data_4CY1
# 
_entry.id   4CY1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4CY1         
PDBE  EBI-60281    
WWPDB D_1290060281 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4CY2 unspecified 'CRYSTAL STRUCTURE OF THE KANSL1-WDR5-KNSL2 COMPLEX.' 
PDB 4CY3 unspecified 'CRYSTAL STRUCTURE OF THE NSL1-WDS COMPLEX.'          
PDB 4CY5 unspecified 'CRYSTAL STRUCTURE OF THE NSL1-WDS-NSL2 COMPLEX.'     
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4CY1 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2014-04-09 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dias, J.'           1 
'Brettschneider, J.' 2 
'Cusack, S.'         3 
'Kadlec, J.'         4 
# 
_citation.id                        primary 
_citation.title                     
;Structural Analysis of the Kansl1/Wdr5/Kansl2 Complex Reveals that Wdr5 is Required for Efficient Assembly and Chromatin Targeting of the Nsl Complex.
;
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_volume            28 
_citation.page_first                929 
_citation.page_last                 ? 
_citation.year                      2014 
_citation.journal_id_ASTM           GEDEEP 
_citation.country                   US 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_id_CSD            2056 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24788516 
_citation.pdbx_database_id_DOI      10.1101/GAD.240200.114 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dias, J.'           1 
primary 'Van Nguyen, N.'     2 
primary 'Georgiev, P.'       3 
primary 'Gaub, A.'           4 
primary 'Brettschneider, J.' 5 
primary 'Cusack, S.'         6 
primary 'Kadlec, J.'         7 
primary 'Akhtar, A.'         8 
# 
_cell.entry_id           4CY1 
_cell.length_a           39.760 
_cell.length_b           92.450 
_cell.length_c           81.170 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.18 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4CY1 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'WD REPEAT-CONTAINING PROTEIN 5'        34620.289 2   ? ? 'RESIDUES 23-334'  ? 
2 polymer     syn 'KAT8 REGULATORY NSL COMPLEX SUBUNIT 1' 1610.834  2   ? ? 'RESIDUES 585-598' ? 
3 non-polymer syn GLYCEROL                                92.094    3   ? ? ?                  ? 
4 water       nat water                                   18.015    321 ? ? ?                  ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'BMP2-INDUCED 3-KB GENE PROTEIN'                                                                                            
2 'KANSL1, MLL1/MLL COMPLEX SUBUNIT KANSL1, MSL1 HOMOLOG 1, HMSL1V1, NSL COMPLEX PROTEIN NSL1, NON-SPECIFIC LETHAL 1 HOMOLOG' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MGATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN
LLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN
RDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKY
CIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDCGA
;
;MGATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN
LLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN
RDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKY
CIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDCGA
;
A,B ? 
2 'polypeptide(L)' no no DGTCVAARTRPVLSY DGTCVAARTRPVLSY C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   ALA n 
1 4   THR n 
1 5   GLN n 
1 6   SER n 
1 7   LYS n 
1 8   PRO n 
1 9   THR n 
1 10  PRO n 
1 11  VAL n 
1 12  LYS n 
1 13  PRO n 
1 14  ASN n 
1 15  TYR n 
1 16  ALA n 
1 17  LEU n 
1 18  LYS n 
1 19  PHE n 
1 20  THR n 
1 21  LEU n 
1 22  ALA n 
1 23  GLY n 
1 24  HIS n 
1 25  THR n 
1 26  LYS n 
1 27  ALA n 
1 28  VAL n 
1 29  SER n 
1 30  SER n 
1 31  VAL n 
1 32  LYS n 
1 33  PHE n 
1 34  SER n 
1 35  PRO n 
1 36  ASN n 
1 37  GLY n 
1 38  GLU n 
1 39  TRP n 
1 40  LEU n 
1 41  ALA n 
1 42  SER n 
1 43  SER n 
1 44  SER n 
1 45  ALA n 
1 46  ASP n 
1 47  LYS n 
1 48  LEU n 
1 49  ILE n 
1 50  LYS n 
1 51  ILE n 
1 52  TRP n 
1 53  GLY n 
1 54  ALA n 
1 55  TYR n 
1 56  ASP n 
1 57  GLY n 
1 58  LYS n 
1 59  PHE n 
1 60  GLU n 
1 61  LYS n 
1 62  THR n 
1 63  ILE n 
1 64  SER n 
1 65  GLY n 
1 66  HIS n 
1 67  LYS n 
1 68  LEU n 
1 69  GLY n 
1 70  ILE n 
1 71  SER n 
1 72  ASP n 
1 73  VAL n 
1 74  ALA n 
1 75  TRP n 
1 76  SER n 
1 77  SER n 
1 78  ASP n 
1 79  SER n 
1 80  ASN n 
1 81  LEU n 
1 82  LEU n 
1 83  VAL n 
1 84  SER n 
1 85  ALA n 
1 86  SER n 
1 87  ASP n 
1 88  ASP n 
1 89  LYS n 
1 90  THR n 
1 91  LEU n 
1 92  LYS n 
1 93  ILE n 
1 94  TRP n 
1 95  ASP n 
1 96  VAL n 
1 97  SER n 
1 98  SER n 
1 99  GLY n 
1 100 LYS n 
1 101 CYS n 
1 102 LEU n 
1 103 LYS n 
1 104 THR n 
1 105 LEU n 
1 106 LYS n 
1 107 GLY n 
1 108 HIS n 
1 109 SER n 
1 110 ASN n 
1 111 TYR n 
1 112 VAL n 
1 113 PHE n 
1 114 CYS n 
1 115 CYS n 
1 116 ASN n 
1 117 PHE n 
1 118 ASN n 
1 119 PRO n 
1 120 GLN n 
1 121 SER n 
1 122 ASN n 
1 123 LEU n 
1 124 ILE n 
1 125 VAL n 
1 126 SER n 
1 127 GLY n 
1 128 SER n 
1 129 PHE n 
1 130 ASP n 
1 131 GLU n 
1 132 SER n 
1 133 VAL n 
1 134 ARG n 
1 135 ILE n 
1 136 TRP n 
1 137 ASP n 
1 138 VAL n 
1 139 LYS n 
1 140 THR n 
1 141 GLY n 
1 142 LYS n 
1 143 CYS n 
1 144 LEU n 
1 145 LYS n 
1 146 THR n 
1 147 LEU n 
1 148 PRO n 
1 149 ALA n 
1 150 HIS n 
1 151 SER n 
1 152 ASP n 
1 153 PRO n 
1 154 VAL n 
1 155 SER n 
1 156 ALA n 
1 157 VAL n 
1 158 HIS n 
1 159 PHE n 
1 160 ASN n 
1 161 ARG n 
1 162 ASP n 
1 163 GLY n 
1 164 SER n 
1 165 LEU n 
1 166 ILE n 
1 167 VAL n 
1 168 SER n 
1 169 SER n 
1 170 SER n 
1 171 TYR n 
1 172 ASP n 
1 173 GLY n 
1 174 LEU n 
1 175 CYS n 
1 176 ARG n 
1 177 ILE n 
1 178 TRP n 
1 179 ASP n 
1 180 THR n 
1 181 ALA n 
1 182 SER n 
1 183 GLY n 
1 184 GLN n 
1 185 CYS n 
1 186 LEU n 
1 187 LYS n 
1 188 THR n 
1 189 LEU n 
1 190 ILE n 
1 191 ASP n 
1 192 ASP n 
1 193 ASP n 
1 194 ASN n 
1 195 PRO n 
1 196 PRO n 
1 197 VAL n 
1 198 SER n 
1 199 PHE n 
1 200 VAL n 
1 201 LYS n 
1 202 PHE n 
1 203 SER n 
1 204 PRO n 
1 205 ASN n 
1 206 GLY n 
1 207 LYS n 
1 208 TYR n 
1 209 ILE n 
1 210 LEU n 
1 211 ALA n 
1 212 ALA n 
1 213 THR n 
1 214 LEU n 
1 215 ASP n 
1 216 ASN n 
1 217 THR n 
1 218 LEU n 
1 219 LYS n 
1 220 LEU n 
1 221 TRP n 
1 222 ASP n 
1 223 TYR n 
1 224 SER n 
1 225 LYS n 
1 226 GLY n 
1 227 LYS n 
1 228 CYS n 
1 229 LEU n 
1 230 LYS n 
1 231 THR n 
1 232 TYR n 
1 233 THR n 
1 234 GLY n 
1 235 HIS n 
1 236 LYS n 
1 237 ASN n 
1 238 GLU n 
1 239 LYS n 
1 240 TYR n 
1 241 CYS n 
1 242 ILE n 
1 243 PHE n 
1 244 ALA n 
1 245 ASN n 
1 246 PHE n 
1 247 SER n 
1 248 VAL n 
1 249 THR n 
1 250 GLY n 
1 251 GLY n 
1 252 LYS n 
1 253 TRP n 
1 254 ILE n 
1 255 VAL n 
1 256 SER n 
1 257 GLY n 
1 258 SER n 
1 259 GLU n 
1 260 ASP n 
1 261 ASN n 
1 262 LEU n 
1 263 VAL n 
1 264 TYR n 
1 265 ILE n 
1 266 TRP n 
1 267 ASN n 
1 268 LEU n 
1 269 GLN n 
1 270 THR n 
1 271 LYS n 
1 272 GLU n 
1 273 ILE n 
1 274 VAL n 
1 275 GLN n 
1 276 LYS n 
1 277 LEU n 
1 278 GLN n 
1 279 GLY n 
1 280 HIS n 
1 281 THR n 
1 282 ASP n 
1 283 VAL n 
1 284 VAL n 
1 285 ILE n 
1 286 SER n 
1 287 THR n 
1 288 ALA n 
1 289 CYS n 
1 290 HIS n 
1 291 PRO n 
1 292 THR n 
1 293 GLU n 
1 294 ASN n 
1 295 ILE n 
1 296 ILE n 
1 297 ALA n 
1 298 SER n 
1 299 ALA n 
1 300 ALA n 
1 301 LEU n 
1 302 GLU n 
1 303 ASN n 
1 304 ASP n 
1 305 LYS n 
1 306 THR n 
1 307 ILE n 
1 308 LYS n 
1 309 LEU n 
1 310 TRP n 
1 311 LYS n 
1 312 SER n 
1 313 ASP n 
1 314 CYS n 
1 315 GLY n 
1 316 ALA n 
2 1   ASP n 
2 2   GLY n 
2 3   THR n 
2 4   CYS n 
2 5   VAL n 
2 6   ALA n 
2 7   ALA n 
2 8   ARG n 
2 9   THR n 
2 10  ARG n 
2 11  PRO n 
2 12  VAL n 
2 13  LEU n 
2 14  SER n 
2 15  TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              STAR 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PPROEXHTB 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP WDR5_HUMAN  1 ? ? P61964 ? 
2 UNP KANL1_HUMAN 2 ? ? Q7Z3B3 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4CY1 A 3 ? 314 ? P61964 23  ? 334 ? 23  334 
2 1 4CY1 B 3 ? 314 ? P61964 23  ? 334 ? 23  334 
3 2 4CY1 C 1 ? 14  ? Q7Z3B3 585 ? 598 ? 585 598 
4 2 4CY1 D 1 ? 14  ? Q7Z3B3 585 ? 598 ? 585 598 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4CY1 MET A 1   ? UNP P61964 ? ? 'expression tag' 21  1  
1 4CY1 GLY A 2   ? UNP P61964 ? ? 'expression tag' 22  2  
1 4CY1 GLY A 315 ? UNP P61964 ? ? 'expression tag' 335 3  
1 4CY1 ALA A 316 ? UNP P61964 ? ? 'expression tag' 336 4  
2 4CY1 MET B 1   ? UNP P61964 ? ? 'expression tag' 21  5  
2 4CY1 GLY B 2   ? UNP P61964 ? ? 'expression tag' 22  6  
2 4CY1 GLY B 315 ? UNP P61964 ? ? 'expression tag' 335 7  
2 4CY1 ALA B 316 ? UNP P61964 ? ? 'expression tag' 336 8  
3 4CY1 TYR C 15  ? UNP Q7Z3B3 ? ? 'expression tag' 599 9  
4 4CY1 TYR D 15  ? UNP Q7Z3B3 ? ? 'expression tag' 599 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4CY1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.07 
_exptl_crystal.density_percent_sol   41 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '26% (W/V) PEG 3350, 0.2 M AMMONIUM SULPHATE, 0.1 M BIS-TRIS, PH 6.5.' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2012-10-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.939 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.939 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4CY1 
_reflns.observed_criterion_sigma_I   2.38 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             100.00 
_reflns.d_resolution_high            1.50 
_reflns.number_obs                   90649 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.60 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.8 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.55 
_reflns_shell.percent_possible_all   89.0 
_reflns_shell.Rmerge_I_obs           0.64 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.40 
_reflns_shell.pdbx_redundancy        3.8 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4CY1 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     86154 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.58 
_refine.ls_d_res_high                            1.50 
_refine.ls_percent_reflns_obs                    96.53 
_refine.ls_R_factor_obs                          0.17057 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.16989 
_refine.ls_R_factor_R_free                       0.18344 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4494 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.957 
_refine.correlation_coeff_Fo_to_Fc_free          0.950 
_refine.B_iso_mean                               11.934 
_refine.aniso_B[1][1]                            -1.17 
_refine.aniso_B[2][2]                            4.49 
_refine.aniso_B[3][3]                            -3.32 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.74 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES REFINED INDIVIDUALLY' 
_refine.pdbx_starting_model                      'PDB ENTRY 2G99' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.020 
_refine.pdbx_overall_ESU_R_Free                  0.015 
_refine.overall_SU_ML                            0.035 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             1.820 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4891 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         18 
_refine_hist.number_atoms_solvent             321 
_refine_hist.number_atoms_total               5230 
_refine_hist.d_res_high                       1.50 
_refine_hist.d_res_low                        40.58 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.004  0.019  ? 5022  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 4762  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.007  1.945  ? 6807  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.665  3.000  ? 11021 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.815  5.000  ? 628   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       29.663 24.815 ? 189   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       11.560 15.000 ? 863   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       10.987 15.000 ? 10    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.060  0.200  ? 775   'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 5577  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1109  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.443  7.196  ? 2524  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.443  60.393 ? 2523  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.540  1.198  ? 2498  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           2.550  3.000  ? 5001  'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          2.657  5.000  ? 4890  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.499 
_refine_ls_shell.d_res_low                        1.538 
_refine_ls_shell.number_reflns_R_work             5563 
_refine_ls_shell.R_factor_R_work                  0.246 
_refine_ls_shell.percent_reflns_obs               84.34 
_refine_ls_shell.R_factor_R_free                  0.280 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             306 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.999940 0.007600  -0.007800 -0.007600 -0.999970 -0.000910 -0.007810 -0.000850 0.999970 11.55323 -22.66982 -40.55124 
2 given ? -0.999890 -0.009110 0.011850  0.009120  -0.999960 0.001020  0.011840  0.001130  0.999930 12.44732 -22.64658 40.65837  
# 
_struct.entry_id                  4CY1 
_struct.title                     'Crystal structure of the KANSL1-WDR5 complex.' 
_struct.pdbx_descriptor           'WD REPEAT-CONTAINING PROTEIN 5, KAT8 REGULATORY NSL COMPLEX SUBUNIT 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4CY1 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'TRANSCRIPTION, EPIGENETIC REGULATOR, HISTONE ACETYLATION, CHROMATIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA C 6 ? ARG C 10 ? ALA C 590 ARG C 594 5 ? 5 
HELX_P HELX_P2 2 ALA D 6 ? ARG D 10 ? ALA D 590 ARG D 594 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 4 ? 
AE ? 4 ? 
AF ? 4 ? 
AG ? 4 ? 
BA ? 4 ? 
BB ? 4 ? 
BC ? 4 ? 
BD ? 4 ? 
BE ? 4 ? 
BF ? 4 ? 
BG ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? anti-parallel 
BF 1 2 ? anti-parallel 
BF 2 3 ? anti-parallel 
BF 3 4 ? anti-parallel 
BG 1 2 ? anti-parallel 
BG 2 3 ? anti-parallel 
BG 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ALA A 16  ? LEU A 21  ? ALA A 36  LEU A 41  
AA 2 ILE A 307 ? LYS A 311 ? ILE A 327 LYS A 331 
AA 3 ILE A 295 ? ALA A 300 ? ILE A 315 ALA A 320 
AA 4 VAL A 284 ? CYS A 289 ? VAL A 304 CYS A 309 
AB 1 VAL A 28  ? PHE A 33  ? VAL A 48  PHE A 53  
AB 2 TRP A 39  ? SER A 44  ? TRP A 59  SER A 64  
AB 3 LEU A 48  ? GLY A 53  ? LEU A 68  GLY A 73  
AB 4 PHE A 59  ? SER A 64  ? PHE A 79  SER A 84  
AC 1 ILE A 70  ? TRP A 75  ? ILE A 90  TRP A 95  
AC 2 LEU A 81  ? SER A 86  ? LEU A 101 SER A 106 
AC 3 LEU A 91  ? ASP A 95  ? LEU A 111 ASP A 115 
AC 4 LYS A 100 ? LEU A 105 ? LYS A 120 LEU A 125 
AD 1 VAL A 112 ? PHE A 117 ? VAL A 132 PHE A 137 
AD 2 LEU A 123 ? SER A 128 ? LEU A 143 SER A 148 
AD 3 VAL A 133 ? ASP A 137 ? VAL A 153 ASP A 157 
AD 4 CYS A 143 ? LEU A 147 ? CYS A 163 LEU A 167 
AE 1 VAL A 154 ? PHE A 159 ? VAL A 174 PHE A 179 
AE 2 LEU A 165 ? SER A 170 ? LEU A 185 SER A 190 
AE 3 CYS A 175 ? ASP A 179 ? CYS A 195 ASP A 199 
AE 4 CYS A 185 ? LEU A 189 ? CYS A 205 LEU A 209 
AF 1 VAL A 197 ? PHE A 202 ? VAL A 217 PHE A 222 
AF 2 ILE A 209 ? THR A 213 ? ILE A 229 THR A 233 
AF 3 THR A 217 ? ASP A 222 ? THR A 237 ASP A 242 
AF 4 LYS A 227 ? TYR A 232 ? LYS A 247 TYR A 252 
AG 1 ALA A 244 ? SER A 247 ? ALA A 264 SER A 267 
AG 2 TRP A 253 ? SER A 256 ? TRP A 273 SER A 276 
AG 3 VAL A 263 ? ASN A 267 ? VAL A 283 ASN A 287 
AG 4 ILE A 273 ? LEU A 277 ? ILE A 293 LEU A 297 
BA 1 ALA B 16  ? LEU B 21  ? ALA B 36  LEU B 41  
BA 2 ILE B 307 ? LYS B 311 ? ILE B 327 LYS B 331 
BA 3 ILE B 295 ? ALA B 300 ? ILE B 315 ALA B 320 
BA 4 VAL B 284 ? CYS B 289 ? VAL B 304 CYS B 309 
BB 1 VAL B 28  ? PHE B 33  ? VAL B 48  PHE B 53  
BB 2 TRP B 39  ? SER B 44  ? TRP B 59  SER B 64  
BB 3 LEU B 48  ? GLY B 53  ? LEU B 68  GLY B 73  
BB 4 PHE B 59  ? SER B 64  ? PHE B 79  SER B 84  
BC 1 ILE B 70  ? TRP B 75  ? ILE B 90  TRP B 95  
BC 2 LEU B 81  ? SER B 86  ? LEU B 101 SER B 106 
BC 3 LEU B 91  ? ASP B 95  ? LEU B 111 ASP B 115 
BC 4 CYS B 101 ? LEU B 105 ? CYS B 121 LEU B 125 
BD 1 VAL B 112 ? PHE B 117 ? VAL B 132 PHE B 137 
BD 2 LEU B 123 ? SER B 128 ? LEU B 143 SER B 148 
BD 3 VAL B 133 ? ASP B 137 ? VAL B 153 ASP B 157 
BD 4 CYS B 143 ? LEU B 147 ? CYS B 163 LEU B 167 
BE 1 VAL B 154 ? PHE B 159 ? VAL B 174 PHE B 179 
BE 2 LEU B 165 ? SER B 170 ? LEU B 185 SER B 190 
BE 3 CYS B 175 ? ASP B 179 ? CYS B 195 ASP B 199 
BE 4 CYS B 185 ? LEU B 189 ? CYS B 205 LEU B 209 
BF 1 VAL B 197 ? PHE B 202 ? VAL B 217 PHE B 222 
BF 2 TYR B 208 ? THR B 213 ? TYR B 228 THR B 233 
BF 3 THR B 217 ? ASP B 222 ? THR B 237 ASP B 242 
BF 4 LYS B 227 ? TYR B 232 ? LYS B 247 TYR B 252 
BG 1 ALA B 244 ? SER B 247 ? ALA B 264 SER B 267 
BG 2 TRP B 253 ? SER B 256 ? TRP B 273 SER B 276 
BG 3 VAL B 263 ? ASN B 267 ? VAL B 283 ASN B 287 
BG 4 ILE B 273 ? LEU B 277 ? ILE B 293 LEU B 297 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 21  ? N LEU A 41  O ILE A 307 ? O ILE A 327 
AA 2 3 N TRP A 310 ? N TRP A 330 O ILE A 296 ? O ILE A 316 
AA 3 4 N ALA A 299 ? N ALA A 319 O SER A 286 ? O SER A 306 
AB 1 2 N LYS A 32  ? N LYS A 52  O ALA A 41  ? O ALA A 61  
AB 2 3 N SER A 44  ? N SER A 64  O LEU A 48  ? O LEU A 68  
AB 3 4 O ILE A 51  ? O ILE A 71  N GLU A 60  ? N GLU A 80  
AC 1 2 N ALA A 74  ? N ALA A 94  O VAL A 83  ? O VAL A 103 
AC 2 3 N SER A 84  ? N SER A 104 O LYS A 92  ? O LYS A 112 
AC 3 4 N ASP A 95  ? N ASP A 115 O LYS A 100 ? O LYS A 120 
AD 1 2 N ASN A 116 ? N ASN A 136 O VAL A 125 ? O VAL A 145 
AD 2 3 N SER A 126 ? N SER A 146 O ARG A 134 ? O ARG A 154 
AD 3 4 O ILE A 135 ? O ILE A 155 N LEU A 144 ? N LEU A 164 
AE 1 2 N HIS A 158 ? N HIS A 178 O VAL A 167 ? O VAL A 187 
AE 2 3 N SER A 168 ? N SER A 188 O ARG A 176 ? O ARG A 196 
AE 3 4 O ILE A 177 ? O ILE A 197 N LEU A 186 ? N LEU A 206 
AF 1 2 N LYS A 201 ? N LYS A 221 O LEU A 210 ? O LEU A 230 
AF 2 3 N THR A 213 ? N THR A 233 O THR A 217 ? O THR A 237 
AF 3 4 N ASP A 222 ? N ASP A 242 O LYS A 227 ? O LYS A 247 
AG 1 2 N SER A 247 ? N SER A 267 O TRP A 253 ? O TRP A 273 
AG 2 3 N SER A 256 ? N SER A 276 O TYR A 264 ? O TYR A 284 
AG 3 4 O ILE A 265 ? O ILE A 285 N VAL A 274 ? N VAL A 294 
BA 1 2 N LEU B 21  ? N LEU B 41  O ILE B 307 ? O ILE B 327 
BA 2 3 N TRP B 310 ? N TRP B 330 O ILE B 296 ? O ILE B 316 
BA 3 4 N ALA B 299 ? N ALA B 319 O SER B 286 ? O SER B 306 
BB 1 2 N LYS B 32  ? N LYS B 52  O ALA B 41  ? O ALA B 61  
BB 2 3 N SER B 44  ? N SER B 64  O LEU B 48  ? O LEU B 68  
BB 3 4 O ILE B 51  ? O ILE B 71  N GLU B 60  ? N GLU B 80  
BC 1 2 N ALA B 74  ? N ALA B 94  O VAL B 83  ? O VAL B 103 
BC 2 3 N SER B 84  ? N SER B 104 O LYS B 92  ? O LYS B 112 
BC 3 4 O ILE B 93  ? O ILE B 113 N LEU B 102 ? N LEU B 122 
BD 1 2 N ASN B 116 ? N ASN B 136 O VAL B 125 ? O VAL B 145 
BD 2 3 N SER B 126 ? N SER B 146 O ARG B 134 ? O ARG B 154 
BD 3 4 O ILE B 135 ? O ILE B 155 N LEU B 144 ? N LEU B 164 
BE 1 2 N HIS B 158 ? N HIS B 178 O VAL B 167 ? O VAL B 187 
BE 2 3 N SER B 168 ? N SER B 188 O ARG B 176 ? O ARG B 196 
BE 3 4 O ILE B 177 ? O ILE B 197 N LEU B 186 ? N LEU B 206 
BF 1 2 N LYS B 201 ? N LYS B 221 O LEU B 210 ? O LEU B 230 
BF 2 3 N THR B 213 ? N THR B 233 O THR B 217 ? O THR B 237 
BF 3 4 N ASP B 222 ? N ASP B 242 O LYS B 227 ? O LYS B 247 
BG 1 2 N SER B 247 ? N SER B 267 O TRP B 253 ? O TRP B 273 
BG 2 3 N SER B 256 ? N SER B 276 O TYR B 264 ? O TYR B 284 
BG 3 4 O ILE B 265 ? O ILE B 285 N VAL B 274 ? N VAL B 294 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL B 1335' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL A 1335' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE GOL D 1000' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASN B 118 ? ASN B 138  . ? 1_555 ? 
2  AC1 5 GLN B 120 ? GLN B 140  . ? 1_555 ? 
3  AC1 5 GLY B 163 ? GLY B 183  . ? 1_555 ? 
4  AC1 5 THR B 180 ? THR B 200  . ? 1_555 ? 
5  AC1 5 HOH I .   ? HOH B 2068 . ? 1_555 ? 
6  AC2 5 ASN A 118 ? ASN A 138  . ? 1_555 ? 
7  AC2 5 GLN A 120 ? GLN A 140  . ? 1_555 ? 
8  AC2 5 ASN A 122 ? ASN A 142  . ? 1_555 ? 
9  AC2 5 GLY A 163 ? GLY A 183  . ? 1_555 ? 
10 AC2 5 HOH H .   ? HOH A 2073 . ? 1_555 ? 
11 AC3 2 ASN A 36  ? ASN A 56   . ? 1_655 ? 
12 AC3 2 TRP A 39  ? TRP A 59   . ? 1_655 ? 
# 
_database_PDB_matrix.entry_id          4CY1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4CY1 
_atom_sites.fract_transf_matrix[1][1]   0.025151 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000079 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010817 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012320 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 11  ? -19.012 2.946   -24.922  1.00 28.97 ? 31   VAL A N   1 
ATOM   2    C CA  . VAL A 1 11  ? -18.020 3.753   -25.701  1.00 26.94 ? 31   VAL A CA  1 
ATOM   3    C C   . VAL A 1 11  ? -16.588 3.254   -25.483  1.00 25.51 ? 31   VAL A C   1 
ATOM   4    O O   . VAL A 1 11  ? -15.820 3.144   -26.439  1.00 26.74 ? 31   VAL A O   1 
ATOM   5    C CB  . VAL A 1 11  ? -18.116 5.259   -25.361  1.00 27.25 ? 31   VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 11  ? -17.057 6.058   -26.112  1.00 27.63 ? 31   VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 11  ? -19.505 5.789   -25.692  1.00 28.25 ? 31   VAL A CG2 1 
ATOM   8    N N   . LYS A 1 12  ? -16.232 2.971   -24.229  1.00 23.50 ? 32   LYS A N   1 
ATOM   9    C CA  . LYS A 1 12  ? -14.922 2.404   -23.897  1.00 21.69 ? 32   LYS A CA  1 
ATOM   10   C C   . LYS A 1 12  ? -15.067 1.187   -22.981  1.00 19.92 ? 32   LYS A C   1 
ATOM   11   O O   . LYS A 1 12  ? -15.973 1.147   -22.145  1.00 20.48 ? 32   LYS A O   1 
ATOM   12   C CB  . LYS A 1 12  ? -14.036 3.453   -23.219  1.00 22.64 ? 32   LYS A CB  1 
ATOM   13   C CG  . LYS A 1 12  ? -13.699 4.648   -24.103  1.00 23.30 ? 32   LYS A CG  1 
ATOM   14   C CD  . LYS A 1 12  ? -12.340 5.248   -23.763  1.00 24.18 ? 32   LYS A CD  1 
ATOM   15   C CE  . LYS A 1 12  ? -12.345 6.007   -22.445  1.00 25.37 ? 32   LYS A CE  1 
ATOM   16   N NZ  . LYS A 1 12  ? -12.723 7.435   -22.628  1.00 26.27 ? 32   LYS A NZ  1 
ATOM   17   N N   . PRO A 1 13  ? -14.170 0.191   -23.127  1.00 17.40 ? 33   PRO A N   1 
ATOM   18   C CA  . PRO A 1 13  ? -14.218 -0.971  -22.245  1.00 16.36 ? 33   PRO A CA  1 
ATOM   19   C C   . PRO A 1 13  ? -13.598 -0.662  -20.886  1.00 15.64 ? 33   PRO A C   1 
ATOM   20   O O   . PRO A 1 13  ? -12.935 0.365   -20.731  1.00 16.23 ? 33   PRO A O   1 
ATOM   21   C CB  . PRO A 1 13  ? -13.389 -2.011  -22.997  1.00 16.25 ? 33   PRO A CB  1 
ATOM   22   C CG  . PRO A 1 13  ? -12.403 -1.214  -23.781  1.00 16.61 ? 33   PRO A CG  1 
ATOM   23   C CD  . PRO A 1 13  ? -12.998 0.149   -24.022  1.00 16.84 ? 33   PRO A CD  1 
ATOM   24   N N   . ASN A 1 14  ? -13.818 -1.545  -19.916  1.00 14.37 ? 34   ASN A N   1 
ATOM   25   C CA  . ASN A 1 14  ? -13.262 -1.376  -18.575  1.00 14.16 ? 34   ASN A CA  1 
ATOM   26   C C   . ASN A 1 14  ? -12.560 -2.648  -18.101  1.00 13.28 ? 34   ASN A C   1 
ATOM   27   O O   . ASN A 1 14  ? -12.800 -3.134  -16.995  1.00 13.34 ? 34   ASN A O   1 
ATOM   28   C CB  . ASN A 1 14  ? -14.351 -0.926  -17.584  1.00 14.46 ? 34   ASN A CB  1 
ATOM   29   C CG  . ASN A 1 14  ? -15.520 -1.898  -17.494  1.00 14.44 ? 34   ASN A CG  1 
ATOM   30   O OD1 . ASN A 1 14  ? -15.578 -2.896  -18.211  1.00 15.25 ? 34   ASN A OD1 1 
ATOM   31   N ND2 . ASN A 1 14  ? -16.462 -1.603  -16.604  1.00 15.32 ? 34   ASN A ND2 1 
ATOM   32   N N   . TYR A 1 15  ? -11.689 -3.184  -18.954  1.00 12.82 ? 35   TYR A N   1 
ATOM   33   C CA  . TYR A 1 15  ? -10.903 -4.364  -18.604  1.00 12.00 ? 35   TYR A CA  1 
ATOM   34   C C   . TYR A 1 15  ? -10.114 -4.147  -17.315  1.00 11.94 ? 35   TYR A C   1 
ATOM   35   O O   . TYR A 1 15  ? -9.412  -3.144  -17.164  1.00 12.92 ? 35   TYR A O   1 
ATOM   36   C CB  . TYR A 1 15  ? -9.961  -4.763  -19.745  1.00 11.55 ? 35   TYR A CB  1 
ATOM   37   C CG  . TYR A 1 15  ? -10.650 -5.559  -20.822  1.00 11.00 ? 35   TYR A CG  1 
ATOM   38   C CD1 . TYR A 1 15  ? -10.829 -6.931  -20.684  1.00 10.52 ? 35   TYR A CD1 1 
ATOM   39   C CD2 . TYR A 1 15  ? -11.148 -4.943  -21.965  1.00 11.03 ? 35   TYR A CD2 1 
ATOM   40   C CE1 . TYR A 1 15  ? -11.471 -7.671  -21.658  1.00 10.77 ? 35   TYR A CE1 1 
ATOM   41   C CE2 . TYR A 1 15  ? -11.792 -5.675  -22.948  1.00 10.83 ? 35   TYR A CE2 1 
ATOM   42   C CZ  . TYR A 1 15  ? -11.948 -7.039  -22.790  1.00 10.81 ? 35   TYR A CZ  1 
ATOM   43   O OH  . TYR A 1 15  ? -12.585 -7.773  -23.758  1.00 11.59 ? 35   TYR A OH  1 
ATOM   44   N N   . ALA A 1 16  ? -10.259 -5.090  -16.388  1.00 11.70 ? 36   ALA A N   1 
ATOM   45   C CA  . ALA A 1 16  ? -9.554  -5.062  -15.112  1.00 11.41 ? 36   ALA A CA  1 
ATOM   46   C C   . ALA A 1 16  ? -8.948  -6.433  -14.837  1.00 10.72 ? 36   ALA A C   1 
ATOM   47   O O   . ALA A 1 16  ? -9.521  -7.459  -15.214  1.00 10.81 ? 36   ALA A O   1 
ATOM   48   C CB  . ALA A 1 16  ? -10.502 -4.668  -13.993  1.00 11.68 ? 36   ALA A CB  1 
ATOM   49   N N   . LEU A 1 17  ? -7.795  -6.440  -14.173  1.00 10.22 ? 37   LEU A N   1 
ATOM   50   C CA  . LEU A 1 17  ? -7.066  -7.677  -13.892  1.00 10.73 ? 37   LEU A CA  1 
ATOM   51   C C   . LEU A 1 17  ? -7.829  -8.554  -12.910  1.00 10.94 ? 37   LEU A C   1 
ATOM   52   O O   . LEU A 1 17  ? -8.202  -8.102  -11.827  1.00 11.94 ? 37   LEU A O   1 
ATOM   53   C CB  . LEU A 1 17  ? -5.678  -7.369  -13.323  1.00 10.46 ? 37   LEU A CB  1 
ATOM   54   C CG  . LEU A 1 17  ? -4.783  -8.568  -12.990  1.00 10.48 ? 37   LEU A CG  1 
ATOM   55   C CD1 . LEU A 1 17  ? -4.450  -9.371  -14.236  1.00 10.03 ? 37   LEU A CD1 1 
ATOM   56   C CD2 . LEU A 1 17  ? -3.509  -8.109  -12.298  1.00 10.54 ? 37   LEU A CD2 1 
ATOM   57   N N   . LYS A 1 18  ? -8.049  -9.810  -13.291  1.00 10.95 ? 38   LYS A N   1 
ATOM   58   C CA  . LYS A 1 18  ? -8.754  -10.765 -12.436  1.00 11.25 ? 38   LYS A CA  1 
ATOM   59   C C   . LYS A 1 18  ? -7.846  -11.875 -11.915  1.00 11.05 ? 38   LYS A C   1 
ATOM   60   O O   . LYS A 1 18  ? -7.948  -12.249 -10.750  1.00 11.42 ? 38   LYS A O   1 
ATOM   61   C CB  . LYS A 1 18  ? -9.950  -11.364 -13.178  1.00 11.99 ? 38   LYS A CB  1 
ATOM   62   C CG  . LYS A 1 18  ? -10.993 -10.340 -13.605  1.00 13.02 ? 38   LYS A CG  1 
ATOM   63   C CD  . LYS A 1 18  ? -11.535 -9.539  -12.430  1.00 13.39 ? 38   LYS A CD  1 
ATOM   64   C CE  . LYS A 1 18  ? -12.706 -8.665  -12.846  1.00 14.50 ? 38   LYS A CE  1 
ATOM   65   N NZ  . LYS A 1 18  ? -13.187 -7.810  -11.727  1.00 15.55 ? 38   LYS A NZ  1 
ATOM   66   N N   . PHE A 1 19  ? -6.974  -12.410 -12.768  1.00 10.29 ? 39   PHE A N   1 
ATOM   67   C CA  . PHE A 1 19  ? -6.062  -13.478 -12.355  1.00 9.88  ? 39   PHE A CA  1 
ATOM   68   C C   . PHE A 1 19  ? -4.687  -13.325 -12.986  1.00 9.41  ? 39   PHE A C   1 
ATOM   69   O O   . PHE A 1 19  ? -4.560  -12.845 -14.114  1.00 9.47  ? 39   PHE A O   1 
ATOM   70   C CB  . PHE A 1 19  ? -6.636  -14.847 -12.725  1.00 10.15 ? 39   PHE A CB  1 
ATOM   71   C CG  . PHE A 1 19  ? -7.999  -15.103 -12.153  1.00 10.23 ? 39   PHE A CG  1 
ATOM   72   C CD1 . PHE A 1 19  ? -8.143  -15.560 -10.851  1.00 10.89 ? 39   PHE A CD1 1 
ATOM   73   C CD2 . PHE A 1 19  ? -9.140  -14.876 -12.913  1.00 10.76 ? 39   PHE A CD2 1 
ATOM   74   C CE1 . PHE A 1 19  ? -9.400  -15.788 -10.317  1.00 11.12 ? 39   PHE A CE1 1 
ATOM   75   C CE2 . PHE A 1 19  ? -10.399 -15.103 -12.384  1.00 10.99 ? 39   PHE A CE2 1 
ATOM   76   C CZ  . PHE A 1 19  ? -10.530 -15.562 -11.085  1.00 11.67 ? 39   PHE A CZ  1 
ATOM   77   N N   . THR A 1 20  ? -3.663  -13.733 -12.240  1.00 9.29  ? 40   THR A N   1 
ATOM   78   C CA  . THR A 1 20  ? -2.311  -13.863 -12.768  1.00 8.76  ? 40   THR A CA  1 
ATOM   79   C C   . THR A 1 20  ? -1.883  -15.321 -12.653  1.00 8.92  ? 40   THR A C   1 
ATOM   80   O O   . THR A 1 20  ? -1.955  -15.923 -11.578  1.00 9.06  ? 40   THR A O   1 
ATOM   81   C CB  . THR A 1 20  ? -1.313  -12.946 -12.042  1.00 8.83  ? 40   THR A CB  1 
ATOM   82   O OG1 . THR A 1 20  ? -1.727  -11.583 -12.191  1.00 8.49  ? 40   THR A OG1 1 
ATOM   83   C CG2 . THR A 1 20  ? 0.095   -13.107 -12.621  1.00 9.16  ? 40   THR A CG2 1 
ATOM   84   N N   . LEU A 1 21  ? -1.442  -15.871 -13.780  1.00 8.51  ? 41   LEU A N   1 
ATOM   85   C CA  . LEU A 1 21  ? -1.113  -17.281 -13.921  1.00 8.66  ? 41   LEU A CA  1 
ATOM   86   C C   . LEU A 1 21  ? 0.401   -17.430 -13.989  1.00 8.90  ? 41   LEU A C   1 
ATOM   87   O O   . LEU A 1 21  ? 1.026   -17.020 -14.972  1.00 10.27 ? 41   LEU A O   1 
ATOM   88   C CB  . LEU A 1 21  ? -1.742  -17.837 -15.202  1.00 9.13  ? 41   LEU A CB  1 
ATOM   89   C CG  . LEU A 1 21  ? -3.261  -18.042 -15.259  1.00 9.14  ? 41   LEU A CG  1 
ATOM   90   C CD1 . LEU A 1 21  ? -4.045  -16.842 -14.745  1.00 9.14  ? 41   LEU A CD1 1 
ATOM   91   C CD2 . LEU A 1 21  ? -3.683  -18.365 -16.685  1.00 9.44  ? 41   LEU A CD2 1 
ATOM   92   N N   . ALA A 1 22  ? 0.987   -18.012 -12.946  1.00 9.07  ? 42   ALA A N   1 
ATOM   93   C CA  . ALA A 1 22  ? 2.432   -18.205 -12.864  1.00 9.62  ? 42   ALA A CA  1 
ATOM   94   C C   . ALA A 1 22  ? 2.757   -19.693 -12.910  1.00 9.71  ? 42   ALA A C   1 
ATOM   95   O O   . ALA A 1 22  ? 2.041   -20.509 -12.323  1.00 10.45 ? 42   ALA A O   1 
ATOM   96   C CB  . ALA A 1 22  ? 2.975   -17.583 -11.587  1.00 10.49 ? 42   ALA A CB  1 
ATOM   97   N N   . GLY A 1 23  ? 3.839   -20.046 -13.597  1.00 9.79  ? 43   GLY A N   1 
ATOM   98   C CA  . GLY A 1 23  ? 4.206   -21.453 -13.756  1.00 9.35  ? 43   GLY A CA  1 
ATOM   99   C C   . GLY A 1 23  ? 5.339   -21.704 -14.732  1.00 9.49  ? 43   GLY A C   1 
ATOM   100  O O   . GLY A 1 23  ? 6.222   -22.523 -14.470  1.00 9.52  ? 43   GLY A O   1 
ATOM   101  N N   . HIS A 1 24  ? 5.305   -21.027 -15.877  1.00 8.70  ? 44   HIS A N   1 
ATOM   102  C CA  . HIS A 1 24  ? 6.401   -21.131 -16.834  1.00 8.85  ? 44   HIS A CA  1 
ATOM   103  C C   . HIS A 1 24  ? 7.677   -20.552 -16.227  1.00 8.92  ? 44   HIS A C   1 
ATOM   104  O O   . HIS A 1 24  ? 7.633   -19.534 -15.533  1.00 8.91  ? 44   HIS A O   1 
ATOM   105  C CB  . HIS A 1 24  ? 6.065   -20.414 -18.143  1.00 9.16  ? 44   HIS A CB  1 
ATOM   106  C CG  . HIS A 1 24  ? 5.063   -21.136 -18.988  1.00 8.86  ? 44   HIS A CG  1 
ATOM   107  N ND1 . HIS A 1 24  ? 5.329   -22.348 -19.588  1.00 9.33  ? 44   HIS A ND1 1 
ATOM   108  C CD2 . HIS A 1 24  ? 3.795   -20.814 -19.337  1.00 9.19  ? 44   HIS A CD2 1 
ATOM   109  C CE1 . HIS A 1 24  ? 4.268   -22.742 -20.269  1.00 9.21  ? 44   HIS A CE1 1 
ATOM   110  N NE2 . HIS A 1 24  ? 3.324   -21.829 -20.135  1.00 9.34  ? 44   HIS A NE2 1 
ATOM   111  N N   . THR A 1 25  ? 8.803   -21.210 -16.496  1.00 9.49  ? 45   THR A N   1 
ATOM   112  C CA  . THR A 1 25  ? 10.103  -20.820 -15.942  1.00 10.17 ? 45   THR A CA  1 
ATOM   113  C C   . THR A 1 25  ? 10.967  -20.045 -16.941  1.00 9.78  ? 45   THR A C   1 
ATOM   114  O O   . THR A 1 25  ? 12.084  -19.634 -16.618  1.00 10.27 ? 45   THR A O   1 
ATOM   115  C CB  . THR A 1 25  ? 10.883  -22.053 -15.450  1.00 10.78 ? 45   THR A CB  1 
ATOM   116  O OG1 . THR A 1 25  ? 11.015  -22.999 -16.517  1.00 11.86 ? 45   THR A OG1 1 
ATOM   117  C CG2 . THR A 1 25  ? 10.155  -22.706 -14.283  1.00 11.23 ? 45   THR A CG2 1 
ATOM   118  N N   . LYS A 1 26  ? 10.454  -19.869 -18.158  1.00 9.58  ? 46   LYS A N   1 
ATOM   119  C CA  . LYS A 1 26  ? 11.084  -19.029 -19.168  1.00 9.64  ? 46   LYS A CA  1 
ATOM   120  C C   . LYS A 1 26  ? 10.002  -18.187 -19.826  1.00 8.83  ? 46   LYS A C   1 
ATOM   121  O O   . LYS A 1 26  ? 8.808   -18.383 -19.577  1.00 8.94  ? 46   LYS A O   1 
ATOM   122  C CB  . LYS A 1 26  ? 11.783  -19.875 -20.236  1.00 10.24 ? 46   LYS A CB  1 
ATOM   123  C CG  . LYS A 1 26  ? 12.757  -20.914 -19.705  1.00 11.34 ? 46   LYS A CG  1 
ATOM   124  C CD  . LYS A 1 26  ? 14.085  -20.304 -19.291  1.00 13.03 ? 46   LYS A CD  1 
ATOM   125  C CE  . LYS A 1 26  ? 15.044  -21.375 -18.792  1.00 14.87 ? 46   LYS A CE  1 
ATOM   126  N NZ  . LYS A 1 26  ? 16.467  -20.940 -18.842  1.00 17.46 ? 46   LYS A NZ  1 
ATOM   127  N N   . ALA A 1 27  ? 10.430  -17.249 -20.665  1.00 8.64  ? 47   ALA A N   1 
ATOM   128  C CA  . ALA A 1 27  ? 9.520   -16.387 -21.418  1.00 8.46  ? 47   ALA A CA  1 
ATOM   129  C C   . ALA A 1 27  ? 8.342   -17.158 -22.015  1.00 7.81  ? 47   ALA A C   1 
ATOM   130  O O   . ALA A 1 27  ? 8.525   -18.223 -22.604  1.00 8.38  ? 47   ALA A O   1 
ATOM   131  C CB  . ALA A 1 27  ? 10.283  -15.683 -22.528  1.00 8.25  ? 47   ALA A CB  1 
ATOM   132  N N   . VAL A 1 28  ? 7.138   -16.619 -21.850  1.00 7.34  ? 48   VAL A N   1 
ATOM   133  C CA  . VAL A 1 28  ? 5.959   -17.162 -22.518  1.00 7.47  ? 48   VAL A CA  1 
ATOM   134  C C   . VAL A 1 28  ? 5.980   -16.642 -23.953  1.00 7.45  ? 48   VAL A C   1 
ATOM   135  O O   . VAL A 1 28  ? 6.391   -15.506 -24.192  1.00 8.11  ? 48   VAL A O   1 
ATOM   136  C CB  . VAL A 1 28  ? 4.655   -16.749 -21.805  1.00 7.84  ? 48   VAL A CB  1 
ATOM   137  C CG1 . VAL A 1 28  ? 3.442   -17.337 -22.514  1.00 7.78  ? 48   VAL A CG1 1 
ATOM   138  C CG2 . VAL A 1 28  ? 4.680   -17.197 -20.350  1.00 8.28  ? 48   VAL A CG2 1 
ATOM   139  N N   . SER A 1 29  ? 5.567   -17.482 -24.902  1.00 7.01  ? 49   SER A N   1 
ATOM   140  C CA  . SER A 1 29  ? 5.554   -17.114 -26.323  1.00 7.00  ? 49   SER A CA  1 
ATOM   141  C C   . SER A 1 29  ? 4.157   -16.860 -26.894  1.00 6.86  ? 49   SER A C   1 
ATOM   142  O O   . SER A 1 29  ? 3.986   -15.986 -27.738  1.00 7.15  ? 49   SER A O   1 
ATOM   143  C CB  . SER A 1 29  ? 6.253   -18.190 -27.157  1.00 6.94  ? 49   SER A CB  1 
ATOM   144  O OG  . SER A 1 29  ? 5.703   -19.473 -26.916  1.00 7.26  ? 49   SER A OG  1 
ATOM   145  N N   . SER A 1 30  ? 3.163   -17.622 -26.451  1.00 6.85  ? 50   SER A N   1 
ATOM   146  C CA  . SER A 1 30  ? 1.833   -17.535 -27.039  1.00 7.15  ? 50   SER A CA  1 
ATOM   147  C C   . SER A 1 30  ? 0.776   -18.060 -26.076  1.00 7.13  ? 50   SER A C   1 
ATOM   148  O O   . SER A 1 30  ? 1.011   -19.044 -25.368  1.00 8.10  ? 50   SER A O   1 
ATOM   149  C CB  . SER A 1 30  ? 1.800   -18.338 -28.342  1.00 7.48  ? 50   SER A CB  1 
ATOM   150  O OG  . SER A 1 30  ? 0.570   -18.180 -29.023  1.00 8.65  ? 50   SER A OG  1 
ATOM   151  N N   . VAL A 1 31  ? -0.375  -17.391 -26.049  1.00 6.99  ? 51   VAL A N   1 
ATOM   152  C CA  . VAL A 1 31  ? -1.544  -17.868 -25.313  1.00 6.98  ? 51   VAL A CA  1 
ATOM   153  C C   . VAL A 1 31  ? -2.759  -17.880 -26.235  1.00 6.86  ? 51   VAL A C   1 
ATOM   154  O O   . VAL A 1 31  ? -2.944  -16.966 -27.040  1.00 6.96  ? 51   VAL A O   1 
ATOM   155  C CB  . VAL A 1 31  ? -1.837  -17.031 -24.047  1.00 6.93  ? 51   VAL A CB  1 
ATOM   156  C CG1 . VAL A 1 31  ? -0.728  -17.224 -23.029  1.00 7.22  ? 51   VAL A CG1 1 
ATOM   157  C CG2 . VAL A 1 31  ? -2.009  -15.552 -24.368  1.00 7.19  ? 51   VAL A CG2 1 
ATOM   158  N N   . LYS A 1 32  ? -3.574  -18.925 -26.122  1.00 7.05  ? 52   LYS A N   1 
ATOM   159  C CA  . LYS A 1 32  ? -4.752  -19.087 -26.972  1.00 6.82  ? 52   LYS A CA  1 
ATOM   160  C C   . LYS A 1 32  ? -5.899  -19.705 -26.186  1.00 6.79  ? 52   LYS A C   1 
ATOM   161  O O   . LYS A 1 32  ? -5.700  -20.685 -25.466  1.00 6.96  ? 52   LYS A O   1 
ATOM   162  C CB  . LYS A 1 32  ? -4.447  -20.009 -28.156  1.00 6.87  ? 52   LYS A CB  1 
ATOM   163  C CG  . LYS A 1 32  ? -3.306  -19.575 -29.063  1.00 7.44  ? 52   LYS A CG  1 
ATOM   164  C CD  . LYS A 1 32  ? -3.673  -18.402 -29.956  1.00 7.78  ? 52   LYS A CD  1 
ATOM   165  C CE  . LYS A 1 32  ? -2.545  -18.073 -30.923  1.00 7.79  ? 52   LYS A CE  1 
ATOM   166  N NZ  . LYS A 1 32  ? -2.334  -19.127 -31.955  1.00 8.39  ? 52   LYS A NZ  1 
ATOM   167  N N   . PHE A 1 33  ? -7.095  -19.140 -26.339  1.00 6.94  ? 53   PHE A N   1 
ATOM   168  C CA  . PHE A 1 33  ? -8.307  -19.724 -25.766  1.00 7.51  ? 53   PHE A CA  1 
ATOM   169  C C   . PHE A 1 33  ? -8.824  -20.842 -26.664  1.00 7.90  ? 53   PHE A C   1 
ATOM   170  O O   . PHE A 1 33  ? -8.808  -20.713 -27.890  1.00 8.14  ? 53   PHE A O   1 
ATOM   171  C CB  . PHE A 1 33  ? -9.412  -18.673 -25.620  1.00 7.76  ? 53   PHE A CB  1 
ATOM   172  C CG  . PHE A 1 33  ? -9.190  -17.701 -24.499  1.00 7.87  ? 53   PHE A CG  1 
ATOM   173  C CD1 . PHE A 1 33  ? -9.326  -18.102 -23.176  1.00 8.08  ? 53   PHE A CD1 1 
ATOM   174  C CD2 . PHE A 1 33  ? -8.866  -16.376 -24.764  1.00 7.97  ? 53   PHE A CD2 1 
ATOM   175  C CE1 . PHE A 1 33  ? -9.128  -17.204 -22.142  1.00 8.03  ? 53   PHE A CE1 1 
ATOM   176  C CE2 . PHE A 1 33  ? -8.672  -15.474 -23.732  1.00 8.19  ? 53   PHE A CE2 1 
ATOM   177  C CZ  . PHE A 1 33  ? -8.803  -15.889 -22.420  1.00 8.03  ? 53   PHE A CZ  1 
ATOM   178  N N   . SER A 1 34  ? -9.301  -21.928 -26.061  1.00 8.39  ? 54   SER A N   1 
ATOM   179  C CA  . SER A 1 34  ? -9.963  -22.977 -26.830  1.00 8.29  ? 54   SER A CA  1 
ATOM   180  C C   . SER A 1 34  ? -11.247 -22.420 -27.446  1.00 8.58  ? 54   SER A C   1 
ATOM   181  O O   . SER A 1 34  ? -11.905 -21.569 -26.841  1.00 8.68  ? 54   SER A O   1 
ATOM   182  C CB  . SER A 1 34  ? -10.281 -24.190 -25.953  1.00 8.35  ? 54   SER A CB  1 
ATOM   183  O OG  . SER A 1 34  ? -11.146 -23.852 -24.885  1.00 8.33  ? 54   SER A OG  1 
ATOM   184  N N   . PRO A 1 35  ? -11.608 -22.884 -28.655  1.00 9.13  ? 55   PRO A N   1 
ATOM   185  C CA  . PRO A 1 35  ? -12.826 -22.378 -29.297  1.00 9.10  ? 55   PRO A CA  1 
ATOM   186  C C   . PRO A 1 35  ? -14.103 -22.496 -28.460  1.00 9.40  ? 55   PRO A C   1 
ATOM   187  O O   . PRO A 1 35  ? -14.990 -21.652 -28.588  1.00 10.38 ? 55   PRO A O   1 
ATOM   188  C CB  . PRO A 1 35  ? -12.931 -23.236 -30.557  1.00 9.28  ? 55   PRO A CB  1 
ATOM   189  C CG  . PRO A 1 35  ? -11.515 -23.532 -30.899  1.00 9.49  ? 55   PRO A CG  1 
ATOM   190  C CD  . PRO A 1 35  ? -10.820 -23.722 -29.579  1.00 9.31  ? 55   PRO A CD  1 
ATOM   191  N N   . ASN A 1 36  ? -14.190 -23.524 -27.616  1.00 9.23  ? 56   ASN A N   1 
ATOM   192  C CA  . ASN A 1 36  ? -15.350 -23.695 -26.734  1.00 9.36  ? 56   ASN A CA  1 
ATOM   193  C C   . ASN A 1 36  ? -15.317 -22.803 -25.485  1.00 9.61  ? 56   ASN A C   1 
ATOM   194  O O   . ASN A 1 36  ? -16.251 -22.832 -24.684  1.00 10.07 ? 56   ASN A O   1 
ATOM   195  C CB  . ASN A 1 36  ? -15.533 -25.172 -26.339  1.00 9.27  ? 56   ASN A CB  1 
ATOM   196  C CG  . ASN A 1 36  ? -14.429 -25.697 -25.431  1.00 9.64  ? 56   ASN A CG  1 
ATOM   197  O OD1 . ASN A 1 36  ? -13.621 -24.938 -24.896  1.00 10.52 ? 56   ASN A OD1 1 
ATOM   198  N ND2 . ASN A 1 36  ? -14.401 -27.012 -25.247  1.00 9.69  ? 56   ASN A ND2 1 
ATOM   199  N N   . GLY A 1 37  ? -14.236 -22.041 -25.314  1.00 9.36  ? 57   GLY A N   1 
ATOM   200  C CA  . GLY A 1 37  ? -14.136 -21.036 -24.257  1.00 9.33  ? 57   GLY A CA  1 
ATOM   201  C C   . GLY A 1 37  ? -13.753 -21.554 -22.881  1.00 9.41  ? 57   GLY A C   1 
ATOM   202  O O   . GLY A 1 37  ? -13.677 -20.777 -21.933  1.00 9.21  ? 57   GLY A O   1 
ATOM   203  N N   . GLU A 1 38  ? -13.502 -22.856 -22.768  1.00 9.20  ? 58   GLU A N   1 
ATOM   204  C CA  . GLU A 1 38  ? -13.282 -23.491 -21.469  1.00 9.82  ? 58   GLU A CA  1 
ATOM   205  C C   . GLU A 1 38  ? -11.840 -23.390 -20.984  1.00 9.23  ? 58   GLU A C   1 
ATOM   206  O O   . GLU A 1 38  ? -11.599 -23.293 -19.780  1.00 9.05  ? 58   GLU A O   1 
ATOM   207  C CB  . GLU A 1 38  ? -13.691 -24.967 -21.533  1.00 10.52 ? 58   GLU A CB  1 
ATOM   208  C CG  . GLU A 1 38  ? -15.184 -25.182 -21.716  1.00 11.78 ? 58   GLU A CG  1 
ATOM   209  C CD  . GLU A 1 38  ? -15.965 -24.969 -20.435  1.00 12.35 ? 58   GLU A CD  1 
ATOM   210  O OE1 . GLU A 1 38  ? -16.076 -25.926 -19.644  1.00 15.07 ? 58   GLU A OE1 1 
ATOM   211  O OE2 . GLU A 1 38  ? -16.474 -23.847 -20.220  1.00 12.54 ? 58   GLU A OE2 1 
ATOM   212  N N   . TRP A 1 39  ? -10.888 -23.414 -21.915  1.00 9.18  ? 59   TRP A N   1 
ATOM   213  C CA  . TRP A 1 39  ? -9.473  -23.547 -21.572  1.00 9.23  ? 59   TRP A CA  1 
ATOM   214  C C   . TRP A 1 39  ? -8.589  -22.472 -22.192  1.00 8.64  ? 59   TRP A C   1 
ATOM   215  O O   . TRP A 1 39  ? -8.925  -21.886 -23.221  1.00 9.10  ? 59   TRP A O   1 
ATOM   216  C CB  . TRP A 1 39  ? -8.964  -24.918 -22.016  1.00 9.87  ? 59   TRP A CB  1 
ATOM   217  C CG  . TRP A 1 39  ? -9.779  -26.042 -21.469  1.00 10.85 ? 59   TRP A CG  1 
ATOM   218  C CD1 . TRP A 1 39  ? -10.723 -26.771 -22.132  1.00 11.17 ? 59   TRP A CD1 1 
ATOM   219  C CD2 . TRP A 1 39  ? -9.742  -26.551 -20.133  1.00 11.73 ? 59   TRP A CD2 1 
ATOM   220  N NE1 . TRP A 1 39  ? -11.268 -27.712 -21.292  1.00 12.22 ? 59   TRP A NE1 1 
ATOM   221  C CE2 . TRP A 1 39  ? -10.682 -27.598 -20.059  1.00 12.04 ? 59   TRP A CE2 1 
ATOM   222  C CE3 . TRP A 1 39  ? -8.997  -26.230 -18.992  1.00 12.42 ? 59   TRP A CE3 1 
ATOM   223  C CZ2 . TRP A 1 39  ? -10.901 -28.326 -18.886  1.00 12.77 ? 59   TRP A CZ2 1 
ATOM   224  C CZ3 . TRP A 1 39  ? -9.214  -26.952 -17.829  1.00 13.27 ? 59   TRP A CZ3 1 
ATOM   225  C CH2 . TRP A 1 39  ? -10.158 -27.989 -17.785  1.00 13.52 ? 59   TRP A CH2 1 
ATOM   226  N N   . LEU A 1 40  ? -7.456  -22.227 -21.542  1.00 8.11  ? 60   LEU A N   1 
ATOM   227  C CA  . LEU A 1 40  ? -6.391  -21.402 -22.096  1.00 7.87  ? 60   LEU A CA  1 
ATOM   228  C C   . LEU A 1 40  ? -5.147  -22.271 -22.224  1.00 7.86  ? 60   LEU A C   1 
ATOM   229  O O   . LEU A 1 40  ? -4.760  -22.948 -21.272  1.00 8.37  ? 60   LEU A O   1 
ATOM   230  C CB  . LEU A 1 40  ? -6.101  -20.202 -21.187  1.00 8.06  ? 60   LEU A CB  1 
ATOM   231  C CG  . LEU A 1 40  ? -5.051  -19.202 -21.696  1.00 8.60  ? 60   LEU A CG  1 
ATOM   232  C CD1 . LEU A 1 40  ? -5.633  -18.316 -22.786  1.00 9.01  ? 60   LEU A CD1 1 
ATOM   233  C CD2 . LEU A 1 40  ? -4.499  -18.355 -20.559  1.00 8.57  ? 60   LEU A CD2 1 
ATOM   234  N N   . ALA A 1 41  ? -4.542  -22.267 -23.408  1.00 7.33  ? 61   ALA A N   1 
ATOM   235  C CA  . ALA A 1 41  ? -3.268  -22.939 -23.637  1.00 7.30  ? 61   ALA A CA  1 
ATOM   236  C C   . ALA A 1 41  ? -2.166  -21.893 -23.719  1.00 7.25  ? 61   ALA A C   1 
ATOM   237  O O   . ALA A 1 41  ? -2.362  -20.833 -24.314  1.00 7.61  ? 61   ALA A O   1 
ATOM   238  C CB  . ALA A 1 41  ? -3.320  -23.755 -24.919  1.00 7.53  ? 61   ALA A CB  1 
ATOM   239  N N   . SER A 1 42  ? -1.021  -22.185 -23.106  1.00 7.13  ? 62   SER A N   1 
ATOM   240  C CA  . SER A 1 42  ? 0.152   -21.323 -23.201  1.00 7.05  ? 62   SER A CA  1 
ATOM   241  C C   . SER A 1 42  ? 1.364   -22.137 -23.628  1.00 6.84  ? 62   SER A C   1 
ATOM   242  O O   . SER A 1 42  ? 1.489   -23.307 -23.265  1.00 6.96  ? 62   SER A O   1 
ATOM   243  C CB  . SER A 1 42  ? 0.427   -20.628 -21.867  1.00 6.96  ? 62   SER A CB  1 
ATOM   244  O OG  . SER A 1 42  ? 0.671   -21.565 -20.834  1.00 7.21  ? 62   SER A OG  1 
ATOM   245  N N   . SER A 1 43  ? 2.235   -21.516 -24.419  1.00 6.84  ? 63   SER A N   1 
ATOM   246  C CA  . SER A 1 43  ? 3.510   -22.112 -24.801  1.00 7.26  ? 63   SER A CA  1 
ATOM   247  C C   . SER A 1 43  ? 4.644   -21.203 -24.356  1.00 7.29  ? 63   SER A C   1 
ATOM   248  O O   . SER A 1 43  ? 4.441   -20.008 -24.135  1.00 7.33  ? 63   SER A O   1 
ATOM   249  C CB  . SER A 1 43  ? 3.574   -22.341 -26.310  1.00 7.27  ? 63   SER A CB  1 
ATOM   250  O OG  . SER A 1 43  ? 3.430   -21.126 -27.025  1.00 7.41  ? 63   SER A OG  1 
ATOM   251  N N   . SER A 1 44  ? 5.840   -21.768 -24.235  1.00 7.66  ? 64   SER A N   1 
ATOM   252  C CA  . SER A 1 44  ? 6.967   -21.042 -23.660  1.00 8.00  ? 64   SER A CA  1 
ATOM   253  C C   . SER A 1 44  ? 8.311   -21.550 -24.165  1.00 8.07  ? 64   SER A C   1 
ATOM   254  O O   . SER A 1 44  ? 8.421   -22.658 -24.699  1.00 8.09  ? 64   SER A O   1 
ATOM   255  C CB  . SER A 1 44  ? 6.889   -21.139 -22.130  1.00 8.16  ? 64   SER A CB  1 
ATOM   256  O OG  . SER A 1 44  ? 8.103   -20.784 -21.490  1.00 8.43  ? 64   SER A OG  1 
ATOM   257  N N   . ALA A 1 45  ? 9.333   -20.718 -23.984  1.00 8.21  ? 65   ALA A N   1 
ATOM   258  C CA  . ALA A 1 45  ? 10.714  -21.106 -24.246  1.00 8.50  ? 65   ALA A CA  1 
ATOM   259  C C   . ALA A 1 45  ? 11.197  -22.219 -23.307  1.00 8.43  ? 65   ALA A C   1 
ATOM   260  O O   . ALA A 1 45  ? 12.223  -22.838 -23.575  1.00 8.90  ? 65   ALA A O   1 
ATOM   261  C CB  . ALA A 1 45  ? 11.628  -19.895 -24.143  1.00 8.44  ? 65   ALA A CB  1 
ATOM   262  N N   . ASP A 1 46  ? 10.466  -22.479 -22.221  1.00 8.34  ? 66   ASP A N   1 
ATOM   263  C CA  . ASP A 1 46  ? 10.781  -23.609 -21.339  1.00 8.58  ? 66   ASP A CA  1 
ATOM   264  C C   . ASP A 1 46  ? 10.396  -24.983 -21.925  1.00 8.29  ? 66   ASP A C   1 
ATOM   265  O O   . ASP A 1 46  ? 10.513  -25.999 -21.241  1.00 8.76  ? 66   ASP A O   1 
ATOM   266  C CB  . ASP A 1 46  ? 10.167  -23.411 -19.939  1.00 9.00  ? 66   ASP A CB  1 
ATOM   267  C CG  . ASP A 1 46  ? 8.645   -23.495 -19.928  1.00 9.25  ? 66   ASP A CG  1 
ATOM   268  O OD1 . ASP A 1 46  ? 8.037   -23.871 -20.950  1.00 9.71  ? 66   ASP A OD1 1 
ATOM   269  O OD2 . ASP A 1 46  ? 8.047   -23.174 -18.878  1.00 10.63 ? 66   ASP A OD2 1 
ATOM   270  N N   . LYS A 1 47  ? 9.944   -25.005 -23.184  1.00 8.55  ? 67   LYS A N   1 
ATOM   271  C CA  . LYS A 1 47  ? 9.642   -26.241 -23.929  1.00 9.01  ? 67   LYS A CA  1 
ATOM   272  C C   . LYS A 1 47  ? 8.313   -26.886 -23.524  1.00 8.82  ? 67   LYS A C   1 
ATOM   273  O O   . LYS A 1 47  ? 8.009   -27.999 -23.957  1.00 9.08  ? 67   LYS A O   1 
ATOM   274  C CB  . LYS A 1 47  ? 10.777  -27.272 -23.814  1.00 9.39  ? 67   LYS A CB  1 
ATOM   275  C CG  . LYS A 1 47  ? 12.180  -26.719 -24.029  1.00 9.60  ? 67   LYS A CG  1 
ATOM   276  C CD  . LYS A 1 47  ? 13.222  -27.826 -24.075  1.00 10.51 ? 67   LYS A CD  1 
ATOM   277  C CE  . LYS A 1 47  ? 13.394  -28.493 -22.718  1.00 11.40 ? 67   LYS A CE  1 
ATOM   278  N NZ  . LYS A 1 47  ? 14.502  -29.486 -22.704  1.00 13.17 ? 67   LYS A NZ  1 
ATOM   279  N N   . LEU A 1 48  ? 7.514   -26.184 -22.724  1.00 8.38  ? 68   LEU A N   1 
ATOM   280  C CA  . LEU A 1 48  ? 6.281   -26.743 -22.183  1.00 8.26  ? 68   LEU A CA  1 
ATOM   281  C C   . LEU A 1 48  ? 5.046   -26.037 -22.726  1.00 8.20  ? 68   LEU A C   1 
ATOM   282  O O   . LEU A 1 48  ? 5.086   -24.854 -23.086  1.00 7.84  ? 68   LEU A O   1 
ATOM   283  C CB  . LEU A 1 48  ? 6.282   -26.653 -20.653  1.00 8.87  ? 68   LEU A CB  1 
ATOM   284  C CG  . LEU A 1 48  ? 7.485   -27.250 -19.920  1.00 8.90  ? 68   LEU A CG  1 
ATOM   285  C CD1 . LEU A 1 48  ? 7.366   -27.021 -18.421  1.00 9.85  ? 68   LEU A CD1 1 
ATOM   286  C CD2 . LEU A 1 48  ? 7.634   -28.737 -20.219  1.00 8.70  ? 68   LEU A CD2 1 
ATOM   287  N N   . ILE A 1 49  ? 3.954   -26.791 -22.787  1.00 8.03  ? 69   ILE A N   1 
ATOM   288  C CA  . ILE A 1 49  ? 2.625   -26.247 -23.004  1.00 7.93  ? 69   ILE A CA  1 
ATOM   289  C C   . ILE A 1 49  ? 1.893   -26.415 -21.683  1.00 7.73  ? 69   ILE A C   1 
ATOM   290  O O   . ILE A 1 49  ? 1.961   -27.480 -21.074  1.00 7.98  ? 69   ILE A O   1 
ATOM   291  C CB  . ILE A 1 49  ? 1.868   -27.007 -24.113  1.00 8.34  ? 69   ILE A CB  1 
ATOM   292  C CG1 . ILE A 1 49  ? 2.520   -26.752 -25.476  1.00 8.59  ? 69   ILE A CG1 1 
ATOM   293  C CG2 . ILE A 1 49  ? 0.398   -26.599 -24.153  1.00 8.59  ? 69   ILE A CG2 1 
ATOM   294  C CD1 . ILE A 1 49  ? 2.225   -27.824 -26.502  1.00 8.94  ? 69   ILE A CD1 1 
ATOM   295  N N   . LYS A 1 50  ? 1.209   -25.371 -21.231  1.00 7.34  ? 70   LYS A N   1 
ATOM   296  C CA  . LYS A 1 50  ? 0.401   -25.470 -20.023  1.00 7.27  ? 70   LYS A CA  1 
ATOM   297  C C   . LYS A 1 50  ? -1.047  -25.134 -20.330  1.00 7.26  ? 70   LYS A C   1 
ATOM   298  O O   . LYS A 1 50  ? -1.332  -24.279 -21.169  1.00 7.59  ? 70   LYS A O   1 
ATOM   299  C CB  . LYS A 1 50  ? 0.955   -24.577 -18.912  1.00 7.63  ? 70   LYS A CB  1 
ATOM   300  C CG  . LYS A 1 50  ? 2.252   -25.105 -18.325  1.00 8.32  ? 70   LYS A CG  1 
ATOM   301  C CD  . LYS A 1 50  ? 2.830   -24.176 -17.275  1.00 8.59  ? 70   LYS A CD  1 
ATOM   302  C CE  . LYS A 1 50  ? 4.128   -24.730 -16.713  1.00 8.96  ? 70   LYS A CE  1 
ATOM   303  N NZ  . LYS A 1 50  ? 3.917   -25.915 -15.837  1.00 9.85  ? 70   LYS A NZ  1 
ATOM   304  N N   . ILE A 1 51  ? -1.947  -25.838 -19.650  1.00 7.02  ? 71   ILE A N   1 
ATOM   305  C CA  . ILE A 1 51  ? -3.382  -25.687 -19.832  1.00 7.21  ? 71   ILE A CA  1 
ATOM   306  C C   . ILE A 1 51  ? -3.961  -25.116 -18.547  1.00 7.21  ? 71   ILE A C   1 
ATOM   307  O O   . ILE A 1 51  ? -3.657  -25.604 -17.457  1.00 7.19  ? 71   ILE A O   1 
ATOM   308  C CB  . ILE A 1 51  ? -4.053  -27.044 -20.142  1.00 7.52  ? 71   ILE A CB  1 
ATOM   309  C CG1 . ILE A 1 51  ? -3.344  -27.762 -21.302  1.00 7.82  ? 71   ILE A CG1 1 
ATOM   310  C CG2 . ILE A 1 51  ? -5.533  -26.859 -20.448  1.00 7.60  ? 71   ILE A CG2 1 
ATOM   311  C CD1 . ILE A 1 51  ? -3.353  -27.010 -22.620  1.00 7.91  ? 71   ILE A CD1 1 
ATOM   312  N N   . TRP A 1 52  ? -4.781  -24.078 -18.687  1.00 7.33  ? 72   TRP A N   1 
ATOM   313  C CA  . TRP A 1 52  ? -5.365  -23.365 -17.555  1.00 7.33  ? 72   TRP A CA  1 
ATOM   314  C C   . TRP A 1 52  ? -6.861  -23.187 -17.792  1.00 7.42  ? 72   TRP A C   1 
ATOM   315  O O   . TRP A 1 52  ? -7.315  -23.179 -18.937  1.00 7.98  ? 72   TRP A O   1 
ATOM   316  C CB  . TRP A 1 52  ? -4.724  -21.980 -17.391  1.00 7.42  ? 72   TRP A CB  1 
ATOM   317  C CG  . TRP A 1 52  ? -3.237  -21.906 -17.631  1.00 7.39  ? 72   TRP A CG  1 
ATOM   318  C CD1 . TRP A 1 52  ? -2.595  -21.935 -18.839  1.00 7.11  ? 72   TRP A CD1 1 
ATOM   319  C CD2 . TRP A 1 52  ? -2.213  -21.739 -16.642  1.00 7.40  ? 72   TRP A CD2 1 
ATOM   320  N NE1 . TRP A 1 52  ? -1.239  -21.822 -18.661  1.00 7.33  ? 72   TRP A NE1 1 
ATOM   321  C CE2 . TRP A 1 52  ? -0.976  -21.698 -17.323  1.00 7.27  ? 72   TRP A CE2 1 
ATOM   322  C CE3 . TRP A 1 52  ? -2.218  -21.631 -15.245  1.00 7.83  ? 72   TRP A CE3 1 
ATOM   323  C CZ2 . TRP A 1 52  ? 0.243   -21.552 -16.656  1.00 7.80  ? 72   TRP A CZ2 1 
ATOM   324  C CZ3 . TRP A 1 52  ? -1.007  -21.488 -14.583  1.00 7.90  ? 72   TRP A CZ3 1 
ATOM   325  C CH2 . TRP A 1 52  ? 0.206   -21.449 -15.289  1.00 7.95  ? 72   TRP A CH2 1 
ATOM   326  N N   . GLY A 1 53  ? -7.621  -23.028 -16.712  1.00 7.49  ? 73   GLY A N   1 
ATOM   327  C CA  . GLY A 1 53  ? -9.038  -22.694 -16.815  1.00 7.63  ? 73   GLY A CA  1 
ATOM   328  C C   . GLY A 1 53  ? -9.193  -21.284 -17.357  1.00 8.02  ? 73   GLY A C   1 
ATOM   329  O O   . GLY A 1 53  ? -8.577  -20.353 -16.846  1.00 8.88  ? 73   GLY A O   1 
ATOM   330  N N   . ALA A 1 54  ? -10.014 -21.125 -18.391  1.00 8.20  ? 74   ALA A N   1 
ATOM   331  C CA  . ALA A 1 54  ? -10.157 -19.834 -19.071  1.00 8.72  ? 74   ALA A CA  1 
ATOM   332  C C   . ALA A 1 54  ? -10.822 -18.756 -18.213  1.00 9.32  ? 74   ALA A C   1 
ATOM   333  O O   . ALA A 1 54  ? -10.576 -17.565 -18.416  1.00 9.89  ? 74   ALA A O   1 
ATOM   334  C CB  . ALA A 1 54  ? -10.934 -20.011 -20.367  1.00 8.89  ? 74   ALA A CB  1 
ATOM   335  N N   . TYR A 1 55  ? -11.666 -19.169 -17.270  1.00 10.28 ? 75   TYR A N   1 
ATOM   336  C CA  . TYR A 1 55  ? -12.439 -18.230 -16.451  1.00 11.22 ? 75   TYR A CA  1 
ATOM   337  C C   . TYR A 1 55  ? -11.809 -17.935 -15.090  1.00 12.45 ? 75   TYR A C   1 
ATOM   338  O O   . TYR A 1 55  ? -11.913 -16.812 -14.599  1.00 14.19 ? 75   TYR A O   1 
ATOM   339  C CB  . TYR A 1 55  ? -13.868 -18.748 -16.269  1.00 11.14 ? 75   TYR A CB  1 
ATOM   340  C CG  . TYR A 1 55  ? -14.584 -18.956 -17.583  1.00 10.69 ? 75   TYR A CG  1 
ATOM   341  C CD1 . TYR A 1 55  ? -14.954 -17.871 -18.372  1.00 10.68 ? 75   TYR A CD1 1 
ATOM   342  C CD2 . TYR A 1 55  ? -14.875 -20.235 -18.049  1.00 10.66 ? 75   TYR A CD2 1 
ATOM   343  C CE1 . TYR A 1 55  ? -15.601 -18.053 -19.583  1.00 10.74 ? 75   TYR A CE1 1 
ATOM   344  C CE2 . TYR A 1 55  ? -15.525 -20.427 -19.258  1.00 10.96 ? 75   TYR A CE2 1 
ATOM   345  C CZ  . TYR A 1 55  ? -15.884 -19.331 -20.022  1.00 10.53 ? 75   TYR A CZ  1 
ATOM   346  O OH  . TYR A 1 55  ? -16.528 -19.509 -21.226  1.00 11.48 ? 75   TYR A OH  1 
ATOM   347  N N   . ASP A 1 56  ? -11.170 -18.936 -14.487  1.00 13.15 ? 76   ASP A N   1 
ATOM   348  C CA  . ASP A 1 56  ? -10.546 -18.778 -13.165  1.00 13.20 ? 76   ASP A CA  1 
