 50.74  ? 152  LYS F CG  1 
ATOM   9824  C CD  . LYS F  2 159 ? 58.521  -7.088   -1.318  1.00 49.88  ? 152  LYS F CD  1 
ATOM   9825  C CE  . LYS F  2 159 ? 59.679  -6.172   -1.654  1.00 52.90  ? 152  LYS F CE  1 
ATOM   9826  N NZ  . LYS F  2 159 ? 60.971  -6.704   -1.135  1.00 53.55  ? 152  LYS F NZ  1 
ATOM   9827  N N   . GLY F  2 160 ? 54.495  -9.737   -3.604  1.00 56.28  ? 153  GLY F N   1 
ATOM   9828  C CA  . GLY F  2 160 ? 53.402  -10.686  -3.682  1.00 53.01  ? 153  GLY F CA  1 
ATOM   9829  C C   . GLY F  2 160 ? 53.907  -12.089  -3.942  1.00 49.56  ? 153  GLY F C   1 
ATOM   9830  O O   . GLY F  2 160 ? 53.337  -13.068  -3.460  1.00 46.70  ? 153  GLY F O   1 
ATOM   9831  N N   . GLY F  2 161 ? 54.988  -12.183  -4.708  1.00 53.07  ? 154  GLY F N   1 
ATOM   9832  C CA  . GLY F  2 161 ? 55.594  -13.463  -5.018  1.00 51.28  ? 154  GLY F CA  1 
ATOM   9833  C C   . GLY F  2 161 ? 56.213  -14.122  -3.801  1.00 45.97  ? 154  GLY F C   1 
ATOM   9834  O O   . GLY F  2 161 ? 56.259  -15.347  -3.709  1.00 44.57  ? 154  GLY F O   1 
ATOM   9835  N N   . LEU F  2 162 ? 56.689  -13.304  -2.867  1.00 40.37  ? 155  LEU F N   1 
ATOM   9836  C CA  . LEU F  2 162 ? 57.309  -13.805  -1.645  1.00 38.13  ? 155  LEU F CA  1 
ATOM   9837  C C   . LEU F  2 162 ? 56.325  -14.608  -0.804  1.00 38.08  ? 155  LEU F C   1 
ATOM   9838  O O   . LEU F  2 162 ? 56.707  -15.561  -0.127  1.00 43.29  ? 155  LEU F O   1 
ATOM   9839  C CB  . LEU F  2 162 ? 57.871  -12.648  -0.818  1.00 34.04  ? 155  LEU F CB  1 
ATOM   9840  C CG  . LEU F  2 162 ? 59.058  -11.894  -1.415  1.00 33.20  ? 155  LEU F CG  1 
ATOM   9841  C CD1 . LEU F  2 162 ? 59.388  -10.672  -0.575  1.00 34.56  ? 155  LEU F CD1 1 
ATOM   9842  C CD2 . LEU F  2 162 ? 60.264  -12.811  -1.530  1.00 31.59  ? 155  LEU F CD2 1 
ATOM   9843  N N   . VAL F  2 163 ? 55.057  -14.214  -0.855  1.00 40.95  ? 156  VAL F N   1 
ATOM   9844  C CA  . VAL F  2 163 ? 54.012  -14.868  -0.077  1.00 49.05  ? 156  VAL F CA  1 
ATOM   9845  C C   . VAL F  2 163 ? 53.805  -16.313  -0.515  1.00 50.47  ? 156  VAL F C   1 
ATOM   9846  O O   . VAL F  2 163 ? 53.924  -17.238  0.289   1.00 49.37  ? 156  VAL F O   1 
ATOM   9847  C CB  . VAL F  2 163 ? 52.677  -14.113  -0.193  1.00 56.31  ? 156  VAL F CB  1 
ATOM   9848  C CG1 . VAL F  2 163 ? 51.618  -14.769  0.680   1.00 58.48  ? 156  VAL F CG1 1 
ATOM   9849  C CG2 . VAL F  2 163 ? 52.865  -12.654  0.188   1.00 58.54  ? 156  VAL F CG2 1 
ATOM   9850  N N   . GLY F  2 164 ? 53.493  -16.498  -1.794  1.00 49.74  ? 157  GLY F N   1 
ATOM   9851  C CA  . GLY F  2 164 ? 53.275  -17.823  -2.344  1.00 49.25  ? 157  GLY F CA  1 
ATOM   9852  C C   . GLY F  2 164 ? 54.529  -18.674  -2.308  1.00 51.80  ? 157  GLY F C   1 
ATOM   9853  O O   . GLY F  2 164 ? 54.461  -19.885  -2.104  1.00 54.92  ? 157  GLY F O   1 
ATOM   9854  N N   . PHE F  2 165 ? 55.678  -18.034  -2.505  1.00 44.80  ? 158  PHE F N   1 
ATOM   9855  C CA  . PHE F  2 165 ? 56.961  -18.726  -2.479  1.00 39.59  ? 158  PHE F CA  1 
ATOM   9856  C C   . PHE F  2 165 ? 57.267  -19.292  -1.099  1.00 33.17  ? 158  PHE F C   1 
ATOM   9857  O O   . PHE F  2 165 ? 57.585  -20.473  -0.960  1.00 35.86  ? 158  PHE F O   1 
ATOM   9858  C CB  . PHE F  2 165 ? 58.084  -17.784  -2.916  1.00 43.21  ? 158  PHE F CB  1 
ATOM   9859  C CG  . PHE F  2 165 ? 59.461  -18.290  -2.595  1.00 43.94  ? 158  PHE F CG  1 
ATOM   9860  C CD1 . PHE F  2 165 ? 60.036  -19.297  -3.350  1.00 45.47  ? 158  PHE F CD1 1 
ATOM   9861  C CD2 . PHE F  2 165 ? 60.183  -17.751  -1.542  1.00 41.27  ? 158  PHE F CD2 1 
ATOM   9862  C CE1 . PHE F  2 165 ? 61.304  -19.764  -3.057  1.00 47.45  ? 158  PHE F CE1 1 
ATOM   9863  C CE2 . PHE F  2 165 ? 61.450  -18.213  -1.244  1.00 39.34  ? 158  PHE F CE2 1 
ATOM   9864  C CZ  . PHE F  2 165 ? 62.011  -19.220  -2.003  1.00 43.98  ? 158  PHE F CZ  1 
ATOM   9865  N N   . SER F  2 166 ? 57.173  -18.439  -0.083  1.00 30.64  ? 159  SER F N   1 
ATOM   9866  C CA  . SER F  2 166 ? 57.461  -18.839  1.290   1.00 32.62  ? 159  SER F CA  1 
ATOM   9867  C C   . SER F  2 166 ? 56.546  -19.967  1.747   1.00 36.33  ? 159  SER F C   1 
ATOM   9868  O O   . SER F  2 166 ? 56.999  -20.934  2.358   1.00 39.81  ? 159  SER F O   1 
ATOM   9869  C CB  . SER F  2 166 ? 57.326  -17.645  2.234   1.00 30.09  ? 159  SER F CB  1 
ATOM   9870  O OG  . SER F  2 166 ? 58.241  -16.620  1.890   1.00 34.93  ? 159  SER F OG  1 
ATOM   9871  N N   . ARG F  2 167 ? 55.259  -19.839  1.443   1.00 33.36  ? 160  ARG F N   1 
ATOM   9872  C CA  . ARG F  2 167 ? 54.276  -20.847  1.819   1.00 35.98  ? 160  ARG F CA  1 