ATOM   349  C C   . ASP A 1 56  ? -9.014  -18.865 -13.168  1.00 12.29 ? 76   ASP A C   1 
ATOM   350  O O   . ASP A 1 56  ? -8.386  -18.697 -12.121  1.00 12.97 ? 76   ASP A O   1 
ATOM   351  C CB  . ASP A 1 56  ? -11.130 -19.794 -12.169  1.00 14.30 ? 76   ASP A CB  1 
ATOM   352  C CG  . ASP A 1 56  ? -10.892 -21.244 -12.577  1.00 14.98 ? 76   ASP A CG  1 
ATOM   353  O OD1 . ASP A 1 56  ? -10.059 -21.507 -13.471  1.00 14.41 ? 76   ASP A OD1 1 
ATOM   354  O OD2 . ASP A 1 56  ? -11.546 -22.131 -11.990  1.00 17.81 ? 76   ASP A OD2 1 
ATOM   355  N N   . GLY A 1 57  ? -8.414  -19.138 -14.327  1.00 11.42 ? 77   GLY A N   1 
ATOM   356  C CA  . GLY A 1 57  ? -6.961  -19.241 -14.435  1.00 10.67 ? 77   GLY A CA  1 
ATOM   357  C C   . GLY A 1 57  ? -6.341  -20.418 -13.698  1.00 10.54 ? 77   GLY A C   1 
ATOM   358  O O   . GLY A 1 57  ? -5.122  -20.476 -13.543  1.00 10.91 ? 77   GLY A O   1 
ATOM   359  N N   . LYS A 1 58  ? -7.163  -21.370 -13.260  1.00 10.71 ? 78   LYS A N   1 
ATOM   360  C CA  . LYS A 1 58  ? -6.662  -22.492 -12.473  1.00 11.03 ? 78   LYS A CA  1 
ATOM   361  C C   . LYS A 1 58  ? -5.809  -23.405 -13.345  1.00 10.48 ? 78   LYS A C   1 
ATOM   362  O O   . LYS A 1 58  ? -6.255  -23.864 -14.394  1.00 10.66 ? 78   LYS A O   1 
ATOM   363  C CB  . LYS A 1 58  ? -7.815  -23.287 -11.859  1.00 12.04 ? 78   LYS A CB  1 
ATOM   364  C CG  . LYS A 1 58  ? -7.360  -24.306 -10.828  1.00 13.99 ? 78   LYS A CG  1 
ATOM   365  C CD  . LYS A 1 58  ? -8.519  -25.134 -10.304  1.00 16.00 ? 78   LYS A CD  1 
ATOM   366  C CE  . LYS A 1 58  ? -8.084  -26.046 -9.167   1.00 17.22 ? 78   LYS A CE  1 
ATOM   367  N NZ  . LYS A 1 58  ? -7.043  -27.030 -9.581   1.00 17.41 ? 78   LYS A NZ  1 
ATOM   368  N N   . PHE A 1 59  ? -4.577  -23.654 -12.911  1.00 9.93  ? 79   PHE A N   1 
ATOM   369  C CA  . PHE A 1 59  ? -3.681  -24.555 -13.629  1.00 9.99  ? 79   PHE A CA  1 
ATOM   370  C C   . PHE A 1 59  ? -4.282  -25.954 -13.717  1.00 10.06 ? 79   PHE A C   1 
ATOM   371  O O   . PHE A 1 59  ? -4.749  -26.492 -12.712  1.00 10.39 ? 79   PHE A O   1 
ATOM   372  C CB  . PHE A 1 59  ? -2.316  -24.629 -12.940  1.00 9.91  ? 79   PHE A CB  1 
ATOM   373  C CG  . PHE A 1 59  ? -1.427  -25.705 -13.492  1.00 10.02 ? 79   PHE A CG  1 
ATOM   374  C CD1 . PHE A 1 59  ? -0.747  -25.513 -14.686  1.00 10.31 ? 79   PHE A CD1 1 
ATOM   375  C CD2 . PHE A 1 59  ? -1.288  -26.921 -12.832  1.00 10.29 ? 79   PHE A CD2 1 
ATOM   376  C CE1 . PHE A 1 59  ? 0.063   -26.508 -15.209  1.00 10.48 ? 79   PHE A CE1 1 
ATOM   377  C CE2 . PHE A 1 59  ? -0.477  -27.918 -13.350  1.00 10.51 ? 79   PHE A CE2 1 
ATOM   378  C CZ  . PHE A 1 59  ? 0.200   -27.711 -14.538  1.00 10.54 ? 79   PHE A CZ  1 
ATOM   379  N N   . GLU A 1 60  ? -4.270  -26.534 -14.916  1.00 10.12 ? 80   GLU A N   1 
ATOM   380  C CA  . GLU A 1 60  ? -4.803  -27.879 -15.125  1.00 9.98  ? 80   GLU A CA  1 
ATOM   381  C C   . GLU A 1 60  ? -3.704  -28.918 -15.320  1.00 10.07 ? 80   GLU A C   1 
ATOM   382  O O   . GLU A 1 60  ? -3.623  -29.883 -14.554  1.00 11.08 ? 80   GLU A O   1 
ATOM   383  C CB  . GLU A 1 60  ? -5.775  -27.909 -16.311  1.00 10.03 ? 80   GLU A CB  1 
ATOM   384  C CG  . GLU A 1 60  ? -6.586  -29.198 -16.409  1.00 10.89 ? 80   GLU A CG  1 
ATOM   385  C CD  . GLU A 1 60  ? -7.404  -29.479 -15.159  1.00 11.21 ? 80   GLU A CD  1 
ATOM   386  O OE1 . GLU A 1 60  ? -7.928  -28.518 -14.562  1.00 11.94 ? 80   GLU A OE1 1 
ATOM   387  O OE2 . GLU A 1 60  ? -7.516  -30.658 -14.760  1.00 11.32 ? 80   GLU A OE2 1 
ATOM   388  N N   . LYS A 1 61  ? -2.872  -28.733 -16.344  1.00 9.84  ? 81   LYS A N   1 
ATOM   389  C CA  . LYS A 1 61  ? -1.830  -29.708 -16.674  1.00 9.64  ? 81   LYS A CA  1 
ATOM   390  C C   . LYS A 1 61  ? -0.697  -29.130 -17.522  1.00 9.24  ? 81   LYS A C   1 
ATOM   391  O O   . LYS A 1 61  ? -0.849  -28.085 -18.165  1.00 8.93  ? 81   LYS A O   1 
ATOM   392  C CB  . LYS A 1 61  ? -2.438  -30.916 -17.400  1.00 9.61  ? 81   LYS A CB  1 
ATOM   393  C CG  . LYS A 1 61  ? -2.962  -30.610 -18.797  1.00 10.10 ? 81   LYS A CG  1 
ATOM   394  C CD  . LYS A 1 61  ? -3.462  -31.858 -19.512  1.00 10.46 ? 81   LYS A CD  1 
ATOM   395  C CE  . LYS A 1 61  ? -4.799  -32.332 -18.969  1.00 10.93 ? 81   LYS A CE  1 
ATOM   396  N NZ  . LYS A 1 61  ? -5.363  -33.421 -19.814  1.00 11.40 ? 81   LYS A NZ  1 
ATOM   397  N N   . THR A 1 62  ? 0.433   -29.834 -17.506  1.00 9.22  ? 82   THR A N   1 
ATOM   398  C CA  . THR A 1 62  ? 1.594   -29.518 -18.332  1.00 9.03  ? 82   THR A CA  1 
ATOM   399  C C   . THR A 1 62  ? 1.764   -30.594 -19.400  1.00 9.27  ? 82   THR A C   1 
ATOM   400  O O   . THR A 1 62  ? 1.644   -31.788 -19.116  1.00 10.40 ? 82   THR A O   1 
ATOM   401  C CB  . THR A 1 62  ? 2.880   -29.451 -17.483  1.00 9.47  ? 82   THR A CB  1 
ATOM   402  O OG1 . THR A 1 62  ? 2.747   -28.415 -16.504  1.00 10.51 ? 82   THR A OG1 1 
ATOM   403  C CG2 . THR A 1 62  ? 4.104   -29.167 -18.349  1.00 9.33  ? 82   THR A CG2 1 
ATOM   404  N N   . ILE A 1 63  ? 2.049   -30.158 -20.623  1.00 9.29  ? 83   ILE A N   1 
ATOM   405  C CA  . ILE A 1 63  ? 2.271   -31.055 -21.752  1.00 9.00  ? 83   ILE A CA  1 
ATOM   406  C C   . ILE A 1 63  ? 3.687   -30.810 -22.270  1.00 9.30  ? 83   ILE A C   1 
ATOM   407  O O   . ILE A 1 63  ? 4.064   -29.668 -22.526  1.00 10.26 ? 83   ILE A O   1 
ATOM   408  C CB  . ILE A 1 63  ? 1.222   -30.809 -22.855  1.00 9.12  ? 83   ILE A CB  1 
ATOM   409  C CG1 . ILE A 1 63  ? -0.173  -31.178 -22.334  1.00 9.07  ? 83   ILE A CG1 1 
ATOM   410  C CG2 . ILE A 1 63  ? 1.547   -31.609 -24.108  1.00 8.56  ? 83   ILE A CG2 1 
ATOM   411  C CD1 . ILE A 1 63  ? -1.318  -30.758 -23.233  1.00 9.88  ? 83   ILE A CD1 1 
ATOM   412  N N   . SER A 1 64  ? 4.465   -31.881 -22.417  1.00 9.32  ? 84   SER A N   1 
ATOM   413  C CA  . SER A 1 64  ? 5.878   -31.772 -22.794  1.00 9.46  ? 84   SER A CA  1 
ATOM   414  C C   . SER A 1 64  ? 6.258   -32.781 -23.870  1.00 9.53  ? 84   SER A C   1 
ATOM   415  O O   . SER A 1 64  ? 5.562   -33.775 -24.078  1.00 9.99  ? 84   SER A O   1 
ATOM   416  C CB  . SER A 1 64  ? 6.771   -31.979 -21.570  1.00 10.37 ? 84   SER A CB  1 
ATOM   417  O OG  . SER A 1 64  ? 6.701   -33.316 -21.111  1.00 11.39 ? 84   SER A OG  1 
ATOM   418  N N   . GLY A 1 65  ? 7.377   -32.520 -24.539  1.00 9.53  ? 85   GLY A N   1 
ATOM   419  C CA  . GLY A 1 65  ? 7.861   -33.395 -25.607  1.00 9.89  ? 85   GLY A CA  1 
ATOM   420  C C   . GLY A 1 65  ? 8.838   -32.753 -26.576  1.00 10.24 ? 85   GLY A C   1 
ATOM   421  O O   . GLY A 1 65  ? 9.750   -33.420 -27.062  1.00 11.45 ? 85   GLY A O   1 
ATOM   422  N N   . HIS A 1 66  ? 8.647   -31.470 -26.878  1.00 9.92  ? 86   HIS A N   1 
ATOM   423  C CA  . HIS A 1 66  ? 9.569   -30.758 -27.762  1.00 9.70  ? 86   HIS A CA  1 
ATOM   424  C C   . HIS A 1 66  ? 10.988  -30.749 -27.188  1.00 9.72  ? 86   HIS A C   1 
ATOM   425  O O   . HIS A 1 66  ? 11.175  -30.711 -25.969  1.00 9.85  ? 86   HIS A O   1 
ATOM   426  C CB  . HIS A 1 66  ? 9.105   -29.318 -28.008  1.00 9.09  ? 86   HIS A CB  1 
ATOM   427  C CG  . HIS A 1 66  ? 8.098   -29.182 -29.107  1.00 8.63  ? 86   HIS A CG  1 
ATOM   428  N ND1 . HIS A 1 66  ? 8.392   -29.470 -30.423  1.00 8.49  ? 86   HIS A ND1 1 
ATOM   429  C CD2 . HIS A 1 66  ? 6.809   -28.769 -29.091  1.00 8.40  ? 86   HIS A CD2 1 
ATOM   430  C CE1 . HIS A 1 66  ? 7.325   -29.250 -31.168  1.00 8.37  ? 86   HIS A CE1 1 
ATOM   431  N NE2 . HIS A 1 66  ? 6.351   -28.822 -30.385  1.00 8.73  ? 86   HIS A NE2 1 
ATOM   432  N N   . LYS A 1 67  ? 11.978  -30.791 -28.077  1.00 10.02 ? 87   LYS A N   1 
ATOM   433  C CA  . LYS A 1 67  ? 13.387  -30.822 -27.677  1.00 10.61 ? 87   LYS A CA  1 
ATOM   434  C C   . LYS A 1 67  ? 13.966  -29.426 -27.462  1.00 9.94  ? 87   LYS A C   1 
ATOM   435  O O   . LYS A 1 67  ? 14.958  -29.275 -26.752  1.00 10.80 ? 87   LYS A O   1 
ATOM   436  C CB  . LYS A 1 67  ? 14.228  -31.580 -28.711  1.00 11.53 ? 87   LYS A CB  1 
ATOM   437  C CG  . LYS A 1 67  ? 13.792  -33.018 -28.965  1.00 13.31 ? 87   LYS A CG  1 
ATOM   438  C CD  . LYS A 1 67  ? 14.396  -34.010 -27.977  1.00 14.89 ? 87   LYS A CD  1 
ATOM   439  C CE  . LYS A 1 67  ? 13.932  -33.778 -26.547  1.00 16.24 ? 87   LYS A CE  1 
ATOM   440  N NZ  . LYS A 1 67  ? 14.140  -34.964 -25.675  1.00 18.08 ? 87   LYS A NZ  1 
ATOM   441  N N   . LEU A 1 68  ? 13.360  -28.420 -28.091  1.00 9.73  ? 88   LEU A N   1 
ATOM   442  C CA  . LEU A 1 68  ? 13.695  -27.018 -27.844  1.00 9.11  ? 88   LEU A CA  1 
ATOM   443  C C   . LEU A 1 68  ? 12.409  -26.256 -27.526  1.00 8.95  ? 88   LEU A C   1 
ATOM   444  O O   . LEU A 1 68  ? 11.329  -26.851 -27.461  1.00 9.11  ? 88   LEU A O   1 
ATOM   445  C CB  . LEU A 1 68  ? 14.433  -26.411 -29.045  1.00 9.48  ? 88   LEU A CB  1 
ATOM   446  C CG  . LEU A 1 68  ? 15.783  -27.054 -29.387  1.00 10.20 ? 88   LEU A CG  1 
ATOM   447  C CD1 . LEU A 1 68  ? 16.330  -26.493 -30.688  1.00 11.01 ? 88   LEU A CD1 1 
ATOM   448  C CD2 . LEU A 1 68  ? 16.803  -26.874 -28.272  1.00 10.57 ? 88   LEU A CD2 1 
ATOM   449  N N   . GLY A 1 69  ? 12.524  -24.950 -27.294  1.00 8.63  ? 89   GLY A N   1 
ATOM   450  C CA  . GLY A 1 69  ? 11.380  -24.142 -26.879  1.00 8.25  ? 89   GLY A CA  1 
ATOM   451  C C   . GLY A 1 69  ? 10.340  -23.954 -27.965  1.00 7.97  ? 89   GLY A C   1 
ATOM   452  O O   . GLY A 1 69  ? 10.577  -24.268 -29.133  1.00 8.49  ? 89   GLY A O   1 
ATOM   453  N N   . ILE A 1 70  ? 9.191   -23.419 -27.561  1.00 6.85  ? 90   ILE A N   1 
ATOM   454  C CA  . ILE A 1 70  ? 8.015   -23.322 -28.421  1.00 6.54  ? 90   ILE A CA  1 
ATOM   455  C C   . ILE A 1 70  ? 7.673   -21.854 -28.653  1.00 6.72  ? 90   ILE A C   1 
ATOM   456  O O   . ILE A 1 70  ? 7.639   -21.067 -27.706  1.00 6.63  ? 90   ILE A O   1 
ATOM   457  C CB  . ILE A 1 70  ? 6.804   -24.036 -27.783  1.00 6.65  ? 90   ILE A CB  1 
ATOM   458  C CG1 . ILE A 1 70  ? 7.137   -25.504 -27.498  1.00 6.62  ? 90   ILE A CG1 1 
ATOM   459  C CG2 . ILE A 1 70  ? 5.584   -23.970 -28.694  1.00 6.76  ? 90   ILE A CG2 1 
ATOM   460  C CD1 . ILE A 1 70  ? 6.191   -26.168 -26.524  1.00 7.04  ? 90   ILE A CD1 1 
ATOM   461  N N   . SER A 1 71  ? 7.406   -21.499 -29.910  1.00 6.65  ? 91   SER A N   1 
ATOM   462  C CA  . SER A 1 71  ? 7.074   -20.120 -30.284  1.00 6.76  ? 91   SER A CA  1 
ATOM   463  C C   . SER A 1 71  ? 5.579   -19.876 -30.473  1.00 6.82  ? 91   SER A C   1 
ATOM   464  O O   . SER A 1 71  ? 5.137   -18.729 -30.464  1.00 7.78  ? 91   SER A O   1 
ATOM   465  C CB  . SER A 1 71  ? 7.800   -19.727 -31.574  1.00 6.63  ? 91   SER A CB  1 
ATOM   466  O OG  . SER A 1 71  ? 9.180   -19.523 -31.337  1.00 7.23  ? 91   SER A OG  1 
ATOM   467  N N   . ASP A 1 72  ? 4.800   -20.935 -30.676  1.00 6.61  ? 92   ASP A N   1 
ATOM   468  C CA  . ASP A 1 72  ? 3.373   -20.772 -30.931  1.00 6.44  ? 92   ASP A CA  1 
ATOM   469  C C   . ASP A 1 72  ? 2.619   -22.054 -30.631  1.00 6.56  ? 92   ASP A C   1 
ATOM   470  O O   . ASP A 1 72  ? 3.188   -23.146 -30.675  1.00 6.70  ? 92   ASP A O   1 
ATOM   471  C CB  . ASP A 1 72  ? 3.160   -20.358 -32.394  1.00 6.78  ? 92   ASP A CB  1 
ATOM   472  C CG  . ASP A 1 72  ? 1.799   -19.727 -32.651  1.00 6.73  ? 92   ASP A CG  1 
ATOM   473  O OD1 . ASP A 1 72  ? 1.050   -19.432 -31.694  1.00 6.69  ? 92   ASP A OD1 1 
ATOM   474  O OD2 . ASP A 1 72  ? 1.486   -19.506 -33.842  1.00 7.45  ? 92   ASP A OD2 1 
ATOM   475  N N   . VAL A 1 73  ? 1.341   -21.898 -30.310  1.00 6.84  ? 93   VAL A N   1 
ATOM   476  C CA  . VAL A 1 73  ? 0.440   -23.013 -30.080  1.00 7.06  ? 93   VAL A CA  1 
ATOM   477  C C   . VAL A 1 73  ? -0.939  -22.612 -30.615  1.00 7.18  ? 93   VAL A C   1 
ATOM   478  O O   . VAL A 1 73  ? -1.255  -21.422 -30.674  1.00 7.83  ? 93   VAL A O   1 
ATOM   479  C CB  . VAL A 1 73  ? 0.409   -23.391 -28.582  1.00 7.49  ? 93   VAL A CB  1 
ATOM   480  C CG1 . VAL A 1 73  ? -0.213  -22.280 -27.746  1.00 7.80  ? 93   VAL A CG1 1 
ATOM   481  C CG2 . VAL A 1 73  ? -0.306  -24.712 -28.362  1.00 8.41  ? 93   VAL A CG2 1 
ATOM   482  N N   . ALA A 1 74  ? -1.737  -23.592 -31.033  1.00 6.86  ? 94   ALA A N   1 
ATOM   483  C CA  . ALA A 1 74  ? -3.049  -23.325 -31.631  1.00 6.87  ? 94   ALA A CA  1 
ATOM   484  C C   . ALA A 1 74  ? -4.015  -24.498 -31.456  1.00 6.94  ? 94   ALA A C   1 
ATOM   485  O O   . ALA A 1 74  ? -3.606  -25.658 -31.495  1.00 7.15  ? 94   ALA A O   1 
ATOM   486  C CB  . ALA A 1 74  ? -2.890  -22.993 -33.105  1.00 7.20  ? 94   ALA A CB  1 
ATOM   487  N N   . TRP A 1 75  ? -5.296  -24.176 -31.280  1.00 7.15  ? 95   TRP A N   1 
ATOM   488  C CA  . TRP A 1 75  ? -6.341  -25.169 -31.006  1.00 7.42  ? 95   TRP A CA  1 
ATOM   489  C C   . TRP A 1 75  ? -7.063  -25.633 -32.262  1.00 7.63  ? 95   TRP A C   1 
ATOM   490  O O   . TRP A 1 75  ? -7.297  -24.847 -33.176  1.00 8.39  ? 95   TRP A O   1 
ATOM   491  C CB  . TRP A 1 75  ? -7.420  -24.574 -30.103  1.00 6.97  ? 95   TRP A CB  1 
ATOM   492  C CG  . TRP A 1 75  ? -7.023  -24.287 -28.699  1.00 7.44  ? 95   TRP A CG  1 
ATOM   493  C CD1 . TRP A 1 75  ? -6.532  -23.112 -28.212  1.00 7.33  ? 95   TRP A CD1 1 
ATOM   494  C CD2 . TRP A 1 75  ? -7.144  -25.169 -27.579  1.00 7.48  ? 95   TRP A CD2 1 
ATOM   495  N NE1 . TRP A 1 75  ? -6.313  -23.216 -26.860  1.00 7.55  ? 95   TRP A NE1 1 
ATOM   496  C CE2 . TRP A 1 75  ? -6.682  -24.468 -26.445  1.00 7.42  ? 95   TRP A CE2 1 
ATOM   497  C CE3 . TRP A 1 75  ? -7.582  -26.490 -27.426  1.00 7.65  ? 95   TRP A CE3 1 
ATOM   498  C CZ2 . TRP A 1 75  ? -6.649  -25.044 -25.173  1.00 7.39  ? 95   TRP A CZ2 1 
ATOM   499  C CZ3 . TRP A 1 75  ? -7.552  -27.061 -26.160  1.00 7.81  ? 95   TRP A CZ3 1 
ATOM   500  C CH2 . TRP A 1 75  ? -7.085  -26.337 -25.051  1.00 7.69  ? 95   TRP A CH2 1 
ATOM   501  N N   . SER A 1 76  ? -7.466  -26.901 -32.280  1.00 7.67  ? 96   SER A N   1 
ATOM   502  C CA  . SER A 1 76  ? -8.414  -27.371 -33.291  1.00 8.37  ? 96   SER A CA  1 
ATOM   503  C C   . SER A 1 76  ? -9.813  -26.857 -32.953  1.00 8.76  ? 96   SER A C   1 
ATOM   504  O O   . SER A 1 76  ? -10.084 -26.462 -31.816  1.00 8.86  ? 96   SER A O   1 
ATOM   505  C CB  . SER A 1 76  ? -8.416  -28.895 -33.373  1.00 9.07  ? 96   SER A CB  1 
ATOM   506  O OG  . SER A 1 76  ? -8.831  -29.469 -32.149  1.00 10.59 ? 96   SER A OG  1 
ATOM   507  N N   . SER A 1 77  ? -10.702 -26.887 -33.943  1.00 9.32  ? 97   SER A N   1 
ATOM   508  C CA  A SER A 1 77  ? -12.044 -26.318 -33.805  0.50 9.42  ? 97   SER A CA  1 
ATOM   509  C CA  B SER A 1 77  ? -12.045 -26.319 -33.804  0.50 7.66  ? 97   SER A CA  1 
ATOM   510  C C   . SER A 1 77  ? -12.918 -27.032 -32.771  1.00 10.37 ? 97   SER A C   1 
ATOM   511  O O   . SER A 1 77  ? -13.853 -26.438 -32.235  1.00 11.05 ? 97   SER A O   1 
ATOM   512  C CB  A SER A 1 77  ? -12.756 -26.301 -35.160  0.50 10.26 ? 97   SER A CB  1 
ATOM   513  C CB  B SER A 1 77  ? -12.759 -26.307 -35.157  0.50 10.68 ? 97   SER A CB  1 
ATOM   514  O OG  A SER A 1 77  ? -12.841 -27.603 -35.710  0.50 10.80 ? 97   SER A OG  1 
ATOM   515  O OG  B SER A 1 77  ? -12.101 -25.443 -36.066  0.50 6.47  ? 97   SER A OG  1 
ATOM   516  N N   . ASP A 1 78  ? -12.624 -28.300 -32.492  1.00 10.39 ? 98   ASP A N   1 
ATOM   517  C CA  . ASP A 1 78  ? -13.389 -29.054 -31.486  1.00 11.43 ? 98   ASP A CA  1 
ATOM   518  C C   . ASP A 1 78  ? -12.792 -28.945 -30.072  1.00 11.51 ? 98   ASP A C   1 
ATOM   519  O O   . ASP A 1 78  ? -13.268 -29.603 -29.147  1.00 12.41 ? 98   ASP A O   1 
ATOM   520  C CB  . ASP A 1 78  ? -13.550 -30.528 -31.902  1.00 13.08 ? 98   ASP A CB  1 
ATOM   521  C CG  . ASP A 1 78  ? -12.231 -31.288 -31.949  1.00 13.77 ? 98   ASP A CG  1 
ATOM   522  O OD1 . ASP A 1 78  ? -11.170 -30.693 -31.667  1.00 14.99 ? 98   ASP A OD1 1 
ATOM   523  O OD2 . ASP A 1 78  ? -12.258 -32.494 -32.276  1.00 16.04 ? 98   ASP A OD2 1 
ATOM   524  N N   . SER A 1 79  ? -11.749 -28.124 -29.922  1.00 11.33 ? 99   SER A N   1 
ATOM   525  C CA  . SER A 1 79  ? -11.080 -27.882 -28.636  1.00 11.58 ? 99   SER A CA  1 
ATOM   526  C C   . SER A 1 79  ? -10.384 -29.117 -28.052  1.00 11.93 ? 99   SER A C   1 
ATOM   527  O O   . SER A 1 79  ? -10.065 -29.141 -26.863  1.00 12.40 ? 99   SER A O   1 
ATOM   528  C CB  . SER A 1 79  ? -12.056 -27.289 -27.604  1.00 11.75 ? 99   SER A CB  1 
ATOM   529  O OG  . SER A 1 79  ? -12.651 -26.093 -28.073  1.00 11.25 ? 99   SER A OG  1 
ATOM   530  N N   . ASN A 1 80  ? -10.132 -30.125 -28.888  1.00 12.74 ? 100  ASN A N   1 
ATOM   531  C CA  . ASN A 1 80  ? -9.529  -31.384 -28.437  1.00 13.37 ? 100  ASN A CA  1 
ATOM   532  C C   . ASN A 1 80  ? -8.033  -31.467 -28.737  1.00 12.59 ? 100  ASN A C   1 
ATOM   533  O O   . ASN A 1 80  ? -7.271  -32.018 -27.941  1.00 14.79 ? 100  ASN A O   1 
ATOM   534  C CB  . ASN A 1 80  ? -10.243 -32.585 -29.069  1.00 14.76 ? 100  ASN A CB  1 
ATOM   535  C CG  . ASN A 1 80  ? -11.668 -32.757 -28.566  1.00 16.27 ? 100  ASN A CG  1 
ATOM   536  O OD1 . ASN A 1 80  ? -11.990 -32.399 -27.432  1.00 18.41 ? 100  ASN A OD1 1 
ATOM   537  N ND2 . ASN A 1 80  ? -12.527 -33.326 -29.408  1.00 17.87 ? 100  ASN A ND2 1 
ATOM   538  N N   . LEU A 1 81  ? -7.614  -30.929 -29.881  1.00 10.53 ? 101  LEU A N   1 
ATOM   539  C CA  . LEU A 1 81  ? -6.212  -30.999 -30.289  1.00 10.09 ? 101  LEU A CA  1 
ATOM   540  C C   . LEU A 1 81  ? -5.513  -29.648 -30.187  1.00 9.38  ? 101  LEU A C   1 
ATOM   541  O O   . LEU A 1 81  ? -6.148  -28.595 -30.285  1.00 9.10  ? 101  LEU A O   1 
ATOM   542  C CB  . LEU A 1 81  ? -6.091  -31.516 -31.725  1.00 11.38 ? 101  LEU A CB  1 
ATOM   543  C CG  . LEU A 1 81  ? -6.784  -32.836 -32.069  1.00 12.13 ? 101  LEU A CG  1 
ATOM   544  C CD1 . LEU A 1 81  ? -6.550  -33.166 -33.536  1.00 12.67 ? 101  LEU A CD1 1 
ATOM   545  C CD2 . LEU A 1 81  ? -6.302  -33.971 -31.179  1.00 12.63 ? 101  LEU A CD2 1 
ATOM   546  N N   . LEU A 1 82  ? -4.200  -29.708 -29.972  1.00 8.88  ? 102  LEU A N   1 
ATOM   547  C CA  . LEU A 1 82  ? -3.317  -28.552 -30.070  1.00 8.58  ? 102  LEU A CA  1 
ATOM   548  C C   . LEU A 1 82  ? -2.220  -28.860 -31.075  1.00 8.20  ? 102  LEU A C   1 
ATOM   549  O O   . LEU A 1 82  ? -1.842  -30.016 -31.261  1.00 8.15  ? 102  LEU A O   1 
ATOM   550  C CB  . LEU A 1 82  ? -2.661  -28.234 -28.722  1.00 9.53  ? 102  LEU A CB  1 
ATOM   551  C CG  . LEU A 1 82  ? -3.490  -27.538 -27.644  1.00 10.29 ? 102  LEU A CG  1 
ATOM   552  C CD1 . LEU A 1 82  ? -2.727  -27.546 -26.325  1.00 11.50 ? 102  LEU A CD1 1 
ATOM   553  C CD2 . LEU A 1 82  ? -3.846  -26.118 -28.045  1.00 11.30 ? 102  LEU A CD2 1 
ATOM   554  N N   . VAL A 1 83  ? -1.715  -27.818 -31.725  1.00 7.54  ? 103  VAL A N   1 
ATOM   555  C CA  . VAL A 1 83  ? -0.485  -27.922 -32.498  1.00 7.66  ? 103  VAL A CA  1 
ATOM   556  C C   . VAL A 1 83  ? 0.491   -26.875 -31.966  1.00 7.70  ? 103  VAL A C   1 
ATOM   557  O O   . VAL A 1 83  ? 0.080   -25.782 -31.584  1.00 7.45  ? 103  VAL A O   1 
ATOM   558  C CB  . VAL A 1 83  ? -0.722  -27.769 -34.022  1.00 7.96  ? 103  VAL A CB  1 
ATOM   559  C CG1 . VAL A 1 83  ? -1.296  -26.403 -34.380  1.00 7.89  ? 103  VAL A CG1 1 
ATOM   560  C CG2 . VAL A 1 83  ? 0.566   -28.037 -34.793  1.00 7.75  ? 103  VAL A CG2 1 
ATOM   561  N N   . SER A 1 84  ? 1.773   -27.228 -31.921  1.00 7.68  ? 104  SER A N   1 
ATOM   562  C CA  . SER A 1 84  ? 2.814   -26.335 -31.417  1.00 7.11  ? 104  SER A CA  1 
ATOM   563  C C   . SER A 1 84  ? 3.951   -26.220 -32.423  1.00 7.10  ? 104  SER A C   1 
ATOM   564  O O   . SER A 1 84  ? 4.216   -27.160 -33.166  1.00 7.32  ? 104  SER A O   1 
ATOM   565  C CB  . SER A 1 84  ? 3.356   -26.852 -30.084  1.00 7.28  ? 104  SER A CB  1 
ATOM   566  O OG  . SER A 1 84  ? 3.733   -28.215 -30.193  1.00 7.47  ? 104  SER A OG  1 
ATOM   567  N N   . ALA A 1 85  ? 4.610   -25.063 -32.436  1.00 6.89  ? 105  ALA A N   1 
ATOM   568  C CA  . ALA A 1 85  ? 5.722   -24.783 -33.345  1.00 6.80  ? 105  ALA A CA  1 
ATOM   569  C C   . ALA A 1 85  ? 6.983   -24.499 -32.537  1.00 6.80  ? 105  ALA A C   1 
ATOM   570  O O   . ALA A 1 85  ? 6.973   -23.633 -31.660  1.00 7.19  ? 105  ALA A O   1 
ATOM   571  C CB  . ALA A 1 85  ? 5.386   -23.591 -34.223  1.00 6.55  ? 105  ALA A CB  1 
ATOM   572  N N   . SER A 1 86  ? 8.068   -25.208 -32.845  1.00 7.26  ? 106  SER A N   1 
ATOM   573  C CA  . SER A 1 86  ? 9.263   -25.206 -31.996  1.00 7.57  ? 106  SER A CA  1 
ATOM   574  C C   . SER A 1 86  ? 10.555  -24.893 -32.748  1.00 7.85  ? 106  SER A C   1 
ATOM   575  O O   . SER A 1 86  ? 10.657  -25.114 -33.953  1.00 8.10  ? 106  SER A O   1 
ATOM   576  C CB  . SER A 1 86  ? 9.396   -26.571 -31.313  1.00 7.58  ? 106  SER A CB  1 
ATOM   577  O OG  . SER A 1 86  ? 10.606  -26.689 -30.576  1.00 7.85  ? 106  SER A OG  1 
ATOM   578  N N   . ASP A 1 87  ? 11.540  -24.387 -32.006  1.00 8.11  ? 107  ASP A N   1 
ATOM   579  C CA  . ASP A 1 87  ? 12.903  -24.203 -32.518  1.00 8.68  ? 107  ASP A CA  1 
ATOM   580  C C   . ASP A 1 87  ? 13.567  -25.519 -32.931  1.00 8.74  ? 107  ASP A C   1 
ATOM   581  O O   . ASP A 1 87  ? 14.556  -25.500 -33.661  1.00 9.72  ? 107  ASP A O   1 
ATOM   582  C CB  . ASP A 1 87  ? 13.796  -23.502 -31.477  1.00 9.21  ? 107  ASP A CB  1 
ATOM   583  C CG  . ASP A 1 87  ? 13.736  -21.982 -31.560  1.00 9.72  ? 107  ASP A CG  1 
ATOM   584  O OD1 . ASP A 1 87  ? 12.727  -21.435 -32.040  1.00 10.27 ? 107  ASP A OD1 1 
ATOM   585  O OD2 . ASP A 1 87  ? 14.713  -21.327 -31.134  1.00 10.31 ? 107  ASP A OD2 1 
ATOM   586  N N   . ASP A 1 88  ? 13.041  -26.654 -32.467  1.00 9.15  ? 108  ASP A N   1 
ATOM   587  C CA  . ASP A 1 88  ? 13.568  -27.964 -32.875  1.00 9.35  ? 108  ASP A CA  1 
ATOM   588  C C   . ASP A 1 88  ? 13.185  -28.357 -34.313  1.00 9.73  ? 108  ASP A C   1 
ATOM   589  O O   . ASP A 1 88  ? 13.404  -29.498 -34.724  1.00 10.24 ? 108  ASP A O   1 
ATOM   590  C CB  . ASP A 1 88  ? 13.177  -29.063 -31.865  1.00 9.30  ? 108  ASP A CB  1 
ATOM   591  C CG  . ASP A 1 88  ? 11.684  -29.392 -31.865  1.00 9.27  ? 108  ASP A CG  1 
ATOM   592  O OD1 . ASP A 1 88  ? 10.948  -28.955 -32.775  1.00 9.61  ? 108  ASP A OD1 1 
ATOM   593  O OD2 . ASP A 1 88  ? 11.242  -30.107 -30.937  1.00 9.81  ? 108  ASP A OD2 1 
ATOM   594  N N   . LYS A 1 89  ? 12.610  -27.408 -35.056  1.00 9.94  ? 109  LYS A N   1 
ATOM   595  C CA  . LYS A 1 89  ? 12.297  -27.551 -36.483  1.00 10.07 ? 109  LYS A CA  1 
ATOM   596  C C   . LYS A 1 89  ? 11.053  -28.399 -36.754  1.00 9.73  ? 109  LYS A C   1 
ATOM   597  O O   . LYS A 1 89  ? 10.743  -28.681 -37.910  1.00 10.73 ? 109  LYS A O   1 
ATOM   598  C CB  . LYS A 1 89  ? 13.495  -28.089 -37.284  1.00 10.89 ? 109  LYS A CB  1 
ATOM   599  C CG  . LYS A 1 89  ? 14.786  -27.307 -37.098  1.00 12.07 ? 109  LYS A CG  1 
ATOM   600  C CD  . LYS A 1 89  ? 15.873  -27.813 -38.032  1.00 13.60 ? 109  LYS A CD  1 
ATOM   601  C CE  . LYS A 1 89  ? 17.137  -26.979 -37.919  1.00 16.57 ? 109  LYS A CE  1 
ATOM   602  N NZ  . LYS A 1 89  ? 18.213  -27.461 -38.827  1.00 18.12 ? 109  LYS A NZ  1 
ATOM   603  N N   . THR A 1 90  ? 10.328  -28.781 -35.703  1.00 9.07  ? 110  THR A N   1 
ATOM   604  C CA  . THR A 1 90  ? 9.124   -29.593 -35.856  1.00 8.78  ? 110  THR A CA  1 
ATOM   605  C C   . THR A 1 90  ? 7.893   -28.879 -35.325  1.00 8.38  ? 110  THR A C   1 
ATOM   606  O O   . THR A 1 90  ? 7.993   -27.902 -34.576  1.00 8.46  ? 110  THR A O   1 
ATOM   607  C CB  . THR A 1 90  ? 9.237   -30.946 -35.112  1.00 9.33  ? 110  THR A CB  1 
ATOM   608  O OG1 . THR A 1 90  ? 9.118   -30.743 -33.695  1.00 9.71  ? 110  THR A OG1 1 
ATOM   609  C CG2 . THR A 1 90  ? 10.560  -31.634 -35.428  1.00 9.89  ? 110  THR A CG2 1 
ATOM   610  N N   . LEU A 1 91  ? 6.732   -29.362 -35.753  1.00 7.96  ? 111  LEU A N   1 
ATOM   611  C CA  . LEU A 1 91  ? 5.489   -29.111 -35.046  1.00 7.71  ? 111  LEU A CA  1 
ATOM   612  C C   . LEU A 1 91  ? 5.059   -30.418 -34.415  1.00 7.78  ? 111  LEU A C   1 
ATOM   613  O O   . LEU A 1 91  ? 5.434   -31.491 -34.886  1.00 8.72  ? 111  LEU A O   1 
ATOM   614  C CB  . LEU A 1 91  ? 4.393   -28.600 -35.978  1.00 7.65  ? 111  LEU A CB  1 
ATOM   615  C CG  . LEU A 1 91  ? 4.768   -27.363 -36.794  1.00 7.91  ? 111  LEU A CG  1 
ATOM   616  C CD1 . LEU A 1 91  ? 5.102   -27.743 -38.230  1.00 8.39  ? 111  LEU A CD1 1 
ATOM   617  C CD2 . LEU A 1 91  ? 3.650   -26.334 -36.764  1.00 8.20  ? 111  LEU A CD2 1 
ATOM   618  N N   . LYS A 1 92  ? 4.284   -30.327 -33.342  1.00 7.81  ? 112  LYS A N   1 
ATOM   619  C CA  . LYS A 1 92  ? 3.699   -31.506 -32.720  1.00 7.61  ? 112  LYS A CA  1 
ATOM   620  C C   . LYS A 1 92  ? 2.199   -31.316 -32.576  1.00 7.76  ? 112  LYS A C   1 
ATOM   621  O O   . LYS A 1 92  ? 1.739   -30.227 -32.229  1.00 7.95  ? 112  LYS A O   1 
ATOM   622  C CB  . LYS A 1 92  ? 4.346   -31.786 -31.363  1.00 7.82  ? 112  LYS A CB  1 
ATOM   623  C CG  . LYS A 1 92  ? 5.723   -32.419 -31.481  1.00 7.97  ? 112  LYS A CG  1 
ATOM   624  C CD  . LYS A 1 92  ? 6.388   -32.589 -30.126  1.00 8.46  ? 112  LYS A CD  1 
ATOM   625  C CE  . LYS A 1 92  ? 7.757   -33.236 -30.255  1.00 8.88  ? 112  LYS A CE  1 
ATOM   626  N NZ  . LYS A 1 92  ? 7.675   -34.695 -30.542  1.00 10.25 ? 112  LYS A NZ  1 
ATOM   627  N N   . ILE A 1 93  ? 1.448   -32.371 -32.882  1.00 7.81  ? 113  ILE A N   1 
ATOM   628  C CA  . ILE A 1 93  ? 0.005   -32.390 -32.677  1.00 7.61  ? 113  ILE A CA  1 
ATOM   629  C C   . ILE A 1 93  ? -0.248  -33.124 -31.366  1.00 8.04  ? 113  ILE A C   1 
ATOM   630  O O   . ILE A 1 93  ? 0.244   -34.236 -31.169  1.00 8.37  ? 113  ILE A O   1 
ATOM   631  C CB  . ILE A 1 93  ? -0.742  -33.089 -33.834  1.00 7.66  ? 113  ILE A CB  1 
ATOM   632  C CG1 . ILE A 1 93  ? -0.390  -32.420 -35.170  1.00 8.08  ? 113  ILE A CG1 1 
ATOM   633  C CG2 . ILE A 1 93  ? -2.249  -33.065 -33.585  1.00 7.91  ? 113  ILE A CG2 1 
ATOM   634  C CD1 . ILE A 1 93  ? -1.003  -33.083 -36.385  1.00 8.21  ? 113  ILE A CD1 1 
ATOM   635  N N   . TRP A 1 94  ? -1.014  -32.495 -30.481  1.00 8.13  ? 114  TRP A N   1 
ATOM   636  C CA  . TRP A 1 94  ? -1.255  -33.024 -29.145  1.00 7.81  ? 114  TRP A CA  1 
ATOM   637  C C   . TRP A 1 94  ? -2.723  -33.337 -28.936  1.00 8.39  ? 114  TRP A C   1 
ATOM   638  O O   . TRP A 1 94  ? -3.594  -32.603 -29.402  1.00 8.76  ? 114  TRP A O   1 
ATOM   639  C CB  . TRP A 1 94  ? -0.843  -32.004 -28.085  1.00 7.52  ? 114  TRP A CB  1 
ATOM   640  C CG  . TRP A 1 94  ? 0.537   -31.475 -28.253  1.00 7.36  ? 114  TRP A CG  1 
ATOM   641  C CD1 . TRP A 1 94  ? 0.911   -30.381 -28.976  1.00 7.27  ? 114  TRP A CD1 1 
ATOM   642  C CD2 . TRP A 1 94  ? 1.735   -32.008 -27.681  1.00 7.53  ? 114  TRP A CD2 1 
ATOM   643  N NE1 . TRP A 1 94  ? 2.269   -30.202 -28.895  1.00 7.28  ? 114  TRP A NE1 1 
ATOM   644  C CE2 . TRP A 1 94  ? 2.799   -31.184 -28.100  1.00 7.56  ? 114  TRP A CE2 1 
ATOM   645  C CE3 . TRP A 1 94  ? 2.012   -33.102 -26.854  1.00 7.56  ? 114  TRP A CE3 1 
ATOM   646  C CZ2 . TRP A 1 94  ? 4.120   -31.422 -27.724  1.00 7.99  ? 114  TRP A CZ2 1 
ATOM   647  C CZ3 . TRP A 1 94  ? 3.325   -33.335 -26.477  1.00 7.78  ? 114  TRP A CZ3 1 
ATOM   648  C CH2 . TRP A 1 94  ? 4.362   -32.499 -26.914  1.00 7.98  ? 114  TRP A CH2 1 
ATOM   649  N N   . ASP A 1 95  ? -2.984  -34.427 -28.222  1.00 8.90  ? 115  ASP A N   1 
ATOM   650  C CA  . ASP A 1 95  ? -4.299  -34.695 -27.667  1.00 9.54  ? 115  ASP A CA  1 
ATOM   651  C C   . ASP A 1 95  ? -4.290  -34.069 -26.277  1.00 9.95  ? 115  ASP A C   1 
ATOM   652  O O   . ASP A 1 95  ? -3.619  -34.565 -25.372  1.00 9.74  ? 115  ASP A O   1 
ATOM   653  C CB  . ASP A 1 95  ? -4.547  -36.204 -27.600  1.00 10.03 ? 115  ASP A CB  1 
ATOM   654  C CG  . ASP A 1 95  ? -5.904  -36.561 -27.015  1.00 10.58 ? 115  ASP A CG  1 
ATOM   655  O OD1 . ASP A 1 95  ? -6.565  -35.694 -26.409  1.00 11.13 ? 115  ASP A OD1 1 
ATOM   656  O OD2 . ASP A 1 95  ? -6.308  -37.732 -27.158  1.00 12.90 ? 115  ASP A OD2 1 
ATOM   657  N N   . VAL A 1 96  ? -5.020  -32.969 -26.116  1.00 10.20 ? 116  VAL A N   1 
ATOM   658  C CA  . VAL A 1 96  ? -4.995  -32.216 -24.859  1.00 10.68 ? 116  VAL A CA  1 
ATOM   659  C C   . VAL A 1 96  ? -5.524  -33.041 -23.690  1.00 10.43 ? 116  VAL A C   1 
ATOM   660  O O   . VAL A 1 96  ? -4.988  -32.966 -22.584  1.00 11.10 ? 116  VAL A O   1 
ATOM   661  C CB  . VAL A 1 96  ? -5.800  -30.904 -24.964  1.00 11.72 ? 116  VAL A CB  1 
ATOM   662  C CG1 . VAL A 1 96  ? -5.902  -30.215 -23.607  1.00 12.39 ? 116  VAL A CG1 1 
ATOM   663  C CG2 . VAL A 1 96  ? -5.153  -29.979 -25.978  1.00 12.65 ? 116  VAL A CG2 1 
ATOM   664  N N   . SER A 1 97  ? -6.564  -33.829 -23.940  1.00 9.76  ? 117  SER A N   1 
ATOM   665  C CA  . SER A 1 97  ? -7.198  -34.622 -22.888  1.00 9.69  ? 117  SER A CA  1 
ATOM   666  C C   . SER A 1 97  ? -6.284  -35.723 -22.340  1.00 10.02 ? 117  SER A C   1 
ATOM   667  O O   . SER A 1 97  ? -6.371  -36.061 -21.163  1.00 10.46 ? 117  SER A O   1 
ATOM   668  C CB  . SER A 1 97  ? -8.518  -35.221 -23.387  1.00 9.63  ? 117  SER A CB  1 
ATOM   669  O OG  . SER A 1 97  ? -8.304  -36.229 -24.359  1.00 9.59  ? 117  SER A OG  1 
ATOM   670  N N   . SER A 1 98  ? -5.412  -36.269 -23.187  1.00 10.15 ? 118  SER A N   1 
ATOM   671  C CA  . SER A 1 98  ? -4.464  -37.308 -22.773  1.00 10.45 ? 118  SER A CA  1 
ATOM   672  C C   . SER A 1 98  ? -3.062  -36.762 -22.486  1.00 10.74 ? 118  SER A C   1 
ATOM   673  O O   . SER A 1 98  ? -2.269  -37.411 -21.803  1.00 10.39 ? 118  SER A O   1 
ATOM   674  C CB  . SER A 1 98  ? -4.361  -38.381 -23.857  1.00 10.75 ? 118  SER A CB  1 
ATOM   675  O OG  . SER A 1 98  ? -3.609  -37.911 -24.963  1.00 10.85 ? 118  SER A OG  1 
ATOM   676  N N   . GLY A 1 99  ? -2.754  -35.583 -23.028  1.00 11.75 ? 119  GLY A N   1 
ATOM   677  C CA  . GLY A 1 99  ? -1.406  -35.019 -22.965  1.00 13.28 ? 119  GLY A CA  1 
ATOM   678  C C   . GLY A 1 99  ? -0.425  -35.640 -23.951  1.00 14.46 ? 119  GLY A C   1 
ATOM   679  O O   . GLY A 1 99  ? 0.761   -35.305 -23.944  1.00 16.41 ? 119  GLY A O   1 
ATOM   680  N N   . LYS A 1 100 ? -0.917  -36.523 -24.819  1.00 14.22 ? 120  LYS A N   1 
ATOM   681  C CA  . LYS A 1 100 ? -0.056  -37.305 -25.704  1.00 15.12 ? 120  LYS A CA  1 
ATOM   682  C C   . LYS A 1 100 ? 0.276   -36.539 -26.973  1.00 14.13 ? 120  LYS A C   1 
ATOM   683  O O   . LYS A 1 100 ? -0.568  -35.827 -27.514  1.00 14.54 ? 120  LYS A O   1 
ATOM   684  C CB  . LYS A 1 100 ? -0.741  -38.616 -26.104  1.00 16.37 ? 120  LYS A CB  1 
ATOM   685  C CG  . LYS A 1 100 ? -1.015  -39.579 -24.960  1.00 17.88 ? 120  LYS A CG  1 
ATOM   686  C CD  . LYS A 1 100 ? 0.188   -40.455 -24.644  1.00 20.22 ? 120  LYS A CD  1 
ATOM   687  C CE  . LYS A 1 100 ? -0.241  -41.702 -23.891  1.00 21.49 ? 120  LYS A CE  1 
ATOM   688  N NZ  . LYS A 1 100 ? 0.883   -42.645 -23.644  1.00 24.54 ? 120  LYS A NZ  1 
ATOM   689  N N   . CYS A 1 101 ? 1.507   -36.701 -27.446  1.00 12.74 ? 121  CYS A N   1 
ATOM   690  C CA  . CYS A 1 101 ? 1.878   -36.260 -28.786  1.00 12.48 ? 121  CYS A CA  1 
ATOM   691  C C   . CYS A 1 101 ? 1.375   -37.299 -29.785  1.00 12.81 ? 121  CYS A C   1 
ATOM   692  O O   . CYS A 1 101 ? 1.820   -38.449 -29.768  1.00 13.82 ? 121  CYS A O   1 
ATOM   693  C CB  . CYS A 1 101 ? 3.393   -36.113 -28.910  1.00 11.98 ? 121  CYS A CB  1 
ATOM   694  S SG  . CYS A 1 101 ? 3.960   -35.714 -30.580  1.00 12.78 ? 121  CYS A SG  1 
ATOM   695  N N   . LEU A 1 102 ? 0.441   -36.894 -30.642  1.00 12.35 ? 122  LEU A N   1 
ATOM   696  C CA  . LEU A 1 102 ? -0.122  -37.787 -31.653  1.00 12.11 ? 122  LEU A CA  1 
ATOM   697  C C   . LEU A 1 102 ? 0.783   -37.891 -32.873  1.00 12.87 ? 122  LEU A C   1 
ATOM   698  O O   . LEU A 1 102 ? 0.996   -38.982 -33.404  1.00 14.18 ? 122  LEU A O   1 
ATOM   699  C CB  . LEU A 1 102 ? -1.503  -37.295 -32.092  1.00 12.31 ? 122  LEU A CB  1 
ATOM   700  C CG  . LEU A 1 102 ? -2.570  -37.141 -31.007  1.00 12.39 ? 122  LEU A CG  1 
ATOM   701  C CD1 . LEU A 1 102 ? -3.849  -36.591 -31.618  1.00 12.95 ? 122  LEU A CD1 1 
ATOM   702  C CD2 . LEU A 1 102 ? -2.838  -38.463 -30.300  1.00 12.95 ? 122  LEU A CD2 1 
ATOM   703  N N   . LYS A 1 103 ? 1.296   -36.749 -33.325  1.00 12.99 ? 123  LYS A N   1 
ATOM   704  C CA  . LYS A 1 103 ? 2.140   -36.690 -34.519  1.00 13.30 ? 123  LYS A CA  1 
ATOM   705  C C   . LYS A 1 103 ? 3.238   -35.643 -34.355  1.00 12.30 ? 123  LYS A C   1 
ATOM   706  O O   . LYS A 1 103 ? 3.040   -34.625 -33.691  1.00 12.23 ? 123  LYS A O   1 
ATOM   707  C CB  . LYS A 1 103 ? 1.294   -36.340 -35.749  1.00 14.86 ? 123  LYS A CB  1 
ATOM   708  C CG  . LYS A 1 103 ? 0.406   -37.463 -36.270  1.00 15.63 ? 123  LYS A CG  1 
ATOM   709  C CD  . LYS A 1 103 ? 1.190   -38.448 -37.124  1.00 17.40 ? 123  LYS A CD  1 
ATOM   710  C CE  . LYS A 1 103 ? 0.335   -39.623 -37.573  1.00 19.17 ? 123  LYS A CE  1 
ATOM   711  N NZ  . LYS A 1 103 ? 0.300   -40.711 -36.558  1.00 20.13 ? 123  LYS A NZ  1 
ATOM   712  N N   . THR A 1 104 ? 4.395   -35.908 -34.958  1.00 11.88 ? 124  THR A N   1 
ATOM   713  C CA  . THR A 1 104 ? 5.463   -34.920 -35.068  1.00 11.76 ? 124  THR A CA  1 
ATOM   714  C C   . THR A 1 104 ? 5.638   -34.588 -36.544  1.00 11.51 ? 124  THR A C   1 
ATOM   715  O O   . THR A 1 104 ? 5.962   -35.462 -37.353  1.00 12.16 ? 124  THR A O   1 
ATOM   716  C CB  . THR A 1 104 ? 6.789   -35.435 -34.476  1.00 11.60 ? 124  THR A CB  1 
ATOM   717  O OG1 . THR A 1 104 ? 6.599   -35.758 -33.092  1.00 11.66 ? 124  THR A OG1 1 
ATOM   718  C CG2 . THR A 1 104 ? 7.895   -34.382 -34.598  1.00 12.29 ? 124  THR A CG2 1 
ATOM   719  N N   . LEU A 1 105 ? 5.407   -33.322 -36.881  1.00 11.88 ? 125  LEU A N   1 
ATOM   720  C CA  . LEU A 1 105 ? 5.437   -32.850 -38.258  1.00 11.60 ? 125  LEU A CA  1 
ATOM   721  C C   . LEU A 1 105 ? 6.843   -32.373 -38.614  1.00 11.89 ? 125  LEU A C   1 
ATOM   722  O O   . LEU A 1 105 ? 7.299   -31.337 -38.128  1.00 12.03 ? 125  LEU A O   1 
ATOM   723  C CB  . LEU A 1 105 ? 4.418   -31.716 -38.440  1.00 11.72 ? 125  LEU A CB  1 
ATOM   724  C CG  . LEU A 1 105 ? 2.984   -32.007 -37.974  1.00 12.39 ? 125  LEU A CG  1 
ATOM   725  C CD1 . LEU A 1 105 ? 2.067   -30.819 -38.222  1.00 12.20 ? 125  LEU A CD1 1 
ATOM   726  C CD2 . LEU A 1 105 ? 2.419   -33.245 -38.651  1.00 12.97 ? 125  LEU A CD2 1 
ATOM   727  N N   . LYS A 1 106 ? 7.526   -33.147 -39.455  1.00 12.31 ? 126  LYS A N   1 
ATOM   728  C CA  . LYS A 1 106 ? 8.910   -32.872 -39.835  1.00 12.62 ? 126  LYS A CA  1 
ATOM   729  C C   . LYS A 1 106 ? 8.990   -32.475 -41.304  1.00 12.19 ? 126  LYS A C   1 
ATOM   730  O O   . LYS A 1 106 ? 8.251   -33.002 -42.139  1.00 12.87 ? 126  LYS A O   1 
ATOM   731  C CB  . LYS A 1 106 ? 9.777   -34.107 -39.586  1.00 13.74 ? 126  LYS A CB  1 
ATOM   732  C CG  . LYS A 1 106 ? 9.826   -34.541 -38.129  1.00 15.05 ? 126  LYS A CG  1 
ATOM   733  C CD  . LYS A 1 106 ? 10.530  -35.879 -37.966  1.00 16.42 ? 126  LYS A CD  1 
ATOM   734  C CE  . LYS A 1 106 ? 10.444  -36.395 -36.538  1.00 18.86 ? 126  LYS A CE  1 
ATOM   735  N NZ  . LYS A 1 106 ? 11.326  -35.646 -35.601  1.00 19.96 ? 126  LYS A NZ  1 
ATOM   736  N N   . GLY A 1 107 ? 9.888   -31.543 -41.613  1.00 11.96 ? 127  GLY A N   1 
ATOM   737  C CA  . GLY A 1 107 ? 10.051  -31.048 -42.981  1.00 12.20 ? 127  GLY A CA  1 
ATOM   738  C C   . GLY A 1 107 ? 10.696  -29.677 -43.060  1.00 11.67 ? 127  GLY A C   1 
ATOM   739  O O   . GLY A 1 107 ? 11.486  -29.411 -43.967  1.00 12.58 ? 127  GLY A O   1 
ATOM   740  N N   . HIS A 1 108 ? 10.352  -28.793 -42.124  1.00 10.95 ? 128  HIS A N   1 
ATOM   741  C CA  . HIS A 1 108 ? 10.991  -27.480 -42.062  1.00 10.26 ? 128  HIS A CA  1 
ATOM   742  C C   . HIS A 1 108 ? 12.483  -27.634 -41.787  1.00 10.67 ? 128  HIS A C   1 
ATOM   743  O O   . HIS A 1 108 ? 12.897  -28.538 -41.063  1.00 11.54 ? 128  HIS A O   1 
ATOM   744  C CB  . HIS A 1 108 ? 10.352  -26.601 -40.984  1.00 9.75  ? 128  HIS A CB  1 
ATOM   745  C CG  . HIS A 1 108 ? 9.045   -25.999 -41.392  1.00 9.50  ? 128  HIS A CG  1 
ATOM   746  N ND1 . HIS A 1 108 ? 8.926   -25.137 -42.461  1.00 9.73  ? 128  HIS A ND1 1 
ATOM   747  C CD2 . HIS A 1 108 ? 7.803   -26.117 -40.865  1.00 9.27  ? 128  HIS A CD2 1 
ATOM   748  C CE1 . HIS A 1 108 ? 7.668   -24.753 -42.578  1.00 9.42  ? 128  HIS A CE1 1 
ATOM   749  N NE2 . HIS A 1 108 ? 6.965   -25.336 -41.623  1.00 9.24  ? 128  HIS A NE2 1 
ATOM   750  N N   . SER A 1 109 ? 13.282  -26.749 -42.375  1.00 10.81 ? 129  SER A N   1 
ATOM   751  C CA  . SER A 1 109 ? 14.737  -26.803 -42.228  1.00 10.91 ? 129  SER A CA  1 
ATOM   752  C C   . SER A 1 109 ? 15.271  -25.774 -41.229  1.00 10.84 ? 129  SER A C   1 
ATOM   753  O O   . SER A 1 109 ? 16.482  -25.610 -41.095  1.00 11.32 ? 129  SER A O   1 
ATOM   754  C CB  . SER A 1 109 ? 15.404  -26.605 -43.590  1.00 12.07 ? 129  SER A CB  1 
ATOM   755  O OG  . SER A 1 109 ? 15.117  -25.325 -44.120  1.00 13.80 ? 129  SER A OG  1 
ATOM   756  N N   . ASN A 1 110 ? 14.369  -25.086 -40.531  1.00 10.42 ? 130  ASN A N   1 
ATOM   757  C CA  . ASN A 1 110 ? 14.747  -24.103 -39.520  1.00 10.52 ? 130  ASN A CA  1 
ATOM   758  C C   . ASN A 1 110 ? 13.599  -23.945 -38.523  1.00 10.24 ? 130  ASN A C   1 
ATOM   759  O O   . ASN A 1 110 ? 12.583  -24.634 -38.640  1.00 10.84 ? 130  ASN A O   1 
ATOM   760  C CB  . ASN A 1 110 ? 15.097  -22.764 -40.190  1.00 11.34 ? 130  ASN A CB  1 
ATOM   761  C CG  . ASN A 1 110 ? 16.118  -21.953 -39.403  1.00 12.05 ? 130  ASN A CG  1 
ATOM   762  O OD1 . ASN A 1 110 ? 16.254  -22.109 -38.187  1.00 12.77 ? 130  ASN A OD1 1 
ATOM   763  N ND2 . ASN A 1 110 ? 16.837  -21.074 -40.096  1.00 12.93 ? 130  ASN A ND2 1 
ATOM   764  N N   . TYR A 1 111 ? 13.760  -23.049 -37.551  1.00 9.89  ? 131  TYR A N   1 
ATOM   765  C CA  . TYR A 1 111 ? 12.754  -22.848 -36.500  1.00 9.42  ? 131  TYR A CA  1 
ATOM   766  C C   . TYR A 1 111 ? 11.346  -22.745 -37.077  1.00 8.50  ? 131  TYR A C   1 
ATOM   767  O O   . TYR A 1 111 ? 11.123  -22.017 -38.041  1.00 9.04  ? 131  TYR A O   1 
ATOM   768  C CB  . TYR A 1 111 ? 13.022  -21.562 -35.707  1.00 10.15 ? 131  TYR A CB  1 
ATOM   769  C CG  . TYR A 1 111 ? 14.454  -21.331 -35.281  1.00 11.02 ? 131  TYR A CG  1 
ATOM   770  C CD1 . TYR A 1 111 ? 15.205  -22.348 -34.699  1.00 11.97 ? 131  TYR A CD1 1 
ATOM   771  C CD2 . TYR A 1 111 ? 15.052  -20.083 -35.440  1.00 11.68 ? 131  TYR A CD2 1 
ATOM   772  C CE1 . TYR A 1 111 ? 16.513  -22.134 -34.301  1.00 12.78 ? 131  TYR A CE1 1 
ATOM   773  C CE2 . TYR A 1 111 ? 16.358  -19.859 -35.043  1.00 12.59 ? 131  TYR A CE2 1 
ATOM   774  C CZ  . TYR A 1 111 ? 17.084  -20.887 -34.475  1.00 13.41 ? 131  TYR A CZ  1 
ATOM   775  O OH  . TYR A 1 111 ? 18.382  -20.665 -34.079  1.00 16.57 ? 131  TYR A OH  1 
ATOM   776  N N   . VAL A 1 112 ? 10.395  -23.456 -36.479  1.00 7.76  ? 132  VAL A N   1 
ATOM   777  C CA  . VAL A 1 112 ? 8.992   -23.258 -36.826  1.00 7.41  ? 132  VAL A CA  1 
ATOM   778  C C   . VAL A 1 112 ? 8.450   -22.196 -35.871  1.00 7.33  ? 132  VAL A C   1 
ATOM   779  O O   . VAL A 1 112 ? 8.602   -22.310 -34.651  1.00 7.81  ? 132  VAL A O   1 
ATOM   780  C CB  . VAL A 1 112 ? 8.162   -24.553 -36.755  1.00 7.44  ? 132  VAL A CB  1 
ATOM   781  C CG1 . VAL A 1 112 ? 6.821   -24.342 -37.443  1.00 7.55  ? 132  VAL A CG1 1 
ATOM   782  C CG2 . VAL A 1 112 ? 8.901   -25.712 -37.414  1.00 7.32  ? 132  VAL A CG2 1 
ATOM   783  N N   . PHE A 1 113 ? 7.845   -21.156 -36.438  1.00 6.81  ? 133  PHE A N   1 
ATOM   784  C CA  . PHE A 1 113 ? 7.531   -19.932 -35.706  1.00 6.57  ? 133  PHE A CA  1 
ATOM   785  C C   . PHE A 1 113 ? 6.044   -19.749 -35.402  1.00 6.69  ? 133  PHE A C   1 
ATOM   786  O O   . PHE A 1 113 ? 5.684   -19.180 -34.370  1.00 6.90  ? 133  PHE A O   1 
ATOM   787  C CB  . PHE A 1 113 ? 8.021   -18.737 -36.522  1.00 6.54  ? 133  PHE A CB  1 
ATOM   788  C CG  . PHE A 1 113 ? 8.126   -17.465 -35.736  1.00 6.75  ? 133  PHE A CG  1 
ATOM   789  C CD1 . PHE A 1 113 ? 9.260   -17.203 -34.981  1.00 6.93  ? 133  PHE A CD1 1 
ATOM   790  C CD2 . PHE A 1 113 ? 7.100   -16.531 -35.751  1.00 7.00  ? 133  PHE A CD2 1 
ATOM   791  C CE1 . PHE A 1 113 ? 9.372   -16.033 -34.254  1.00 7.15  ? 133  PHE A CE1 1 
ATOM   792  C CE2 . PHE A 1 113 ? 7.206   -15.355 -35.028  1.00 7.14  ? 133  PHE A CE2 1 
ATOM   793  C CZ  . PHE A 1 113 ? 8.342   -15.110 -34.273  1.00 7.31  ? 133  PHE A CZ  1 
ATOM   794  N N   . CYS A 1 114 ? 5.189   -20.206 -36.311  1.00 7.02  ? 134  CYS A N   1 
ATOM   795  C CA  . CYS A 1 114 ? 3.756   -19.957 -36.221  1.00 7.13  ? 134  CYS A CA  1 
ATOM   796  C C   . CYS A 1 114 ? 2.975   -21.144 -36.763  1.00 7.24  ? 134  CYS A C   1 
ATOM   797  O O   . CYS A 1 114 ? 3.478   -21.898 -37.597  1.00 7.20  ? 134  CYS A O   1 
ATOM   798  C CB  . CYS A 1 114 ? 3.394   -18.693 -37.007  1.00 7.74  ? 134  CYS A CB  1 
ATOM   799  S SG  . CYS A 1 114 ? 4.076   -18.631 -38.684  1.00 8.30  ? 134  CYS A SG  1 
ATOM   800  N N   . CYS A 1 115 ? 1.747   -21.308 -36.281  1.00 7.39  ? 135  CYS A N   1 
ATOM   801  C CA  . CYS A 1 115 ? 0.913   -22.430 -36.699  1.00 7.79  ? 135  CYS A CA  1 
ATOM   802  C C   . CYS A 1 115 ? -0.569  -22.185 -36.449  1.00 7.61  ? 135  CYS A C   1 
ATOM   803  O O   . CYS A 1 115 ? -0.943  -21.383 -35.599  1.00 8.33  ? 135  CYS A O   1 
ATOM   804  C CB  . CYS A 1 115 ? 1.360   -23.718 -35.999  1.00 8.06  ? 135  CYS A CB  1 
ATOM   805  S SG  . CYS A 1 115 ? 1.443   -23.630 -34.192  1.00 8.78  ? 135  CYS A SG  1 
ATOM   806  N N   . ASN A 1 116 ? -1.405  -22.884 -37.209  1.00 7.54  ? 136  ASN A N   1 
ATOM   807  C CA  . ASN A 1 116 ? -2.854  -22.806 -37.053  1.00 7.83  ? 136  ASN A CA  1 
ATOM   808  C C   . ASN A 1 116 ? -3.551  -23.980 -37.729  1.00 8.09  ? 136  ASN A C   1 
ATOM   809  O O   . ASN A 1 116 ? -3.073  -24.489 -38.744  1.00 8.39  ? 136  ASN A O   1 
ATOM   810  C CB  . ASN A 1 116 ? -3.386  -21.491 -37.641  1.00 8.14  ? 136  ASN A CB  1 
ATOM   811  C CG  . ASN A 1 116 ? -3.664  -20.439 -36.582  1.00 8.25  ? 136  ASN A CG  1 
ATOM   812  O OD1 . ASN A 1 116 ? -4.331  -20.711 -35.585  1.00 8.62  ? 136  ASN A OD1 1 
ATOM   813  N ND2 . ASN A 1 116 ? -3.180  -19.222 -36.808  1.00 8.52  ? 136  ASN A ND2 1 
ATOM   814  N N   . PHE A 1 117 ? -4.674  -24.405 -37.152  1.00 8.03  ? 137  PHE A N   1 
ATOM   815  C CA  . PHE A 1 117 ? -5.581  -25.345 -37.805  1.00 8.34  ? 137  PHE A CA  1 
ATOM   816  C C   . PHE A 1 117 ? -6.497  -24.560 -38.736  1.00 8.99  ? 137  PHE A C   1 
ATOM   817  O O   . PHE A 1 117 ? -6.720  -23.368 -38.528  1.00 9.16  ? 137  PHE A O   1 
ATOM   818  C CB  . PHE A 1 117 ? -6.467  -26.060 -36.778  1.00 7.94  ? 137  PHE A CB  1 
ATOM   819  C CG  . PHE A 1 117 ? -5.774  -27.141 -35.998  1.00 7.67  ? 137  PHE A CG  1 
ATOM   820  C CD1 . PHE A 1 117 ? -5.113  -26.850 -34.812  1.00 7.90  ? 137  PHE A CD1 1 
ATOM   821  C CD2 . PHE A 1 117 ? -5.824  -28.461 -36.426  1.00 7.65  ? 137  PHE A CD2 1 
ATOM   822  C CE1 . PHE A 1 117 ? -4.491  -27.851 -34.081  1.00 7.87  ? 137  PHE A CE1 1 
ATOM   823  C CE2 . PHE A 1 117 ? -5.204  -29.466 -35.701  1.00 7.81  ? 137  PHE A CE2 1 
ATOM   824  C CZ  . PHE A 1 117 ? -4.538  -29.162 -34.526  1.00 7.82  ? 137  PHE A CZ  1 
ATOM   825  N N   . ASN A 1 118 ? -7.041  -25.224 -39.751  1.00 9.32  ? 138  ASN A N   1 
ATOM   826  C CA  . ASN A 1 118 ? -8.164  -24.652 -40.496  1.00 9.88  ? 138  ASN A CA  1 
ATOM   827  C C   . ASN A 1 118 ? -9.456  -24.924 -39.716  1.00 10.09 ? 138  ASN A C   1 
ATOM   828  O O   . ASN A 1 118 ? -9.444  -25.720 -38.772  1.00 10.04 ? 138  ASN A O   1 
ATOM   829  C CB  . ASN A 1 118 ? -8.223  -25.178 -41.943  1.00 9.93  ? 138  ASN A CB  1 
ATOM   830  C CG  . ASN A 1 118 ? -8.477  -26.670 -42.029  1.00 10.17 ? 138  ASN A CG  1 
ATOM   831  O OD1 . ASN A 1 118 ? -8.260  -27.408 -41.071  1.00 10.53 ? 138  ASN A OD1 1 
ATOM   832  N ND2 . ASN A 1 118 ? -8.922  -27.124 -43.192  1.00 11.43 ? 138  ASN A ND2 1 
ATOM   833  N N   . PRO A 1 119 ? -10.566 -24.252 -40.079  1.00 10.64 ? 139  PRO A N   1 
ATOM   834  C CA  . PRO A 1 119 ? -11.830 -24.446 -39.353  1.00 11.06 ? 139  PRO A CA  1 
ATOM   835  C C   . PRO A 1 119 ? -12.341 -25.890 -39.329  1.00 11.76 ? 139  PRO A C   1 
ATOM   836  O O   . PRO A 1 119 ? -12.886 -26.329 -38.316  1.00 12.03 ? 139  PRO A O   1 
ATOM   837  C CB  . PRO A 1 119 ? -12.803 -23.541 -40.111  1.00 11.53 ? 139  PRO A CB  1 
ATOM   838  C CG  . PRO A 1 119 ? -11.940 -22.453 -40.645  1.00 11.22 ? 139  PRO A CG  1 
ATOM   839  C CD  . PRO A 1 119 ? -10.655 -23.122 -41.025  1.00 10.81 ? 139  PRO A CD  1 
ATOM   840  N N   . GLN A 1 120 ? -12.176 -26.617 -40.431  1.00 12.03 ? 140  GLN A N   1 
ATOM   841  C CA  . GLN A 1 120 ? -12.510 -28.044 -40.467  1.00 12.41 ? 140  GLN A CA  1 
ATOM   842  C C   . GLN A 1 120 ? -11.554 -28.853 -39.578  1.00 12.51 ? 140  GLN A C   1 
ATOM   843  O O   . GLN A 1 120 ? -11.915 -29.918 -39.069  1.00 13.36 ? 140  GLN A O   1 
ATOM   844  C CB  . GLN A 1 120 ? -12.464 -28.559 -41.908  1.00 13.86 ? 140  GLN A CB  1 
ATOM   845  C CG  . GLN A 1 120 ? -12.900 -30.004 -42.086  1.00 15.32 ? 140  GLN A CG  1 
ATOM   846  C CD  . GLN A 1 120 ? -12.829 -30.463 -43.531  1.00 16.71 ? 140  GLN A CD  1 
ATOM   847  O OE1 . GLN A 1 120 ? -12.878 -29.653 -44.457  1.00 17.70 ? 140  GLN A OE1 1 
ATOM   848  N NE2 . GLN A 1 120 ? -12.713 -31.771 -43.731  1.00 17.86 ? 140  GLN A NE2 1 
ATOM   849  N N   . SER A 1 121 ? -10.337 -28.330 -39.418  1.00 11.85 ? 141  SER A N   1 
ATOM   850  C CA  . SER A 1 121 ? -9.276  -28.905 -38.581  1.00 11.50 ? 141  SER A CA  1 
ATOM   851  C C   . SER A 1 121 ? -8.750  -30.249 -39.094  1.00 11.43 ? 141  SER A C   1 
ATOM   852  O O   . SER A 1 121 ? -8.226  -31.055 -38.326  1.00 13.32 ? 141  SER A O   1 
ATOM   853  C CB  . SER A 1 121 ? -9.699  -28.970 -37.106  1.00 11.25 ? 141  SER A CB  1 
ATOM   854  O OG  . SER A 1 121 ? -9.866  -27.657 -36.591  1.00 11.08 ? 141  SER A OG  1 
ATOM   855  N N   . ASN A 1 122 ? -8.874  -30.466 -40.404  1.00 10.91 ? 142  ASN A N   1 
ATOM   856  C CA  . ASN A 1 122 ? -8.185  -31.562 -41.082  1.00 10.44 ? 142  ASN A CA  1 
ATOM   857  C C   . ASN A 1 122 ? -6.813  -31.119 -41.601  1.00 9.96  ? 142  ASN A C   1 
ATOM   858  O O   . ASN A 1 122 ? -6.000  -31.954 -41.992  1.00 10.26 ? 142  ASN A O   1 
ATOM   859  C CB  . ASN A 1 122 ? -9.030  -32.111 -42.237  1.00 10.66 ? 142  ASN A CB  1 
ATOM   860  C CG  . ASN A 1 122 ? -9.184  -31.117 -43.371  1.00 11.49 ? 142  ASN A CG  1 
ATOM   861  O OD1 . ASN A 1 122 ? -9.500  -29.950 -43.144  1.00 11.57 ? 142  ASN A OD1 1 
ATOM   862  N ND2 . ASN A 1 122 ? -8.963  -31.574 -44.598  1.00 13.03 ? 142  ASN A ND2 1 
ATOM   863  N N   . LEU A 1 123 ? -6.563  -29.807 -41.604  1.00 9.67  ? 143  LEU A N   1 
ATOM   864  C CA  . LEU A 1 123 ? -5.275  -29.261 -42.037  1.00 9.74  ? 143  LEU A CA  1 
ATOM   865  C C   . LEU A 1 123 ? -4.625  -28.388 -40.966  1.00 9.26  ? 143  LEU A C   1 
ATOM   866  O O   . LEU A 1 123 ? -5.308  -27.783 -40.138  1.00 9.40  ? 143  LEU A O   1 
ATOM   867  C CB  . LEU A 1 123 ? -5.440  -28.420 -43.307  1.00 10.41 ? 143  LEU A CB  1 
ATOM   868  C CG  . LEU A 1 123 ? -6.043  -29.088 -44.544  1.00 10.85 ? 143  LEU A CG  1 
ATOM   869  C CD1 . LEU A 1 123 ? -6.222  -28.062 -45.655  1.00 10.88 ? 143  LEU A CD1 1 
ATOM   870  C CD2 . LEU A 1 123 ? -5.176  -30.244 -45.014  1.00 11.21 ? 143  LEU A CD2 1 
ATOM   871  N N   . ILE A 1 124 ? -3.297  -28.337 -41.008  1.00 8.76  ? 144  ILE A N   1 
ATOM   872  C CA  . ILE A 1 124 ? -2.509  -27.388 -40.232  1.00 9.01  ? 144  ILE A CA  1 
ATOM   873  C C   . ILE A 1 124 ? -1.636  -26.589 -41.193  1.00 8.36  ? 144  ILE A C   1 
ATOM   874  O O   . ILE A 1 124 ? -1.100  -27.140 -42.155  1.00 8.68  ? 144  ILE A O   1 
ATOM   875  C CB  . ILE A 1 124 ? -1.634  -28.113 -39.187  1.00 9.55  ? 144  ILE A CB  1 
ATOM   876  C CG1 . ILE A 1 124 ? -2.509  -28.611 -38.034  1.00 10.10 ? 144  ILE A CG1 1 
ATOM   877  C CG2 . ILE A 1 124 ? -0.541  -27.199 -38.640  1.00 9.84  ? 144  ILE A CG2 1 
ATOM   878  C CD1 . ILE A 1 124 ? -1.868  -29.695 -37.197  1.00 10.18 ? 144  ILE A CD1 1 
ATOM   879  N N   . VAL A 1 125 ? -1.509  -25.291 -40.936  1.00 7.67  ? 145  VAL A N   1 
ATOM   880  C CA  . VAL A 1 125 ? -0.578  -24.439 -41.682  1.00 7.76  ? 145  VAL A CA  1 
ATOM   881  C C   . VAL A 1 125 ? 0.541   -23.998 -40.741  1.00 7.78  ? 145  VAL A C   1 
ATOM   882  O O   . VAL A 1 125 ? 0.300   -23.737 -39.563  1.00 8.28  ? 145  VAL A O   1 
ATOM   883  C CB  . VAL A 1 125 ? -1.280  -23.218 -42.333  1.00 7.78  ? 145  VAL A CB  1 
ATOM   884  C CG1 . VAL A 1 125 ? -1.897  -22.287 -41.291  1.00 7.60  ? 145  VAL A CG1 1 
ATOM   885  C CG2 . VAL A 1 125 ? -0.313  -22.455 -43.232  1.00 7.68  ? 145  VAL A CG2 1 
ATOM   886  N N   . SER A 1 126 ? 1.763   -23.923 -41.263  1.00 7.33  ? 146  SER A N   1 
ATOM   887  C CA  . SER A 1 126 ? 2.919   -23.532 -40.461  1.00 7.35  ? 146  SER A CA  1 
ATOM   888  C C   . SER A 1 126 ? 3.817   -22.572 -41.228  1.00 7.47  ? 146  SER A C   1 
ATOM   889  O O   . SER A 1 126 ? 3.883   -22.621 -42.452  1.00 7.74  ? 146  SER A O   1 
ATOM   890  C CB  . SER A 1 126 ? 3.718   -24.765 -40.047  1.00 7.53  ? 146  SER A CB  1 
ATOM   891  O OG  . SER A 1 126 ? 4.224   -25.450 -41.182  1.00 7.70  ? 146  SER A OG  1 
ATOM   892  N N   . GLY A 1 127 ? 4.499   -21.701 -40.490  1.00 7.62  ? 147  GLY A N   1 
ATOM   893  C CA  . GLY A 1 127 ? 5.485   -20.789 -41.058  1.00 7.72  ? 147  GLY A CA  1 
ATOM   894  C C   . GLY A 1 127 ? 6.795   -20.950 -40.314  1.00 7.81  ? 147  GLY A C   1 
ATOM   895  O O   . GLY A 1 127 ? 6.808   -21.229 -39.113  1.00 8.18  ? 147  GLY A O   1 
ATOM   896  N N   . SER A 1 128 ? 7.901   -20.772 -41.028  1.00 8.09  ? 148  SER A N   1 
ATOM   897  C CA  . SER A 1 128 ? 9.218   -21.078 -40.486  1.00 8.27  ? 148  SER A CA  1 
ATOM   898  C C   . SER A 1 128 ? 10.266  -20.034 -40.867  1.00 8.67  ? 148  SER A C   1 
ATOM   899  O O   . SER A 1 128 ? 10.077  -19.247 -41.799  1.00 9.40  ? 148  SER A O   1 
ATOM   900  C CB  . SER A 1 128 ? 9.647   -22.468 -40.976  1.00 8.50  ? 148  SER A CB  1 
ATOM   901  O OG  . SER A 1 128 ? 11.020  -22.723 -40.738  1.00 8.92  ? 148  SER A OG  1 
ATOM   902  N N   . PHE A 1 129 ? 11.373  -20.042 -40.129  1.00 8.85  ? 149  PHE A N   1 
ATOM   903  C CA  . PHE A 1 129 ? 12.556  -19.262 -40.494  1.00 9.55  ? 149  PHE A CA  1 
ATOM   904  C C   . PHE A 1 129 ? 13.162  -19.722 -41.825  1.00 9.89  ? 149  PHE A C   1 
ATOM   905  O O   . PHE A 1 129 ? 13.926  -18.978 -42.440  1.00 11.09 ? 149  PHE A O   1 
ATOM   906  C CB  . PHE A 1 129 ? 13.621  -19.313 -39.385  1.00 10.06 ? 149  PHE A CB  1 
ATOM   907  C CG  . PHE A 1 129 ? 13.579  -18.137 -38.446  1.00 10.77 ? 149  PHE A CG  1 
ATOM   908  C CD1 . PHE A 1 129 ? 12.417  -17.818 -37.763  1.00 11.37 ? 149  PHE A CD1 1 
ATOM   909  C CD2 . PHE A 1 129 ? 14.708  -17.352 -38.241  1.00 11.86 ? 149  PHE A CD2 1 
ATOM   910  C CE1 . PHE A 1 129 ? 12.373  -16.733 -36.900  1.00 11.98 ? 149  PHE A CE1 1 
ATOM   911  C CE2 . PHE A 1 129 ? 14.672  -16.268 -37.378  1.00 12.19 ? 149  PHE A CE2 1 
ATOM   912  C CZ  . PHE A 1 129 ? 13.503  -15.958 -36.705  1.00 12.27 ? 149  PHE A CZ  1 
ATOM   913  N N   . ASP A 1 130 ? 12.825  -20.935 -42.274  1.00 10.10 ? 150  ASP A N   1 
ATOM   914  C CA  . ASP A 1 130 ? 13.251  -21.407 -43.601  1.00 10.03 ? 150  ASP A CA  1 
ATOM   915  C C   . ASP A 1 130 ? 12.513  -20.715 -44.760  1.00 10.11 ? 150  ASP A C   1 
ATOM   916  O O   . ASP A 1 130 ? 12.751  -21.043 -45.926  1.00 10.99 ? 150  ASP A O   1 
ATOM   917  C CB  . ASP A 1 130 ? 13.149  -22.940 -43.716  1.00 9.68  ? 150  ASP A CB  1 
ATOM   918  C CG  . ASP A 1 130 ? 11.711  -23.451 -43.773  1.00 9.80  ? 150  ASP A CG  1 
ATOM   919  O OD1 . ASP A 1 130 ? 10.781  -22.656 -44.018  1.00 9.69  ? 150  ASP A OD1 1 
ATOM   920  O OD2 . ASP A 1 130 ? 11.513  -24.671 -43.578  1.00 9.68  ? 150  ASP A OD2 1 
ATOM   921  N N   . GLU A 1 131 ? 11.616  -19.781 -44.426  1.00 10.37 ? 151  GLU A N   1 
ATOM   922  C CA  . GLU A 1 131 ? 10.981  -18.860 -45.380  1.00 9.86  ? 151  GLU A CA  1 
ATOM   923  C C   . GLU A 1 131 ? 9.799   -19.484 -46.131  1.00 9.92  ? 151  GLU A C   1 
ATOM   924  O O   . GLU A 1 131 ? 9.227   -18.860 -47.029  1.00 9.85  ? 151  GLU A O   1 
ATOM   925  C CB  . GLU A 1 131 ? 12.021  -18.254 -46.344  1.00 10.35 ? 151  GLU A CB  1 
ATOM   926  C CG  . GLU A 1 131 ? 13.270  -17.753 -45.624  1.00 11.20 ? 151  GLU A CG  1 
ATOM   927  C CD  . GLU A 1 131 ? 14.256  -17.032 -46.519  1.00 11.78 ? 151  GLU A CD  1 
ATOM   928  O OE1 . GLU A 1 131 ? 14.066  -17.014 -47.752  1.00 12.25 ? 151  GLU A OE1 1 