ATOM   9873  C C   . ARG F  2 167 ? 54.521  -22.167  1.094   1.00 42.12  ? 160  ARG F C   1 
ATOM   9874  O O   . ARG F  2 167 ? 54.360  -23.240  1.674   1.00 44.71  ? 160  ARG F O   1 
ATOM   9875  C CB  . ARG F  2 167 ? 52.862  -20.340  1.537   1.00 34.60  ? 160  ARG F CB  1 
ATOM   9876  C CG  . ARG F  2 167 ? 52.381  -19.300  2.533   1.00 35.50  ? 160  ARG F CG  1 
ATOM   9877  C CD  . ARG F  2 167 ? 51.039  -18.720  2.130   1.00 40.90  ? 160  ARG F CD  1 
ATOM   9878  N NE  . ARG F  2 167 ? 50.487  -17.858  3.171   1.00 45.49  ? 160  ARG F NE  1 
ATOM   9879  C CZ  . ARG F  2 167 ? 49.460  -17.034  2.992   1.00 45.26  ? 160  ARG F CZ  1 
ATOM   9880  N NH1 . ARG F  2 167 ? 48.873  -16.951  1.805   1.00 45.26  ? 160  ARG F NH1 1 
ATOM   9881  N NH2 . ARG F  2 167 ? 49.023  -16.288  3.997   1.00 44.26  ? 160  ARG F NH2 1 
ATOM   9882  N N   . ALA F  2 168 ? 54.911  -22.083  -0.174  1.00 43.64  ? 161  ALA F N   1 
ATOM   9883  C CA  . ALA F  2 168 ? 55.267  -23.271  -0.939  1.00 41.30  ? 161  ALA F CA  1 
ATOM   9884  C C   . ALA F  2 168 ? 56.558  -23.871  -0.399  1.00 41.08  ? 161  ALA F C   1 
ATOM   9885  O O   . ALA F  2 168 ? 56.749  -25.087  -0.418  1.00 43.19  ? 161  ALA F O   1 
ATOM   9886  C CB  . ALA F  2 168 ? 55.409  -22.938  -2.412  1.00 37.88  ? 161  ALA F CB  1 
ATOM   9887  N N   . LEU F  2 169 ? 57.442  -23.005  0.083   1.00 40.86  ? 162  LEU F N   1 
ATOM   9888  C CA  . LEU F  2 169 ? 58.697  -23.442  0.676   1.00 44.43  ? 162  LEU F CA  1 
ATOM   9889  C C   . LEU F  2 169 ? 58.465  -23.973  2.086   1.00 43.48  ? 162  LEU F C   1 
ATOM   9890  O O   . LEU F  2 169 ? 59.116  -24.925  2.514   1.00 47.42  ? 162  LEU F O   1 
ATOM   9891  C CB  . LEU F  2 169 ? 59.710  -22.296  0.700   1.00 49.90  ? 162  LEU F CB  1 
ATOM   9892  C CG  . LEU F  2 169 ? 61.099  -22.630  1.245   1.00 55.46  ? 162  LEU F CG  1 
ATOM   9893  C CD1 . LEU F  2 169 ? 61.722  -23.767  0.450   1.00 57.10  ? 162  LEU F CD1 1 
ATOM   9894  C CD2 . LEU F  2 169 ? 61.995  -21.400  1.226   1.00 55.56  ? 162  LEU F CD2 1 
ATOM   9895  N N   . ALA F  2 170 ? 57.531  -23.353  2.801   1.00 36.79  ? 163  ALA F N   1 
ATOM   9896  C CA  . ALA F  2 170 ? 57.196  -23.777  4.155   1.00 36.48  ? 163  ALA F CA  1 
ATOM   9897  C C   . ALA F  2 170 ? 56.618  -25.187  4.156   1.00 37.58  ? 163  ALA F C   1 
ATOM   9898  O O   . ALA F  2 170 ? 57.016  -26.023  4.962   1.00 37.93  ? 163  ALA F O   1 
ATOM   9899  C CB  . ALA F  2 170 ? 56.218  -22.803  4.795   1.00 32.48  ? 163  ALA F CB  1 
ATOM   9900  N N   . LYS F  2 171 ? 55.681  -25.444  3.249   1.00 37.22  ? 164  LYS F N   1 
ATOM   9901  C CA  . LYS F  2 171 ? 55.084  -26.769  3.116   1.00 40.15  ? 164  LYS F CA  1 
ATOM   9902  C C   . LYS F  2 171 ? 56.131  -27.805  2.726   1.00 43.55  ? 164  LYS F C   1 
ATOM   9903  O O   . LYS F  2 171 ? 56.122  -28.934  3.217   1.00 46.66  ? 164  LYS F O   1 
ATOM   9904  C CB  . LYS F  2 171 ? 53.962  -26.757  2.075   1.00 37.55  ? 164  LYS F CB  1 
ATOM   9905  C CG  . LYS F  2 171 ? 52.741  -25.940  2.459   1.00 33.00  ? 164  LYS F CG  1 
ATOM   9906  C CD  . LYS F  2 171 ? 51.690  -26.000  1.361   1.00 33.58  ? 164  LYS F CD  1 
ATOM   9907  C CE  . LYS F  2 171 ? 50.452  -25.200  1.726   1.00 32.88  ? 164  LYS F CE  1 
ATOM   9908  N NZ  . LYS F  2 171 ? 49.431  -25.239  0.644   1.00 36.57  ? 164  LYS F NZ  1 
ATOM   9909  N N   . GLU F  2 172 ? 57.033  -27.402  1.839   1.00 40.67  ? 165  GLU F N   1 
ATOM   9910  C CA  . GLU F  2 172 ? 58.031  -28.300  1.274   1.00 42.37  ? 165  GLU F CA  1 
ATOM   9911  C C   . GLU F  2 172 ? 59.053  -28.781  2.299   1.00 45.19  ? 165  GLU F C   1 
ATOM   9912  O O   . GLU F  2 172 ? 59.533  -29.913  2.224   1.00 49.92  ? 165  GLU F O   1 
ATOM   9913  C CB  . GLU F  2 172 ? 58.748  -27.604  0.112   1.00 43.56  ? 165  GLU F CB  1 
ATOM   9914  C CG  . GLU F  2 172 ? 59.906  -28.385  -0.484  1.00 52.79  ? 165  GLU F CG  1 
ATOM   9915  C CD  . GLU F  2 172 ? 60.566  -27.652  -1.634  1.00 59.69  ? 165  GLU F CD  1 
ATOM   9916  O OE1 . GLU F  2 172 ? 59.841  -27.005  -2.419  1.00 60.71  ? 165  GLU F OE1 1 
ATOM   9917  O OE2 . GLU F  2 172 ? 61.808  -27.716  -1.750  1.00 63.58  ? 165  GLU F OE2 1 
ATOM   9918  N N   . VAL F  2 173 ? 59.373  -27.930  3.266   1.00 45.76  ? 166  VAL F N   1 
ATOM   9919  C CA  . VAL F  2 173 ? 60.516  -28.185  4.133   1.00 44.76  ? 166  VAL F CA  1 
ATOM   9920  C C   . VAL F  2 173 ? 60.150  -28.193  5.626   1.00 45.27  ? 166  VAL F C   1 
ATOM   9921  O O   . VAL F  2 173 ? 61.026  -28.245  6.493   1.00 48.91  ? 166  VAL F O   1 
ATOM   9922  C CB  . VAL F  2 173 ? 61.627  -27.142  3.856   1.00 43.18  ? 166  VAL F CB  1 