ATOM   929  O OE2 . GLU A 1 131 ? 15.235  -16.483 -45.975  1.00 13.52 ? 151  GLU A OE2 1 
ATOM   930  N N   . SER A 1 132 ? 9.409   -20.694 -45.728  1.00 9.54  ? 152  SER A N   1 
ATOM   931  C CA  . SER A 1 132 ? 8.318   -21.416 -46.375  1.00 9.49  ? 152  SER A CA  1 
ATOM   932  C C   . SER A 1 132 ? 7.068   -21.449 -45.509  1.00 9.20  ? 152  SER A C   1 
ATOM   933  O O   . SER A 1 132 ? 7.130   -21.262 -44.288  1.00 9.31  ? 152  SER A O   1 
ATOM   934  C CB  . SER A 1 132 ? 8.741   -22.857 -46.676  1.00 9.51  ? 152  SER A CB  1 
ATOM   935  O OG  . SER A 1 132 ? 8.809   -23.635 -45.492  1.00 10.38 ? 152  SER A OG  1 
ATOM   936  N N   . VAL A 1 133 ? 5.937   -21.679 -46.168  1.00 8.83  ? 153  VAL A N   1 
ATOM   937  C CA  . VAL A 1 133 ? 4.692   -22.036 -45.510  1.00 8.96  ? 153  VAL A CA  1 
ATOM   938  C C   . VAL A 1 133 ? 4.394   -23.479 -45.895  1.00 9.26  ? 153  VAL A C   1 
ATOM   939  O O   . VAL A 1 133 ? 4.449   -23.827 -47.076  1.00 9.90  ? 153  VAL A O   1 
ATOM   940  C CB  . VAL A 1 133 ? 3.532   -21.129 -45.969  1.00 8.90  ? 153  VAL A CB  1 
ATOM   941  C CG1 . VAL A 1 133 ? 2.195   -21.650 -45.454  1.00 9.03  ? 153  VAL A CG1 1 
ATOM   942  C CG2 . VAL A 1 133 ? 3.762   -19.700 -45.501  1.00 9.05  ? 153  VAL A CG2 1 
ATOM   943  N N   . ARG A 1 134 ? 4.089   -24.317 -44.907  1.00 9.35  ? 154  ARG A N   1 
ATOM   944  C CA  . ARG A 1 134 ? 3.734   -25.710 -45.170  1.00 9.41  ? 154  ARG A CA  1 
ATOM   945  C C   . ARG A 1 134 ? 2.299   -25.992 -44.755  1.00 9.16  ? 154  ARG A C   1 
ATOM   946  O O   . ARG A 1 134 ? 1.805   -25.427 -43.779  1.00 9.31  ? 154  ARG A O   1 
ATOM   947  C CB  . ARG A 1 134 ? 4.700   -26.658 -44.462  1.00 9.77  ? 154  ARG A CB  1 
ATOM   948  C CG  . ARG A 1 134 ? 6.022   -26.809 -45.197  1.00 10.45 ? 154  ARG A CG  1 
ATOM   949  C CD  . ARG A 1 134 ? 7.014   -27.668 -44.434  1.00 11.53 ? 154  ARG A CD  1 
ATOM   950  N NE  . ARG A 1 134 ? 8.286   -27.778 -45.150  1.00 13.60 ? 154  ARG A NE  1 
ATOM   951  C CZ  . ARG A 1 134 ? 8.652   -28.792 -45.933  1.00 14.14 ? 154  ARG A CZ  1 
ATOM   952  N NH1 . ARG A 1 134 ? 7.856   -29.841 -46.130  1.00 15.92 ? 154  ARG A NH1 1 
ATOM   953  N NH2 . ARG A 1 134 ? 9.841   -28.759 -46.527  1.00 14.94 ? 154  ARG A NH2 1 
ATOM   954  N N   . ILE A 1 135 ? 1.633   -26.849 -45.528  1.00 9.13  ? 155  ILE A N   1 
ATOM   955  C CA  . ILE A 1 135 ? 0.275   -27.290 -45.229  1.00 9.19  ? 155  ILE A CA  1 
ATOM   956  C C   . ILE A 1 135 ? 0.332   -28.784 -44.943  1.00 9.51  ? 155  ILE A C   1 
ATOM   957  O O   . ILE A 1 135 ? 0.809   -29.564 -45.772  1.00 10.52 ? 155  ILE A O   1 
ATOM   958  C CB  . ILE A 1 135 ? -0.694  -27.001 -46.393  1.00 9.16  ? 155  ILE A CB  1 
ATOM   959  C CG1 . ILE A 1 135 ? -0.698  -25.500 -46.713  1.00 9.53  ? 155  ILE A CG1 1 
ATOM   960  C CG2 . ILE A 1 135 ? -2.104  -27.479 -46.052  1.00 9.53  ? 155  ILE A CG2 1 
ATOM   961  C CD1 . ILE A 1 135 ? -1.371  -25.144 -48.021  1.00 9.82  ? 155  ILE A CD1 1 
ATOM   962  N N   . TRP A 1 136 ? -0.161  -29.171 -43.770  1.00 9.56  ? 156  TRP A N   1 
ATOM   963  C CA  . TRP A 1 136 ? -0.015  -30.532 -43.269  1.00 9.86  ? 156  TRP A CA  1 
ATOM   964  C C   . TRP A 1 136 ? -1.365  -31.209 -43.131  1.00 10.47 ? 156  TRP A C   1 
ATOM   965  O O   . TRP A 1 136 ? -2.360  -30.557 -42.830  1.00 9.91  ? 156  TRP A O   1 
ATOM   966  C CB  . TRP A 1 136 ? 0.649   -30.519 -41.891  1.00 9.94  ? 156  TRP A CB  1 
ATOM   967  C CG  . TRP A 1 136 ? 1.927   -29.738 -41.808  1.00 9.96  ? 156  TRP A CG  1 
ATOM   968  C CD1 . TRP A 1 136 ? 2.056   -28.388 -41.638  1.00 9.99  ? 156  TRP A CD1 1 
ATOM   969  C CD2 . TRP A 1 136 ? 3.259   -30.264 -41.860  1.00 9.84  ? 156  TRP A CD2 1 
ATOM   970  N NE1 . TRP A 1 136 ? 3.383   -28.041 -41.591  1.00 9.78  ? 156  TRP A NE1 1 
ATOM   971  C CE2 . TRP A 1 136 ? 4.143   -29.172 -41.727  1.00 10.03 ? 156  TRP A CE2 1 
ATOM   972  C CE3 . TRP A 1 136 ? 3.790   -31.551 -42.014  1.00 9.14  ? 156  TRP A CE3 1 
ATOM   973  C CZ2 . TRP A 1 136 ? 5.531   -29.329 -41.738  1.00 9.60  ? 156  TRP A CZ2 1 
ATOM   974  C CZ3 . TRP A 1 136 ? 5.169   -31.706 -42.025  1.00 9.36  ? 156  TRP A CZ3 1 
ATOM   975  C CH2 . TRP A 1 136 ? 6.023   -30.598 -41.892  1.00 9.15  ? 156  TRP A CH2 1 
ATOM   976  N N   . ASP A 1 137 ? -1.386  -32.523 -43.338  1.00 11.43 ? 157  ASP A N   1 
ATOM   977  C CA  . ASP A 1 137 ? -2.574  -33.329 -43.081  1.00 12.35 ? 157  ASP A CA  1 
ATOM   978  C C   . ASP A 1 137 ? -2.586  -33.744 -41.610  1.00 12.54 ? 157  ASP A C   1 
ATOM   979  O O   . ASP A 1 137 ? -1.645  -34.374 -41.136  1.00 13.07 ? 157  ASP A O   1 
ATOM   980  C CB  . ASP A 1 137 ? -2.580  -34.570 -43.972  1.00 14.23 ? 157  ASP A CB  1 
ATOM   981  C CG  . ASP A 1 137 ? -3.842  -35.390 -43.813  1.00 16.50 ? 157  ASP A CG  1 
ATOM   982  O OD1 . ASP A 1 137 ? -4.924  -34.875 -44.152  1.00 18.33 ? 157  ASP A OD1 1 
ATOM   983  O OD2 . ASP A 1 137 ? -3.753  -36.546 -43.351  1.00 19.82 ? 157  ASP A OD2 1 
ATOM   984  N N   . VAL A 1 138 ? -3.651  -33.389 -40.896  1.00 12.34 ? 158  VAL A N   1 
ATOM   985  C CA  . VAL A 1 138 ? -3.743  -33.664 -39.458  1.00 12.79 ? 158  VAL A CA  1 
ATOM   986  C C   . VAL A 1 138 ? -3.785  -35.165 -39.160  1.00 13.74 ? 158  VAL A C   1 
ATOM   987  O O   . VAL A 1 138 ? -3.129  -35.633 -38.229  1.00 13.83 ? 158  VAL A O   1 
ATOM   988  C CB  . VAL A 1 138 ? -4.972  -32.965 -38.831  1.00 12.50 ? 158  VAL A CB  1 
ATOM   989  C CG1 . VAL A 1 138 ? -5.227  -33.451 -37.409  1.00 12.88 ? 158  VAL A CG1 1 
ATOM   990  C CG2 . VAL A 1 138 ? -4.780  -31.454 -38.845  1.00 12.38 ? 158  VAL A CG2 1 
ATOM   991  N N   . LYS A 1 139 ? -4.552  -35.905 -39.958  1.00 14.82 ? 159  LYS A N   1 
ATOM   992  C CA  . LYS A 1 139 ? -4.739  -37.346 -39.758  1.00 16.32 ? 159  LYS A CA  1 
ATOM   993  C C   . LYS A 1 139 ? -3.435  -38.136 -39.903  1.00 16.68 ? 159  LYS A C   1 
ATOM   994  O O   . LYS A 1 139 ? -3.090  -38.935 -39.031  1.00 17.85 ? 159  LYS A O   1 
ATOM   995  C CB  . LYS A 1 139 ? -5.791  -37.874 -40.746  1.00 17.72 ? 159  LYS A CB  1 
ATOM   996  C CG  . LYS A 1 139 ? -6.048  -39.376 -40.694  1.00 19.24 ? 159  LYS A CG  1 
ATOM   997  C CD  . LYS A 1 139 ? -6.582  -39.829 -39.346  1.00 20.61 ? 159  LYS A CD  1 
ATOM   998  C CE  . LYS A 1 139 ? -6.920  -41.312 -39.363  1.00 21.45 ? 159  LYS A CE  1 
ATOM   999  N NZ  . LYS A 1 139 ? -7.550  -41.768 -38.094  1.00 23.73 ? 159  LYS A NZ  1 
ATOM   1000 N N   . THR A 1 140 ? -2.720  -37.905 -41.001  1.00 16.91 ? 160  THR A N   1 
ATOM   1001 C CA  . THR A 1 140 ? -1.498  -38.655 -41.312  1.00 17.46 ? 160  THR A CA  1 
ATOM   1002 C C   . THR A 1 140 ? -0.218  -37.975 -40.820  1.00 16.73 ? 160  THR A C   1 
ATOM   1003 O O   . THR A 1 140 ? 0.804   -38.636 -40.639  1.00 17.83 ? 160  THR A O   1 
ATOM   1004 C CB  . THR A 1 140 ? -1.356  -38.880 -42.829  1.00 18.36 ? 160  THR A CB  1 
ATOM   1005 O OG1 . THR A 1 140 ? -1.300  -37.617 -43.502  1.00 18.16 ? 160  THR A OG1 1 
ATOM   1006 C CG2 . THR A 1 140 ? -2.526  -39.693 -43.370  1.00 18.33 ? 160  THR A CG2 1 
ATOM   1007 N N   . GLY A 1 141 ? -0.271  -36.659 -40.625  1.00 15.74 ? 161  GLY A N   1 
ATOM   1008 C CA  . GLY A 1 141 ? 0.909   -35.883 -40.251  1.00 14.59 ? 161  GLY A CA  1 
ATOM   1009 C C   . GLY A 1 141 ? 1.833   -35.594 -41.422  1.00 13.93 ? 161  GLY A C   1 
ATOM   1010 O O   . GLY A 1 141 ? 2.966   -35.154 -41.227  1.00 14.13 ? 161  GLY A O   1 
ATOM   1011 N N   . LYS A 1 142 ? 1.346   -35.825 -42.639  1.00 13.86 ? 162  LYS A N   1 
ATOM   1012 C CA  . LYS A 1 142 ? 2.146   -35.639 -43.846  1.00 14.06 ? 162  LYS A CA  1 
ATOM   1013 C C   . LYS A 1 142 ? 2.067   -34.206 -44.343  1.00 13.19 ? 162  LYS A C   1 
ATOM   1014 O O   . LYS A 1 142 ? 1.024   -33.559 -44.240  1.00 12.90 ? 162  LYS A O   1 
ATOM   1015 C CB  . LYS A 1 142 ? 1.660   -36.570 -44.957  1.00 14.44 ? 162  LYS A CB  1 
ATOM   1016 C CG  . LYS A 1 142 ? 1.889   -38.044 -44.682  1.00 15.69 ? 162  LYS A CG  1 
ATOM   1017 C CD  . LYS A 1 142 ? 3.355   -38.409 -44.829  1.00 16.46 ? 162  LYS A CD  1 
ATOM   1018 C CE  . LYS A 1 142 ? 3.569   -39.904 -44.686  1.00 17.47 ? 162  LYS A CE  1 
ATOM   1019 N NZ  . LYS A 1 142 ? 4.988   -40.277 -44.919  1.00 18.72 ? 162  LYS A NZ  1 
ATOM   1020 N N   . CYS A 1 143 ? 3.176   -33.719 -44.891  1.00 13.19 ? 163  CYS A N   1 
ATOM   1021 C CA  . CYS A 1 143 ? 3.202   -32.415 -45.534  1.00 13.36 ? 163  CYS A CA  1 
ATOM   1022 C C   . CYS A 1 143 ? 2.583   -32.544 -46.919  1.00 13.66 ? 163  CYS A C   1 
ATOM   1023 O O   . CYS A 1 143 ? 3.099   -33.274 -47.767  1.00 14.38 ? 163  CYS A O   1 
ATOM   1024 C CB  . CYS A 1 143 ? 4.632   -31.895 -45.651  1.00 13.75 ? 163  CYS A CB  1 
ATOM   1025 S SG  . CYS A 1 143 ? 4.720   -30.207 -46.283  1.00 15.22 ? 163  CYS A SG  1 
ATOM   1026 N N   . LEU A 1 144 ? 1.473   -31.844 -47.138  1.00 12.99 ? 164  LEU A N   1 
ATOM   1027 C CA  . LEU A 1 144 ? 0.763   -31.898 -48.415  1.00 13.11 ? 164  LEU A CA  1 
ATOM   1028 C C   . LEU A 1 144 ? 1.344   -30.911 -49.420  1.00 13.17 ? 164  LEU A C   1 
ATOM   1029 O O   . LEU A 1 144 ? 1.469   -31.229 -50.604  1.00 13.29 ? 164  LEU A O   1 
ATOM   1030 C CB  . LEU A 1 144 ? -0.729  -31.625 -48.211  1.00 13.25 ? 164  LEU A CB  1 
ATOM   1031 C CG  . LEU A 1 144 ? -1.458  -32.590 -47.273  1.00 14.36 ? 164  LEU A CG  1 
ATOM   1032 C CD1 . LEU A 1 144 ? -2.897  -32.142 -47.074  1.00 14.46 ? 164  LEU A CD1 1 
ATOM   1033 C CD2 . LEU A 1 144 ? -1.405  -34.017 -47.800  1.00 15.08 ? 164  LEU A CD2 1 
ATOM   1034 N N   . LYS A 1 145 ? 1.688   -29.714 -48.950  1.00 13.12 ? 165  LYS A N   1 
ATOM   1035 C CA  . LYS A 1 145 ? 2.272   -28.691 -49.812  1.00 12.90 ? 165  LYS A CA  1 
ATOM   1036 C C   . LYS A 1 145 ? 3.333   -27.876 -49.085  1.00 12.46 ? 165  LYS A C   1 
ATOM   1037 O O   . LYS A 1 145 ? 3.206   -27.596 -47.893  1.00 12.77 ? 165  LYS A O   1 
ATOM   1038 C CB  . LYS A 1 145 ? 1.182   -27.755 -50.342  1.00 13.45 ? 165  LYS A CB  1 
ATOM   1039 C CG  . LYS A 1 145 ? 0.220   -28.414 -51.317  1.00 13.76 ? 165  LYS A CG  1 
ATOM   1040 C CD  . LYS A 1 145 ? -0.692  -27.398 -51.983  1.00 15.32 ? 165  LYS A CD  1 
ATOM   1041 C CE  . LYS A 1 145 ? -1.538  -28.037 -53.074  1.00 15.84 ? 165  LYS A CE  1 
ATOM   1042 N NZ  . LYS A 1 145 ? -2.574  -28.965 -52.540  1.00 16.30 ? 165  LYS A NZ  1 
ATOM   1043 N N   . THR A 1 146 ? 4.381   -27.514 -49.819  1.00 12.76 ? 166  THR A N   1 
ATOM   1044 C CA  . THR A 1 146 ? 5.375   -26.556 -49.357  1.00 12.34 ? 166  THR A CA  1 
ATOM   1045 C C   . THR A 1 146 ? 5.324   -25.353 -50.290  1.00 12.32 ? 166  THR A C   1 
ATOM   1046 O O   . THR A 1 146 ? 5.600   -25.478 -51.488  1.00 13.46 ? 166  THR A O   1 
ATOM   1047 C CB  . THR A 1 146 ? 6.795   -27.155 -49.368  1.00 12.91 ? 166  THR A CB  1 
ATOM   1048 O OG1 . THR A 1 146 ? 6.810   -28.366 -48.601  1.00 13.61 ? 166  THR A OG1 1 
ATOM   1049 C CG2 . THR A 1 146 ? 7.805   -26.175 -48.777  1.00 13.58 ? 166  THR A CG2 1 
ATOM   1050 N N   . LEU A 1 147 ? 4.959   -24.198 -49.740  1.00 11.42 ? 167  LEU A N   1 
ATOM   1051 C CA  . LEU A 1 147 ? 4.842   -22.968 -50.517  1.00 10.51 ? 167  LEU A CA  1 
ATOM   1052 C C   . LEU A 1 147 ? 6.127   -22.153 -50.381  1.00 10.53 ? 167  LEU A C   1 
ATOM   1053 O O   . LEU A 1 147 ? 6.601   -21.935 -49.265  1.00 10.40 ? 167  LEU A O   1 
ATOM   1054 C CB  . LEU A 1 147 ? 3.651   -22.138 -50.028  1.00 10.64 ? 167  LEU A CB  1 
ATOM   1055 C CG  . LEU A 1 147 ? 2.345   -22.893 -49.756  1.00 11.15 ? 167  LEU A CG  1 
ATOM   1056 C CD1 . LEU A 1 147 ? 1.248   -21.931 -49.324  1.00 11.26 ? 167  LEU A CD1 1 
ATOM   1057 C CD2 . LEU A 1 147 ? 1.907   -23.697 -50.970  1.00 11.86 ? 167  LEU A CD2 1 
ATOM   1058 N N   . PRO A 1 148 ? 6.699   -21.695 -51.511  1.00 10.62 ? 168  PRO A N   1 
ATOM   1059 C CA  . PRO A 1 148 ? 7.876   -20.827 -51.479  1.00 10.83 ? 168  PRO A CA  1 
ATOM   1060 C C   . PRO A 1 148 ? 7.439   -19.402 -51.150  1.00 10.54 ? 168  PRO A C   1 
ATOM   1061 O O   . PRO A 1 148 ? 7.604   -18.483 -51.952  1.00 11.24 ? 168  PRO A O   1 
ATOM   1062 C CB  . PRO A 1 148 ? 8.418   -20.939 -52.904  1.00 10.95 ? 168  PRO A CB  1 
ATOM   1063 C CG  . PRO A 1 148 ? 7.194   -21.126 -53.733  1.00 10.98 ? 168  PRO A CG  1 
ATOM   1064 C CD  . PRO A 1 148 ? 6.241   -21.935 -52.894  1.00 10.92 ? 168  PRO A CD  1 
ATOM   1065 N N   . ALA A 1 149 ? 6.907   -19.237 -49.943  1.00 10.25 ? 169  ALA A N   1 
ATOM   1066 C CA  . ALA A 1 149 ? 6.020   -18.123 -49.635  1.00 9.98  ? 169  ALA A CA  1 
ATOM   1067 C C   . ALA A 1 149 ? 6.702   -16.768 -49.566  1.00 9.66  ? 169  ALA A C   1 
ATOM   1068 O O   . ALA A 1 149 ? 6.132   -15.767 -50.003  1.00 9.88  ? 169  ALA A O   1 
ATOM   1069 C CB  . ALA A 1 149 ? 5.278   -18.396 -48.334  1.00 9.98  ? 169  ALA A CB  1 
ATOM   1070 N N   . HIS A 1 150 ? 7.910   -16.738 -49.012  1.00 9.62  ? 170  HIS A N   1 
ATOM   1071 C CA  . HIS A 1 150 ? 8.581   -15.477 -48.711  1.00 9.58  ? 170  HIS A CA  1 
ATOM   1072 C C   . HIS A 1 150 ? 10.095  -15.571 -48.890  1.00 9.82  ? 170  HIS A C   1 
ATOM   1073 O O   . HIS A 1 150 ? 10.634  -16.651 -49.133  1.00 10.09 ? 170  HIS A O   1 
ATOM   1074 C CB  . HIS A 1 150 ? 8.221   -15.046 -47.284  1.00 9.43  ? 170  HIS A CB  1 
ATOM   1075 C CG  . HIS A 1 150 ? 6.787   -14.644 -47.128  1.00 9.24  ? 170  HIS A CG  1 
ATOM   1076 N ND1 . HIS A 1 150 ? 6.295   -13.449 -47.606  1.00 9.22  ? 170  HIS A ND1 1 
ATOM   1077 C CD2 . HIS A 1 150 ? 5.738   -15.276 -46.549  1.00 9.42  ? 170  HIS A CD2 1 
ATOM   1078 C CE1 . HIS A 1 150 ? 5.006   -13.362 -47.331  1.00 9.34  ? 170  HIS A CE1 1 
ATOM   1079 N NE2 . HIS A 1 150 ? 4.643   -14.459 -46.693  1.00 9.30  ? 170  HIS A NE2 1 
ATOM   1080 N N   . SER A 1 151 ? 10.767  -14.425 -48.799  1.00 10.03 ? 171  SER A N   1 
ATOM   1081 C CA  . SER A 1 151 ? 12.226  -14.361 -48.909  1.00 10.55 ? 171  SER A CA  1 
ATOM   1082 C C   . SER A 1 151 ? 12.884  -14.010 -47.568  1.00 10.85 ? 171  SER A C   1 
ATOM   1083 O O   . SER A 1 151 ? 14.018  -13.528 -47.525  1.00 12.00 ? 171  SER A O   1 
ATOM   1084 C CB  . SER A 1 151 ? 12.625  -13.348 -49.990  1.00 10.77 ? 171  SER A CB  1 
ATOM   1085 O OG  . SER A 1 151 ? 12.150  -12.049 -49.688  1.00 10.97 ? 171  SER A OG  1 
ATOM   1086 N N   . ASP A 1 152 ? 12.162  -14.274 -46.480  1.00 10.69 ? 172  ASP A N   1 
ATOM   1087 C CA  . ASP A 1 152 ? 12.625  -14.014 -45.120  1.00 10.42 ? 172  ASP A CA  1 
ATOM   1088 C C   . ASP A 1 152 ? 11.739  -14.839 -44.187  1.00 9.75  ? 172  ASP A C   1 
ATOM   1089 O O   . ASP A 1 152 ? 10.762  -15.437 -44.644  1.00 9.62  ? 172  ASP A O   1 
ATOM   1090 C CB  . ASP A 1 152 ? 12.522  -12.519 -44.793  1.00 11.33 ? 172  ASP A CB  1 
ATOM   1091 C CG  . ASP A 1 152 ? 13.790  -11.747 -45.134  1.00 12.84 ? 172  ASP A CG  1 
ATOM   1092 O OD1 . ASP A 1 152 ? 14.898  -12.215 -44.792  1.00 13.94 ? 172  ASP A OD1 1 
ATOM   1093 O OD2 . ASP A 1 152 ? 13.676  -10.657 -45.735  1.00 14.45 ? 172  ASP A OD2 1 
ATOM   1094 N N   . PRO A 1 153 ? 12.072  -14.887 -42.884  1.00 9.50  ? 173  PRO A N   1 
ATOM   1095 C CA  . PRO A 1 153 ? 11.242  -15.656 -41.956  1.00 8.95  ? 173  PRO A CA  1 
ATOM   1096 C C   . PRO A 1 153 ? 9.749   -15.336 -42.036  1.00 8.38  ? 173  PRO A C   1 
ATOM   1097 O O   . PRO A 1 153 ? 9.362   -14.173 -42.202  1.00 7.79  ? 173  PRO A O   1 
ATOM   1098 C CB  . PRO A 1 153 ? 11.803  -15.262 -40.591  1.00 9.32  ? 173  PRO A CB  1 
ATOM   1099 C CG  . PRO A 1 153 ? 13.244  -15.009 -40.861  1.00 9.71  ? 173  PRO A CG  1 
ATOM   1100 C CD  . PRO A 1 153 ? 13.283  -14.367 -42.221  1.00 9.84  ? 173  PRO A CD  1 
ATOM   1101 N N   . VAL A 1 154 ? 8.934   -16.381 -41.920  1.00 7.82  ? 174  VAL A N   1 
ATOM   1102 C CA  . VAL A 1 154 ? 7.479   -16.266 -41.951  1.00 7.89  ? 174  VAL A CA  1 
ATOM   1103 C C   . VAL A 1 154 ? 6.970   -16.084 -40.520  1.00 7.84  ? 174  VAL A C   1 
ATOM   1104 O O   . VAL A 1 154 ? 7.040   -17.010 -39.711  1.00 8.63  ? 174  VAL A O   1 
ATOM   1105 C CB  . VAL A 1 154 ? 6.838   -17.519 -42.584  1.00 7.82  ? 174  VAL A CB  1 
ATOM   1106 C CG1 . VAL A 1 154 ? 5.330   -17.354 -42.703  1.00 7.80  ? 174  VAL A CG1 1 
ATOM   1107 C CG2 . VAL A 1 154 ? 7.443   -17.796 -43.953  1.00 8.20  ? 174  VAL A CG2 1 
ATOM   1108 N N   . SER A 1 155 ? 6.453   -14.895 -40.219  1.00 7.60  ? 175  SER A N   1 
ATOM   1109 C CA  . SER A 1 155 ? 6.095   -14.520 -38.848  1.00 7.63  ? 175  SER A CA  1 
ATOM   1110 C C   . SER A 1 155 ? 4.709   -14.986 -38.394  1.00 7.51  ? 175  SER A C   1 
ATOM   1111 O O   . SER A 1 155 ? 4.481   -15.151 -37.193  1.00 8.42  ? 175  SER A O   1 
ATOM   1112 C CB  . SER A 1 155 ? 6.191   -13.003 -38.683  1.00 7.60  ? 175  SER A CB  1 
ATOM   1113 O OG  . SER A 1 155 ? 5.452   -12.337 -39.690  1.00 7.86  ? 175  SER A OG  1 
ATOM   1114 N N   . ALA A 1 156 ? 3.789   -15.183 -39.337  1.00 7.69  ? 176  ALA A N   1 
ATOM   1115 C CA  . ALA A 1 156 ? 2.431   -15.611 -39.008  1.00 7.60  ? 176  ALA A CA  1 
ATOM   1116 C C   . ALA A 1 156 ? 1.737   -16.289 -40.185  1.00 7.79  ? 176  ALA A C   1 
ATOM   1117 O O   . ALA A 1 156 ? 2.019   -15.980 -41.345  1.00 7.96  ? 176  ALA A O   1 
ATOM   1118 C CB  . ALA A 1 156 ? 1.608   -14.426 -38.539  1.00 7.41  ? 176  ALA A CB  1 
ATOM   1119 N N   . VAL A 1 157 ? 0.841   -17.220 -39.860  1.00 7.67  ? 177  VAL A N   1 
ATOM   1120 C CA  . VAL A 1 157 ? -0.013  -17.897 -40.832  1.00 7.57  ? 177  VAL A CA  1 
ATOM   1121 C C   . VAL A 1 157 ? -1.390  -18.115 -40.210  1.00 7.76  ? 177  VAL A C   1 
ATOM   1122 O O   . VAL A 1 157 ? -1.496  -18.417 -39.020  1.00 8.80  ? 177  VAL A O   1 
ATOM   1123 C CB  . VAL A 1 157 ? 0.568   -19.261 -41.273  1.00 7.74  ? 177  VAL A CB  1 
ATOM   1124 C CG1 . VAL A 1 157 ? 1.817   -19.064 -42.119  1.00 8.22  ? 177  VAL A CG1 1 
ATOM   1125 C CG2 . VAL A 1 157 ? 0.869   -20.152 -40.074  1.00 7.80  ? 177  VAL A CG2 1 
ATOM   1126 N N   . HIS A 1 158 ? -2.441  -17.962 -41.011  1.00 7.81  ? 178  HIS A N   1 
ATOM   1127 C CA  . HIS A 1 158 ? -3.811  -18.034 -40.506  1.00 8.07  ? 178  HIS A CA  1 
ATOM   1128 C C   . HIS A 1 158 ? -4.770  -18.416 -41.634  1.00 8.81  ? 178  HIS A C   1 
ATOM   1129 O O   . HIS A 1 158 ? -4.606  -17.961 -42.769  1.00 9.30  ? 178  HIS A O   1 
ATOM   1130 C CB  . HIS A 1 158 ? -4.198  -16.679 -39.904  1.00 8.46  ? 178  HIS A CB  1 
ATOM   1131 C CG  . HIS A 1 158 ? -5.483  -16.688 -39.135  1.00 9.27  ? 178  HIS A CG  1 
ATOM   1132 N ND1 . HIS A 1 158 ? -6.592  -15.983 -39.542  1.00 9.86  ? 178  HIS A ND1 1 
ATOM   1133 C CD2 . HIS A 1 158 ? -5.832  -17.298 -37.977  1.00 9.77  ? 178  HIS A CD2 1 
ATOM   1134 C CE1 . HIS A 1 158 ? -7.572  -16.161 -38.675  1.00 10.17 ? 178  HIS A CE1 1 
ATOM   1135 N NE2 . HIS A 1 158 ? -7.137  -16.957 -37.716  1.00 10.17 ? 178  HIS A NE2 1 
ATOM   1136 N N   . PHE A 1 159 ? -5.749  -19.266 -41.321  1.00 8.92  ? 179  PHE A N   1 
ATOM   1137 C CA  . PHE A 1 159 ? -6.820  -19.615 -42.262  1.00 9.30  ? 179  PHE A CA  1 
ATOM   1138 C C   . PHE A 1 159 ? -7.991  -18.650 -42.122  1.00 9.87  ? 179  PHE A C   1 
ATOM   1139 O O   . PHE A 1 159 ? -8.237  -18.114 -41.039  1.00 10.23 ? 179  PHE A O   1 
ATOM   1140 C CB  . PHE A 1 159 ? -7.346  -21.032 -42.007  1.00 9.22  ? 179  PHE A CB  1 
ATOM   1141 C CG  . PHE A 1 159 ? -6.466  -22.123 -42.538  1.00 9.14  ? 179  PHE A CG  1 
ATOM   1142 C CD1 . PHE A 1 159 ? -6.544  -22.506 -43.870  1.00 9.03  ? 179  PHE A CD1 1 
ATOM   1143 C CD2 . PHE A 1 159 ? -5.587  -22.798 -41.700  1.00 9.28  ? 179  PHE A CD2 1 
ATOM   1144 C CE1 . PHE A 1 159 ? -5.748  -23.526 -44.359  1.00 8.91  ? 179  PHE A CE1 1 
ATOM   1145 C CE2 . PHE A 1 159 ? -4.789  -23.819 -42.183  1.00 9.35  ? 179  PHE A CE2 1 
ATOM   1146 C CZ  . PHE A 1 159 ? -4.866  -24.183 -43.516  1.00 9.31  ? 179  PHE A CZ  1 
ATOM   1147 N N   . ASN A 1 160 ? -8.723  -18.443 -43.216  1.00 10.20 ? 180  ASN A N   1 
ATOM   1148 C CA  . ASN A 1 160 ? -9.961  -17.656 -43.179  1.00 11.21 ? 180  ASN A CA  1 
ATOM   1149 C C   . ASN A 1 160 ? -11.142 -18.507 -42.699  1.00 11.98 ? 180  ASN A C   1 
ATOM   1150 O O   . ASN A 1 160 ? -10.977 -19.694 -42.413  1.00 11.83 ? 180  ASN A O   1 
ATOM   1151 C CB  . ASN A 1 160 ? -10.249 -17.010 -44.544  1.00 11.20 ? 180  ASN A CB  1 
ATOM   1152 C CG  . ASN A 1 160 ? -10.667 -18.014 -45.603  1.00 10.75 ? 180  ASN A CG  1 
ATOM   1153 O OD1 . ASN A 1 160 ? -10.314 -19.192 -45.539  1.00 10.82 ? 180  ASN A OD1 1 
ATOM   1154 N ND2 . ASN A 1 160 ? -11.409 -17.542 -46.601  1.00 11.99 ? 180  ASN A ND2 1 
ATOM   1155 N N   . ARG A 1 161 ? -12.328 -17.904 -42.628  1.00 13.65 ? 181  ARG A N   1 
ATOM   1156 C CA  . ARG A 1 161 ? -13.491 -18.530 -41.981  1.00 15.32 ? 181  ARG A CA  1 
ATOM   1157 C C   . ARG A 1 161 ? -13.925 -19.885 -42.561  1.00 14.76 ? 181  ARG A C   1 
ATOM   1158 O O   . ARG A 1 161 ? -14.428 -20.731 -41.821  1.00 15.58 ? 181  ARG A O   1 
ATOM   1159 C CB  . ARG A 1 161 ? -14.683 -17.564 -41.976  1.00 17.47 ? 181  ARG A CB  1 
ATOM   1160 C CG  . ARG A 1 161 ? -15.385 -17.411 -43.319  1.00 19.07 ? 181  ARG A CG  1 
ATOM   1161 C CD  . ARG A 1 161 ? -16.243 -16.154 -43.385  1.00 21.87 ? 181  ARG A CD  1 
ATOM   1162 N NE  . ARG A 1 161 ? -17.139 -16.012 -42.236  1.00 24.21 ? 181  ARG A NE  1 
ATOM   1163 C CZ  . ARG A 1 161 ? -18.020 -15.024 -42.085  1.00 24.93 ? 181  ARG A CZ  1 
ATOM   1164 N NH1 . ARG A 1 161 ? -18.149 -14.079 -43.011  1.00 26.61 ? 181  ARG A NH1 1 
ATOM   1165 N NH2 . ARG A 1 161 ? -18.785 -14.984 -40.999  1.00 27.16 ? 181  ARG A NH2 1 
ATOM   1166 N N   . ASP A 1 162 ? -13.745 -20.089 -43.866  1.00 14.45 ? 182  ASP A N   1 
ATOM   1167 C CA  . ASP A 1 162 ? -14.116 -21.364 -44.506  1.00 14.68 ? 182  ASP A CA  1 
ATOM   1168 C C   . ASP A 1 162 ? -12.910 -22.233 -44.895  1.00 13.28 ? 182  ASP A C   1 
ATOM   1169 O O   . ASP A 1 162 ? -13.071 -23.270 -45.540  1.00 12.89 ? 182  ASP A O   1 
ATOM   1170 C CB  . ASP A 1 162 ? -15.041 -21.128 -45.715  1.00 16.21 ? 182  ASP A CB  1 
ATOM   1171 C CG  . ASP A 1 162 ? -14.358 -20.399 -46.867  1.00 17.65 ? 182  ASP A CG  1 
ATOM   1172 O OD1 . ASP A 1 162 ? -13.254 -19.847 -46.683  1.00 18.04 ? 182  ASP A OD1 1 
ATOM   1173 O OD2 . ASP A 1 162 ? -14.947 -20.374 -47.970  1.00 19.38 ? 182  ASP A OD2 1 
ATOM   1174 N N   . GLY A 1 163 ? -11.708 -21.811 -44.497  1.00 12.55 ? 183  GLY A N   1 
ATOM   1175 C CA  . GLY A 1 163 ? -10.488 -22.569 -44.766  1.00 12.59 ? 183  GLY A CA  1 
ATOM   1176 C C   . GLY A 1 163 ? -9.984  -22.531 -46.202  1.00 12.11 ? 183  GLY A C   1 
ATOM   1177 O O   . GLY A 1 163 ? -9.002  -23.195 -46.526  1.00 12.41 ? 183  GLY A O   1 
ATOM   1178 N N   . SER A 1 164 ? -10.637 -21.750 -47.060  1.00 12.15 ? 184  SER A N   1 
ATOM   1179 C CA  . SER A 1 164 ? -10.286 -21.706 -48.479  1.00 11.64 ? 184  SER A CA  1 
ATOM   1180 C C   . SER A 1 164 ? -9.042  -20.859 -48.740  1.00 11.05 ? 184  SER A C   1 
ATOM   1181 O O   . SER A 1 164 ? -8.386  -21.027 -49.767  1.00 11.44 ? 184  SER A O   1 
ATOM   1182 C CB  . SER A 1 164 ? -11.461 -21.177 -49.308  1.00 12.18 ? 184  SER A CB  1 
ATOM   1183 O OG  . SER A 1 164 ? -11.784 -19.847 -48.949  1.00 13.31 ? 184  SER A OG  1 
ATOM   1184 N N   . LEU A 1 165 ? -8.726  -19.954 -47.812  1.00 10.49 ? 185  LEU A N   1 
ATOM   1185 C CA  . LEU A 1 165 ? -7.571  -19.066 -47.941  1.00 9.70  ? 185  LEU A CA  1 
ATOM   1186 C C   . LEU A 1 165 ? -6.635  -19.158 -46.748  1.00 9.44  ? 185  LEU A C   1 
ATOM   1187 O O   . LEU A 1 165 ? -7.058  -19.450 -45.630  1.00 10.33 ? 185  LEU A O   1 
ATOM   1188 C CB  . LEU A 1 165 ? -8.010  -17.607 -48.077  1.00 9.62  ? 185  LEU A CB  1 
ATOM   1189 C CG  . LEU A 1 165 ? -8.869  -17.215 -49.276  1.00 9.98  ? 185  LEU A CG  1 
ATOM   1190 C CD1 . LEU A 1 165 ? -9.146  -15.724 -49.219  1.00 10.26 ? 185  LEU A CD1 1 
ATOM   1191 C CD2 . LEU A 1 165 ? -8.193  -17.582 -50.588  1.00 10.21 ? 185  LEU A CD2 1 
ATOM   1192 N N   . ILE A 1 166 ? -5.361  -18.897 -47.013  1.00 8.68  ? 186  ILE A N   1 
ATOM   1193 C CA  . ILE A 1 166 ? -4.347  -18.735 -45.985  1.00 8.55  ? 186  ILE A CA  1 
ATOM   1194 C C   . ILE A 1 166 ? -3.721  -17.356 -46.165  1.00 8.68  ? 186  ILE A C   1 
ATOM   1195 O O   . ILE A 1 166 ? -3.423  -16.955 -47.291  1.00 9.64  ? 186  ILE A O   1 
ATOM   1196 C CB  . ILE A 1 166 ? -3.242  -19.804 -46.115  1.00 8.59  ? 186  ILE A CB  1 
ATOM   1197 C CG1 . ILE A 1 166 ? -3.791  -21.190 -45.772  1.00 8.73  ? 186  ILE A CG1 1 
ATOM   1198 C CG2 . ILE A 1 166 ? -2.046  -19.470 -45.226  1.00 8.59  ? 186  ILE A CG2 1 
ATOM   1199 C CD1 . ILE A 1 166 ? -2.939  -22.323 -46.297  1.00 8.96  ? 186  ILE A CD1 1 
ATOM   1200 N N   . VAL A 1 167 ? -3.514  -16.637 -45.065  1.00 8.37  ? 187  VAL A N   1 
ATOM   1201 C CA  . VAL A 1 167 ? -2.733  -15.403 -45.104  1.00 7.91  ? 187  VAL A CA  1 
ATOM   1202 C C   . VAL A 1 167 ? -1.408  -15.638 -44.384  1.00 8.02  ? 187  VAL A C   1 
ATOM   1203 O O   . VAL A 1 167 ? -1.376  -16.254 -43.319  1.00 8.74  ? 187  VAL A O   1 
ATOM   1204 C CB  . VAL A 1 167 ? -3.490  -14.180 -44.522  1.00 8.12  ? 187  VAL A CB  1 
ATOM   1205 C CG1 . VAL A 1 167 ? -3.782  -14.336 -43.033  1.00 8.46  ? 187  VAL A CG1 1 
ATOM   1206 C CG2 . VAL A 1 167 ? -2.705  -12.898 -44.784  1.00 8.31  ? 187  VAL A CG2 1 
ATOM   1207 N N   . SER A 1 168 ? -0.321  -15.173 -44.993  1.00 7.87  ? 188  SER A N   1 
ATOM   1208 C CA  . SER A 1 168 ? 1.012   -15.293 -44.412  1.00 7.70  ? 188  SER A CA  1 
ATOM   1209 C C   . SER A 1 168 ? 1.682   -13.926 -44.363  1.00 7.86  ? 188  SER A C   1 
ATOM   1210 O O   . SER A 1 168 ? 1.401   -13.059 -45.191  1.00 8.34  ? 188  SER A O   1 
ATOM   1211 C CB  . SER A 1 168 ? 1.868   -16.275 -45.219  1.00 8.01  ? 188  SER A CB  1 
ATOM   1212 O OG  . SER A 1 168 ? 2.109   -15.802 -46.534  1.00 8.31  ? 188  SER A OG  1 
ATOM   1213 N N   . SER A 1 169 ? 2.563   -13.746 -43.385  1.00 7.89  ? 189  SER A N   1 
ATOM   1214 C CA  . SER A 1 169 ? 3.342   -12.517 -43.248  1.00 7.70  ? 189  SER A CA  1 
ATOM   1215 C C   . SER A 1 169 ? 4.807   -12.853 -43.022  1.00 7.72  ? 189  SER A C   1 
ATOM   1216 O O   . SER A 1 169 ? 5.140   -13.950 -42.568  1.00 7.90  ? 189  SER A O   1 
ATOM   1217 C CB  . SER A 1 169 ? 2.825   -11.668 -42.089  1.00 7.56  ? 189  SER A CB  1 
ATOM   1218 O OG  . SER A 1 169 ? 2.847   -12.397 -40.874  1.00 7.83  ? 189  SER A OG  1 
ATOM   1219 N N   . SER A 1 170 ? 5.681   -11.901 -43.333  1.00 7.96  ? 190  SER A N   1 
ATOM   1220 C CA  . SER A 1 170 ? 7.117   -12.139 -43.263  1.00 8.04  ? 190  SER A CA  1 
ATOM   1221 C C   . SER A 1 170 ? 7.916   -10.862 -43.043  1.00 8.30  ? 190  SER A C   1 
ATOM   1222 O O   . SER A 1 170 ? 7.443   -9.756  -43.320  1.00 7.55  ? 190  SER A O   1 
ATOM   1223 C CB  . SER A 1 170 ? 7.571   -12.831 -44.552  1.00 8.49  ? 190  SER A CB  1 
ATOM   1224 O OG  . SER A 1 170 ? 8.977   -12.836 -44.698  1.00 8.99  ? 190  SER A OG  1 
ATOM   1225 N N   . TYR A 1 171 ? 9.149   -11.035 -42.567  1.00 8.64  ? 191  TYR A N   1 
ATOM   1226 C CA  . TYR A 1 171 ? 10.077  -9.918  -42.419  1.00 9.15  ? 191  TYR A CA  1 
ATOM   1227 C C   . TYR A 1 171 ? 10.484  -9.315  -43.766  1.00 9.34  ? 191  TYR A C   1 
ATOM   1228 O O   . TYR A 1 171 ? 11.080  -8.241  -43.797  1.00 9.84  ? 191  TYR A O   1 
ATOM   1229 C CB  . TYR A 1 171 ? 11.340  -10.331 -41.651  1.00 10.00 ? 191  TYR A CB  1 
ATOM   1230 C CG  . TYR A 1 171 ? 11.116  -10.880 -40.255  1.00 10.56 ? 191  TYR A CG  1 
ATOM   1231 C CD1 . TYR A 1 171 ? 9.956   -10.596 -39.534  1.00 11.41 ? 191  TYR A CD1 1 
ATOM   1232 C CD2 . TYR A 1 171 ? 12.090  -11.663 -39.643  1.00 10.89 ? 191  TYR A CD2 1 
ATOM   1233 C CE1 . TYR A 1 171 ? 9.765   -11.098 -38.258  1.00 12.66 ? 191  TYR A CE1 1 
ATOM   1234 C CE2 . TYR A 1 171 ? 11.908  -12.170 -38.365  1.00 11.80 ? 191  TYR A CE2 1 
ATOM   1235 C CZ  . TYR A 1 171 ? 10.747  -11.882 -37.677  1.00 12.71 ? 191  TYR A CZ  1 
ATOM   1236 O OH  . TYR A 1 171 ? 10.565  -12.379 -36.407  1.00 14.97 ? 191  TYR A OH  1 
ATOM   1237 N N   . ASP A 1 172 ? 10.163  -9.995  -44.872  1.00 8.91  ? 192  ASP A N   1 
ATOM   1238 C CA  . ASP A 1 172 ? 10.365  -9.427  -46.212  1.00 9.26  ? 192  ASP A CA  1 
ATOM   1239 C C   . ASP A 1 172 ? 9.444   -8.232  -46.509  1.00 9.42  ? 192  ASP A C   1 
ATOM   1240 O O   . ASP A 1 172 ? 9.587   -7.576  -47.545  1.00 10.11 ? 192  ASP A O   1 
ATOM   1241 C CB  . ASP A 1 172 ? 10.239  -10.505 -47.311  1.00 9.56  ? 192  ASP A CB  1 
ATOM   1242 C CG  . ASP A 1 172 ? 8.820   -11.060 -47.470  1.00 9.87  ? 192  ASP A CG  1 
ATOM   1243 O OD1 . ASP A 1 172 ? 7.858   -10.523 -46.880  1.00 9.81  ? 192  ASP A OD1 1 
ATOM   1244 O OD2 . ASP A 1 172 ? 8.667   -12.054 -48.217  1.00 9.98  ? 192  ASP A OD2 1 
ATOM   1245 N N   . GLY A 1 173 ? 8.491   -7.972  -45.614  1.00 9.10  ? 193  GLY A N   1 
ATOM   1246 C CA  . GLY A 1 173 ? 7.626   -6.807  -45.710  1.00 9.07  ? 193  GLY A CA  1 
ATOM   1247 C C   . GLY A 1 173 ? 6.302   -7.082  -46.396  1.00 8.87  ? 193  GLY A C   1 
ATOM   1248 O O   . GLY A 1 173 ? 5.515   -6.161  -46.615  1.00 8.96  ? 193  GLY A O   1 
ATOM   1249 N N   . LEU A 1 174 ? 6.043   -8.347  -46.719  1.00 8.84  ? 194  LEU A N   1 
ATOM   1250 C CA  . LEU A 1 174 ? 4.855   -8.718  -47.477  1.00 9.19  ? 194  LEU A CA  1 
ATOM   1251 C C   . LEU A 1 174 ? 3.854   -9.493  -46.641  1.00 9.46  ? 194  LEU A C   1 
ATOM   1252 O O   . LEU A 1 174 ? 4.227   -10.231 -45.724  1.00 9.70  ? 194  LEU A O   1 
ATOM   1253 C CB  . LEU A 1 174 ? 5.238   -9.581  -48.679  1.00 9.71  ? 194  LEU A CB  1 
ATOM   1254 C CG  . LEU A 1 174 ? 6.262   -9.016  -49.661  1.00 10.21 ? 194  LEU A CG  1 
ATOM   1255 C CD1 . LEU A 1 174 ? 6.530   -10.038 -50.753  1.00 10.95 ? 194  LEU A CD1 1 
ATOM   1256 C CD2 . LEU A 1 174 ? 5.800   -7.698  -50.259  1.00 11.03 ? 194  LEU A CD2 1 
ATOM   1257 N N   . CYS A 1 175 ? 2.579   -9.294  -46.963  1.00 9.89  ? 195  CYS A N   1 
ATOM   1258 C CA  . CYS A 1 175 ? 1.528   -10.239 -46.626  1.00 9.85  ? 195  CYS A CA  1 
ATOM   1259 C C   . CYS A 1 175 ? 1.084   -10.883 -47.926  1.00 9.59  ? 195  CYS A C   1 
ATOM   1260 O O   . CYS A 1 175 ? 0.995   -10.207 -48.954  1.00 9.73  ? 195  CYS A O   1 
ATOM   1261 C CB  . CYS A 1 175 ? 0.338   -9.540  -45.980  1.00 10.53 ? 195  CYS A CB  1 
ATOM   1262 S SG  . CYS A 1 175 ? 0.670   -8.849  -44.351  1.00 13.11 ? 195  CYS A SG  1 
ATOM   1263 N N   . ARG A 1 176 ? 0.813   -12.183 -47.888  1.00 9.11  ? 196  ARG A N   1 
ATOM   1264 C CA  . ARG A 1 176 ? 0.342   -12.897 -49.068  1.00 8.86  ? 196  ARG A CA  1 
ATOM   1265 C C   . ARG A 1 176 ? -0.881  -13.741 -48.754  1.00 9.29  ? 196  ARG A C   1 
ATOM   1266 O O   . ARG A 1 176 ? -0.991  -14.304 -47.663  1.00 9.57  ? 196  ARG A O   1 
ATOM   1267 C CB  . ARG A 1 176 ? 1.471   -13.739 -49.664  1.00 8.54  ? 196  ARG A CB  1 
ATOM   1268 C CG  . ARG A 1 176 ? 2.410   -12.895 -50.505  1.00 8.85  ? 196  ARG A CG  1 
ATOM   1269 C CD  . ARG A 1 176 ? 3.615   -13.644 -51.038  1.00 9.17  ? 196  ARG A CD  1 
ATOM   1270 N NE  . ARG A 1 176 ? 4.237   -12.886 -52.126  1.00 8.79  ? 196  ARG A NE  1 
ATOM   1271 C CZ  . ARG A 1 176 ? 5.501   -13.004 -52.531  1.00 9.65  ? 196  ARG A CZ  1 
ATOM   1272 N NH1 . ARG A 1 176 ? 6.339   -13.850 -51.939  1.00 10.06 ? 196  ARG A NH1 1 
ATOM   1273 N NH2 . ARG A 1 176 ? 5.935   -12.253 -53.537  1.00 10.51 ? 196  ARG A NH2 1 
ATOM   1274 N N   . ILE A 1 177 ? -1.806  -13.789 -49.713  1.00 9.35  ? 197  ILE A N   1 
ATOM   1275 C CA  . ILE A 1 177 ? -3.020  -14.594 -49.609  1.00 9.94  ? 197  ILE A CA  1 
ATOM   1276 C C   . ILE A 1 177 ? -2.869  -15.800 -50.532  1.00 9.98  ? 197  ILE A C   1 
ATOM   1277 O O   . ILE A 1 177 ? -2.552  -15.647 -51.716  1.00 10.49 ? 197  ILE A O   1 
ATOM   1278 C CB  . ILE A 1 177 ? -4.281  -13.796 -50.012  1.00 10.55 ? 197  ILE A CB  1 
ATOM   1279 C CG1 . ILE A 1 177 ? -4.417  -12.504 -49.191  1.00 11.36 ? 197  ILE A CG1 1 
ATOM   1280 C CG2 . ILE A 1 177 ? -5.533  -14.652 -49.850  1.00 11.18 ? 197  ILE A CG2 1 
ATOM   1281 C CD1 . ILE A 1 177 ? -4.707  -12.709 -47.719  1.00 11.74 ? 197  ILE A CD1 1 
ATOM   1282 N N   . TRP A 1 178 ? -3.114  -16.990 -49.986  1.00 9.82  ? 198  TRP A N   1 
ATOM   1283 C CA  . TRP A 1 178 ? -2.899  -18.249 -50.696  1.00 9.86  ? 198  TRP A CA  1 
ATOM   1284 C C   . TRP A 1 178 ? -4.182  -19.052 -50.802  1.00 10.44 ? 198  TRP A C   1 
ATOM   1285 O O   . TRP A 1 178 ? -4.941  -19.141 -49.841  1.00 11.25 ? 198  TRP A O   1 
ATOM   1286 C CB  . TRP A 1 178 ? -1.868  -19.100 -49.952  1.00 9.87  ? 198  TRP A CB  1 
ATOM   1287 C CG  . TRP A 1 178 ? -0.592  -18.395 -49.708  1.00 9.78  ? 198  TRP A CG  1 
ATOM   1288 C CD1 . TRP A 1 178 ? -0.273  -17.617 -48.632  1.00 9.89  ? 198  TRP A CD1 1 
ATOM   1289 C CD2 . TRP A 1 178 ? 0.552   -18.394 -50.561  1.00 9.78  ? 198  TRP A CD2 1 
ATOM   1290 N NE1 . TRP A 1 178 ? 1.005   -17.131 -48.764  1.00 10.10 ? 198  TRP A NE1 1 
ATOM   1291 C CE2 . TRP A 1 178 ? 1.533   -17.591 -49.941  1.00 9.91  ? 198  TRP A CE2 1 
ATOM   1292 C CE3 . TRP A 1 178 ? 0.844   -18.995 -51.790  1.00 9.83  ? 198  TRP A CE3 1 
ATOM   1293 C CZ2 . TRP A 1 178 ? 2.784   -17.372 -50.511  1.00 10.50 ? 198  TRP A CZ2 1 
ATOM   1294 C CZ3 . TRP A 1 178 ? 2.091   -18.778 -52.356  1.00 10.46 ? 198  TRP A CZ3 1 
ATOM   1295 C CH2 . TRP A 1 178 ? 3.044   -17.971 -51.717  1.00 10.86 ? 198  TRP A CH2 1 
ATOM   1296 N N   . ASP A 1 179 ? -4.413  -19.642 -51.972  1.00 10.59 ? 199  ASP A N   1 
ATOM   1297 C CA  . ASP A 1 179 ? -5.487  -20.606 -52.145  1.00 11.16 ? 199  ASP A CA  1 
ATOM   1298 C C   . ASP A 1 179 ? -5.067  -21.912 -51.482  1.00 10.65 ? 199  ASP A C   1 
ATOM   1299 O O   . ASP A 1 179 ? -4.062  -22.504 -51.865  1.00 11.07 ? 199  ASP A O   1 
ATOM   1300 C CB  . ASP A 1 179 ? -5.757  -20.842 -53.630  1.00 11.76 ? 199  ASP A CB  1 
ATOM   1301 C CG  . ASP A 1 179 ? -6.939  -21.762 -53.868  1.00 12.75 ? 199  ASP A CG  1 
ATOM   1302 O OD1 . ASP A 1 179 ? -8.082  -21.353 -53.571  1.00 13.24 ? 199  ASP A OD1 1 
ATOM   1303 O OD2 . ASP A 1 179 ? -6.722  -22.892 -54.351  1.00 14.51 ? 199  ASP A OD2 1 
ATOM   1304 N N   . THR A 1 180 ? -5.835  -22.352 -50.487  1.00 10.61 ? 200  THR A N   1 
ATOM   1305 C CA  . THR A 1 180 ? -5.515  -23.567 -49.738  1.00 11.21 ? 200  THR A CA  1 
ATOM   1306 C C   . THR A 1 180 ? -5.463  -24.812 -50.627  1.00 11.13 ? 200  THR A C   1 
ATOM   1307 O O   . THR A 1 180 ? -4.545  -25.623 -50.508  1.00 11.49 ? 200  THR A O   1 
ATOM   1308 C CB  . THR A 1 180 ? -6.534  -23.796 -48.606  1.00 11.40 ? 200  THR A CB  1 
ATOM   1309 O OG1 . THR A 1 180 ? -6.536  -22.656 -47.739  1.00 11.05 ? 200  THR A OG1 1 
ATOM   1310 C CG2 . THR A 1 180 ? -6.191  -25.044 -47.796  1.00 11.15 ? 200  THR A CG2 1 
ATOM   1311 N N   . ALA A 1 181 ? -6.444  -24.950 -51.517  1.00 11.24 ? 201  ALA A N   1 
ATOM   1312 C CA  . ALA A 1 181 ? -6.568  -26.148 -52.351  1.00 11.80 ? 201  ALA A CA  1 
ATOM   1313 C C   . ALA A 1 181 ? -5.420  -26.317 -53.352  1.00 12.20 ? 201  ALA A C   1 
ATOM   1314 O O   . ALA A 1 181 ? -4.882  -27.415 -53.500  1.00 13.43 ? 201  ALA A O   1 
ATOM   1315 C CB  . ALA A 1 181 ? -7.903  -26.144 -53.079  1.00 11.49 ? 201  ALA A CB  1 
ATOM   1316 N N   . SER A 1 182 ? -5.051  -25.232 -54.028  1.00 12.38 ? 202  SER A N   1 
ATOM   1317 C CA  . SER A 1 182 ? -4.030  -25.277 -55.082  1.00 12.83 ? 202  SER A CA  1 
ATOM   1318 C C   . SER A 1 182 ? -2.644  -24.820 -54.630  1.00 13.15 ? 202  SER A C   1 
ATOM   1319 O O   . SER A 1 182 ? -1.644  -25.165 -55.259  1.00 14.17 ? 202  SER A O   1 
ATOM   1320 C CB  . SER A 1 182 ? -4.463  -24.406 -56.260  1.00 13.01 ? 202  SER A CB  1 
ATOM   1321 O OG  . SER A 1 182 ? -4.407  -23.030 -55.922  1.00 13.09 ? 202  SER A OG  1 
ATOM   1322 N N   . GLY A 1 183 ? -2.590  -24.024 -53.564  1.00 13.03 ? 203  GLY A N   1 
ATOM   1323 C CA  . GLY A 1 183 ? -1.337  -23.440 -53.095  1.00 12.80 ? 203  GLY A CA  1 
ATOM   1324 C C   . GLY A 1 183 ? -0.880  -22.240 -53.911  1.00 12.51 ? 203  GLY A C   1 
ATOM   1325 O O   . GLY A 1 183 ? 0.241   -21.765 -53.734  1.00 13.81 ? 203  GLY A O   1 
ATOM   1326 N N   . GLN A 1 184 ? -1.738  -21.744 -54.802  1.00 12.60 ? 204  GLN A N   1 
ATOM   1327 C CA  . GLN A 1 184 ? -1.404  -20.579 -55.621  1.00 12.74 ? 204  GLN A CA  1 
ATOM   1328 C C   . GLN A 1 184 ? -1.490  -19.305 -54.788  1.00 12.06 ? 204  GLN A C   1 
ATOM   1329 O O   . GLN A 1 184 ? -2.403  -19.145 -53.978  1.00 11.28 ? 204  GLN A O   1 
ATOM   1330 C CB  . GLN A 1 184 ? -2.347  -20.459 -56.828  1.00 14.17 ? 204  GLN A CB  1 
ATOM   1331 C CG  . GLN A 1 184 ? -2.061  -19.242 -57.707  1.00 16.22 ? 204  GLN A CG  1 
ATOM   1332 C CD  . GLN A 1 184 ? -3.052  -19.045 -58.842  1.00 18.68 ? 204  GLN A CD  1 
ATOM   1333 O OE1 . GLN A 1 184 ? -4.137  -19.626 -58.852  1.00 20.53 ? 204  GLN A OE1 1 
ATOM   1334 N NE2 . GLN A 1 184 ? -2.683  -18.203 -59.802  1.00 20.31 ? 204  GLN A NE2 1 
ATOM   1335 N N   . CYS A 1 185 ? -0.542  -18.398 -55.009  1.00 11.22 ? 205  CYS A N   1 
ATOM   1336 C CA  . CYS A 1 185 ? -0.598  -17.069 -54.416  1.00 11.13 ? 205  CYS A CA  1 
ATOM   1337 C C   . CYS A 1 185 ? -1.648  -16.241 -55.152  1.00 11.45 ? 205  CYS A C   1 
ATOM   1338 O O   . CYS A 1 185 ? -1.538  -16.034 -56.362  1.00 12.35 ? 205  CYS A O   1 
ATOM   1339 C CB  . CYS A 1 185 ? 0.766   -16.391 -54.516  1.00 11.22 ? 205  CYS A CB  1 
ATOM   1340 S SG  . CYS A 1 185 ? 0.877   -14.815 -53.646  1.00 11.30 ? 205  CYS A SG  1 
ATOM   1341 N N   . LEU A 1 186 ? -2.667  -15.784 -54.426  1.00 11.30 ? 206  LEU A N   1 
ATOM   1342 C CA  . LEU A 1 186 ? -3.757  -14.996 -55.009  1.00 11.28 ? 206  LEU A CA  1 
ATOM   1343 C C   . LEU A 1 186 ? -3.573  -13.489 -54.834  1.00 11.38 ? 206  LEU A C   1 
ATOM   1344 O O   . LEU A 1 186 ? -4.231  -12.704 -55.516  1.00 13.32 ? 206  LEU A O   1 
ATOM   1345 C CB  . LEU A 1 186 ? -5.098  -15.404 -54.393  1.00 11.41 ? 206  LEU A CB  1 
ATOM   1346 C CG  . LEU A 1 186 ? -5.532  -16.862 -54.553  1.00 12.41 ? 206  LEU A CG  1 
ATOM   1347 C CD1 . LEU A 1 186 ? -6.817  -17.106 -53.778  1.00 13.20 ? 206  LEU A CD1 1 
ATOM   1348 C CD2 . LEU A 1 186 ? -5.715  -17.230 -56.017  1.00 13.30 ? 206  LEU A CD2 1 
ATOM   1349 N N   . LYS A 1 187 ? -2.704  -13.084 -53.911  1.00 10.91 ? 207  LYS A N   1 
ATOM   1350 C CA  . LYS A 1 187 ? -2.511  -11.669 -53.619  1.00 10.31 ? 207  LYS A CA  1 
ATOM   1351 C C   . LYS A 1 187 ? -1.201  -11.445 -52.882  1.00 10.29 ? 207  LYS A C   1 
ATOM   1352 O O   . LYS A 1 187 ? -0.824  -12.234 -52.015  1.00 10.47 ? 207  LYS A O   1 
ATOM   1353 C CB  . LYS A 1 187 ? -3.666  -11.148 -52.755  1.00 11.49 ? 207  LYS A CB  1 
ATOM   1354 C CG  . LYS A 1 187 ? -3.770  -9.632  -52.672  1.00 12.63 ? 207  LYS A CG  1 
ATOM   1355 C CD  . LYS A 1 187 ? -4.559  -9.063  -53.838  1.00 14.61 ? 207  LYS A CD  1 
ATOM   1356 C CE  . LYS A 1 187 ? -4.578  -7.543  -53.812  1.00 15.85 ? 207  LYS A CE  1 
ATOM   1357 N NZ  . LYS A 1 187 ? -5.457  -6.983  -54.873  1.00 17.76 ? 207  LYS A NZ  1 
ATOM   1358 N N   . THR A 1 188 ? -0.505  -10.373 -53.246  1.00 9.67  ? 208  THR A N   1 
ATOM   1359 C CA  . THR A 1 188 ? 0.598   -9.857  -52.450  1.00 9.81  ? 208  THR A CA  1 
ATOM   1360 C C   . THR A 1 188 ? 0.243   -8.424  -52.084  1.00 10.60 ? 208  THR A C   1 
ATOM   1361 O O   . THR A 1 188 ? -0.010  -7.597  -52.962  1.00 10.75 ? 208  THR A O   1 
ATOM   1362 C CB  . THR A 1 188 ? 1.934   -9.904  -53.213  1.00 9.59  ? 208  THR A CB  1 
ATOM   1363 O OG1 . THR A 1 188 ? 2.258   -11.266 -53.516  1.00 9.43  ? 208  THR A OG1 1 
ATOM   1364 C CG2 . THR A 1 188 ? 3.061   -9.303  -52.378  1.00 9.77  ? 208  THR A CG2 1 
ATOM   1365 N N   . LEU A 1 189 ? 0.206   -8.138  -50.786  1.00 11.47 ? 209  LEU A N   1 
ATOM   1366 C CA  . LEU A 1 189 ? -0.147  -6.809  -50.307  1.00 13.08 ? 209  LEU A CA  1 
ATOM   1367 C C   . LEU A 1 189 ? 1.108   -5.974  -50.127  1.00 14.64 ? 209  LEU A C   1 
ATOM   1368 O O   . LEU A 1 189 ? 2.042   -6.381  -49.435  1.00 14.88 ? 209  LEU A O   1 
ATOM   1369 C CB  . LEU A 1 189 ? -0.916  -6.900  -48.993  1.00 14.13 ? 209  LEU A CB  1 
ATOM   1370 C CG  . LEU A 1 189 ? -2.241  -7.661  -49.069  1.00 15.95 ? 209  LEU A CG  1 
ATOM   1371 C CD1 . LEU A 1 189 ? -2.802  -7.855  -47.677  1.00 17.42 ? 209  LEU A CD1 1 
ATOM   1372 C CD2 . LEU A 1 189 ? -3.254  -6.947  -49.951  1.00 17.29 ? 209  LEU A CD2 1 
ATOM   1373 N N   . ILE A 1 190 ? 1.117   -4.809  -50.766  1.00 16.33 ? 210  ILE A N   1 
ATOM   1374 C CA  . ILE A 1 190 ? 2.264   -3.913  -50.752  1.00 18.91 ? 210  ILE A CA  1 
ATOM   1375 C C   . ILE A 1 190 ? 1.792   -2.512  -50.387  1.00 20.10 ? 210  ILE A C   1 
ATOM   1376 O O   . ILE A 1 190 ? 0.878   -1.972  -51.011  1.00 21.94 ? 210  ILE A O   1 
ATOM   1377 C CB  . ILE A 1 190 ? 2.979   -3.926  -52.122  1.00 20.67 ? 210  ILE A CB  1 
ATOM   1378 C CG1 . ILE A 1 190 ? 3.843   -5.187  -52.242  1.00 21.47 ? 210  ILE A CG1 1 
ATOM   1379 C CG2 . ILE A 1 190 ? 3.846   -2.685  -52.316  1.00 21.66 ? 210  ILE A CG2 1 
ATOM   1380 C CD1 . ILE A 1 190 ? 3.832   -5.804  -53.619  1.00 23.31 ? 210  ILE A CD1 1 
ATOM   1381 N N   . ASP A 1 191 ? 2.421   -1.943  -49.362  1.00 21.44 ? 211  ASP A N   1 
ATOM   1382 C CA  . ASP A 1 191 ? 2.120   -0.593  -48.905  1.00 22.75 ? 211  ASP A CA  1 
ATOM   1383 C C   . ASP A 1 191 ? 3.125   0.373   -49.534  1.00 23.83 ? 211  ASP A C   1 
ATOM   1384 O O   . ASP A 1 191 ? 3.967   -0.036  -50.339  1.00 22.35 ? 211  ASP A O   1 
ATOM   1385 C CB  . ASP A 1 191 ? 2.200   -0.539  -47.372  1.00 24.38 ? 211  ASP A CB  1 
ATOM   1386 C CG  . ASP A 1 191 ? 1.281   0.513   -46.765  1.00 24.96 ? 211  ASP A CG  1 
ATOM   1387 O OD1 . ASP A 1 191 ? 0.873   1.454   -47.479  1.00 25.82 ? 211  ASP A OD1 1 
ATOM   1388 O OD2 . ASP A 1 191 ? 0.973   0.399   -45.561  1.00 26.68 ? 211  ASP A OD2 1 
ATOM   1389 N N   . ASP A 1 192 ? 3.028   1.651   -49.176  1.00 24.46 ? 212  ASP A N   1 
ATOM   1390 C CA  . ASP A 1 192 ? 3.976   2.664   -49.641  1.00 24.24 ? 212  ASP A CA  1 
ATOM   1391 C C   . ASP A 1 192 ? 5.368   2.403   -49.074  1.00 24.45 ? 212  ASP A C   1 
ATOM   1392 O O   . ASP A 1 192 ? 6.374   2.623   -49.748  1.00 25.02 ? 212  ASP A O   1 
ATOM   1393 C CB  . ASP A 1 192 ? 3.512   4.065   -49.228  1.00 24.20 ? 212  ASP A CB  1 
ATOM   1394 C CG  . ASP A 1 192 ? 2.199   4.464   -49.878  1.00 25.38 ? 212  ASP A CG  1 
ATOM   1395 O OD1 . ASP A 1 192 ? 2.071   4.312   -51.111  1.00 26.64 ? 212  ASP A OD1 1 
ATOM   1396 O OD2 . ASP A 1 192 ? 1.297   4.938   -49.155  1.00 27.17 ? 212  ASP A OD2 1 
ATOM   1397 N N   . ASN A 1 194 ? 7.955   -0.922  -46.933  1.00 19.21 ? 214  ASN A N   1 
ATOM   1398 C CA  . ASN A 1 194 ? 8.010   -2.374  -46.786  1.00 20.79 ? 214  ASN A CA  1 
ATOM   1399 C C   . ASN A 1 194 ? 8.642   -2.817  -45.463  1.00 17.86 ? 214  ASN A C   1 
ATOM   1400 O O   . ASN A 1 194 ? 9.542   -3.659  -45.462  1.00 17.72 ? 214  ASN A O   1 
ATOM   1401 C CB  . ASN A 1 194 ? 8.802   -2.989  -47.947  1.00 22.72 ? 214  ASN A CB  1 
ATOM   1402 C CG  . ASN A 1 194 ? 8.314   -2.522  -49.306  1.00 23.26 ? 214  ASN A CG  1 
ATOM   1403 O OD1 . ASN A 1 194 ? 7.121   -2.581  -49.604  1.00 25.08 ? 214  ASN A OD1 1 
ATOM   1404 N ND2 . ASN A 1 194 ? 9.239   -2.060  -50.142  1.00 22.99 ? 214  ASN A ND2 1 
ATOM   1405 N N   . PRO A 1 195 ? 8.173   -2.263  -44.328  1.00 14.84 ? 215  PRO A N   1 
ATOM   1406 C CA  . PRO A 1 195 ? 8.763   -2.680  -43.055  1.00 13.22 ? 215  PRO A CA  1 
ATOM   1407 C C   . PRO A 1 195 ? 8.432   -4.140  -42.746  1.00 12.02 ? 215  PRO A C   1 
ATOM   1408 O O   . PRO A 1 195 ? 7.393   -4.629  -43.186  1.00 12.29 ? 215  PRO A O   1 
ATOM   1409 C CB  . PRO A 1 195 ? 8.091   -1.752  -42.041  1.00 13.39 ? 215  PRO A CB  1 
ATOM   1410 C CG  . PRO A 1 195 ? 6.776   -1.423  -42.656  1.00 13.92 ? 215  PRO A CG  1 
ATOM   1411 C CD  . PRO A 1 195 ? 7.048   -1.332  -44.130  1.00 14.83 ? 215  PRO A CD  1 
ATOM   1412 N N   . PRO A 1 196 ? 9.312   -4.838  -42.004  1.00 10.66 ? 216  PRO A N   1 
ATOM   1413 C CA  . PRO A 1 196 ? 9.027   -6.228  -41.649  1.00 10.11 ? 216  PRO A CA  1 
ATOM   1414 C C   . PRO A 1 196 ? 7.623   -6.399  -41.071  1.00 9.60  ? 216  PRO A C   1 
ATOM   1415 O O   . PRO A 1 196 ? 7.218   -5.629  -40.201  1.00 10.03 ? 216  PRO A O   1 
ATOM   1416 C CB  . PRO A 1 196 ? 10.083  -6.540  -40.587  1.00 10.50 ? 216  PRO A CB  1 
ATOM   1417 C CG  . PRO A 1 196 ? 11.223  -5.643  -40.916  1.00 10.79 ? 216  PRO A CG  1 
ATOM   1418 C CD  . PRO A 1 196 ? 10.611  -4.387  -41.467  1.00 10.89 ? 216  PRO A CD  1 
ATOM   1419 N N   . VAL A 1 197 ? 6.888   -7.391  -41.568  1.00 8.88  ? 217  VAL A N   1 
ATOM   1420 C CA  . VAL A 1 197 ? 5.556   -7.690  -41.056  1.00 8.50  ? 217  VAL A CA  1 
ATOM   1421 C C   . VAL A 1 197 ? 5.715   -8.787  -40.013  1.00 8.60  ? 217  VAL A C   1 
ATOM   1422 O O   . VAL A 1 197 ? 6.190   -9.882  -40.317  1.00 9.12  ? 217  VAL A O   1 
ATOM   1423 C CB  . VAL A 1 197 ? 4.585   -8.143  -42.165  1.00 8.25  ? 217  VAL A CB  1 
ATOM   1424 C CG1 . VAL A 1 197 ? 3.167   -8.233  -41.623  1.00 8.43  ? 217  VAL A CG1 1 
ATOM   1425 C CG2 . VAL A 1 197 ? 4.616   -7.175  -43.338  1.00 9.10  ? 217  VAL A CG2 1 
ATOM   1426 N N   . SER A 1 198 ? 5.314   -8.474  -38.784  1.00 8.67  ? 218  SER A N   1 
ATOM   1427 C CA  . SER A 1 198 ? 5.566   -9.331  -37.632  1.00 8.49  ? 218  SER A CA  1 
ATOM   1428 C C   . SER A 1 198 ? 4.355   -10.157 -37.193  1.00 8.32  ? 218  SER A C   1 
ATOM   1429 O O   . SER A 1 198 ? 4.502   -11.070 -36.387  1.00 8.73  ? 218  SER A O   1 
ATOM   1430 C CB  . SER A 1 198 ? 6.049   -8.466  -36.469  1.00 8.88  ? 218  SER A CB  1 
ATOM   1431 O OG  . SER A 1 198 ? 5.172   -7.374  -36.250  1.00 9.58  ? 218  SER A OG  1 
ATOM   1432 N N   . PHE A 1 199 ? 3.169   -9.835  -37.704  1.00 8.10  ? 219  PHE A N   1 
ATOM   1433 C CA  . PHE A 1 199 ? 1.971   -10.621 -37.423  1.00 8.38  ? 219  PHE A CA  1 
ATOM   1434 C C   . PHE A 1 199 ? 0.868   -10.306 -38.426  1.00 8.12  ? 219  PHE A C   1 
ATOM   1435 O O   . PHE A 1 199 ? 0.785   -9.187  -38.930  1.00 8.14  ? 219  PHE A O   1 
ATOM   1436 C CB  . PHE A 1 199 ? 1.449   -10.365 -36.003  1.00 8.55  ? 219  PHE A CB  1 
ATOM   1437 C CG  . PHE A 1 199 ? 0.222   -11.168 -35.669  1.00 8.98  ? 219  PHE A CG  1 
ATOM   1438 C CD1 . PHE A 1 199 ? 0.333   -12.500 -35.289  1.00 9.18  ? 219  PHE A CD1 1 
ATOM   1439 C CD2 . PHE A 1 199 ? -1.046  -10.612 -35.782  1.00 9.32  ? 219  PHE A CD2 1 
ATOM   1440 C CE1 . PHE A 1 199 ? -0.791  -13.252 -35.002  1.00 9.51  ? 219  PHE A CE1 1 
ATOM   1441 C CE2 . PHE A 1 199 ? -2.176  -11.362 -35.500  1.00 9.60  ? 219  PHE A CE2 1 
ATOM   1442 C CZ  . PHE A 1 199 ? -2.047  -12.682 -35.105  1.00 9.30  ? 219  PHE A CZ  1 
ATOM   1443 N N   . VAL A 1 200 ? 0.025   -11.296 -38.703  1.00 8.30  ? 220  VAL A N   1 
ATOM   1444 C CA  . VAL A 1 200 ? -1.159  -11.096 -39.533  1.00 8.52  ? 220  VAL A CA  1 
ATOM   1445 C C   . VAL A 1 200 ? -2.226  -12.138 -39.199  1.00 8.69  ? 220  VAL A C   1 
ATOM   1446 O O   . VAL A 1 200 ? -1.902  -13.259 -38.804  1.00 8.89  ? 220  VAL A O   1 
ATOM   1447 C CB  . VAL A 1 200 ? -0.822  -11.140 -41.045  1.00 8.66  ? 220  VAL A CB  1 
ATOM   1448 C CG1 . VAL A 1 200 ? -0.477  -12.554 -41.498  1.00 8.29  ? 220  VAL A CG1 1 
ATOM   1449 C CG2 . VAL A 1 200 ? -1.971  -10.576 -41.872  1.00 8.89  ? 220  VAL A CG2 1 
ATOM   1450 N N   . LYS A 1 201 ? -3.491  -11.747 -39.344  1.00 9.27  ? 221  LYS A N   1 
ATOM   1451 C CA  . LYS A 1 201 ? -4.619  -12.674 -39.240  1.00 9.18  ? 221  LYS A CA  1 
ATOM   1452 C C   . LYS A 1 201 ? -5.866  -12.087 -39.907  1.00 9.13  ? 221  LYS A C   1 
ATOM   1453 O O   . LYS A 1 201 ? -6.038  -10.868 -39.962  1.00 9.09  ? 221  LYS A O   1 
ATOM   1454 C CB  . LYS A 1 201 ? -4.917  -13.032 -37.773  1.00 9.49  ? 221  LYS A CB  1 
ATOM   1455 C CG  . LYS A 1 201 ? -5.690  -11.979 -36.990  1.00 9.69  ? 221  LYS A CG  1 
ATOM   1456 C CD  . LYS A 1 201 ? -5.772  -12.298 -35.501  1.00 10.03 ? 221  LYS A CD  1 
ATOM   1457 C CE  . LYS A 1 201 ? -6.426  -13.641 -35.210  1.00 9.97  ? 221  LYS A CE  1 
ATOM   1458 N NZ  . LYS A 1 201 ? -6.694  -13.817 -33.754  1.00 10.16 ? 221  LYS A NZ  1 
ATOM   1459 N N   . PHE A 1 202 ? -6.707  -12.965 -40.441  1.00 9.23  ? 222  PHE A N   1 
ATOM   1460 C CA  . PHE A 1 202 ? -8.047  -12.599 -40.897  1.00 9.86  ? 222  PHE A CA  1 
ATOM   1461 C C   . PHE A 1 202 ? -8.928  -12.131 -39.742  1.00 10.10 ? 222  PHE A C   1 
ATOM   1462 O O   . PHE A 1 202 ? -8.782  -12.594 -38.607  1.00 10.36 ? 222  PHE A O   1 
ATOM   1463 C CB  . PHE A 1 202 ? -8.740  -13.791 -41.571  1.00 9.68  ? 222  PHE A CB  1 
ATOM   1464 C CG  . PHE A 1 202 ? -8.166  -14.159 -42.911  1.00 10.05 ? 222  PHE A CG  1 
ATOM   1465 C CD1 . PHE A 1 202 ? -8.466  -13.406 -44.040  1.00 10.12 ? 222  PHE A CD1 1 
ATOM   1466 C CD2 . PHE A 1 202 ? -7.344  -15.269 -43.050  1.00 10.11 ? 222  PHE A CD2 1 
ATOM   1467 C CE1 . PHE A 1 202 ? -7.943  -13.747 -45.276  1.00 10.01 ? 222  PHE A CE1 1 
ATOM   1468 C CE2 . PHE A 1 202 ? -6.818  -15.614 -44.284  1.00 10.26 ? 222  PHE A CE2 1 
ATOM   1469 C CZ  . PHE A 1 202 ? -7.121  -14.853 -45.399  1.00 10.31 ? 222  PHE A CZ  1 
ATOM   1470 N N   . SER A 1 203 ? -9.852  -11.221 -40.044  1.00 10.17 ? 223  SER A N   1 
ATOM   1471 C CA  . SER A 1 203 ? -10.905 -10.847 -39.106  1.00 11.18 ? 223  SER A CA  1 
ATOM   1472 C C   . SER A 1 203 ? -11.879 -12.021 -38.975  1.00 12.03 ? 223  SER A C   1 
ATOM   1473 O O   . SER A 1 203 ? -11.978 -12.838 -39.892  1.00 12.15 ? 223  SER A O   1 
ATOM   1474 C CB  . SER A 1 203 ? -11.642 -9.600  -39.598  1.00 11.69 ? 223  SER A CB  1 
ATOM   1475 O OG  . SER A 1 203 ? -12.204 -9.814  -40.881  1.00 11.62 ? 223  SER A OG  1 
ATOM   1476 N N   . PRO A 1 204 ? -12.602 -12.113 -37.841  1.00 13.01 ? 224  PRO A N   1 
ATOM   1477 C CA  . PRO A 1 204 ? -13.575 -13.203 -37.674  1.00 13.80 ? 224  PRO A CA  1 
ATOM   1478 C C   . PRO A 1 204 ? -14.660 -13.259 -38.761  1.00 14.43 ? 224  PRO A C   1 
ATOM   1479 O O   . PRO A 1 204 ? -15.077 -14.353 -39.152  1.00 16.19 ? 224  PRO A O   1 
ATOM   1480 C CB  . PRO A 1 204 ? -14.199 -12.916 -36.304  1.00 14.49 ? 224  PRO A CB  1 
ATOM   1481 C CG  . PRO A 1 204 ? -13.192 -12.098 -35.578  1.00 14.30 ? 224  PRO A CG  1 
ATOM   1482 C CD  . PRO A 1 204 ? -12.474 -11.293 -36.622  1.00 13.63 ? 224  PRO A CD  1 
ATOM   1483 N N   . ASN A 1 205 ? -15.104 -12.096 -39.241  1.00 14.43 ? 225  ASN A N   1 
ATOM   1484 C CA  . ASN A 1 205 ? -16.098 -12.033 -40.322  1.00 15.31 ? 225  ASN A CA  1 
ATOM   1485 C C   . ASN A 1 205 ? -15.497 -12.230 -41.720  1.00 15.81 ? 225  ASN A C   1 
ATOM   1486 O O   . ASN A 1 205 ? -16.224 -12.261 -42.712  1.00 17.45 ? 225  ASN A O   1 
ATOM   1487 C CB  . ASN A 1 205 ? -16.917 -10.733 -40.252  1.00 15.01 ? 225  ASN A CB  1 
ATOM   1488 C CG  . ASN A 1 205 ? -16.093 -9.483  -40.522  1.00 15.30 ? 225  ASN A CG  1 
ATOM   1489 O OD1 . ASN A 1 205 ? -14.880 -9.543  -40.719  1.00 15.05 ? 225  ASN A OD1 1 
ATOM   1490 N ND2 . ASN A 1 205 ? -16.760 -8.335  -40.523  1.00 15.01 ? 225  ASN A ND2 1 
ATOM   1491 N N   . GLY A 1 206 ? -14.170 -12.326 -41.792  1.00 16.05 ? 226  GLY A N   1 
ATOM   1492 C CA  . GLY A 1 206 ? -13.480 -12.742 -43.008  1.00 15.68 ? 226  GLY A CA  1 
ATOM   1493 C C   . GLY A 1 206 ? -13.174 -11.647 -44.013  1.00 16.28 ? 226  GLY A C   1 
ATOM   1494 O O   . GLY A 1 206 ? -12.480 -11.899 -44.996  1.00 18.12 ? 226  GLY A O   1 
ATOM   1495 N N   . LYS A 1 207 ? -13.662 -10.430 -43.775  1.00 16.31 ? 227  LYS A N   1 
ATOM   1496 C CA  . LYS A 1 207 ? -13.563 -9.367  -44.781  1.00 18.00 ? 227  LYS A CA  1 
ATOM   1497 C C   . LYS A 1 207 ? -12.304 -8.499  -44.656  1.00 16.62 ? 227  LYS A C   1 
ATOM   1498 O O   . LYS A 1 207 ? -12.042 -7.668  -45.528  1.00 17.94 ? 227  LYS A O   1 
ATOM   1499 C CB  . LYS A 1 207 ? -14.830 -8.503  -44.776  1.00 20.32 ? 227  LYS A CB  1 
ATOM   1500 C CG  . LYS A 1 207 ? -14.943 -7.520  -43.624  1.00 21.00 ? 227  LYS A CG  1 
ATOM   1501 C CD  . LYS A 1 207 ? -16.379 -7.060  -43.407  1.00 22.69 ? 227  LYS A CD  1 
ATOM   1502 C CE  . LYS A 1 207 ? -16.922 -6.277  -44.593  1.00 24.16 ? 227  LYS A CE  1 
ATOM   1503 N NZ  . LYS A 1 207 ? -18.322 -5.824  -44.359  1.00 26.29 ? 227  LYS A NZ  1 
ATOM   1504 N N   . TYR A 1 208 ? -11.529 -8.684  -43.588  1.00 14.34 ? 228  TYR A N   1 
ATOM   1505 C CA  . TYR A 1 208 ? -10.273 -7.950  -43.414  1.00 13.40 ? 228  TYR A CA  1 
ATOM   1506 C C   . TYR A 1 208 ? -9.132  -8.872  -43.016  1.00 11.80 ? 228  TYR A C   1 
ATOM   1507 O O   . TYR A 1 208 ? -9.357  -10.001 -42.580  1.00 11.28 ? 228  TYR A O   1 