ATOM   9923  C CG1 . VAL F  2 173 ? 61.372  -25.844  4.619   1.00 35.68  ? 166  VAL F CG1 1 
ATOM   9924  C CG2 . VAL F  2 173 ? 63.000  -27.718  4.163   1.00 49.32  ? 166  VAL F CG2 1 
ATOM   9925  N N   . ALA F  2 174 ? 58.853  -28.174  5.921   1.00 45.16  ? 167  ALA F N   1 
ATOM   9926  C CA  . ALA F  2 174 ? 58.380  -28.171  7.305   1.00 45.72  ? 167  ALA F CA  1 
ATOM   9927  C C   . ALA F  2 174 ? 58.768  -29.442  8.058   1.00 48.81  ? 167  ALA F C   1 
ATOM   9928  O O   . ALA F  2 174 ? 59.031  -29.402  9.259   1.00 49.06  ? 167  ALA F O   1 
ATOM   9929  C CB  . ALA F  2 174 ? 56.871  -27.987  7.347   1.00 46.62  ? 167  ALA F CB  1 
ATOM   9930  N N   . ARG F  2 175 ? 58.803  -30.567  7.349   1.00 49.60  ? 168  ARG F N   1 
ATOM   9931  C CA  . ARG F  2 175 ? 59.108  -31.853  7.971   1.00 44.34  ? 168  ARG F CA  1 
ATOM   9932  C C   . ARG F  2 175 ? 60.594  -32.003  8.284   1.00 48.06  ? 168  ARG F C   1 
ATOM   9933  O O   . ARG F  2 175 ? 61.027  -33.031  8.805   1.00 51.23  ? 168  ARG F O   1 
ATOM   9934  C CB  . ARG F  2 175 ? 58.640  -33.001  7.076   1.00 40.84  ? 168  ARG F CB  1 
ATOM   9935  C CG  . ARG F  2 175 ? 57.130  -33.147  7.017   1.00 41.56  ? 168  ARG F CG  1 
ATOM   9936  C CD  . ARG F  2 175 ? 56.554  -33.382  8.407   1.00 42.93  ? 168  ARG F CD  1 
ATOM   9937  N NE  . ARG F  2 175 ? 55.096  -33.305  8.421   1.00 42.63  ? 168  ARG F NE  1 
ATOM   9938  C CZ  . ARG F  2 175 ? 54.290  -34.348  8.248   1.00 46.43  ? 168  ARG F CZ  1 
ATOM   9939  N NH1 . ARG F  2 175 ? 54.798  -35.556  8.044   1.00 44.65  ? 168  ARG F NH1 1 
ATOM   9940  N NH2 . ARG F  2 175 ? 52.975  -34.182  8.278   1.00 51.18  ? 168  ARG F NH2 1 
ATOM   9941  N N   . LYS F  2 176 ? 61.368  -30.973  7.964   1.00 48.97  ? 169  LYS F N   1 
ATOM   9942  C CA  . LYS F  2 176 ? 62.789  -30.953  8.283   1.00 49.34  ? 169  LYS F CA  1 
ATOM   9943  C C   . LYS F  2 176 ? 63.080  -29.891  9.336   1.00 47.10  ? 169  LYS F C   1 
ATOM   9944  O O   . LYS F  2 176 ? 64.187  -29.361  9.405   1.00 46.56  ? 169  LYS F O   1 
ATOM   9945  C CB  . LYS F  2 176 ? 63.616  -30.706  7.022   1.00 52.47  ? 169  LYS F CB  1 
ATOM   9946  C CG  . LYS F  2 176 ? 63.580  -31.868  6.046   1.00 61.12  ? 169  LYS F CG  1 
ATOM   9947  C CD  . LYS F  2 176 ? 63.363  -31.399  4.620   1.00 68.18  ? 169  LYS F CD  1 
ATOM   9948  C CE  . LYS F  2 176 ? 63.213  -32.582  3.676   1.00 74.07  ? 169  LYS F CE  1 
ATOM   9949  N NZ  . LYS F  2 176 ? 62.922  -32.155  2.281   1.00 73.53  ? 169  LYS F NZ  1 
ATOM   9950  N N   . LYS F  2 177 ? 62.067  -29.593  10.148  1.00 46.52  ? 170  LYS F N   1 
ATOM   9951  C CA  . LYS F  2 177 ? 62.174  -28.629  11.241  1.00 42.93  ? 170  LYS F CA  1 
ATOM   9952  C C   . LYS F  2 177 ? 62.642  -27.256  10.765  1.00 45.58  ? 170  LYS F C   1 
ATOM   9953  O O   . LYS F  2 177 ? 63.398  -26.573  11.456  1.00 46.72  ? 170  LYS F O   1 
ATOM   9954  C CB  . LYS F  2 177 ? 63.117  -29.157  12.326  1.00 40.10  ? 170  LYS F CB  1 
ATOM   9955  C CG  . LYS F  2 177 ? 62.659  -30.462  12.954  1.00 46.03  ? 170  LYS F CG  1 
ATOM   9956  C CD  . LYS F  2 177 ? 63.631  -30.936  14.021  1.00 53.45  ? 170  LYS F CD  1 
ATOM   9957  C CE  . LYS F  2 177 ? 63.197  -32.270  14.605  1.00 58.43  ? 170  LYS F CE  1 
ATOM   9958  N NZ  . LYS F  2 177 ? 63.098  -33.325  13.559  1.00 59.83  ? 170  LYS F NZ  1 
ATOM   9959  N N   . ILE F  2 178 ? 62.184  -26.856  9.583   1.00 44.05  ? 171  ILE F N   1 
ATOM   9960  C CA  . ILE F  2 178 ? 62.544  -25.560  9.022   1.00 42.98  ? 171  ILE F CA  1 
ATOM   9961  C C   . ILE F  2 178 ? 61.304  -24.712  8.767   1.00 41.36  ? 171  ILE F C   1 
ATOM   9962  O O   . ILE F  2 178 ? 60.425  -25.095  7.995   1.00 41.16  ? 171  ILE F O   1 
ATOM   9963  C CB  . ILE F  2 178 ? 63.336  -25.716  7.714   1.00 41.06  ? 171  ILE F CB  1 
ATOM   9964  C CG1 . ILE F  2 178 ? 64.604  -26.532  7.965   1.00 36.06  ? 171  ILE F CG1 1 
ATOM   9965  C CG2 . ILE F  2 178 ? 63.683  -24.352  7.136   1.00 40.06  ? 171  ILE F CG2 1 
ATOM   9966  C CD1 . ILE F  2 178 ? 65.299  -26.981  6.710   1.00 37.47  ? 171  ILE F CD1 1 
ATOM   9967  N N   . ARG F  2 179 ? 61.241  -23.558  9.423   1.00 40.91  ? 172  ARG F N   1 
ATOM   9968  C CA  . ARG F  2 179 ? 60.078  -22.684  9.326   1.00 37.26  ? 172  ARG F CA  1 
ATOM   9969  C C   . ARG F  2 179 ? 60.347  -21.485  8.422   1.00 34.73  ? 172  ARG F C   1 
ATOM   9970  O O   . ARG F  2 179 ? 61.382  -20.828  8.534   1.00 34.80  ? 172  ARG F O   1 
ATOM   9971  C CB  . ARG F  2 179 ? 59.654  -22.210  10.719  1.00 37.56  ? 172  ARG F CB  1 
ATOM   9972  C CG  . ARG F  2 179 ? 59.246  -23.339  11.655  1.00 38.43  ? 172  ARG F CG  1 
ATOM   9973  C CD  . ARG F  2 179 ? 58.787  -22.820  13.012  1.00 43.26  ? 172  ARG F CD  1 
ATOM   9974  N NE  . ARG F  2 179 ? 59.884  -22.265  13.801  1.00 48.78  ? 172  ARG F NE  1 
ATOM   9975  C CZ  . ARG F  2 179 ? 60.128  -20.965  13.934  1.00 47.12  ? 172  ARG F CZ  1 
ATOM   9976  N NH1 . ARG F  2 179 ? 59.348  -20.077  13.332  1.00 37.87  ? 172  ARG F NH1 1 
ATOM   9977  N NH2 . ARG F  2 179 ? 61.148  -20.551  14.674  1.00 50.59  ? 172  ARG F NH2 1 
ATOM   9978  N N   . VAL F  2 180 ? 59.408  -21.209  7.522   1.00 34.53  ? 173  VAL F N   1 
ATOM   9979  C CA  . VAL F  2 180 ? 59.518  -20.068  6.620   1.00 33.63  ? 173  VAL F CA  1 
ATOM   9980  C C   . VAL F  2 180 ? 58.303  -19.155  6.764   1.00 30.87  ? 173  VAL F C   1 
ATOM   9981  O O   . VAL F  2 180 ? 57.167  -19.590  6.583   1.00 35.28  ? 173  VAL F O   1 
ATOM   9982  C CB  . VAL F  2 180 ? 59.648  -20.513  5.149   1.00 33.03  ? 173  VAL F CB  1 
ATOM   9983  C CG1 . VAL F  2 180 ? 59.923  -19.314  4.256   1.00 31.62  ? 173  VAL F CG1 1 
ATOM   9984  C CG2 . VAL F  2 180 ? 60.749  -21.554  5.000   1.00 31.51  ? 173  VAL F CG2 1 
ATOM   9985  N N   . ASN F  2 181 ? 58.547  -17.890  7.092   1.00 28.96  ? 174  ASN F N   1 
ATOM   9986  C CA  . ASN F  2 181 ? 57.463  -16.927  7.267   1.00 31.23  ? 174  ASN F CA  1 
ATOM   9987  C C   . ASN F  2 181 ? 57.742  -15.594  6.585   1.00 29.84  ? 174  ASN F C   1 
ATOM   9988  O O   . ASN F  2 181 ? 58.840  -15.357  6.082   1.00 32.33  ? 174  ASN F O   1 
ATOM   9989  C CB  . ASN F  2 181 ? 57.191  -16.694  8.754   1.00 35.47  ? 174  ASN F CB  1 
ATOM   9990  C CG  . ASN F  2 181 ? 56.549  -17.891  9.421   1.00 37.66  ? 174  ASN F CG  1 
ATOM   9991  O OD1 . ASN F  2 181 ? 55.334  -18.072  9.358   1.00 37.22  ? 174  ASN F OD1 1 
ATOM   9992  N ND2 . ASN F  2 181 ? 57.364  -18.715  10.069  1.00 42.27  ? 174  ASN F ND2 1 
ATOM   9993  N N   . VAL F  2 182 ? 56.736  -14.725  6.576   1.00 32.39  ? 175  VAL F N   1 
ATOM   9994  C CA  . VAL F  2 182 ? 56.842  -13.428  5.919   1.00 33.85  ? 175  VAL F CA  1 
ATOM   9995  C C   . VAL F  2 182 ? 56.312  -12.299  6.796   1.00 34.62  ? 175  VAL F C   1 
ATOM   9996  O O   . VAL F  2 182 ? 55.196  -12.371  7.307   1.00 34.95  ? 175  VAL F O   1 
ATOM   9997  C CB  . VAL F  2 182 ? 56.072  -13.412  4.579   1.00 36.84  ? 175  VAL F CB  1 
ATOM   9998  C CG1 . VAL F  2 182 ? 55.961  -11.993  4.037   1.00 40.78  ? 175  VAL F CG1 1 
ATOM   9999  C CG2 . VAL F  2 182 ? 56.743  -14.320  3.566   1.00 38.49  ? 175  VAL F CG2 1 
ATOM   10000 N N   . VAL F  2 183 ? 57.121  -11.260  6.975   1.00 34.84  ? 176  VAL F N   1 
ATOM   10001 C CA  . VAL F  2 183 ? 56.643  -10.036  7.604   1.00 34.60  ? 176  VAL F CA  1 
ATOM   10002 C C   . VAL F  2 183 ? 56.167  -9.067   6.529   1.00 27.69  ? 176  VAL F C   1 
ATOM   10003 O O   . VAL F  2 183 ? 56.828  -8.889   5.506   1.00 28.48  ? 176  VAL F O   1 
ATOM   10004 C CB  . VAL F  2 183 ? 57.730  -9.361   8.464   1.00 34.74  ? 176  VAL F CB  1 
ATOM   10005 C CG1 . VAL F  2 183 ? 57.831  -10.037  9.820   1.00 29.88  ? 176  VAL F CG1 1 
ATOM   10006 C CG2 . VAL F  2 183 ? 59.068  -9.379   7.746   1.00 43.55  ? 176  VAL F CG2 1 
ATOM   10007 N N   . ALA F  2 184 ? 55.013  -8.451   6.758   1.00 23.49  ? 177  ALA F N   1 
ATOM   10008 C CA  . ALA F  2 184 ? 54.453  -7.508   5.798   1.00 30.69  ? 177  ALA F CA  1 
ATOM   10009 C C   . ALA F  2 184 ? 54.290  -6.127   6.420   1.00 31.32  ? 177  ALA F C   1 
ATOM   10010 O O   . ALA F  2 184 ? 53.192  -5.754   6.831   1.00 35.80  ? 177  ALA F O   1 
ATOM   10011 C CB  . ALA F  2 184 ? 53.118  -8.015   5.273   1.00 31.71  ? 177  ALA F CB  1 
ATOM   10012 N N   . PRO F  2 185 ? 55.390  -5.362   6.493   1.00 27.90  ? 178  PRO F N   1 
ATOM   10013 C CA  . PRO F  2 185 ? 55.358  -4.020   7.081   1.00 31.94  ? 178  PRO F CA  1 
ATOM   10014 C C   . PRO F  2 185 ? 54.497  -3.060   6.272   1.00 31.49  ? 178  PRO F C   1 
ATOM   10015 O O   . PRO F  2 185 ? 54.390  -3.202   5.054   1.00 34.17  ? 178  PRO F O   1 
ATOM   10016 C CB  . PRO F  2 185 ? 56.828  -3.583   7.050   1.00 35.44  ? 178  PRO F CB  1 
ATOM   10017 C CG  . PRO F  2 185 ? 57.610  -4.843   6.882   1.00 33.95  ? 178  PRO F CG  1 
ATOM   10018 C CD  . PRO F  2 185 ? 56.744  -5.732   6.054   1.00 31.31  ? 178  PRO F CD  1 
ATOM   10019 N N   . GLY F  2 186 ? 53.886  -2.097   6.950   1.00 34.74  ? 179  GLY F N   1 
ATOM   10020 C CA  . GLY F  2 186 ? 53.145  -1.053   6.272   1.00 34.86  ? 179  GLY F CA  1 