ATOM   1508 C CB  . TYR A 1 208 ? -10.397 -6.884  -42.318  1.00 14.16 ? 228  TYR A CB  1 
ATOM   1509 C CG  . TYR A 1 208 ? -11.662 -6.058  -42.333  1.00 15.58 ? 228  TYR A CG  1 
ATOM   1510 C CD1 . TYR A 1 208 ? -11.916 -5.153  -43.359  1.00 16.00 ? 228  TYR A CD1 1 
ATOM   1511 C CD2 . TYR A 1 208 ? -12.588 -6.152  -41.297  1.00 16.48 ? 228  TYR A CD2 1 
ATOM   1512 C CE1 . TYR A 1 208 ? -13.068 -4.384  -43.364  1.00 17.31 ? 228  TYR A CE1 1 
ATOM   1513 C CE2 . TYR A 1 208 ? -13.741 -5.386  -41.292  1.00 17.68 ? 228  TYR A CE2 1 
ATOM   1514 C CZ  . TYR A 1 208 ? -13.976 -4.503  -42.328  1.00 17.98 ? 228  TYR A CZ  1 
ATOM   1515 O OH  . TYR A 1 208 ? -15.120 -3.741  -42.333  1.00 19.42 ? 228  TYR A OH  1 
ATOM   1516 N N   . ILE A 1 209 ? -7.907  -8.375  -43.168  1.00 10.51 ? 229  ILE A N   1 
ATOM   1517 C CA  . ILE A 1 209 ? -6.774  -8.888  -42.401  1.00 11.06 ? 229  ILE A CA  1 
ATOM   1518 C C   . ILE A 1 209 ? -6.209  -7.762  -41.543  1.00 10.50 ? 229  ILE A C   1 
ATOM   1519 O O   . ILE A 1 209 ? -6.272  -6.586  -41.918  1.00 10.12 ? 229  ILE A O   1 
ATOM   1520 C CB  . ILE A 1 209 ? -5.655  -9.501  -43.274  1.00 11.56 ? 229  ILE A CB  1 
ATOM   1521 C CG1 . ILE A 1 209 ? -5.068  -8.472  -44.241  1.00 12.57 ? 229  ILE A CG1 1 
ATOM   1522 C CG2 . ILE A 1 209 ? -6.171  -10.721 -44.023  1.00 11.36 ? 229  ILE A CG2 1 
ATOM   1523 C CD1 . ILE A 1 209 ? -3.754  -8.904  -44.844  1.00 13.79 ? 229  ILE A CD1 1 
ATOM   1524 N N   . LEU A 1 210 ? -5.673  -8.135  -40.385  1.00 9.87  ? 230  LEU A N   1 
ATOM   1525 C CA  . LEU A 1 210 ? -5.019  -7.203  -39.478  1.00 9.73  ? 230  LEU A CA  1 
ATOM   1526 C C   . LEU A 1 210 ? -3.540  -7.541  -39.494  1.00 9.58  ? 230  LEU A C   1 
ATOM   1527 O O   . LEU A 1 210 ? -3.170  -8.677  -39.212  1.00 9.92  ? 230  LEU A O   1 
ATOM   1528 C CB  . LEU A 1 210 ? -5.580  -7.353  -38.066  1.00 10.43 ? 230  LEU A CB  1 
ATOM   1529 C CG  . LEU A 1 210 ? -4.974  -6.472  -36.971  1.00 10.82 ? 230  LEU A CG  1 
ATOM   1530 C CD1 . LEU A 1 210 ? -5.325  -5.009  -37.192  1.00 11.58 ? 230  LEU A CD1 1 
ATOM   1531 C CD2 . LEU A 1 210 ? -5.457  -6.942  -35.606  1.00 11.40 ? 230  LEU A CD2 1 
ATOM   1532 N N   . ALA A 1 211 ? -2.702  -6.565  -39.835  1.00 9.62  ? 231  ALA A N   1 
ATOM   1533 C CA  . ALA A 1 211 ? -1.268  -6.797  -39.981  1.00 9.45  ? 231  ALA A CA  1 
ATOM   1534 C C   . ALA A 1 211 ? -0.467  -5.879  -39.066  1.00 9.55  ? 231  ALA A C   1 
ATOM   1535 O O   . ALA A 1 211 ? -0.727  -4.676  -39.002  1.00 10.30 ? 231  ALA A O   1 
ATOM   1536 C CB  . ALA A 1 211 ? -0.846  -6.595  -41.429  1.00 9.84  ? 231  ALA A CB  1 
ATOM   1537 N N   . ALA A 1 212 ? 0.508   -6.456  -38.367  1.00 9.37  ? 232  ALA A N   1 
ATOM   1538 C CA  . ALA A 1 212 ? 1.438   -5.701  -37.533  1.00 9.64  ? 232  ALA A CA  1 
ATOM   1539 C C   . ALA A 1 212 ? 2.777   -5.573  -38.247  1.00 9.43  ? 232  ALA A C   1 
ATOM   1540 O O   . ALA A 1 212 ? 3.270   -6.547  -38.825  1.00 9.76  ? 232  ALA A O   1 
ATOM   1541 C CB  . ALA A 1 212 ? 1.633   -6.404  -36.199  1.00 9.71  ? 232  ALA A CB  1 
ATOM   1542 N N   . THR A 1 213 ? 3.364   -4.379  -38.206  1.00 9.98  ? 233  THR A N   1 
ATOM   1543 C CA  . THR A 1 213 ? 4.703   -4.154  -38.754  1.00 10.47 ? 233  THR A CA  1 
ATOM   1544 C C   . THR A 1 213 ? 5.634   -3.580  -37.692  1.00 10.61 ? 233  THR A C   1 
ATOM   1545 O O   . THR A 1 213 ? 5.189   -2.891  -36.773  1.00 11.17 ? 233  THR A O   1 
ATOM   1546 C CB  . THR A 1 213 ? 4.672   -3.215  -39.980  1.00 11.31 ? 233  THR A CB  1 
ATOM   1547 O OG1 . THR A 1 213 ? 3.783   -2.116  -39.736  1.00 12.21 ? 233  THR A OG1 1 
ATOM   1548 C CG2 . THR A 1 213 ? 4.213   -3.969  -41.215  1.00 11.81 ? 233  THR A CG2 1 
ATOM   1549 N N   . LEU A 1 214 ? 6.932   -3.842  -37.837  1.00 10.21 ? 234  LEU A N   1 
ATOM   1550 C CA  . LEU A 1 214 ? 7.921   -3.439  -36.832  1.00 10.56 ? 234  LEU A CA  1 
ATOM   1551 C C   . LEU A 1 214 ? 8.317   -1.961  -36.935  1.00 11.12 ? 234  LEU A C   1 
ATOM   1552 O O   . LEU A 1 214 ? 9.475   -1.597  -36.708  1.00 12.57 ? 234  LEU A O   1 
ATOM   1553 C CB  . LEU A 1 214 ? 9.155   -4.348  -36.902  1.00 10.52 ? 234  LEU A CB  1 
ATOM   1554 C CG  . LEU A 1 214 ? 8.888   -5.833  -36.628  1.00 10.77 ? 234  LEU A CG  1 
ATOM   1555 C CD1 . LEU A 1 214 ? 10.179  -6.630  -36.713  1.00 11.32 ? 234  LEU A CD1 1 
ATOM   1556 C CD2 . LEU A 1 214 ? 8.230   -6.036  -35.268  1.00 10.99 ? 234  LEU A CD2 1 
ATOM   1557 N N   . ASP A 1 215 ? 7.339   -1.123  -37.272  1.00 11.73 ? 235  ASP A N   1 
ATOM   1558 C CA  . ASP A 1 215 ? 7.467   0.330   -37.208  1.00 12.53 ? 235  ASP A CA  1 
ATOM   1559 C C   . ASP A 1 215 ? 6.367   0.891   -36.298  1.00 12.34 ? 235  ASP A C   1 
ATOM   1560 O O   . ASP A 1 215 ? 5.860   1.992   -36.526  1.00 12.92 ? 235  ASP A O   1 
ATOM   1561 C CB  . ASP A 1 215 ? 7.391   0.943   -38.617  1.00 13.76 ? 235  ASP A CB  1 
ATOM   1562 C CG  . ASP A 1 215 ? 6.060   0.676   -39.314  1.00 14.28 ? 235  ASP A CG  1 
ATOM   1563 O OD1 . ASP A 1 215 ? 5.236   -0.093  -38.773  1.00 14.14 ? 235  ASP A OD1 1 
ATOM   1564 O OD2 . ASP A 1 215 ? 5.838   1.240   -40.408  1.00 16.53 ? 235  ASP A OD2 1 
ATOM   1565 N N   . ASN A 1 216 ? 6.002   0.118   -35.272  1.00 12.22 ? 236  ASN A N   1 
ATOM   1566 C CA  . ASN A 1 216 ? 5.004   0.527   -34.281  1.00 11.89 ? 236  ASN A CA  1 
ATOM   1567 C C   . ASN A 1 216 ? 3.620   0.786   -34.883  1.00 11.80 ? 236  ASN A C   1 
ATOM   1568 O O   . ASN A 1 216 ? 2.928   1.724   -34.485  1.00 11.84 ? 236  ASN A O   1 
ATOM   1569 C CB  . ASN A 1 216 ? 5.486   1.772   -33.526  1.00 11.88 ? 236  ASN A CB  1 
ATOM   1570 C CG  . ASN A 1 216 ? 6.923   1.650   -33.061  1.00 11.95 ? 236  ASN A CG  1 
ATOM   1571 O OD1 . ASN A 1 216 ? 7.236   0.828   -32.203  1.00 11.96 ? 236  ASN A OD1 1 
ATOM   1572 N ND2 . ASN A 1 216 ? 7.806   2.468   -33.624  1.00 12.40 ? 236  ASN A ND2 1 
ATOM   1573 N N   . THR A 1 217 ? 3.212   -0.057  -35.829  1.00 12.15 ? 237  THR A N   1 
ATOM   1574 C CA  . THR A 1 217 ? 1.957   0.155   -36.550  1.00 11.99 ? 237  THR A CA  1 
ATOM   1575 C C   . THR A 1 217 ? 1.184   -1.141  -36.767  1.00 11.47 ? 237  THR A C   1 
ATOM   1576 O O   . THR A 1 217 ? 1.758   -2.167  -37.132  1.00 11.86 ? 237  THR A O   1 
ATOM   1577 C CB  . THR A 1 217 ? 2.210   0.810   -37.925  1.00 12.99 ? 237  THR A CB  1 
ATOM   1578 O OG1 . THR A 1 217 ? 3.020   1.982   -37.761  1.00 14.22 ? 237  THR A OG1 1 
ATOM   1579 C CG2 . THR A 1 217 ? 0.897   1.201   -38.598  1.00 13.86 ? 237  THR A CG2 1 
ATOM   1580 N N   . LEU A 1 218 ? -0.123  -1.073  -36.524  1.00 10.89 ? 238  LEU A N   1 
ATOM   1581 C CA  . LEU A 1 218 ? -1.068  -2.113  -36.925  1.00 11.75 ? 238  LEU A CA  1 
ATOM   1582 C C   . LEU A 1 218 ? -1.914  -1.553  -38.059  1.00 12.01 ? 238  LEU A C   1 
ATOM   1583 O O   . LEU A 1 218 ? -2.257  -0.372  -38.045  1.00 12.50 ? 238  LEU A O   1 
ATOM   1584 C CB  . LEU A 1 218 ? -1.969  -2.508  -35.756  1.00 11.88 ? 238  LEU A CB  1 
ATOM   1585 C CG  . LEU A 1 218 ? -1.368  -3.467  -34.727  1.00 11.87 ? 238  LEU A CG  1 
ATOM   1586 C CD1 . LEU A 1 218 ? -2.099  -3.365  -33.398  1.00 12.58 ? 238  LEU A CD1 1 
ATOM   1587 C CD2 . LEU A 1 218 ? -1.398  -4.897  -35.245  1.00 11.67 ? 238  LEU A CD2 1 
ATOM   1588 N N   . LYS A 1 219 ? -2.246  -2.394  -39.036  1.00 12.12 ? 239  LYS A N   1 
ATOM   1589 C CA  . LYS A 1 219 ? -3.006  -1.955  -40.203  1.00 13.25 ? 239  LYS A CA  1 
ATOM   1590 C C   . LYS A 1 219 ? -4.138  -2.921  -40.535  1.00 12.59 ? 239  LYS A C   1 
ATOM   1591 O O   . LYS A 1 219 ? -3.941  -4.137  -40.565  1.00 12.59 ? 239  LYS A O   1 
ATOM   1592 C CB  . LYS A 1 219 ? -2.080  -1.793  -41.410  1.00 14.59 ? 239  LYS A CB  1 
ATOM   1593 C CG  . LYS A 1 219 ? -1.066  -0.674  -41.249  1.00 16.19 ? 239  LYS A CG  1 
ATOM   1594 C CD  . LYS A 1 219 ? -0.395  -0.317  -42.566  1.00 17.49 ? 239  LYS A CD  1 
ATOM   1595 C CE  . LYS A 1 219 ? 0.747   0.664   -42.351  1.00 20.16 ? 239  LYS A CE  1 
ATOM   1596 N NZ  . LYS A 1 219 ? 2.002   -0.022  -41.937  1.00 22.01 ? 239  LYS A NZ  1 
ATOM   1597 N N   . LEU A 1 220 ? -5.323  -2.364  -40.775  1.00 12.56 ? 240  LEU A N   1 
ATOM   1598 C CA  . LEU A 1 220 ? -6.482  -3.136  -41.212  1.00 12.55 ? 240  LEU A CA  1 
ATOM   1599 C C   . LEU A 1 220 ? -6.576  -3.013  -42.727  1.00 12.80 ? 240  LEU A C   1 
ATOM   1600 O O   . LEU A 1 220 ? -6.658  -1.904  -43.254  1.00 13.21 ? 240  LEU A O   1 
ATOM   1601 C CB  . LEU A 1 220 ? -7.756  -2.602  -40.555  1.00 12.44 ? 240  LEU A CB  1 
ATOM   1602 C CG  . LEU A 1 220 ? -9.041  -3.414  -40.743  1.00 13.06 ? 240  LEU A CG  1 
ATOM   1603 C CD1 . LEU A 1 220 ? -8.985  -4.713  -39.954  1.00 13.26 ? 240  LEU A CD1 1 
ATOM   1604 C CD2 . LEU A 1 220 ? -10.248 -2.589  -40.326  1.00 13.69 ? 240  LEU A CD2 1 
ATOM   1605 N N   . TRP A 1 221 ? -6.552  -4.152  -43.417  1.00 13.15 ? 241  TRP A N   1 
ATOM   1606 C CA  . TRP A 1 221 ? -6.555  -4.183  -44.878  1.00 13.99 ? 241  TRP A CA  1 
ATOM   1607 C C   . TRP A 1 221 ? -7.808  -4.839  -45.433  1.00 14.23 ? 241  TRP A C   1 
ATOM   1608 O O   . TRP A 1 221 ? -8.275  -5.852  -44.910  1.00 13.71 ? 241  TRP A O   1 
ATOM   1609 C CB  . TRP A 1 221 ? -5.359  -4.982  -45.396  1.00 14.77 ? 241  TRP A CB  1 
ATOM   1610 C CG  . TRP A 1 221 ? -4.040  -4.308  -45.259  1.00 15.90 ? 241  TRP A CG  1 
ATOM   1611 C CD1 . TRP A 1 221 ? -3.316  -4.144  -44.114  1.00 16.57 ? 241  TRP A CD1 1 
ATOM   1612 C CD2 . TRP A 1 221 ? -3.265  -3.728  -46.313  1.00 17.10 ? 241  TRP A CD2 1 
ATOM   1613 N NE1 . TRP A 1 221 ? -2.143  -3.484  -44.388  1.00 17.62 ? 241  TRP A NE1 1 
ATOM   1614 C CE2 . TRP A 1 221 ? -2.086  -3.217  -45.731  1.00 17.84 ? 241  TRP A CE2 1 
ATOM   1615 C CE3 . TRP A 1 221 ? -3.458  -3.584  -47.693  1.00 17.81 ? 241  TRP A CE3 1 
ATOM   1616 C CZ2 . TRP A 1 221 ? -1.100  -2.573  -46.481  1.00 18.62 ? 241  TRP A CZ2 1 
ATOM   1617 C CZ3 . TRP A 1 221 ? -2.477  -2.944  -48.439  1.00 18.73 ? 241  TRP A CZ3 1 
ATOM   1618 C CH2 . TRP A 1 221 ? -1.312  -2.445  -47.830  1.00 18.67 ? 241  TRP A CH2 1 
ATOM   1619 N N   . ASP A 1 222 ? -8.340  -4.248  -46.499  1.00 14.61 ? 242  ASP A N   1 
ATOM   1620 C CA  . ASP A 1 222 ? -9.220  -4.953  -47.416  1.00 15.64 ? 242  ASP A CA  1 
ATOM   1621 C C   . ASP A 1 222 ? -8.292  -5.691  -48.375  1.00 16.28 ? 242  ASP A C   1 
ATOM   1622 O O   . ASP A 1 222 ? -7.692  -5.083  -49.260  1.00 17.00 ? 242  ASP A O   1 
ATOM   1623 C CB  . ASP A 1 222 ? -10.120 -3.971  -48.172  1.00 16.10 ? 242  ASP A CB  1 
ATOM   1624 C CG  . ASP A 1 222 ? -11.130 -4.667  -49.066  1.00 16.80 ? 242  ASP A CG  1 
ATOM   1625 O OD1 . ASP A 1 222 ? -10.812 -5.743  -49.616  1.00 16.48 ? 242  ASP A OD1 1 
ATOM   1626 O OD2 . ASP A 1 222 ? -12.246 -4.133  -49.225  1.00 19.40 ? 242  ASP A OD2 1 
ATOM   1627 N N   . TYR A 1 223 ? -8.166  -7.000  -48.179  1.00 17.04 ? 243  TYR A N   1 
ATOM   1628 C CA  . TYR A 1 223 ? -7.205  -7.809  -48.941  1.00 17.59 ? 243  TYR A CA  1 
ATOM   1629 C C   . TYR A 1 223 ? -7.679  -8.152  -50.357  1.00 18.95 ? 243  TYR A C   1 
ATOM   1630 O O   . TYR A 1 223 ? -6.884  -8.608  -51.180  1.00 21.21 ? 243  TYR A O   1 
ATOM   1631 C CB  . TYR A 1 223 ? -6.827  -9.086  -48.177  1.00 16.67 ? 243  TYR A CB  1 
ATOM   1632 C CG  . TYR A 1 223 ? -7.985  -10.006 -47.856  1.00 16.83 ? 243  TYR A CG  1 
ATOM   1633 C CD1 . TYR A 1 223 ? -8.407  -10.972 -48.766  1.00 16.86 ? 243  TYR A CD1 1 
ATOM   1634 C CD2 . TYR A 1 223 ? -8.652  -9.919  -46.636  1.00 16.78 ? 243  TYR A CD2 1 
ATOM   1635 C CE1 . TYR A 1 223 ? -9.463  -11.817 -48.475  1.00 17.26 ? 243  TYR A CE1 1 
ATOM   1636 C CE2 . TYR A 1 223 ? -9.708  -10.758 -46.337  1.00 17.53 ? 243  TYR A CE2 1 
ATOM   1637 C CZ  . TYR A 1 223 ? -10.109 -11.705 -47.260  1.00 17.16 ? 243  TYR A CZ  1 
ATOM   1638 O OH  . TYR A 1 223 ? -11.157 -12.542 -46.965  1.00 18.97 ? 243  TYR A OH  1 
ATOM   1639 N N   . SER A 1 224 ? -8.965  -7.947  -50.637  1.00 19.48 ? 244  SER A N   1 
ATOM   1640 C CA  . SER A 1 224 ? -9.492  -8.103  -51.994  1.00 19.94 ? 244  SER A CA  1 
ATOM   1641 C C   . SER A 1 224 ? -9.096  -6.901  -52.848  1.00 19.80 ? 244  SER A C   1 
ATOM   1642 O O   . SER A 1 224 ? -8.550  -7.061  -53.942  1.00 20.58 ? 244  SER A O   1 
ATOM   1643 C CB  . SER A 1 224 ? -11.015 -8.252  -51.967  1.00 20.59 ? 244  SER A CB  1 
ATOM   1644 O OG  . SER A 1 224 ? -11.533 -8.464  -53.270  1.00 22.79 ? 244  SER A OG  1 
ATOM   1645 N N   . LYS A 1 225 ? -9.380  -5.702  -52.343  1.00 19.15 ? 245  LYS A N   1 
ATOM   1646 C CA  . LYS A 1 225 ? -8.991  -4.461  -53.013  1.00 19.85 ? 245  LYS A CA  1 
ATOM   1647 C C   . LYS A 1 225 ? -7.490  -4.199  -52.919  1.00 20.07 ? 245  LYS A C   1 
ATOM   1648 O O   . LYS A 1 225 ? -6.927  -3.500  -53.762  1.00 21.67 ? 245  LYS A O   1 
ATOM   1649 C CB  . LYS A 1 225 ? -9.735  -3.264  -52.414  1.00 20.56 ? 245  LYS A CB  1 
ATOM   1650 C CG  . LYS A 1 225 ? -11.233 -3.255  -52.663  1.00 21.80 ? 245  LYS A CG  1 
ATOM   1651 C CD  . LYS A 1 225 ? -11.841 -1.939  -52.206  1.00 23.53 ? 245  LYS A CD  1 
ATOM   1652 C CE  . LYS A 1 225 ? -13.356 -2.001  -52.150  1.00 24.62 ? 245  LYS A CE  1 
ATOM   1653 N NZ  . LYS A 1 225 ? -13.930 -0.734  -51.619  1.00 25.46 ? 245  LYS A NZ  1 
ATOM   1654 N N   . GLY A 1 226 ? -6.850  -4.746  -51.887  1.00 20.46 ? 246  GLY A N   1 
ATOM   1655 C CA  . GLY A 1 226 ? -5.438  -4.487  -51.628  1.00 20.61 ? 246  GLY A CA  1 
ATOM   1656 C C   . GLY A 1 226 ? -5.244  -3.065  -51.143  1.00 21.19 ? 246  GLY A C   1 
ATOM   1657 O O   . GLY A 1 226 ? -4.353  -2.355  -51.610  1.00 23.20 ? 246  GLY A O   1 
ATOM   1658 N N   . LYS A 1 227 ? -6.087  -2.661  -50.195  1.00 20.61 ? 247  LYS A N   1 
ATOM   1659 C CA  . LYS A 1 227 ? -6.139  -1.284  -49.717  1.00 20.79 ? 247  LYS A CA  1 
ATOM   1660 C C   . LYS A 1 227 ? -6.182  -1.242  -48.192  1.00 19.85 ? 247  LYS A C   1 
ATOM   1661 O O   . LYS A 1 227 ? -6.882  -2.034  -47.560  1.00 17.71 ? 247  LYS A O   1 
ATOM   1662 C CB  . LYS A 1 227 ? -7.367  -0.583  -50.312  1.00 22.54 ? 247  LYS A CB  1 
ATOM   1663 C CG  . LYS A 1 227 ? -7.864  0.634   -49.546  1.00 24.30 ? 247  LYS A CG  1 
ATOM   1664 C CD  . LYS A 1 227 ? -8.862  1.428   -50.372  1.00 26.12 ? 247  LYS A CD  1 
ATOM   1665 C CE  . LYS A 1 227 ? -9.769  2.273   -49.494  1.00 27.10 ? 247  LYS A CE  1 
ATOM   1666 N NZ  . LYS A 1 227 ? -10.691 3.111   -50.309  1.00 28.91 ? 247  LYS A NZ  1 
ATOM   1667 N N   . CYS A 1 228 ? -5.431  -0.306  -47.616  1.00 20.24 ? 248  CYS A N   1 
ATOM   1668 C CA  . CYS A 1 228 ? -5.396  -0.107  -46.172  1.00 19.49 ? 248  CYS A CA  1 
ATOM   1669 C C   . CYS A 1 228 ? -6.565  0.778   -45.742  1.00 18.99 ? 248  CYS A C   1 
ATOM   1670 O O   . CYS A 1 228 ? -6.713  1.899   -46.233  1.00 20.01 ? 248  CYS A O   1 
ATOM   1671 C CB  . CYS A 1 228 ? -4.073  0.538   -45.761  1.00 19.77 ? 248  CYS A CB  1 
ATOM   1672 S SG  . CYS A 1 228 ? -3.838  0.675   -43.976  1.00 22.16 ? 248  CYS A SG  1 
ATOM   1673 N N   . LEU A 1 229 ? -7.388  0.267   -44.828  1.00 17.47 ? 249  LEU A N   1 
ATOM   1674 C CA  . LEU A 1 229 ? -8.585  0.972   -44.364  1.00 18.06 ? 249  LEU A CA  1 
ATOM   1675 C C   . LEU A 1 229 ? -8.328  1.767   -43.089  1.00 17.79 ? 249  LEU A C   1 
ATOM   1676 O O   . LEU A 1 229 ? -8.710  2.932   -42.993  1.00 19.97 ? 249  LEU A O   1 
ATOM   1677 C CB  . LEU A 1 229 ? -9.721  -0.022  -44.112  1.00 18.18 ? 249  LEU A CB  1 
ATOM   1678 C CG  . LEU A 1 229 ? -10.134 -0.913  -45.286  1.00 18.66 ? 249  LEU A CG  1 
ATOM   1679 C CD1 . LEU A 1 229 ? -11.131 -1.961  -44.818  1.00 18.58 ? 249  LEU A CD1 1 
ATOM   1680 C CD2 . LEU A 1 229 ? -10.713 -0.093  -46.430  1.00 19.09 ? 249  LEU A CD2 1 
ATOM   1681 N N   . LYS A 1 230 ? -7.700  1.120   -42.108  1.00 17.12 ? 250  LYS A N   1 
ATOM   1682 C CA  . LYS A 1 230 ? -7.424  1.732   -40.810  1.00 17.21 ? 250  LYS A CA  1 
ATOM   1683 C C   . LYS A 1 230 ? -5.978  1.461   -40.404  1.00 16.25 ? 250  LYS A C   1 
ATOM   1684 O O   . LYS A 1 230 ? -5.379  0.472   -40.833  1.00 16.07 ? 250  LYS A O   1 
ATOM   1685 C CB  . LYS A 1 230 ? -8.355  1.158   -39.732  1.00 17.24 ? 250  LYS A CB  1 
ATOM   1686 C CG  . LYS A 1 230 ? -9.845  1.204   -40.049  1.00 18.68 ? 250  LYS A CG  1 
ATOM   1687 C CD  . LYS A 1 230 ? -10.434 2.589   -39.841  1.00 18.76 ? 250  LYS A CD  1 
ATOM   1688 C CE  . LYS A 1 230 ? -11.936 2.587   -40.086  1.00 18.80 ? 250  LYS A CE  1 
ATOM   1689 N NZ  . LYS A 1 230 ? -12.537 3.936   -39.898  1.00 19.46 ? 250  LYS A NZ  1 
ATOM   1690 N N   . THR A 1 231 ? -5.421  2.348   -39.584  1.00 15.79 ? 251  THR A N   1 
ATOM   1691 C CA  . THR A 1 231 ? -4.135  2.104   -38.934  1.00 15.37 ? 251  THR A CA  1 
ATOM   1692 C C   . THR A 1 231 ? -4.270  2.413   -37.445  1.00 14.13 ? 251  THR A C   1 
ATOM   1693 O O   . THR A 1 231 ? -5.048  3.287   -37.056  1.00 14.03 ? 251  THR A O   1 
ATOM   1694 C CB  . THR A 1 231 ? -2.995  2.948   -39.542  1.00 16.63 ? 251  THR A CB  1 
ATOM   1695 O OG1 . THR A 1 231 ? -3.180  4.330   -39.217  1.00 18.60 ? 251  THR A OG1 1 
ATOM   1696 C CG2 . THR A 1 231 ? -2.944  2.786   -41.058  1.00 17.29 ? 251  THR A CG2 1 
ATOM   1697 N N   . TYR A 1 232 ? -3.521  1.683   -36.621  1.00 12.88 ? 252  TYR A N   1 
ATOM   1698 C CA  . TYR A 1 232 ? -3.565  1.847   -35.168  1.00 11.79 ? 252  TYR A CA  1 
ATOM   1699 C C   . TYR A 1 232 ? -2.148  2.033   -34.640  1.00 11.47 ? 252  TYR A C   1 
ATOM   1700 O O   . TYR A 1 232 ? -1.256  1.236   -34.940  1.00 11.65 ? 252  TYR A O   1 
ATOM   1701 C CB  . TYR A 1 232 ? -4.236  0.634   -34.516  1.00 11.25 ? 252  TYR A CB  1 
ATOM   1702 C CG  . TYR A 1 232 ? -5.549  0.267   -35.167  1.00 11.10 ? 252  TYR A CG  1 
ATOM   1703 C CD1 . TYR A 1 232 ? -6.746  0.824   -34.731  1.00 10.81 ? 252  TYR A CD1 1 
ATOM   1704 C CD2 . TYR A 1 232 ? -5.591  -0.623  -36.237  1.00 10.88 ? 252  TYR A CD2 1 
ATOM   1705 C CE1 . TYR A 1 232 ? -7.949  0.501   -35.336  1.00 10.98 ? 252  TYR A CE1 1 
ATOM   1706 C CE2 . TYR A 1 232 ? -6.788  -0.952  -36.850  1.00 11.14 ? 252  TYR A CE2 1 
ATOM   1707 C CZ  . TYR A 1 232 ? -7.966  -0.388  -36.394  1.00 11.10 ? 252  TYR A CZ  1 
ATOM   1708 O OH  . TYR A 1 232 ? -9.159  -0.713  -36.997  1.00 11.70 ? 252  TYR A OH  1 
ATOM   1709 N N   . THR A 1 233 ? -1.943  3.104   -33.875  1.00 11.25 ? 253  THR A N   1 
ATOM   1710 C CA  . THR A 1 233 ? -0.619  3.465   -33.373  1.00 11.79 ? 253  THR A CA  1 
ATOM   1711 C C   . THR A 1 233 ? -0.700  3.918   -31.919  1.00 11.71 ? 253  THR A C   1 
ATOM   1712 O O   . THR A 1 233 ? -1.791  4.038   -31.360  1.00 11.83 ? 253  THR A O   1 
ATOM   1713 C CB  . THR A 1 233 ? 0.011   4.594   -34.217  1.00 12.62 ? 253  THR A CB  1 
ATOM   1714 O OG1 . THR A 1 233 ? -0.769  5.787   -34.086  1.00 14.64 ? 253  THR A OG1 1 
ATOM   1715 C CG2 . THR A 1 233 ? 0.088   4.202   -35.687  1.00 13.12 ? 253  THR A CG2 1 
ATOM   1716 N N   . GLY A 1 234 ? 0.466   4.159   -31.320  1.00 11.81 ? 254  GLY A N   1 
ATOM   1717 C CA  . GLY A 1 234 ? 0.579   4.612   -29.929  1.00 12.44 ? 254  GLY A CA  1 
ATOM   1718 C C   . GLY A 1 234 ? 1.326   3.617   -29.057  1.00 12.36 ? 254  GLY A C   1 
ATOM   1719 O O   . GLY A 1 234 ? 1.833   3.964   -27.989  1.00 13.07 ? 254  GLY A O   1 
ATOM   1720 N N   . HIS A 1 235 ? 1.385   2.374   -29.523  1.00 12.02 ? 255  HIS A N   1 
ATOM   1721 C CA  . HIS A 1 235 ? 2.091   1.292   -28.840  1.00 11.54 ? 255  HIS A CA  1 
ATOM   1722 C C   . HIS A 1 235 ? 3.533   1.174   -29.338  1.00 11.45 ? 255  HIS A C   1 
ATOM   1723 O O   . HIS A 1 235 ? 3.935   1.871   -30.271  1.00 11.61 ? 255  HIS A O   1 
ATOM   1724 C CB  . HIS A 1 235 ? 1.338   -0.033  -29.032  1.00 11.51 ? 255  HIS A CB  1 
ATOM   1725 C CG  . HIS A 1 235 ? 1.363   -0.560  -30.438  1.00 12.13 ? 255  HIS A CG  1 
ATOM   1726 N ND1 . HIS A 1 235 ? 0.799   0.110   -31.505  1.00 11.54 ? 255  HIS A ND1 1 
ATOM   1727 C CD2 . HIS A 1 235 ? 1.865   -1.710  -30.943  1.00 12.37 ? 255  HIS A CD2 1 
ATOM   1728 C CE1 . HIS A 1 235 ? 0.967   -0.598  -32.606  1.00 12.45 ? 255  HIS A CE1 1 
ATOM   1729 N NE2 . HIS A 1 235 ? 1.609   -1.708  -32.293  1.00 13.31 ? 255  HIS A NE2 1 
ATOM   1730 N N   . LYS A 1 236 ? 4.311   0.299   -28.706  1.00 11.10 ? 256  LYS A N   1 
ATOM   1731 C CA  . LYS A 1 236 ? 5.697   0.064   -29.108  1.00 11.65 ? 256  LYS A CA  1 
ATOM   1732 C C   . LYS A 1 236 ? 5.847   -1.338  -29.678  1.00 11.61 ? 256  LYS A C   1 
ATOM   1733 O O   . LYS A 1 236 ? 5.551   -2.325  -29.005  1.00 12.08 ? 256  LYS A O   1 
ATOM   1734 C CB  . LYS A 1 236 ? 6.652   0.241   -27.926  1.00 12.96 ? 256  LYS A CB  1 
ATOM   1735 C CG  . LYS A 1 236 ? 8.122   0.164   -28.318  1.00 15.28 ? 256  LYS A CG  1 
ATOM   1736 C CD  . LYS A 1 236 ? 9.035   0.100   -27.108  1.00 17.59 ? 256  LYS A CD  1 
ATOM   1737 C CE  . LYS A 1 236 ? 10.478  -0.164  -27.514  1.00 19.57 ? 256  LYS A CE  1 
ATOM   1738 N NZ  . LYS A 1 236 ? 11.082  0.989   -28.236  1.00 21.93 ? 256  LYS A NZ  1 
ATOM   1739 N N   . ASN A 1 237 ? 6.321   -1.421  -30.917  1.00 11.52 ? 257  ASN A N   1 
ATOM   1740 C CA  . ASN A 1 237 ? 6.548   -2.705  -31.566  1.00 11.01 ? 257  ASN A CA  1 
ATOM   1741 C C   . ASN A 1 237 ? 7.562   -2.568  -32.698  1.00 10.46 ? 257  ASN A C   1 
ATOM   1742 O O   . ASN A 1 237 ? 7.193   -2.280  -33.837  1.00 10.54 ? 257  ASN A O   1 
ATOM   1743 C CB  . ASN A 1 237 ? 5.224   -3.276  -32.083  1.00 10.56 ? 257  ASN A CB  1 
ATOM   1744 C CG  . ASN A 1 237 ? 5.350   -4.707  -32.575  1.00 10.61 ? 257  ASN A CG  1 
ATOM   1745 O OD1 . ASN A 1 237 ? 6.279   -5.429  -32.208  1.00 10.73 ? 257  ASN A OD1 1 
ATOM   1746 N ND2 . ASN A 1 237 ? 4.404   -5.127  -33.402  1.00 10.03 ? 257  ASN A ND2 1 
ATOM   1747 N N   . GLU A 1 238 ? 8.838   -2.746  -32.357  1.00 10.90 ? 258  GLU A N   1 
ATOM   1748 C CA  . GLU A 1 238 ? 9.939   -2.725  -33.326  1.00 11.94 ? 258  GLU A CA  1 
ATOM   1749 C C   . GLU A 1 238 ? 10.833  -3.975  -33.300  1.00 11.46 ? 258  GLU A C   1 
ATOM   1750 O O   . GLU A 1 238 ? 11.710  -4.113  -34.154  1.00 12.57 ? 258  GLU A O   1 
ATOM   1751 C CB  . GLU A 1 238 ? 10.825  -1.501  -33.076  1.00 13.30 ? 258  GLU A CB  1 
ATOM   1752 C CG  . GLU A 1 238 ? 10.093  -0.169  -33.127  1.00 14.65 ? 258  GLU A CG  1 
ATOM   1753 C CD  . GLU A 1 238 ? 11.012  1.029   -32.951  1.00 16.31 ? 258  GLU A CD  1 
ATOM   1754 O OE1 . GLU A 1 238 ? 12.172  0.851   -32.525  1.00 18.30 ? 258  GLU A OE1 1 
ATOM   1755 O OE2 . GLU A 1 238 ? 10.570  2.160   -33.240  1.00 16.98 ? 258  GLU A OE2 1 
ATOM   1756 N N   . LYS A 1 239 ? 10.621  -4.879  -32.342  1.00 10.56 ? 259  LYS A N   1 
ATOM   1757 C CA  . LYS A 1 239 ? 11.555  -5.988  -32.109  1.00 10.69 ? 259  LYS A CA  1 
ATOM   1758 C C   . LYS A 1 239 ? 10.933  -7.387  -32.088  1.00 9.88  ? 259  LYS A C   1 
ATOM   1759 O O   . LYS A 1 239 ? 11.613  -8.361  -32.414  1.00 10.16 ? 259  LYS A O   1 
ATOM   1760 C CB  . LYS A 1 239 ? 12.295  -5.783  -30.787  1.00 11.79 ? 259  LYS A CB  1 
ATOM   1761 C CG  . LYS A 1 239 ? 13.013  -4.451  -30.651  1.00 13.37 ? 259  LYS A CG  1 
ATOM   1762 C CD  . LYS A 1 239 ? 13.748  -4.383  -29.320  1.00 15.62 ? 259  LYS A CD  1 
ATOM   1763 C CE  . LYS A 1 239 ? 13.828  -2.965  -28.783  1.00 18.12 ? 259  LYS A CE  1 
ATOM   1764 N NZ  . LYS A 1 239 ? 14.416  -2.930  -27.417  1.00 20.52 ? 259  LYS A NZ  1 
ATOM   1765 N N   . TYR A 1 240 ? 9.668   -7.501  -31.684  1.00 8.89  ? 260  TYR A N   1 
ATOM   1766 C CA  . TYR A 1 240 ? 9.051   -8.810  -31.458  1.00 8.66  ? 260  TYR A CA  1 
ATOM   1767 C C   . TYR A 1 240 ? 7.803   -9.030  -32.297  1.00 8.62  ? 260  TYR A C   1 
ATOM   1768 O O   . TYR A 1 240 ? 7.139   -8.081  -32.708  1.00 8.81  ? 260  TYR A O   1 
ATOM   1769 C CB  . TYR A 1 240 ? 8.698   -8.977  -29.981  1.00 8.47  ? 260  TYR A CB  1 
ATOM   1770 C CG  . TYR A 1 240 ? 9.906   -8.984  -29.077  1.00 8.46  ? 260  TYR A CG  1 
ATOM   1771 C CD1 . TYR A 1 240 ? 10.598  -10.163 -28.816  1.00 8.40  ? 260  TYR A CD1 1 
ATOM   1772 C CD2 . TYR A 1 240 ? 10.367  -7.810  -28.494  1.00 8.79  ? 260  TYR A CD2 1 
ATOM   1773 C CE1 . TYR A 1 240 ? 11.710  -10.174 -27.988  1.00 8.78  ? 260  TYR A CE1 1 
ATOM   1774 C CE2 . TYR A 1 240 ? 11.478  -7.808  -27.669  1.00 9.04  ? 260  TYR A CE2 1 
ATOM   1775 C CZ  . TYR A 1 240 ? 12.146  -8.990  -27.416  1.00 9.08  ? 260  TYR A CZ  1 
ATOM   1776 O OH  . TYR A 1 240 ? 13.252  -8.983  -26.598  1.00 10.46 ? 260  TYR A OH  1 
ATOM   1777 N N   . CYS A 1 241 ? 7.503   -10.300 -32.551  1.00 8.25  ? 261  CYS A N   1 
ATOM   1778 C CA  . CYS A 1 241 ? 6.292   -10.684 -33.257  1.00 8.31  ? 261  CYS A CA  1 
ATOM   1779 C C   . CYS A 1 241 ? 5.158   -10.828 -32.253  1.00 8.15  ? 261  CYS A C   1 
ATOM   1780 O O   . CYS A 1 241 ? 4.882   -11.920 -31.739  1.00 8.96  ? 261  CYS A O   1 
ATOM   1781 C CB  . CYS A 1 241 ? 6.521   -11.967 -34.049  1.00 8.69  ? 261  CYS A CB  1 
ATOM   1782 S SG  . CYS A 1 241 ? 7.695   -11.725 -35.396  1.00 9.52  ? 261  CYS A SG  1 
ATOM   1783 N N   . ILE A 1 242 ? 4.523   -9.694  -31.974  1.00 8.18  ? 262  ILE A N   1 
ATOM   1784 C CA  . ILE A 1 242 ? 3.468   -9.597  -30.979  1.00 7.97  ? 262  ILE A CA  1 
ATOM   1785 C C   . ILE A 1 242 ? 2.106   -9.887  -31.611  1.00 8.28  ? 262  ILE A C   1 
ATOM   1786 O O   . ILE A 1 242 ? 1.749   -9.311  -32.644  1.00 8.65  ? 262  ILE A O   1 
ATOM   1787 C CB  . ILE A 1 242 ? 3.470   -8.200  -30.319  1.00 7.92  ? 262  ILE A CB  1 
ATOM   1788 C CG1 . ILE A 1 242 ? 4.821   -7.952  -29.638  1.00 7.66  ? 262  ILE A CG1 1 
ATOM   1789 C CG2 . ILE A 1 242 ? 2.335   -8.070  -29.317  1.00 8.04  ? 262  ILE A CG2 1 
ATOM   1790 C CD1 . ILE A 1 242 ? 4.982   -6.561  -29.063  1.00 7.42  ? 262  ILE A CD1 1 
ATOM   1791 N N   . PHE A 1 243 ? 1.347   -10.780 -30.980  1.00 8.75  ? 263  PHE A N   1 
ATOM   1792 C CA  . PHE A 1 243 ? 0.015   -11.138 -31.461  1.00 8.66  ? 263  PHE A CA  1 
ATOM   1793 C C   . PHE A 1 243 ? -0.934  -9.948  -31.317  1.00 9.32  ? 263  PHE A C   1 
ATOM   1794 O O   . PHE A 1 243 ? -0.842  -9.181  -30.357  1.00 10.63 ? 263  PHE A O   1 
ATOM   1795 C CB  . PHE A 1 243 ? -0.553  -12.327 -30.674  1.00 8.36  ? 263  PHE A CB  1 
ATOM   1796 C CG  . PHE A 1 243 ? 0.140   -13.635 -30.944  1.00 7.79  ? 263  PHE A CG  1 
ATOM   1797 C CD1 . PHE A 1 243 ? 1.277   -14.000 -30.232  1.00 7.70  ? 263  PHE A CD1 1 
ATOM   1798 C CD2 . PHE A 1 243 ? -0.361  -14.517 -31.890  1.00 7.66  ? 263  PHE A CD2 1 
ATOM   1799 C CE1 . PHE A 1 243 ? 1.906   -15.212 -30.469  1.00 7.90  ? 263  PHE A CE1 1 
ATOM   1800 C CE2 . PHE A 1 243 ? 0.264   -15.728 -32.134  1.00 7.56  ? 263  PHE A CE2 1 
ATOM   1801 C CZ  . PHE A 1 243 ? 1.398   -16.079 -31.420  1.00 7.77  ? 263  PHE A CZ  1 
ATOM   1802 N N   . ALA A 1 244 ? -1.834  -9.803  -32.285  1.00 9.56  ? 264  ALA A N   1 
ATOM   1803 C CA  . ALA A 1 244 ? -2.902  -8.811  -32.235  1.00 10.05 ? 264  ALA A CA  1 
ATOM   1804 C C   . ALA A 1 244 ? -4.222  -9.524  -32.484  1.00 9.87  ? 264  ALA A C   1 
ATOM   1805 O O   . ALA A 1 244 ? -4.244  -10.622 -33.044  1.00 10.18 ? 264  ALA A O   1 
ATOM   1806 C CB  . ALA A 1 244 ? -2.679  -7.720  -33.268  1.00 10.37 ? 264  ALA A CB  1 
ATOM   1807 N N   . ASN A 1 245 ? -5.320  -8.907  -32.058  1.00 10.02 ? 265  ASN A N   1 
ATOM   1808 C CA  . ASN A 1 245 ? -6.626  -9.557  -32.096  1.00 10.68 ? 265  ASN A CA  1 
ATOM   1809 C C   . ASN A 1 245 ? -7.755  -8.599  -32.411  1.00 10.38 ? 265  ASN A C   1 
ATOM   1810 O O   . ASN A 1 245 ? -7.654  -7.396  -32.166  1.00 9.87  ? 265  ASN A O   1 
ATOM   1811 C CB  . ASN A 1 245 ? -6.939  -10.223 -30.751  1.00 11.76 ? 265  ASN A CB  1 
ATOM   1812 C CG  . ASN A 1 245 ? -5.824  -11.123 -30.265  1.00 12.27 ? 265  ASN A CG  1 
ATOM   1813 O OD1 . ASN A 1 245 ? -5.803  -12.316 -30.559  1.00 13.52 ? 265  ASN A OD1 1 
ATOM   1814 N ND2 . ASN A 1 245 ? -4.877  -10.550 -29.535  1.00 13.07 ? 265  ASN A ND2 1 
ATOM   1815 N N   . PHE A 1 246 ? -8.829  -9.158  -32.957  1.00 10.70 ? 266  PHE A N   1 
ATOM   1816 C CA  . PHE A 1 246 ? -10.125 -8.506  -32.989  1.00 11.14 ? 266  PHE A CA  1 
ATOM   1817 C C   . PHE A 1 246 ? -10.881 -8.937  -31.741  1.00 11.72 ? 266  PHE A C   1 
ATOM   1818 O O   . PHE A 1 246 ? -10.952 -10.129 -31.437  1.00 12.67 ? 266  PHE A O   1 
ATOM   1819 C CB  . PHE A 1 246 ? -10.915 -8.928  -34.228  1.00 11.14 ? 266  PHE A CB  1 
ATOM   1820 C CG  . PHE A 1 246 ? -10.313 -8.465  -35.520  1.00 11.00 ? 266  PHE A CG  1 
ATOM   1821 C CD1 . PHE A 1 246 ? -9.289  -9.183  -36.123  1.00 10.61 ? 266  PHE A CD1 1 
ATOM   1822 C CD2 . PHE A 1 246 ? -10.777 -7.315  -36.140  1.00 11.05 ? 266  PHE A CD2 1 
ATOM   1823 C CE1 . PHE A 1 246 ? -8.732  -8.757  -37.317  1.00 11.11 ? 266  PHE A CE1 1 
ATOM   1824 C CE2 . PHE A 1 246 ? -10.227 -6.883  -37.334  1.00 11.37 ? 266  PHE A CE2 1 
ATOM   1825 C CZ  . PHE A 1 246 ? -9.204  -7.606  -37.924  1.00 11.27 ? 266  PHE A CZ  1 
ATOM   1826 N N   . SER A 1 247 ? -11.422 -7.969  -31.009  1.00 12.27 ? 267  SER A N   1 
ATOM   1827 C CA  . SER A 1 247 ? -12.319 -8.250  -29.896  1.00 12.05 ? 267  SER A CA  1 
ATOM   1828 C C   . SER A 1 247 ? -13.726 -7.865  -30.330  1.00 12.55 ? 267  SER A C   1 
ATOM   1829 O O   . SER A 1 247 ? -13.988 -6.696  -30.613  1.00 12.68 ? 267  SER A O   1 
ATOM   1830 C CB  . SER A 1 247 ? -11.908 -7.456  -28.658  1.00 11.68 ? 267  SER A CB  1 
ATOM   1831 O OG  . SER A 1 247 ? -12.766 -7.748  -27.570  1.00 12.07 ? 267  SER A OG  1 
ATOM   1832 N N   . VAL A 1 248 ? -14.621 -8.849  -30.398  1.00 13.36 ? 268  VAL A N   1 
ATOM   1833 C CA  . VAL A 1 248 ? -15.967 -8.635  -30.951  1.00 14.51 ? 268  VAL A CA  1 
ATOM   1834 C C   . VAL A 1 248 ? -17.109 -9.233  -30.112  1.00 15.25 ? 268  VAL A C   1 
ATOM   1835 O O   . VAL A 1 248 ? -18.239 -9.345  -30.592  1.00 16.16 ? 268  VAL A O   1 
ATOM   1836 C CB  . VAL A 1 248 ? -16.054 -9.171  -32.401  1.00 15.05 ? 268  VAL A CB  1 
ATOM   1837 C CG1 . VAL A 1 248 ? -15.099 -8.407  -33.306  1.00 15.20 ? 268  VAL A CG1 1 
ATOM   1838 C CG2 . VAL A 1 248 ? -15.759 -10.665 -32.460  1.00 14.78 ? 268  VAL A CG2 1 
ATOM   1839 N N   . THR A 1 249 ? -16.826 -9.597  -28.862  1.00 15.34 ? 269  THR A N   1 
ATOM   1840 C CA  . THR A 1 249 ? -17.847 -10.147 -27.967  1.00 15.43 ? 269  THR A CA  1 
ATOM   1841 C C   . THR A 1 249 ? -18.737 -9.045  -27.387  1.00 15.81 ? 269  THR A C   1 
ATOM   1842 O O   . THR A 1 249 ? -19.919 -9.274  -27.114  1.00 16.93 ? 269  THR A O   1 
ATOM   1843 C CB  . THR A 1 249 ? -17.209 -10.954 -26.820  1.00 15.03 ? 269  THR A CB  1 
ATOM   1844 O OG1 . THR A 1 249 ? -16.110 -10.219 -26.265  1.00 14.18 ? 269  THR A OG1 1 
ATOM   1845 C CG2 . THR A 1 249 ? -16.706 -12.294 -27.335  1.00 14.85 ? 269  THR A CG2 1 
ATOM   1846 N N   . GLY A 1 250 ? -18.161 -7.859  -27.190  1.00 15.73 ? 270  GLY A N   1 
ATOM   1847 C CA  . GLY A 1 250 ? -18.903 -6.687  -26.730  1.00 15.63 ? 270  GLY A CA  1 
ATOM   1848 C C   . GLY A 1 250 ? -18.760 -5.570  -27.743  1.00 15.31 ? 270  GLY A C   1 
ATOM   1849 O O   . GLY A 1 250 ? -19.287 -5.663  -28.850  1.00 15.79 ? 270  GLY A O   1 
ATOM   1850 N N   . GLY A 1 251 ? -18.048 -4.512  -27.367  1.00 14.91 ? 271  GLY A N   1 
ATOM   1851 C CA  . GLY A 1 251 ? -17.683 -3.459  -28.312  1.00 15.00 ? 271  GLY A CA  1 
ATOM   1852 C C   . GLY A 1 251 ? -16.649 -3.978  -29.297  1.00 15.42 ? 271  GLY A C   1 
ATOM   1853 O O   . GLY A 1 251 ? -16.027 -5.013  -29.061  1.00 15.97 ? 271  GLY A O   1 
ATOM   1854 N N   . LYS A 1 252 ? -16.463 -3.264  -30.402  1.00 15.39 ? 272  LYS A N   1 
ATOM   1855 C CA  . LYS A 1 252 ? -15.523 -3.695  -31.441  1.00 14.73 ? 272  LYS A CA  1 
ATOM   1856 C C   . LYS A 1 252 ? -14.159 -3.056  -31.234  1.00 13.51 ? 272  LYS A C   1 
ATOM   1857 O O   . LYS A 1 252 ? -13.973 -1.868  -31.509  1.00 12.85 ? 272  LYS A O   1 
ATOM   1858 C CB  . LYS A 1 252 ? -16.063 -3.378  -32.839  1.00 16.08 ? 272  LYS A CB  1 
ATOM   1859 C CG  . LYS A 1 252 ? -16.889 -4.504  -33.441  1.00 18.42 ? 272  LYS A CG  1 
ATOM   1860 C CD  . LYS A 1 252 ? -18.209 -4.693  -32.713  1.00 19.66 ? 272  LYS A CD  1 
ATOM   1861 C CE  . LYS A 1 252 ? -18.784 -6.082  -32.923  1.00 20.40 ? 272  LYS A CE  1 
ATOM   1862 N NZ  . LYS A 1 252 ? -19.902 -6.330  -31.974  1.00 22.35 ? 272  LYS A NZ  1 
ATOM   1863 N N   . TRP A 1 253 ? -13.209 -3.852  -30.747  1.00 12.48 ? 273  TRP A N   1 
ATOM   1864 C CA  . TRP A 1 253 ? -11.876 -3.354  -30.437  1.00 11.77 ? 273  TRP A CA  1 
ATOM   1865 C C   . TRP A 1 253 ? -10.790 -4.092  -31.201  1.00 10.73 ? 273  TRP A C   1 
ATOM   1866 O O   . TRP A 1 253 ? -10.990 -5.214  -31.675  1.00 10.81 ? 273  TRP A O   1 
ATOM   1867 C CB  . TRP A 1 253 ? -11.573 -3.476  -28.939  1.00 12.22 ? 273  TRP A CB  1 
ATOM   1868 C CG  . TRP A 1 253 ? -12.745 -3.274  -28.039  1.00 12.64 ? 273  TRP A CG  1 
ATOM   1869 C CD1 . TRP A 1 253 ? -13.364 -4.222  -27.281  1.00 13.29 ? 273  TRP A CD1 1 
ATOM   1870 C CD2 . TRP A 1 253 ? -13.439 -2.047  -27.796  1.00 12.94 ? 273  TRP A CD2 1 
ATOM   1871 N NE1 . TRP A 1 253 ? -14.402 -3.664  -26.579  1.00 13.41 ? 273  TRP A NE1 1 
ATOM   1872 C CE2 . TRP A 1 253 ? -14.472 -2.329  -26.878  1.00 13.24 ? 273  TRP A CE2 1 
ATOM   1873 C CE3 . TRP A 1 253 ? -13.292 -0.738  -28.267  1.00 13.42 ? 273  TRP A CE3 1 
ATOM   1874 C CZ2 . TRP A 1 253 ? -15.354 -1.348  -26.420  1.00 13.57 ? 273  TRP A CZ2 1 
ATOM   1875 C CZ3 . TRP A 1 253 ? -14.167 0.237   -27.810  1.00 13.61 ? 273  TRP A CZ3 1 
ATOM   1876 C CH2 . TRP A 1 253 ? -15.187 -0.075  -26.897  1.00 13.45 ? 273  TRP A CH2 1 
ATOM   1877 N N   . ILE A 1 254 ? -9.641  -3.431  -31.310  1.00 10.06 ? 274  ILE A N   1 
ATOM   1878 C CA  . ILE A 1 254 ? -8.387  -4.069  -31.672  1.00 9.94  ? 274  ILE A CA  1 
ATOM   1879 C C   . ILE A 1 254 ? -7.566  -4.173  -30.390  1.00 9.69  ? 274  ILE A C   1 
ATOM   1880 O O   . ILE A 1 254 ? -7.489  -3.215  -29.614  1.00 9.55  ? 274  ILE A O   1 
ATOM   1881 C CB  . ILE A 1 254 ? -7.617  -3.255  -32.733  1.00 10.40 ? 274  ILE A CB  1 
ATOM   1882 C CG1 . ILE A 1 254 ? -8.411  -3.188  -34.046  1.00 10.45 ? 274  ILE A CG1 1 
ATOM   1883 C CG2 . ILE A 1 254 ? -6.233  -3.844  -32.971  1.00 10.97 ? 274  ILE A CG2 1 
ATOM   1884 C CD1 . ILE A 1 254 ? -8.622  -4.522  -34.734  1.00 11.08 ? 274  ILE A CD1 1 
ATOM   1885 N N   . VAL A 1 255 ? -6.973  -5.343  -30.168  1.00 9.58  ? 275  VAL A N   1 
ATOM   1886 C CA  . VAL A 1 255 ? -6.189  -5.611  -28.965  1.00 9.29  ? 275  VAL A CA  1 
ATOM   1887 C C   . VAL A 1 255 ? -4.797  -6.070  -29.376  1.00 9.41  ? 275  VAL A C   1 
ATOM   1888 O O   . VAL A 1 255 ? -4.655  -6.883  -30.290  1.00 10.07 ? 275  VAL A O   1 
ATOM   1889 C CB  . VAL A 1 255 ? -6.848  -6.702  -28.093  1.00 9.19  ? 275  VAL A CB  1 
ATOM   1890 C CG1 . VAL A 1 255 ? -6.004  -6.997  -26.857  1.00 9.51  ? 275  VAL A CG1 1 
ATOM   1891 C CG2 . VAL A 1 255 ? -8.253  -6.283  -27.685  1.00 9.16  ? 275  VAL A CG2 1 
ATOM   1892 N N   . SER A 1 256 ? -3.775  -5.554  -28.698  1.00 9.15  ? 276  SER A N   1 
ATOM   1893 C CA  . SER A 1 256 ? -2.392  -5.947  -28.964  1.00 9.48  ? 276  SER A CA  1 
ATOM   1894 C C   . SER A 1 256 ? -1.514  -5.766  -27.740  1.00 9.11  ? 276  SER A C   1 
ATOM   1895 O O   . SER A 1 256 ? -1.764  -4.896  -26.907  1.00 10.19 ? 276  SER A O   1 
ATOM   1896 C CB  . SER A 1 256 ? -1.811  -5.119  -30.112  1.00 9.99  ? 276  SER A CB  1 
ATOM   1897 O OG  . SER A 1 256 ? -0.488  -5.523  -30.424  1.00 10.69 ? 276  SER A OG  1 
ATOM   1898 N N   . GLY A 1 257 ? -0.476  -6.591  -27.645  1.00 8.71  ? 277  GLY A N   1 
ATOM   1899 C CA  . GLY A 1 257 ? 0.592   -6.369  -26.685  1.00 8.59  ? 277  GLY A CA  1 
ATOM   1900 C C   . GLY A 1 257 ? 1.510   -5.254  -27.161  1.00 8.62  ? 277  GLY A C   1 
ATOM   1901 O O   . GLY A 1 257 ? 1.311   -4.678  -28.236  1.00 9.19  ? 277  GLY A O   1 
ATOM   1902 N N   . SER A 1 258 ? 2.530   -4.957  -26.365  1.00 8.42  ? 278  SER A N   1 
ATOM   1903 C CA  . SER A 1 258 ? 3.436   -3.850  -26.653  1.00 8.32  ? 278  SER A CA  1 
ATOM   1904 C C   . SER A 1 258 ? 4.759   -4.047  -25.925  1.00 8.44  ? 278  SER A C   1 
ATOM   1905 O O   . SER A 1 258 ? 4.814   -4.722  -24.896  1.00 8.78  ? 278  SER A O   1 
ATOM   1906 C CB  . SER A 1 258 ? 2.792   -2.530  -26.225  1.00 8.99  ? 278  SER A CB  1 
ATOM   1907 O OG  . SER A 1 258 ? 3.624   -1.418  -26.508  1.00 9.09  ? 278  SER A OG  1 
ATOM   1908 N N   . GLU A 1 259 ? 5.814   -3.441  -26.462  1.00 8.39  ? 279  GLU A N   1 
ATOM   1909 C CA  . GLU A 1 259 ? 7.158   -3.557  -25.895  1.00 8.38  ? 279  GLU A CA  1 
ATOM   1910 C C   . GLU A 1 259 ? 7.406   -2.596  -24.727  1.00 8.51  ? 279  GLU A C   1 
ATOM   1911 O O   . GLU A 1 259 ? 8.490   -2.600  -24.144  1.00 9.18  ? 279  GLU A O   1 
ATOM   1912 C CB  . GLU A 1 259 ? 8.209   -3.384  -26.997  1.00 8.87  ? 279  GLU A CB  1 
ATOM   1913 C CG  . GLU A 1 259 ? 8.295   -4.605  -27.902  1.00 9.35  ? 279  GLU A CG  1 
ATOM   1914 C CD  . GLU A 1 259 ? 8.862   -4.324  -29.280  1.00 9.86  ? 279  GLU A CD  1 
ATOM   1915 O OE1 . GLU A 1 259 ? 9.476   -3.255  -29.498  1.00 10.65 ? 279  GLU A OE1 1 
ATOM   1916 O OE2 . GLU A 1 259 ? 8.674   -5.183  -30.169  1.00 9.79  ? 279  GLU A OE2 1 
ATOM   1917 N N   . ASP A 1 260 ? 6.401   -1.785  -24.389  1.00 8.80  ? 280  ASP A N   1 
ATOM   1918 C CA  . ASP A 1 260 ? 6.421   -0.990  -23.156  1.00 9.04  ? 280  ASP A CA  1 
ATOM   1919 C C   . ASP A 1 260 ? 5.655   -1.674  -22.014  1.00 9.33  ? 280  ASP A C   1 
ATOM   1920 O O   . ASP A 1 260 ? 5.327   -1.035  -21.015  1.00 10.16 ? 280  ASP A O   1 
ATOM   1921 C CB  . ASP A 1 260 ? 5.881   0.431   -23.407  1.00 9.24  ? 280  ASP A CB  1 
ATOM   1922 C CG  . ASP A 1 260 ? 4.418   0.454   -23.841  1.00 9.47  ? 280  ASP A CG  1 
ATOM   1923 O OD1 . ASP A 1 260 ? 3.783   -0.619  -23.928  1.00 9.86  ? 280  ASP A OD1 1 
ATOM   1924 O OD2 . ASP A 1 260 ? 3.902   1.562   -24.091  1.00 10.76 ? 280  ASP A OD2 1 
ATOM   1925 N N   . ASN A 1 261 ? 5.375   -2.969  -22.176  1.00 9.14  ? 281  ASN A N   1 
ATOM   1926 C CA  . ASN A 1 261 ? 4.783   -3.822  -21.132  1.00 8.72  ? 281  ASN A CA  1 
ATOM   1927 C C   . ASN A 1 261 ? 3.274   -3.645  -20.915  1.00 8.40  ? 281  ASN A C   1 
ATOM   1928 O O   . ASN A 1 261 ? 2.729   -4.173  -19.947  1.00 8.76  ? 281  ASN A O   1 
ATOM   1929 C CB  . ASN A 1 261 ? 5.513   -3.666  -19.784  1.00 8.89  ? 281  ASN A CB  1 
ATOM   1930 C CG  . ASN A 1 261 ? 7.024   -3.733  -19.914  1.00 9.08  ? 281  ASN A CG  1 
ATOM   1931 O OD1 . ASN A 1 261 ? 7.555   -4.239  -20.900  1.00 9.88  ? 281  ASN A OD1 1 
ATOM   1932 N ND2 . ASN A 1 261 ? 7.727   -3.226  -18.906  1.00 10.03 ? 281  ASN A ND2 1 
ATOM   1933 N N   . LEU A 1 262 ? 2.599   -2.928  -21.812  1.00 8.50  ? 282  LEU A N   1 
ATOM   1934 C CA  . LEU A 1 262 ? 1.160   -2.679  -21.685  1.00 8.44  ? 282  LEU A CA  1 
ATOM   1935 C C   . LEU A 1 262 ? 0.366   -3.454  -22.732  1.00 8.69  ? 282  LEU A C   1 
ATOM   1936 O O   . LEU A 1 262 ? 0.880   -3.771  -23.802  1.00 9.49  ? 282  LEU A O   1 
ATOM   1937 C CB  . LEU A 1 262 ? 0.866   -1.186  -21.852  1.00 8.91  ? 282  LEU A CB  1 
ATOM   1938 C CG  . LEU A 1 262 ? 1.527   -0.215  -20.873  1.00 9.31  ? 282  LEU A CG  1 
ATOM   1939 C CD1 . LEU A 1 262 ? 1.357   1.215   -21.363  1.00 9.79  ? 282  LEU A CD1 1 
ATOM   1940 C CD2 . LEU A 1 262 ? 0.957   -0.373  -19.472  1.00 9.36  ? 282  LEU A CD2 1 
ATOM   1941 N N   . VAL A 1 263 ? -0.888  -3.759  -22.411  1.00 8.63  ? 283  VAL A N   1 
ATOM   1942 C CA  . VAL A 1 263 ? -1.839  -4.236  -23.410  1.00 8.80  ? 283  VAL A CA  1 
ATOM   1943 C C   . VAL A 1 263 ? -2.584  -3.013  -23.918  1.00 9.03  ? 283  VAL A C   1 
ATOM   1944 O O   . VAL A 1 263 ? -3.165  -2.272  -23.126  1.00 9.66  ? 283  VAL A O   1 
ATOM   1945 C CB  . VAL A 1 263 ? -2.858  -5.237  -22.825  1.00 9.19  ? 283  VAL A CB  1 
ATOM   1946 C CG1 . VAL A 1 263 ? -3.807  -5.731  -23.909  1.00 9.54  ? 283  VAL A CG1 1 
ATOM   1947 C CG2 . VAL A 1 263 ? -2.151  -6.417  -22.176  1.00 9.08  ? 283  VAL A CG2 1 
ATOM   1948 N N   . TYR A 1 264 ? -2.558  -2.804  -25.232  1.00 9.22  ? 284  TYR A N   1 
ATOM   1949 C CA  . TYR A 1 264 ? -3.267  -1.692  -25.858  1.00 9.26  ? 284  TYR A CA  1 
ATOM   1950 C C   . TYR A 1 264 ? -4.595  -2.157  -26.432  1.00 9.36  ? 284  TYR A C   1 
ATOM   1951 O O   . TYR A 1 264 ? -4.678  -3.239  -27.017  1.00 9.41  ? 284  TYR A O   1 
ATOM   1952 C CB  . TYR A 1 264 ? -2.422  -1.069  -26.972  1.00 9.34  ? 284  TYR A CB  1 
ATOM   1953 C CG  . TYR A 1 264 ? -1.371  -0.117  -26.466  1.00 9.50  ? 284  TYR A CG  1 
ATOM   1954 C CD1 . TYR A 1 264 ? -0.255  -0.584  -25.784  1.00 9.51  ? 284  TYR A CD1 1 
ATOM   1955 C CD2 . TYR A 1 264 ? -1.493  1.257   -26.663  1.00 9.71  ? 284  TYR A CD2 1 
ATOM   1956 C CE1 . TYR A 1 264 ? 0.710   0.286   -25.311  1.00 9.77  ? 284  TYR A CE1 1 
ATOM   1957 C CE2 . TYR A 1 264 ? -0.534  2.134   -26.192  1.00 10.37 ? 284  TYR A CE2 1 
ATOM   1958 C CZ  . TYR A 1 264 ? 0.566   1.646   -25.518  1.00 10.15 ? 284  TYR A CZ  1 
ATOM   1959 O OH  . TYR A 1 264 ? 1.520   2.516   -25.049  1.00 11.75 ? 284  TYR A OH  1 
ATOM   1960 N N   . ILE A 1 265 ? -5.623  -1.328  -26.269  1.00 9.27  ? 285  ILE A N   1 
ATOM   1961 C CA  . ILE A 1 265 ? -6.937  -1.579  -26.849  1.00 9.78  ? 285  ILE A CA  1 
ATOM   1962 C C   . ILE A 1 265 ? -7.362  -0.334  -27.625  1.00 10.46 ? 285  ILE A C   1 
ATOM   1963 O O   . ILE A 1 265 ? -7.355  0.770   -27.076  1.00 11.12 ? 285  ILE A O   1 
ATOM   1964 C CB  . ILE A 1 265 ? -7.993  -1.924  -25.771  1.00 9.93  ? 285  ILE A CB  1 
ATOM   1965 C CG1 . ILE A 1 265 ? -7.486  -3.064  -24.875  1.00 10.20 ? 285  ILE A CG1 1 
ATOM   1966 C CG2 . ILE A 1 265 ? -9.319  -2.309  -26.419  1.00 10.18 ? 285  ILE A CG2 1 
ATOM   1967 C CD1 . ILE A 1 265 ? -8.419  -3.449  -23.746  1.00 10.86 ? 285  ILE A CD1 1 
ATOM   1968 N N   . TRP A 1 266 ? -7.710  -0.522  -28.898  1.00 10.59 ? 286  TRP A N   1 
ATOM   1969 C CA  . TRP A 1 266 ? -8.184  0.565   -29.759  1.00 10.79 ? 286  TRP A CA  1 
ATOM   1970 C C   . TRP A 1 266 ? -9.641  0.365   -30.139  1.00 11.35 ? 286  TRP A C   1 
ATOM   1971 O O   . TRP A 1 266 ? -10.117 -0.766  -30.248  1.00 11.27 ? 286  TRP A O   1 
ATOM   1972 C CB  . TRP A 1 266 ? -7.397  0.612   -31.070  1.00 10.36 ? 286  TRP A CB  1 
ATOM   1973 C CG  . TRP A 1 266 ? -5.964  0.998   -30.971  1.00 9.71  ? 286  TRP A CG  1 
ATOM   1974 C CD1 . TRP A 1 266 ? -5.439  2.246   -31.128  1.00 9.69  ? 286  TRP A CD1 1 
ATOM   1975 C CD2 . TRP A 1 266 ? -4.857  0.121   -30.751  1.00 9.73  ? 286  TRP A CD2 1 
ATOM   1976 N NE1 . TRP A 1 266 ? -4.074  2.204   -31.001  1.00 9.47  ? 286  TRP A NE1 1 
ATOM   1977 C CE2 . TRP A 1 266 ? -3.690  0.909   -30.770  1.00 9.35  ? 286  TRP A CE2 1 
ATOM   1978 C CE3 . TRP A 1 266 ? -4.740  -1.256  -30.532  1.00 9.50  ? 286  TRP A CE3 1 
ATOM   1979 C CZ2 . TRP A 1 266 ? -2.419  0.368   -30.574  1.00 9.43  ? 286  TRP A CZ2 1 
ATOM   1980 C CZ3 . TRP A 1 266 ? -3.478  -1.793  -30.339  1.00 9.29  ? 286  TRP A CZ3 1 
ATOM   1981 C CH2 . TRP A 1 266 ? -2.334  -0.984  -30.362  1.00 9.01  ? 286  TRP A CH2 1 
ATOM   1982 N N   . ASN A 1 267 ? -10.336 1.474   -30.370  1.00 12.39 ? 287  ASN A N   1 
ATOM   1983 C CA  . ASN A 1 267 ? -11.628 1.446   -31.044  1.00 13.27 ? 287  ASN A CA  1 
ATOM   1984 C C   . ASN A 1 267 ? -11.381 1.126   -32.518  1.00 13.90 ? 287  ASN A C   1 
ATOM   1985 O O   . ASN A 1 267 ? -10.662 1.854   -33.200  1.00 14.10 ? 287  ASN A O   1 
ATOM   1986 C CB  . ASN A 1 267 ? -12.329 2.798   -30.886  1.00 14.16 ? 287  ASN A CB  1 
ATOM   1987 C CG  . ASN A 1 267 ? -13.727 2.821   -31.494  1.00 14.93 ? 287  ASN A CG  1 
ATOM   1988 O OD1 . ASN A 1 267 ? -13.909 2.548   -32.683  1.00 15.12 ? 287  ASN A OD1 1 
ATOM   1989 N ND2 . ASN A 1 267 ? -14.720 3.176   -30.683  1.00 16.26 ? 287  ASN A ND2 1 
ATOM   1990 N N   . LEU A 1 268 ? -11.964 0.028   -32.998  1.00 14.56 ? 288  LEU A N   1 
ATOM   1991 C CA  . LEU A 1 268 ? -11.715 -0.459  -34.360  1.00 15.38 ? 288  LEU A CA  1 
ATOM   1992 C C   . LEU A 1 268 ? -12.056 0.591   -35.420  1.00 15.77 ? 288  LEU A C   1 
ATOM   1993 O O   . LEU A 1 268 ? -11.268 0.831   -36.337  1.00 16.19 ? 288  LEU A O   1 
ATOM   1994 C CB  . LEU A 1 268 ? -12.500 -1.753  -34.623  1.00 15.74 ? 288  LEU A CB  1 
ATOM   1995 C CG  . LEU A 1 268 ? -12.164 -2.544  -35.899  1.00 15.81 ? 288  LEU A CG  1 
ATOM   1996 C CD1 . LEU A 1 268 ? -12.390 -4.035  -35.687  1.00 15.96 ? 288  LEU A CD1 1 
ATOM   1997 C CD2 . LEU A 1 268 ? -12.957 -2.059  -37.107  1.00 16.20 ? 288  LEU A CD2 1 
ATOM   1998 N N   . GLN A 1 269 ? -13.222 1.216   -35.279  1.00 16.85 ? 289  GLN A N   1 
ATOM   1999 C CA  . GLN A 1 269 ? -13.705 2.194   -36.263  1.00 17.13 ? 289  GLN A CA  1 
ATOM   2000 C C   . GLN A 1 269 ? -12.950 3.526   -36.206  1.00 16.80 ? 289  GLN A C   1 
ATOM   2001 O O   . GLN A 1 269 ? -12.471 4.011   -37.231  1.00 17.11 ? 289  GLN A O   1 
ATOM   2002 C CB  . GLN A 1 269 ? -15.214 2.439   -36.094  1.00 18.71 ? 289  GLN A CB  1 
ATOM   2003 C CG  . GLN A 1 269 ? -16.101 1.672   -37.070  1.00 21.73 ? 289  GLN A CG  1 
ATOM   2004 C CD  . GLN A 1 269 ? -15.970 0.161   -36.967  1.00 23.38 ? 289  GLN A CD  1 
ATOM   2005 O OE1 . GLN A 1 269 ? -15.788 -0.522  -37.975  1.00 25.91 ? 289  GLN A OE1 1 
ATOM   2006 N NE2 . GLN A 1 269 ? -16.074 -0.370  -35.751  1.00 24.28 ? 289  GLN A NE2 1 
ATOM   2007 N N   . THR A 1 270 ? -12.847 4.109   -35.012  1.00 17.07 ? 290  THR A N   1 
ATOM   2008 C CA  . THR A 1 270 ? -12.264 5.450   -34.848  1.00 16.50 ? 290  THR A CA  1 
ATOM   2009 C C   . THR A 1 270 ? -10.737 5.445   -34.738  1.00 15.99 ? 290  THR A C   1 
ATOM   2010 O O   . THR A 1 270 ? -10.100 6.478   -34.952  1.00 15.84 ? 290  THR A O   1 
ATOM   2011 C CB  . THR A 1 270 ? -12.824 6.179   -33.606  1.00 16.59 ? 290  THR A CB  1 
ATOM   2012 O OG1 . THR A 1 270 ? -12.340 5.554   -32.412  1.00 16.91 ? 290  THR A OG1 1 
ATOM   2013 C CG2 . THR A 1 270 ? -14.350 6.182   -33.606  1.00 16.58 ? 290  THR A CG2 1 
ATOM   2014 N N   . LYS A 1 271 ? -10.167 4.291   -34.385  1.00 15.86 ? 291  LYS A N   1 
ATOM   2015 C CA  . LYS A 1 271 ? -8.714  4.107   -34.229  1.00 15.56 ? 291  LYS A CA  1 
ATOM   2016 C C   . LYS A 1 271 ? -8.140  4.773   -32.971  1.00 15.13 ? 291  LYS A C   1 
ATOM   2017 O O   . LYS A 1 271 ? -6.924  4.842   -32.807  1.00 14.03 ? 291  LYS A O   1 
ATOM   2018 C CB  . LYS A 1 271 ? -7.943  4.583   -35.472  1.00 16.36 ? 291  LYS A CB  1 
ATOM   2019 C CG  . LYS A 1 271 ? -8.449  4.013   -36.791  1.00 17.36 ? 291  LYS A CG  1 
ATOM   2020 C CD  . LYS A 1 271 ? -7.894  4.775   -37.986  1.00 18.39 ? 291  LYS A CD  1 
ATOM   2021 C CE  . LYS A 1 271 ? -8.560  6.132   -38.153  1.00 19.91 ? 291  LYS A CE  1 
ATOM   2022 N NZ  . LYS A 1 271 ? -8.127  6.814   -39.403  1.00 20.88 ? 291  LYS A NZ  1 
ATOM   2023 N N   . GLU A 1 272 ? -9.010  5.240   -32.078  1.00 15.59 ? 292  GLU A N   1 
ATOM   2024 C CA  . GLU A 1 272 ? -8.579  5.872   -30.835  1.00 16.61 ? 292  GLU A CA  1 
ATOM   2025 C C   . GLU A 1 272 ? -8.214  4.799   -29.815  1.00 15.41 ? 292  GLU A C   1 
ATOM   2026 O O   . GLU A 1 272 ? -8.886  3.771   -29.724  1.00 15.91 ? 292  GLU A O   1 
ATOM   2027 C CB  . GLU A 1 272 ? -9.699  6.741   -30.262  1.00 18.74 ? 292  GLU A CB  1 
ATOM   2028 C CG  . GLU A 1 272 ? -10.159 7.871   -31.174  1.00 21.57 ? 292  GLU A CG  1 
ATOM   2029 C CD  . GLU A 1 272 ? -11.532 8.405   -30.804  1.00 23.97 ? 292  GLU A CD  1 
ATOM   2030 O OE1 . GLU A 1 272 ? -12.461 7.591   -30.607  1.00 25.84 ? 292  GLU A OE1 1 
ATOM   2031 O OE2 . GLU A 1 272 ? -11.689 9.642   -30.724  1.00 26.95 ? 292  GLU A OE2 1 
ATOM   2032 N N   . ILE A 1 273 ? -7.153  5.044   -29.049  1.00 14.69 ? 293  ILE A N   1 
ATOM   2033 C CA  . ILE A 1 273 ? -6.815  4.188   -27.914  1.00 14.58 ? 293  ILE A CA  1 
ATOM   2034 C C   . ILE A 1 273 ? -7.870  4.398   -26.831  1.00 14.62 ? 293  ILE A C   1 
ATOM   2035 O O   . ILE A 1 273 ? -8.139  5.532   -26.428  1.00 15.30 ? 293  ILE A O   1 
ATOM   2036 C CB  . ILE A 1 273 ? -5.410  4.493   -27.349  1.00 14.41 ? 293  ILE A CB  1 
ATOM   2037 C CG1 . ILE A 1 273 ? -4.337  4.157   -28.390  1.00 14.77 ? 293  ILE A CG1 1 
ATOM   2038 C CG2 . ILE A 1 273 ? -5.153  3.691   -26.076  1.00 14.81 ? 293  ILE A CG2 1 
ATOM   2039 C CD1 . ILE A 1 273 ? -2.955  4.666   -28.040  1.00 15.13 ? 293  ILE A CD1 1 
ATOM   2040 N N   . VAL A 1 274 ? -8.466  3.299   -26.373  1.00 14.02 ? 294  VAL A N   1 
ATOM   2041 C CA  . VAL A 1 274 ? -9.524  3.347   -25.357  1.00 13.81 ? 294  VAL A CA  1 
ATOM   2042 C C   . VAL A 1 274 ? -9.076  2.796   -23.998  1.00 13.91 ? 294  VAL A C   1 
ATOM   2043 O O   . VAL A 1 274 ? -9.634  3.172   -22.966  1.00 14.55 ? 294  VAL A O   1 
ATOM   2044 C CB  . VAL A 1 274 ? -10.812 2.630   -25.830  1.00 13.73 ? 294  VAL A CB  1 
ATOM   2045 C CG1 . VAL A 1 274 ? -11.421 3.367   -27.013  1.00 13.90 ? 294  VAL A CG1 1 
ATOM   2046 C CG2 . VAL A 1 274 ? -10.550 1.170   -26.184  1.00 14.30 ? 294  VAL A CG2 1 
ATOM   2047 N N   . GLN A 1 275 ? -8.078  1.911   -23.993  1.00 13.63 ? 295  GLN A N   1 
ATOM   2048 C CA  . GLN A 1 275 ? -7.512  1.398   -22.745  1.00 13.35 ? 295  GLN A CA  1 
ATOM   2049 C C   . GLN A 1 275 ? -6.058  0.966   -22.897  1.00 12.75 ? 295  GLN A C   1 
ATOM   2050 O O   . GLN A 1 275 ? -5.643  0.500   -23.960  1.00 12.29 ? 295  GLN A O   1 
ATOM   2051 C CB  . GLN A 1 275 ? -8.333  0.213   -22.220  1.00 14.19 ? 295  GLN A CB  1 
ATOM   2052 C CG  . GLN A 1 275 ? -9.234  0.547   -21.045  1.00 15.00 ? 295  GLN A CG  1 
ATOM   2053 C CD  . GLN A 1 275 ? -9.730  -0.696  -20.329  1.00 14.92 ? 295  GLN A CD  1 
ATOM   2054 O OE1 . GLN A 1 275 ? -10.343 -1.569  -20.942  1.00 14.72 ? 295  GLN A OE1 1 
ATOM   2055 N NE2 . GLN A 1 275 ? -9.473  -0.780  -19.027  1.00 15.18 ? 295  GLN A NE2 1 
ATOM   2056 N N   . LYS A 1 276 ? -5.302  1.128   -21.815  1.00 12.47 ? 296  LYS A N   1 
ATOM   2057 C CA  . LYS A 1 276 ? -3.945  0.604   -21.700  1.00 13.13 ? 296  LYS A CA  1 
ATOM   2058 C C   . LYS A 1 276 ? -3.838  -0.160  -20.382  1.00 13.14 ? 296  LYS A C   1 
ATOM   2059 O O   . LYS A 1 276 ? -3.879  0.441   -19.305  1.00 14.78 ? 296  LYS A O   1 
ATOM   2060 C CB  . LYS A 1 276 ? -2.922  1.738   -21.740  1.00 13.95 ? 296  LYS A CB  1 
ATOM   2061 C CG  . LYS A 1 276 ? -2.912  2.507   -23.051  1.00 15.26 ? 296  LYS A CG  1 
ATOM   2062 C CD  . LYS A 1 276 ? -1.856  3.601   -23.060  1.00 17.02 ? 296  LYS A CD  1 
ATOM   2063 C CE  . LYS A 1 276 ? -2.210  4.741   -22.119  1.00 18.49 ? 296  LYS A CE  1 
ATOM   2064 N NZ  . LYS A 1 276 ? -1.325  5.919   -22.326  1.00 21.00 ? 296  LYS A NZ  1 
ATOM   2065 N N   . LEU A 1 277 ? -3.711  -1.483  -20.468  1.00 11.75 ? 297  LEU A N   1 
ATOM   2066 C CA  . LEU A 1 277 ? -3.746  -2.340  -19.282  1.00 11.19 ? 297  LEU A CA  1 
ATOM   2067 C C   . LEU A 1 277 ? -2.346  -2.509  -18.701  1.00 10.84 ? 297  LEU A C   1 
ATOM   2068 O O   . LEU A 1 277 ? -1.452  -3.035  -19.368  1.00 10.46 ? 297  LEU A O   1 
ATOM   2069 C CB  . LEU A 1 277 ? -4.347  -3.708  -19.620  1.00 10.74 ? 297  LEU A CB  1 
ATOM   2070 C CG  . LEU A 1 277 ? -5.630  -3.724  -20.457  1.00 10.89 ? 297  LEU A CG  1 
ATOM   2071 C CD1 . LEU A 1 277 ? -6.109  -5.152  -20.666  1.00 11.49 ? 297  LEU A CD1 1 
ATOM   2072 C CD2 . LEU A 1 277 ? -6.722  -2.884  -19.810  1.00 11.38 ? 297  LEU A CD2 1 
ATOM   2073 N N   . GLN A 1 278 ? -2.164  -2.059  -17.460  1.00 11.35 ? 298  GLN A N   1 
ATOM   2074 C CA  . GLN A 1 278 ? -0.869  -2.118  -16.781  1.00 11.33 ? 298  GLN A CA  1 
ATOM   2075 C C   . GLN A 1 278 ? -0.809  -3.286  -15.797  1.00 10.87 ? 298  GLN A C   1 
ATOM   2076 O O   . GLN A 1 278 ? -1.784  -3.569  -15.098  1.00 11.23 ? 298  GLN A O   1 
ATOM   2077 C CB  . GLN A 1 278 ? -0.603  -0.806  -16.036  1.00 12.33 ? 298  GLN A CB  1 
ATOM   2078 C CG  . GLN A 1 278 ? 0.780   -0.725  -15.403  1.00 13.73 ? 298  GLN A CG  1 
ATOM   2079 C CD  . GLN A 1 278 ? 1.124   0.665   -14.901  1.00 15.35 ? 298  GLN A CD  1 
ATOM   2080 O OE1 . GLN A 1 278 ? 2.126   1.251   -15.310  1.00 17.49 ? 298  GLN A OE1 1 
ATOM   2081 N NE2 . GLN A 1 278 ? 0.295   1.199   -14.013  1.00 16.37 ? 298  GLN A NE2 1 
ATOM   2082 N N   . GLY A 1 279 ? 0.348   -3.943  -15.733  1.00 10.16 ? 299  GLY A N   1 
ATOM   2083 C CA  . GLY A 1 279 ? 0.537   -5.084  -14.834  1.00 10.04 ? 299  GLY A CA  1 
ATOM   2084 C C   . GLY A 1 279 ? 1.768   -5.912  -15.154  1.00 9.78  ? 299  GLY A C   1 
ATOM   2085 O O   . GLY A 1 279 ? 2.507   -6.315  -14.256  1.00 10.15 ? 299  GLY A O   1 
ATOM   2086 N N   . HIS A 1 280 ? 1.989   -6.184  -16.437  1.00 8.90  ? 300  HIS A N   1 
ATOM   2087 C CA  . HIS A 1 280 ? 3.170   -6.936  -16.846  1.00 8.70  ? 300  HIS A CA  1 