ATOM   10021 C C   . GLY F  2 186 ? 54.086  0.067    5.887   1.00 38.97  ? 179  GLY F C   1 
ATOM   10022 O O   . GLY F  2 186 ? 55.119  -0.168   5.260   1.00 43.28  ? 179  GLY F O   1 
ATOM   10023 N N   . PHE F  2 187 ? 53.736  1.288    6.271   1.00 41.09  ? 180  PHE F N   1 
ATOM   10024 C CA  . PHE F  2 187 ? 54.588  2.438    6.002   1.00 43.38  ? 180  PHE F CA  1 
ATOM   10025 C C   . PHE F  2 187 ? 55.605  2.626    7.122   1.00 47.33  ? 180  PHE F C   1 
ATOM   10026 O O   . PHE F  2 187 ? 55.264  3.086    8.211   1.00 50.30  ? 180  PHE F O   1 
ATOM   10027 C CB  . PHE F  2 187 ? 53.745  3.701    5.826   1.00 44.29  ? 180  PHE F CB  1 
ATOM   10028 C CG  . PHE F  2 187 ? 52.815  3.650    4.646   1.00 53.56  ? 180  PHE F CG  1 
ATOM   10029 C CD1 . PHE F  2 187 ? 53.133  2.900    3.526   1.00 55.65  ? 180  PHE F CD1 1 
ATOM   10030 C CD2 . PHE F  2 187 ? 51.620  4.350    4.659   1.00 60.28  ? 180  PHE F CD2 1 
ATOM   10031 C CE1 . PHE F  2 187 ? 52.278  2.851    2.440   1.00 57.17  ? 180  PHE F CE1 1 
ATOM   10032 C CE2 . PHE F  2 187 ? 50.761  4.307    3.577   1.00 62.61  ? 180  PHE F CE2 1 
ATOM   10033 C CZ  . PHE F  2 187 ? 51.091  3.556    2.467   1.00 60.65  ? 180  PHE F CZ  1 
ATOM   10034 N N   . VAL F  2 188 ? 56.852  2.255    6.851   1.00 46.97  ? 181  VAL F N   1 
ATOM   10035 C CA  . VAL F  2 188 ? 57.932  2.421    7.816   1.00 48.19  ? 181  VAL F CA  1 
ATOM   10036 C C   . VAL F  2 188 ? 58.680  3.718    7.509   1.00 53.97  ? 181  VAL F C   1 
ATOM   10037 O O   . VAL F  2 188 ? 58.395  4.376    6.511   1.00 61.48  ? 181  VAL F O   1 
ATOM   10038 C CB  . VAL F  2 188 ? 58.905  1.222    7.789   1.00 45.69  ? 181  VAL F CB  1 
ATOM   10039 C CG1 . VAL F  2 188 ? 59.545  1.016    9.155   1.00 45.51  ? 181  VAL F CG1 1 
ATOM   10040 C CG2 . VAL F  2 188 ? 58.171  -0.041   7.363   1.00 42.00  ? 181  VAL F CG2 1 
ATOM   10041 N N   . HIS F  2 189 ? 59.622  4.091    8.368   1.00 60.14  ? 182  HIS F N   1 
ATOM   10042 C CA  . HIS F  2 189 ? 60.412  5.301    8.159   1.00 67.87  ? 182  HIS F CA  1 
ATOM   10043 C C   . HIS F  2 189 ? 61.884  4.978    7.946   1.00 65.24  ? 182  HIS F C   1 
ATOM   10044 O O   . HIS F  2 189 ? 62.668  4.954    8.895   1.00 65.79  ? 182  HIS F O   1 
ATOM   10045 C CB  . HIS F  2 189 ? 60.254  6.257    9.342   1.00 79.12  ? 182  HIS F CB  1 
ATOM   10046 C CG  . HIS F  2 189 ? 59.040  7.128    9.256   1.00 88.29  ? 182  HIS F CG  1 
ATOM   10047 N ND1 . HIS F  2 189 ? 58.500  7.761    10.354  1.00 89.24  ? 182  HIS F ND1 1 
ATOM   10048 C CD2 . HIS F  2 189 ? 58.267  7.477    8.201   1.00 94.27  ? 182  HIS F CD2 1 
ATOM   10049 C CE1 . HIS F  2 189 ? 57.443  8.460    9.981   1.00 94.43  ? 182  HIS F CE1 1 
ATOM   10050 N NE2 . HIS F  2 189 ? 57.280  8.306    8.679   1.00 98.22  ? 182  HIS F NE2 1 
ATOM   10051 N N   . THR F  2 190 ? 62.253  4.723    6.695   1.00 61.38  ? 183  THR F N   1 
ATOM   10052 C CA  . THR F  2 190 ? 63.630  4.395    6.353   1.00 65.48  ? 183  THR F CA  1 
ATOM   10053 C C   . THR F  2 190 ? 64.111  5.226    5.165   1.00 76.06  ? 183  THR F C   1 
ATOM   10054 O O   . THR F  2 190 ? 63.703  6.373    4.988   1.00 84.35  ? 183  THR F O   1 
ATOM   10055 C CB  . THR F  2 190 ? 63.794  2.899    6.010   1.00 58.41  ? 183  THR F CB  1 
ATOM   10056 O OG1 . THR F  2 190 ? 63.210  2.632    4.729   1.00 61.90  ? 183  THR F OG1 1 
ATOM   10057 C CG2 . THR F  2 190 ? 63.130  2.019    7.066   1.00 47.56  ? 183  THR F CG2 1 
ATOM   10058 N N   . ASP F  2 191 ? 64.979  4.627    4.355   1.00 79.36  ? 184  ASP F N   1 
ATOM   10059 C CA  . ASP F  2 191 ? 65.529  5.266    3.164   1.00 82.38  ? 184  ASP F CA  1 
ATOM   10060 C C   . ASP F  2 191 ? 64.477  5.345    2.060   1.00 84.84  ? 184  ASP F C   1 
ATOM   10061 O O   . ASP F  2 191 ? 64.387  6.339    1.337   1.00 85.56  ? 184  ASP F O   1 
ATOM   10062 C CB  . ASP F  2 191 ? 66.756  4.494    2.670   1.00 84.77  ? 184  ASP F CB  1 
ATOM   10063 C CG  . ASP F  2 191 ? 67.750  5.374    1.936   1.00 92.37  ? 184  ASP F CG  1 
ATOM   10064 O OD1 . ASP F  2 191 ? 67.420  6.544    1.645   1.00 96.71  ? 184  ASP F OD1 1 
ATOM   10065 O OD2 . ASP F  2 191 ? 68.865  4.890    1.644   1.00 93.92  ? 184  ASP F OD2 1 
ATOM   10066 N N   . MET F  2 192 ? 63.686  4.281    1.941   1.00 83.52  ? 185  MET F N   1 
ATOM   10067 C CA  . MET F  2 192 ? 62.649  4.180    0.917   1.00 82.85  ? 185  MET F CA  1 
ATOM   10068 C C   . MET F  2 192 ? 61.544  5.218    1.095   1.00 83.52  ? 185  MET F C   1 
ATOM   10069 O O   . MET F  2 192 ? 61.131  5.861    0.131   1.00 85.95  ? 185  MET F O   1 
ATOM   10070 C CB  . MET F  2 192 ? 62.041  2.774    0.917   1.00 78.72  ? 185  MET F CB  1 