ATOM   2088 C C   . HIS A 1 280 ? 4.447   -6.130  -16.618  1.00 8.64  ? 300  HIS A C   1 
ATOM   2089 O O   . HIS A 1 280 ? 4.425   -4.896  -16.599  1.00 9.10  ? 300  HIS A O   1 
ATOM   2090 C CB  . HIS A 1 280 ? 3.067   -7.375  -18.309  1.00 8.40  ? 300  HIS A CB  1 
ATOM   2091 C CG  . HIS A 1 280 ? 2.084   -8.482  -18.534  1.00 8.22  ? 300  HIS A CG  1 
ATOM   2092 N ND1 . HIS A 1 280 ? 2.279   -9.757  -18.048  1.00 8.42  ? 300  HIS A ND1 1 
ATOM   2093 C CD2 . HIS A 1 280 ? 0.904   -8.509  -19.198  1.00 8.09  ? 300  HIS A CD2 1 
ATOM   2094 C CE1 . HIS A 1 280 ? 1.260   -10.520 -18.399  1.00 8.33  ? 300  HIS A CE1 1 
ATOM   2095 N NE2 . HIS A 1 280 ? 0.413   -9.788  -19.099  1.00 8.39  ? 300  HIS A NE2 1 
ATOM   2096 N N   . THR A 1 281 ? 5.551   -6.844  -16.425  1.00 8.96  ? 301  THR A N   1 
ATOM   2097 C CA  . THR A 1 281 ? 6.842   -6.230  -16.138  1.00 9.06  ? 301  THR A CA  1 
ATOM   2098 C C   . THR A 1 281 ? 7.856   -6.456  -17.265  1.00 8.71  ? 301  THR A C   1 
ATOM   2099 O O   . THR A 1 281 ? 9.030   -6.126  -17.120  1.00 9.59  ? 301  THR A O   1 
ATOM   2100 C CB  . THR A 1 281 ? 7.420   -6.768  -14.815  1.00 9.02  ? 301  THR A CB  1 
ATOM   2101 O OG1 . THR A 1 281 ? 7.679   -8.172  -14.934  1.00 9.77  ? 301  THR A OG1 1 
ATOM   2102 C CG2 . THR A 1 281 ? 6.449   -6.521  -13.663  1.00 9.22  ? 301  THR A CG2 1 
ATOM   2103 N N   . ASP A 1 282 ? 7.396   -7.023  -18.379  1.00 8.36  ? 302  ASP A N   1 
ATOM   2104 C CA  . ASP A 1 282 ? 8.221   -7.188  -19.569  1.00 7.99  ? 302  ASP A CA  1 
ATOM   2105 C C   . ASP A 1 282 ? 7.311   -7.118  -20.794  1.00 7.59  ? 302  ASP A C   1 
ATOM   2106 O O   . ASP A 1 282 ? 6.094   -6.996  -20.656  1.00 7.81  ? 302  ASP A O   1 
ATOM   2107 C CB  . ASP A 1 282 ? 8.975   -8.524  -19.517  1.00 8.02  ? 302  ASP A CB  1 
ATOM   2108 C CG  . ASP A 1 282 ? 10.243  -8.532  -20.374  1.00 8.26  ? 302  ASP A CG  1 
ATOM   2109 O OD1 . ASP A 1 282 ? 10.457  -7.586  -21.170  1.00 8.90  ? 302  ASP A OD1 1 
ATOM   2110 O OD2 . ASP A 1 282 ? 11.022  -9.501  -20.264  1.00 9.08  ? 302  ASP A OD2 1 
ATOM   2111 N N   . VAL A 1 283 ? 7.912   -7.172  -21.980  1.00 7.35  ? 303  VAL A N   1 
ATOM   2112 C CA  . VAL A 1 283 ? 7.193   -7.104  -23.250  1.00 7.59  ? 303  VAL A CA  1 
ATOM   2113 C C   . VAL A 1 283 ? 5.996   -8.047  -23.241  1.00 7.32  ? 303  VAL A C   1 
ATOM   2114 O O   . VAL A 1 283 ? 6.138   -9.222  -22.905  1.00 7.26  ? 303  VAL A O   1 
ATOM   2115 C CB  . VAL A 1 283 ? 8.120   -7.492  -24.426  1.00 7.93  ? 303  VAL A CB  1 
ATOM   2116 C CG1 . VAL A 1 283 ? 7.349   -7.565  -25.741  1.00 7.73  ? 303  VAL A CG1 1 
ATOM   2117 C CG2 . VAL A 1 283 ? 9.285   -6.516  -24.547  1.00 7.97  ? 303  VAL A CG2 1 
ATOM   2118 N N   . VAL A 1 284 ? 4.823   -7.530  -23.604  1.00 7.29  ? 304  VAL A N   1 
ATOM   2119 C CA  . VAL A 1 284 ? 3.628   -8.360  -23.734  1.00 7.55  ? 304  VAL A CA  1 
ATOM   2120 C C   . VAL A 1 284 ? 3.632   -8.940  -25.146  1.00 7.57  ? 304  VAL A C   1 
ATOM   2121 O O   . VAL A 1 284 ? 3.186   -8.300  -26.101  1.00 8.17  ? 304  VAL A O   1 
ATOM   2122 C CB  . VAL A 1 284 ? 2.327   -7.580  -23.448  1.00 7.35  ? 304  VAL A CB  1 
ATOM   2123 C CG1 . VAL A 1 284 ? 1.118   -8.505  -23.502  1.00 7.60  ? 304  VAL A CG1 1 
ATOM   2124 C CG2 . VAL A 1 284 ? 2.402   -6.914  -22.080  1.00 7.50  ? 304  VAL A CG2 1 
ATOM   2125 N N   . ILE A 1 285 ? 4.168   -10.151 -25.255  1.00 7.30  ? 305  ILE A N   1 
ATOM   2126 C CA  . ILE A 1 285 ? 4.365   -10.828 -26.537  1.00 7.05  ? 305  ILE A CA  1 
ATOM   2127 C C   . ILE A 1 285 ? 3.058   -11.337 -27.142  1.00 7.15  ? 305  ILE A C   1 
ATOM   2128 O O   . ILE A 1 285 ? 2.924   -11.407 -28.362  1.00 7.64  ? 305  ILE A O   1 
ATOM   2129 C CB  . ILE A 1 285 ? 5.363   -12.004 -26.390  1.00 7.06  ? 305  ILE A CB  1 
ATOM   2130 C CG1 . ILE A 1 285 ? 5.788   -12.562 -27.753  1.00 7.34  ? 305  ILE A CG1 1 
ATOM   2131 C CG2 . ILE A 1 285 ? 4.783   -13.129 -25.541  1.00 7.46  ? 305  ILE A CG2 1 
ATOM   2132 C CD1 . ILE A 1 285 ? 6.595   -11.598 -28.593  1.00 6.63  ? 305  ILE A CD1 1 
ATOM   2133 N N   . SER A 1 286 ? 2.102   -11.697 -26.292  1.00 7.23  ? 306  SER A N   1 
ATOM   2134 C CA  . SER A 1 286 ? 0.885   -12.356 -26.750  1.00 7.52  ? 306  SER A CA  1 
ATOM   2135 C C   . SER A 1 286 ? -0.357  -11.839 -26.037  1.00 7.81  ? 306  SER A C   1 
ATOM   2136 O O   . SER A 1 286 ? -0.345  -11.601 -24.831  1.00 8.33  ? 306  SER A O   1 
ATOM   2137 C CB  . SER A 1 286 ? 1.007   -13.868 -26.538  1.00 7.83  ? 306  SER A CB  1 
ATOM   2138 O OG  . SER A 1 286 ? -0.159  -14.547 -26.967  1.00 8.03  ? 306  SER A OG  1 
ATOM   2139 N N   . THR A 1 287 ? -1.416  -11.635 -26.815  1.00 7.86  ? 307  THR A N   1 
ATOM   2140 C CA  . THR A 1 287 ? -2.749  -11.393 -26.286  1.00 8.40  ? 307  THR A CA  1 
ATOM   2141 C C   . THR A 1 287 ? -3.721  -12.290 -27.035  1.00 8.74  ? 307  THR A C   1 
ATOM   2142 O O   . THR A 1 287 ? -3.492  -12.621 -28.200  1.00 9.26  ? 307  THR A O   1 
ATOM   2143 C CB  . THR A 1 287 ? -3.186  -9.927  -26.454  1.00 8.80  ? 307  THR A CB  1 
ATOM   2144 O OG1 . THR A 1 287 ? -3.008  -9.522  -27.817  1.00 9.39  ? 307  THR A OG1 1 
ATOM   2145 C CG2 . THR A 1 287 ? -2.383  -9.016  -25.535  1.00 9.06  ? 307  THR A CG2 1 
ATOM   2146 N N   . ALA A 1 288 ? -4.795  -12.684 -26.360  1.00 8.99  ? 308  ALA A N   1 
ATOM   2147 C CA  . ALA A 1 288 ? -5.862  -13.470 -26.970  1.00 8.89  ? 308  ALA A CA  1 
ATOM   2148 C C   . ALA A 1 288 ? -7.201  -13.006 -26.423  1.00 9.17  ? 308  ALA A C   1 
ATOM   2149 O O   . ALA A 1 288 ? -7.298  -12.619 -25.257  1.00 9.64  ? 308  ALA A O   1 
ATOM   2150 C CB  . ALA A 1 288 ? -5.657  -14.949 -26.691  1.00 9.47  ? 308  ALA A CB  1 
ATOM   2151 N N   . CYS A 1 289 ? -8.223  -13.032 -27.276  1.00 9.38  ? 309  CYS A N   1 
ATOM   2152 C CA  . CYS A 1 289 ? -9.572  -12.623 -26.900  1.00 9.57  ? 309  CYS A CA  1 
ATOM   2153 C C   . CYS A 1 289 ? -10.487 -13.840 -26.830  1.00 10.03 ? 309  CYS A C   1 
ATOM   2154 O O   . CYS A 1 289 ? -10.529 -14.650 -27.754  1.00 10.78 ? 309  CYS A O   1 
ATOM   2155 C CB  . CYS A 1 289 ? -10.116 -11.609 -27.904  1.00 10.37 ? 309  CYS A CB  1 
ATOM   2156 S SG  . CYS A 1 289 ? -9.205  -10.047 -27.929  1.00 10.70 ? 309  CYS A SG  1 
ATOM   2157 N N   . HIS A 1 290 ? -11.221 -13.952 -25.727  1.00 10.54 ? 310  HIS A N   1 
ATOM   2158 C CA  . HIS A 1 290 ? -12.092 -15.098 -25.465  1.00 10.53 ? 310  HIS A CA  1 
ATOM   2159 C C   . HIS A 1 290 ? -13.235 -15.137 -26.490  1.00 10.83 ? 310  HIS A C   1 
ATOM   2160 O O   . HIS A 1 290 ? -13.718 -14.090 -26.903  1.00 10.77 ? 310  HIS A O   1 
ATOM   2161 C CB  . HIS A 1 290 ? -12.627 -14.988 -24.034  1.00 10.79 ? 310  HIS A CB  1 
ATOM   2162 C CG  . HIS A 1 290 ? -13.293 -16.226 -23.528  1.00 10.80 ? 310  HIS A CG  1 
ATOM   2163 N ND1 . HIS A 1 290 ? -14.592 -16.549 -23.844  1.00 10.71 ? 310  HIS A ND1 1 
ATOM   2164 C CD2 . HIS A 1 290 ? -12.850 -17.213 -22.714  1.00 11.07 ? 310  HIS A CD2 1 
ATOM   2165 C CE1 . HIS A 1 290 ? -14.920 -17.686 -23.259  1.00 11.03 ? 310  HIS A CE1 1 
ATOM   2166 N NE2 . HIS A 1 290 ? -13.879 -18.110 -22.567  1.00 10.75 ? 310  HIS A NE2 1 
ATOM   2167 N N   . PRO A 1 291 ? -13.657 -16.344 -26.918  1.00 11.12 ? 311  PRO A N   1 
ATOM   2168 C CA  . PRO A 1 291 ? -14.653 -16.436 -28.001  1.00 11.17 ? 311  PRO A CA  1 
ATOM   2169 C C   . PRO A 1 291 ? -16.076 -15.939 -27.683  1.00 12.66 ? 311  PRO A C   1 
ATOM   2170 O O   . PRO A 1 291 ? -16.730 -15.390 -28.568  1.00 14.02 ? 311  PRO A O   1 
ATOM   2171 C CB  . PRO A 1 291 ? -14.676 -17.937 -28.330  1.00 11.29 ? 311  PRO A CB  1 
ATOM   2172 C CG  . PRO A 1 291 ? -14.143 -18.611 -27.114  1.00 11.49 ? 311  PRO A CG  1 
ATOM   2173 C CD  . PRO A 1 291 ? -13.118 -17.669 -26.567  1.00 11.33 ? 311  PRO A CD  1 
ATOM   2174 N N   . THR A 1 292 ? -16.558 -16.164 -26.461  1.00 13.86 ? 312  THR A N   1 
ATOM   2175 C CA  . THR A 1 292 ? -17.928 -15.783 -26.072  1.00 14.86 ? 312  THR A CA  1 
ATOM   2176 C C   . THR A 1 292 ? -18.065 -14.660 -25.027  1.00 15.38 ? 312  THR A C   1 
ATOM   2177 O O   . THR A 1 292 ? -19.133 -14.055 -24.917  1.00 17.81 ? 312  THR A O   1 
ATOM   2178 C CB  . THR A 1 292 ? -18.699 -17.008 -25.542  1.00 16.16 ? 312  THR A CB  1 
ATOM   2179 O OG1 . THR A 1 292 ? -18.023 -17.554 -24.403  1.00 17.15 ? 312  THR A OG1 1 
ATOM   2180 C CG2 . THR A 1 292 ? -18.814 -18.071 -26.620  1.00 16.52 ? 312  THR A CG2 1 
ATOM   2181 N N   . GLU A 1 293 ? -16.998 -14.377 -24.283  1.00 14.91 ? 313  GLU A N   1 
ATOM   2182 C CA  . GLU A 1 293 ? -17.032 -13.445 -23.153  1.00 14.66 ? 313  GLU A CA  1 
ATOM   2183 C C   . GLU A 1 293 ? -16.012 -12.336 -23.367  1.00 13.34 ? 313  GLU A C   1 
ATOM   2184 O O   . GLU A 1 293 ? -15.071 -12.492 -24.148  1.00 12.98 ? 313  GLU A O   1 
ATOM   2185 C CB  . GLU A 1 293 ? -16.718 -14.173 -21.841  1.00 15.76 ? 313  GLU A CB  1 
ATOM   2186 C CG  . GLU A 1 293 ? -17.743 -15.219 -21.422  1.00 18.22 ? 313  GLU A CG  1 
ATOM   2187 C CD  . GLU A 1 293 ? -19.051 -14.630 -20.916  1.00 19.83 ? 313  GLU A CD  1 
ATOM   2188 O OE1 . GLU A 1 293 ? -19.099 -13.423 -20.596  1.00 22.72 ? 313  GLU A OE1 1 
ATOM   2189 O OE2 . GLU A 1 293 ? -20.041 -15.387 -20.834  1.00 22.74 ? 313  GLU A OE2 1 
ATOM   2190 N N   . ASN A 1 294 ? -16.201 -11.222 -22.663  1.00 13.15 ? 314  ASN A N   1 
ATOM   2191 C CA  . ASN A 1 294 ? -15.276 -10.092 -22.727  1.00 12.39 ? 314  ASN A CA  1 
ATOM   2192 C C   . ASN A 1 294 ? -14.079 -10.343 -21.813  1.00 11.42 ? 314  ASN A C   1 
ATOM   2193 O O   . ASN A 1 294 ? -13.967 -9.745  -20.742  1.00 11.59 ? 314  ASN A O   1 
ATOM   2194 C CB  . ASN A 1 294 ? -15.987 -8.793  -22.331  1.00 13.16 ? 314  ASN A CB  1 
ATOM   2195 C CG  . ASN A 1 294 ? -17.178 -8.482  -23.220  1.00 14.26 ? 314  ASN A CG  1 
ATOM   2196 O OD1 . ASN A 1 294 ? -17.096 -8.584  -24.444  1.00 15.21 ? 314  ASN A OD1 1 
ATOM   2197 N ND2 . ASN A 1 294 ? -18.295 -8.100  -22.608  1.00 15.42 ? 314  ASN A ND2 1 
ATOM   2198 N N   . ILE A 1 295 ? -13.197 -11.239 -22.252  1.00 10.21 ? 315  ILE A N   1 
ATOM   2199 C CA  . ILE A 1 295 ? -12.021 -11.647 -21.486  1.00 9.82  ? 315  ILE A CA  1 
ATOM   2200 C C   . ILE A 1 295 ? -10.793 -11.587 -22.393  1.00 9.76  ? 315  ILE A C   1 
ATOM   2201 O O   . ILE A 1 295 ? -10.825 -12.086 -23.519  1.00 10.96 ? 315  ILE A O   1 
ATOM   2202 C CB  . ILE A 1 295 ? -12.169 -13.084 -20.927  1.00 10.07 ? 315  ILE A CB  1 
ATOM   2203 C CG1 . ILE A 1 295 ? -13.444 -13.206 -20.080  1.00 10.35 ? 315  ILE A CG1 1 
ATOM   2204 C CG2 . ILE A 1 295 ? -10.941 -13.481 -20.111  1.00 9.79  ? 315  ILE A CG2 1 
ATOM   2205 C CD1 . ILE A 1 295 ? -13.732 -14.609 -19.590  1.00 10.89 ? 315  ILE A CD1 1 
ATOM   2206 N N   . ILE A 1 296 ? -9.719  -10.976 -21.896  1.00 9.03  ? 316  ILE A N   1 
ATOM   2207 C CA  . ILE A 1 296 ? -8.438  -10.952 -22.597  1.00 8.97  ? 316  ILE A CA  1 
ATOM   2208 C C   . ILE A 1 296 ? -7.415  -11.738 -21.790  1.00 8.72  ? 316  ILE A C   1 
ATOM   2209 O O   . ILE A 1 296 ? -7.333  -11.582 -20.575  1.00 9.45  ? 316  ILE A O   1 
ATOM   2210 C CB  . ILE A 1 296 ? -7.923  -9.509  -22.807  1.00 9.08  ? 316  ILE A CB  1 
ATOM   2211 C CG1 . ILE A 1 296 ? -8.822  -8.765  -23.800  1.00 9.26  ? 316  ILE A CG1 1 
ATOM   2212 C CG2 . ILE A 1 296 ? -6.484  -9.513  -23.311  1.00 9.40  ? 316  ILE A CG2 1 
ATOM   2213 C CD1 . ILE A 1 296 ? -8.586  -7.269  -23.858  1.00 9.15  ? 316  ILE A CD1 1 
ATOM   2214 N N   . ALA A 1 297 ? -6.649  -12.588 -22.468  1.00 8.40  ? 317  ALA A N   1 
ATOM   2215 C CA  . ALA A 1 297 ? -5.469  -13.208 -21.879  1.00 8.16  ? 317  ALA A CA  1 
ATOM   2216 C C   . ALA A 1 297 ? -4.247  -12.515 -22.456  1.00 7.90  ? 317  ALA A C   1 
ATOM   2217 O O   . ALA A 1 297 ? -4.210  -12.219 -23.647  1.00 8.50  ? 317  ALA A O   1 
ATOM   2218 C CB  . ALA A 1 297 ? -5.428  -14.699 -22.178  1.00 8.37  ? 317  ALA A CB  1 
ATOM   2219 N N   . SER A 1 298 ? -3.261  -12.240 -21.607  1.00 7.76  ? 318  SER A N   1 
ATOM   2220 C CA  . SER A 1 298 ? -2.010  -11.632 -22.044  1.00 7.43  ? 318  SER A CA  1 
ATOM   2221 C C   . SER A 1 298 ? -0.840  -12.377 -21.423  1.00 7.15  ? 318  SER A C   1 
ATOM   2222 O O   . SER A 1 298 ? -0.977  -12.968 -20.352  1.00 7.50  ? 318  SER A O   1 
ATOM   2223 C CB  . SER A 1 298 ? -1.967  -10.156 -21.653  1.00 7.50  ? 318  SER A CB  1 
ATOM   2224 O OG  . SER A 1 298 ? -2.053  -10.007 -20.247  1.00 7.90  ? 318  SER A OG  1 
ATOM   2225 N N   . ALA A 1 299 ? 0.307   -12.359 -22.096  1.00 6.87  ? 319  ALA A N   1 
ATOM   2226 C CA  . ALA A 1 299 ? 1.494   -13.048 -21.603  1.00 7.06  ? 319  ALA A CA  1 
ATOM   2227 C C   . ALA A 1 299 ? 2.751   -12.273 -21.946  1.00 6.74  ? 319  ALA A C   1 
ATOM   2228 O O   . ALA A 1 299 ? 2.809   -11.579 -22.966  1.00 6.73  ? 319  ALA A O   1 
ATOM   2229 C CB  . ALA A 1 299 ? 1.571   -14.450 -22.181  1.00 7.77  ? 319  ALA A CB  1 
ATOM   2230 N N   . ALA A 1 300 ? 3.766   -12.418 -21.101  1.00 6.93  ? 320  ALA A N   1 
ATOM   2231 C CA  . ALA A 1 300 ? 4.971   -11.605 -21.202  1.00 7.49  ? 320  ALA A CA  1 
ATOM   2232 C C   . ALA A 1 300 ? 6.255   -12.425 -21.264  1.00 7.37  ? 320  ALA A C   1 
ATOM   2233 O O   . ALA A 1 300 ? 6.262   -13.631 -20.988  1.00 7.41  ? 320  ALA A O   1 
ATOM   2234 C CB  . ALA A 1 300 ? 5.025   -10.622 -20.045  1.00 7.46  ? 320  ALA A CB  1 
ATOM   2235 N N   . LEU A 1 301 ? 7.339   -11.739 -21.615  1.00 7.32  ? 321  LEU A N   1 
ATOM   2236 C CA  . LEU A 1 301 ? 8.634   -12.362 -21.886  1.00 7.82  ? 321  LEU A CA  1 
ATOM   2237 C C   . LEU A 1 301 ? 9.462   -12.639 -20.613  1.00 8.23  ? 321  LEU A C   1 
ATOM   2238 O O   . LEU A 1 301 ? 8.937   -12.575 -19.500  1.00 8.24  ? 321  LEU A O   1 
ATOM   2239 C CB  . LEU A 1 301 ? 9.409   -11.499 -22.900  1.00 8.05  ? 321  LEU A CB  1 
ATOM   2240 C CG  . LEU A 1 301 ? 8.826   -11.427 -24.317  1.00 7.82  ? 321  LEU A CG  1 
ATOM   2241 C CD1 . LEU A 1 301 ? 9.770   -10.645 -25.217  1.00 8.05  ? 321  LEU A CD1 1 
ATOM   2242 C CD2 . LEU A 1 301 ? 8.577   -12.811 -24.905  1.00 8.15  ? 321  LEU A CD2 1 
ATOM   2243 N N   . GLU A 1 302 ? 10.750  -12.937 -20.804  1.00 8.79  ? 322  GLU A N   1 
ATOM   2244 C CA  . GLU A 1 302 ? 11.634  -13.544 -19.793  1.00 9.31  ? 322  GLU A CA  1 
ATOM   2245 C C   . GLU A 1 302 ? 11.660  -12.902 -18.402  1.00 9.19  ? 322  GLU A C   1 
ATOM   2246 O O   . GLU A 1 302 ? 11.751  -13.610 -17.403  1.00 9.26  ? 322  GLU A O   1 
ATOM   2247 C CB  . GLU A 1 302 ? 13.068  -13.608 -20.351  1.00 10.26 ? 322  GLU A CB  1 
ATOM   2248 C CG  . GLU A 1 302 ? 14.085  -14.350 -19.490  1.00 11.74 ? 322  GLU A CG  1 
ATOM   2249 C CD  . GLU A 1 302 ? 13.821  -15.843 -19.380  1.00 12.90 ? 322  GLU A CD  1 
ATOM   2250 O OE1 . GLU A 1 302 ? 13.067  -16.398 -20.209  1.00 14.33 ? 322  GLU A OE1 1 
ATOM   2251 O OE2 . GLU A 1 302 ? 14.380  -16.472 -18.459  1.00 15.72 ? 322  GLU A OE2 1 
ATOM   2252 N N   . ASN A 1 303 ? 11.587  -11.576 -18.330  1.00 8.96  ? 323  ASN A N   1 
ATOM   2253 C CA  . ASN A 1 303 ? 11.684  -10.885 -17.040  1.00 9.32  ? 323  ASN A CA  1 
ATOM   2254 C C   . ASN A 1 303 ? 10.373  -10.881 -16.249  1.00 9.43  ? 323  ASN A C   1 
ATOM   2255 O O   . ASN A 1 303 ? 10.339  -10.392 -15.114  1.00 10.29 ? 323  ASN A O   1 
ATOM   2256 C CB  . ASN A 1 303 ? 12.167  -9.445  -17.234  1.00 9.97  ? 323  ASN A CB  1 
ATOM   2257 C CG  . ASN A 1 303 ? 13.529  -9.367  -17.901  1.00 10.96 ? 323  ASN A CG  1 
ATOM   2258 O OD1 . ASN A 1 303 ? 14.288  -10.337 -17.914  1.00 12.97 ? 323  ASN A OD1 1 
ATOM   2259 N ND2 . ASN A 1 303 ? 13.845  -8.206  -18.458  1.00 12.65 ? 323  ASN A ND2 1 
ATOM   2260 N N   . ASP A 1 304 ? 9.307   -11.415 -16.847  1.00 9.22  ? 324  ASP A N   1 
ATOM   2261 C CA  . ASP A 1 304 ? 7.982   -11.472 -16.231  1.00 8.98  ? 324  ASP A CA  1 
ATOM   2262 C C   . ASP A 1 304 ? 7.518   -12.933 -16.152  1.00 9.02  ? 324  ASP A C   1 
ATOM   2263 O O   . ASP A 1 304 ? 7.379   -13.488 -15.059  1.00 9.05  ? 324  ASP A O   1 
ATOM   2264 C CB  . ASP A 1 304 ? 7.005   -10.608 -17.050  1.00 9.05  ? 324  ASP A CB  1 
ATOM   2265 C CG  . ASP A 1 304 ? 5.584   -10.629 -16.509  1.00 9.36  ? 324  ASP A CG  1 
ATOM   2266 O OD1 . ASP A 1 304 ? 5.190   -11.622 -15.869  1.00 9.91  ? 324  ASP A OD1 1 
ATOM   2267 O OD2 . ASP A 1 304 ? 4.850   -9.648  -16.748  1.00 9.82  ? 324  ASP A OD2 1 
ATOM   2268 N N   . LYS A 1 305 ? 7.266   -13.533 -17.317  1.00 8.97  ? 325  LYS A N   1 
ATOM   2269 C CA  . LYS A 1 305 ? 6.882   -14.949 -17.457  1.00 9.75  ? 325  LYS A CA  1 
ATOM   2270 C C   . LYS A 1 305 ? 5.484   -15.317 -16.935  1.00 9.07  ? 325  LYS A C   1 
ATOM   2271 O O   . LYS A 1 305 ? 5.142   -16.503 -16.881  1.00 9.60  ? 325  LYS A O   1 
ATOM   2272 C CB  . LYS A 1 305 ? 7.941   -15.869 -16.833  1.00 10.67 ? 325  LYS A CB  1 
ATOM   2273 C CG  . LYS A 1 305 ? 9.335   -15.658 -17.400  1.00 11.11 ? 325  LYS A CG  1 
ATOM   2274 C CD  . LYS A 1 305 ? 10.385  -16.479 -16.672  1.00 11.66 ? 325  LYS A CD  1 
ATOM   2275 C CE  . LYS A 1 305 ? 10.624  -15.962 -15.264  1.00 12.64 ? 325  LYS A CE  1 
ATOM   2276 N NZ  . LYS A 1 305 ? 11.848  -16.539 -14.647  1.00 13.82 ? 325  LYS A NZ  1 
ATOM   2277 N N   . THR A 1 306 ? 4.675   -14.323 -16.570  1.00 8.42  ? 326  THR A N   1 
ATOM   2278 C CA  . THR A 1 306 ? 3.306   -14.582 -16.126  1.00 8.38  ? 326  THR A CA  1 
ATOM   2279 C C   . THR A 1 306 ? 2.291   -14.312 -17.230  1.00 8.16  ? 326  THR A C   1 
ATOM   2280 O O   . THR A 1 306 ? 2.560   -13.594 -18.202  1.00 8.21  ? 326  THR A O   1 
ATOM   2281 C CB  . THR A 1 306 ? 2.919   -13.762 -14.875  1.00 8.53  ? 326  THR A CB  1 
ATOM   2282 O OG1 . THR A 1 306 ? 2.840   -12.369 -15.197  1.00 8.99  ? 326  THR A OG1 1 
ATOM   2283 C CG2 . THR A 1 306 ? 3.924   -13.981 -13.754  1.00 8.39  ? 326  THR A CG2 1 
ATOM   2284 N N   . ILE A 1 307 ? 1.123   -14.916 -17.051  1.00 7.73  ? 327  ILE A N   1 
ATOM   2285 C CA  . ILE A 1 307 ? -0.010  -14.770 -17.941  1.00 7.20  ? 327  ILE A CA  1 
ATOM   2286 C C   . ILE A 1 307 ? -1.092  -14.078 -17.120  1.00 7.32  ? 327  ILE A C   1 
ATOM   2287 O O   . ILE A 1 307 ? -1.235  -14.358 -15.933  1.00 7.59  ? 327  ILE A O   1 
ATOM   2288 C CB  . ILE A 1 307 ? -0.484  -16.157 -18.427  1.00 7.34  ? 327  ILE A CB  1 
ATOM   2289 C CG1 . ILE A 1 307 ? 0.605   -16.828 -19.273  1.00 7.18  ? 327  ILE A CG1 1 
ATOM   2290 C CG2 . ILE A 1 307 ? -1.784  -16.062 -19.212  1.00 7.41  ? 327  ILE A CG2 1 
ATOM   2291 C CD1 . ILE A 1 307 ? 0.531   -18.341 -19.269  1.00 7.42  ? 327  ILE A CD1 1 
ATOM   2292 N N   . LYS A 1 308 ? -1.837  -13.163 -17.733  1.00 7.18  ? 328  LYS A N   1 
ATOM   2293 C CA  . LYS A 1 308 ? -2.876  -12.430 -17.014  1.00 6.96  ? 328  LYS A CA  1 
ATOM   2294 C C   . LYS A 1 308 ? -4.224  -12.527 -17.710  1.00 7.49  ? 328  LYS A C   1 
ATOM   2295 O O   . LYS A 1 308 ? -4.299  -12.494 -18.939  1.00 8.00  ? 328  LYS A O   1 
ATOM   2296 C CB  . LYS A 1 308 ? -2.461  -10.968 -16.828  1.00 6.76  ? 328  LYS A CB  1 
ATOM   2297 C CG  . LYS A 1 308 ? -1.267  -10.827 -15.897  1.00 6.64  ? 328  LYS A CG  1 
ATOM   2298 C CD  . LYS A 1 308 ? -0.837  -9.385  -15.687  1.00 7.02  ? 328  LYS A CD  1 
ATOM   2299 C CE  . LYS A 1 308 ? 0.415   -9.307  -14.824  1.00 7.38  ? 328  LYS A CE  1 
ATOM   2300 N NZ  . LYS A 1 308 ? 0.153   -9.553  -13.379  1.00 7.79  ? 328  LYS A NZ  1 
ATOM   2301 N N   . LEU A 1 309 ? -5.281  -12.671 -16.911  1.00 7.63  ? 329  LEU A N   1 
ATOM   2302 C CA  . LEU A 1 309 ? -6.653  -12.668 -17.412  1.00 8.02  ? 329  LEU A CA  1 
ATOM   2303 C C   . LEU A 1 309 ? -7.342  -11.372 -16.989  1.00 8.59  ? 329  LEU A C   1 
ATOM   2304 O O   . LEU A 1 309 ? -7.395  -11.051 -15.799  1.00 8.79  ? 329  LEU A O   1 
ATOM   2305 C CB  . LEU A 1 309 ? -7.432  -13.876 -16.885  1.00 8.27  ? 329  LEU A CB  1 
ATOM   2306 C CG  . LEU A 1 309 ? -6.979  -15.252 -17.388  1.00 8.62  ? 329  LEU A CG  1 
ATOM   2307 C CD1 . LEU A 1 309 ? -7.694  -16.364 -16.635  1.00 8.88  ? 329  LEU A CD1 1 
ATOM   2308 C CD2 . LEU A 1 309 ? -7.201  -15.406 -18.887  1.00 8.73  ? 329  LEU A CD2 1 
ATOM   2309 N N   . TRP A 1 310 ? -7.858  -10.635 -17.972  1.00 8.88  ? 330  TRP A N   1 
ATOM   2310 C CA  . TRP A 1 310 ? -8.532  -9.361  -17.738  1.00 9.03  ? 330  TRP A CA  1 
ATOM   2311 C C   . TRP A 1 310 ? -9.980  -9.491  -18.189  1.00 9.42  ? 330  TRP A C   1 
ATOM   2312 O O   . TRP A 1 310 ? -10.250 -10.131 -19.206  1.00 9.66  ? 330  TRP A O   1 
ATOM   2313 C CB  . TRP A 1 310 ? -7.870  -8.238  -18.541  1.00 8.77  ? 330  TRP A CB  1 
ATOM   2314 C CG  . TRP A 1 310 ? -6.365  -8.241  -18.552  1.00 8.47  ? 330  TRP A CG  1 
ATOM   2315 C CD1 . TRP A 1 310 ? -5.552  -9.059  -19.282  1.00 8.56  ? 330  TRP A CD1 1 
ATOM   2316 C CD2 . TRP A 1 310 ? -5.497  -7.355  -17.831  1.00 8.74  ? 330  TRP A CD2 1 
ATOM   2317 N NE1 . TRP A 1 310 ? -4.236  -8.750  -19.051  1.00 8.62  ? 330  TRP A NE1 1 
ATOM   2318 C CE2 . TRP A 1 310 ? -4.173  -7.705  -18.167  1.00 8.59  ? 330  TRP A CE2 1 
ATOM   2319 C CE3 . TRP A 1 310 ? -5.711  -6.300  -16.934  1.00 8.69  ? 330  TRP A CE3 1 
ATOM   2320 C CZ2 . TRP A 1 310 ? -3.065  -7.047  -17.628  1.00 8.84  ? 330  TRP A CZ2 1 
ATOM   2321 C CZ3 . TRP A 1 310 ? -4.609  -5.644  -16.402  1.00 8.77  ? 330  TRP A CZ3 1 
ATOM   2322 C CH2 . TRP A 1 310 ? -3.303  -6.018  -16.755  1.00 8.79  ? 330  TRP A CH2 1 
ATOM   2323 N N   . LYS A 1 311 ? -10.904 -8.871  -17.454  1.00 10.24 ? 331  LYS A N   1 
ATOM   2324 C CA  . LYS A 1 311 ? -12.329 -8.941  -17.784  1.00 11.12 ? 331  LYS A CA  1 
ATOM   2325 C C   . LYS A 1 311 ? -12.988 -7.562  -17.809  1.00 11.64 ? 331  LYS A C   1 
ATOM   2326 O O   . LYS A 1 311 ? -12.665 -6.697  -16.997  1.00 11.87 ? 331  LYS A O   1 
ATOM   2327 C CB  . LYS A 1 311 ? -13.056 -9.851  -16.796  1.00 11.75 ? 331  LYS A CB  1 
ATOM   2328 C CG  . LYS A 1 311 ? -12.483 -11.256 -16.745  1.00 12.66 ? 331  LYS A CG  1 
ATOM   2329 C CD  . LYS A 1 311 ? -13.371 -12.210 -15.970  1.00 13.49 ? 331  LYS A CD  1 
ATOM   2330 C CE  . LYS A 1 311 ? -12.708 -13.571 -15.828  1.00 13.98 ? 331  LYS A CE  1 
ATOM   2331 N NZ  . LYS A 1 311 ? -13.514 -14.511 -15.004  1.00 14.20 ? 331  LYS A NZ  1 
ATOM   2332 N N   . SER A 1 312 ? -13.918 -7.384  -18.746  1.00 12.10 ? 332  SER A N   1 
ATOM   2333 C CA  . SER A 1 312 ? -14.620 -6.118  -18.954  1.00 13.20 ? 332  SER A CA  1 
ATOM   2334 C C   . SER A 1 312 ? -16.122 -6.361  -19.055  1.00 14.21 ? 332  SER A C   1 
ATOM   2335 O O   . SER A 1 312 ? -16.564 -7.488  -19.281  1.00 13.97 ? 332  SER A O   1 
ATOM   2336 C CB  . SER A 1 312 ? -14.113 -5.450  -20.236  1.00 13.82 ? 332  SER A CB  1 
ATOM   2337 O OG  . SER A 1 312 ? -14.868 -4.297  -20.570  1.00 13.91 ? 332  SER A OG  1 
ATOM   2338 N N   . ASP A 1 313 ? -16.897 -5.293  -18.885  1.00 15.10 ? 333  ASP A N   1 
ATOM   2339 C CA  . ASP A 1 313 ? -18.352 -5.357  -19.016  1.00 16.36 ? 333  ASP A CA  1 
ATOM   2340 C C   . ASP A 1 313 ? -18.816 -5.104  -20.455  1.00 17.43 ? 333  ASP A C   1 
ATOM   2341 O O   . ASP A 1 313 ? -19.991 -5.293  -20.771  1.00 19.01 ? 333  ASP A O   1 
ATOM   2342 C CB  . ASP A 1 313 ? -19.011 -4.358  -18.062  1.00 17.25 ? 333  ASP A CB  1 
ATOM   2343 C CG  . ASP A 1 313 ? -18.680 -4.638  -16.603  1.00 17.36 ? 333  ASP A CG  1 
ATOM   2344 O OD1 . ASP A 1 313 ? -18.658 -5.822  -16.203  1.00 18.19 ? 333  ASP A OD1 1 
ATOM   2345 O OD2 . ASP A 1 313 ? -18.443 -3.668  -15.852  1.00 17.73 ? 333  ASP A OD2 1 
ATOM   2346 N N   . CYS A 1 314 ? -17.896 -4.674  -21.317  1.00 17.70 ? 334  CYS A N   1 
ATOM   2347 C CA  . CYS A 1 314 ? -18.181 -4.498  -22.742  1.00 18.19 ? 334  CYS A CA  1 
ATOM   2348 C C   . CYS A 1 314 ? -16.897 -4.579  -23.562  1.00 18.34 ? 334  CYS A C   1 
ATOM   2349 O O   . CYS A 1 314 ? -16.902 -4.366  -24.775  1.00 19.00 ? 334  CYS A O   1 
ATOM   2350 C CB  . CYS A 1 314 ? -18.872 -3.156  -22.992  1.00 20.10 ? 334  CYS A CB  1 
ATOM   2351 S SG  . CYS A 1 314 ? -17.826 -1.708  -22.709  1.00 20.73 ? 334  CYS A SG  1 
ATOM   2352 O OXT . CYS A 1 314 ? -15.825 -4.862  -23.027  1.00 16.62 ? 334  CYS A OXT 1 
ATOM   2353 N N   . LYS B 1 12  ? 28.005  -25.600 -64.592  1.00 24.76 ? 32   LYS B N   1 
ATOM   2354 C CA  . LYS B 1 12  ? 26.669  -24.965 -64.362  1.00 22.80 ? 32   LYS B CA  1 
ATOM   2355 C C   . LYS B 1 12  ? 26.793  -23.731 -63.464  1.00 20.88 ? 32   LYS B C   1 
ATOM   2356 O O   . LYS B 1 12  ? 27.699  -23.660 -62.634  1.00 21.22 ? 32   LYS B O   1 
ATOM   2357 C CB  . LYS B 1 12  ? 25.695  -25.964 -63.727  1.00 24.46 ? 32   LYS B CB  1 
ATOM   2358 C CG  . LYS B 1 12  ? 25.429  -27.207 -64.567  1.00 25.36 ? 32   LYS B CG  1 
ATOM   2359 C CD  . LYS B 1 12  ? 24.097  -27.859 -64.219  1.00 27.22 ? 32   LYS B CD  1 
ATOM   2360 C CE  . LYS B 1 12  ? 24.130  -28.582 -62.881  1.00 28.04 ? 32   LYS B CE  1 
ATOM   2361 N NZ  . LYS B 1 12  ? 24.607  -29.986 -63.018  1.00 29.00 ? 32   LYS B NZ  1 
ATOM   2362 N N   . PRO B 1 13  ? 25.877  -22.756 -63.621  1.00 19.23 ? 33   PRO B N   1 
ATOM   2363 C CA  . PRO B 1 13  ? 25.902  -21.590 -62.744  1.00 17.90 ? 33   PRO B CA  1 
ATOM   2364 C C   . PRO B 1 13  ? 25.288  -21.902 -61.382  1.00 16.89 ? 33   PRO B C   1 
ATOM   2365 O O   . PRO B 1 13  ? 24.657  -22.946 -61.215  1.00 16.83 ? 33   PRO B O   1 
ATOM   2366 C CB  . PRO B 1 13  ? 25.054  -20.568 -63.501  1.00 18.30 ? 33   PRO B CB  1 
ATOM   2367 C CG  . PRO B 1 13  ? 24.086  -21.386 -64.284  1.00 18.20 ? 33   PRO B CG  1 
ATOM   2368 C CD  . PRO B 1 13  ? 24.725  -22.723 -64.542  1.00 18.65 ? 33   PRO B CD  1 
ATOM   2369 N N   . ASN B 1 14  ? 25.479  -21.003 -60.421  1.00 16.13 ? 34   ASN B N   1 
ATOM   2370 C CA  . ASN B 1 14  ? 24.926  -21.180 -59.078  1.00 15.50 ? 34   ASN B CA  1 
ATOM   2371 C C   . ASN B 1 14  ? 24.204  -19.921 -58.598  1.00 15.14 ? 34   ASN B C   1 
ATOM   2372 O O   . ASN B 1 14  ? 24.430  -19.440 -57.487  1.00 15.31 ? 34   ASN B O   1 
ATOM   2373 C CB  . ASN B 1 14  ? 26.021  -21.617 -58.090  1.00 16.13 ? 34   ASN B CB  1 
ATOM   2374 C CG  . ASN B 1 14  ? 27.150  -20.606 -57.959  1.00 16.33 ? 34   ASN B CG  1 
ATOM   2375 O OD1 . ASN B 1 14  ? 27.241  -19.642 -58.720  1.00 16.50 ? 34   ASN B OD1 1 
ATOM   2376 N ND2 . ASN B 1 14  ? 28.025  -20.829 -56.982  1.00 17.63 ? 34   ASN B ND2 1 
ATOM   2377 N N   . TYR B 1 15  ? 23.333  -19.391 -59.453  1.00 13.72 ? 35   TYR B N   1 
ATOM   2378 C CA  . TYR B 1 15  ? 22.540  -18.218 -59.101  1.00 13.17 ? 35   TYR B CA  1 
ATOM   2379 C C   . TYR B 1 15  ? 21.752  -18.467 -57.822  1.00 13.24 ? 35   TYR B C   1 
ATOM   2380 O O   . TYR B 1 15  ? 21.049  -19.472 -57.699  1.00 14.29 ? 35   TYR B O   1 
ATOM   2381 C CB  . TYR B 1 15  ? 21.605  -17.814 -60.246  1.00 12.92 ? 35   TYR B CB  1 
ATOM   2382 C CG  . TYR B 1 15  ? 22.316  -17.027 -61.319  1.00 12.20 ? 35   TYR B CG  1 
ATOM   2383 C CD1 . TYR B 1 15  ? 22.510  -15.659 -61.181  1.00 11.72 ? 35   TYR B CD1 1 
ATOM   2384 C CD2 . TYR B 1 15  ? 22.823  -17.651 -62.456  1.00 12.11 ? 35   TYR B CD2 1 
ATOM   2385 C CE1 . TYR B 1 15  ? 23.174  -14.928 -62.145  1.00 11.76 ? 35   TYR B CE1 1 
ATOM   2386 C CE2 . TYR B 1 15  ? 23.491  -16.927 -63.431  1.00 11.36 ? 35   TYR B CE2 1 
ATOM   2387 C CZ  . TYR B 1 15  ? 23.661  -15.565 -63.271  1.00 11.65 ? 35   TYR B CZ  1 
ATOM   2388 O OH  . TYR B 1 15  ? 24.318  -14.830 -64.229  1.00 13.10 ? 35   TYR B OH  1 
ATOM   2389 N N   . ALA B 1 16  ? 21.911  -17.556 -56.865  1.00 13.10 ? 36   ALA B N   1 
ATOM   2390 C CA  . ALA B 1 16  ? 21.201  -17.609 -55.595  1.00 12.56 ? 36   ALA B CA  1 
ATOM   2391 C C   . ALA B 1 16  ? 20.582  -16.245 -55.326  1.00 11.66 ? 36   ALA B C   1 
ATOM   2392 O O   . ALA B 1 16  ? 21.129  -15.217 -55.731  1.00 12.19 ? 36   ALA B O   1 
ATOM   2393 C CB  . ALA B 1 16  ? 22.152  -17.987 -54.473  1.00 12.69 ? 36   ALA B CB  1 
ATOM   2394 N N   . LEU B 1 17  ? 19.448  -16.245 -54.636  1.00 10.61 ? 37   LEU B N   1 
ATOM   2395 C CA  . LEU B 1 17  ? 18.720  -15.014 -54.351  1.00 11.04 ? 37   LEU B CA  1 
ATOM   2396 C C   . LEU B 1 17  ? 19.482  -14.134 -53.364  1.00 11.66 ? 37   LEU B C   1 
ATOM   2397 O O   . LEU B 1 17  ? 19.927  -14.606 -52.315  1.00 12.71 ? 37   LEU B O   1 
ATOM   2398 C CB  . LEU B 1 17  ? 17.333  -15.337 -53.797  1.00 10.95 ? 37   LEU B CB  1 
ATOM   2399 C CG  . LEU B 1 17  ? 16.403  -14.157 -53.513  1.00 10.86 ? 37   LEU B CG  1 
ATOM   2400 C CD1 . LEU B 1 17  ? 16.133  -13.349 -54.774  1.00 10.96 ? 37   LEU B CD1 1 
ATOM   2401 C CD2 . LEU B 1 17  ? 15.104  -14.668 -52.911  1.00 11.08 ? 37   LEU B CD2 1 
ATOM   2402 N N   . LYS B 1 18  ? 19.628  -12.857 -53.712  1.00 11.91 ? 38   LYS B N   1 
ATOM   2403 C CA  . LYS B 1 18  ? 20.317  -11.888 -52.855  1.00 11.91 ? 38   LYS B CA  1 
ATOM   2404 C C   . LYS B 1 18  ? 19.414  -10.757 -52.359  1.00 11.66 ? 38   LYS B C   1 
ATOM   2405 O O   . LYS B 1 18  ? 19.544  -10.330 -51.213  1.00 12.47 ? 38   LYS B O   1 
ATOM   2406 C CB  . LYS B 1 18  ? 21.532  -11.304 -53.582  1.00 12.07 ? 38   LYS B CB  1 
ATOM   2407 C CG  . LYS B 1 18  ? 22.559  -12.341 -54.013  1.00 13.28 ? 38   LYS B CG  1 
ATOM   2408 C CD  . LYS B 1 18  ? 23.169  -13.073 -52.824  1.00 13.91 ? 38   LYS B CD  1 
ATOM   2409 C CE  . LYS B 1 18  ? 24.206  -14.088 -53.270  1.00 15.58 ? 38   LYS B CE  1 
ATOM   2410 N NZ  . LYS B 1 18  ? 24.836  -14.772 -52.109  1.00 17.54 ? 38   LYS B NZ  1 
ATOM   2411 N N   . PHE B 1 19  ? 18.522  -10.260 -53.216  1.00 10.99 ? 39   PHE B N   1 
ATOM   2412 C CA  . PHE B 1 19  ? 17.628  -9.162  -52.845  1.00 10.17 ? 39   PHE B CA  1 
ATOM   2413 C C   . PHE B 1 19  ? 16.262  -9.302  -53.501  1.00 9.67  ? 39   PHE B C   1 
ATOM   2414 O O   . PHE B 1 19  ? 16.157  -9.755  -54.641  1.00 10.23 ? 39   PHE B O   1 
ATOM   2415 C CB  . PHE B 1 19  ? 18.239  -7.817  -53.247  1.00 10.26 ? 39   PHE B CB  1 
ATOM   2416 C CG  . PHE B 1 19  ? 19.588  -7.558  -52.642  1.00 10.84 ? 39   PHE B CG  1 
ATOM   2417 C CD1 . PHE B 1 19  ? 19.699  -7.062  -51.352  1.00 11.02 ? 39   PHE B CD1 1 
ATOM   2418 C CD2 . PHE B 1 19  ? 20.748  -7.818  -53.361  1.00 11.22 ? 39   PHE B CD2 1 
ATOM   2419 C CE1 . PHE B 1 19  ? 20.942  -6.822  -50.790  1.00 11.21 ? 39   PHE B CE1 1 
ATOM   2420 C CE2 . PHE B 1 19  ? 21.994  -7.584  -52.804  1.00 10.98 ? 39   PHE B CE2 1 
ATOM   2421 C CZ  . PHE B 1 19  ? 22.091  -7.085  -51.516  1.00 11.28 ? 39   PHE B CZ  1 
ATOM   2422 N N   . THR B 1 20  ? 15.224  -8.913  -52.764  1.00 9.14  ? 40   THR B N   1 
ATOM   2423 C CA  . THR B 1 20  ? 13.871  -8.809  -53.299  1.00 8.96  ? 40   THR B CA  1 
ATOM   2424 C C   . THR B 1 20  ? 13.418  -7.356  -53.172  1.00 9.13  ? 40   THR B C   1 
ATOM   2425 O O   . THR B 1 20  ? 13.496  -6.763  -52.095  1.00 9.79  ? 40   THR B O   1 
ATOM   2426 C CB  . THR B 1 20  ? 12.888  -9.748  -52.575  1.00 8.93  ? 40   THR B CB  1 
ATOM   2427 O OG1 . THR B 1 20  ? 13.318  -11.107 -52.737  1.00 9.18  ? 40   THR B OG1 1 
ATOM   2428 C CG2 . THR B 1 20  ? 11.476  -9.599  -53.145  1.00 8.61  ? 40   THR B CG2 1 
ATOM   2429 N N   . LEU B 1 21  ? 12.952  -6.800  -54.287  1.00 9.43  ? 41   LEU B N   1 
ATOM   2430 C CA  . LEU B 1 21  ? 12.621  -5.386  -54.402  1.00 9.54  ? 41   LEU B CA  1 
ATOM   2431 C C   . LEU B 1 21  ? 11.108  -5.242  -54.511  1.00 9.94  ? 41   LEU B C   1 
ATOM   2432 O O   . LEU B 1 21  ? 10.506  -5.684  -55.491  1.00 11.39 ? 41   LEU B O   1 
ATOM   2433 C CB  . LEU B 1 21  ? 13.287  -4.792  -55.648  1.00 10.02 ? 41   LEU B CB  1 
ATOM   2434 C CG  . LEU B 1 21  ? 14.811  -4.602  -55.691  1.00 10.41 ? 41   LEU B CG  1 
ATOM   2435 C CD1 . LEU B 1 21  ? 15.582  -5.816  -55.189  1.00 10.44 ? 41   LEU B CD1 1 
ATOM   2436 C CD2 . LEU B 1 21  ? 15.253  -4.256  -57.107  1.00 10.72 ? 41   LEU B CD2 1 
ATOM   2437 N N   . ALA B 1 22  ? 10.500  -4.628  -53.502  1.00 9.58  ? 42   ALA B N   1 
ATOM   2438 C CA  . ALA B 1 22  ? 9.055   -4.440  -53.459  1.00 9.50  ? 42   ALA B CA  1 
ATOM   2439 C C   . ALA B 1 22  ? 8.733   -2.955  -53.506  1.00 9.22  ? 42   ALA B C   1 
ATOM   2440 O O   . ALA B 1 22  ? 9.420   -2.144  -52.882  1.00 9.52  ? 42   ALA B O   1 
ATOM   2441 C CB  . ALA B 1 22  ? 8.479   -5.067  -52.201  1.00 10.11 ? 42   ALA B CB  1 
ATOM   2442 N N   . GLY B 1 23  ? 7.684   -2.603  -54.242  1.00 9.23  ? 43   GLY B N   1 
ATOM   2443 C CA  . GLY B 1 23  ? 7.295   -1.203  -54.390  1.00 9.35  ? 43   GLY B CA  1 
ATOM   2444 C C   . GLY B 1 23  ? 6.172   -0.972  -55.382  1.00 9.22  ? 43   GLY B C   1 
ATOM   2445 O O   . GLY B 1 23  ? 5.269   -0.174  -55.129  1.00 9.97  ? 43   GLY B O   1 
ATOM   2446 N N   . HIS B 1 24  ? 6.237   -1.643  -56.527  1.00 8.74  ? 44   HIS B N   1 
ATOM   2447 C CA  . HIS B 1 24  ? 5.147   -1.581  -57.496  1.00 8.62  ? 44   HIS B CA  1 
ATOM   2448 C C   . HIS B 1 24  ? 3.871   -2.173  -56.899  1.00 8.75  ? 44   HIS B C   1 
ATOM   2449 O O   . HIS B 1 24  ? 3.923   -3.185  -56.198  1.00 8.77  ? 44   HIS B O   1 
ATOM   2450 C CB  . HIS B 1 24  ? 5.525   -2.309  -58.790  1.00 8.31  ? 44   HIS B CB  1 
ATOM   2451 C CG  . HIS B 1 24  ? 6.515   -1.563  -59.629  1.00 8.08  ? 44   HIS B CG  1 
ATOM   2452 N ND1 . HIS B 1 24  ? 6.222   -0.354  -60.220  1.00 8.26  ? 44   HIS B ND1 1 
ATOM   2453 C CD2 . HIS B 1 24  ? 7.789   -1.854  -59.981  1.00 8.22  ? 44   HIS B CD2 1 
ATOM   2454 C CE1 . HIS B 1 24  ? 7.273   0.070   -60.898  1.00 8.42  ? 44   HIS B CE1 1 
ATOM   2455 N NE2 . HIS B 1 24  ? 8.238   -0.822  -60.769  1.00 8.27  ? 44   HIS B NE2 1 
ATOM   2456 N N   . THR B 1 25  ? 2.735   -1.532  -57.175  1.00 9.03  ? 45   THR B N   1 
ATOM   2457 C CA  . THR B 1 25  ? 1.440   -1.946  -56.621  1.00 9.84  ? 45   THR B CA  1 
ATOM   2458 C C   . THR B 1 25  ? 0.584   -2.728  -57.623  1.00 9.79  ? 45   THR B C   1 
ATOM   2459 O O   . THR B 1 25  ? -0.537  -3.133  -57.307  1.00 10.41 ? 45   THR B O   1 
ATOM   2460 C CB  . THR B 1 25  ? 0.633   -0.730  -56.123  1.00 10.63 ? 45   THR B CB  1 
ATOM   2461 O OG1 . THR B 1 25  ? 0.370   0.158   -57.216  1.00 11.20 ? 45   THR B OG1 1 
ATOM   2462 C CG2 . THR B 1 25  ? 1.395   0.007   -55.029  1.00 11.57 ? 45   THR B CG2 1 
ATOM   2463 N N   . LYS B 1 26  ? 1.109   -2.920  -58.832  1.00 9.56  ? 46   LYS B N   1 
ATOM   2464 C CA  . LYS B 1 26  ? 0.475   -3.750  -59.852  1.00 9.34  ? 46   LYS B CA  1 
ATOM   2465 C C   . LYS B 1 26  ? 1.561   -4.584  -60.506  1.00 8.53  ? 46   LYS B C   1 
ATOM   2466 O O   . LYS B 1 26  ? 2.749   -4.396  -60.229  1.00 8.64  ? 46   LYS B O   1 
ATOM   2467 C CB  . LYS B 1 26  ? -0.214  -2.890  -60.913  1.00 10.28 ? 46   LYS B CB  1 
ATOM   2468 C CG  . LYS B 1 26  ? -1.228  -1.893  -60.377  1.00 11.36 ? 46   LYS B CG  1 
ATOM   2469 C CD  . LYS B 1 26  ? -2.535  -2.554  -59.967  1.00 13.79 ? 46   LYS B CD  1 
ATOM   2470 C CE  . LYS B 1 26  ? -3.511  -1.527  -59.414  1.00 16.19 ? 46   LYS B CE  1 
ATOM   2471 N NZ  . LYS B 1 26  ? -4.931  -1.926  -59.612  1.00 18.83 ? 46   LYS B NZ  1 
ATOM   2472 N N   . ALA B 1 27  ? 1.154   -5.500  -61.380  1.00 8.05  ? 47   ALA B N   1 
ATOM   2473 C CA  . ALA B 1 27  ? 2.095   -6.345  -62.117  1.00 7.75  ? 47   ALA B CA  1 
ATOM   2474 C C   . ALA B 1 27  ? 3.272   -5.547  -62.681  1.00 7.35  ? 47   ALA B C   1 
ATOM   2475 O O   . ALA B 1 27  ? 3.093   -4.467  -63.248  1.00 7.88  ? 47   ALA B O   1 
ATOM   2476 C CB  . ALA B 1 27  ? 1.375   -7.066  -63.245  1.00 7.79  ? 47   ALA B CB  1 
ATOM   2477 N N   . VAL B 1 28  ? 4.478   -6.078  -62.505  1.00 7.17  ? 48   VAL B N   1 
ATOM   2478 C CA  . VAL B 1 28  ? 5.656   -5.521  -63.160  1.00 7.13  ? 48   VAL B CA  1 
ATOM   2479 C C   . VAL B 1 28  ? 5.628   -6.032  -64.602  1.00 7.06  ? 48   VAL B C   1 
ATOM   2480 O O   . VAL B 1 28  ? 5.171   -7.148  -64.850  1.00 7.64  ? 48   VAL B O   1 
ATOM   2481 C CB  . VAL B 1 28  ? 6.957   -5.934  -62.439  1.00 7.38  ? 48   VAL B CB  1 
ATOM   2482 C CG1 . VAL B 1 28  ? 8.180   -5.332  -63.121  1.00 7.56  ? 48   VAL B CG1 1 
ATOM   2483 C CG2 . VAL B 1 28  ? 6.913   -5.503  -60.979  1.00 7.95  ? 48   VAL B CG2 1 
ATOM   2484 N N   . SER B 1 29  ? 6.079   -5.204  -65.545  1.00 6.61  ? 49   SER B N   1 
ATOM   2485 C CA  . SER B 1 29  ? 6.093   -5.581  -66.962  1.00 6.68  ? 49   SER B CA  1 
ATOM   2486 C C   . SER B 1 29  ? 7.493   -5.824  -67.526  1.00 6.71  ? 49   SER B C   1 
ATOM   2487 O O   . SER B 1 29  ? 7.670   -6.701  -68.369  1.00 6.80  ? 49   SER B O   1 
ATOM   2488 C CB  . SER B 1 29  ? 5.377   -4.524  -67.805  1.00 6.69  ? 49   SER B CB  1 
ATOM   2489 O OG  . SER B 1 29  ? 5.919   -3.235  -67.593  1.00 7.07  ? 49   SER B OG  1 
ATOM   2490 N N   . SER B 1 30  ? 8.483   -5.056  -67.075  1.00 6.59  ? 50   SER B N   1 
ATOM   2491 C CA  . SER B 1 30  ? 9.822   -5.133  -67.657  1.00 6.74  ? 50   SER B CA  1 
ATOM   2492 C C   . SER B 1 30  ? 10.873  -4.600  -66.693  1.00 6.62  ? 50   SER B C   1 
ATOM   2493 O O   . SER B 1 30  ? 10.645  -3.590  -66.026  1.00 7.15  ? 50   SER B O   1 
ATOM   2494 C CB  . SER B 1 30  ? 9.854   -4.331  -68.963  1.00 7.22  ? 50   SER B CB  1 
ATOM   2495 O OG  . SER B 1 30  ? 11.083  -4.484  -69.643  1.00 7.64  ? 50   SER B OG  1 
ATOM   2496 N N   . VAL B 1 31  ? 12.014  -5.286  -66.622  1.00 6.46  ? 51   VAL B N   1 
ATOM   2497 C CA  . VAL B 1 31  ? 13.181  -4.790  -65.893  1.00 6.54  ? 51   VAL B CA  1 
ATOM   2498 C C   . VAL B 1 31  ? 14.401  -4.773  -66.814  1.00 6.45  ? 51   VAL B C   1 
ATOM   2499 O O   . VAL B 1 31  ? 14.575  -5.670  -67.641  1.00 7.17  ? 51   VAL B O   1 
ATOM   2500 C CB  . VAL B 1 31  ? 13.478  -5.593  -64.603  1.00 6.73  ? 51   VAL B CB  1 
ATOM   2501 C CG1 . VAL B 1 31  ? 12.334  -5.444  -63.615  1.00 7.07  ? 51   VAL B CG1 1 
ATOM   2502 C CG2 . VAL B 1 31  ? 13.744  -7.064  -64.895  1.00 6.96  ? 51   VAL B CG2 1 
ATOM   2503 N N   . LYS B 1 32  ? 15.230  -3.739  -66.674  1.00 6.59  ? 52   LYS B N   1 
ATOM   2504 C CA  . LYS B 1 32  ? 16.406  -3.540  -67.526  1.00 6.79  ? 52   LYS B CA  1 
ATOM   2505 C C   . LYS B 1 32  ? 17.546  -2.928  -66.719  1.00 6.97  ? 52   LYS B C   1 
ATOM   2506 O O   . LYS B 1 32  ? 17.339  -1.953  -65.994  1.00 7.10  ? 52   LYS B O   1 
ATOM   2507 C CB  . LYS B 1 32  ? 16.090  -2.579  -68.676  1.00 6.76  ? 52   LYS B CB  1 
ATOM   2508 C CG  . LYS B 1 32  ? 14.971  -2.990  -69.618  1.00 6.96  ? 52   LYS B CG  1 
ATOM   2509 C CD  . LYS B 1 32  ? 15.346  -4.163  -70.509  1.00 7.09  ? 52   LYS B CD  1 
ATOM   2510 C CE  . LYS B 1 32  ? 14.226  -4.498  -71.483  1.00 7.53  ? 52   LYS B CE  1 
ATOM   2511 N NZ  . LYS B 1 32  ? 14.030  -3.447  -72.520  1.00 8.08  ? 52   LYS B NZ  1 
ATOM   2512 N N   . PHE B 1 33  ? 18.746  -3.484  -66.861  1.00 7.39  ? 53   PHE B N   1 
ATOM   2513 C CA  . PHE B 1 33  ? 19.937  -2.905  -66.243  1.00 7.90  ? 53   PHE B CA  1 
ATOM   2514 C C   . PHE B 1 33  ? 20.452  -1.756  -67.104  1.00 8.30  ? 53   PHE B C   1 
ATOM   2515 O O   . PHE B 1 33  ? 20.439  -1.848  -68.332  1.00 8.66  ? 53   PHE B O   1 
ATOM   2516 C CB  . PHE B 1 33  ? 21.046  -3.952  -66.092  1.00 8.01  ? 53   PHE B CB  1 
ATOM   2517 C CG  . PHE B 1 33  ? 20.815  -4.930  -64.978  1.00 7.91  ? 53   PHE B CG  1 
ATOM   2518 C CD1 . PHE B 1 33  ? 20.967  -4.540  -63.653  1.00 8.14  ? 53   PHE B CD1 1 
ATOM   2519 C CD2 . PHE B 1 33  ? 20.473  -6.248  -65.251  1.00 8.14  ? 53   PHE B CD2 1 
ATOM   2520 C CE1 . PHE B 1 33  ? 20.764  -5.443  -62.624  1.00 8.10  ? 53   PHE B CE1 1 
ATOM   2521 C CE2 . PHE B 1 33  ? 20.263  -7.154  -64.224  1.00 8.47  ? 53   PHE B CE2 1 
ATOM   2522 C CZ  . PHE B 1 33  ? 20.417  -6.751  -62.908  1.00 8.39  ? 53   PHE B CZ  1 
ATOM   2523 N N   . SER B 1 34  ? 20.915  -0.683  -66.467  1.00 8.57  ? 54   SER B N   1 
ATOM   2524 C CA  . SER B 1 34  ? 21.563  0.399   -67.206  1.00 8.77  ? 54   SER B CA  1 
ATOM   2525 C C   . SER B 1 34  ? 22.859  -0.120  -67.831  1.00 9.35  ? 54   SER B C   1 
ATOM   2526 O O   . SER B 1 34  ? 23.535  -0.963  -67.235  1.00 9.22  ? 54   SER B O   1 
ATOM   2527 C CB  . SER B 1 34  ? 21.868  1.585   -66.293  1.00 8.77  ? 54   SER B CB  1 
ATOM   2528 O OG  . SER B 1 34  ? 22.715  1.201   -65.225  1.00 9.00  ? 54   SER B OG  1 
ATOM   2529 N N   . PRO B 1 35  ? 23.214  0.373   -69.032  1.00 9.75  ? 55   PRO B N   1 
ATOM   2530 C CA  . PRO B 1 35  ? 24.456  -0.084  -69.663  1.00 10.03 ? 55   PRO B CA  1 
ATOM   2531 C C   . PRO B 1 35  ? 25.710  0.083   -68.805  1.00 10.55 ? 55   PRO B C   1 
ATOM   2532 O O   . PRO B 1 35  ? 26.630  -0.730  -68.915  1.00 11.78 ? 55   PRO B O   1 
ATOM   2533 C CB  . PRO B 1 35  ? 24.549  0.789   -70.914  1.00 10.33 ? 55   PRO B CB  1 
ATOM   2534 C CG  . PRO B 1 35  ? 23.132  1.058   -71.269  1.00 10.51 ? 55   PRO B CG  1 
ATOM   2535 C CD  . PRO B 1 35  ? 22.407  1.193   -69.957  1.00 9.72  ? 55   PRO B CD  1 
ATOM   2536 N N   . ASN B 1 36  ? 25.744  1.117   -67.962  1.00 10.65 ? 56   ASN B N   1 
ATOM   2537 C CA  . ASN B 1 36  ? 26.876  1.326   -67.052  1.00 11.05 ? 56   ASN B CA  1 
ATOM   2538 C C   . ASN B 1 36  ? 26.855  0.404   -65.827  1.00 11.69 ? 56   ASN B C   1 
ATOM   2539 O O   . ASN B 1 36  ? 27.784  0.427   -65.019  1.00 13.06 ? 56   ASN B O   1 
ATOM   2540 C CB  . ASN B 1 36  ? 27.005  2.808   -66.638  1.00 11.05 ? 56   ASN B CB  1 
ATOM   2541 C CG  . ASN B 1 36  ? 25.858  3.299   -65.762  1.00 11.67 ? 56   ASN B CG  1 
ATOM   2542 O OD1 . ASN B 1 36  ? 25.067  2.518   -65.235  1.00 12.09 ? 56   ASN B OD1 1 
ATOM   2543 N ND2 . ASN B 1 36  ? 25.777  4.615   -65.595  1.00 12.21 ? 56   ASN B ND2 1 
ATOM   2544 N N   . GLY B 1 37  ? 25.790  -0.387  -65.684  1.00 11.87 ? 57   GLY B N   1 
ATOM   2545 C CA  . GLY B 1 37  ? 25.708  -1.421  -64.652  1.00 12.22 ? 57   GLY B CA  1 
ATOM   2546 C C   . GLY B 1 37  ? 25.305  -0.930  -63.273  1.00 11.66 ? 57   GLY B C   1 
ATOM   2547 O O   . GLY B 1 37  ? 25.207  -1.727  -62.339  1.00 12.38 ? 57   GLY B O   1 
ATOM   2548 N N   . GLU B 1 38  ? 25.051  0.369   -63.142  1.00 11.49 ? 58   GLU B N   1 
ATOM   2549 C CA  . GLU B 1 38  ? 24.791  0.979   -61.840  1.00 11.67 ? 58   GLU B CA  1 
ATOM   2550 C C   . GLU B 1 38  ? 23.347  0.802   -61.381  1.00 11.12 ? 58   GLU B C   1 
ATOM   2551 O O   . GLU B 1 38  ? 23.086  0.702   -60.181  1.00 11.76 ? 58   GLU B O   1 
ATOM   2552 C CB  . GLU B 1 38  ? 25.133  2.474   -61.878  1.00 12.65 ? 58   GLU B CB  1 
ATOM   2553 C CG  . GLU B 1 38  ? 26.615  2.764   -62.055  1.00 13.85 ? 58   GLU B CG  1 
ATOM   2554 C CD  . GLU B 1 38  ? 27.413  2.486   -60.796  1.00 15.07 ? 58   GLU B CD  1 
ATOM   2555 O OE1 . GLU B 1 38  ? 27.509  3.390   -59.941  1.00 18.31 ? 58   GLU B OE1 1 
ATOM   2556 O OE2 . GLU B 1 38  ? 27.943  1.366   -60.661  1.00 16.47 ? 58   GLU B OE2 1 
ATOM   2557 N N   . TRP B 1 39  ? 22.413  0.765   -62.330  1.00 10.16 ? 59   TRP B N   1 
ATOM   2558 C CA  . TRP B 1 39  ? 20.990  0.842   -62.006  1.00 10.37 ? 59   TRP B CA  1 
ATOM   2559 C C   . TRP B 1 39  ? 20.167  -0.270  -62.636  1.00 9.72  ? 59   TRP B C   1 
ATOM   2560 O O   . TRP B 1 39  ? 20.552  -0.850  -63.651  1.00 9.61  ? 59   TRP B O   1 
ATOM   2561 C CB  . TRP B 1 39  ? 20.425  2.187   -62.467  1.00 11.15 ? 59   TRP B CB  1 
ATOM   2562 C CG  . TRP B 1 39  ? 21.228  3.353   -61.998  1.00 12.49 ? 59   TRP B CG  1 
ATOM   2563 C CD1 . TRP B 1 39  ? 22.035  4.149   -62.755  1.00 13.24 ? 59   TRP B CD1 1 
ATOM   2564 C CD2 . TRP B 1 39  ? 21.319  3.845   -60.658  1.00 13.13 ? 59   TRP B CD2 1 
ATOM   2565 N NE1 . TRP B 1 39  ? 22.616  5.115   -61.971  1.00 14.44 ? 59   TRP B NE1 1 
ATOM   2566 C CE2 . TRP B 1 39  ? 22.194  4.950   -60.679  1.00 13.88 ? 59   TRP B CE2 1 
ATOM   2567 C CE3 . TRP B 1 39  ? 20.741  3.462   -59.441  1.00 13.53 ? 59   TRP B CE3 1 
ATOM   2568 C CZ2 . TRP B 1 39  ? 22.507  5.678   -59.529  1.00 14.36 ? 59   TRP B CZ2 1 
ATOM   2569 C CZ3 . TRP B 1 39  ? 21.053  4.186   -58.299  1.00 13.45 ? 59   TRP B CZ3 1 
ATOM   2570 C CH2 . TRP B 1 39  ? 21.928  5.282   -58.352  1.00 14.37 ? 59   TRP B CH2 1 
ATOM   2571 N N   . LEU B 1 40  ? 19.034  -0.559  -62.003  1.00 8.76  ? 60   LEU B N   1 
ATOM   2572 C CA  . LEU B 1 40  ? 17.977  -1.361  -62.604  1.00 8.05  ? 60   LEU B CA  1 
ATOM   2573 C C   . LEU B 1 40  ? 16.742  -0.478  -62.729  1.00 7.89  ? 60   LEU B C   1 
ATOM   2574 O O   . LEU B 1 40  ? 16.346  0.176   -61.762  1.00 8.11  ? 60   LEU B O   1 
ATOM   2575 C CB  . LEU B 1 40  ? 17.652  -2.583  -61.741  1.00 8.08  ? 60   LEU B CB  1 
ATOM   2576 C CG  . LEU B 1 40  ? 16.623  -3.562  -62.325  1.00 8.09  ? 60   LEU B CG  1 
ATOM   2577 C CD1 . LEU B 1 40  ? 17.244  -4.412  -63.423  1.00 8.10  ? 60   LEU B CD1 1 
ATOM   2578 C CD2 . LEU B 1 40  ? 16.044  -4.445  -61.228  1.00 8.48  ? 60   LEU B CD2 1 
ATOM   2579 N N   . ALA B 1 41  ? 16.153  -0.441  -63.922  1.00 7.29  ? 61   ALA B N   1 
ATOM   2580 C CA  . ALA B 1 41  ? 14.875  0.232   -64.136  1.00 7.34  ? 61   ALA B CA  1 
ATOM   2581 C C   . ALA B 1 41  ? 13.773  -0.812  -64.225  1.00 6.83  ? 61   ALA B C   1 
ATOM   2582 O O   . ALA B 1 41  ? 13.976  -1.880  -64.802  1.00 6.90  ? 61   ALA B O   1 
ATOM   2583 C CB  . ALA B 1 41  ? 14.915  1.065   -65.406  1.00 7.62  ? 61   ALA B CB  1 
ATOM   2584 N N   . SER B 1 42  ? 12.613  -0.504  -63.648  1.00 6.73  ? 62   SER B N   1 
ATOM   2585 C CA  . SER B 1 42  ? 11.440  -1.365  -63.752  1.00 6.58  ? 62   SER B CA  1 
ATOM   2586 C C   . SER B 1 42  ? 10.226  -0.563  -64.200  1.00 6.56  ? 62   SER B C   1 
ATOM   2587 O O   . SER B 1 42  ? 10.073  0.597   -63.824  1.00 6.92  ? 62   SER B O   1 
ATOM   2588 C CB  . SER B 1 42  ? 11.142  -2.046  -62.417  1.00 6.31  ? 62   SER B CB  1 
ATOM   2589 O OG  . SER B 1 42  ? 10.917  -1.096  -61.391  1.00 6.23  ? 62   SER B OG  1 
ATOM   2590 N N   . SER B 1 43  ? 9.375   -1.189  -65.009  1.00 6.29  ? 63   SER B N   1 
ATOM   2591 C CA  . SER B 1 43  ? 8.109   -0.596  -65.423  1.00 6.24  ? 63   SER B CA  1 
ATOM   2592 C C   . SER B 1 43  ? 6.973   -1.503  -64.985  1.00 6.16  ? 63   SER B C   1 
ATOM   2593 O O   . SER B 1 43  ? 7.168   -2.700  -64.776  1.00 5.92  ? 63   SER B O   1 
ATOM   2594 C CB  . SER B 1 43  ? 8.067   -0.387  -66.936  1.00 6.16  ? 63   SER B CB  1 
ATOM   2595 O OG  . SER B 1 43  ? 8.265   -1.603  -67.631  1.00 6.60  ? 63   SER B OG  1 
ATOM   2596 N N   . SER B 1 44  ? 5.780   -0.934  -64.860  1.00 6.29  ? 64   SER B N   1 
ATOM   2597 C CA  . SER B 1 44  ? 4.658   -1.661  -64.287  1.00 6.49  ? 64   SER B CA  1 
ATOM   2598 C C   . SER B 1 44  ? 3.313   -1.171  -64.808  1.00 6.33  ? 64   SER B C   1 
ATOM   2599 O O   . SER B 1 44  ? 3.187   -0.055  -65.319  1.00 6.20  ? 64   SER B O   1 
ATOM   2600 C CB  . SER B 1 44  ? 4.722   -1.550  -62.757  1.00 6.37  ? 64   SER B CB  1 
ATOM   2601 O OG  . SER B 1 44  ? 3.517   -1.958  -62.128  1.00 6.64  ? 64   SER B OG  1 
ATOM   2602 N N   . ALA B 1 45  ? 2.308   -2.029  -64.663  1.00 6.65  ? 65   ALA B N   1 
ATOM   2603 C CA  . ALA B 1 45  ? 0.922   -1.667  -64.914  1.00 6.87  ? 65   ALA B CA  1 
ATOM   2604 C C   . ALA B 1 45  ? 0.436   -0.545  -63.991  1.00 7.28  ? 65   ALA B C   1 
ATOM   2605 O O   . ALA B 1 45  ? -0.570  0.086   -64.284  1.00 7.76  ? 65   ALA B O   1 
ATOM   2606 C CB  . ALA B 1 45  ? 0.030   -2.890  -64.757  1.00 7.16  ? 65   ALA B CB  1 
ATOM   2607 N N   . ASP B 1 46  ? 1.143   -0.296  -62.885  1.00 7.29  ? 66   ASP B N   1 
ATOM   2608 C CA  . ASP B 1 46  ? 0.815   0.828   -62.000  1.00 7.64  ? 66   ASP B CA  1 
ATOM   2609 C C   . ASP B 1 46  ? 1.212   2.201   -62.564  1.00 7.65  ? 66   ASP B C   1 
ATOM   2610 O O   . ASP B 1 46  ? 1.116   3.204   -61.863  1.00 8.27  ? 66   ASP B O   1 
ATOM   2611 C CB  . ASP B 1 46  ? 1.419   0.621   -60.598  1.00 7.91  ? 66   ASP B CB  1 
ATOM   2612 C CG  . ASP B 1 46  ? 2.936   0.748   -60.569  1.00 8.24  ? 66   ASP B CG  1 
ATOM   2613 O OD1 . ASP B 1 46  ? 3.548   1.138   -61.583  1.00 8.51  ? 66   ASP B OD1 1 
ATOM   2614 O OD2 . ASP B 1 46  ? 3.524   0.447   -59.510  1.00 9.32  ? 66   ASP B OD2 1 
ATOM   2615 N N   . LYS B 1 47  ? 1.659   2.235   -63.821  1.00 7.88  ? 67   LYS B N   1 
ATOM   2616 C CA  . LYS B 1 47  ? 1.953   3.480   -64.545  1.00 8.03  ? 67   LYS B CA  1 
ATOM   2617 C C   . LYS B 1 47  ? 3.258   4.142   -64.106  1.00 7.77  ? 67   LYS B C   1 
ATOM   2618 O O   . LYS B 1 47  ? 3.514   5.291   -64.467  1.00 7.92  ? 67   LYS B O   1 
ATOM   2619 C CB  . LYS B 1 47  ? 0.801   4.494   -64.435  1.00 8.61  ? 67   LYS B CB  1 
ATOM   2620 C CG  . LYS B 1 47  ? -0.597  3.913   -64.589  1.00 8.97  ? 67   LYS B CG  1 
ATOM   2621 C CD  . LYS B 1 47  ? -1.659  5.001   -64.574  1.00 9.48  ? 67   LYS B CD  1 
ATOM   2622 C CE  . LYS B 1 47  ? -1.853  5.581   -63.182  1.00 10.29 ? 67   LYS B CE  1 
ATOM   2623 N NZ  . LYS B 1 47  ? -2.936  6.600   -63.154  1.00 12.14 ? 67   LYS B NZ  1 
ATOM   2624 N N   . LEU B 1 48  ? 4.085   3.422   -63.351  1.00 7.51  ? 68   LEU B N   1 
ATOM   2625 C CA  . LEU B 1 48  ? 5.322   3.980   -62.820  1.00 7.39  ? 68   LEU B CA  1 
ATOM   2626 C C   . LEU B 1 48  ? 6.561   3.297   -63.385  1.00 7.32  ? 68   LEU B C   1 
ATOM   2627 O O   . LEU B 1 48  ? 6.535   2.111   -63.736  1.00 7.13  ? 68   LEU B O   1 
ATOM   2628 C CB  . LEU B 1 48  ? 5.346   3.854   -61.295  1.00 7.97  ? 68   LEU B CB  1 
ATOM   2629 C CG  . LEU B 1 48  ? 4.144   4.392   -60.518  1.00 7.87  ? 68   LEU B CG  1 
ATOM   2630 C CD1 . LEU B 1 48  ? 4.317   4.112   -59.034  1.00 8.68  ? 68   LEU B CD1 1 
ATOM   2631 C CD2 . LEU B 1 48  ? 3.954   5.880   -60.763  1.00 7.93  ? 68   LEU B CD2 1 
ATOM   2632 N N   . ILE B 1 49  ? 7.634   4.076   -63.483  1.00 7.21  ? 69   ILE B N   1 
ATOM   2633 C CA  . ILE B 1 49  ? 8.987   3.560   -63.615  1.00 7.28  ? 69   ILE B CA  1 
ATOM   2634 C C   . ILE B 1 49  ? 9.661   3.730   -62.261  1.00 7.28  ? 69   ILE B C   1 
ATOM   2635 O O   . ILE B 1 49  ? 9.513   4.772   -61.616  1.00 7.21  ? 69   ILE B O   1 
ATOM   2636 C CB  . ILE B 1 49  ? 9.801   4.327   -64.676  1.00 7.84  ? 69   ILE B CB  1 
ATOM   2637 C CG1 . ILE B 1 49  ? 9.228   4.085   -66.073  1.00 8.27  ? 69   ILE B CG1 1 
ATOM   2638 C CG2 . ILE B 1 49  ? 11.267  3.912   -64.642  1.00 8.02  ? 69   ILE B CG2 1 
ATOM   2639 C CD1 . ILE B 1 49  ? 9.803   5.003   -67.131  1.00 9.02  ? 69   ILE B CD1 1 
ATOM   2640 N N   . LYS B 1 50  ? 10.392  2.709   -61.828  1.00 7.22  ? 70   LYS B N   1 
ATOM   2641 C CA  . LYS B 1 50  ? 11.205  2.811   -60.623  1.00 7.15  ? 70   LYS B CA  1 
ATOM   2642 C C   . LYS B 1 50  ? 12.652  2.458   -60.929  1.00 7.43  ? 70   LYS B C   1 
ATOM   2643 O O   . LYS B 1 50  ? 12.929  1.588   -61.757  1.00 7.26  ? 70   LYS B O   1 
ATOM   2644 C CB  . LYS B 1 50  ? 10.639  1.927   -59.511  1.00 7.37  ? 70   LYS B CB  1 
ATOM   2645 C CG  . LYS B 1 50  ? 9.364   2.486   -58.907  1.00 7.36  ? 70   LYS B CG  1 
ATOM   2646 C CD  . LYS B 1 50  ? 8.778   1.566   -57.851  1.00 7.38  ? 70   LYS B CD  1 
ATOM   2647 C CE  . LYS B 1 50  ? 7.457   2.106   -57.333  1.00 8.14  ? 70   LYS B CE  1 
ATOM   2648 N NZ  . LYS B 1 50  ? 7.634   3.317   -56.486  1.00 9.10  ? 70   LYS B NZ  1 
ATOM   2649 N N   . ILE B 1 51  ? 13.564  3.154   -60.256  1.00 7.42  ? 71   ILE B N   1 
ATOM   2650 C CA  . ILE B 1 51  ? 14.998  2.968   -60.422  1.00 7.96  ? 71   ILE B CA  1 
ATOM   2651 C C   . ILE B 1 51  ? 15.547  2.404   -59.121  1.00 8.12  ? 71   ILE B C   1 
ATOM   2652 O O   . ILE B 1 51  ? 15.239  2.913   -58.042  1.00 8.92  ? 71   ILE B O   1 
ATOM   2653 C CB  . ILE B 1 51  ? 15.707  4.302   -60.743  1.00 8.28  ? 71   ILE B CB  1 
ATOM   2654 C CG1 . ILE B 1 51  ? 14.988  5.038   -61.884  1.00 9.04  ? 71   ILE B CG1 1 
ATOM   2655 C CG2 . ILE B 1 51  ? 17.175  4.072   -61.088  1.00 8.47  ? 71   ILE B CG2 1 
ATOM   2656 C CD1 . ILE B 1 51  ? 14.928  4.275   -63.188  1.00 9.77  ? 71   ILE B CD1 1 
ATOM   2657 N N   . TRP B 1 52  ? 16.344  1.345   -59.235  1.00 8.05  ? 72   TRP B N   1 
ATOM   2658 C CA  . TRP B 1 52  ? 16.924  0.669   -58.080  1.00 7.92  ? 72   TRP B CA  1 
ATOM   2659 C C   . TRP B 1 52  ? 18.421  0.487   -58.299  1.00 8.54  ? 72   TRP B C   1 
ATOM   2660 O O   . TRP B 1 52  ? 18.881  0.424   -59.436  1.00 8.96  ? 72   TRP B O   1 
ATOM   2661 C CB  . TRP B 1 52  ? 16.286  -0.712  -57.875  1.00 7.84  ? 72   TRP B CB  1 
ATOM   2662 C CG  . TRP B 1 52  ? 14.799  -0.791  -58.116  1.00 7.67  ? 72   TRP B CG  1 
ATOM   2663 C CD1 . TRP B 1 52  ? 14.162  -0.799  -59.324  1.00 7.36  ? 72   TRP B CD1 1 
ATOM   2664 C CD2 . TRP B 1 52  ? 13.772  -0.920  -57.123  1.00 7.77  ? 72   TRP B CD2 1 
ATOM   2665 N NE1 . TRP B 1 52  ? 12.806  -0.904  -59.145  1.00 7.47  ? 72   TRP B NE1 1 
ATOM   2666 C CE2 . TRP B 1 52  ? 12.538  -0.981  -57.804  1.00 7.62  ? 72   TRP B CE2 1 