ATOM   10071 C CG  . MET F  2 192 ? 62.941  1.698    0.329   1.00 77.37  ? 185  MET F CG  1 
ATOM   10072 S SD  . MET F  2 192 ? 62.304  0.034    0.606   1.00 64.18  ? 185  MET F SD  1 
ATOM   10073 C CE  . MET F  2 192 ? 60.589  0.242    0.135   1.00 60.06  ? 185  MET F CE  1 
ATOM   10074 N N   . THR F  2 193 ? 61.064  5.376    2.325   1.00 80.33  ? 186  THR F N   1 
ATOM   10075 C CA  . THR F  2 193 ? 59.970  6.303    2.595   1.00 78.18  ? 186  THR F CA  1 
ATOM   10076 C C   . THR F  2 193 ? 60.481  7.688    2.969   1.00 80.36  ? 186  THR F C   1 
ATOM   10077 O O   . THR F  2 193 ? 60.094  8.252    3.992   1.00 82.10  ? 186  THR F O   1 
ATOM   10078 C CB  . THR F  2 193 ? 59.053  5.782    3.717   1.00 72.69  ? 186  THR F CB  1 
ATOM   10079 O OG1 . THR F  2 193 ? 59.824  5.560    4.904   1.00 69.13  ? 186  THR F OG1 1 
ATOM   10080 C CG2 . THR F  2 193 ? 58.390  4.480    3.294   1.00 69.22  ? 186  THR F CG2 1 
ATOM   10081 N N   . LYS F  2 194 ? 61.354  8.230    2.128   1.00 82.35  ? 187  LYS F N   1 
ATOM   10082 C CA  . LYS F  2 194 ? 61.857  9.582    2.315   1.00 86.93  ? 187  LYS F CA  1 
ATOM   10083 C C   . LYS F  2 194 ? 61.092  10.542   1.413   1.00 93.39  ? 187  LYS F C   1 
ATOM   10084 O O   . LYS F  2 194 ? 60.996  11.737   1.693   1.00 97.67  ? 187  LYS F O   1 
ATOM   10085 C CB  . LYS F  2 194 ? 63.356  9.648    2.021   1.00 86.46  ? 187  LYS F CB  1 
ATOM   10086 N N   . ASP F  2 195 ? 60.539  10.005   0.331   1.00 93.49  ? 188  ASP F N   1 
ATOM   10087 C CA  . ASP F  2 195 ? 59.773  10.808   -0.612  1.00 94.36  ? 188  ASP F CA  1 
ATOM   10088 C C   . ASP F  2 195 ? 58.290  10.453   -0.587  1.00 93.54  ? 188  ASP F C   1 
ATOM   10089 O O   . ASP F  2 195 ? 57.641  10.409   -1.631  1.00 92.61  ? 188  ASP F O   1 
ATOM   10090 C CB  . ASP F  2 195 ? 60.318  10.637   -2.029  1.00 95.97  ? 188  ASP F CB  1 
ATOM   10091 N N   . LEU F  2 196 ? 57.754  10.200   0.602   1.00 93.89  ? 189  LEU F N   1 
ATOM   10092 C CA  . LEU F  2 196 ? 56.334  9.897    0.746   1.00 99.97  ? 189  LEU F CA  1 
ATOM   10093 C C   . LEU F  2 196 ? 55.679  10.866   1.717   1.00 113.94 ? 189  LEU F C   1 
ATOM   10094 O O   . LEU F  2 196 ? 56.207  11.116   2.800   1.00 116.55 ? 189  LEU F O   1 
ATOM   10095 C CB  . LEU F  2 196 ? 56.125  8.457    1.227   1.00 88.95  ? 189  LEU F CB  1 
ATOM   10096 C CG  . LEU F  2 196 ? 55.845  7.374    0.184   1.00 80.25  ? 189  LEU F CG  1 
ATOM   10097 C CD1 . LEU F  2 196 ? 57.042  7.218    -0.725  1.00 76.57  ? 189  LEU F CD1 1 
ATOM   10098 C CD2 . LEU F  2 196 ? 55.490  6.044    0.844   1.00 76.41  ? 189  LEU F CD2 1 
ATOM   10099 N N   . LYS F  2 197 ? 54.530  11.406   1.322   1.00 125.97 ? 190  LYS F N   1 
ATOM   10100 C CA  . LYS F  2 197 ? 53.774  12.333   2.161   1.00 136.85 ? 190  LYS F CA  1 
ATOM   10101 C C   . LYS F  2 197 ? 53.116  11.623   3.338   1.00 127.02 ? 190  LYS F C   1 
ATOM   10102 O O   . LYS F  2 197 ? 52.037  11.047   3.200   1.00 126.05 ? 190  LYS F O   1 
ATOM   10103 C CB  . LYS F  2 197 ? 52.707  13.052   1.335   1.00 160.88 ? 190  LYS F CB  1 
ATOM   10104 N N   . GLU F  2 198 ? 53.762  11.679   4.498   1.00 119.42 ? 191  GLU F N   1 
ATOM   10105 C CA  . GLU F  2 198 ? 53.272  10.969   5.672   1.00 112.19 ? 191  GLU F CA  1 
ATOM   10106 C C   . GLU F  2 198 ? 51.947  11.549   6.150   1.00 110.73 ? 191  GLU F C   1 
ATOM   10107 O O   . GLU F  2 198 ? 50.988  10.815   6.381   1.00 108.46 ? 191  GLU F O   1 
ATOM   10108 C CB  . GLU F  2 198 ? 54.308  11.013   6.795   1.00 107.72 ? 191  GLU F CB  1 
ATOM   10109 N N   . GLU F  2 199 ? 51.890  12.874   6.254   1.00 112.06 ? 192  GLU F N   1 
ATOM   10110 C CA  . GLU F  2 199 ? 50.703  13.580   6.738   1.00 110.16 ? 192  GLU F CA  1 
ATOM   10111 C C   . GLU F  2 199 ? 49.440  13.337   5.904   1.00 112.32 ? 192  GLU F C   1 
ATOM   10112 O O   . GLU F  2 199 ? 48.374  13.862   6.223   1.00 111.49 ? 192  GLU F O   1 
ATOM   10113 C CB  . GLU F  2 199 ? 50.986  15.082   6.800   1.00 111.58 ? 192  GLU F CB  1 
ATOM   10114 N N   . HIS F  2 200 ? 49.553  12.549   4.840   1.00 113.21 ? 193  HIS F N   1 
ATOM   10115 C CA  . HIS F  2 200 ? 48.387  12.207   4.036   1.00 116.93 ? 193  HIS F CA  1 
ATOM   10116 C C   . HIS F  2 200 ? 47.752  10.902   4.514   1.00 115.77 ? 193  HIS F C   1 
ATOM   10117 O O   . HIS F  2 200 ? 46.663  10.910   5.086   1.00 117.31 ? 193  HIS F O   1 
ATOM   10118 C CB  . HIS F  2 200 ? 48.762  12.104   2.556   1.00 114.26 ? 193  HIS F CB  1 
ATOM   10119 N N   . LEU F  2 201 ? 48.439  9.785    4.294   1.00 118.38 ? 194  LEU F N   1 