ATOM   2667 C CE3 . TRP B 1 52  ? 13.775  -0.983  -55.722  1.00 7.88  ? 72   TRP B CE3 1 
ATOM   2668 C CZ2 . TRP B 1 52  ? 11.318  -1.100  -57.136  1.00 7.91  ? 72   TRP B CZ2 1 
ATOM   2669 C CZ3 . TRP B 1 52  ? 12.559  -1.100  -55.058  1.00 7.97  ? 72   TRP B CZ3 1 
ATOM   2670 C CH2 . TRP B 1 52  ? 11.349  -1.158  -55.766  1.00 7.71  ? 72   TRP B CH2 1 
ATOM   2671 N N   . GLY B 1 53  ? 19.177  0.389   -57.210  1.00 9.00  ? 73   GLY B N   1 
ATOM   2672 C CA  . GLY B 1 53  ? 20.593  0.053   -57.298  1.00 9.33  ? 73   GLY B CA  1 
ATOM   2673 C C   . GLY B 1 53  ? 20.750  -1.355  -57.846  1.00 9.41  ? 73   GLY B C   1 
ATOM   2674 O O   . GLY B 1 53  ? 20.103  -2.283  -57.371  1.00 10.07 ? 73   GLY B O   1 
ATOM   2675 N N   . ALA B 1 54  ? 21.609  -1.515  -58.849  1.00 9.62  ? 74   ALA B N   1 
ATOM   2676 C CA  . ALA B 1 54  ? 21.768  -2.804  -59.530  1.00 10.24 ? 74   ALA B CA  1 
ATOM   2677 C C   . ALA B 1 54  ? 22.415  -3.886  -58.663  1.00 10.42 ? 74   ALA B C   1 
ATOM   2678 O O   . ALA B 1 54  ? 22.182  -5.074  -58.883  1.00 10.79 ? 74   ALA B O   1 
ATOM   2679 C CB  . ALA B 1 54  ? 22.572  -2.623  -60.807  1.00 10.64 ? 74   ALA B CB  1 
ATOM   2680 N N   . TYR B 1 55  ? 23.228  -3.474  -57.693  1.00 11.17 ? 75   TYR B N   1 
ATOM   2681 C CA  . TYR B 1 55  ? 24.020  -4.411  -56.893  1.00 12.17 ? 75   TYR B CA  1 
ATOM   2682 C C   . TYR B 1 55  ? 23.398  -4.753  -55.539  1.00 12.84 ? 75   TYR B C   1 
ATOM   2683 O O   . TYR B 1 55  ? 23.603  -5.858  -55.032  1.00 14.81 ? 75   TYR B O   1 
ATOM   2684 C CB  . TYR B 1 55  ? 25.435  -3.859  -56.701  1.00 12.38 ? 75   TYR B CB  1 
ATOM   2685 C CG  . TYR B 1 55  ? 26.144  -3.604  -58.013  1.00 11.78 ? 75   TYR B CG  1 
ATOM   2686 C CD1 . TYR B 1 55  ? 26.570  -4.663  -58.808  1.00 11.95 ? 75   TYR B CD1 1 
ATOM   2687 C CD2 . TYR B 1 55  ? 26.371  -2.308  -58.467  1.00 11.53 ? 75   TYR B CD2 1 
ATOM   2688 C CE1 . TYR B 1 55  ? 27.212  -4.439  -60.012  1.00 12.08 ? 75   TYR B CE1 1 
ATOM   2689 C CE2 . TYR B 1 55  ? 27.012  -2.074  -59.673  1.00 11.91 ? 75   TYR B CE2 1 
ATOM   2690 C CZ  . TYR B 1 55  ? 27.430  -3.144  -60.440  1.00 11.76 ? 75   TYR B CZ  1 
ATOM   2691 O OH  . TYR B 1 55  ? 28.065  -2.922  -61.637  1.00 13.15 ? 75   TYR B OH  1 
ATOM   2692 N N   . ASP B 1 56  ? 22.651  -3.813  -54.960  1.00 13.19 ? 76   ASP B N   1 
ATOM   2693 C CA  . ASP B 1 56  ? 22.008  -4.018  -53.655  1.00 13.88 ? 76   ASP B CA  1 
ATOM   2694 C C   . ASP B 1 56  ? 20.482  -3.856  -53.665  1.00 13.98 ? 76   ASP B C   1 
ATOM   2695 O O   . ASP B 1 56  ? 19.842  -4.011  -52.627  1.00 15.01 ? 76   ASP B O   1 
ATOM   2696 C CB  . ASP B 1 56  ? 22.623  -3.082  -52.603  1.00 14.85 ? 76   ASP B CB  1 
ATOM   2697 C CG  . ASP B 1 56  ? 22.431  -1.605  -52.930  1.00 15.18 ? 76   ASP B CG  1 
ATOM   2698 O OD1 . ASP B 1 56  ? 21.771  -1.276  -53.940  1.00 14.85 ? 76   ASP B OD1 1 
ATOM   2699 O OD2 . ASP B 1 56  ? 22.947  -0.765  -52.167  1.00 17.50 ? 76   ASP B OD2 1 
ATOM   2700 N N   . GLY B 1 57  ? 19.904  -3.531  -54.820  1.00 13.39 ? 77   GLY B N   1 
ATOM   2701 C CA  . GLY B 1 57  ? 18.460  -3.333  -54.927  1.00 12.36 ? 77   GLY B CA  1 
ATOM   2702 C C   . GLY B 1 57  ? 17.910  -2.122  -54.188  1.00 12.77 ? 77   GLY B C   1 
ATOM   2703 O O   . GLY B 1 57  ? 16.697  -2.003  -54.027  1.00 13.13 ? 77   GLY B O   1 
ATOM   2704 N N   . LYS B 1 58  ? 18.782  -1.214  -53.750  1.00 12.63 ? 78   LYS B N   1 
ATOM   2705 C CA  . LYS B 1 58  ? 18.340  -0.051  -52.983  1.00 13.15 ? 78   LYS B CA  1 
ATOM   2706 C C   . LYS B 1 58  ? 17.488  0.861   -53.856  1.00 12.39 ? 78   LYS B C   1 
ATOM   2707 O O   . LYS B 1 58  ? 17.924  1.284   -54.926  1.00 12.11 ? 78   LYS B O   1 
ATOM   2708 C CB  . LYS B 1 58  ? 19.530  0.738   -52.429  1.00 14.04 ? 78   LYS B CB  1 
ATOM   2709 C CG  . LYS B 1 58  ? 19.121  1.920   -51.560  1.00 16.27 ? 78   LYS B CG  1 
ATOM   2710 C CD  . LYS B 1 58  ? 20.316  2.689   -51.025  1.00 18.62 ? 78   LYS B CD  1 
ATOM   2711 C CE  . LYS B 1 58  ? 19.862  3.886   -50.203  1.00 21.27 ? 78   LYS B CE  1 
ATOM   2712 N NZ  . LYS B 1 58  ? 21.000  4.639   -49.609  1.00 23.14 ? 78   LYS B NZ  1 
ATOM   2713 N N   . PHE B 1 59  ? 16.280  1.167   -53.391  1.00 11.69 ? 79   PHE B N   1 
ATOM   2714 C CA  . PHE B 1 59  ? 15.372  2.031   -54.136  1.00 11.91 ? 79   PHE B CA  1 
ATOM   2715 C C   . PHE B 1 59  ? 15.956  3.433   -54.292  1.00 12.20 ? 79   PHE B C   1 
ATOM   2716 O O   . PHE B 1 59  ? 16.433  4.022   -53.322  1.00 12.21 ? 79   PHE B O   1 
ATOM   2717 C CB  . PHE B 1 59  ? 14.004  2.110   -53.453  1.00 11.47 ? 79   PHE B CB  1 
ATOM   2718 C CG  . PHE B 1 59  ? 13.088  3.125   -54.069  1.00 11.92 ? 79   PHE B CG  1 
ATOM   2719 C CD1 . PHE B 1 59  ? 12.454  2.862   -55.275  1.00 11.82 ? 79   PHE B CD1 1 
ATOM   2720 C CD2 . PHE B 1 59  ? 12.880  4.354   -53.459  1.00 11.96 ? 79   PHE B CD2 1 
ATOM   2721 C CE1 . PHE B 1 59  ? 11.619  3.800   -55.854  1.00 12.17 ? 79   PHE B CE1 1 
ATOM   2722 C CE2 . PHE B 1 59  ? 12.046  5.296   -54.034  1.00 12.27 ? 79   PHE B CE2 1 
ATOM   2723 C CZ  . PHE B 1 59  ? 11.413  5.019   -55.231  1.00 12.24 ? 79   PHE B CZ  1 
ATOM   2724 N N   . GLU B 1 60  ? 15.908  3.960   -55.515  1.00 11.60 ? 80   GLU B N   1 
ATOM   2725 C CA  . GLU B 1 60  ? 16.453  5.284   -55.813  1.00 12.38 ? 80   GLU B CA  1 
ATOM   2726 C C   . GLU B 1 60  ? 15.349  6.314   -56.038  1.00 11.97 ? 80   GLU B C   1 
ATOM   2727 O O   . GLU B 1 60  ? 15.276  7.315   -55.322  1.00 12.54 ? 80   GLU B O   1 
ATOM   2728 C CB  . GLU B 1 60  ? 17.380  5.217   -57.033  1.00 13.40 ? 80   GLU B CB  1 
ATOM   2729 C CG  . GLU B 1 60  ? 18.168  6.494   -57.310  1.00 15.00 ? 80   GLU B CG  1 
ATOM   2730 C CD  . GLU B 1 60  ? 19.193  6.822   -56.234  1.00 16.08 ? 80   GLU B CD  1 
ATOM   2731 O OE1 . GLU B 1 60  ? 19.556  5.927   -55.442  1.00 16.27 ? 80   GLU B OE1 1 
ATOM   2732 O OE2 . GLU B 1 60  ? 19.639  7.988   -56.184  1.00 18.54 ? 80   GLU B OE2 1 
ATOM   2733 N N   . LYS B 1 61  ? 14.496  6.074   -57.032  1.00 11.19 ? 81   LYS B N   1 
ATOM   2734 C CA  . LYS B 1 61  ? 13.442  7.030   -57.375  1.00 10.74 ? 81   LYS B CA  1 
ATOM   2735 C C   . LYS B 1 61  ? 12.309  6.428   -58.196  1.00 9.97  ? 81   LYS B C   1 
ATOM   2736 O O   . LYS B 1 61  ? 12.441  5.352   -58.778  1.00 10.28 ? 81   LYS B O   1 
ATOM   2737 C CB  . LYS B 1 61  ? 14.029  8.220   -58.143  1.00 11.40 ? 81   LYS B CB  1 
ATOM   2738 C CG  . LYS B 1 61  ? 14.528  7.886   -59.545  1.00 11.63 ? 81   LYS B CG  1 
ATOM   2739 C CD  . LYS B 1 61  ? 14.997  9.125   -60.289  1.00 12.79 ? 81   LYS B CD  1 
ATOM   2740 C CE  . LYS B 1 61  ? 16.322  9.640   -59.753  1.00 13.86 ? 81   LYS B CE  1 
ATOM   2741 N NZ  . LYS B 1 61  ? 16.693  10.942  -60.371  1.00 14.93 ? 81   LYS B NZ  1 
ATOM   2742 N N   . THR B 1 62  ? 11.200  7.156   -58.233  1.00 9.43  ? 82   THR B N   1 
ATOM   2743 C CA  . THR B 1 62  ? 10.076  6.845   -59.098  1.00 9.30  ? 82   THR B CA  1 
ATOM   2744 C C   . THR B 1 62  ? 9.969   7.931   -60.158  1.00 9.34  ? 82   THR B C   1 
ATOM   2745 O O   . THR B 1 62  ? 10.296  9.091   -59.904  1.00 9.35  ? 82   THR B O   1 
ATOM   2746 C CB  . THR B 1 62  ? 8.761   6.786   -58.302  1.00 9.08  ? 82   THR B CB  1 
ATOM   2747 O OG1 . THR B 1 62  ? 8.889   5.830   -57.245  1.00 9.33  ? 82   THR B OG1 1 
ATOM   2748 C CG2 . THR B 1 62  ? 7.587   6.393   -59.192  1.00 9.29  ? 82   THR B CG2 1 
ATOM   2749 N N   . ILE B 1 63  ? 9.521   7.540   -61.346  1.00 9.37  ? 83   ILE B N   1 
ATOM   2750 C CA  . ILE B 1 63  ? 9.254   8.470   -62.439  1.00 9.44  ? 83   ILE B CA  1 
ATOM   2751 C C   . ILE B 1 63  ? 7.864   8.148   -62.982  1.00 10.02 ? 83   ILE B C   1 
ATOM   2752 O O   . ILE B 1 63  ? 7.549   6.984   -63.229  1.00 10.65 ? 83   ILE B O   1 
ATOM   2753 C CB  . ILE B 1 63  ? 10.301  8.336   -63.565  1.00 9.67  ? 83   ILE B CB  1 
ATOM   2754 C CG1 . ILE B 1 63  ? 11.710  8.624   -63.028  1.00 9.64  ? 83   ILE B CG1 1 
ATOM   2755 C CG2 . ILE B 1 63  ? 9.966   9.273   -64.719  1.00 10.04 ? 83   ILE B CG2 1 
ATOM   2756 C CD1 . ILE B 1 63  ? 12.829  8.337   -64.011  1.00 9.99  ? 83   ILE B CD1 1 
ATOM   2757 N N   . SER B 1 64  ? 7.035   9.173   -63.162  1.00 10.28 ? 84   SER B N   1 
ATOM   2758 C CA  . SER B 1 64  ? 5.652   8.966   -63.602  1.00 10.32 ? 84   SER B CA  1 
ATOM   2759 C C   . SER B 1 64  ? 5.180   10.058  -64.555  1.00 9.94  ? 84   SER B C   1 
ATOM   2760 O O   . SER B 1 64  ? 5.811   11.110  -64.676  1.00 9.93  ? 84   SER B O   1 
ATOM   2761 C CB  . SER B 1 64  ? 4.713   8.892   -62.393  1.00 11.26 ? 84   SER B CB  1 
ATOM   2762 O OG  . SER B 1 64  ? 4.409   10.182  -61.893  1.00 12.56 ? 84   SER B OG  1 
ATOM   2763 N N   . GLY B 1 65  ? 4.053   9.800   -65.212  1.00 9.28  ? 85   GLY B N   1 
ATOM   2764 C CA  . GLY B 1 65  ? 3.488   10.735  -66.184  1.00 9.20  ? 85   GLY B CA  1 
ATOM   2765 C C   . GLY B 1 65  ? 2.541   10.122  -67.202  1.00 9.00  ? 85   GLY B C   1 
ATOM   2766 O O   . GLY B 1 65  ? 1.652   10.809  -67.709  1.00 10.37 ? 85   GLY B O   1 
ATOM   2767 N N   . HIS B 1 66  ? 2.740   8.845   -67.533  1.00 8.48  ? 86   HIS B N   1 
ATOM   2768 C CA  . HIS B 1 66  ? 1.828   8.143   -68.438  1.00 8.42  ? 86   HIS B CA  1 
ATOM   2769 C C   . HIS B 1 66  ? 0.416   8.095   -67.859  1.00 8.74  ? 86   HIS B C   1 
ATOM   2770 O O   . HIS B 1 66  ? 0.240   7.958   -66.647  1.00 9.64  ? 86   HIS B O   1 
ATOM   2771 C CB  . HIS B 1 66  ? 2.304   6.709   -68.708  1.00 7.86  ? 86   HIS B CB  1 
ATOM   2772 C CG  . HIS B 1 66  ? 3.347   6.599   -69.775  1.00 7.60  ? 86   HIS B CG  1 
ATOM   2773 N ND1 . HIS B 1 66  ? 3.085   6.876   -71.099  1.00 7.51  ? 86   HIS B ND1 1 
ATOM   2774 C CD2 . HIS B 1 66  ? 4.642   6.209   -69.722  1.00 7.38  ? 86   HIS B CD2 1 
ATOM   2775 C CE1 . HIS B 1 66  ? 4.177   6.675   -71.814  1.00 7.16  ? 86   HIS B CE1 1 
ATOM   2776 N NE2 . HIS B 1 66  ? 5.138   6.273   -71.002  1.00 7.33  ? 86   HIS B NE2 1 
ATOM   2777 N N   . LYS B 1 67  ? -0.581  8.198   -68.733  1.00 9.30  ? 87   LYS B N   1 
ATOM   2778 C CA  . LYS B 1 67  ? -1.986  8.153   -68.322  1.00 9.94  ? 87   LYS B CA  1 
ATOM   2779 C C   . LYS B 1 67  ? -2.486  6.733   -68.060  1.00 9.59  ? 87   LYS B C   1 
ATOM   2780 O O   . LYS B 1 67  ? -3.447  6.546   -67.314  1.00 10.79 ? 87   LYS B O   1 
ATOM   2781 C CB  . LYS B 1 67  ? -2.869  8.839   -69.371  1.00 11.05 ? 87   LYS B CB  1 
ATOM   2782 C CG  . LYS B 1 67  ? -2.605  10.331  -69.521  1.00 12.58 ? 87   LYS B CG  1 
ATOM   2783 C CD  . LYS B 1 67  ? -2.818  11.074  -68.211  1.00 14.93 ? 87   LYS B CD  1 
ATOM   2784 C CE  . LYS B 1 67  ? -2.810  12.581  -68.400  1.00 17.06 ? 87   LYS B CE  1 
ATOM   2785 N NZ  . LYS B 1 67  ? -2.736  13.295  -67.095  1.00 20.65 ? 87   LYS B NZ  1 
ATOM   2786 N N   . LEU B 1 68  ? -1.845  5.748   -68.685  1.00 9.09  ? 88   LEU B N   1 
ATOM   2787 C CA  . LEU B 1 68  ? -2.132  4.336   -68.447  1.00 8.63  ? 88   LEU B CA  1 
ATOM   2788 C C   . LEU B 1 68  ? -0.834  3.598   -68.129  1.00 8.09  ? 88   LEU B C   1 
ATOM   2789 O O   . LEU B 1 68  ? 0.231   4.213   -68.054  1.00 8.02  ? 88   LEU B O   1 
ATOM   2790 C CB  . LEU B 1 68  ? -2.834  3.721   -69.661  1.00 9.09  ? 88   LEU B CB  1 
ATOM   2791 C CG  . LEU B 1 68  ? -4.183  4.349   -70.030  1.00 9.23  ? 88   LEU B CG  1 
ATOM   2792 C CD1 . LEU B 1 68  ? -4.714  3.771   -71.334  1.00 9.01  ? 88   LEU B CD1 1 
ATOM   2793 C CD2 . LEU B 1 68  ? -5.205  4.160   -68.919  1.00 9.59  ? 88   LEU B CD2 1 
ATOM   2794 N N   . GLY B 1 69  ? -0.923  2.285   -67.926  1.00 7.68  ? 89   GLY B N   1 
ATOM   2795 C CA  . GLY B 1 69  ? 0.234   1.492   -67.517  1.00 7.14  ? 89   GLY B CA  1 
ATOM   2796 C C   . GLY B 1 69  ? 1.294   1.335   -68.590  1.00 6.79  ? 89   GLY B C   1 
ATOM   2797 O O   . GLY B 1 69  ? 1.100   1.720   -69.743  1.00 6.93  ? 89   GLY B O   1 
ATOM   2798 N N   . ILE B 1 70  ? 2.420   0.755   -68.192  1.00 6.04  ? 90   ILE B N   1 
ATOM   2799 C CA  . ILE B 1 70  ? 3.599   0.662   -69.038  1.00 5.65  ? 90   ILE B CA  1 
ATOM   2800 C C   . ILE B 1 70  ? 3.941   -0.804  -69.281  1.00 5.66  ? 90   ILE B C   1 
ATOM   2801 O O   . ILE B 1 70  ? 3.983   -1.595  -68.337  1.00 5.62  ? 90   ILE B O   1 
ATOM   2802 C CB  . ILE B 1 70  ? 4.798   1.357   -68.365  1.00 5.85  ? 90   ILE B CB  1 
ATOM   2803 C CG1 . ILE B 1 70  ? 4.486   2.827   -68.071  1.00 5.91  ? 90   ILE B CG1 1 
ATOM   2804 C CG2 . ILE B 1 70  ? 6.032   1.268   -69.249  1.00 5.91  ? 90   ILE B CG2 1 
ATOM   2805 C CD1 . ILE B 1 70  ? 5.462   3.478   -67.112  1.00 6.13  ? 90   ILE B CD1 1 
ATOM   2806 N N   . SER B 1 71  ? 4.194   -1.153  -70.543  1.00 5.62  ? 91   SER B N   1 
ATOM   2807 C CA  . SER B 1 71  ? 4.551   -2.526  -70.926  1.00 5.50  ? 91   SER B CA  1 
ATOM   2808 C C   . SER B 1 71  ? 6.046   -2.761  -71.118  1.00 5.59  ? 91   SER B C   1 
ATOM   2809 O O   . SER B 1 71  ? 6.495   -3.908  -71.138  1.00 6.09  ? 91   SER B O   1 
ATOM   2810 C CB  . SER B 1 71  ? 3.825   -2.927  -72.211  1.00 5.53  ? 91   SER B CB  1 
ATOM   2811 O OG  . SER B 1 71  ? 2.462   -3.192  -71.948  1.00 5.83  ? 91   SER B OG  1 
ATOM   2812 N N   . ASP B 1 72  ? 6.818   -1.695  -71.294  1.00 5.57  ? 92   ASP B N   1 
ATOM   2813 C CA  . ASP B 1 72  ? 8.251   -1.845  -71.533  1.00 5.72  ? 92   ASP B CA  1 
ATOM   2814 C C   . ASP B 1 72  ? 8.996   -0.557  -71.206  1.00 5.78  ? 92   ASP B C   1 
ATOM   2815 O O   . ASP B 1 72  ? 8.416   0.530   -71.219  1.00 5.66  ? 92   ASP B O   1 
ATOM   2816 C CB  . ASP B 1 72  ? 8.501   -2.249  -72.995  1.00 6.04  ? 92   ASP B CB  1 
ATOM   2817 C CG  . ASP B 1 72  ? 9.849   -2.933  -73.213  1.00 6.24  ? 92   ASP B CG  1 
ATOM   2818 O OD1 . ASP B 1 72  ? 10.572  -3.235  -72.236  1.00 6.37  ? 92   ASP B OD1 1 
ATOM   2819 O OD2 . ASP B 1 72  ? 10.185  -3.181  -74.392  1.00 6.77  ? 92   ASP B OD2 1 
ATOM   2820 N N   . VAL B 1 73  ? 10.281  -0.706  -70.904  1.00 6.00  ? 93   VAL B N   1 
ATOM   2821 C CA  . VAL B 1 73  ? 11.170  0.413   -70.624  1.00 6.32  ? 93   VAL B CA  1 
ATOM   2822 C C   . VAL B 1 73  ? 12.555  0.044   -71.157  1.00 6.43  ? 93   VAL B C   1 
ATOM   2823 O O   . VAL B 1 73  ? 12.889  -1.142  -71.235  1.00 7.13  ? 93   VAL B O   1 
ATOM   2824 C CB  . VAL B 1 73  ? 11.213  0.723   -69.110  1.00 6.74  ? 93   VAL B CB  1 
ATOM   2825 C CG1 . VAL B 1 73  ? 11.789  -0.451  -68.323  1.00 7.29  ? 93   VAL B CG1 1 
ATOM   2826 C CG2 . VAL B 1 73  ? 11.986  2.002   -68.831  1.00 7.49  ? 93   VAL B CG2 1 
ATOM   2827 N N   . ALA B 1 74  ? 13.341  1.046   -71.549  1.00 6.63  ? 94   ALA B N   1 
ATOM   2828 C CA  . ALA B 1 74  ? 14.682  0.813   -72.085  1.00 6.70  ? 94   ALA B CA  1 
ATOM   2829 C C   . ALA B 1 74  ? 15.614  2.001   -71.838  1.00 6.63  ? 94   ALA B C   1 
ATOM   2830 O O   . ALA B 1 74  ? 15.163  3.143   -71.753  1.00 6.72  ? 94   ALA B O   1 
ATOM   2831 C CB  . ALA B 1 74  ? 14.603  0.504   -73.568  1.00 6.85  ? 94   ALA B CB  1 
ATOM   2832 N N   . TRP B 1 75  ? 16.910  1.708   -71.732  1.00 6.99  ? 95   TRP B N   1 
ATOM   2833 C CA  . TRP B 1 75  ? 17.944  2.700   -71.431  1.00 7.30  ? 95   TRP B CA  1 
ATOM   2834 C C   . TRP B 1 75  ? 18.662  3.182   -72.685  1.00 7.45  ? 95   TRP B C   1 
ATOM   2835 O O   . TRP B 1 75  ? 18.912  2.404   -73.603  1.00 7.24  ? 95   TRP B O   1 
ATOM   2836 C CB  . TRP B 1 75  ? 19.023  2.090   -70.534  1.00 7.38  ? 95   TRP B CB  1 
ATOM   2837 C CG  . TRP B 1 75  ? 18.621  1.758   -69.136  1.00 7.28  ? 95   TRP B CG  1 
ATOM   2838 C CD1 . TRP B 1 75  ? 18.126  0.570   -68.683  1.00 7.18  ? 95   TRP B CD1 1 
ATOM   2839 C CD2 . TRP B 1 75  ? 18.742  2.606   -67.989  1.00 7.25  ? 95   TRP B CD2 1 
ATOM   2840 N NE1 . TRP B 1 75  ? 17.906  0.634   -67.327  1.00 7.21  ? 95   TRP B NE1 1 
ATOM   2841 C CE2 . TRP B 1 75  ? 18.273  1.875   -66.877  1.00 7.23  ? 95   TRP B CE2 1 
ATOM   2842 C CE3 . TRP B 1 75  ? 19.183  3.922   -67.796  1.00 7.63  ? 95   TRP B CE3 1 
ATOM   2843 C CZ2 . TRP B 1 75  ? 18.241  2.412   -65.589  1.00 7.30  ? 95   TRP B CZ2 1 
ATOM   2844 C CZ3 . TRP B 1 75  ? 19.151  4.454   -66.514  1.00 7.60  ? 95   TRP B CZ3 1 
ATOM   2845 C CH2 . TRP B 1 75  ? 18.680  3.700   -65.428  1.00 7.56  ? 95   TRP B CH2 1 
ATOM   2846 N N   . SER B 1 76  ? 19.036  4.457   -72.698  1.00 7.73  ? 96   SER B N   1 
ATOM   2847 C CA  . SER B 1 76  ? 19.989  4.961   -73.685  1.00 8.30  ? 96   SER B CA  1 
ATOM   2848 C C   . SER B 1 76  ? 21.389  4.444   -73.353  1.00 8.75  ? 96   SER B C   1 
ATOM   2849 O O   . SER B 1 76  ? 21.668  4.064   -72.211  1.00 8.63  ? 96   SER B O   1 
ATOM   2850 C CB  . SER B 1 76  ? 19.986  6.489   -73.709  1.00 8.30  ? 96   SER B CB  1 
ATOM   2851 O OG  . SER B 1 76  ? 20.374  7.024   -72.453  1.00 9.04  ? 96   SER B OG  1 
ATOM   2852 N N   . SER B 1 77  ? 22.273  4.448   -74.346  1.00 9.56  ? 97   SER B N   1 
ATOM   2853 C CA  . SER B 1 77  ? 23.611  3.873   -74.187  1.00 10.44 ? 97   SER B CA  1 
ATOM   2854 C C   . SER B 1 77  ? 24.458  4.549   -73.104  1.00 10.50 ? 97   SER B C   1 
ATOM   2855 O O   . SER B 1 77  ? 25.292  3.892   -72.482  1.00 11.70 ? 97   SER B O   1 
ATOM   2856 C CB  . SER B 1 77  ? 24.365  3.876   -75.519  1.00 11.43 ? 97   SER B CB  1 
ATOM   2857 O OG  . SER B 1 77  ? 24.529  5.189   -76.018  1.00 14.10 ? 97   SER B OG  1 
ATOM   2858 N N   . ASP B 1 78  ? 24.238  5.842   -72.866  1.00 10.02 ? 98   ASP B N   1 
ATOM   2859 C CA  . ASP B 1 78  ? 24.967  6.567   -71.811  1.00 10.78 ? 98   ASP B CA  1 
ATOM   2860 C C   . ASP B 1 78  ? 24.314  6.462   -70.420  1.00 10.92 ? 98   ASP B C   1 
ATOM   2861 O O   . ASP B 1 78  ? 24.781  7.089   -69.466  1.00 11.28 ? 98   ASP B O   1 
ATOM   2862 C CB  . ASP B 1 78  ? 25.162  8.041   -72.202  1.00 11.57 ? 98   ASP B CB  1 
ATOM   2863 C CG  . ASP B 1 78  ? 23.858  8.820   -72.270  1.00 12.08 ? 98   ASP B CG  1 
ATOM   2864 O OD1 . ASP B 1 78  ? 22.776  8.222   -72.087  1.00 12.88 ? 98   ASP B OD1 1 
ATOM   2865 O OD2 . ASP B 1 78  ? 23.919  10.043  -72.517  1.00 13.79 ? 98   ASP B OD2 1 
ATOM   2866 N N   . SER B 1 79  ? 23.239  5.678   -70.314  1.00 10.39 ? 99   SER B N   1 
ATOM   2867 C CA  . SER B 1 79  ? 22.504  5.466   -69.054  1.00 10.72 ? 99   SER B CA  1 
ATOM   2868 C C   . SER B 1 79  ? 21.819  6.728   -68.514  1.00 10.95 ? 99   SER B C   1 
ATOM   2869 O O   . SER B 1 79  ? 21.413  6.762   -67.351  1.00 11.55 ? 99   SER B O   1 
ATOM   2870 C CB  . SER B 1 79  ? 23.415  4.861   -67.969  1.00 10.70 ? 99   SER B CB  1 
ATOM   2871 O OG  . SER B 1 79  ? 24.108  3.718   -68.438  1.00 11.38 ? 99   SER B OG  1 
ATOM   2872 N N   . ASN B 1 80  ? 21.668  7.751   -69.356  1.00 10.84 ? 100  ASN B N   1 
ATOM   2873 C CA  . ASN B 1 80  ? 21.092  9.029   -68.922  1.00 10.96 ? 100  ASN B CA  1 
ATOM   2874 C C   . ASN B 1 80  ? 19.615  9.206   -69.273  1.00 10.36 ? 100  ASN B C   1 
ATOM   2875 O O   . ASN B 1 80  ? 18.934  10.034  -68.664  1.00 11.37 ? 100  ASN B O   1 
ATOM   2876 C CB  . ASN B 1 80  ? 21.897  10.199  -69.497  1.00 12.28 ? 100  ASN B CB  1 
ATOM   2877 C CG  . ASN B 1 80  ? 23.279  10.325  -68.875  1.00 13.18 ? 100  ASN B CG  1 
ATOM   2878 O OD1 . ASN B 1 80  ? 23.473  10.040  -67.692  1.00 14.02 ? 100  ASN B OD1 1 
ATOM   2879 N ND2 . ASN B 1 80  ? 24.246  10.769  -69.671  1.00 14.27 ? 100  ASN B ND2 1 
ATOM   2880 N N   . LEU B 1 81  ? 19.123  8.448   -70.254  1.00 9.68  ? 101  LEU B N   1 
ATOM   2881 C CA  . LEU B 1 81  ? 17.717  8.513   -70.648  1.00 9.45  ? 101  LEU B CA  1 
ATOM   2882 C C   . LEU B 1 81  ? 17.028  7.159   -70.542  1.00 8.71  ? 101  LEU B C   1 
ATOM   2883 O O   . LEU B 1 81  ? 17.659  6.114   -70.687  1.00 8.73  ? 101  LEU B O   1 
ATOM   2884 C CB  . LEU B 1 81  ? 17.570  9.016   -72.086  1.00 9.96  ? 101  LEU B CB  1 
ATOM   2885 C CG  . LEU B 1 81  ? 18.225  10.338  -72.481  1.00 10.48 ? 101  LEU B CG  1 
ATOM   2886 C CD1 . LEU B 1 81  ? 17.961  10.603  -73.956  1.00 10.97 ? 101  LEU B CD1 1 
ATOM   2887 C CD2 . LEU B 1 81  ? 17.717  11.493  -71.633  1.00 10.66 ? 101  LEU B CD2 1 
ATOM   2888 N N   . LEU B 1 82  ? 15.723  7.203   -70.289  1.00 8.50  ? 102  LEU B N   1 
ATOM   2889 C CA  . LEU B 1 82  ? 14.850  6.042   -70.416  1.00 8.24  ? 102  LEU B CA  1 
ATOM   2890 C C   . LEU B 1 82  ? 13.777  6.336   -71.452  1.00 7.64  ? 102  LEU B C   1 
ATOM   2891 O O   . LEU B 1 82  ? 13.432  7.494   -71.681  1.00 7.54  ? 102  LEU B O   1 
ATOM   2892 C CB  . LEU B 1 82  ? 14.173  5.716   -69.086  1.00 8.63  ? 102  LEU B CB  1 
ATOM   2893 C CG  . LEU B 1 82  ? 15.073  5.132   -67.997  1.00 9.07  ? 102  LEU B CG  1 
ATOM   2894 C CD1 . LEU B 1 82  ? 14.392  5.216   -66.642  1.00 9.84  ? 102  LEU B CD1 1 
ATOM   2895 C CD2 . LEU B 1 82  ? 15.448  3.694   -68.314  1.00 9.35  ? 102  LEU B CD2 1 
ATOM   2896 N N   . VAL B 1 83  ? 13.264  5.282   -72.079  1.00 7.18  ? 103  VAL B N   1 
ATOM   2897 C CA  . VAL B 1 83  ? 12.049  5.380   -72.888  1.00 7.30  ? 103  VAL B CA  1 
ATOM   2898 C C   . VAL B 1 83  ? 11.064  4.327   -72.391  1.00 7.12  ? 103  VAL B C   1 
ATOM   2899 O O   . VAL B 1 83  ? 11.467  3.223   -72.036  1.00 7.18  ? 103  VAL B O   1 
ATOM   2900 C CB  . VAL B 1 83  ? 12.323  5.221   -74.407  1.00 7.46  ? 103  VAL B CB  1 
ATOM   2901 C CG1 . VAL B 1 83  ? 12.926  3.858   -74.736  1.00 7.58  ? 103  VAL B CG1 1 
ATOM   2902 C CG2 . VAL B 1 83  ? 11.048  5.452   -75.210  1.00 7.61  ? 103  VAL B CG2 1 
ATOM   2903 N N   . SER B 1 84  ? 9.782   4.683   -72.359  1.00 7.04  ? 104  SER B N   1 
ATOM   2904 C CA  . SER B 1 84  ? 8.727   3.783   -71.891  1.00 6.79  ? 104  SER B CA  1 
ATOM   2905 C C   . SER B 1 84  ? 7.646   3.644   -72.950  1.00 6.67  ? 104  SER B C   1 
ATOM   2906 O O   . SER B 1 84  ? 7.410   4.573   -73.711  1.00 7.31  ? 104  SER B O   1 
ATOM   2907 C CB  . SER B 1 84  ? 8.108   4.318   -70.598  1.00 6.73  ? 104  SER B CB  1 
ATOM   2908 O OG  . SER B 1 84  ? 7.726   5.682   -70.732  1.00 6.62  ? 104  SER B OG  1 
ATOM   2909 N N   . ALA B 1 85  ? 6.998   2.481   -72.983  1.00 6.52  ? 105  ALA B N   1 
ATOM   2910 C CA  . ALA B 1 85  ? 5.920   2.189   -73.928  1.00 6.42  ? 105  ALA B CA  1 
ATOM   2911 C C   . ALA B 1 85  ? 4.649   1.891   -73.142  1.00 6.38  ? 105  ALA B C   1 
ATOM   2912 O O   . ALA B 1 85  ? 4.659   1.025   -72.266  1.00 6.75  ? 105  ALA B O   1 
ATOM   2913 C CB  . ALA B 1 85  ? 6.294   0.993   -74.788  1.00 6.75  ? 105  ALA B CB  1 
ATOM   2914 N N   . SER B 1 86  ? 3.557   2.587   -73.468  1.00 6.59  ? 106  SER B N   1 
ATOM   2915 C CA  . SER B 1 86  ? 2.353   2.578   -72.632  1.00 6.88  ? 106  SER B CA  1 
ATOM   2916 C C   . SER B 1 86  ? 1.067   2.226   -73.381  1.00 7.08  ? 106  SER B C   1 
ATOM   2917 O O   . SER B 1 86  ? 0.971   2.384   -74.601  1.00 7.32  ? 106  SER B O   1 
ATOM   2918 C CB  . SER B 1 86  ? 2.192   3.949   -71.970  1.00 7.02  ? 106  SER B CB  1 
ATOM   2919 O OG  . SER B 1 86  ? 1.002   4.046   -71.199  1.00 7.53  ? 106  SER B OG  1 
ATOM   2920 N N   . ASP B 1 87  ? 0.078   1.750   -72.621  1.00 7.31  ? 107  ASP B N   1 
ATOM   2921 C CA  . ASP B 1 87  ? -1.282  1.535   -73.133  1.00 7.60  ? 107  ASP B CA  1 
ATOM   2922 C C   . ASP B 1 87  ? -1.961  2.840   -73.563  1.00 7.66  ? 107  ASP B C   1 
ATOM   2923 O O   . ASP B 1 87  ? -2.959  2.800   -74.284  1.00 8.20  ? 107  ASP B O   1 
ATOM   2924 C CB  . ASP B 1 87  ? -2.167  0.829   -72.090  1.00 7.66  ? 107  ASP B CB  1 
ATOM   2925 C CG  . ASP B 1 87  ? -2.118  -0.688  -72.195  1.00 7.69  ? 107  ASP B CG  1 
ATOM   2926 O OD1 . ASP B 1 87  ? -1.102  -1.233  -72.671  1.00 7.89  ? 107  ASP B OD1 1 
ATOM   2927 O OD2 . ASP B 1 87  ? -3.104  -1.341  -71.785  1.00 8.17  ? 107  ASP B OD2 1 
ATOM   2928 N N   . ASP B 1 88  ? -1.434  3.990   -73.133  1.00 7.71  ? 108  ASP B N   1 
ATOM   2929 C CA  . ASP B 1 88  ? -1.975  5.286   -73.566  1.00 7.95  ? 108  ASP B CA  1 
ATOM   2930 C C   . ASP B 1 88  ? -1.595  5.656   -75.012  1.00 8.41  ? 108  ASP B C   1 
ATOM   2931 O O   . ASP B 1 88  ? -1.849  6.777   -75.450  1.00 8.84  ? 108  ASP B O   1 
ATOM   2932 C CB  . ASP B 1 88  ? -1.613  6.411   -72.572  1.00 8.09  ? 108  ASP B CB  1 
ATOM   2933 C CG  . ASP B 1 88  ? -0.131  6.773   -72.572  1.00 8.02  ? 108  ASP B CG  1 
ATOM   2934 O OD1 . ASP B 1 88  ? 0.613   6.364   -73.489  1.00 8.13  ? 108  ASP B OD1 1 
ATOM   2935 O OD2 . ASP B 1 88  ? 0.295   7.492   -71.637  1.00 8.23  ? 108  ASP B OD2 1 
ATOM   2936 N N   . LYS B 1 89  ? -0.992  4.706   -75.733  1.00 8.42  ? 109  LYS B N   1 
ATOM   2937 C CA  . LYS B 1 89  ? -0.649  4.836   -77.157  1.00 8.71  ? 109  LYS B CA  1 
ATOM   2938 C C   . LYS B 1 89  ? 0.605   5.669   -77.413  1.00 8.29  ? 109  LYS B C   1 
ATOM   2939 O O   . LYS B 1 89  ? 0.950   5.918   -78.567  1.00 8.79  ? 109  LYS B O   1 
ATOM   2940 C CB  . LYS B 1 89  ? -1.823  5.380   -77.987  1.00 9.80  ? 109  LYS B CB  1 
ATOM   2941 C CG  . LYS B 1 89  ? -3.117  4.599   -77.843  1.00 10.38 ? 109  LYS B CG  1 
ATOM   2942 C CD  . LYS B 1 89  ? -4.178  5.155   -78.776  1.00 11.83 ? 109  LYS B CD  1 
ATOM   2943 C CE  . LYS B 1 89  ? -5.459  4.345   -78.721  1.00 13.55 ? 109  LYS B CE  1 
ATOM   2944 N NZ  . LYS B 1 89  ? -6.474  4.855   -79.682  1.00 15.71 ? 109  LYS B NZ  1 
ATOM   2945 N N   . THR B 1 90  ? 1.299   6.081   -76.354  1.00 7.80  ? 110  THR B N   1 
ATOM   2946 C CA  . THR B 1 90  ? 2.492   6.900   -76.508  1.00 7.55  ? 110  THR B CA  1 
ATOM   2947 C C   . THR B 1 90  ? 3.716   6.205   -75.946  1.00 7.17  ? 110  THR B C   1 
ATOM   2948 O O   . THR B 1 90  ? 3.610   5.252   -75.166  1.00 7.10  ? 110  THR B O   1 
ATOM   2949 C CB  . THR B 1 90  ? 2.364   8.255   -75.776  1.00 8.11  ? 110  THR B CB  1 
ATOM   2950 O OG1 . THR B 1 90  ? 2.467   8.057   -74.358  1.00 8.28  ? 110  THR B OG1 1 
ATOM   2951 C CG2 . THR B 1 90  ? 1.043   8.946   -76.111  1.00 8.71  ? 110  THR B CG2 1 
ATOM   2952 N N   . LEU B 1 91  ? 4.879   6.683   -76.371  1.00 6.78  ? 111  LEU B N   1 
ATOM   2953 C CA  . LEU B 1 91  ? 6.108   6.460   -75.631  1.00 6.79  ? 111  LEU B CA  1 
ATOM   2954 C C   . LEU B 1 91  ? 6.509   7.777   -74.996  1.00 6.92  ? 111  LEU B C   1 
ATOM   2955 O O   . LEU B 1 91  ? 6.136   8.845   -75.485  1.00 7.43  ? 111  LEU B O   1 
ATOM   2956 C CB  . LEU B 1 91  ? 7.229   5.955   -76.535  1.00 6.74  ? 111  LEU B CB  1 
ATOM   2957 C CG  . LEU B 1 91  ? 6.925   4.685   -77.328  1.00 6.79  ? 111  LEU B CG  1 
ATOM   2958 C CD1 . LEU B 1 91  ? 6.567   5.028   -78.768  1.00 6.74  ? 111  LEU B CD1 1 
ATOM   2959 C CD2 . LEU B 1 91  ? 8.106   3.727   -77.294  1.00 6.69  ? 111  LEU B CD2 1 
ATOM   2960 N N   . LYS B 1 92  ? 7.259   7.699   -73.901  1.00 7.01  ? 112  LYS B N   1 
ATOM   2961 C CA  . LYS B 1 92  ? 7.832   8.890   -73.279  1.00 7.40  ? 112  LYS B CA  1 
ATOM   2962 C C   . LYS B 1 92  ? 9.330   8.718   -73.082  1.00 7.58  ? 112  LYS B C   1 
ATOM   2963 O O   . LYS B 1 92  ? 9.792   7.642   -72.703  1.00 8.07  ? 112  LYS B O   1 
ATOM   2964 C CB  . LYS B 1 92  ? 7.146   9.194   -71.945  1.00 7.42  ? 112  LYS B CB  1 
ATOM   2965 C CG  . LYS B 1 92  ? 5.754   9.783   -72.113  1.00 7.48  ? 112  LYS B CG  1 
ATOM   2966 C CD  . LYS B 1 92  ? 5.034   9.947   -70.783  1.00 7.63  ? 112  LYS B CD  1 
ATOM   2967 C CE  . LYS B 1 92  ? 3.632   10.512  -70.966  1.00 7.97  ? 112  LYS B CE  1 
ATOM   2968 N NZ  . LYS B 1 92  ? 3.632   11.954  -71.342  1.00 8.41  ? 112  LYS B NZ  1 
ATOM   2969 N N   . ILE B 1 93  ? 10.073  9.786   -73.363  1.00 7.84  ? 113  ILE B N   1 
ATOM   2970 C CA  . ILE B 1 93  ? 11.510  9.836   -73.121  1.00 7.80  ? 113  ILE B CA  1 
ATOM   2971 C C   . ILE B 1 93  ? 11.729  10.592  -71.818  1.00 8.01  ? 113  ILE B C   1 
ATOM   2972 O O   . ILE B 1 93  ? 11.203  11.691  -71.634  1.00 8.17  ? 113  ILE B O   1 
ATOM   2973 C CB  . ILE B 1 93  ? 12.261  10.536  -74.274  1.00 7.97  ? 113  ILE B CB  1 
ATOM   2974 C CG1 . ILE B 1 93  ? 11.935  9.846   -75.604  1.00 8.36  ? 113  ILE B CG1 1 
ATOM   2975 C CG2 . ILE B 1 93  ? 13.766  10.533  -74.016  1.00 8.21  ? 113  ILE B CG2 1 
ATOM   2976 C CD1 . ILE B 1 93  ? 12.605  10.456  -76.816  1.00 8.94  ? 113  ILE B CD1 1 
ATOM   2977 N N   . TRP B 1 94  ? 12.510  10.000  -70.920  1.00 7.88  ? 114  TRP B N   1 
ATOM   2978 C CA  . TRP B 1 94  ? 12.699  10.546  -69.585  1.00 8.06  ? 114  TRP B CA  1 
ATOM   2979 C C   . TRP B 1 94  ? 14.158  10.869  -69.325  1.00 8.61  ? 114  TRP B C   1 
ATOM   2980 O O   . TRP B 1 94  ? 15.040  10.096  -69.687  1.00 8.77  ? 114  TRP B O   1 
ATOM   2981 C CB  . TRP B 1 94  ? 12.250  9.533   -68.538  1.00 7.76  ? 114  TRP B CB  1 
ATOM   2982 C CG  . TRP B 1 94  ? 10.884  8.987   -68.752  1.00 7.58  ? 114  TRP B CG  1 
ATOM   2983 C CD1 . TRP B 1 94  ? 10.549  7.855   -69.441  1.00 7.42  ? 114  TRP B CD1 1 
ATOM   2984 C CD2 . TRP B 1 94  ? 9.657   9.539   -68.268  1.00 7.39  ? 114  TRP B CD2 1 
ATOM   2985 N NE1 . TRP B 1 94  ? 9.189   7.669   -69.412  1.00 7.59  ? 114  TRP B NE1 1 
ATOM   2986 C CE2 . TRP B 1 94  ? 8.617   8.690   -68.699  1.00 7.54  ? 114  TRP B CE2 1 
ATOM   2987 C CE3 . TRP B 1 94  ? 9.335   10.671  -67.511  1.00 7.35  ? 114  TRP B CE3 1 
ATOM   2988 C CZ2 . TRP B 1 94  ? 7.279   8.936   -68.396  1.00 7.47  ? 114  TRP B CZ2 1 
ATOM   2989 C CZ3 . TRP B 1 94  ? 8.008   10.912  -67.207  1.00 7.47  ? 114  TRP B CZ3 1 
ATOM   2990 C CH2 . TRP B 1 94  ? 6.995   10.051  -67.653  1.00 7.56  ? 114  TRP B CH2 1 
ATOM   2991 N N   . ASP B 1 95  ? 14.405  12.009  -68.685  1.00 9.65  ? 115  ASP B N   1 
ATOM   2992 C CA  . ASP B 1 95  ? 15.716  12.293  -68.120  1.00 11.28 ? 115  ASP B CA  1 
ATOM   2993 C C   . ASP B 1 95  ? 15.774  11.610  -66.760  1.00 12.04 ? 115  ASP B C   1 
ATOM   2994 O O   . ASP B 1 95  ? 14.982  11.929  -65.875  1.00 12.22 ? 115  ASP B O   1 
ATOM   2995 C CB  . ASP B 1 95  ? 15.934  13.795  -67.968  1.00 12.45 ? 115  ASP B CB  1 
ATOM   2996 C CG  . ASP B 1 95  ? 17.328  14.131  -67.488  1.00 14.70 ? 115  ASP B CG  1 
ATOM   2997 O OD1 . ASP B 1 95  ? 18.270  14.066  -68.303  1.00 16.44 ? 115  ASP B OD1 1 
ATOM   2998 O OD2 . ASP B 1 95  ? 17.479  14.460  -66.295  1.00 16.63 ? 115  ASP B OD2 1 
ATOM   2999 N N   . VAL B 1 96  ? 16.705  10.674  -66.595  1.00 12.52 ? 116  VAL B N   1 
ATOM   3000 C CA  . VAL B 1 96  ? 16.758  9.851   -65.383  1.00 14.03 ? 116  VAL B CA  1 
ATOM   3001 C C   . VAL B 1 96  ? 17.166  10.670  -64.157  1.00 14.71 ? 116  VAL B C   1 
ATOM   3002 O O   . VAL B 1 96  ? 16.657  10.439  -63.058  1.00 15.68 ? 116  VAL B O   1 
ATOM   3003 C CB  . VAL B 1 96  ? 17.713  8.648   -65.552  1.00 14.76 ? 116  VAL B CB  1 
ATOM   3004 C CG1 . VAL B 1 96  ? 17.800  7.832   -64.267  1.00 15.23 ? 116  VAL B CG1 1 
ATOM   3005 C CG2 . VAL B 1 96  ? 17.250  7.763   -66.700  1.00 15.36 ? 116  VAL B CG2 1 
ATOM   3006 N N   . SER B 1 97  ? 18.073  11.624  -64.352  1.00 14.28 ? 117  SER B N   1 
ATOM   3007 C CA  . SER B 1 97  ? 18.577  12.454  -63.255  1.00 14.79 ? 117  SER B CA  1 
ATOM   3008 C C   . SER B 1 97  ? 17.499  13.365  -62.666  1.00 14.73 ? 117  SER B C   1 
ATOM   3009 O O   . SER B 1 97  ? 17.341  13.434  -61.448  1.00 14.97 ? 117  SER B O   1 
ATOM   3010 C CB  . SER B 1 97  ? 19.761  13.303  -63.728  1.00 15.91 ? 117  SER B CB  1 
ATOM   3011 O OG  . SER B 1 97  ? 20.253  14.119  -62.677  1.00 17.40 ? 117  SER B OG  1 
ATOM   3012 N N   . SER B 1 98  ? 16.769  14.064  -63.531  1.00 14.05 ? 118  SER B N   1 
ATOM   3013 C CA  . SER B 1 98  ? 15.730  15.000  -63.094  1.00 13.22 ? 118  SER B CA  1 
ATOM   3014 C C   . SER B 1 98  ? 14.347  14.353  -62.998  1.00 13.50 ? 118  SER B C   1 
ATOM   3015 O O   . SER B 1 98  ? 13.477  14.851  -62.284  1.00 13.87 ? 118  SER B O   1 
ATOM   3016 C CB  . SER B 1 98  ? 15.668  16.201  -64.041  1.00 14.14 ? 118  SER B CB  1 
ATOM   3017 O OG  . SER B 1 98  ? 15.076  15.851  -65.280  1.00 13.19 ? 118  SER B OG  1 
ATOM   3018 N N   . GLY B 1 99  ? 14.145  13.257  -63.729  1.00 13.09 ? 119  GLY B N   1 
ATOM   3019 C CA  . GLY B 1 99  ? 12.843  12.596  -63.801  1.00 12.70 ? 119  GLY B CA  1 
ATOM   3020 C C   . GLY B 1 99  ? 11.896  13.233  -64.805  1.00 12.25 ? 119  GLY B C   1 
ATOM   3021 O O   . GLY B 1 99  ? 10.757  12.794  -64.946  1.00 11.96 ? 119  GLY B O   1 
ATOM   3022 N N   . LYS B 1 100 ? 12.368  14.255  -65.517  1.00 11.97 ? 120  LYS B N   1 
ATOM   3023 C CA  . LYS B 1 100 ? 11.520  15.035  -66.416  1.00 12.34 ? 120  LYS B CA  1 
ATOM   3024 C C   . LYS B 1 100 ? 11.157  14.246  -67.671  1.00 11.27 ? 120  LYS B C   1 
ATOM   3025 O O   . LYS B 1 100 ? 11.996  13.539  -68.227  1.00 10.31 ? 120  LYS B O   1 
ATOM   3026 C CB  . LYS B 1 100 ? 12.235  16.335  -66.814  1.00 13.22 ? 120  LYS B CB  1 
ATOM   3027 C CG  . LYS B 1 100 ? 11.462  17.202  -67.796  1.00 14.66 ? 120  LYS B CG  1 
ATOM   3028 C CD  . LYS B 1 100 ? 12.198  18.489  -68.117  1.00 16.70 ? 120  LYS B CD  1 
ATOM   3029 C CE  . LYS B 1 100 ? 11.431  19.308  -69.139  1.00 17.59 ? 120  LYS B CE  1 
ATOM   3030 N NZ  . LYS B 1 100 ? 12.054  20.635  -69.403  1.00 19.02 ? 120  LYS B NZ  1 
ATOM   3031 N N   . CYS B 1 101 ? 9.904   14.373  -68.107  1.00 10.44 ? 121  CYS B N   1 
ATOM   3032 C CA  . CYS B 1 101 ? 9.491   13.862  -69.411  1.00 10.60 ? 121  CYS B CA  1 
ATOM   3033 C C   . CYS B 1 101 ? 9.979   14.822  -70.489  1.00 10.59 ? 121  CYS B C   1 
ATOM   3034 O O   . CYS B 1 101 ? 9.447   15.924  -70.637  1.00 10.42 ? 121  CYS B O   1 
ATOM   3035 C CB  . CYS B 1 101 ? 7.973   13.725  -69.494  1.00 10.69 ? 121  CYS B CB  1 
ATOM   3036 S SG  . CYS B 1 101 ? 7.396   13.163  -71.111  1.00 12.24 ? 121  CYS B SG  1 
ATOM   3037 N N   . LEU B 1 102 ? 11.000  14.405  -71.232  1.00 9.99  ? 122  LEU B N   1 
ATOM   3038 C CA  . LEU B 1 102 ? 11.591  15.256  -72.262  1.00 10.00 ? 122  LEU B CA  1 
ATOM   3039 C C   . LEU B 1 102 ? 10.719  15.321  -73.508  1.00 10.58 ? 122  LEU B C   1 
ATOM   3040 O O   . LEU B 1 102 ? 10.560  16.389  -74.100  1.00 11.04 ? 122  LEU B O   1 
ATOM   3041 C CB  . LEU B 1 102 ? 12.986  14.755  -72.637  1.00 10.05 ? 122  LEU B CB  1 
ATOM   3042 C CG  . LEU B 1 102 ? 14.017  14.727  -71.506  1.00 10.61 ? 122  LEU B CG  1 
ATOM   3043 C CD1 . LEU B 1 102 ? 15.303  14.085  -71.997  1.00 11.19 ? 122  LEU B CD1 1 
ATOM   3044 C CD2 . LEU B 1 102 ? 14.287  16.122  -70.958  1.00 11.11 ? 122  LEU B CD2 1 
ATOM   3045 N N   . LYS B 1 103 ? 10.173  14.175  -73.911  1.00 10.64 ? 123  LYS B N   1 
ATOM   3046 C CA  . LYS B 1 103 ? 9.359   14.079  -75.121  1.00 10.61 ? 123  LYS B CA  1 
ATOM   3047 C C   . LYS B 1 103 ? 8.264   13.034  -74.949  1.00 9.80  ? 123  LYS B C   1 
ATOM   3048 O O   . LYS B 1 103 ? 8.467   12.016  -74.282  1.00 9.71  ? 123  LYS B O   1 
ATOM   3049 C CB  . LYS B 1 103 ? 10.230  13.686  -76.322  1.00 11.07 ? 123  LYS B CB  1 
ATOM   3050 C CG  . LYS B 1 103 ? 11.191  14.760  -76.813  1.00 11.89 ? 123  LYS B CG  1 
ATOM   3051 C CD  . LYS B 1 103 ? 10.463  15.850  -77.583  1.00 13.23 ? 123  LYS B CD  1 
ATOM   3052 C CE  . LYS B 1 103 ? 11.403  16.955  -78.042  1.00 14.94 ? 123  LYS B CE  1 
ATOM   3053 N NZ  . LYS B 1 103 ? 11.444  18.098  -77.090  1.00 16.76 ? 123  LYS B NZ  1 
ATOM   3054 N N   . THR B 1 104 ? 7.105   13.295  -75.548  1.00 9.48  ? 124  THR B N   1 
ATOM   3055 C CA  . THR B 1 104 ? 6.044   12.298  -75.654  1.00 9.54  ? 124  THR B CA  1 
ATOM   3056 C C   . THR B 1 104 ? 5.895   11.944  -77.132  1.00 9.52  ? 124  THR B C   1 
ATOM   3057 O O   . THR B 1 104 ? 5.604   12.807  -77.961  1.00 9.98  ? 124  THR B O   1 
ATOM   3058 C CB  . THR B 1 104 ? 4.715   12.806  -75.063  1.00 9.65  ? 124  THR B CB  1 
ATOM   3059 O OG1 . THR B 1 104 ? 4.903   13.118  -73.677  1.00 9.84  ? 124  THR B OG1 1 
ATOM   3060 C CG2 . THR B 1 104 ? 3.619   11.750  -75.186  1.00 9.53  ? 124  THR B CG2 1 
ATOM   3061 N N   . LEU B 1 105 ? 6.120   10.671  -77.447  1.00 9.44  ? 125  LEU B N   1 
ATOM   3062 C CA  . LEU B 1 105 ? 6.139   10.188  -78.822  1.00 9.59  ? 125  LEU B CA  1 
ATOM   3063 C C   . LEU B 1 105 ? 4.753   9.693   -79.213  1.00 9.59  ? 125  LEU B C   1 
ATOM   3064 O O   . LEU B 1 105 ? 4.296   8.654   -78.729  1.00 9.31  ? 125  LEU B O   1 
ATOM   3065 C CB  . LEU B 1 105 ? 7.174   9.068   -78.972  1.00 9.96  ? 125  LEU B CB  1 
ATOM   3066 C CG  . LEU B 1 105 ? 8.568   9.356   -78.398  1.00 11.14 ? 125  LEU B CG  1 
ATOM   3067 C CD1 . LEU B 1 105 ? 9.552   8.253   -78.755  1.00 10.83 ? 125  LEU B CD1 1 
ATOM   3068 C CD2 . LEU B 1 105 ? 9.098   10.700  -78.866  1.00 11.09 ? 125  LEU B CD2 1 
ATOM   3069 N N   . LYS B 1 106 ? 4.096   10.445  -80.094  1.00 10.08 ? 126  LYS B N   1 
ATOM   3070 C CA  . LYS B 1 106 ? 2.710   10.198  -80.471  1.00 10.72 ? 126  LYS B CA  1 
ATOM   3071 C C   . LYS B 1 106 ? 2.626   9.806   -81.942  1.00 10.25 ? 126  LYS B C   1 
ATOM   3072 O O   . LYS B 1 106 ? 3.317   10.381  -82.786  1.00 10.29 ? 126  LYS B O   1 
ATOM   3073 C CB  . LYS B 1 106 ? 1.869   11.452  -80.220  1.00 11.55 ? 126  LYS B CB  1 
ATOM   3074 C CG  . LYS B 1 106 ? 2.052   12.043  -78.830  1.00 12.87 ? 126  LYS B CG  1 
ATOM   3075 C CD  . LYS B 1 106 ? 1.188   13.272  -78.613  1.00 14.54 ? 126  LYS B CD  1 
ATOM   3076 C CE  . LYS B 1 106 ? 1.424   13.862  -77.233  1.00 16.25 ? 126  LYS B CE  1 
ATOM   3077 N NZ  . LYS B 1 106 ? 0.416   14.899  -76.885  1.00 19.34 ? 126  LYS B NZ  1 
ATOM   3078 N N   . GLY B 1 107 ? 1.775   8.831   -82.244  1.00 9.83  ? 127  GLY B N   1 
ATOM   3079 C CA  . GLY B 1 107 ? 1.641   8.337   -83.613  1.00 9.83  ? 127  GLY B CA  1 
ATOM   3080 C C   . GLY B 1 107 ? 1.000   6.967   -83.711  1.00 9.50  ? 127  GLY B C   1 
ATOM   3081 O O   . GLY B 1 107 ? 0.206   6.715   -84.617  1.00 10.19 ? 127  GLY B O   1 
ATOM   3082 N N   . HIS B 1 108 ? 1.352   6.069   -82.793  1.00 9.44  ? 128  HIS B N   1 
ATOM   3083 C CA  . HIS B 1 108 ? 0.708   4.758   -82.734  1.00 9.00  ? 128  HIS B CA  1 
ATOM   3084 C C   . HIS B 1 108 ? -0.788  4.923   -82.457  1.00 9.28  ? 128  HIS B C   1 
ATOM   3085 O O   . HIS B 1 108 ? -1.198  5.847   -81.751  1.00 9.55  ? 128  HIS B O   1 
ATOM   3086 C CB  . HIS B 1 108 ? 1.343   3.874   -81.654  1.00 8.53  ? 128  HIS B CB  1 
ATOM   3087 C CG  . HIS B 1 108 ? 2.655   3.269   -82.052  1.00 8.06  ? 128  HIS B CG  1 
ATOM   3088 N ND1 . HIS B 1 108 ? 2.790   2.420   -83.130  1.00 7.97  ? 128  HIS B ND1 1 
ATOM   3089 C CD2 . HIS B 1 108 ? 3.885   3.364   -81.493  1.00 7.59  ? 128  HIS B CD2 1 
ATOM   3090 C CE1 . HIS B 1 108 ? 4.048   2.028   -83.226  1.00 7.71  ? 128  HIS B CE1 1 
ATOM   3091 N NE2 . HIS B 1 108 ? 4.734   2.588   -82.245  1.00 7.57  ? 128  HIS B NE2 1 
ATOM   3092 N N   . SER B 1 109 ? -1.591  4.026   -83.023  1.00 9.55  ? 129  SER B N   1 
ATOM   3093 C CA  . SER B 1 109 ? -3.050  4.077   -82.880  1.00 9.80  ? 129  SER B CA  1 
ATOM   3094 C C   . SER B 1 109 ? -3.592  3.017   -81.912  1.00 10.07 ? 129  SER B C   1 
ATOM   3095 O O   . SER B 1 109 ? -4.805  2.830   -81.806  1.00 10.75 ? 129  SER B O   1 
ATOM   3096 C CB  . SER B 1 109 ? -3.710  3.919   -84.251  1.00 10.50 ? 129  SER B CB  1 
ATOM   3097 O OG  . SER B 1 109 ? -3.353  2.687   -84.851  1.00 10.65 ? 129  SER B OG  1 
ATOM   3098 N N   . ASN B 1 110 ? -2.694  2.331   -81.208  1.00 10.16 ? 130  ASN B N   1 
ATOM   3099 C CA  . ASN B 1 110 ? -3.076  1.339   -80.208  1.00 9.83  ? 130  ASN B CA  1 
ATOM   3100 C C   . ASN B 1 110 ? -1.940  1.218   -79.195  1.00 9.61  ? 130  ASN B C   1 
ATOM   3101 O O   . ASN B 1 110 ? -0.937  1.924   -79.313  1.00 9.84  ? 130  ASN B O   1 
ATOM   3102 C CB  . ASN B 1 110 ? -3.366  -0.008  -80.885  1.00 10.54 ? 130  ASN B CB  1 
ATOM   3103 C CG  . ASN B 1 110 ? -4.367  -0.856  -80.114  1.00 11.46 ? 130  ASN B CG  1 
ATOM   3104 O OD1 . ASN B 1 110 ? -4.492  -0.738  -78.896  1.00 12.03 ? 130  ASN B OD1 1 
ATOM   3105 N ND2 . ASN B 1 110 ? -5.070  -1.733  -80.822  1.00 12.19 ? 130  ASN B ND2 1 
ATOM   3106 N N   . TYR B 1 111 ? -2.092  0.328   -78.215  1.00 9.02  ? 131  TYR B N   1 
ATOM   3107 C CA  . TYR B 1 111 ? -1.096  0.153   -77.151  1.00 8.70  ? 131  TYR B CA  1 
ATOM   3108 C C   . TYR B 1 111 ? 0.315   0.048   -77.719  1.00 8.16  ? 131  TYR B C   1 
ATOM   3109 O O   . TYR B 1 111 ? 0.534   -0.657  -78.700  1.00 8.44  ? 131  TYR B O   1 
ATOM   3110 C CB  . TYR B 1 111 ? -1.368  -1.115  -76.328  1.00 9.04  ? 131  TYR B CB  1 
ATOM   3111 C CG  . TYR B 1 111 ? -2.815  -1.359  -75.953  1.00 9.52  ? 131  TYR B CG  1 
ATOM   3112 C CD1 . TYR B 1 111 ? -3.586  -0.355  -75.378  1.00 9.91  ? 131  TYR B CD1 1 
ATOM   3113 C CD2 . TYR B 1 111 ? -3.405  -2.603  -76.156  1.00 10.22 ? 131  TYR B CD2 1 
ATOM   3114 C CE1 . TYR B 1 111 ? -4.909  -0.577  -75.030  1.00 10.93 ? 131  TYR B CE1 1 
ATOM   3115 C CE2 . TYR B 1 111 ? -4.726  -2.836  -75.810  1.00 11.33 ? 131  TYR B CE2 1 
ATOM   3116 C CZ  . TYR B 1 111 ? -5.472  -1.820  -75.248  1.00 11.92 ? 131  TYR B CZ  1 
ATOM   3117 O OH  . TYR B 1 111 ? -6.785  -2.048  -74.904  1.00 15.16 ? 131  TYR B OH  1 
ATOM   3118 N N   . VAL B 1 112 ? 1.269   0.741   -77.100  1.00 7.79  ? 132  VAL B N   1 
ATOM   3119 C CA  . VAL B 1 112 ? 2.674   0.562   -77.452  1.00 7.52  ? 132  VAL B CA  1 
ATOM   3120 C C   . VAL B 1 112 ? 3.217   -0.496  -76.498  1.00 7.22  ? 132  VAL B C   1 
ATOM   3121 O O   . VAL B 1 112 ? 3.062   -0.378  -75.284  1.00 7.31  ? 132  VAL B O   1 
ATOM   3122 C CB  . VAL B 1 112 ? 3.494   1.862   -77.355  1.00 7.86  ? 132  VAL B CB  1 
ATOM   3123 C CG1 . VAL B 1 112 ? 4.842   1.662   -78.030  1.00 7.96  ? 132  VAL B CG1 1 
ATOM   3124 C CG2 . VAL B 1 112 ? 2.758   3.024   -78.009  1.00 7.87  ? 132  VAL B CG2 1 
ATOM   3125 N N   . PHE B 1 113 ? 3.834   -1.530  -77.060  1.00 6.57  ? 133  PHE B N   1 
ATOM   3126 C CA  . PHE B 1 113 ? 4.142   -2.758  -76.326  1.00 6.21  ? 133  PHE B CA  1 
ATOM   3127 C C   . PHE B 1 113 ? 5.622   -2.941  -75.992  1.00 6.16  ? 133  PHE B C   1 
ATOM   3128 O O   . PHE B 1 113 ? 5.960   -3.510  -74.950  1.00 6.36  ? 133  PHE B O   1 
ATOM   3129 C CB  . PHE B 1 113 ? 3.675   -3.951  -77.156  1.00 6.37  ? 133  PHE B CB  1 
ATOM   3130 C CG  . PHE B 1 113 ? 3.572   -5.227  -76.377  1.00 6.27  ? 133  PHE B CG  1 
ATOM   3131 C CD1 . PHE B 1 113 ? 2.426   -5.516  -75.651  1.00 6.29  ? 133  PHE B CD1 1 
ATOM   3132 C CD2 . PHE B 1 113 ? 4.618   -6.141  -76.374  1.00 6.43  ? 133  PHE B CD2 1 
ATOM   3133 C CE1 . PHE B 1 113 ? 2.322   -6.694  -74.933  1.00 6.41  ? 133  PHE B CE1 1 
ATOM   3134 C CE2 . PHE B 1 113 ? 4.520   -7.322  -75.657  1.00 6.41  ? 133  PHE B CE2 1 
ATOM   3135 C CZ  . PHE B 1 113 ? 3.372   -7.596  -74.933  1.00 6.61  ? 133  PHE B CZ  1 
ATOM   3136 N N   . CYS B 1 114 ? 6.494   -2.476  -76.882  1.00 6.21  ? 134  CYS B N   1 
ATOM   3137 C CA  . CYS B 1 114 ? 7.925   -2.739  -76.787  1.00 6.02  ? 134  CYS B CA  1 
ATOM   3138 C C   . CYS B 1 114 ? 8.713   -1.559  -77.330  1.00 6.17  ? 134  CYS B C   1 
ATOM   3139 O O   . CYS B 1 114 ? 8.238   -0.844  -78.210  1.00 6.31  ? 134  CYS B O   1 
ATOM   3140 C CB  . CYS B 1 114 ? 8.280   -4.009  -77.567  1.00 6.40  ? 134  CYS B CB  1 
ATOM   3141 S SG  . CYS B 1 114 ? 7.626   -4.061  -79.251  1.00 7.42  ? 134  CYS B SG  1 
ATOM   3142 N N   . CYS B 1 115 ? 9.920   -1.361  -76.805  1.00 6.37  ? 135  CYS B N   1 
ATOM   3143 C CA  . CYS B 1 115 ? 10.739  -0.219  -77.194  1.00 6.69  ? 135  CYS B CA  1 
ATOM   3144 C C   . CYS B 1 115 ? 12.218  -0.428  -76.901  1.00 6.73  ? 135  CYS B C   1 
ATOM   3145 O O   . CYS B 1 115 ? 12.584  -1.218  -76.031  1.00 7.27  ? 135  CYS B O   1 
ATOM   3146 C CB  . CYS B 1 115 ? 10.243  1.046   -76.488  1.00 7.07  ? 135  CYS B CB  1 
ATOM   3147 S SG  . CYS B 1 115 ? 10.225  0.959   -74.680  1.00 8.11  ? 135  CYS B SG  1 
ATOM   3148 N N   . ASN B 1 116 ? 13.058  0.298   -77.634  1.00 6.97  ? 136  ASN B N   1 
ATOM   3149 C CA  . ASN B 1 116 ? 14.508  0.228   -77.482  1.00 7.08  ? 136  ASN B CA  1 
ATOM   3150 C C   . ASN B 1 116 ? 15.195  1.406   -78.161  1.00 7.25  ? 136  ASN B C   1 
ATOM   3151 O O   . ASN B 1 116 ? 14.724  1.887   -79.190  1.00 7.88  ? 136  ASN B O   1 
ATOM   3152 C CB  . ASN B 1 116 ? 15.047  -1.072  -78.091  1.00 7.45  ? 136  ASN B CB  1 
ATOM   3153 C CG  . ASN B 1 116 ? 15.310  -2.148  -77.054  1.00 7.64  ? 136  ASN B CG  1 
ATOM   3154 O OD1 . ASN B 1 116 ? 15.898  -1.880  -76.007  1.00 8.61  ? 136  ASN B OD1 1 
ATOM   3155 N ND2 . ASN B 1 116 ? 14.905  -3.379  -77.353  1.00 7.72  ? 136  ASN B ND2 1 
ATOM   3156 N N   . PHE B 1 117 ? 16.302  1.859   -77.574  1.00 7.54  ? 137  PHE B N   1 
ATOM   3157 C CA  . PHE B 1 117 ? 17.216  2.794   -78.228  1.00 7.32  ? 137  PHE B CA  1 
ATOM   3158 C C   . PHE B 1 117 ? 18.159  2.011   -79.139  1.00 7.74  ? 137  PHE B C   1 
ATOM   3159 O O   . PHE B 1 117 ? 18.410  0.824   -78.908  1.00 7.85  ? 137  PHE B O   1 
ATOM   3160 C CB  . PHE B 1 117 ? 18.081  3.526   -77.197  1.00 6.95  ? 137  PHE B CB  1 
ATOM   3161 C CG  . PHE B 1 117 ? 17.368  4.606   -76.432  1.00 6.75  ? 137  PHE B CG  1 
ATOM   3162 C CD1 . PHE B 1 117 ? 16.690  4.312   -75.258  1.00 6.86  ? 137  PHE B CD1 1 
ATOM   3163 C CD2 . PHE B 1 117 ? 17.424  5.930   -76.855  1.00 6.56  ? 137  PHE B CD2 1 
ATOM   3164 C CE1 . PHE B 1 117 ? 16.058  5.311   -74.535  1.00 6.69  ? 137  PHE B CE1 1 
ATOM   3165 C CE2 . PHE B 1 117 ? 16.798  6.933   -76.135  1.00 6.74  ? 137  PHE B CE2 1 
ATOM   3166 C CZ  . PHE B 1 117 ? 16.114  6.623   -74.975  1.00 6.56  ? 137  PHE B CZ  1 
ATOM   3167 N N   . ASN B 1 118 ? 18.695  2.676   -80.161  1.00 8.15  ? 138  ASN B N   1 
ATOM   3168 C CA  . ASN B 1 118 ? 19.839  2.133   -80.897  1.00 8.41  ? 138  ASN B CA  1 
ATOM   3169 C C   . ASN B 1 118 ? 21.118  2.443   -80.109  1.00 9.03  ? 138  ASN B C   1 
ATOM   3170 O O   . ASN B 1 118 ? 21.083  3.265   -79.187  1.00 8.91  ? 138  ASN B O   1 
ATOM   3171 C CB  . ASN B 1 118 ? 19.896  2.658   -82.346  1.00 8.86  ? 138  ASN B CB  1 
ATOM   3172 C CG  . ASN B 1 118 ? 20.144  4.153   -82.441  1.00 8.95  ? 138  ASN B CG  1 
ATOM   3173 O OD1 . ASN B 1 118 ? 19.915  4.900   -81.491  1.00 9.12  ? 138  ASN B OD1 1 
ATOM   3174 N ND2 . ASN B 1 118 ? 20.597  4.600   -83.609  1.00 9.33  ? 138  ASN B ND2 1 
ATOM   3175 N N   . PRO B 1 119 ? 22.238  1.774   -80.442  1.00 9.69  ? 139  PRO B N   1 
ATOM   3176 C CA  . PRO B 1 119 ? 23.500  1.998   -79.722  1.00 10.22 ? 139  PRO B CA  1 
ATOM   3177 C C   . PRO B 1 119 ? 23.956  3.457   -79.669  1.00 10.68 ? 139  PRO B C   1 
ATOM   3178 O O   . PRO B 1 119 ? 24.386  3.924   -78.614  1.00 12.24 ? 139  PRO B O   1 
ATOM   3179 C CB  . PRO B 1 119 ? 24.497  1.142   -80.503  1.00 10.88 ? 139  PRO B CB  1 
ATOM   3180 C CG  . PRO B 1 119 ? 23.671  0.014   -81.012  1.00 10.91 ? 139  PRO B CG  1 
ATOM   3181 C CD  . PRO B 1 119 ? 22.328  0.604   -81.337  1.00 10.26 ? 139  PRO B CD  1 
ATOM   3182 N N   . GLN B 1 120 ? 23.856  4.169   -80.789  1.00 10.90 ? 140  GLN B N   1 
ATOM   3183 C CA  . GLN B 1 120 ? 24.144  5.607   -80.818  1.00 10.93 ? 140  GLN B CA  1 
ATOM   3184 C C   . GLN B 1 120 ? 23.159  6.386   -79.938  1.00 10.93 ? 140  GLN B C   1 
ATOM   3185 O O   . GLN B 1 120 ? 23.493  7.453   -79.416  1.00 11.86 ? 140  GLN B O   1 
ATOM   3186 C CB  . GLN B 1 120 ? 24.090  6.127   -82.260  1.00 11.59 ? 140  GLN B CB  1 
ATOM   3187 C CG  . GLN B 1 120 ? 24.475  7.592   -82.426  1.00 13.44 ? 140  GLN B CG  1 
ATOM   3188 C CD  . GLN B 1 120 ? 24.396  8.064   -83.868  1.00 14.75 ? 140  GLN B CD  1 
ATOM   3189 O OE1 . GLN B 1 120 ? 24.326  7.259   -84.799  1.00 16.94 ? 140  GLN B OE1 1 
ATOM   3190 N NE2 . GLN B 1 120 ? 24.406  9.379   -84.059  1.00 15.93 ? 140  GLN B NE2 1 
ATOM   3191 N N   . SER B 1 121 ? 21.949  5.841   -79.796  1.00 10.42 ? 141  SER B N   1 
ATOM   3192 C CA  . SER B 1 121 ? 20.874  6.404   -78.969  1.00 10.32 ? 141  SER B CA  1 
ATOM   3193 C C   . SER B 1 121 ? 20.335  7.742   -79.488  1.00 10.40 ? 141  SER B C   1 
ATOM   3194 O O   . SER B 1 121 ? 19.789  8.546   -78.728  1.00 11.41 ? 141  SER B O   1 
ATOM   3195 C CB  . SER B 1 121 ? 21.283  6.469   -77.489  1.00 10.14 ? 141  SER B CB  1 
ATOM   3196 O OG  . SER B 1 121 ? 21.302  5.162   -76.937  1.00 10.32 ? 141  SER B OG  1 
ATOM   3197 N N   . ASN B 1 122 ? 20.470  7.954   -80.797  1.00 10.02 ? 142  ASN B N   1 
ATOM   3198 C CA  . ASN B 1 122 ? 19.780  9.041   -81.487  1.00 9.56  ? 142  ASN B CA  1 
ATOM   3199 C C   . ASN B 1 122 ? 18.406  8.593   -81.992  1.00 9.20  ? 142  ASN B C   1 
ATOM   3200 O O   . ASN B 1 122 ? 17.593  9.425   -82.396  1.00 9.56  ? 142  ASN B O   1 
ATOM   3201 C CB  . ASN B 1 122 ? 20.619  9.573   -82.658  1.00 10.06 ? 142  ASN B CB  1 
ATOM   3202 C CG  . ASN B 1 122 ? 20.832  8.537   -83.750  1.00 10.62 ? 142  ASN B CG  1 
ATOM   3203 O OD1 . ASN B 1 122 ? 21.108  7.373   -83.466  1.00 10.70 ? 142  ASN B OD1 1 
ATOM   3204 N ND2 . ASN B 1 122 ? 20.714  8.958   -85.007  1.00 12.00 ? 142  ASN B ND2 1 
ATOM   3205 N N   . LEU B 1 123 ? 18.157  7.281   -81.969  1.00 8.38  ? 143  LEU B N   1 
ATOM   3206 C CA  . LEU B 1 123 ? 16.884  6.718   -82.416  1.00 8.23  ? 143  LEU B CA  1 
ATOM   3207 C C   . LEU B 1 123 ? 16.231  5.848   -81.354  1.00 7.71  ? 143  LEU B C   1 
ATOM   3208 O O   . LEU B 1 123 ? 16.906  5.252   -80.513  1.00 7.86  ? 143  LEU B O   1 
ATOM   3209 C CB  . LEU B 1 123 ? 17.082  5.854   -83.662  1.00 8.58  ? 143  LEU B CB  1 
ATOM   3210 C CG  . LEU B 1 123 ? 17.673  6.507   -84.909  1.00 9.11  ? 143  LEU B CG  1 
ATOM   3211 C CD1 . LEU B 1 123 ? 17.870  5.453   -85.989  1.00 9.66  ? 143  LEU B CD1 1 
ATOM   3212 C CD2 . LEU B 1 123 ? 16.784  7.636   -85.408  1.00 9.45  ? 143  LEU B CD2 1 
ATOM   3213 N N   . ILE B 1 124 ? 14.906  5.778   -81.420  1.00 7.18  ? 144  ILE B N   1 
ATOM   3214 C CA  . ILE B 1 124 ? 14.134  4.804   -80.662  1.00 7.39  ? 144  ILE B CA  1 
ATOM   3215 C C   . ILE B 1 124 ? 13.311  4.003   -81.662  1.00 7.25  ? 144  ILE B C   1 
ATOM   3216 O O   . ILE B 1 124 ? 12.812  4.552   -82.644  1.00 7.57  ? 144  ILE B O   1 
ATOM   3217 C CB  . ILE B 1 124 ? 13.210  5.485   -79.627  1.00 7.40  ? 144  ILE B CB  1 
ATOM   3218 C CG1 . ILE B 1 124 ? 14.034  6.022   -78.454  1.00 7.71  ? 144  ILE B CG1 1 
ATOM   3219 C CG2 . ILE B 1 124 ? 12.156  4.514   -79.101  1.00 7.45  ? 144  ILE B CG2 1 
ATOM   3220 C CD1 . ILE B 1 124 ? 13.354  7.139   -77.692  1.00 7.97  ? 144  ILE B CD1 1 
ATOM   3221 N N   . VAL B 1 125 ? 13.198  2.701   -81.417  1.00 6.89  ? 145  VAL B N   1 
ATOM   3222 C CA  . VAL B 1 125 ? 12.283  1.850   -82.171  1.00 6.85  ? 145  VAL B CA  1 
ATOM   3223 C C   . VAL B 1 125 ? 11.167  1.403   -81.229  1.00 6.59  ? 145  VAL B C   1 
ATOM   3224 O O   . VAL B 1 125 ? 11.409  1.171   -80.041  1.00 6.57  ? 145  VAL B O   1 
ATOM   3225 C CB  . VAL B 1 125 ? 13.002  0.641   -82.821  1.00 6.88  ? 145  VAL B CB  1 
ATOM   3226 C CG1 . VAL B 1 125 ? 13.598  -0.303  -81.776  1.00 7.09  ? 145  VAL B CG1 1 
ATOM   3227 C CG2 . VAL B 1 125 ? 12.055  -0.098  -83.757  1.00 7.08  ? 145  VAL B CG2 1 
ATOM   3228 N N   . SER B 1 126 ? 9.949   1.307   -81.756  1.00 6.50  ? 146  SER B N   1 
ATOM   3229 C CA  . SER B 1 126 ? 8.799   0.868   -80.973  1.00 6.53  ? 146  SER B CA  1 
ATOM   3230 C C   . SER B 1 126 ? 7.951   -0.118  -81.761  1.00 6.45  ? 146  SER B C   1 
ATOM   3231 O O   . SER B 1 126 ? 7.937   -0.091  -82.991  1.00 6.58  ? 146  SER B O   1 
ATOM   3232 C CB  . SER B 1 126 ? 7.948   2.070   -80.561  1.00 6.65  ? 146  SER B CB  1 
ATOM   3233 O OG  . SER B 1 126 ? 7.416   2.736   -81.695  1.00 6.75  ? 146  SER B OG  1 
ATOM   3234 N N   . GLY B 1 127 ? 7.251   -0.988  -81.038  1.00 6.53  ? 147  GLY B N   1 
ATOM   3235 C CA  . GLY B 1 127 ? 6.269   -1.891  -81.629  1.00 6.67  ? 147  GLY B CA  1 
ATOM   3236 C C   . GLY B 1 127 ? 4.955   -1.742  -80.894  1.00 6.84  ? 147  GLY B C   1 
ATOM   3237 O O   . GLY B 1 127 ? 4.934   -1.454  -79.693  1.00 6.81  ? 147  GLY B O   1 
ATOM   3238 N N   . SER B 1 128 ? 3.857   -1.945  -81.612  1.00 7.20  ? 148  SER B N   1 
ATOM   3239 C CA  . SER B 1 128 ? 2.532   -1.645  -81.084  1.00 7.84  ? 148  SER B CA  1 
ATOM   3240 C C   . SER B 1 128 ? 1.484   -2.675  -81.491  1.00 8.00  ? 148  SER B C   1 
ATOM   3241 O O   . SER B 1 128 ? 1.672   -3.444  -82.442  1.00 8.26  ? 148  SER B O   1 
ATOM   3242 C CB  . SER B 1 128 ? 2.115   -0.248  -81.559  1.00 7.95  ? 148  SER B CB  1 
ATOM   3243 O OG  . SER B 1 128 ? 0.739   0.012   -81.346  1.00 8.52  ? 148  SER B OG  1 
ATOM   3244 N N   . PHE B 1 129 ? 0.372   -2.666  -80.760  1.00 8.42  ? 149  PHE B N   1 
ATOM   3245 C CA  . PHE B 1 129 ? -0.804  -3.458  -81.116  1.00 8.52  ? 149  PHE B CA  1 