ATOM   10120 C CA  . LEU F  2 201 ? 47.874  8.475    4.603   1.00 118.54 ? 194  LEU F CA  1 
ATOM   10121 C C   . LEU F  2 201 ? 47.962  8.107    6.087   1.00 117.50 ? 194  LEU F C   1 
ATOM   10122 O O   . LEU F  2 201 ? 47.449  7.069    6.500   1.00 119.49 ? 194  LEU F O   1 
ATOM   10123 C CB  . LEU F  2 201 ? 48.559  7.395    3.762   1.00 114.68 ? 194  LEU F CB  1 
ATOM   10124 N N   . LYS F  2 202 ? 48.601  8.954    6.889   1.00 110.47 ? 195  LYS F N   1 
ATOM   10125 C CA  . LYS F  2 202 ? 48.703  8.694    8.324   1.00 98.57  ? 195  LYS F CA  1 
ATOM   10126 C C   . LYS F  2 202 ? 47.480  9.207    9.080   1.00 89.15  ? 195  LYS F C   1 
ATOM   10127 O O   . LYS F  2 202 ? 47.390  9.065    10.298  1.00 89.38  ? 195  LYS F O   1 
ATOM   10128 C CB  . LYS F  2 202 ? 49.972  9.324    8.902   1.00 96.58  ? 195  LYS F CB  1 
ATOM   10129 N N   . LYS F  2 203 ? 46.541  9.805    8.355   1.00 88.54  ? 196  LYS F N   1 
ATOM   10130 C CA  . LYS F  2 203 ? 45.317  10.307   8.970   1.00 88.92  ? 196  LYS F CA  1 
ATOM   10131 C C   . LYS F  2 203 ? 44.281  9.196    9.075   1.00 86.57  ? 196  LYS F C   1 
ATOM   10132 O O   . LYS F  2 203 ? 43.418  9.213    9.954   1.00 87.51  ? 196  LYS F O   1 
ATOM   10133 C CB  . LYS F  2 203 ? 44.756  11.485   8.170   1.00 90.05  ? 196  LYS F CB  1 
ATOM   10134 N N   . ASN F  2 204 ? 44.384  8.226    8.172   1.00 84.75  ? 197  ASN F N   1 
ATOM   10135 C CA  . ASN F  2 204 ? 43.461  7.100    8.130   1.00 84.18  ? 197  ASN F CA  1 
ATOM   10136 C C   . ASN F  2 204 ? 43.964  5.915    8.947   1.00 77.46  ? 197  ASN F C   1 
ATOM   10137 O O   . ASN F  2 204 ? 43.171  5.153    9.500   1.00 77.79  ? 197  ASN F O   1 
ATOM   10138 C CB  . ASN F  2 204 ? 43.218  6.668    6.684   1.00 90.79  ? 197  ASN F CB  1 
ATOM   10139 C CG  . ASN F  2 204 ? 42.635  7.782    5.833   1.00 99.67  ? 197  ASN F CG  1 
ATOM   10140 O OD1 . ASN F  2 204 ? 41.949  8.670    6.340   1.00 103.75 ? 197  ASN F OD1 1 
ATOM   10141 N ND2 . ASN F  2 204 ? 42.904  7.738    4.533   1.00 100.99 ? 197  ASN F ND2 1 
ATOM   10142 N N   . ILE F  2 205 ? 45.284  5.762    9.014   1.00 69.05  ? 198  ILE F N   1 
ATOM   10143 C CA  . ILE F  2 205 ? 45.893  4.703    9.813   1.00 59.55  ? 198  ILE F CA  1 
ATOM   10144 C C   . ILE F  2 205 ? 45.419  4.794    11.256  1.00 58.92  ? 198  ILE F C   1 
ATOM   10145 O O   . ILE F  2 205 ? 45.581  5.833    11.894  1.00 62.35  ? 198  ILE F O   1 
ATOM   10146 C CB  . ILE F  2 205 ? 47.429  4.773    9.784   1.00 52.38  ? 198  ILE F CB  1 
ATOM   10147 C CG1 . ILE F  2 205 ? 47.952  4.532    8.367   1.00 49.87  ? 198  ILE F CG1 1 
ATOM   10148 C CG2 . ILE F  2 205 ? 48.027  3.757    10.749  1.00 49.67  ? 198  ILE F CG2 1 
ATOM   10149 C CD1 . ILE F  2 205 ? 49.448  4.724    8.230   1.00 48.47  ? 198  ILE F CD1 1 
ATOM   10150 N N   . PRO F  2 206 ? 44.819  3.706    11.766  1.00 54.09  ? 199  PRO F N   1 
ATOM   10151 C CA  . PRO F  2 206 ? 44.271  3.624    13.125  1.00 47.76  ? 199  PRO F CA  1 
ATOM   10152 C C   . PRO F  2 206 ? 45.237  4.119    14.200  1.00 51.40  ? 199  PRO F C   1 
ATOM   10153 O O   . PRO F  2 206 ? 44.805  4.759    15.157  1.00 56.58  ? 199  PRO F O   1 
ATOM   10154 C CB  . PRO F  2 206 ? 43.992  2.130    13.293  1.00 40.85  ? 199  PRO F CB  1 
ATOM   10155 C CG  . PRO F  2 206 ? 43.695  1.663    11.913  1.00 39.05  ? 199  PRO F CG  1 
ATOM   10156 C CD  . PRO F  2 206 ? 44.593  2.463    11.008  1.00 44.47  ? 199  PRO F CD  1 
ATOM   10157 N N   . LEU F  2 207 ? 46.526  3.838    14.036  1.00 49.86  ? 200  LEU F N   1 
ATOM   10158 C CA  . LEU F  2 207 ? 47.523  4.270    15.009  1.00 46.96  ? 200  LEU F CA  1 
ATOM   10159 C C   . LEU F  2 207 ? 48.022  5.683    14.709  1.00 47.68  ? 200  LEU F C   1 
ATOM   10160 O O   . LEU F  2 207 ? 48.870  6.214    15.426  1.00 49.16  ? 200  LEU F O   1 
ATOM   10161 C CB  . LEU F  2 207 ? 48.695  3.288    15.048  1.00 41.66  ? 200  LEU F CB  1 
ATOM   10162 C CG  . LEU F  2 207 ? 48.329  1.859    15.459  1.00 39.00  ? 200  LEU F CG  1 
ATOM   10163 C CD1 . LEU F  2 207 ? 49.575  1.041    15.754  1.00 37.74  ? 200  LEU F CD1 1 
ATOM   10164 C CD2 . LEU F  2 207 ? 47.390  1.864    16.658  1.00 38.71  ? 200  LEU F CD2 1 
ATOM   10165 N N   . GLY F  2 208 ? 47.490  6.280    13.646  1.00 48.97  ? 201  GLY F N   1 
ATOM   10166 C CA  . GLY F  2 208 ? 47.756  7.671    13.318  1.00 56.00  ? 201  GLY F CA  1 
ATOM   10167 C C   . GLY F  2 208 ? 49.210  8.024    13.072  1.00 57.91  ? 201  GLY F C   1 
ATOM   10168 O O   . GLY F  2 208 ? 49.610  9.177    13.241  1.00 62.09  ? 201  GLY F O   1 
ATOM   10169 N N   . ARG F  2 209 ? 50.004  7.038    12.668  1.00 52.11  ? 202  ARG F N   1 