ATOM   3246 C C   . PHE B 1 129 ? -1.421  -2.999  -82.439  1.00 8.63  ? 149  PHE B C   1 
ATOM   3247 O O   . PHE B 1 129 ? -2.192  -3.739  -83.043  1.00 8.93  ? 149  PHE B O   1 
ATOM   3248 C CB  . PHE B 1 129 ? -1.859  -3.421  -79.996  1.00 9.11  ? 149  PHE B CB  1 
ATOM   3249 C CG  . PHE B 1 129 ? -1.815  -4.616  -79.081  1.00 9.83  ? 149  PHE B CG  1 
ATOM   3250 C CD1 . PHE B 1 129 ? -0.641  -4.968  -78.426  1.00 10.07 ? 149  PHE B CD1 1 
ATOM   3251 C CD2 . PHE B 1 129 ? -2.953  -5.387  -78.870  1.00 10.45 ? 149  PHE B CD2 1 
ATOM   3252 C CE1 . PHE B 1 129 ? -0.600  -6.071  -77.586  1.00 10.63 ? 149  PHE B CE1 1 
ATOM   3253 C CE2 . PHE B 1 129 ? -2.919  -6.489  -78.032  1.00 11.22 ? 149  PHE B CE2 1 
ATOM   3254 C CZ  . PHE B 1 129 ? -1.741  -6.831  -77.389  1.00 10.95 ? 149  PHE B CZ  1 
ATOM   3255 N N   . ASP B 1 130 ? -1.076  -1.794  -82.897  1.00 8.41  ? 150  ASP B N   1 
ATOM   3256 C CA  . ASP B 1 130 ? -1.503  -1.335  -84.224  1.00 8.56  ? 150  ASP B CA  1 
ATOM   3257 C C   . ASP B 1 130 ? -0.741  -2.018  -85.371  1.00 8.98  ? 150  ASP B C   1 
ATOM   3258 O O   . ASP B 1 130 ? -0.951  -1.682  -86.537  1.00 9.86  ? 150  ASP B O   1 
ATOM   3259 C CB  . ASP B 1 130 ? -1.427  0.197   -84.339  1.00 8.75  ? 150  ASP B CB  1 
ATOM   3260 C CG  . ASP B 1 130 ? 0.000   0.732   -84.385  1.00 8.90  ? 150  ASP B CG  1 
ATOM   3261 O OD1 . ASP B 1 130 ? 0.952   -0.046  -84.598  1.00 9.38  ? 150  ASP B OD1 1 
ATOM   3262 O OD2 . ASP B 1 130 ? 0.166   1.958   -84.218  1.00 9.59  ? 150  ASP B OD2 1 
ATOM   3263 N N   . GLU B 1 131 ? 0.145   -2.959  -85.028  1.00 9.01  ? 151  GLU B N   1 
ATOM   3264 C CA  . GLU B 1 131 ? 0.803   -3.858  -85.985  1.00 8.94  ? 151  GLU B CA  1 
ATOM   3265 C C   . GLU B 1 131 ? 1.961   -3.200  -86.741  1.00 8.75  ? 151  GLU B C   1 
ATOM   3266 O O   . GLU B 1 131 ? 2.522   -3.800  -87.662  1.00 8.74  ? 151  GLU B O   1 
ATOM   3267 C CB  . GLU B 1 131 ? -0.216  -4.475  -86.962  1.00 9.53  ? 151  GLU B CB  1 
ATOM   3268 C CG  . GLU B 1 131 ? -1.478  -4.982  -86.272  1.00 10.46 ? 151  GLU B CG  1 
ATOM   3269 C CD  . GLU B 1 131 ? -2.437  -5.705  -87.191  1.00 11.44 ? 151  GLU B CD  1 
ATOM   3270 O OE1 . GLU B 1 131 ? -2.214  -5.721  -88.419  1.00 12.45 ? 151  GLU B OE1 1 
ATOM   3271 O OE2 . GLU B 1 131 ? -3.431  -6.251  -86.670  1.00 12.57 ? 151  GLU B OE2 1 
ATOM   3272 N N   . SER B 1 132 ? 2.338   -1.991  -86.330  1.00 8.34  ? 152  SER B N   1 
ATOM   3273 C CA  . SER B 1 132 ? 3.419   -1.253  -86.975  1.00 8.76  ? 152  SER B CA  1 
ATOM   3274 C C   . SER B 1 132 ? 4.663   -1.210  -86.097  1.00 8.41  ? 152  SER B C   1 
ATOM   3275 O O   . SER B 1 132 ? 4.593   -1.415  -84.877  1.00 8.49  ? 152  SER B O   1 
ATOM   3276 C CB  . SER B 1 132 ? 2.980   0.180   -87.292  1.00 8.88  ? 152  SER B CB  1 
ATOM   3277 O OG  . SER B 1 132 ? 2.961   0.987   -86.124  1.00 10.28 ? 152  SER B OG  1 
ATOM   3278 N N   . VAL B 1 133 ? 5.799   -0.967  -86.743  1.00 7.98  ? 153  VAL B N   1 
ATOM   3279 C CA  . VAL B 1 133 ? 7.039   -0.609  -86.069  1.00 7.92  ? 153  VAL B CA  1 
ATOM   3280 C C   . VAL B 1 133 ? 7.327   0.839   -86.441  1.00 8.24  ? 153  VAL B C   1 
ATOM   3281 O O   . VAL B 1 133 ? 7.234   1.208   -87.613  1.00 8.54  ? 153  VAL B O   1 
ATOM   3282 C CB  . VAL B 1 133 ? 8.212   -1.507  -86.518  1.00 7.69  ? 153  VAL B CB  1 
ATOM   3283 C CG1 . VAL B 1 133 ? 9.552   -0.959  -86.030  1.00 8.00  ? 153  VAL B CG1 1 
ATOM   3284 C CG2 . VAL B 1 133 ? 8.007   -2.930  -86.019  1.00 7.96  ? 153  VAL B CG2 1 
ATOM   3285 N N   . ARG B 1 134 ? 7.659   1.661   -85.450  1.00 8.23  ? 154  ARG B N   1 
ATOM   3286 C CA  . ARG B 1 134 ? 8.003   3.057   -85.707  1.00 8.22  ? 154  ARG B CA  1 
ATOM   3287 C C   . ARG B 1 134 ? 9.425   3.349   -85.263  1.00 8.06  ? 154  ARG B C   1 
ATOM   3288 O O   . ARG B 1 134 ? 9.914   2.762   -84.298  1.00 7.96  ? 154  ARG B O   1 
ATOM   3289 C CB  . ARG B 1 134 ? 7.012   3.999   -85.020  1.00 8.66  ? 154  ARG B CB  1 
ATOM   3290 C CG  . ARG B 1 134 ? 5.677   4.080   -85.743  1.00 9.35  ? 154  ARG B CG  1 
ATOM   3291 C CD  . ARG B 1 134 ? 4.684   4.992   -85.037  1.00 10.75 ? 154  ARG B CD  1 
ATOM   3292 N NE  . ARG B 1 134 ? 3.430   5.103   -85.786  1.00 12.44 ? 154  ARG B NE  1 
ATOM   3293 C CZ  . ARG B 1 134 ? 3.066   6.137   -86.546  1.00 12.54 ? 154  ARG B CZ  1 
ATOM   3294 N NH1 . ARG B 1 134 ? 3.843   7.210   -86.682  1.00 13.87 ? 154  ARG B NH1 1 
ATOM   3295 N NH2 . ARG B 1 134 ? 1.897   6.099   -87.179  1.00 13.36 ? 154  ARG B NH2 1 
ATOM   3296 N N   . ILE B 1 135 ? 10.077  4.248   -85.994  1.00 8.25  ? 155  ILE B N   1 
ATOM   3297 C CA  . ILE B 1 135 ? 11.423  4.705   -85.675  1.00 8.47  ? 155  ILE B CA  1 
ATOM   3298 C C   . ILE B 1 135 ? 11.332  6.200   -85.381  1.00 8.77  ? 155  ILE B C   1 
ATOM   3299 O O   . ILE B 1 135 ? 10.822  6.969   -86.202  1.00 9.22  ? 155  ILE B O   1 
ATOM   3300 C CB  . ILE B 1 135 ? 12.404  4.443   -86.839  1.00 8.52  ? 155  ILE B CB  1 
ATOM   3301 C CG1 . ILE B 1 135 ? 12.421  2.949   -87.193  1.00 9.11  ? 155  ILE B CG1 1 
ATOM   3302 C CG2 . ILE B 1 135 ? 13.809  4.924   -86.483  1.00 8.93  ? 155  ILE B CG2 1 
ATOM   3303 C CD1 . ILE B 1 135 ? 13.127  2.628   -88.494  1.00 9.70  ? 155  ILE B CD1 1 
ATOM   3304 N N   . TRP B 1 136 ? 11.833  6.600   -84.214  1.00 8.65  ? 156  TRP B N   1 
ATOM   3305 C CA  . TRP B 1 136 ? 11.657  7.957   -83.702  1.00 8.83  ? 156  TRP B CA  1 
ATOM   3306 C C   . TRP B 1 136 ? 12.988  8.676   -83.521  1.00 9.06  ? 156  TRP B C   1 
ATOM   3307 O O   . TRP B 1 136 ? 13.993  8.057   -83.177  1.00 8.61  ? 156  TRP B O   1 
ATOM   3308 C CB  . TRP B 1 136 ? 10.955  7.925   -82.342  1.00 8.40  ? 156  TRP B CB  1 
ATOM   3309 C CG  . TRP B 1 136 ? 9.690   7.118   -82.286  1.00 8.01  ? 156  TRP B CG  1 
ATOM   3310 C CD1 . TRP B 1 136 ? 9.584   5.764   -82.115  1.00 8.23  ? 156  TRP B CD1 1 
ATOM   3311 C CD2 . TRP B 1 136 ? 8.352   7.617   -82.370  1.00 7.87  ? 156  TRP B CD2 1 
ATOM   3312 N NE1 . TRP B 1 136 ? 8.263   5.392   -82.098  1.00 7.96  ? 156  TRP B NE1 1 
ATOM   3313 C CE2 . TRP B 1 136 ? 7.485   6.510   -82.254  1.00 7.83  ? 156  TRP B CE2 1 
ATOM   3314 C CE3 . TRP B 1 136 ? 7.800   8.893   -82.541  1.00 7.42  ? 156  TRP B CE3 1 
ATOM   3315 C CZ2 . TRP B 1 136 ? 6.096   6.640   -82.300  1.00 7.72  ? 156  TRP B CZ2 1 
ATOM   3316 C CZ3 . TRP B 1 136 ? 6.418   9.021   -82.584  1.00 7.48  ? 156  TRP B CZ3 1 
ATOM   3317 C CH2 . TRP B 1 136 ? 5.584   7.900   -82.466  1.00 7.82  ? 156  TRP B CH2 1 
ATOM   3318 N N   . ASP B 1 137 ? 12.974  9.990   -83.736  1.00 9.58  ? 157  ASP B N   1 
ATOM   3319 C CA  . ASP B 1 137 ? 14.122  10.853  -83.465  1.00 10.80 ? 157  ASP B CA  1 
ATOM   3320 C C   . ASP B 1 137 ? 14.105  11.212  -81.978  1.00 10.86 ? 157  ASP B C   1 
ATOM   3321 O O   . ASP B 1 137 ? 13.174  11.861  -81.506  1.00 10.84 ? 157  ASP B O   1 
ATOM   3322 C CB  . ASP B 1 137 ? 14.022  12.110  -84.339  1.00 11.90 ? 157  ASP B CB  1 
ATOM   3323 C CG  . ASP B 1 137 ? 15.279  12.969  -84.312  1.00 13.83 ? 157  ASP B CG  1 
ATOM   3324 O OD1 . ASP B 1 137 ? 15.949  13.066  -83.262  1.00 15.45 ? 157  ASP B OD1 1 
ATOM   3325 O OD2 . ASP B 1 137 ? 15.582  13.576  -85.362  1.00 15.30 ? 157  ASP B OD2 1 
ATOM   3326 N N   . VAL B 1 138 ? 15.131  10.780  -81.248  1.00 10.55 ? 158  VAL B N   1 
ATOM   3327 C CA  . VAL B 1 138 ? 15.217  10.998  -79.798  1.00 11.45 ? 158  VAL B CA  1 
ATOM   3328 C C   . VAL B 1 138 ? 15.209  12.486  -79.434  1.00 12.05 ? 158  VAL B C   1 
ATOM   3329 O O   . VAL B 1 138 ? 14.558  12.894  -78.472  1.00 12.39 ? 158  VAL B O   1 
ATOM   3330 C CB  . VAL B 1 138 ? 16.482  10.324  -79.210  1.00 11.08 ? 158  VAL B CB  1 
ATOM   3331 C CG1 . VAL B 1 138 ? 16.763  10.790  -77.784  1.00 11.68 ? 158  VAL B CG1 1 
ATOM   3332 C CG2 . VAL B 1 138 ? 16.332  8.809   -79.244  1.00 11.35 ? 158  VAL B CG2 1 
ATOM   3333 N N   . LYS B 1 139 ? 15.930  13.287  -80.213  1.00 13.01 ? 159  LYS B N   1 
ATOM   3334 C CA  . LYS B 1 139 ? 16.125  14.704  -79.903  1.00 13.78 ? 159  LYS B CA  1 
ATOM   3335 C C   . LYS B 1 139 ? 14.894  15.574  -80.189  1.00 13.60 ? 159  LYS B C   1 
ATOM   3336 O O   . LYS B 1 139 ? 14.618  16.515  -79.442  1.00 15.00 ? 159  LYS B O   1 
ATOM   3337 C CB  . LYS B 1 139 ? 17.352  15.229  -80.658  1.00 15.51 ? 159  LYS B CB  1 
ATOM   3338 C CG  . LYS B 1 139 ? 18.648  14.573  -80.198  1.00 17.69 ? 159  LYS B CG  1 
ATOM   3339 C CD  . LYS B 1 139 ? 19.757  14.647  -81.235  1.00 20.28 ? 159  LYS B CD  1 
ATOM   3340 C CE  . LYS B 1 139 ? 21.075  14.160  -80.643  1.00 22.46 ? 159  LYS B CE  1 
ATOM   3341 N NZ  . LYS B 1 139 ? 22.157  13.917  -81.640  1.00 24.20 ? 159  LYS B NZ  1 
ATOM   3342 N N   . THR B 1 140 ? 14.162  15.263  -81.257  1.00 13.03 ? 160  THR B N   1 
ATOM   3343 C CA  . THR B 1 140 ? 12.961  16.025  -81.630  1.00 13.18 ? 160  THR B CA  1 
ATOM   3344 C C   . THR B 1 140 ? 11.653  15.363  -81.190  1.00 12.60 ? 160  THR B C   1 
ATOM   3345 O O   . THR B 1 140 ? 10.619  16.028  -81.100  1.00 13.03 ? 160  THR B O   1 
ATOM   3346 C CB  . THR B 1 140 ? 12.884  16.252  -83.155  1.00 13.48 ? 160  THR B CB  1 
ATOM   3347 O OG1 . THR B 1 140 ? 12.681  15.001  -83.824  1.00 12.75 ? 160  THR B OG1 1 
ATOM   3348 C CG2 . THR B 1 140 ? 14.159  16.908  -83.675  1.00 13.99 ? 160  THR B CG2 1 
ATOM   3349 N N   . GLY B 1 141 ? 11.692  14.054  -80.945  1.00 12.19 ? 161  GLY B N   1 
ATOM   3350 C CA  . GLY B 1 141 ? 10.488  13.285  -80.636  1.00 12.16 ? 161  GLY B CA  1 
ATOM   3351 C C   . GLY B 1 141 ? 9.597   12.995  -81.838  1.00 12.50 ? 161  GLY B C   1 
ATOM   3352 O O   . GLY B 1 141 ? 8.488   12.482  -81.676  1.00 12.60 ? 161  GLY B O   1 
ATOM   3353 N N   . LYS B 1 142 ? 10.076  13.310  -83.041  1.00 13.03 ? 162  LYS B N   1 
ATOM   3354 C CA  . LYS B 1 142 ? 9.309   13.101  -84.267  1.00 13.12 ? 162  LYS B CA  1 
ATOM   3355 C C   . LYS B 1 142 ? 9.423   11.658  -84.735  1.00 11.58 ? 162  LYS B C   1 
ATOM   3356 O O   . LYS B 1 142 ? 10.467  11.026  -84.571  1.00 10.89 ? 162  LYS B O   1 
ATOM   3357 C CB  . LYS B 1 142 ? 9.824   14.011  -85.385  1.00 13.65 ? 162  LYS B CB  1 
ATOM   3358 C CG  . LYS B 1 142 ? 9.702   15.500  -85.106  1.00 16.06 ? 162  LYS B CG  1 
ATOM   3359 C CD  . LYS B 1 142 ? 8.253   15.953  -85.116  1.00 18.07 ? 162  LYS B CD  1 
ATOM   3360 C CE  . LYS B 1 142 ? 8.143   17.469  -85.122  1.00 20.03 ? 162  LYS B CE  1 
ATOM   3361 N NZ  . LYS B 1 142 ? 6.732   17.923  -85.267  1.00 22.60 ? 162  LYS B NZ  1 
ATOM   3362 N N   . CYS B 1 143 ? 8.350   11.146  -85.332  1.00 11.03 ? 163  CYS B N   1 
ATOM   3363 C CA  . CYS B 1 143 ? 8.396   9.845   -85.990  1.00 11.13 ? 163  CYS B CA  1 
ATOM   3364 C C   . CYS B 1 143 ? 9.088   10.006  -87.340  1.00 11.60 ? 163  CYS B C   1 
ATOM   3365 O O   . CYS B 1 143 ? 8.662   10.817  -88.163  1.00 12.63 ? 163  CYS B O   1 
ATOM   3366 C CB  . CYS B 1 143 ? 6.991   9.284   -86.193  1.00 10.89 ? 163  CYS B CB  1 
ATOM   3367 S SG  . CYS B 1 143 ? 6.988   7.575   -86.780  1.00 12.96 ? 163  CYS B SG  1 
ATOM   3368 N N   . LEU B 1 144 ? 10.157  9.243   -87.557  1.00 11.37 ? 164  LEU B N   1 
ATOM   3369 C CA  . LEU B 1 144 ? 10.910  9.302   -88.810  1.00 10.94 ? 164  LEU B CA  1 
ATOM   3370 C C   . LEU B 1 144 ? 10.365  8.328   -89.848  1.00 10.99 ? 164  LEU B C   1 
ATOM   3371 O O   . LEU B 1 144 ? 10.257  8.671   -91.026  1.00 11.70 ? 164  LEU B O   1 
ATOM   3372 C CB  . LEU B 1 144 ? 12.393  9.023   -88.561  1.00 10.98 ? 164  LEU B CB  1 
ATOM   3373 C CG  . LEU B 1 144 ? 13.102  10.003  -87.623  1.00 11.34 ? 164  LEU B CG  1 
ATOM   3374 C CD1 . LEU B 1 144 ? 14.523  9.538   -87.351  1.00 11.63 ? 164  LEU B CD1 1 
ATOM   3375 C CD2 . LEU B 1 144 ? 13.103  11.416  -88.192  1.00 11.82 ? 164  LEU B CD2 1 
ATOM   3376 N N   . LYS B 1 145 ? 10.037  7.112   -89.413  1.00 11.18 ? 165  LYS B N   1 
ATOM   3377 C CA  . LYS B 1 145 ? 9.474   6.097   -90.303  1.00 10.80 ? 165  LYS B CA  1 
ATOM   3378 C C   . LYS B 1 145 ? 8.410   5.270   -89.594  1.00 10.50 ? 165  LYS B C   1 
ATOM   3379 O O   . LYS B 1 145 ? 8.493   5.041   -88.389  1.00 11.26 ? 165  LYS B O   1 
ATOM   3380 C CB  . LYS B 1 145 ? 10.572  5.166   -90.822  1.00 11.60 ? 165  LYS B CB  1 
ATOM   3381 C CG  . LYS B 1 145 ? 11.505  5.808   -91.831  1.00 12.09 ? 165  LYS B CG  1 
ATOM   3382 C CD  . LYS B 1 145 ? 12.476  4.795   -92.412  1.00 12.97 ? 165  LYS B CD  1 
ATOM   3383 C CE  . LYS B 1 145 ? 13.340  5.413   -93.499  1.00 14.42 ? 165  LYS B CE  1 
ATOM   3384 N NZ  . LYS B 1 145 ? 14.304  6.416   -92.966  1.00 15.10 ? 165  LYS B NZ  1 
ATOM   3385 N N   . THR B 1 146 ? 7.408   4.843   -90.356  1.00 10.52 ? 166  THR B N   1 
ATOM   3386 C CA  . THR B 1 146 ? 6.422   3.874   -89.899  1.00 10.10 ? 166  THR B CA  1 
ATOM   3387 C C   . THR B 1 146 ? 6.482   2.677   -90.834  1.00 10.44 ? 166  THR B C   1 
ATOM   3388 O O   . THR B 1 146 ? 6.213   2.801   -92.031  1.00 11.44 ? 166  THR B O   1 
ATOM   3389 C CB  . THR B 1 146 ? 4.996   4.456   -89.909  1.00 10.68 ? 166  THR B CB  1 
ATOM   3390 O OG1 . THR B 1 146 ? 4.958   5.645   -89.114  1.00 11.07 ? 166  THR B OG1 1 
ATOM   3391 C CG2 . THR B 1 146 ? 3.989   3.449   -89.355  1.00 10.64 ? 166  THR B CG2 1 
ATOM   3392 N N   . LEU B 1 147 ? 6.834   1.520   -90.285  1.00 10.10 ? 167  LEU B N   1 
ATOM   3393 C CA  . LEU B 1 147 ? 6.964   0.304   -91.073  1.00 10.00 ? 167  LEU B CA  1 
ATOM   3394 C C   . LEU B 1 147 ? 5.682   -0.515  -90.947  1.00 10.06 ? 167  LEU B C   1 
ATOM   3395 O O   . LEU B 1 147 ? 5.208   -0.742  -89.836  1.00 10.30 ? 167  LEU B O   1 
ATOM   3396 C CB  . LEU B 1 147 ? 8.165   -0.518  -90.592  1.00 10.22 ? 167  LEU B CB  1 
ATOM   3397 C CG  . LEU B 1 147 ? 9.462   0.240   -90.277  1.00 10.96 ? 167  LEU B CG  1 
ATOM   3398 C CD1 . LEU B 1 147 ? 10.573  -0.730  -89.903  1.00 11.32 ? 167  LEU B CD1 1 
ATOM   3399 C CD2 . LEU B 1 147 ? 9.892   1.120   -91.441  1.00 11.23 ? 167  LEU B CD2 1 
ATOM   3400 N N   . PRO B 1 148 ? 5.109   -0.958  -92.083  1.00 10.49 ? 168  PRO B N   1 
ATOM   3401 C CA  . PRO B 1 148 ? 3.942   -1.835  -92.046  1.00 10.27 ? 168  PRO B CA  1 
ATOM   3402 C C   . PRO B 1 148 ? 4.400   -3.256  -91.742  1.00 9.86  ? 168  PRO B C   1 
ATOM   3403 O O   . PRO B 1 148 ? 4.281   -4.157  -92.575  1.00 10.25 ? 168  PRO B O   1 
ATOM   3404 C CB  . PRO B 1 148 ? 3.380   -1.713  -93.461  1.00 10.70 ? 168  PRO B CB  1 
ATOM   3405 C CG  . PRO B 1 148 ? 4.590   -1.504  -94.305  1.00 11.28 ? 168  PRO B CG  1 
ATOM   3406 C CD  . PRO B 1 148 ? 5.551   -0.702  -93.467  1.00 11.08 ? 168  PRO B CD  1 
ATOM   3407 N N   . ALA B 1 149 ? 4.912   -3.440  -90.530  1.00 9.61  ? 169  ALA B N   1 
ATOM   3408 C CA  . ALA B 1 149 ? 5.810   -4.550  -90.230  1.00 9.29  ? 169  ALA B CA  1 
ATOM   3409 C C   . ALA B 1 149 ? 5.134   -5.913  -90.185  1.00 8.78  ? 169  ALA B C   1 
ATOM   3410 O O   . ALA B 1 149 ? 5.716   -6.909  -90.620  1.00 9.14  ? 169  ALA B O   1 
ATOM   3411 C CB  . ALA B 1 149 ? 6.544   -4.286  -88.920  1.00 9.02  ? 169  ALA B CB  1 
ATOM   3412 N N   . HIS B 1 150 ? 3.915   -5.953  -89.657  1.00 8.50  ? 170  HIS B N   1 
ATOM   3413 C CA  . HIS B 1 150 ? 3.253   -7.218  -89.356  1.00 8.72  ? 170  HIS B CA  1 
ATOM   3414 C C   . HIS B 1 150 ? 1.742   -7.135  -89.550  1.00 9.09  ? 170  HIS B C   1 
ATOM   3415 O O   . HIS B 1 150 ? 1.201   -6.061  -89.810  1.00 10.29 ? 170  HIS B O   1 
ATOM   3416 C CB  . HIS B 1 150 ? 3.593   -7.629  -87.922  1.00 8.72  ? 170  HIS B CB  1 
ATOM   3417 C CG  . HIS B 1 150 ? 5.024   -8.023  -87.739  1.00 8.34  ? 170  HIS B CG  1 
ATOM   3418 N ND1 . HIS B 1 150 ? 5.529   -9.219  -88.199  1.00 8.53  ? 170  HIS B ND1 1 
ATOM   3419 C CD2 . HIS B 1 150 ? 6.060   -7.381  -87.147  1.00 8.12  ? 170  HIS B CD2 1 
ATOM   3420 C CE1 . HIS B 1 150 ? 6.813   -9.297  -87.903  1.00 8.64  ? 170  HIS B CE1 1 
ATOM   3421 N NE2 . HIS B 1 150 ? 7.161   -8.194  -87.265  1.00 8.57  ? 170  HIS B NE2 1 
ATOM   3422 N N   . SER B 1 151 ? 1.075   -8.284  -89.439  1.00 9.47  ? 171  SER B N   1 
ATOM   3423 C CA  . SER B 1 151 ? -0.384  -8.363  -89.564  1.00 9.83  ? 171  SER B CA  1 
ATOM   3424 C C   . SER B 1 151 ? -1.057  -8.712  -88.231  1.00 10.31 ? 171  SER B C   1 
ATOM   3425 O O   . SER B 1 151 ? -2.202  -9.168  -88.201  1.00 10.87 ? 171  SER B O   1 
ATOM   3426 C CB  . SER B 1 151 ? -0.765  -9.387  -90.638  1.00 10.47 ? 171  SER B CB  1 
ATOM   3427 O OG  . SER B 1 151 ? -0.310  -10.685 -90.302  1.00 10.11 ? 171  SER B OG  1 
ATOM   3428 N N   . ASP B 1 152 ? -0.336  -8.476  -87.136  1.00 10.25 ? 172  ASP B N   1 
ATOM   3429 C CA  . ASP B 1 152 ? -0.814  -8.735  -85.778  1.00 10.28 ? 172  ASP B CA  1 
ATOM   3430 C C   . ASP B 1 152 ? 0.065   -7.910  -84.833  1.00 9.69  ? 172  ASP B C   1 
ATOM   3431 O O   . ASP B 1 152 ? 1.054   -7.325  -85.278  1.00 9.57  ? 172  ASP B O   1 
ATOM   3432 C CB  . ASP B 1 152 ? -0.722  -10.231 -85.450  1.00 11.46 ? 172  ASP B CB  1 
ATOM   3433 C CG  . ASP B 1 152 ? -1.986  -10.997 -85.813  1.00 12.96 ? 172  ASP B CG  1 
ATOM   3434 O OD1 . ASP B 1 152 ? -3.097  -10.528 -85.481  1.00 13.91 ? 172  ASP B OD1 1 
ATOM   3435 O OD2 . ASP B 1 152 ? -1.864  -12.083 -86.421  1.00 15.04 ? 172  ASP B OD2 1 
ATOM   3436 N N   . PRO B 1 153 ? -0.284  -7.853  -83.533  1.00 9.41  ? 173  PRO B N   1 
ATOM   3437 C CA  . PRO B 1 153 ? 0.522   -7.066  -82.596  1.00 8.65  ? 173  PRO B CA  1 
ATOM   3438 C C   . PRO B 1 153 ? 2.024   -7.374  -82.640  1.00 8.30  ? 173  PRO B C   1 
ATOM   3439 O O   . PRO B 1 153 ? 2.424   -8.535  -82.789  1.00 7.94  ? 173  PRO B O   1 
ATOM   3440 C CB  . PRO B 1 153 ? -0.074  -7.439  -81.239  1.00 8.76  ? 173  PRO B CB  1 
ATOM   3441 C CG  . PRO B 1 153 ? -1.505  -7.714  -81.541  1.00 9.28  ? 173  PRO B CG  1 
ATOM   3442 C CD  . PRO B 1 153 ? -1.495  -8.390  -82.884  1.00 9.56  ? 173  PRO B CD  1 
ATOM   3443 N N   . VAL B 1 154 ? 2.835   -6.324  -82.529  1.00 7.68  ? 174  VAL B N   1 
ATOM   3444 C CA  . VAL B 1 154 ? 4.289   -6.438  -82.542  1.00 7.43  ? 174  VAL B CA  1 
ATOM   3445 C C   . VAL B 1 154 ? 4.767   -6.624  -81.106  1.00 7.38  ? 174  VAL B C   1 
ATOM   3446 O O   . VAL B 1 154 ? 4.634   -5.720  -80.280  1.00 7.76  ? 174  VAL B O   1 
ATOM   3447 C CB  . VAL B 1 154 ? 4.940   -5.187  -83.167  1.00 7.53  ? 174  VAL B CB  1 
ATOM   3448 C CG1 . VAL B 1 154 ? 6.454   -5.314  -83.201  1.00 7.70  ? 174  VAL B CG1 1 
ATOM   3449 C CG2 . VAL B 1 154 ? 4.403   -4.963  -84.574  1.00 7.70  ? 174  VAL B CG2 1 
ATOM   3450 N N   . SER B 1 155 ? 5.312   -7.801  -80.816  1.00 7.54  ? 175  SER B N   1 
ATOM   3451 C CA  . SER B 1 155 ? 5.669   -8.180  -79.448  1.00 7.13  ? 175  SER B CA  1 
ATOM   3452 C C   . SER B 1 155 ? 7.052   -7.709  -78.988  1.00 7.02  ? 175  SER B C   1 
ATOM   3453 O O   . SER B 1 155 ? 7.282   -7.570  -77.787  1.00 7.46  ? 175  SER B O   1 
ATOM   3454 C CB  . SER B 1 155 ? 5.574   -9.699  -79.289  1.00 7.35  ? 175  SER B CB  1 
ATOM   3455 O OG  . SER B 1 155 ? 6.343   -10.360 -80.279  1.00 7.91  ? 175  SER B OG  1 
ATOM   3456 N N   . ALA B 1 156 ? 7.972   -7.480  -79.924  1.00 6.73  ? 176  ALA B N   1 
ATOM   3457 C CA  . ALA B 1 156 ? 9.327   -7.055  -79.569  1.00 6.68  ? 176  ALA B CA  1 
ATOM   3458 C C   . ALA B 1 156 ? 10.026  -6.349  -80.723  1.00 6.72  ? 176  ALA B C   1 
ATOM   3459 O O   . ALA B 1 156 ? 9.767   -6.648  -81.889  1.00 7.08  ? 176  ALA B O   1 
ATOM   3460 C CB  . ALA B 1 156 ? 10.148  -8.250  -79.121  1.00 6.70  ? 176  ALA B CB  1 
ATOM   3461 N N   . VAL B 1 157 ? 10.911  -5.414  -80.376  1.00 6.78  ? 177  VAL B N   1 
ATOM   3462 C CA  . VAL B 1 157 ? 11.765  -4.709  -81.336  1.00 6.87  ? 177  VAL B CA  1 
ATOM   3463 C C   . VAL B 1 157 ? 13.151  -4.502  -80.716  1.00 7.12  ? 177  VAL B C   1 
ATOM   3464 O O   . VAL B 1 157 ? 13.264  -4.210  -79.521  1.00 8.17  ? 177  VAL B O   1 
ATOM   3465 C CB  . VAL B 1 157 ? 11.180  -3.337  -81.749  1.00 6.80  ? 177  VAL B CB  1 
ATOM   3466 C CG1 . VAL B 1 157 ? 9.957   -3.514  -82.636  1.00 6.53  ? 177  VAL B CG1 1 
ATOM   3467 C CG2 . VAL B 1 157 ? 10.842  -2.489  -80.526  1.00 6.88  ? 177  VAL B CG2 1 
ATOM   3468 N N   . HIS B 1 158 ? 14.201  -4.652  -81.520  1.00 7.36  ? 178  HIS B N   1 
ATOM   3469 C CA  . HIS B 1 158 ? 15.574  -4.589  -81.016  1.00 7.57  ? 178  HIS B CA  1 
ATOM   3470 C C   . HIS B 1 158 ? 16.557  -4.191  -82.120  1.00 7.91  ? 178  HIS B C   1 
ATOM   3471 O O   . HIS B 1 158 ? 16.454  -4.674  -83.249  1.00 8.47  ? 178  HIS B O   1 
ATOM   3472 C CB  . HIS B 1 158 ? 15.961  -5.949  -80.420  1.00 7.77  ? 178  HIS B CB  1 
ATOM   3473 C CG  . HIS B 1 158 ? 17.228  -5.930  -79.624  1.00 8.64  ? 178  HIS B CG  1 
ATOM   3474 N ND1 . HIS B 1 158 ? 18.345  -6.643  -79.994  1.00 9.20  ? 178  HIS B ND1 1 
ATOM   3475 C CD2 . HIS B 1 158 ? 17.555  -5.293  -78.475  1.00 9.00  ? 178  HIS B CD2 1 
ATOM   3476 C CE1 . HIS B 1 158 ? 19.307  -6.448  -79.112  1.00 9.43  ? 178  HIS B CE1 1 
ATOM   3477 N NE2 . HIS B 1 158 ? 18.853  -5.631  -78.179  1.00 9.28  ? 178  HIS B NE2 1 
ATOM   3478 N N   . PHE B 1 159 ? 17.495  -3.304  -81.790  1.00 8.00  ? 179  PHE B N   1 
ATOM   3479 C CA  . PHE B 1 159 ? 18.579  -2.932  -82.704  1.00 8.57  ? 179  PHE B CA  1 
ATOM   3480 C C   . PHE B 1 159 ? 19.754  -3.891  -82.545  1.00 9.24  ? 179  PHE B C   1 
ATOM   3481 O O   . PHE B 1 159 ? 20.005  -4.392  -81.447  1.00 8.90  ? 179  PHE B O   1 
ATOM   3482 C CB  . PHE B 1 159 ? 19.082  -1.512  -82.422  1.00 8.53  ? 179  PHE B CB  1 
ATOM   3483 C CG  . PHE B 1 159 ? 18.193  -0.423  -82.952  1.00 8.61  ? 179  PHE B CG  1 
ATOM   3484 C CD1 . PHE B 1 159 ? 18.285  -0.015  -84.277  1.00 8.64  ? 179  PHE B CD1 1 
ATOM   3485 C CD2 . PHE B 1 159 ? 17.294  0.225   -82.115  1.00 8.56  ? 179  PHE B CD2 1 
ATOM   3486 C CE1 . PHE B 1 159 ? 17.478  0.999   -84.762  1.00 8.47  ? 179  PHE B CE1 1 
ATOM   3487 C CE2 . PHE B 1 159 ? 16.486  1.242   -82.592  1.00 8.46  ? 179  PHE B CE2 1 
ATOM   3488 C CZ  . PHE B 1 159 ? 16.577  1.630   -83.918  1.00 8.45  ? 179  PHE B CZ  1 
ATOM   3489 N N   . ASN B 1 160 ? 20.486  -4.127  -83.633  1.00 9.96  ? 180  ASN B N   1 
ATOM   3490 C CA  . ASN B 1 160 ? 21.731  -4.897  -83.569  1.00 10.74 ? 180  ASN B CA  1 
ATOM   3491 C C   . ASN B 1 160 ? 22.887  -4.027  -83.054  1.00 11.40 ? 180  ASN B C   1 
ATOM   3492 O O   . ASN B 1 160 ? 22.690  -2.854  -82.731  1.00 10.33 ? 180  ASN B O   1 
ATOM   3493 C CB  . ASN B 1 160 ? 22.060  -5.530  -84.930  1.00 10.91 ? 180  ASN B CB  1 
ATOM   3494 C CG  . ASN B 1 160 ? 22.494  -4.514  -85.968  1.00 10.83 ? 180  ASN B CG  1 
ATOM   3495 O OD1 . ASN B 1 160 ? 22.255  -3.315  -85.826  1.00 10.99 ? 180  ASN B OD1 1 
ATOM   3496 N ND2 . ASN B 1 160 ? 23.124  -4.996  -87.036  1.00 11.90 ? 180  ASN B ND2 1 
ATOM   3497 N N   . ARG B 1 161 ? 24.088  -4.600  -82.999  1.00 12.96 ? 181  ARG B N   1 
ATOM   3498 C CA  . ARG B 1 161 ? 25.229  -3.979  -82.314  1.00 14.65 ? 181  ARG B CA  1 
ATOM   3499 C C   . ARG B 1 161 ? 25.681  -2.622  -82.871  1.00 14.22 ? 181  ARG B C   1 
ATOM   3500 O O   . ARG B 1 161 ? 26.217  -1.805  -82.122  1.00 14.26 ? 181  ARG B O   1 
ATOM   3501 C CB  . ARG B 1 161 ? 26.418  -4.950  -82.287  1.00 17.12 ? 181  ARG B CB  1 
ATOM   3502 C CG  . ARG B 1 161 ? 27.135  -5.116  -83.621  1.00 19.39 ? 181  ARG B CG  1 
ATOM   3503 C CD  . ARG B 1 161 ? 27.969  -6.390  -83.679  1.00 22.30 ? 181  ARG B CD  1 
ATOM   3504 N NE  . ARG B 1 161 ? 28.936  -6.490  -82.585  1.00 25.06 ? 181  ARG B NE  1 
ATOM   3505 C CZ  . ARG B 1 161 ? 29.861  -7.444  -82.476  1.00 25.54 ? 181  ARG B CZ  1 
ATOM   3506 N NH1 . ARG B 1 161 ? 29.970  -8.397  -83.397  1.00 27.18 ? 181  ARG B NH1 1 
ATOM   3507 N NH2 . ARG B 1 161 ? 30.689  -7.443  -81.437  1.00 27.12 ? 181  ARG B NH2 1 
ATOM   3508 N N   . ASP B 1 162 ? 25.488  -2.388  -84.170  1.00 14.52 ? 182  ASP B N   1 
ATOM   3509 C CA  . ASP B 1 162 ? 25.859  -1.102  -84.785  1.00 14.47 ? 182  ASP B CA  1 
ATOM   3510 C C   . ASP B 1 162 ? 24.651  -0.247  -85.197  1.00 13.49 ? 182  ASP B C   1 
ATOM   3511 O O   . ASP B 1 162 ? 24.812  0.795   -85.836  1.00 13.33 ? 182  ASP B O   1 
ATOM   3512 C CB  . ASP B 1 162 ? 26.802  -1.321  -85.980  1.00 16.05 ? 182  ASP B CB  1 
ATOM   3513 C CG  . ASP B 1 162 ? 26.096  -1.881  -87.206  1.00 16.96 ? 182  ASP B CG  1 
ATOM   3514 O OD1 . ASP B 1 162 ? 25.014  -2.490  -87.068  1.00 17.81 ? 182  ASP B OD1 1 
ATOM   3515 O OD2 . ASP B 1 162 ? 26.641  -1.717  -88.319  1.00 19.07 ? 182  ASP B OD2 1 
ATOM   3516 N N   . GLY B 1 163 ? 23.448  -0.689  -84.832  1.00 12.87 ? 183  GLY B N   1 
ATOM   3517 C CA  . GLY B 1 163 ? 22.221  0.052   -85.121  1.00 12.12 ? 183  GLY B CA  1 
ATOM   3518 C C   . GLY B 1 163 ? 21.733  0.008   -86.561  1.00 11.92 ? 183  GLY B C   1 
ATOM   3519 O O   . GLY B 1 163 ? 20.741  0.659   -86.892  1.00 11.76 ? 183  GLY B O   1 
ATOM   3520 N N   . SER B 1 164 ? 22.410  -0.764  -87.414  1.00 11.55 ? 184  SER B N   1 
ATOM   3521 C CA  . SER B 1 164 ? 22.074  -0.826  -88.838  1.00 11.07 ? 184  SER B CA  1 
ATOM   3522 C C   . SER B 1 164 ? 20.840  -1.685  -89.125  1.00 10.46 ? 184  SER B C   1 
ATOM   3523 O O   . SER B 1 164 ? 20.203  -1.523  -90.168  1.00 10.36 ? 184  SER B O   1 
ATOM   3524 C CB  . SER B 1 164 ? 23.270  -1.345  -89.648  1.00 11.34 ? 184  SER B CB  1 
ATOM   3525 O OG  . SER B 1 164 ? 23.550  -2.700  -89.348  1.00 12.96 ? 184  SER B OG  1 
ATOM   3526 N N   . LEU B 1 165 ? 20.511  -2.589  -88.202  1.00 9.73  ? 185  LEU B N   1 
ATOM   3527 C CA  . LEU B 1 165 ? 19.362  -3.484  -88.352  1.00 9.27  ? 185  LEU B CA  1 
ATOM   3528 C C   . LEU B 1 165 ? 18.415  -3.419  -87.162  1.00 8.55  ? 185  LEU B C   1 
ATOM   3529 O O   . LEU B 1 165 ? 18.832  -3.184  -86.027  1.00 8.83  ? 185  LEU B O   1 
ATOM   3530 C CB  . LEU B 1 165 ? 19.818  -4.936  -88.524  1.00 9.82  ? 185  LEU B CB  1 
ATOM   3531 C CG  . LEU B 1 165 ? 20.715  -5.283  -89.713  1.00 9.98  ? 185  LEU B CG  1 
ATOM   3532 C CD1 . LEU B 1 165 ? 21.097  -6.753  -89.654  1.00 10.21 ? 185  LEU B CD1 1 
ATOM   3533 C CD2 . LEU B 1 165 ? 20.039  -4.968  -91.039  1.00 10.44 ? 185  LEU B CD2 1 
ATOM   3534 N N   . ILE B 1 166 ? 17.137  -3.643  -87.448  1.00 7.56  ? 186  ILE B N   1 
ATOM   3535 C CA  . ILE B 1 166 ? 16.107  -3.828  -86.438  1.00 7.73  ? 186  ILE B CA  1 
ATOM   3536 C C   . ILE B 1 166 ? 15.521  -5.223  -86.628  1.00 7.52  ? 186  ILE B C   1 
ATOM   3537 O O   . ILE B 1 166 ? 15.272  -5.642  -87.759  1.00 7.89  ? 186  ILE B O   1 
ATOM   3538 C CB  . ILE B 1 166 ? 14.977  -2.787  -86.589  1.00 7.77  ? 186  ILE B CB  1 
ATOM   3539 C CG1 . ILE B 1 166 ? 15.495  -1.377  -86.283  1.00 7.96  ? 186  ILE B CG1 1 
ATOM   3540 C CG2 . ILE B 1 166 ? 13.790  -3.136  -85.694  1.00 7.72  ? 186  ILE B CG2 1 
ATOM   3541 C CD1 . ILE B 1 166 ? 14.640  -0.271  -86.865  1.00 7.95  ? 186  ILE B CD1 1 
ATOM   3542 N N   . VAL B 1 167 ? 15.296  -5.938  -85.531  1.00 7.69  ? 187  VAL B N   1 
ATOM   3543 C CA  . VAL B 1 167 ? 14.529  -7.182  -85.581  1.00 7.33  ? 187  VAL B CA  1 
ATOM   3544 C C   . VAL B 1 167 ? 13.192  -6.960  -84.885  1.00 7.24  ? 187  VAL B C   1 
ATOM   3545 O O   . VAL B 1 167 ? 13.140  -6.351  -83.818  1.00 7.57  ? 187  VAL B O   1 
ATOM   3546 C CB  . VAL B 1 167 ? 15.286  -8.398  -84.980  1.00 7.70  ? 187  VAL B CB  1 
ATOM   3547 C CG1 . VAL B 1 167 ? 15.550  -8.236  -83.487  1.00 7.83  ? 187  VAL B CG1 1 
ATOM   3548 C CG2 . VAL B 1 167 ? 14.521  -9.687  -85.249  1.00 7.83  ? 187  VAL B CG2 1 
ATOM   3549 N N   . SER B 1 168 ? 12.118  -7.432  -85.512  1.00 7.25  ? 188  SER B N   1 
ATOM   3550 C CA  . SER B 1 168 ? 10.777  -7.349  -84.937  1.00 7.41  ? 188  SER B CA  1 
ATOM   3551 C C   . SER B 1 168 ? 10.135  -8.729  -84.898  1.00 7.55  ? 188  SER B C   1 
ATOM   3552 O O   . SER B 1 168 ? 10.440  -9.585  -85.726  1.00 7.63  ? 188  SER B O   1 
ATOM   3553 C CB  . SER B 1 168 ? 9.899   -6.385  -85.738  1.00 7.91  ? 188  SER B CB  1 
ATOM   3554 O OG  . SER B 1 168 ? 9.636   -6.873  -87.043  1.00 8.37  ? 188  SER B OG  1 
ATOM   3555 N N   . SER B 1 169 ? 9.250   -8.934  -83.927  1.00 7.63  ? 189  SER B N   1 
ATOM   3556 C CA  . SER B 1 169 ? 8.475   -10.171 -83.815  1.00 7.51  ? 189  SER B CA  1 
ATOM   3557 C C   . SER B 1 169 ? 7.004   -9.844  -83.615  1.00 7.41  ? 189  SER B C   1 
ATOM   3558 O O   . SER B 1 169 ? 6.663   -8.752  -83.154  1.00 7.06  ? 189  SER B O   1 
ATOM   3559 C CB  . SER B 1 169 ? 8.976   -11.024 -82.653  1.00 7.74  ? 189  SER B CB  1 
ATOM   3560 O OG  . SER B 1 169 ? 8.938   -10.301 -81.436  1.00 8.40  ? 189  SER B OG  1 
ATOM   3561 N N   . SER B 1 170 ? 6.135   -10.793 -83.954  1.00 7.15  ? 190  SER B N   1 
ATOM   3562 C CA  . SER B 1 170 ? 4.696   -10.568 -83.875  1.00 7.28  ? 190  SER B CA  1 
ATOM   3563 C C   . SER B 1 170 ? 3.902   -11.850 -83.643  1.00 7.40  ? 190  SER B C   1 
ATOM   3564 O O   . SER B 1 170 ? 4.394   -12.957 -83.874  1.00 7.26  ? 190  SER B O   1 
ATOM   3565 C CB  . SER B 1 170 ? 4.227   -9.878  -85.160  1.00 7.53  ? 190  SER B CB  1 
ATOM   3566 O OG  . SER B 1 170 ? 2.817   -9.834  -85.266  1.00 7.85  ? 190  SER B OG  1 
ATOM   3567 N N   . TYR B 1 171 ? 2.656   -11.683 -83.203  1.00 7.98  ? 191  TYR B N   1 
ATOM   3568 C CA  . TYR B 1 171 ? 1.737   -12.810 -83.062  1.00 8.65  ? 191  TYR B CA  1 
ATOM   3569 C C   . TYR B 1 171 ? 1.361   -13.434 -84.411  1.00 9.17  ? 191  TYR B C   1 
ATOM   3570 O O   . TYR B 1 171 ? 0.830   -14.540 -84.438  1.00 9.38  ? 191  TYR B O   1 
ATOM   3571 C CB  . TYR B 1 171 ? 0.458   -12.408 -82.313  1.00 9.39  ? 191  TYR B CB  1 
ATOM   3572 C CG  . TYR B 1 171 ? 0.649   -11.868 -80.910  1.00 10.09 ? 191  TYR B CG  1 
ATOM   3573 C CD1 . TYR B 1 171 ? 1.815   -12.111 -80.185  1.00 10.80 ? 191  TYR B CD1 1 
ATOM   3574 C CD2 . TYR B 1 171 ? -0.362  -11.136 -80.294  1.00 10.72 ? 191  TYR B CD2 1 
ATOM   3575 C CE1 . TYR B 1 171 ? 1.976   -11.617 -78.903  1.00 11.65 ? 191  TYR B CE1 1 
ATOM   3576 C CE2 . TYR B 1 171 ? -0.211  -10.641 -79.010  1.00 11.27 ? 191  TYR B CE2 1 
ATOM   3577 C CZ  . TYR B 1 171 ? 0.959   -10.884 -78.321  1.00 11.91 ? 191  TYR B CZ  1 
ATOM   3578 O OH  . TYR B 1 171 ? 1.106   -10.397 -77.046  1.00 13.53 ? 191  TYR B OH  1 
ATOM   3579 N N   . ASP B 1 172 ? 1.643   -12.740 -85.518  1.00 9.25  ? 192  ASP B N   1 
ATOM   3580 C CA  . ASP B 1 172 ? 1.476   -13.322 -86.859  1.00 9.21  ? 192  ASP B CA  1 
ATOM   3581 C C   . ASP B 1 172 ? 2.449   -14.480 -87.138  1.00 9.26  ? 192  ASP B C   1 
ATOM   3582 O O   . ASP B 1 172 ? 2.377   -15.113 -88.192  1.00 9.80  ? 192  ASP B O   1 
ATOM   3583 C CB  . ASP B 1 172 ? 1.575   -12.247 -87.966  1.00 9.44  ? 192  ASP B CB  1 
ATOM   3584 C CG  . ASP B 1 172 ? 2.966   -11.620 -88.093  1.00 9.68  ? 192  ASP B CG  1 
ATOM   3585 O OD1 . ASP B 1 172 ? 3.931   -12.097 -87.461  1.00 10.14 ? 192  ASP B OD1 1 
ATOM   3586 O OD2 . ASP B 1 172 ? 3.095   -10.627 -88.848  1.00 10.26 ? 192  ASP B OD2 1 
ATOM   3587 N N   . GLY B 1 173 ? 3.365   -14.735 -86.204  1.00 8.94  ? 193  GLY B N   1 
ATOM   3588 C CA  . GLY B 1 173 ? 4.246   -15.890 -86.276  1.00 8.75  ? 193  GLY B CA  1 
ATOM   3589 C C   . GLY B 1 173 ? 5.552   -15.622 -86.992  1.00 8.05  ? 193  GLY B C   1 
ATOM   3590 O O   . GLY B 1 173 ? 6.321   -16.549 -87.243  1.00 8.51  ? 193  GLY B O   1 
ATOM   3591 N N   . LEU B 1 174 ? 5.815   -14.356 -87.309  1.00 8.10  ? 194  LEU B N   1 
ATOM   3592 C CA  . LEU B 1 174 ? 6.991   -13.982 -88.081  1.00 8.62  ? 194  LEU B CA  1 
ATOM   3593 C C   . LEU B 1 174 ? 7.996   -13.208 -87.243  1.00 8.52  ? 194  LEU B C   1 
ATOM   3594 O O   . LEU B 1 174 ? 7.619   -12.461 -86.339  1.00 8.88  ? 194  LEU B O   1 
ATOM   3595 C CB  . LEU B 1 174 ? 6.586   -13.111 -89.273  1.00 9.14  ? 194  LEU B CB  1 
ATOM   3596 C CG  . LEU B 1 174 ? 5.513   -13.640 -90.227  1.00 9.50  ? 194  LEU B CG  1 
ATOM   3597 C CD1 . LEU B 1 174 ? 5.268   -12.613 -91.323  1.00 10.28 ? 194  LEU B CD1 1 
ATOM   3598 C CD2 . LEU B 1 174 ? 5.909   -14.980 -90.826  1.00 9.75  ? 194  LEU B CD2 1 
ATOM   3599 N N   . CYS B 1 175 ? 9.274   -13.403 -87.556  1.00 8.99  ? 195  CYS B N   1 
ATOM   3600 C CA  . CYS B 1 175 ? 10.325  -12.464 -87.187  1.00 9.25  ? 195  CYS B CA  1 
ATOM   3601 C C   . CYS B 1 175 ? 10.764  -11.780 -88.467  1.00 8.60  ? 195  CYS B C   1 
ATOM   3602 O O   . CYS B 1 175 ? 10.880  -12.431 -89.506  1.00 8.25  ? 195  CYS B O   1 
ATOM   3603 C CB  . CYS B 1 175 ? 11.516  -13.176 -86.557  1.00 10.41 ? 195  CYS B CB  1 
ATOM   3604 S SG  . CYS B 1 175 ? 11.188  -13.865 -84.927  1.00 13.04 ? 195  CYS B SG  1 
ATOM   3605 N N   . ARG B 1 176 ? 10.994  -10.473 -88.403  1.00 8.11  ? 196  ARG B N   1 
ATOM   3606 C CA  . ARG B 1 176 ? 11.466  -9.727  -89.565  1.00 8.32  ? 196  ARG B CA  1 
ATOM   3607 C C   . ARG B 1 176 ? 12.673  -8.859  -89.243  1.00 8.50  ? 196  ARG B C   1 
ATOM   3608 O O   . ARG B 1 176 ? 12.759  -8.282  -88.159  1.00 8.58  ? 196  ARG B O   1 
ATOM   3609 C CB  . ARG B 1 176 ? 10.324  -8.907  -90.167  1.00 8.34  ? 196  ARG B CB  1 
ATOM   3610 C CG  . ARG B 1 176 ? 9.480   -9.741  -91.112  1.00 8.92  ? 196  ARG B CG  1 
ATOM   3611 C CD  . ARG B 1 176 ? 8.213   -9.050  -91.584  1.00 8.78  ? 196  ARG B CD  1 
ATOM   3612 N NE  . ARG B 1 176 ? 7.608   -9.805  -92.682  1.00 8.56  ? 196  ARG B NE  1 
ATOM   3613 C CZ  . ARG B 1 176 ? 6.340   -9.713  -93.079  1.00 8.81  ? 196  ARG B CZ  1 
ATOM   3614 N NH1 . ARG B 1 176 ? 5.490   -8.886  -92.481  1.00 8.79  ? 196  ARG B NH1 1 
ATOM   3615 N NH2 . ARG B 1 176 ? 5.918   -10.461 -94.093  1.00 9.16  ? 196  ARG B NH2 1 
ATOM   3616 N N   . ILE B 1 177 ? 13.607  -8.802  -90.193  1.00 8.51  ? 197  ILE B N   1 
ATOM   3617 C CA  . ILE B 1 177 ? 14.823  -7.997  -90.087  1.00 8.82  ? 197  ILE B CA  1 
ATOM   3618 C C   . ILE B 1 177 ? 14.669  -6.789  -91.005  1.00 8.62  ? 197  ILE B C   1 
ATOM   3619 O O   . ILE B 1 177 ? 14.328  -6.940  -92.183  1.00 8.98  ? 197  ILE B O   1 
ATOM   3620 C CB  . ILE B 1 177 ? 16.078  -8.799  -90.499  1.00 9.76  ? 197  ILE B CB  1 
ATOM   3621 C CG1 . ILE B 1 177 ? 16.222  -10.078 -89.660  1.00 10.03 ? 197  ILE B CG1 1 
ATOM   3622 C CG2 . ILE B 1 177 ? 17.329  -7.939  -90.379  1.00 10.05 ? 197  ILE B CG2 1 
ATOM   3623 C CD1 . ILE B 1 177 ? 16.581  -9.851  -88.205  1.00 10.22 ? 197  ILE B CD1 1 
ATOM   3624 N N   . TRP B 1 178 ? 14.922  -5.600  -90.459  1.00 8.56  ? 198  TRP B N   1 
ATOM   3625 C CA  . TRP B 1 178 ? 14.705  -4.338  -91.168  1.00 8.81  ? 198  TRP B CA  1 
ATOM   3626 C C   . TRP B 1 178 ? 15.979  -3.518  -91.263  1.00 8.96  ? 198  TRP B C   1 
ATOM   3627 O O   . TRP B 1 178 ? 16.723  -3.413  -90.292  1.00 9.71  ? 198  TRP B O   1 
ATOM   3628 C CB  . TRP B 1 178 ? 13.661  -3.499  -90.431  1.00 8.91  ? 198  TRP B CB  1 
ATOM   3629 C CG  . TRP B 1 178 ? 12.394  -4.222  -90.200  1.00 8.78  ? 198  TRP B CG  1 
ATOM   3630 C CD1 . TRP B 1 178 ? 12.082  -5.011  -89.131  1.00 8.89  ? 198  TRP B CD1 1 
ATOM   3631 C CD2 . TRP B 1 178 ? 11.259  -4.246  -91.065  1.00 8.63  ? 198  TRP B CD2 1 
ATOM   3632 N NE1 . TRP B 1 178 ? 10.816  -5.519  -89.275  1.00 9.08  ? 198  TRP B NE1 1 
ATOM   3633 C CE2 . TRP B 1 178 ? 10.288  -5.066  -90.455  1.00 8.75  ? 198  TRP B CE2 1 
ATOM   3634 C CE3 . TRP B 1 178 ? 10.964  -3.646  -92.294  1.00 8.53  ? 198  TRP B CE3 1 
ATOM   3635 C CZ2 . TRP B 1 178 ? 9.043   -5.305  -91.036  1.00 9.09  ? 198  TRP B CZ2 1 
ATOM   3636 C CZ3 . TRP B 1 178 ? 9.729   -3.882  -92.868  1.00 8.61  ? 198  TRP B CZ3 1 
ATOM   3637 C CH2 . TRP B 1 178 ? 8.784   -4.705  -92.242  1.00 9.33  ? 198  TRP B CH2 1 
ATOM   3638 N N   . ASP B 1 179 ? 16.217  -2.925  -92.430  1.00 9.39  ? 199  ASP B N   1 
ATOM   3639 C CA  . ASP B 1 179 ? 17.286  -1.951  -92.588  1.00 9.99  ? 199  ASP B CA  1 
ATOM   3640 C C   . ASP B 1 179 ? 16.834  -0.651  -91.938  1.00 9.62  ? 199  ASP B C   1 
ATOM   3641 O O   . ASP B 1 179 ? 15.824  -0.072  -92.338  1.00 9.77  ? 199  ASP B O   1 
ATOM   3642 C CB  . ASP B 1 179 ? 17.588  -1.714  -94.067  1.00 10.78 ? 199  ASP B CB  1 
ATOM   3643 C CG  . ASP B 1 179 ? 18.797  -0.824  -94.277  1.00 11.85 ? 199  ASP B CG  1 
ATOM   3644 O OD1 . ASP B 1 179 ? 19.926  -1.277  -93.995  1.00 13.02 ? 199  ASP B OD1 1 
ATOM   3645 O OD2 . ASP B 1 179 ? 18.617  0.330   -94.720  1.00 13.34 ? 199  ASP B OD2 1 
ATOM   3646 N N   . THR B 1 180 ? 17.576  -0.204  -90.929  1.00 9.61  ? 200  THR B N   1 
ATOM   3647 C CA  . THR B 1 180 ? 17.222  1.006   -90.190  1.00 9.76  ? 200  THR B CA  1 
ATOM   3648 C C   . THR B 1 180 ? 17.175  2.239   -91.092  1.00 9.85  ? 200  THR B C   1 
ATOM   3649 O O   . THR B 1 180 ? 16.243  3.040   -91.001  1.00 10.80 ? 200  THR B O   1 
ATOM   3650 C CB  . THR B 1 180 ? 18.215  1.249   -89.038  1.00 10.03 ? 200  THR B CB  1 
ATOM   3651 O OG1 . THR B 1 180 ? 18.179  0.130   -88.147  1.00 9.42  ? 200  THR B OG1 1 
ATOM   3652 C CG2 . THR B 1 180 ? 17.875  2.516   -88.261  1.00 9.97  ? 200  THR B CG2 1 
ATOM   3653 N N   . ALA B 1 181 ? 18.174  2.379   -91.961  1.00 10.34 ? 201  ALA B N   1 
ATOM   3654 C CA  . ALA B 1 181 ? 18.313  3.576   -92.793  1.00 10.56 ? 201  ALA B CA  1 
ATOM   3655 C C   . ALA B 1 181 ? 17.178  3.744   -93.808  1.00 10.67 ? 201  ALA B C   1 
ATOM   3656 O O   . ALA B 1 181 ? 16.662  4.849   -93.982  1.00 11.61 ? 201  ALA B O   1 
ATOM   3657 C CB  . ALA B 1 181 ? 19.658  3.567   -93.504  1.00 10.63 ? 201  ALA B CB  1 
ATOM   3658 N N   . SER B 1 182 ? 16.804  2.651   -94.472  1.00 10.78 ? 202  SER B N   1 
ATOM   3659 C CA  . SER B 1 182 ? 15.805  2.680   -95.545  1.00 11.05 ? 202  SER B CA  1 
ATOM   3660 C C   . SER B 1 182 ? 14.418  2.203   -95.118  1.00 11.15 ? 202  SER B C   1 
ATOM   3661 O O   . SER B 1 182 ? 13.427  2.508   -95.781  1.00 12.24 ? 202  SER B O   1 
ATOM   3662 C CB  . SER B 1 182 ? 16.276  1.807   -96.708  1.00 10.81 ? 202  SER B CB  1 
ATOM   3663 O OG  . SER B 1 182 ? 16.214  0.434   -96.362  1.00 11.45 ? 202  SER B OG  1 
ATOM   3664 N N   . GLY B 1 183 ? 14.354  1.427   -94.037  1.00 11.31 ? 203  GLY B N   1 
ATOM   3665 C CA  . GLY B 1 183 ? 13.101  0.827   -93.588  1.00 11.72 ? 203  GLY B CA  1 
ATOM   3666 C C   . GLY B 1 183 ? 12.677  -0.393  -94.392  1.00 11.83 ? 203  GLY B C   1 
ATOM   3667 O O   . GLY B 1 183 ? 11.563  -0.885  -94.217  1.00 13.08 ? 203  GLY B O   1 
ATOM   3668 N N   . GLN B 1 184 ? 13.555  -0.891  -95.267  1.00 11.61 ? 204  GLN B N   1 
ATOM   3669 C CA  . GLN B 1 184 ? 13.241  -2.061  -96.088  1.00 11.88 ? 204  GLN B CA  1 
ATOM   3670 C C   . GLN B 1 184 ? 13.348  -3.337  -95.264  1.00 10.73 ? 204  GLN B C   1 
ATOM   3671 O O   . GLN B 1 184 ? 14.271  -3.495  -94.467  1.00 10.44 ? 204  GLN B O   1 
ATOM   3672 C CB  . GLN B 1 184 ? 14.181  -2.168  -97.299  1.00 13.74 ? 204  GLN B CB  1 
ATOM   3673 C CG  . GLN B 1 184 ? 13.871  -3.367  -98.195  1.00 15.22 ? 204  GLN B CG  1 
ATOM   3674 C CD  . GLN B 1 184 ? 14.838  -3.549  -99.351  1.00 16.96 ? 204  GLN B CD  1 
ATOM   3675 O OE1 . GLN B 1 184 ? 15.967  -3.062  -99.322  1.00 19.76 ? 204  GLN B OE1 1 
ATOM   3676 N NE2 . GLN B 1 184 ? 14.399  -4.277  -100.374 1.00 19.59 ? 204  GLN B NE2 1 
ATOM   3677 N N   . CYS B 1 185 ? 12.402  -4.246  -95.473  1.00 9.97  ? 205  CYS B N   1 
ATOM   3678 C CA  . CYS B 1 185 ? 12.471  -5.577  -94.893  1.00 9.78  ? 205  CYS B CA  1 
ATOM   3679 C C   . CYS B 1 185 ? 13.522  -6.401  -95.637  1.00 10.26 ? 205  CYS B C   1 
ATOM   3680 O O   . CYS B 1 185 ? 13.400  -6.626  -96.842  1.00 10.99 ? 205  CYS B O   1 
ATOM   3681 C CB  . CYS B 1 185 ? 11.112  -6.261  -94.992  1.00 9.70  ? 205  CYS B CB  1 
ATOM   3682 S SG  . CYS B 1 185 ? 11.041  -7.860  -94.170  1.00 10.39 ? 205  CYS B SG  1 
ATOM   3683 N N   . LEU B 1 186 ? 14.556  -6.833  -94.920  1.00 9.98  ? 206  LEU B N   1 
ATOM   3684 C CA  . LEU B 1 186 ? 15.649  -7.604  -95.515  1.00 10.05 ? 206  LEU B CA  1 
ATOM   3685 C C   . LEU B 1 186 ? 15.487  -9.115  -95.346  1.00 10.51 ? 206  LEU B C   1 
ATOM   3686 O O   . LEU B 1 186 ? 16.171  -9.887  -96.017  1.00 11.57 ? 206  LEU B O   1 
ATOM   3687 C CB  . LEU B 1 186 ? 16.985  -7.179  -94.904  1.00 10.34 ? 206  LEU B CB  1 
ATOM   3688 C CG  . LEU B 1 186 ? 17.380  -5.710  -95.063  1.00 11.25 ? 206  LEU B CG  1 
ATOM   3689 C CD1 . LEU B 1 186 ? 18.639  -5.427  -94.257  1.00 11.96 ? 206  LEU B CD1 1 
ATOM   3690 C CD2 . LEU B 1 186 ? 17.590  -5.344  -96.523  1.00 11.56 ? 206  LEU B CD2 1 
ATOM   3691 N N   . LYS B 1 187 ? 14.603  -9.535  -94.444  1.00 10.66 ? 207  LYS B N   1 
ATOM   3692 C CA  . LYS B 1 187 ? 14.428  -10.953 -94.148  1.00 10.52 ? 207  LYS B CA  1 
ATOM   3693 C C   . LYS B 1 187 ? 13.115  -11.196 -93.410  1.00 10.22 ? 207  LYS B C   1 
ATOM   3694 O O   . LYS B 1 187 ? 12.724  -10.411 -92.550  1.00 10.69 ? 207  LYS B O   1 
ATOM   3695 C CB  . LYS B 1 187 ? 15.597  -11.463 -93.292  1.00 11.70 ? 207  LYS B CB  1 
ATOM   3696 C CG  . LYS B 1 187 ? 15.727  -12.978 -93.214  1.00 12.92 ? 207  LYS B CG  1 
ATOM   3697 C CD  . LYS B 1 187 ? 16.536  -13.537 -94.372  1.00 14.23 ? 207  LYS B CD  1 
ATOM   3698 C CE  . LYS B 1 187 ? 16.682  -15.047 -94.269  1.00 15.97 ? 207  LYS B CE  1 
ATOM   3699 N NZ  . LYS B 1 187 ? 17.486  -15.617 -95.386  1.00 17.98 ? 207  LYS B NZ  1 
ATOM   3700 N N   . THR B 1 188 ? 12.436  -12.281 -93.765  1.00 10.09 ? 208  THR B N   1 
ATOM   3701 C CA  . THR B 1 188 ? 11.318  -12.796 -92.985  1.00 9.99  ? 208  THR B CA  1 
ATOM   3702 C C   . THR B 1 188 ? 11.670  -14.227 -92.593  1.00 11.17 ? 208  THR B C   1 
ATOM   3703 O O   . THR B 1 188 ? 11.967  -15.057 -93.455  1.00 11.40 ? 208  THR B O   1 
ATOM   3704 C CB  . THR B 1 188 ? 9.996   -12.774 -93.780  1.00 9.94  ? 208  THR B CB  1 
ATOM   3705 O OG1 . THR B 1 188 ? 9.623   -11.419 -94.056  1.00 9.42  ? 208  THR B OG1 1 
ATOM   3706 C CG2 . THR B 1 188 ? 8.872   -13.433 -92.992  1.00 9.61  ? 208  THR B CG2 1 
ATOM   3707 N N   . LEU B 1 189 ? 11.655  -14.506 -91.293  1.00 12.02 ? 209  LEU B N   1 
ATOM   3708 C CA  . LEU B 1 189 ? 11.985  -15.835 -90.792  1.00 13.34 ? 209  LEU B CA  1 
ATOM   3709 C C   . LEU B 1 189 ? 10.728  -16.674 -90.654  1.00 14.59 ? 209  LEU B C   1 
ATOM   3710 O O   . LEU B 1 189 ? 9.792   -16.300 -89.947  1.00 14.48 ? 209  LEU B O   1 
ATOM   3711 C CB  . LEU B 1 189 ? 12.711  -15.746 -89.452  1.00 13.93 ? 209  LEU B CB  1 
ATOM   3712 C CG  . LEU B 1 189 ? 14.050  -15.005 -89.469  1.00 15.25 ? 209  LEU B CG  1 
ATOM   3713 C CD1 . LEU B 1 189 ? 14.610  -14.947 -88.063  1.00 15.67 ? 209  LEU B CD1 1 
ATOM   3714 C CD2 . LEU B 1 189 ? 15.056  -15.651 -90.410  1.00 15.92 ? 209  LEU B CD2 1 
ATOM   3715 N N   . ILE B 1 190 ? 10.727  -17.808 -91.348  1.00 17.44 ? 210  ILE B N   1 
ATOM   3716 C CA  . ILE B 1 190 ? 9.604   -18.732 -91.360  1.00 19.62 ? 210  ILE B CA  1 
ATOM   3717 C C   . ILE B 1 190 ? 10.132  -20.126 -91.045  1.00 21.66 ? 210  ILE B C   1 
ATOM   3718 O O   . ILE B 1 190 ? 11.063  -20.611 -91.695  1.00 21.69 ? 210  ILE B O   1 
ATOM   3719 C CB  . ILE B 1 190 ? 8.883   -18.700 -92.727  1.00 22.11 ? 210  ILE B CB  1 
ATOM   3720 C CG1 . ILE B 1 190 ? 7.982   -17.461 -92.807  1.00 23.18 ? 210  ILE B CG1 1 
ATOM   3721 C CG2 . ILE B 1 190 ? 8.054   -19.962 -92.949  1.00 21.52 ? 210  ILE B CG2 1 
ATOM   3722 C CD1 . ILE B 1 190 ? 7.753   -16.951 -94.210  1.00 24.78 ? 210  ILE B CD1 1 
ATOM   3723 N N   . ASP B 1 191 ? 9.534   -20.753 -90.037  1.00 27.35 ? 211  ASP B N   1 
ATOM   3724 C CA  . ASP B 1 191 ? 9.944   -22.072 -89.573  1.00 27.37 ? 211  ASP B CA  1 
ATOM   3725 C C   . ASP B 1 191 ? 9.038   -23.148 -90.168  1.00 27.50 ? 211  ASP B C   1 
ATOM   3726 O O   . ASP B 1 191 ? 7.978   -22.848 -90.721  1.00 27.68 ? 211  ASP B O   1 
ATOM   3727 C CB  . ASP B 1 191 ? 9.887   -22.119 -88.042  1.00 27.39 ? 211  ASP B CB  1 
ATOM   3728 C CG  . ASP B 1 191 ? 10.672  -23.281 -87.453  1.00 27.46 ? 211  ASP B CG  1 
ATOM   3729 O OD1 . ASP B 1 191 ? 11.208  -24.114 -88.216  1.00 27.55 ? 211  ASP B OD1 1 
ATOM   3730 O OD2 . ASP B 1 191 ? 10.753  -23.360 -86.210  1.00 27.51 ? 211  ASP B OD2 1 
ATOM   3731 N N   . ASN B 1 194 ? 4.155   -21.814 -87.619  1.00 24.13 ? 214  ASN B N   1 
ATOM   3732 C CA  . ASN B 1 194 ? 4.369   -20.399 -87.328  1.00 24.40 ? 214  ASN B CA  1 
ATOM   3733 C C   . ASN B 1 194 ? 3.554   -19.917 -86.121  1.00 24.20 ? 214  ASN B C   1 
ATOM   3734 O O   . ASN B 1 194 ? 2.685   -19.055 -86.253  1.00 23.83 ? 214  ASN B O   1 
ATOM   3735 C CB  . ASN B 1 194 ? 4.067   -19.551 -88.573  1.00 24.70 ? 214  ASN B CB  1 
ATOM   3736 C CG  . ASN B 1 194 ? 2.741   -19.914 -89.227  1.00 24.92 ? 214  ASN B CG  1 
ATOM   3737 O OD1 . ASN B 1 194 ? 1.678   -19.763 -88.627  1.00 25.20 ? 214  ASN B OD1 1 
ATOM   3738 N ND2 . ASN B 1 194 ? 2.798   -20.389 -90.467  1.00 25.07 ? 214  ASN B ND2 1 
ATOM   3739 N N   . PRO B 1 195 ? 3.839   -20.473 -84.928  1.00 13.47 ? 215  PRO B N   1 
ATOM   3740 C CA  . PRO B 1 195 ? 3.121   -20.034 -83.734  1.00 13.51 ? 215  PRO B CA  1 
ATOM   3741 C C   . PRO B 1 195 ? 3.463   -18.585 -83.387  1.00 12.33 ? 215  PRO B C   1 
ATOM   3742 O O   . PRO B 1 195 ? 4.529   -18.107 -83.772  1.00 12.29 ? 215  PRO B O   1 
ATOM   3743 C CB  . PRO B 1 195 ? 3.637   -20.980 -82.647  1.00 13.99 ? 215  PRO B CB  1 
ATOM   3744 C CG  . PRO B 1 195 ? 4.989   -21.384 -83.119  1.00 14.03 ? 215  PRO B CG  1 
ATOM   3745 C CD  . PRO B 1 195 ? 4.873   -21.474 -84.611  1.00 14.29 ? 215  PRO B CD  1 
ATOM   3746 N N   . PRO B 1 196 ? 2.567   -17.888 -82.665  1.00 11.48 ? 216  PRO B N   1 
ATOM   3747 C CA  . PRO B 1 196 ? 2.832   -16.501 -82.281  1.00 10.98 ? 216  PRO B CA  1 
ATOM   3748 C C   . PRO B 1 196 ? 4.226   -16.319 -81.683  1.00 10.19 ? 216  PRO B C   1 
ATOM   3749 O O   . PRO B 1 196 ? 4.616   -17.074 -80.793  1.00 10.83 ? 216  PRO B O   1 
ATOM   3750 C CB  . PRO B 1 196 ? 1.756   -16.223 -81.229  1.00 11.43 ? 216  PRO B CB  1 
ATOM   3751 C CG  . PRO B 1 196 ? 0.625   -17.108 -81.617  1.00 12.25 ? 216  PRO B CG  1 
ATOM   3752 C CD  . PRO B 1 196 ? 1.252   -18.350 -82.180  1.00 11.96 ? 216  PRO B CD  1 
ATOM   3753 N N   . VAL B 1 197 ? 4.971   -15.339 -82.190  1.00 9.11  ? 217  VAL B N   1 
ATOM   3754 C CA  . VAL B 1 197 ? 6.292   -15.020 -81.657  1.00 8.70  ? 217  VAL B CA  1 
ATOM   3755 C C   . VAL B 1 197 ? 6.125   -13.927 -80.609  1.00 8.58  ? 217  VAL B C   1 
ATOM   3756 O O   . VAL B 1 197 ? 5.679   -12.822 -80.916  1.00 8.97  ? 217  VAL B O   1 
ATOM   3757 C CB  . VAL B 1 197 ? 7.277   -14.557 -82.753  1.00 8.79  ? 217  VAL B CB  1 
ATOM   3758 C CG1 . VAL B 1 197 ? 8.683   -14.453 -82.188  1.00 9.08  ? 217  VAL B CG1 1 
ATOM   3759 C CG2 . VAL B 1 197 ? 7.276   -15.524 -83.928  1.00 8.99  ? 217  VAL B CG2 1 
ATOM   3760 N N   . SER B 1 198 ? 6.500   -14.247 -79.376  1.00 8.38  ? 218  SER B N   1 
ATOM   3761 C CA  . SER B 1 198 ? 6.229   -13.398 -78.221  1.00 8.29  ? 218  SER B CA  1 
ATOM   3762 C C   . SER B 1 198 ? 7.425   -12.552 -77.778  1.00 7.91  ? 218  SER B C   1 
ATOM   3763 O O   . SER B 1 198 ? 7.266   -11.648 -76.962  1.00 8.04  ? 218  SER B O   1 
ATOM   3764 C CB  . SER B 1 198 ? 5.775   -14.282 -77.066  1.00 8.67  ? 218  SER B CB  1 
ATOM   3765 O OG  . SER B 1 198 ? 6.680   -15.355 -76.881  1.00 9.12  ? 218  SER B OG  1 
ATOM   3766 N N   . PHE B 1 199 ? 8.613   -12.849 -78.296  1.00 7.79  ? 219  PHE B N   1 
ATOM   3767 C CA  . PHE B 1 199 ? 9.802   -12.056 -77.998  1.00 7.73  ? 219  PHE B CA  1 
ATOM   3768 C C   . PHE B 1 199 ? 10.911  -12.355 -78.994  1.00 7.41  ? 219  PHE B C   1 
ATOM   3769 O O   . PHE B 1 199 ? 11.007  -13.470 -79.502  1.00 7.59  ? 219  PHE B O   1 
ATOM   3770 C CB  . PHE B 1 199 ? 10.321  -12.325 -76.578  1.00 8.38  ? 219  PHE B CB  1 
ATOM   3771 C CG  . PHE B 1 199 ? 11.540  -11.515 -76.226  1.00 8.56  ? 219  PHE B CG  1 
ATOM   3772 C CD1 . PHE B 1 199 ? 11.416  -10.177 -75.871  1.00 8.92  ? 219  PHE B CD1 1 
ATOM   3773 C CD2 . PHE B 1 199 ? 12.812  -12.072 -76.289  1.00 8.82  ? 219  PHE B CD2 1 
ATOM   3774 C CE1 . PHE B 1 199 ? 12.533  -9.419  -75.567  1.00 8.91  ? 219  PHE B CE1 1 
ATOM   3775 C CE2 . PHE B 1 199 ? 13.934  -11.317 -75.987  1.00 8.80  ? 219  PHE B CE2 1 
ATOM   3776 C CZ  . PHE B 1 199 ? 13.794  -9.990  -75.625  1.00 8.87  ? 219  PHE B CZ  1 
ATOM   3777 N N   . VAL B 1 200 ? 11.753  -11.358 -79.254  1.00 7.51  ? 220  VAL B N   1 
ATOM   3778 C CA  . VAL B 1 200 ? 12.943  -11.547 -80.071  1.00 7.52  ? 220  VAL B CA  1 
ATOM   3779 C C   . VAL B 1 200 ? 14.007  -10.507 -79.711  1.00 7.48  ? 220  VAL B C   1 
ATOM   3780 O O   . VAL B 1 200 ? 13.681  -9.389  -79.310  1.00 7.51  ? 220  VAL B O   1 
ATOM   3781 C CB  . VAL B 1 200 ? 12.612  -11.497 -81.585  1.00 7.57  ? 220  VAL B CB  1 
ATOM   3782 C CG1 . VAL B 1 200 ? 12.292  -10.079 -82.043  1.00 7.24  ? 220  VAL B CG1 1 
ATOM   3783 C CG2 . VAL B 1 200 ? 13.750  -12.086 -82.408  1.00 7.60  ? 220  VAL B CG2 1 
ATOM   3784 N N   . LYS B 1 201 ? 15.274  -10.890 -79.839  1.00 7.96  ? 221  LYS B N   1 
ATOM   3785 C CA  . LYS B 1 201 ? 16.388  -9.946  -79.734  1.00 8.36  ? 221  LYS B CA  1 
ATOM   3786 C C   . LYS B 1 201 ? 17.638  -10.528 -80.396  1.00 8.39  ? 221  LYS B C   1 
ATOM   3787 O O   . LYS B 1 201 ? 17.800  -11.744 -80.473  1.00 8.70  ? 221  LYS B O   1 
ATOM   3788 C CB  . LYS B 1 201 ? 16.674  -9.570  -78.269  1.00 9.04  ? 221  LYS B CB  1 
ATOM   3789 C CG  . LYS B 1 201 ? 17.468  -10.601 -77.473  1.00 9.33  ? 221  LYS B CG  1 
ATOM   3790 C CD  . LYS B 1 201 ? 17.547  -10.272 -75.986  1.00 9.44  ? 221  LYS B CD  1 
ATOM   3791 C CE  . LYS B 1 201 ? 18.192  -8.921  -75.711  1.00 9.48  ? 221  LYS B CE  1 
ATOM   3792 N NZ  . LYS B 1 201 ? 18.508  -8.737  -74.265  1.00 9.66  ? 221  LYS B NZ  1 
ATOM   3793 N N   . PHE B 1 202 ? 18.490  -9.649  -80.913  1.00 8.57  ? 222  PHE B N   1 
ATOM   3794 C CA  . PHE B 1 202 ? 19.828  -10.017 -81.377  1.00 9.18  ? 222  PHE B CA  1 
ATOM   3795 C C   . PHE B 1 202 ? 20.712  -10.498 -80.231  1.00 9.69  ? 222  PHE B C   1 
ATOM   3796 O O   . PHE B 1 202 ? 20.570  -10.050 -79.093  1.00 10.30 ? 222  PHE B O   1 
ATOM   3797 C CB  . PHE B 1 202 ? 20.522  -8.820  -82.037  1.00 8.83  ? 222  PHE B CB  1 
ATOM   3798 C CG  . PHE B 1 202 ? 19.949  -8.433  -83.372  1.00 8.92  ? 222  PHE B CG  1 
ATOM   3799 C CD1 . PHE B 1 202 ? 20.253  -9.166  -84.512  1.00 9.22  ? 222  PHE B CD1 1 
ATOM   3800 C CD2 . PHE B 1 202 ? 19.137  -7.314  -83.497  1.00 8.90  ? 222  PHE B CD2 1 
ATOM   3801 C CE1 . PHE B 1 202 ? 19.737  -8.803  -85.746  1.00 9.42  ? 222  PHE B CE1 1 
ATOM   3802 C CE2 . PHE B 1 202 ? 18.618  -6.946  -84.728  1.00 9.14  ? 222  PHE B CE2 1 
ATOM   3803 C CZ  . PHE B 1 202 ? 18.921  -7.690  -85.855  1.00 9.43  ? 222  PHE B CZ  1 
ATOM   3804 N N   . SER B 1 203 ? 21.642  -11.395 -80.544  1.00 10.36 ? 223  SER B N   1 
ATOM   3805 C CA  . SER B 1 203 ? 22.693  -11.767 -79.604  1.00 11.36 ? 223  SER B CA  1 
ATOM   3806 C C   . SER B 1 203 ? 23.657  -10.588 -79.472  1.00 12.32 ? 223  SER B C   1 
ATOM   3807 O O   . SER B 1 203 ? 23.760  -9.777  -80.393  1.00 12.50 ? 223  SER B O   1 
ATOM   3808 C CB  . SER B 1 203 ? 23.436  -13.013 -80.092  1.00 11.55 ? 223  SER B CB  1 
ATOM   3809 O OG  . SER B 1 203 ? 23.963  -12.826 -81.394  1.00 11.84 ? 223  SER B OG  1 
ATOM   3810 N N   . PRO B 1 204 ? 24.359  -10.473 -78.329  1.00 13.55 ? 224  PRO B N   1 
ATOM   3811 C CA  . PRO B 1 204 ? 25.350  -9.393  -78.216  1.00 14.69 ? 224  PRO B CA  1 
ATOM   3812 C C   . PRO B 1 204 ? 26.406  -9.457  -79.328  1.00 15.71 ? 224  PRO B C   1 
ATOM   3813 O O   . PRO B 1 204 ? 26.908  -8.422  -79.774  1.00 17.56 ? 224  PRO B O   1 
ATOM   3814 C CB  . PRO B 1 204 ? 25.982  -9.634  -76.841  1.00 14.82 ? 224  PRO B CB  1 
ATOM   3815 C CG  . PRO B 1 204 ? 24.959  -10.400 -76.072  1.00 14.93 ? 224  PRO B CG  1 
ATOM   3816 C CD  . PRO B 1 204 ? 24.230  -11.244 -77.078  1.00 13.88 ? 224  PRO B CD  1 
ATOM   3817 N N   . ASN B 1 205 ? 26.725  -10.685 -79.740  1.00 16.44 ? 225  ASN B N   1 
ATOM   3818 C CA  . ASN B 1 205 ? 27.517  -10.989 -80.938  1.00 17.47 ? 225  ASN B CA  1 
ATOM   3819 C C   . ASN B 1 205 ? 27.062  -10.312 -82.220  1.00 19.72 ? 225  ASN B C   1 
ATOM   3820 O O   . ASN B 1 205 ? 27.884  -9.908  -83.045  1.00 19.15 ? 225  ASN B O   1 
ATOM   3821 C CB  . ASN B 1 205 ? 27.445  -12.498 -81.224  1.00 18.08 ? 225  ASN B CB  1 
ATOM   3822 C CG  . ASN B 1 205 ? 28.497  -13.296 -80.494  1.00 21.52 ? 225  ASN B CG  1 
ATOM   3823 O OD1 . ASN B 1 205 ? 29.244  -12.772 -79.670  1.00 20.67 ? 225  ASN B OD1 1 
ATOM   3824 N ND2 . ASN B 1 205 ? 28.564  -14.586 -80.804  1.00 19.73 ? 225  ASN B ND2 1 
ATOM   3825 N N   . GLY B 1 206 ? 25.747  -10.248 -82.407  1.00 18.87 ? 226  GLY B N   1 