ATOM   10170 C CA  . ARG F  2 209 ? 51.422  7.264    12.421  1.00 51.29  ? 202  ARG F CA  1 
ATOM   10171 C C   . ARG F  2 209 ? 52.027  6.164    11.563  1.00 48.27  ? 202  ARG F C   1 
ATOM   10172 O O   . ARG F  2 209 ? 51.455  5.083    11.421  1.00 44.53  ? 202  ARG F O   1 
ATOM   10173 C CB  . ARG F  2 209 ? 52.188  7.359    13.741  1.00 42.71  ? 202  ARG F CB  1 
ATOM   10174 C CG  . ARG F  2 209 ? 52.193  6.065    14.539  1.00 48.44  ? 202  ARG F CG  1 
ATOM   10175 C CD  . ARG F  2 209 ? 53.046  6.181    15.791  1.00 40.45  ? 202  ARG F CD  1 
ATOM   10176 N NE  . ARG F  2 209 ? 53.026  4.949    16.575  1.00 42.63  ? 202  ARG F NE  1 
ATOM   10177 C CZ  . ARG F  2 209 ? 53.885  3.947    16.417  1.00 42.22  ? 202  ARG F CZ  1 
ATOM   10178 N NH1 . ARG F  2 209 ? 54.841  4.028    15.501  1.00 44.59  ? 202  ARG F NH1 1 
ATOM   10179 N NH2 . ARG F  2 209 ? 53.790  2.864    17.176  1.00 40.54  ? 202  ARG F NH2 1 
ATOM   10180 N N   . PHE F  2 210 ? 53.191  6.449    10.992  1.00 52.29  ? 203  PHE F N   1 
ATOM   10181 C CA  . PHE F  2 210 ? 53.959  5.434    10.289  1.00 53.04  ? 203  PHE F CA  1 
ATOM   10182 C C   . PHE F  2 210 ? 54.743  4.616    11.307  1.00 52.75  ? 203  PHE F C   1 
ATOM   10183 O O   . PHE F  2 210 ? 54.931  5.047    12.445  1.00 54.74  ? 203  PHE F O   1 
ATOM   10184 C CB  . PHE F  2 210 ? 54.900  6.065    9.259   1.00 53.68  ? 203  PHE F CB  1 
ATOM   10185 C CG  . PHE F  2 210 ? 54.208  6.541    8.009   1.00 57.10  ? 203  PHE F CG  1 
ATOM   10186 C CD1 . PHE F  2 210 ? 52.825  6.535    7.917   1.00 59.07  ? 203  PHE F CD1 1 
ATOM   10187 C CD2 . PHE F  2 210 ? 54.943  6.978    6.920   1.00 58.02  ? 203  PHE F CD2 1 
ATOM   10188 C CE1 . PHE F  2 210 ? 52.190  6.969    6.770   1.00 60.39  ? 203  PHE F CE1 1 
ATOM   10189 C CE2 . PHE F  2 210 ? 54.313  7.411    5.768   1.00 60.26  ? 203  PHE F CE2 1 
ATOM   10190 C CZ  . PHE F  2 210 ? 52.935  7.405    5.694   1.00 61.27  ? 203  PHE F CZ  1 
ATOM   10191 N N   . GLY F  2 211 ? 55.194  3.436    10.903  1.00 51.51  ? 204  GLY F N   1 
ATOM   10192 C CA  . GLY F  2 211 ? 55.908  2.557    11.809  1.00 49.92  ? 204  GLY F CA  1 
ATOM   10193 C C   . GLY F  2 211 ? 57.383  2.880    11.918  1.00 54.01  ? 204  GLY F C   1 
ATOM   10194 O O   . GLY F  2 211 ? 58.001  3.343    10.960  1.00 54.94  ? 204  GLY F O   1 
ATOM   10195 N N   . GLU F  2 212 ? 57.949  2.643    13.096  1.00 52.61  ? 205  GLU F N   1 
ATOM   10196 C CA  . GLU F  2 212 ? 59.383  2.792    13.284  1.00 48.63  ? 205  GLU F CA  1 
ATOM   10197 C C   . GLU F  2 212 ? 60.089  1.506    12.882  1.00 47.28  ? 205  GLU F C   1 
ATOM   10198 O O   . GLU F  2 212 ? 59.489  0.431    12.873  1.00 42.94  ? 205  GLU F O   1 
ATOM   10199 C CB  . GLU F  2 212 ? 59.715  3.160    14.730  1.00 49.01  ? 205  GLU F CB  1 
ATOM   10200 C CG  . GLU F  2 212 ? 59.344  4.586    15.099  1.00 54.99  ? 205  GLU F CG  1 
ATOM   10201 C CD  . GLU F  2 212 ? 60.004  5.613    14.197  1.00 62.07  ? 205  GLU F CD  1 
ATOM   10202 O OE1 . GLU F  2 212 ? 61.180  5.414    13.822  1.00 62.50  ? 205  GLU F OE1 1 
ATOM   10203 O OE2 . GLU F  2 212 ? 59.345  6.617    13.857  1.00 65.77  ? 205  GLU F OE2 1 
ATOM   10204 N N   . THR F  2 213 ? 61.367  1.628    12.547  1.00 49.34  ? 206  THR F N   1 
ATOM   10205 C CA  . THR F  2 213 ? 62.141  0.511    12.027  1.00 48.16  ? 206  THR F CA  1 
ATOM   10206 C C   . THR F  2 213 ? 62.262  -0.633   13.034  1.00 45.52  ? 206  THR F C   1 
ATOM   10207 O O   . THR F  2 213 ? 62.146  -1.804   12.670  1.00 40.71  ? 206  THR F O   1 
ATOM   10208 C CB  . THR F  2 213 ? 63.548  0.970    11.612  1.00 55.01  ? 206  THR F CB  1 
ATOM   10209 O OG1 . THR F  2 213 ? 63.447  2.122    10.767  1.00 61.50  ? 206  THR F OG1 1 
ATOM   10210 C CG2 . THR F  2 213 ? 64.258  -0.129   10.866  1.00 53.29  ? 206  THR F CG2 1 
ATOM   10211 N N   . ILE F  2 214 ? 62.482  -0.288   14.298  1.00 45.82  ? 207  ILE F N   1 
ATOM   10212 C CA  . ILE F  2 214 ? 62.671  -1.288   15.344  1.00 47.72  ? 207  ILE F CA  1 
ATOM   10213 C C   . ILE F  2 214 ? 61.385  -2.073   15.606  1.00 48.12  ? 207  ILE F C   1 
ATOM   10214 O O   . ILE F  2 214 ? 61.426  -3.217   16.059  1.00 50.81  ? 207  ILE F O   1 
ATOM   10215 C CB  . ILE F  2 214 ? 63.166  -0.638   16.660  1.00 53.25  ? 207  ILE F CB  1 
ATOM   10216 C CG1 . ILE F  2 214 ? 63.612  -1.708   17.662  1.00 53.65  ? 207  ILE F CG1 1 
ATOM   10217 C CG2 . ILE F  2 214 ? 62.097  0.269    17.259  1.00 55.07  ? 207  ILE F CG2 1 
ATOM   10218 C CD1 . ILE F  2 214 ? 64.713  -2.608   17.144  1.00 54.12  ? 207  ILE F C