ATOM   3826 C CA  . GLY B 1 206 ? 25.162  -9.913  -83.699  1.00 19.28 ? 226  GLY B CA  1 
ATOM   3827 C C   . GLY B 1 206 ? 25.024  -11.120 -84.619  1.00 18.92 ? 226  GLY B C   1 
ATOM   3828 O O   . GLY B 1 206 ? 24.482  -10.997 -85.713  1.00 20.64 ? 226  GLY B O   1 
ATOM   3829 N N   . LYS B 1 207 ? 25.492  -12.289 -84.177  1.00 18.55 ? 227  LYS B N   1 
ATOM   3830 C CA  . LYS B 1 207 ? 25.466  -13.505 -84.996  1.00 19.55 ? 227  LYS B CA  1 
ATOM   3831 C C   . LYS B 1 207 ? 24.052  -14.056 -85.096  1.00 18.87 ? 227  LYS B C   1 
ATOM   3832 O O   . LYS B 1 207 ? 23.621  -14.500 -86.161  1.00 20.81 ? 227  LYS B O   1 
ATOM   3833 C CB  . LYS B 1 207 ? 26.354  -14.606 -84.395  1.00 20.69 ? 227  LYS B CB  1 
ATOM   3834 C CG  . LYS B 1 207 ? 27.848  -14.501 -84.667  1.00 22.09 ? 227  LYS B CG  1 
ATOM   3835 C CD  . LYS B 1 207 ? 28.538  -15.792 -84.233  1.00 24.35 ? 227  LYS B CD  1 
ATOM   3836 C CE  . LYS B 1 207 ? 29.997  -15.874 -84.659  1.00 25.93 ? 227  LYS B CE  1 
ATOM   3837 N NZ  . LYS B 1 207 ? 30.935  -15.737 -83.510  1.00 26.34 ? 227  LYS B NZ  1 
ATOM   3838 N N   . TYR B 1 208 ? 23.340  -14.030 -83.972  1.00 16.41 ? 228  TYR B N   1 
ATOM   3839 C CA  . TYR B 1 208 ? 22.064  -14.714 -83.852  1.00 15.57 ? 228  TYR B CA  1 
ATOM   3840 C C   . TYR B 1 208 ? 20.944  -13.765 -83.486  1.00 13.47 ? 228  TYR B C   1 
ATOM   3841 O O   . TYR B 1 208 ? 21.177  -12.617 -83.102  1.00 13.37 ? 228  TYR B O   1 
ATOM   3842 C CB  . TYR B 1 208 ? 22.136  -15.782 -82.755  1.00 15.86 ? 228  TYR B CB  1 
ATOM   3843 C CG  . TYR B 1 208 ? 23.403  -16.608 -82.740  1.00 18.12 ? 228  TYR B CG  1 
ATOM   3844 C CD1 . TYR B 1 208 ? 23.633  -17.580 -83.707  1.00 18.71 ? 228  TYR B CD1 1 
ATOM   3845 C CD2 . TYR B 1 208 ? 24.360  -16.434 -81.742  1.00 18.60 ? 228  TYR B CD2 1 
ATOM   3846 C CE1 . TYR B 1 208 ? 24.787  -18.345 -83.693  1.00 19.67 ? 228  TYR B CE1 1 
ATOM   3847 C CE2 . TYR B 1 208 ? 25.517  -17.194 -81.719  1.00 19.29 ? 228  TYR B CE2 1 
ATOM   3848 C CZ  . TYR B 1 208 ? 25.725  -18.148 -82.696  1.00 20.08 ? 228  TYR B CZ  1 
ATOM   3849 O OH  . TYR B 1 208 ? 26.870  -18.911 -82.684  1.00 22.25 ? 228  TYR B OH  1 
ATOM   3850 N N   . ILE B 1 209 ? 19.721  -14.267 -83.609  1.00 11.81 ? 229  ILE B N   1 
ATOM   3851 C CA  . ILE B 1 209 ? 18.597  -13.718 -82.868  1.00 12.24 ? 229  ILE B CA  1 
ATOM   3852 C C   . ILE B 1 209 ? 18.001  -14.838 -82.022  1.00 11.85 ? 229  ILE B C   1 
ATOM   3853 O O   . ILE B 1 209 ? 18.031  -16.011 -82.411  1.00 12.81 ? 229  ILE B O   1 
ATOM   3854 C CB  . ILE B 1 209 ? 17.517  -13.089 -83.772  1.00 12.62 ? 229  ILE B CB  1 
ATOM   3855 C CG1 . ILE B 1 209 ? 17.004  -14.088 -84.805  1.00 13.52 ? 229  ILE B CG1 1 
ATOM   3856 C CG2 . ILE B 1 209 ? 18.059  -11.851 -84.469  1.00 12.38 ? 229  ILE B CG2 1 
ATOM   3857 C CD1 . ILE B 1 209 ? 15.626  -13.745 -85.312  1.00 15.18 ? 229  ILE B CD1 1 
ATOM   3858 N N   . LEU B 1 210 ? 17.489  -14.469 -80.853  1.00 11.32 ? 230  LEU B N   1 
ATOM   3859 C CA  . LEU B 1 210 ? 16.806  -15.402 -79.971  1.00 10.77 ? 230  LEU B CA  1 
ATOM   3860 C C   . LEU B 1 210 ? 15.329  -15.069 -80.013  1.00 10.36 ? 230  LEU B C   1 
ATOM   3861 O O   . LEU B 1 210 ? 14.947  -13.936 -79.725  1.00 10.38 ? 230  LEU B O   1 
ATOM   3862 C CB  . LEU B 1 210 ? 17.336  -15.270 -78.545  1.00 11.68 ? 230  LEU B CB  1 
ATOM   3863 C CG  . LEU B 1 210 ? 16.689  -16.152 -77.473  1.00 12.09 ? 230  LEU B CG  1 
ATOM   3864 C CD1 . LEU B 1 210 ? 16.933  -17.630 -77.734  1.00 12.26 ? 230  LEU B CD1 1 
ATOM   3865 C CD2 . LEU B 1 210 ? 17.217  -15.760 -76.103  1.00 12.64 ? 230  LEU B CD2 1 
ATOM   3866 N N   . ALA B 1 211 ? 14.506  -16.051 -80.375  1.00 10.03 ? 231  ALA B N   1 
ATOM   3867 C CA  . ALA B 1 211 ? 13.072  -15.843 -80.536  1.00 9.63  ? 231  ALA B CA  1 
ATOM   3868 C C   . ALA B 1 211 ? 12.272  -16.784 -79.642  1.00 9.58  ? 231  ALA B C   1 
ATOM   3869 O O   . ALA B 1 211 ? 12.545  -17.985 -79.587  1.00 10.78 ? 231  ALA B O   1 
ATOM   3870 C CB  . ALA B 1 211 ? 12.671  -16.037 -81.991  1.00 9.74  ? 231  ALA B CB  1 
ATOM   3871 N N   . ALA B 1 212 ? 11.289  -16.225 -78.941  1.00 9.25  ? 232  ALA B N   1 
ATOM   3872 C CA  . ALA B 1 212 ? 10.375  -17.004 -78.118  1.00 9.21  ? 232  ALA B CA  1 
ATOM   3873 C C   . ALA B 1 212 ? 9.042   -17.130 -78.838  1.00 9.32  ? 232  ALA B C   1 
ATOM   3874 O O   . ALA B 1 212 ? 8.556   -16.156 -79.415  1.00 9.29  ? 232  ALA B O   1 
ATOM   3875 C CB  . ALA B 1 212 ? 10.178  -16.326 -76.773  1.00 10.07 ? 232  ALA B CB  1 
ATOM   3876 N N   . THR B 1 213 ? 8.457   -18.326 -78.806  1.00 9.83  ? 233  THR B N   1 
ATOM   3877 C CA  . THR B 1 213 ? 7.123   -18.548 -79.362  1.00 10.38 ? 233  THR B CA  1 
ATOM   3878 C C   . THR B 1 213 ? 6.205   -19.134 -78.299  1.00 10.44 ? 233  THR B C   1 
ATOM   3879 O O   . THR B 1 213 ? 6.668   -19.813 -77.380  1.00 11.14 ? 233  THR B O   1 
ATOM   3880 C CB  . THR B 1 213 ? 7.156   -19.485 -80.586  1.00 11.44 ? 233  THR B CB  1 
ATOM   3881 O OG1 . THR B 1 213 ? 8.026   -20.595 -80.328  1.00 13.23 ? 233  THR B OG1 1 
ATOM   3882 C CG2 . THR B 1 213 ? 7.642   -18.733 -81.820  1.00 11.83 ? 233  THR B CG2 1 
ATOM   3883 N N   . LEU B 1 214 ? 4.903   -18.889 -78.442  1.00 10.33 ? 234  LEU B N   1 
ATOM   3884 C CA  . LEU B 1 214 ? 3.919   -19.292 -77.432  1.00 10.91 ? 234  LEU B CA  1 
ATOM   3885 C C   . LEU B 1 214 ? 3.510   -20.766 -77.541  1.00 11.39 ? 234  LEU B C   1 
ATOM   3886 O O   . LEU B 1 214 ? 2.350   -21.120 -77.322  1.00 12.76 ? 234  LEU B O   1 
ATOM   3887 C CB  . LEU B 1 214 ? 2.689   -18.377 -77.482  1.00 10.70 ? 234  LEU B CB  1 
ATOM   3888 C CG  . LEU B 1 214 ? 2.946   -16.893 -77.199  1.00 10.76 ? 234  LEU B CG  1 
ATOM   3889 C CD1 . LEU B 1 214 ? 1.654   -16.102 -77.310  1.00 11.25 ? 234  LEU B CD1 1 
ATOM   3890 C CD2 . LEU B 1 214 ? 3.573   -16.691 -75.826  1.00 10.74 ? 234  LEU B CD2 1 
ATOM   3891 N N   . ASP B 1 215 ? 4.482   -21.615 -77.866  1.00 12.28 ? 235  ASP B N   1 
ATOM   3892 C CA  . ASP B 1 215 ? 4.340   -23.064 -77.783  1.00 12.70 ? 235  ASP B CA  1 
ATOM   3893 C C   . ASP B 1 215 ? 5.442   -23.612 -76.869  1.00 12.65 ? 235  ASP B C   1 
ATOM   3894 O O   . ASP B 1 215 ? 5.978   -24.699 -77.102  1.00 13.46 ? 235  ASP B O   1 
ATOM   3895 C CB  . ASP B 1 215 ? 4.398   -23.699 -79.181  1.00 13.21 ? 235  ASP B CB  1 
ATOM   3896 C CG  . ASP B 1 215 ? 5.703   -23.408 -79.918  1.00 13.95 ? 235  ASP B CG  1 
ATOM   3897 O OD1 . ASP B 1 215 ? 6.538   -22.641 -79.394  1.00 14.38 ? 235  ASP B OD1 1 
ATOM   3898 O OD2 . ASP B 1 215 ? 5.890   -23.951 -81.028  1.00 16.07 ? 235  ASP B OD2 1 
ATOM   3899 N N   . ASN B 1 216 ? 5.775   -22.837 -75.835  1.00 12.00 ? 236  ASN B N   1 
ATOM   3900 C CA  . ASN B 1 216 ? 6.762   -23.227 -74.826  1.00 12.10 ? 236  ASN B CA  1 
ATOM   3901 C C   . ASN B 1 216 ? 8.156   -23.465 -75.408  1.00 12.40 ? 236  ASN B C   1 
ATOM   3902 O O   . ASN B 1 216 ? 8.866   -24.377 -74.980  1.00 13.48 ? 236  ASN B O   1 
ATOM   3903 C CB  . ASN B 1 216 ? 6.280   -24.477 -74.075  1.00 11.96 ? 236  ASN B CB  1 
ATOM   3904 C CG  . ASN B 1 216 ? 4.829   -24.372 -73.645  1.00 11.93 ? 236  ASN B CG  1 
ATOM   3905 O OD1 . ASN B 1 216 ? 4.487   -23.556 -72.793  1.00 11.86 ? 236  ASN B OD1 1 
ATOM   3906 N ND2 . ASN B 1 216 ? 3.967   -25.191 -74.239  1.00 12.40 ? 236  ASN B ND2 1 
ATOM   3907 N N   . THR B 1 217 ? 8.552   -22.633 -76.371  1.00 12.61 ? 237  THR B N   1 
ATOM   3908 C CA  . THR B 1 217 ? 9.793   -22.853 -77.109  1.00 12.85 ? 237  THR B CA  1 
ATOM   3909 C C   . THR B 1 217 ? 10.592  -21.567 -77.321  1.00 12.62 ? 237  THR B C   1 
ATOM   3910 O O   . THR B 1 217 ? 10.040  -20.539 -77.712  1.00 13.38 ? 237  THR B O   1 
ATOM   3911 C CB  . THR B 1 217 ? 9.503   -23.477 -78.491  1.00 13.58 ? 237  THR B CB  1 
ATOM   3912 O OG1 . THR B 1 217 ? 8.624   -24.600 -78.341  1.00 14.13 ? 237  THR B OG1 1 
ATOM   3913 C CG2 . THR B 1 217 ? 10.784  -23.942 -79.157  1.00 13.89 ? 237  THR B CG2 1 
ATOM   3914 N N   . LEU B 1 218 ? 11.894  -21.644 -77.049  1.00 12.51 ? 238  LEU B N   1 
ATOM   3915 C CA  . LEU B 1 218 ? 12.851  -20.616 -77.455  1.00 13.40 ? 238  LEU B CA  1 
ATOM   3916 C C   . LEU B 1 218 ? 13.701  -21.185 -78.582  1.00 13.72 ? 238  LEU B C   1 
ATOM   3917 O O   . LEU B 1 218 ? 14.029  -22.372 -78.570  1.00 14.42 ? 238  LEU B O   1 
ATOM   3918 C CB  . LEU B 1 218 ? 13.753  -20.219 -76.287  1.00 13.37 ? 238  LEU B CB  1 
ATOM   3919 C CG  . LEU B 1 218 ? 13.180  -19.228 -75.275  1.00 13.46 ? 238  LEU B CG  1 
ATOM   3920 C CD1 . LEU B 1 218 ? 13.936  -19.316 -73.959  1.00 14.58 ? 238  LEU B CD1 1 
ATOM   3921 C CD2 . LEU B 1 218 ? 13.223  -17.811 -75.828  1.00 13.23 ? 238  LEU B CD2 1 
ATOM   3922 N N   . LYS B 1 219 ? 14.057  -20.344 -79.549  1.00 13.94 ? 239  LYS B N   1 
ATOM   3923 C CA  . LYS B 1 219 ? 14.853  -20.783 -80.694  1.00 14.66 ? 239  LYS B CA  1 
ATOM   3924 C C   . LYS B 1 219 ? 15.966  -19.794 -81.018  1.00 14.14 ? 239  LYS B C   1 
ATOM   3925 O O   . LYS B 1 219 ? 15.745  -18.581 -81.052  1.00 14.17 ? 239  LYS B O   1 
ATOM   3926 C CB  . LYS B 1 219 ? 13.961  -20.984 -81.920  1.00 16.31 ? 239  LYS B CB  1 
ATOM   3927 C CG  . LYS B 1 219 ? 12.954  -22.113 -81.767  1.00 17.58 ? 239  LYS B CG  1 
ATOM   3928 C CD  . LYS B 1 219 ? 12.279  -22.454 -83.087  1.00 19.86 ? 239  LYS B CD  1 
ATOM   3929 C CE  . LYS B 1 219 ? 11.076  -23.361 -82.878  1.00 21.36 ? 239  LYS B CE  1 
ATOM   3930 N NZ  . LYS B 1 219 ? 9.869   -22.604 -82.443  1.00 23.44 ? 239  LYS B NZ  1 
ATOM   3931 N N   . LEU B 1 220 ? 17.164  -20.327 -81.245  1.00 14.05 ? 240  LEU B N   1 
ATOM   3932 C CA  . LEU B 1 220 ? 18.308  -19.536 -81.680  1.00 14.13 ? 240  LEU B CA  1 
ATOM   3933 C C   . LEU B 1 220 ? 18.410  -19.645 -83.197  1.00 14.26 ? 240  LEU B C   1 
ATOM   3934 O O   . LEU B 1 220 ? 18.512  -20.748 -83.733  1.00 14.99 ? 240  LEU B O   1 
ATOM   3935 C CB  . LEU B 1 220 ? 19.588  -20.051 -81.023  1.00 13.90 ? 240  LEU B CB  1 
ATOM   3936 C CG  . LEU B 1 220 ? 20.851  -19.206 -81.197  1.00 14.15 ? 240  LEU B CG  1 
ATOM   3937 C CD1 . LEU B 1 220 ? 20.763  -17.923 -80.385  1.00 14.05 ? 240  LEU B CD1 1 
ATOM   3938 C CD2 . LEU B 1 220 ? 22.080  -20.007 -80.797  1.00 14.73 ? 240  LEU B CD2 1 
ATOM   3939 N N   . TRP B 1 221 ? 18.374  -18.502 -83.880  1.00 14.50 ? 241  TRP B N   1 
ATOM   3940 C CA  . TRP B 1 221 ? 18.380  -18.462 -85.341  1.00 15.14 ? 241  TRP B CA  1 
ATOM   3941 C C   . TRP B 1 221 ? 19.643  -17.820 -85.890  1.00 14.92 ? 241  TRP B C   1 
ATOM   3942 O O   . TRP B 1 221 ? 20.136  -16.833 -85.344  1.00 14.85 ? 241  TRP B O   1 
ATOM   3943 C CB  . TRP B 1 221 ? 17.194  -17.645 -85.860  1.00 14.90 ? 241  TRP B CB  1 
ATOM   3944 C CG  . TRP B 1 221 ? 15.862  -18.297 -85.729  1.00 16.46 ? 241  TRP B CG  1 
ATOM   3945 C CD1 . TRP B 1 221 ? 15.130  -18.447 -84.587  1.00 16.51 ? 241  TRP B CD1 1 
ATOM   3946 C CD2 . TRP B 1 221 ? 15.077  -18.858 -86.787  1.00 17.18 ? 241  TRP B CD2 1 
ATOM   3947 N NE1 . TRP B 1 221 ? 13.944  -19.082 -84.866  1.00 17.65 ? 241  TRP B NE1 1 
ATOM   3948 C CE2 . TRP B 1 221 ? 13.886  -19.347 -86.210  1.00 17.85 ? 241  TRP B CE2 1 
ATOM   3949 C CE3 . TRP B 1 221 ? 15.270  -19.004 -88.168  1.00 17.64 ? 241  TRP B CE3 1 
ATOM   3950 C CZ2 . TRP B 1 221 ? 12.889  -19.971 -86.964  1.00 18.30 ? 241  TRP B CZ2 1 
ATOM   3951 C CZ3 . TRP B 1 221 ? 14.277  -19.625 -88.918  1.00 17.91 ? 241  TRP B CZ3 1 
ATOM   3952 C CH2 . TRP B 1 221 ? 13.102  -20.101 -88.313  1.00 18.33 ? 241  TRP B CH2 1 
ATOM   3953 N N   . ASP B 1 222 ? 20.155  -18.390 -86.977  1.00 15.58 ? 242  ASP B N   1 
ATOM   3954 C CA  . ASP B 1 222 ? 21.057  -17.684 -87.873  1.00 16.45 ? 242  ASP B CA  1 
ATOM   3955 C C   . ASP B 1 222 ? 20.147  -16.936 -88.841  1.00 16.74 ? 242  ASP B C   1 
ATOM   3956 O O   . ASP B 1 222 ? 19.543  -17.541 -89.725  1.00 17.07 ? 242  ASP B O   1 
ATOM   3957 C CB  . ASP B 1 222 ? 21.964  -18.671 -88.619  1.00 17.55 ? 242  ASP B CB  1 
ATOM   3958 C CG  . ASP B 1 222 ? 23.020  -17.978 -89.469  1.00 18.83 ? 242  ASP B CG  1 
ATOM   3959 O OD1 . ASP B 1 222 ? 22.708  -16.952 -90.107  1.00 19.28 ? 242  ASP B OD1 1 
ATOM   3960 O OD2 . ASP B 1 222 ? 24.167  -18.472 -89.509  1.00 21.48 ? 242  ASP B OD2 1 
ATOM   3961 N N   . TYR B 1 223 ? 20.033  -15.623 -88.651  1.00 16.93 ? 243  TYR B N   1 
ATOM   3962 C CA  . TYR B 1 223 ? 19.086  -14.809 -89.427  1.00 17.55 ? 243  TYR B CA  1 
ATOM   3963 C C   . TYR B 1 223 ? 19.579  -14.476 -90.839  1.00 18.06 ? 243  TYR B C   1 
ATOM   3964 O O   . TYR B 1 223 ? 18.796  -14.016 -91.670  1.00 19.63 ? 243  TYR B O   1 
ATOM   3965 C CB  . TYR B 1 223 ? 18.698  -13.527 -88.672  1.00 17.45 ? 243  TYR B CB  1 
ATOM   3966 C CG  . TYR B 1 223 ? 19.845  -12.591 -88.355  1.00 17.51 ? 243  TYR B CG  1 
ATOM   3967 C CD1 . TYR B 1 223 ? 20.229  -11.598 -89.252  1.00 18.15 ? 243  TYR B CD1 1 
ATOM   3968 C CD2 . TYR B 1 223 ? 20.536  -12.690 -87.151  1.00 17.58 ? 243  TYR B CD2 1 
ATOM   3969 C CE1 . TYR B 1 223 ? 21.276  -10.740 -88.963  1.00 18.49 ? 243  TYR B CE1 1 
ATOM   3970 C CE2 . TYR B 1 223 ? 21.584  -11.839 -86.853  1.00 17.42 ? 243  TYR B CE2 1 
ATOM   3971 C CZ  . TYR B 1 223 ? 21.950  -10.865 -87.760  1.00 17.96 ? 243  TYR B CZ  1 
ATOM   3972 O OH  . TYR B 1 223 ? 22.990  -10.019 -87.460  1.00 20.35 ? 243  TYR B OH  1 
ATOM   3973 N N   . SER B 1 224 ? 20.864  -14.696 -91.106  1.00 17.97 ? 244  SER B N   1 
ATOM   3974 C CA  . SER B 1 224 ? 21.404  -14.548 -92.460  1.00 19.49 ? 244  SER B CA  1 
ATOM   3975 C C   . SER B 1 224 ? 20.989  -15.738 -93.323  1.00 19.73 ? 244  SER B C   1 
ATOM   3976 O O   . SER B 1 224 ? 20.416  -15.565 -94.401  1.00 20.55 ? 244  SER B O   1 
ATOM   3977 C CB  . SER B 1 224 ? 22.928  -14.435 -92.424  1.00 20.79 ? 244  SER B CB  1 
ATOM   3978 O OG  . SER B 1 224 ? 23.456  -14.242 -93.725  1.00 23.36 ? 244  SER B OG  1 
ATOM   3979 N N   . LYS B 1 225 ? 21.281  -16.942 -92.837  1.00 19.19 ? 245  LYS B N   1 
ATOM   3980 C CA  . LYS B 1 225 ? 20.872  -18.174 -93.511  1.00 19.74 ? 245  LYS B CA  1 
ATOM   3981 C C   . LYS B 1 225 ? 19.361  -18.404 -93.418  1.00 19.64 ? 245  LYS B C   1 
ATOM   3982 O O   . LYS B 1 225 ? 18.779  -19.064 -94.279  1.00 21.33 ? 245  LYS B O   1 
ATOM   3983 C CB  . LYS B 1 225 ? 21.597  -19.383 -92.910  1.00 20.24 ? 245  LYS B CB  1 
ATOM   3984 C CG  . LYS B 1 225 ? 23.101  -19.396 -93.123  1.00 21.53 ? 245  LYS B CG  1 
ATOM   3985 C CD  . LYS B 1 225 ? 23.697  -20.704 -92.629  1.00 22.52 ? 245  LYS B CD  1 
ATOM   3986 C CE  . LYS B 1 225 ? 25.204  -20.748 -92.809  1.00 23.27 ? 245  LYS B CE  1 
ATOM   3987 N NZ  . LYS B 1 225 ? 25.782  -21.977 -92.196  1.00 23.69 ? 245  LYS B NZ  1 
ATOM   3988 N N   . GLY B 1 226 ? 18.735  -17.863 -92.374  1.00 20.29 ? 246  GLY B N   1 
ATOM   3989 C CA  . GLY B 1 226 ? 17.317  -18.095 -92.118  1.00 20.20 ? 246  GLY B CA  1 
ATOM   3990 C C   . GLY B 1 226 ? 17.102  -19.512 -91.624  1.00 20.75 ? 246  GLY B C   1 
ATOM   3991 O O   . GLY B 1 226 ? 16.218  -20.222 -92.104  1.00 22.29 ? 246  GLY B O   1 
ATOM   3992 N N   . LYS B 1 227 ? 17.919  -19.913 -90.653  1.00 20.94 ? 247  LYS B N   1 
ATOM   3993 C CA  . LYS B 1 227 ? 17.966  -21.294 -90.186  1.00 21.68 ? 247  LYS B CA  1 
ATOM   3994 C C   . LYS B 1 227 ? 17.980  -21.346 -88.662  1.00 20.66 ? 247  LYS B C   1 
ATOM   3995 O O   . LYS B 1 227 ? 18.711  -20.595 -88.014  1.00 19.13 ? 247  LYS B O   1 
ATOM   3996 C CB  . LYS B 1 227 ? 19.204  -21.984 -90.771  1.00 23.70 ? 247  LYS B CB  1 
ATOM   3997 C CG  . LYS B 1 227 ? 19.729  -23.184 -89.995  1.00 25.37 ? 247  LYS B CG  1 
ATOM   3998 C CD  . LYS B 1 227 ? 20.793  -23.920 -90.795  1.00 27.74 ? 247  LYS B CD  1 
ATOM   3999 C CE  . LYS B 1 227 ? 21.727  -24.713 -89.895  1.00 26.56 ? 247  LYS B CE  1 
ATOM   4000 N NZ  . LYS B 1 227 ? 22.705  -25.514 -90.682  1.00 29.85 ? 247  LYS B NZ  1 
ATOM   4001 N N   . CYS B 1 228 ? 17.164  -22.236 -88.101  1.00 20.61 ? 248  CYS B N   1 
ATOM   4002 C CA  . CYS B 1 228 ? 17.134  -22.463 -86.660  1.00 20.80 ? 248  CYS B CA  1 
ATOM   4003 C C   . CYS B 1 228 ? 18.289  -23.373 -86.264  1.00 20.45 ? 248  CYS B C   1 
ATOM   4004 O O   . CYS B 1 228 ? 18.412  -24.488 -86.777  1.00 21.44 ? 248  CYS B O   1 
ATOM   4005 C CB  . CYS B 1 228 ? 15.809  -23.097 -86.238  1.00 21.24 ? 248  CYS B CB  1 
ATOM   4006 S SG  . CYS B 1 228 ? 15.683  -23.420 -84.463  1.00 24.01 ? 248  CYS B SG  1 
ATOM   4007 N N   . LEU B 1 229 ? 19.131  -22.890 -85.353  1.00 19.80 ? 249  LEU B N   1 
ATOM   4008 C CA  . LEU B 1 229 ? 20.308  -23.627 -84.903  1.00 20.88 ? 249  LEU B CA  1 
ATOM   4009 C C   . LEU B 1 229 ? 19.994  -24.459 -83.664  1.00 21.65 ? 249  LEU B C   1 
ATOM   4010 O O   . LEU B 1 229 ? 20.261  -25.661 -83.635  1.00 22.89 ? 249  LEU B O   1 
ATOM   4011 C CB  . LEU B 1 229 ? 21.453  -22.658 -84.595  1.00 21.00 ? 249  LEU B CB  1 
ATOM   4012 C CG  . LEU B 1 229 ? 21.876  -21.707 -85.718  1.00 21.44 ? 249  LEU B CG  1 
ATOM   4013 C CD1 . LEU B 1 229 ? 22.899  -20.710 -85.200  1.00 20.81 ? 249  LEU B CD1 1 
ATOM   4014 C CD2 . LEU B 1 229 ? 22.428  -22.466 -86.916  1.00 21.84 ? 249  LEU B CD2 1 
ATOM   4015 N N   . LYS B 1 230 ? 19.430  -23.807 -82.648  1.00 21.32 ? 250  LYS B N   1 
ATOM   4016 C CA  . LYS B 1 230 ? 19.140  -24.442 -81.362  1.00 21.31 ? 250  LYS B CA  1 
ATOM   4017 C C   . LYS B 1 230 ? 17.677  -24.250 -80.972  1.00 19.78 ? 250  LYS B C   1 
ATOM   4018 O O   . LYS B 1 230 ? 17.018  -23.315 -81.428  1.00 18.97 ? 250  LYS B O   1 
ATOM   4019 C CB  . LYS B 1 230 ? 20.012  -23.841 -80.254  1.00 22.21 ? 250  LYS B CB  1 
ATOM   4020 C CG  . LYS B 1 230 ? 21.493  -23.686 -80.576  1.00 24.61 ? 250  LYS B CG  1 
ATOM   4021 C CD  . LYS B 1 230 ? 22.293  -24.945 -80.289  1.00 24.92 ? 250  LYS B CD  1 
ATOM   4022 C CE  . LYS B 1 230 ? 23.777  -24.625 -80.197  1.00 24.75 ? 250  LYS B CE  1 
ATOM   4023 N NZ  . LYS B 1 230 ? 24.623  -25.846 -80.256  1.00 26.60 ? 250  LYS B NZ  1 
ATOM   4024 N N   . THR B 1 231 ? 17.188  -25.143 -80.116  1.00 18.22 ? 251  THR B N   1 
ATOM   4025 C CA  . THR B 1 231 ? 15.859  -25.030 -79.524  1.00 18.28 ? 251  THR B CA  1 
ATOM   4026 C C   . THR B 1 231 ? 15.935  -25.309 -78.021  1.00 17.07 ? 251  THR B C   1 
ATOM   4027 O O   . THR B 1 231 ? 16.473  -26.334 -77.606  1.00 17.84 ? 251  THR B O   1 
ATOM   4028 C CB  . THR B 1 231 ? 14.881  -26.020 -80.181  1.00 19.36 ? 251  THR B CB  1 
ATOM   4029 O OG1 . THR B 1 231 ? 14.862  -25.805 -81.598  1.00 21.24 ? 251  THR B OG1 1 
ATOM   4030 C CG2 . THR B 1 231 ? 13.479  -25.836 -79.635  1.00 19.62 ? 251  THR B CG2 1 
ATOM   4031 N N   . TYR B 1 232 ? 15.392  -24.400 -77.211  1.00 14.48 ? 252  TYR B N   1 
ATOM   4032 C CA  . TYR B 1 232 ? 15.398  -24.547 -75.751  1.00 13.83 ? 252  TYR B CA  1 
ATOM   4033 C C   . TYR B 1 232 ? 13.975  -24.732 -75.235  1.00 13.46 ? 252  TYR B C   1 
ATOM   4034 O O   . TYR B 1 232 ? 13.078  -23.953 -75.569  1.00 13.71 ? 252  TYR B O   1 
ATOM   4035 C CB  . TYR B 1 232 ? 16.043  -23.327 -75.088  1.00 13.63 ? 252  TYR B CB  1 
ATOM   4036 C CG  . TYR B 1 232 ? 17.365  -22.941 -75.705  1.00 13.79 ? 252  TYR B CG  1 
ATOM   4037 C CD1 . TYR B 1 232 ? 18.557  -23.494 -75.249  1.00 13.94 ? 252  TYR B CD1 1 
ATOM   4038 C CD2 . TYR B 1 232 ? 17.422  -22.031 -76.758  1.00 14.41 ? 252  TYR B CD2 1 
ATOM   4039 C CE1 . TYR B 1 232 ? 19.769  -23.149 -75.821  1.00 14.04 ? 252  TYR B CE1 1 
ATOM   4040 C CE2 . TYR B 1 232 ? 18.630  -21.679 -77.335  1.00 14.52 ? 252  TYR B CE2 1 
ATOM   4041 C CZ  . TYR B 1 232 ? 19.800  -22.241 -76.864  1.00 14.72 ? 252  TYR B CZ  1 
ATOM   4042 O OH  . TYR B 1 232 ? 21.002  -21.896 -77.432  1.00 14.93 ? 252  TYR B OH  1 
ATOM   4043 N N   . THR B 1 233 ? 13.775  -25.773 -74.429  1.00 13.05 ? 253  THR B N   1 
ATOM   4044 C CA  . THR B 1 233 ? 12.448  -26.137 -73.931  1.00 13.52 ? 253  THR B CA  1 
ATOM   4045 C C   . THR B 1 233 ? 12.518  -26.599 -72.474  1.00 12.86 ? 253  THR B C   1 
ATOM   4046 O O   . THR B 1 233 ? 13.603  -26.701 -71.898  1.00 13.20 ? 253  THR B O   1 
ATOM   4047 C CB  . THR B 1 233 ? 11.824  -27.258 -74.788  1.00 14.21 ? 253  THR B CB  1 
ATOM   4048 O OG1 . THR B 1 233 ? 12.686  -28.401 -74.784  1.00 16.29 ? 253  THR B OG1 1 
ATOM   4049 C CG2 . THR B 1 233 ? 11.606  -26.792 -76.224  1.00 14.57 ? 253  THR B CG2 1 
ATOM   4050 N N   . GLY B 1 234 ? 11.350  -26.864 -71.891  1.00 13.24 ? 254  GLY B N   1 
ATOM   4051 C CA  . GLY B 1 234 ? 11.231  -27.310 -70.500  1.00 13.63 ? 254  GLY B CA  1 
ATOM   4052 C C   . GLY B 1 234 ? 10.449  -26.308 -69.670  1.00 13.82 ? 254  GLY B C   1 
ATOM   4053 O O   . GLY B 1 234 ? 9.787   -26.671 -68.698  1.00 15.53 ? 254  GLY B O   1 
ATOM   4054 N N   . HIS B 1 235 ? 10.558  -25.038 -70.048  1.00 13.35 ? 255  HIS B N   1 
ATOM   4055 C CA  . HIS B 1 235 ? 9.786   -23.952 -69.439  1.00 12.42 ? 255  HIS B CA  1 
ATOM   4056 C C   . HIS B 1 235 ? 8.340   -23.884 -69.948  1.00 11.91 ? 255  HIS B C   1 
ATOM   4057 O O   . HIS B 1 235 ? 7.947   -24.634 -70.843  1.00 12.24 ? 255  HIS B O   1 
ATOM   4058 C CB  . HIS B 1 235 ? 10.503  -22.612 -69.661  1.00 12.45 ? 255  HIS B CB  1 
ATOM   4059 C CG  . HIS B 1 235 ? 10.419  -22.090 -71.064  1.00 13.13 ? 255  HIS B CG  1 
ATOM   4060 N ND1 . HIS B 1 235 ? 10.807  -22.823 -72.166  1.00 13.25 ? 255  HIS B ND1 1 
ATOM   4061 C CD2 . HIS B 1 235 ? 10.014  -20.889 -71.540  1.00 13.72 ? 255  HIS B CD2 1 
ATOM   4062 C CE1 . HIS B 1 235 ? 10.629  -22.103 -73.258  1.00 13.59 ? 255  HIS B CE1 1 
ATOM   4063 N NE2 . HIS B 1 235 ? 10.152  -20.924 -72.906  1.00 13.83 ? 255  HIS B NE2 1 
ATOM   4064 N N   . LYS B 1 236 ? 7.554   -22.987 -69.355  1.00 11.55 ? 256  LYS B N   1 
ATOM   4065 C CA  . LYS B 1 236 ? 6.148   -22.802 -69.715  1.00 12.16 ? 256  LYS B CA  1 
ATOM   4066 C C   . LYS B 1 236 ? 5.947   -21.408 -70.302  1.00 11.47 ? 256  LYS B C   1 
ATOM   4067 O O   . LYS B 1 236 ? 6.212   -20.409 -69.635  1.00 11.05 ? 256  LYS B O   1 
ATOM   4068 C CB  . LYS B 1 236 ? 5.268   -22.980 -68.475  1.00 13.66 ? 256  LYS B CB  1 
ATOM   4069 C CG  . LYS B 1 236 ? 3.767   -22.964 -68.727  1.00 15.46 ? 256  LYS B CG  1 
ATOM   4070 C CD  . LYS B 1 236 ? 3.007   -22.957 -67.409  1.00 18.16 ? 256  LYS B CD  1 
ATOM   4071 C CE  . LYS B 1 236 ? 1.503   -22.865 -67.608  1.00 20.79 ? 256  LYS B CE  1 
ATOM   4072 N NZ  . LYS B 1 236 ? 0.914   -24.152 -68.067  1.00 23.21 ? 256  LYS B NZ  1 
ATOM   4073 N N   . ASN B 1 237 ? 5.477   -21.342 -71.545  1.00 10.99 ? 257  ASN B N   1 
ATOM   4074 C CA  . ASN B 1 237 ? 5.227   -20.063 -72.206  1.00 11.49 ? 257  ASN B CA  1 
ATOM   4075 C C   . ASN B 1 237 ? 4.209   -20.204 -73.337  1.00 11.28 ? 257  ASN B C   1 
ATOM   4076 O O   . ASN B 1 237 ? 4.570   -20.511 -74.474  1.00 11.17 ? 257  ASN B O   1 
ATOM   4077 C CB  . ASN B 1 237 ? 6.541   -19.473 -72.728  1.00 11.49 ? 257  ASN B CB  1 
ATOM   4078 C CG  . ASN B 1 237 ? 6.407   -18.026 -73.174  1.00 11.82 ? 257  ASN B CG  1 
ATOM   4079 O OD1 . ASN B 1 237 ? 5.430   -17.342 -72.854  1.00 11.73 ? 257  ASN B OD1 1 
ATOM   4080 N ND2 . ASN B 1 237 ? 7.405   -17.546 -73.903  1.00 11.41 ? 257  ASN B ND2 1 
ATOM   4081 N N   . GLU B 1 238 ? 2.936   -20.008 -72.998  1.00 11.94 ? 258  GLU B N   1 
ATOM   4082 C CA  . GLU B 1 238 ? 1.839   -20.038 -73.969  1.00 12.66 ? 258  GLU B CA  1 
ATOM   4083 C C   . GLU B 1 238 ? 0.968   -18.777 -73.962  1.00 12.16 ? 258  GLU B C   1 
ATOM   4084 O O   . GLU B 1 238 ? 0.104   -18.631 -74.824  1.00 13.41 ? 258  GLU B O   1 
ATOM   4085 C CB  . GLU B 1 238 ? 0.932   -21.242 -73.695  1.00 14.34 ? 258  GLU B CB  1 
ATOM   4086 C CG  . GLU B 1 238 ? 1.630   -22.587 -73.790  1.00 15.68 ? 258  GLU B CG  1 
ATOM   4087 C CD  . GLU B 1 238 ? 0.690   -23.764 -73.590  1.00 16.86 ? 258  GLU B CD  1 
ATOM   4088 O OE1 . GLU B 1 238 ? -0.411  -23.574 -73.032  1.00 18.92 ? 258  GLU B OE1 1 
ATOM   4089 O OE2 . GLU B 1 238 ? 1.060   -24.889 -73.988  1.00 18.51 ? 258  GLU B OE2 1 
ATOM   4090 N N   . LYS B 1 239 ? 1.187   -17.872 -73.007  1.00 12.23 ? 259  LYS B N   1 
ATOM   4091 C CA  . LYS B 1 239 ? 0.240   -16.780 -72.761  1.00 12.23 ? 259  LYS B CA  1 
ATOM   4092 C C   . LYS B 1 239 ? 0.829   -15.366 -72.731  1.00 11.01 ? 259  LYS B C   1 
ATOM   4093 O O   . LYS B 1 239 ? 0.119   -14.412 -73.039  1.00 11.45 ? 259  LYS B O   1 
ATOM   4094 C CB  . LYS B 1 239 ? -0.510  -17.028 -71.446  1.00 13.17 ? 259  LYS B CB  1 
ATOM   4095 C CG  . LYS B 1 239 ? -1.362  -18.291 -71.428  1.00 14.88 ? 259  LYS B CG  1 
ATOM   4096 C CD  . LYS B 1 239 ? -2.543  -18.198 -72.384  1.00 16.76 ? 259  LYS B CD  1 
ATOM   4097 C CE  . LYS B 1 239 ? -3.420  -19.439 -72.315  1.00 18.82 ? 259  LYS B CE  1 
ATOM   4098 N NZ  . LYS B 1 239 ? -4.479  -19.432 -73.363  1.00 22.27 ? 259  LYS B NZ  1 
ATOM   4099 N N   . TYR B 1 240 ? 2.098   -15.226 -72.352  1.00 9.75  ? 260  TYR B N   1 
ATOM   4100 C CA  . TYR B 1 240 ? 2.688   -13.911 -72.110  1.00 9.18  ? 260  TYR B CA  1 
ATOM   4101 C C   . TYR B 1 240 ? 3.950   -13.670 -72.921  1.00 8.45  ? 260  TYR B C   1 
ATOM   4102 O O   . TYR B 1 240 ? 4.642   -14.610 -73.312  1.00 9.10  ? 260  TYR B O   1 
ATOM   4103 C CB  . TYR B 1 240 ? 3.009   -13.758 -70.625  1.00 9.30  ? 260  TYR B CB  1 
ATOM   4104 C CG  . TYR B 1 240 ? 1.784   -13.769 -69.745  1.00 9.54  ? 260  TYR B CG  1 
ATOM   4105 C CD1 . TYR B 1 240 ? 1.053   -12.605 -69.517  1.00 9.64  ? 260  TYR B CD1 1 
ATOM   4106 C CD2 . TYR B 1 240 ? 1.347   -14.947 -69.146  1.00 9.71  ? 260  TYR B CD2 1 
ATOM   4107 C CE1 . TYR B 1 240 ? -0.074  -12.614 -68.712  1.00 10.04 ? 260  TYR B CE1 1 
ATOM   4108 C CE2 . TYR B 1 240 ? 0.221   -14.967 -68.343  1.00 10.19 ? 260  TYR B CE2 1 
ATOM   4109 C CZ  . TYR B 1 240 ? -0.484  -13.799 -68.125  1.00 10.30 ? 260  TYR B CZ  1 
ATOM   4110 O OH  . TYR B 1 240 ? -1.604  -13.822 -67.327  1.00 11.62 ? 260  TYR B OH  1 
ATOM   4111 N N   . CYS B 1 241 ? 4.239   -12.395 -73.163  1.00 7.87  ? 261  CYS B N   1 
ATOM   4112 C CA  . CYS B 1 241 ? 5.442   -11.993 -73.874  1.00 7.85  ? 261  CYS B CA  1 
ATOM   4113 C C   . CYS B 1 241 ? 6.577   -11.834 -72.880  1.00 7.67  ? 261  CYS B C   1 
ATOM   4114 O O   . CYS B 1 241 ? 6.838   -10.742 -72.366  1.00 8.10  ? 261  CYS B O   1 
ATOM   4115 C CB  . CYS B 1 241 ? 5.195   -10.713 -74.667  1.00 8.31  ? 261  CYS B CB  1 
ATOM   4116 S SG  . CYS B 1 241 ? 4.071   -10.986 -76.051  1.00 9.90  ? 261  CYS B SG  1 
ATOM   4117 N N   . ILE B 1 242 ? 7.235   -12.956 -72.618  1.00 7.73  ? 262  ILE B N   1 
ATOM   4118 C CA  . ILE B 1 242 ? 8.277   -13.052 -71.610  1.00 7.53  ? 262  ILE B CA  1 
ATOM   4119 C C   . ILE B 1 242 ? 9.637   -12.741 -72.228  1.00 8.07  ? 262  ILE B C   1 
ATOM   4120 O O   . ILE B 1 242 ? 9.985   -13.282 -73.280  1.00 8.48  ? 262  ILE B O   1 
ATOM   4121 C CB  . ILE B 1 242 ? 8.286   -14.463 -70.979  1.00 7.38  ? 262  ILE B CB  1 
ATOM   4122 C CG1 . ILE B 1 242 ? 6.954   -14.720 -70.264  1.00 7.67  ? 262  ILE B CG1 1 
ATOM   4123 C CG2 . ILE B 1 242 ? 9.443   -14.618 -70.004  1.00 7.63  ? 262  ILE B CG2 1 
ATOM   4124 C CD1 . ILE B 1 242 ? 6.782   -16.128 -69.734  1.00 7.84  ? 262  ILE B CD1 1 
ATOM   4125 N N   . PHE B 1 243 ? 10.403  -11.878 -71.563  1.00 8.06  ? 263  PHE B N   1 
ATOM   4126 C CA  . PHE B 1 243 ? 11.740  -11.511 -72.029  1.00 8.44  ? 263  PHE B CA  1 
ATOM   4127 C C   . PHE B 1 243 ? 12.698  -12.682 -71.839  1.00 8.84  ? 263  PHE B C   1 
ATOM   4128 O O   . PHE B 1 243 ? 12.630  -13.399 -70.841  1.00 9.64  ? 263  PHE B O   1 
ATOM   4129 C CB  . PHE B 1 243 ? 12.292  -10.304 -71.258  1.00 8.51  ? 263  PHE B CB  1 
ATOM   4130 C CG  . PHE B 1 243 ? 11.568  -9.012  -71.521  1.00 7.90  ? 263  PHE B CG  1 
ATOM   4131 C CD1 . PHE B 1 243 ? 10.441  -8.666  -70.787  1.00 7.86  ? 263  PHE B CD1 1 
ATOM   4132 C CD2 . PHE B 1 243 ? 12.034  -8.122  -72.477  1.00 7.65  ? 263  PHE B CD2 1 
ATOM   4133 C CE1 . PHE B 1 243 ? 9.786   -7.468  -71.011  1.00 7.75  ? 263  PHE B CE1 1 
ATOM   4134 C CE2 . PHE B 1 243 ? 11.382  -6.924  -72.710  1.00 7.46  ? 263  PHE B CE2 1 
ATOM   4135 C CZ  . PHE B 1 243 ? 10.254  -6.597  -71.976  1.00 7.66  ? 263  PHE B CZ  1 
ATOM   4136 N N   . ALA B 1 244 ? 13.592  -12.865 -72.802  1.00 9.36  ? 264  ALA B N   1 
ATOM   4137 C CA  . ALA B 1 244 ? 14.666  -13.840 -72.702  1.00 10.20 ? 264  ALA B CA  1 
ATOM   4138 C C   . ALA B 1 244 ? 15.976  -13.110 -72.949  1.00 10.09 ? 264  ALA B C   1 
ATOM   4139 O O   . ALA B 1 244 ? 15.982  -12.005 -73.497  1.00 10.33 ? 264  ALA B O   1 
ATOM   4140 C CB  . ALA B 1 244 ? 14.473  -14.963 -73.706  1.00 10.74 ? 264  ALA B CB  1 
ATOM   4141 N N   . ASN B 1 245 ? 17.083  -13.711 -72.524  1.00 10.31 ? 265  ASN B N   1 
ATOM   4142 C CA  . ASN B 1 245 ? 18.382  -13.048 -72.573  1.00 10.92 ? 265  ASN B CA  1 
ATOM   4143 C C   . ASN B 1 245 ? 19.516  -13.996 -72.909  1.00 10.99 ? 265  ASN B C   1 
ATOM   4144 O O   . ASN B 1 245 ? 19.418  -15.207 -72.692  1.00 11.58 ? 265  ASN B O   1 
ATOM   4145 C CB  . ASN B 1 245 ? 18.706  -12.389 -71.228  1.00 11.97 ? 265  ASN B CB  1 
ATOM   4146 C CG  . ASN B 1 245 ? 17.615  -11.452 -70.753  1.00 12.42 ? 265  ASN B CG  1 
ATOM   4147 O OD1 . ASN B 1 245 ? 17.692  -10.245 -70.958  1.00 13.67 ? 265  ASN B OD1 1 
ATOM   4148 N ND2 . ASN B 1 245 ? 16.584  -12.008 -70.128  1.00 13.59 ? 265  ASN B ND2 1 
ATOM   4149 N N   . PHE B 1 246 ? 20.585  -13.419 -73.446  1.00 10.94 ? 266  PHE B N   1 
ATOM   4150 C CA  . PHE B 1 246 ? 21.889  -14.060 -73.500  1.00 10.85 ? 266  PHE B CA  1 
ATOM   4151 C C   . PHE B 1 246 ? 22.665  -13.617 -72.270  1.00 11.31 ? 266  PHE B C   1 
ATOM   4152 O O   . PHE B 1 246 ? 22.804  -12.417 -72.023  1.00 12.14 ? 266  PHE B O   1 
ATOM   4153 C CB  . PHE B 1 246 ? 22.656  -13.623 -74.746  1.00 10.94 ? 266  PHE B CB  1 
ATOM   4154 C CG  . PHE B 1 246 ? 22.049  -14.095 -76.033  1.00 11.65 ? 266  PHE B CG  1 
ATOM   4155 C CD1 . PHE B 1 246 ? 21.038  -13.370 -76.650  1.00 11.54 ? 266  PHE B CD1 1 
ATOM   4156 C CD2 . PHE B 1 246 ? 22.499  -15.262 -76.639  1.00 11.86 ? 266  PHE B CD2 1 
ATOM   4157 C CE1 . PHE B 1 246 ? 20.483  -13.804 -77.842  1.00 11.82 ? 266  PHE B CE1 1 
ATOM   4158 C CE2 . PHE B 1 246 ? 21.949  -15.699 -77.830  1.00 12.54 ? 266  PHE B CE2 1 
ATOM   4159 C CZ  . PHE B 1 246 ? 20.940  -14.970 -78.433  1.00 12.21 ? 266  PHE B CZ  1 
ATOM   4160 N N   . SER B 1 247 ? 23.158  -14.582 -71.500  1.00 12.00 ? 267  SER B N   1 
ATOM   4161 C CA  . SER B 1 247 ? 24.048  -14.305 -70.379  1.00 12.38 ? 267  SER B CA  1 
ATOM   4162 C C   . SER B 1 247 ? 25.458  -14.719 -70.779  1.00 13.20 ? 267  SER B C   1 
ATOM   4163 O O   . SER B 1 247 ? 25.717  -15.904 -71.000  1.00 13.38 ? 267  SER B O   1 
ATOM   4164 C CB  . SER B 1 247 ? 23.600  -15.077 -69.142  1.00 12.23 ? 267  SER B CB  1 
ATOM   4165 O OG  . SER B 1 247 ? 24.446  -14.805 -68.041  1.00 12.93 ? 267  SER B OG  1 
ATOM   4166 N N   . VAL B 1 248 ? 26.359  -13.743 -70.879  1.00 14.29 ? 268  VAL B N   1 
ATOM   4167 C CA  . VAL B 1 248 ? 27.713  -13.981 -71.403  1.00 15.20 ? 268  VAL B CA  1 
ATOM   4168 C C   . VAL B 1 248 ? 28.841  -13.392 -70.540  1.00 16.17 ? 268  VAL B C   1 
ATOM   4169 O O   . VAL B 1 248 ? 29.991  -13.323 -70.983  1.00 17.44 ? 268  VAL B O   1 
ATOM   4170 C CB  . VAL B 1 248 ? 27.839  -13.451 -72.851  1.00 15.94 ? 268  VAL B CB  1 
ATOM   4171 C CG1 . VAL B 1 248 ? 26.918  -14.225 -73.782  1.00 16.57 ? 268  VAL B CG1 1 
ATOM   4172 C CG2 . VAL B 1 248 ? 27.535  -11.960 -72.922  1.00 16.01 ? 268  VAL B CG2 1 
ATOM   4173 N N   . THR B 1 249 ? 28.520  -12.992 -69.310  1.00 15.64 ? 269  THR B N   1 
ATOM   4174 C CA  . THR B 1 249 ? 29.515  -12.437 -68.390  1.00 16.59 ? 269  THR B CA  1 
ATOM   4175 C C   . THR B 1 249 ? 30.377  -13.532 -67.752  1.00 17.25 ? 269  THR B C   1 
ATOM   4176 O O   . THR B 1 249 ? 31.539  -13.294 -67.417  1.00 19.12 ? 269  THR B O   1 
ATOM   4177 C CB  . THR B 1 249 ? 28.843  -11.604 -67.283  1.00 16.57 ? 269  THR B CB  1 
ATOM   4178 O OG1 . THR B 1 249 ? 27.761  -12.350 -66.711  1.00 16.17 ? 269  THR B OG1 1 
ATOM   4179 C CG2 . THR B 1 249 ? 28.307  -10.299 -67.852  1.00 16.25 ? 269  THR B CG2 1 
ATOM   4180 N N   . GLY B 1 250 ? 29.800  -14.720 -67.577  1.00 17.00 ? 270  GLY B N   1 
ATOM   4181 C CA  . GLY B 1 250 ? 30.533  -15.890 -67.090  1.00 17.16 ? 270  GLY B CA  1 
ATOM   4182 C C   . GLY B 1 250 ? 30.454  -16.998 -68.122  1.00 16.79 ? 270  GLY B C   1 
ATOM   4183 O O   . GLY B 1 250 ? 31.003  -16.870 -69.215  1.00 17.78 ? 270  GLY B O   1 
ATOM   4184 N N   . GLY B 1 251 ? 29.767  -18.084 -67.779  1.00 16.51 ? 271  GLY B N   1 
ATOM   4185 C CA  . GLY B 1 251 ? 29.430  -19.115 -68.756  1.00 16.45 ? 271  GLY B CA  1 
ATOM   4186 C C   . GLY B 1 251 ? 28.391  -18.588 -69.733  1.00 16.66 ? 271  GLY B C   1 
ATOM   4187 O O   . GLY B 1 251 ? 27.762  -17.560 -69.484  1.00 17.85 ? 271  GLY B O   1 
ATOM   4188 N N   . LYS B 1 252 ? 28.209  -19.290 -70.847  1.00 16.37 ? 272  LYS B N   1 
ATOM   4189 C CA  . LYS B 1 252 ? 27.271  -18.854 -71.884  1.00 16.27 ? 272  LYS B CA  1 
ATOM   4190 C C   . LYS B 1 252 ? 25.908  -19.504 -71.680  1.00 15.27 ? 272  LYS B C   1 
ATOM   4191 O O   . LYS B 1 252 ? 25.730  -20.689 -71.964  1.00 15.67 ? 272  LYS B O   1 
ATOM   4192 C CB  . LYS B 1 252 ? 27.821  -19.167 -73.279  1.00 17.12 ? 272  LYS B CB  1 
ATOM   4193 C CG  . LYS B 1 252 ? 28.726  -18.082 -73.846  1.00 19.61 ? 272  LYS B CG  1 
ATOM   4194 C CD  . LYS B 1 252 ? 29.954  -17.841 -72.983  1.00 21.43 ? 272  LYS B CD  1 
ATOM   4195 C CE  . LYS B 1 252 ? 30.788  -16.683 -73.501  1.00 23.12 ? 272  LYS B CE  1 
ATOM   4196 N NZ  . LYS B 1 252 ? 31.852  -16.317 -72.527  1.00 26.02 ? 272  LYS B NZ  1 
ATOM   4197 N N   . TRP B 1 253 ? 24.952  -18.719 -71.183  1.00 13.84 ? 273  TRP B N   1 
ATOM   4198 C CA  . TRP B 1 253 ? 23.619  -19.226 -70.865  1.00 13.25 ? 273  TRP B CA  1 
ATOM   4199 C C   . TRP B 1 253 ? 22.525  -18.504 -71.638  1.00 12.38 ? 273  TRP B C   1 
ATOM   4200 O O   . TRP B 1 253 ? 22.715  -17.383 -72.116  1.00 12.89 ? 273  TRP B O   1 
ATOM   4201 C CB  . TRP B 1 253 ? 23.319  -19.081 -69.367  1.00 13.32 ? 273  TRP B CB  1 
ATOM   4202 C CG  . TRP B 1 253 ? 24.487  -19.296 -68.463  1.00 13.66 ? 273  TRP B CG  1 
ATOM   4203 C CD1 . TRP B 1 253 ? 25.089  -18.365 -67.668  1.00 13.91 ? 273  TRP B CD1 1 
ATOM   4204 C CD2 . TRP B 1 253 ? 25.195  -20.522 -68.253  1.00 14.00 ? 273  TRP B CD2 1 
ATOM   4205 N NE1 . TRP B 1 253 ? 26.130  -18.936 -66.975  1.00 14.44 ? 273  TRP B NE1 1 
ATOM   4206 C CE2 . TRP B 1 253 ? 26.218  -20.259 -67.318  1.00 14.34 ? 273  TRP B CE2 1 
ATOM   4207 C CE3 . TRP B 1 253 ? 25.066  -21.817 -68.767  1.00 14.44 ? 273  TRP B CE3 1 
ATOM   4208 C CZ2 . TRP B 1 253 ? 27.108  -21.247 -66.884  1.00 14.68 ? 273  TRP B CZ2 1 
ATOM   4209 C CZ3 . TRP B 1 253 ? 25.952  -22.798 -68.336  1.00 14.47 ? 273  TRP B CZ3 1 
ATOM   4210 C CH2 . TRP B 1 253 ? 26.960  -22.506 -67.406  1.00 14.89 ? 273  TRP B CH2 1 
ATOM   4211 N N   . ILE B 1 254 ? 21.381  -19.172 -71.752  1.00 11.36 ? 274  ILE B N   1 
ATOM   4212 C CA  . ILE B 1 254 ? 20.127  -18.536 -72.135  1.00 10.69 ? 274  ILE B CA  1 
ATOM   4213 C C   . ILE B 1 254 ? 19.296  -18.420 -70.861  1.00 10.26 ? 274  ILE B C   1 
ATOM   4214 O O   . ILE B 1 254 ? 19.194  -19.380 -70.098  1.00 9.98  ? 274  ILE B O   1 
ATOM   4215 C CB  . ILE B 1 254 ? 19.368  -19.361 -73.196  1.00 11.29 ? 274  ILE B CB  1 
ATOM   4216 C CG1 . ILE B 1 254 ? 20.189  -19.466 -74.489  1.00 11.70 ? 274  ILE B CG1 1 
ATOM   4217 C CG2 . ILE B 1 254 ? 17.992  -18.768 -73.473  1.00 11.41 ? 274  ILE B CG2 1 
ATOM   4218 C CD1 . ILE B 1 254 ? 20.450  -18.151 -75.195  1.00 12.53 ? 274  ILE B CD1 1 
ATOM   4219 N N   . VAL B 1 255 ? 18.731  -17.239 -70.623  1.00 10.15 ? 275  VAL B N   1 
ATOM   4220 C CA  . VAL B 1 255 ? 17.929  -16.978 -69.426  1.00 9.80  ? 275  VAL B CA  1 
ATOM   4221 C C   . VAL B 1 255 ? 16.537  -16.527 -69.850  1.00 9.89  ? 275  VAL B C   1 
ATOM   4222 O O   . VAL B 1 255 ? 16.404  -15.693 -70.742  1.00 10.63 ? 275  VAL B O   1 
ATOM   4223 C CB  . VAL B 1 255 ? 18.569  -15.886 -68.540  1.00 9.75  ? 275  VAL B CB  1 
ATOM   4224 C CG1 . VAL B 1 255 ? 17.725  -15.627 -67.298  1.00 10.00 ? 275  VAL B CG1 1 
ATOM   4225 C CG2 . VAL B 1 255 ? 19.988  -16.274 -68.143  1.00 9.95  ? 275  VAL B CG2 1 
ATOM   4226 N N   . SER B 1 256 ? 15.504  -17.072 -69.213  1.00 9.65  ? 276  SER B N   1 
ATOM   4227 C CA  . SER B 1 256 ? 14.130  -16.662 -69.493  1.00 9.84  ? 276  SER B CA  1 
ATOM   4228 C C   . SER B 1 256 ? 13.221  -16.837 -68.288  1.00 9.79  ? 276  SER B C   1 
ATOM   4229 O O   . SER B 1 256 ? 13.470  -17.671 -67.414  1.00 10.72 ? 276  SER B O   1 
ATOM   4230 C CB  . SER B 1 256 ? 13.557  -17.461 -70.662  1.00 10.28 ? 276  SER B CB  1 
ATOM   4231 O OG  . SER B 1 256 ? 12.217  -17.089 -70.931  1.00 11.00 ? 276  SER B OG  1 
ATOM   4232 N N   . GLY B 1 257 ? 12.159  -16.039 -68.256  1.00 9.60  ? 277  GLY B N   1 
ATOM   4233 C CA  . GLY B 1 257 ? 11.069  -16.254 -67.322  1.00 9.42  ? 277  GLY B CA  1 
ATOM   4234 C C   . GLY B 1 257 ? 10.201  -17.407 -67.788  1.00 9.33  ? 277  GLY B C   1 
ATOM   4235 O O   . GLY B 1 257 ? 10.441  -17.994 -68.850  1.00 9.42  ? 277  GLY B O   1 
ATOM   4236 N N   . SER B 1 258 ? 9.186   -17.724 -66.993  1.00 9.25  ? 278  SER B N   1 
ATOM   4237 C CA  . SER B 1 258 ? 8.289   -18.837 -67.272  1.00 9.08  ? 278  SER B CA  1 
ATOM   4238 C C   . SER B 1 258 ? 6.974   -18.669 -66.520  1.00 8.75  ? 278  SER B C   1 
ATOM   4239 O O   . SER B 1 258 ? 6.920   -18.017 -65.473  1.00 8.54  ? 278  SER B O   1 
ATOM   4240 C CB  . SER B 1 258 ? 8.951   -20.161 -66.885  1.00 9.15  ? 278  SER B CB  1 
ATOM   4241 O OG  . SER B 1 258 ? 8.079   -21.257 -67.098  1.00 9.55  ? 278  SER B OG  1 
ATOM   4242 N N   . GLU B 1 259 ? 5.923   -19.277 -67.060  1.00 8.82  ? 279  GLU B N   1 
ATOM   4243 C CA  . GLU B 1 259 ? 4.581   -19.176 -66.494  1.00 9.13  ? 279  GLU B CA  1 
ATOM   4244 C C   . GLU B 1 259 ? 4.341   -20.147 -65.327  1.00 9.24  ? 279  GLU B C   1 
ATOM   4245 O O   . GLU B 1 259 ? 3.259   -20.153 -64.741  1.00 9.90  ? 279  GLU B O   1 
ATOM   4246 C CB  . GLU B 1 259 ? 3.536   -19.355 -67.604  1.00 9.88  ? 279  GLU B CB  1 
ATOM   4247 C CG  . GLU B 1 259 ? 3.416   -18.123 -68.496  1.00 10.34 ? 279  GLU B CG  1 
ATOM   4248 C CD  . GLU B 1 259 ? 2.937   -18.422 -69.906  1.00 10.65 ? 279  GLU B CD  1 
ATOM   4249 O OE1 . GLU B 1 259 ? 2.395   -19.518 -70.156  1.00 10.51 ? 279  GLU B OE1 1 
ATOM   4250 O OE2 . GLU B 1 259 ? 3.115   -17.551 -70.784  1.00 10.88 ? 279  GLU B OE2 1 
ATOM   4251 N N   . ASP B 1 260 ? 5.351   -20.950 -64.990  1.00 9.64  ? 280  ASP B N   1 
ATOM   4252 C CA  . ASP B 1 260 ? 5.342   -21.742 -63.751  1.00 9.82  ? 280  ASP B CA  1 
ATOM   4253 C C   . ASP B 1 260 ? 6.118   -21.053 -62.615  1.00 9.74  ? 280  ASP B C   1 
ATOM   4254 O O   . ASP B 1 260 ? 6.513   -21.702 -61.644  1.00 10.76 ? 280  ASP B O   1 
ATOM   4255 C CB  . ASP B 1 260 ? 5.879   -23.162 -64.002  1.00 10.27 ? 280  ASP B CB  1 
ATOM   4256 C CG  . ASP B 1 260 ? 7.326   -23.183 -64.479  1.00 10.59 ? 280  ASP B CG  1 
ATOM   4257 O OD1 . ASP B 1 260 ? 7.962   -22.112 -64.558  1.00 11.10 ? 280  ASP B OD1 1 
ATOM   4258 O OD2 . ASP B 1 260 ? 7.826   -24.286 -64.783  1.00 12.53 ? 280  ASP B OD2 1 
ATOM   4259 N N   . ASN B 1 261 ? 6.334   -19.743 -62.757  1.00 9.24  ? 281  ASN B N   1 
ATOM   4260 C CA  . ASN B 1 261 ? 6.908   -18.886 -61.707  1.00 8.81  ? 281  ASN B CA  1 
ATOM   4261 C C   . ASN B 1 261 ? 8.420   -19.020 -61.498  1.00 8.33  ? 281  ASN B C   1 
ATOM   4262 O O   . ASN B 1 261 ? 8.958   -18.448 -60.553  1.00 8.61  ? 281  ASN B O   1 
ATOM   4263 C CB  . ASN B 1 261 ? 6.177   -19.077 -60.365  1.00 9.34  ? 281  ASN B CB  1 
ATOM   4264 C CG  . ASN B 1 261 ? 4.665   -19.034 -60.505  1.00 9.56  ? 281  ASN B CG  1 
ATOM   4265 O OD1 . ASN B 1 261 ? 4.132   -18.559 -61.507  1.00 10.07 ? 281  ASN B OD1 1 
ATOM   4266 N ND2 . ASN B 1 261 ? 3.965   -19.535 -59.493  1.00 10.95 ? 281  ASN B ND2 1 
ATOM   4267 N N   . LEU B 1 262 ? 9.105   -19.739 -62.387  1.00 8.48  ? 282  LEU B N   1 
ATOM   4268 C CA  . LEU B 1 262 ? 10.543  -19.980 -62.258  1.00 8.24  ? 282  LEU B CA  1 
ATOM   4269 C C   . LEU B 1 262 ? 11.353  -19.202 -63.295  1.00 8.28  ? 282  LEU B C   1 
ATOM   4270 O O   . LEU B 1 262 ? 10.860  -18.901 -64.384  1.00 8.76  ? 282  LEU B O   1 
ATOM   4271 C CB  . LEU B 1 262 ? 10.836  -21.473 -62.431  1.00 8.44  ? 282  LEU B CB  1 
ATOM   4272 C CG  . LEU B 1 262 ? 10.138  -22.446 -61.478  1.00 8.67  ? 282  LEU B CG  1 
ATOM   4273 C CD1 . LEU B 1 262 ? 10.333  -23.873 -61.964  1.00 8.99  ? 282  LEU B CD1 1 
ATOM   4274 C CD2 . LEU B 1 262 ? 10.658  -22.287 -60.057  1.00 9.08  ? 282  LEU B CD2 1 
ATOM   4275 N N   . VAL B 1 263 ? 12.597  -18.884 -62.950  1.00 8.47  ? 283  VAL B N   1 
ATOM   4276 C CA  . VAL B 1 263 ? 13.577  -18.412 -63.927  1.00 8.72  ? 283  VAL B CA  1 
ATOM   4277 C C   . VAL B 1 263 ? 14.322  -19.637 -64.442  1.00 9.37  ? 283  VAL B C   1 
ATOM   4278 O O   . VAL B 1 263 ? 14.882  -20.396 -63.652  1.00 9.79  ? 283  VAL B O   1 
ATOM   4279 C CB  . VAL B 1 263 ? 14.591  -17.429 -63.308  1.00 8.66  ? 283  VAL B CB  1 
ATOM   4280 C CG1 . VAL B 1 263 ? 15.611  -16.978 -64.345  1.00 8.66  ? 283  VAL B CG1 1 
ATOM   4281 C CG2 . VAL B 1 263 ? 13.879  -16.224 -62.708  1.00 8.48  ? 283  VAL B CG2 1 
ATOM   4282 N N   . TYR B 1 264 ? 14.314  -19.832 -65.759  1.00 8.99  ? 284  TYR B N   1 
ATOM   4283 C CA  . TYR B 1 264 ? 15.031  -20.941 -66.387  1.00 9.46  ? 284  TYR B CA  1 
ATOM   4284 C C   . TYR B 1 264 ? 16.365  -20.467 -66.942  1.00 9.55  ? 284  TYR B C   1 
ATOM   4285 O O   . TYR B 1 264 ? 16.445  -19.399 -67.551  1.00 9.96  ? 284  TYR B O   1 
ATOM   4286 C CB  . TYR B 1 264 ? 14.192  -21.557 -67.509  1.00 9.51  ? 284  TYR B CB  1 
ATOM   4287 C CG  . TYR B 1 264 ? 13.139  -22.524 -67.019  1.00 9.76  ? 284  TYR B CG  1 
ATOM   4288 C CD1 . TYR B 1 264 ? 12.009  -22.074 -66.347  1.00 9.68  ? 284  TYR B CD1 1 
ATOM   4289 C CD2 . TYR B 1 264 ? 13.275  -23.896 -67.226  1.00 10.18 ? 284  TYR B CD2 1 
ATOM   4290 C CE1 . TYR B 1 264 ? 11.046  -22.959 -65.896  1.00 10.21 ? 284  TYR B CE1 1 
ATOM   4291 C CE2 . TYR B 1 264 ? 12.314  -24.788 -66.781  1.00 10.68 ? 284  TYR B CE2 1 
ATOM   4292 C CZ  . TYR B 1 264 ? 11.203  -24.316 -66.114  1.00 10.57 ? 284  TYR B CZ  1 
ATOM   4293 O OH  . TYR B 1 264 ? 10.245  -25.196 -65.666  1.00 11.92 ? 284  TYR B OH  1 
ATOM   4294 N N   . ILE B 1 265 ? 17.406  -21.269 -66.729  1.00 10.14 ? 285  ILE B N   1 
ATOM   4295 C CA  . ILE B 1 265 ? 18.725  -21.010 -67.291  1.00 10.39 ? 285  ILE B CA  1 
ATOM   4296 C C   . ILE B 1 265 ? 19.166  -22.252 -68.061  1.00 10.82 ? 285  ILE B C   1 
ATOM   4297 O O   . ILE B 1 265 ? 19.215  -23.348 -67.497  1.00 11.63 ? 285  ILE B O   1 
ATOM   4298 C CB  . ILE B 1 265 ? 19.765  -20.656 -66.206  1.00 10.77 ? 285  ILE B CB  1 
ATOM   4299 C CG1 . ILE B 1 265 ? 19.277  -19.461 -65.374  1.00 10.98 ? 285  ILE B CG1 1 
ATOM   4300 C CG2 . ILE B 1 265 ? 21.108  -20.327 -66.849  1.00 11.15 ? 285  ILE B CG2 1 
ATOM   4301 C CD1 . ILE B 1 265 ? 20.134  -19.135 -64.169  1.00 11.42 ? 285  ILE B CD1 1 
ATOM   4302 N N   . TRP B 1 266 ? 19.459  -22.071 -69.349  1.00 10.79 ? 286  TRP B N   1 
ATOM   4303 C CA  . TRP B 1 266 ? 19.940  -23.152 -70.211  1.00 10.69 ? 286  TRP B CA  1 
ATOM   4304 C C   . TRP B 1 266 ? 21.413  -22.963 -70.548  1.00 11.73 ? 286  TRP B C   1 
ATOM   4305 O O   . TRP B 1 266 ? 21.912  -21.838 -70.595  1.00 11.22 ? 286  TRP B O   1 
ATOM   4306 C CB  . TRP B 1 266 ? 19.175  -23.175 -71.537  1.00 10.38 ? 286  TRP B CB  1 
ATOM   4307 C CG  . TRP B 1 266 ? 17.734  -23.575 -71.472  1.00 10.85 ? 286  TRP B CG  1 
ATOM   4308 C CD1 . TRP B 1 266 ? 17.224  -24.827 -71.652  1.00 10.74 ? 286  TRP B CD1 1 
ATOM   4309 C CD2 . TRP B 1 266 ? 16.609  -22.711 -71.270  1.00 10.83 ? 286  TRP B CD2 1 
ATOM   4310 N NE1 . TRP B 1 266 ? 15.854  -24.801 -71.556  1.00 10.51 ? 286  TRP B NE1 1 
ATOM   4311 C CE2 . TRP B 1 266 ? 15.451  -23.513 -71.318  1.00 10.69 ? 286  TRP B CE2 1 
ATOM   4312 C CE3 . TRP B 1 266 ? 16.470  -21.338 -71.036  1.00 10.58 ? 286  TRP B CE3 1 
ATOM   4313 C CZ2 . TRP B 1 266 ? 14.169  -22.989 -71.145  1.00 10.45 ? 286  TRP B CZ2 1 
ATOM   4314 C CZ3 . TRP B 1 266 ? 15.199  -20.818 -70.867  1.00 10.54 ? 286  TRP B CZ3 1 
ATOM   4315 C CH2 . TRP B 1 266 ? 14.064  -21.641 -70.921  1.00 10.26 ? 286  TRP B CH2 1 
ATOM   4316 N N   . ASN B 1 267 ? 22.096  -24.074 -70.805  1.00 12.48 ? 287  ASN B N   1 
ATOM   4317 C CA  . ASN B 1 267 ? 23.399  -24.049 -71.453  1.00 13.39 ? 287  ASN B CA  1 
ATOM   4318 C C   . ASN B 1 267 ? 23.182  -23.695 -72.922  1.00 13.64 ? 287  ASN B C   1 
ATOM   4319 O O   . ASN B 1 267 ? 22.452  -24.392 -73.626  1.00 13.79 ? 287  ASN B O   1 
ATOM   4320 C CB  . ASN B 1 267 ? 24.075  -25.415 -71.315  1.00 14.41 ? 287  ASN B CB  1 
ATOM   4321 C CG  . ASN B 1 267 ? 25.511  -25.422 -71.817  1.00 15.50 ? 287  ASN B CG  1 
ATOM   4322 O OD1 . ASN B 1 267 ? 25.789  -25.033 -72.951  1.00 16.16 ? 287  ASN B OD1 1 
ATOM   4323 N ND2 . ASN B 1 267 ? 26.430  -25.891 -70.977  1.00 17.36 ? 287  ASN B ND2 1 
ATOM   4324 N N   . LEU B 1 268 ? 23.799  -22.607 -73.374  1.00 14.43 ? 288  LEU B N   1 
ATOM   4325 C CA  . LEU B 1 268 ? 23.569  -22.097 -74.729  1.00 14.47 ? 288  LEU B CA  1 
ATOM   4326 C C   . LEU B 1 268 ? 23.948  -23.126 -75.790  1.00 14.41 ? 288  LEU B C   1 
ATOM   4327 O O   . LEU B 1 268 ? 23.201  -23.342 -76.746  1.00 13.93 ? 288  LEU B O   1 
ATOM   4328 C CB  . LEU B 1 268 ? 24.348  -20.794 -74.955  1.00 14.66 ? 288  LEU B CB  1 
ATOM   4329 C CG  . LEU B 1 268 ? 23.992  -19.972 -76.202  1.00 15.31 ? 288  LEU B CG  1 
ATOM   4330 C CD1 . LEU B 1 268 ? 24.201  -18.488 -75.939  1.00 15.67 ? 288  LEU B CD1 1 
ATOM   4331 C CD2 . LEU B 1 268 ? 24.784  -20.405 -77.429  1.00 15.63 ? 288  LEU B CD2 1 
ATOM   4332 N N   . GLN B 1 269 ? 25.102  -23.762 -75.605  1.00 15.09 ? 289  GLN B N   1 
ATOM   4333 C CA  . GLN B 1 269 ? 25.619  -24.737 -76.565  1.00 15.72 ? 289  GLN B CA  1 
ATOM   4334 C C   . GLN B 1 269 ? 24.829  -26.046 -76.558  1.00 15.58 ? 289  GLN B C   1 
ATOM   4335 O O   . GLN B 1 269 ? 24.356  -26.498 -77.603  1.00 14.87 ? 289  GLN B O   1 
ATOM   4336 C CB  . GLN B 1 269 ? 27.095  -25.029 -76.271  1.00 17.23 ? 289  GLN B CB  1 
ATOM   4337 C CG  . GLN B 1 269 ? 27.760  -25.984 -77.260  1.00 18.49 ? 289  GLN B CG  1 
ATOM   4338 C CD  . GLN B 1 269 ? 29.224  -26.252 -76.951  1.00 20.25 ? 289  GLN B CD  1 
ATOM   4339 O OE1 . GLN B 1 269 ? 30.057  -26.292 -77.856  1.00 21.36 ? 289  GLN B OE1 1 
ATOM   4340 N NE2 . GLN B 1 269 ? 29.544  -26.448 -75.675  1.00 20.96 ? 289  GLN B NE2 1 
ATOM   4341 N N   . THR B 1 270 ? 24.689  -26.644 -75.378  1.00 16.17 ? 290  THR B N   1 
ATOM   4342 C CA  . THR B 1 270 ? 24.129  -27.993 -75.247  1.00 16.19 ? 290  THR B CA  1 
ATOM   4343 C C   . THR B 1 270 ? 22.608  -27.998 -75.109  1.00 16.31 ? 290  THR B C   1 
ATOM   4344 O O   . THR B 1 270 ? 21.972  -29.030 -75.327  1.00 15.92 ? 290  THR B O   1 
ATOM   4345 C CB  . THR B 1 270 ? 24.722  -28.743 -74.035  1.00 16.34 ? 290  THR B CB  1 
ATOM   4346 O OG1 . THR B 1 270 ? 24.195  -28.197 -72.819  1.00 17.12 ? 290  THR B OG1 1 
ATOM   4347 C CG2 . THR B 1 270 ? 26.248  -28.654 -74.021  1.00 16.57 ? 290  THR B CG2 1 
ATOM   4348 N N   . LYS B 1 271 ? 22.042  -26.848 -74.734  1.00 16.43 ? 291  LYS B N   1 
ATOM   4349 C CA  . LYS B 1 271 ? 20.592  -26.668 -74.558  1.00 16.49 ? 291  LYS B CA  1 
ATOM   4350 C C   . LYS B 1 271 ? 20.035  -27.358 -73.311  1.00 16.26 ? 291  LYS B C   1 
ATOM   4351 O O   . LYS B 1 271 ? 18.818  -27.447 -73.148  1.00 15.61 ? 291  LYS B O   1 
ATOM   4352 C CB  . LYS B 1 271 ? 19.812  -27.141 -75.787  1.00 17.85 ? 291  LYS B CB  1 
ATOM   4353 C CG  . LYS B 1 271 ? 20.396  -26.709 -77.123  1.00 18.97 ? 291  LYS B CG  1 
ATOM   4354 C CD  . LYS B 1 271 ? 19.560  -27.234 -78.274  1.00 20.75 ? 291  LYS B CD  1 
ATOM   4355 C CE  . LYS B 1 271 ? 19.637  -28.745 -78.404  1.00 22.67 ? 291  LYS B CE  1 
ATOM   4356 N NZ  . LYS B 1 271 ? 18.705  -29.231 -79.451  1.00 24.44 ? 291  LYS B NZ  1 
ATOM   4357 N N   . GLU B 1 272 ? 20.915  -27.836 -72.434  1.00 16.39 ? 292  GLU B N   1 
ATOM   4358 C CA  . GLU B 1 272 ? 20.492  -28.480 -71.196  1.00 17.19 ? 292  GLU B CA  1 
ATOM   4359 C C   . GLU B 1 272 ? 20.068  -27.409 -70.203  1.00 16.14 ? 292  GLU B C   1 
ATOM   4360 O O   . GLU B 1 272 ? 20.721  -26.371 -70.096  1.00 15.88 ? 292  GLU B O   1 
ATOM   4361 C CB  . GLU B 1 272 ? 21.640  -29.294 -70.596  1.00 19.82 ? 292  GLU B CB  1 
ATOM   4362 C CG  . GLU B 1 272 ? 22.126  -30.440 -71.472  1.00 21.89 ? 292  GLU B CG  1 
ATOM   4363 C CD  . GLU B 1 272 ? 23.444  -31.028 -70.998  1.00 24.72 ? 292  GLU B CD  1 
ATOM   4364 O OE1 . GLU B 1 272 ? 24.396  -30.253 -70.749  1.00 26.03 ? 292  GLU B OE1 1 
ATOM   4365 O OE2 . GLU B 1 272 ? 23.534  -32.269 -70.884  1.00 27.23 ? 292  GLU B OE2 1 
ATOM   4366 N N   . ILE B 1 273 ? 18.979  -27.658 -69.479  1.00 15.21 ? 293  ILE B N   1 
ATOM   4367 C CA  . ILE B 1 273 ? 18.600  -26.788 -68.369  1.00 14.48 ? 293  ILE B CA  1 
ATOM   4368 C C   . ILE B 1 273 ? 19.635  -26.984 -67.269  1.00 15.02 ? 293  ILE B C   1 
ATOM   4369 O O   . ILE B 1 273 ? 19.864  -28.110 -66.822  1.00 16.16 ? 293  ILE B O   1 
ATOM   4370 C CB  . ILE B 1 273 ? 17.187  -27.095 -67.828  1.00 14.05 ? 293  ILE B CB  1 
ATOM   4371 C CG1 . ILE B 1 273 ? 16.133  -26.798 -68.899  1.00 13.82 ? 293  ILE B CG1 1 
ATOM   4372 C CG2 . ILE B 1 273 ? 16.896  -26.265 -66.580  1.00 15.11 ? 293  ILE B CG2 1 
ATOM   4373 C CD1 . ILE B 1 273 ? 14.744  -27.295 -68.559  1.00 14.77 ? 293  ILE B CD1 1 
ATOM   4374 N N   . VAL B 1 274 ? 20.268  -25.888 -66.857  1.00 14.24 ? 294  VAL B N   1 
ATOM   4375 C CA  . VAL B 1 274 ? 21.323  -25.927 -65.837  1.00 14.17 ? 294  VAL B CA  1 
ATOM   4376 C C   . VAL B 1 274 ? 20.876  -25.361 -64.485  1.00 14.42 ? 294  VAL B C   1 
ATOM   4377 O O   . VAL B 1 274 ? 21.476  -25.675 -63.457  1.00 14.04 ? 294  VAL B O   1 
ATOM   4378 C CB  . VAL B 1 274 ? 22.614  -25.211 -66.309  1.00 14.34 ? 294  VAL B CB  1 
ATOM   4379 C CG1 . VAL B 1 274 ? 23.228  -25.949 -67.490  1.00 15.70 ? 294  VAL B CG1 1 
ATOM   4380 C CG2 . VAL B 1 274 ? 22.357  -23.751 -66.666  1.00 14.79 ? 294  VAL B CG2 1 
ATOM   4381 N N   . GLN B 1 275 ? 19.832  -24.531 -64.486  1.00 14.49 ? 295  GLN B N   1 
ATOM   4382 C CA  . GLN B 1 275 ? 19.271  -23.998 -63.247  1.00 14.25 ? 295  GLN B CA  1 
ATOM   4383 C C   . GLN B 1 275 ? 17.816  -23.570 -63.409  1.00 13.70 ? 295  GLN B C   1 
ATOM   4384 O O   . GLN B 1 275 ? 17.414  -23.078 -64.464  1.00 14.23 ? 295  GLN B O   1 
ATOM   4385 C CB  . GLN B 1 275 ? 20.090  -22.803 -62.751  1.00 15.07 ? 295  GLN B CB  1 
ATOM   4386 C CG  . GLN B 1 275 ? 21.124  -23.135 -61.690  1.00 16.40 ? 295  GLN B CG  1 
ATOM   4387 C CD  . GLN B 1 275 ? 21.544  -21.913 -60.894  1.00 16.86 ? 295  GLN B CD  1 
ATOM   4388 O OE1 . GLN B 1 275 ? 22.085  -20.956 -61.450  1.00 17.07 ? 295  GLN B OE1 1 
ATOM   4389 N NE2 . GLN B 1 275 ? 21.297  -21.936 -59.587  1.00 17.12 ? 295  GLN B NE2 1 
ATOM   4390 N N   . LYS B 1 276 ? 17.042  -23.768 -62.346  1.00 13.34 ? 296  LYS B N   1 
ATOM   4391 C CA  . LYS B 1 276 ? 15.692  -23.235 -62.230  1.00 13.37 ? 296  LYS B CA  1 
ATOM   4392 C C   . LYS B 1 276 ? 15.612  -22.480 -60.906  1.00 13.45 ? 296  LYS B C   1 
ATOM   4393 O O   . LYS B 1 276 ? 15.752  -23.080 -59.840  1.00 14.93 ? 296  LYS B O   1 
ATOM   4394 C CB  . LYS B 1 276 ? 14.662  -24.362 -62.271  1.00 13.77 ? 296  LYS B CB  1 
ATOM   4395 C CG  . LYS B 1 276 ? 14.649  -25.128 -63.588  1.00 14.83 ? 296  LYS B CG  1 
ATOM   4396 C CD  . LYS B 1 276 ? 13.581  -26.212 -63.613  1.00 16.99 ? 296  LYS B CD  1 
ATOM   4397 C CE  . LYS B 1 276 ? 13.937  -27.380 -62.709  1.00 18.68 ? 296  LYS B CE  1 
ATOM   4398 N NZ  . LYS B 1 276 ? 13.009  -28.528 -62.895  1.00 20.98 ? 296  LYS B NZ  1 
ATOM   4399 N N   . LEU B 1 277 ? 15.404  -21.168 -60.977  1.00 12.16 ? 297  LEU B N   1 
ATOM   4400 C CA  . LEU B 1 277 ? 15.420  -20.316 -59.787  1.00 11.53 ? 297  LEU B CA  1 
ATOM   4401 C C   . LEU B 1 277 ? 14.010  -20.157 -59.229  1.00 11.23 ? 297  LEU B C   1 
ATOM   4402 O O   . LEU B 1 277 ? 13.126  -19.633 -59.908  1.00 11.14 ? 297  LEU B O   1 
ATOM   4403 C CB  . LEU B 1 277 ? 16.013  -18.941 -60.112  1.00 11.00 ? 297  LEU B CB  1 
ATOM   4404 C CG  . LEU B 1 277 ? 17.280  -18.910 -60.976  1.00 10.78 ? 297  LEU B CG  1 
ATOM   4405 C CD1 . LEU B 1 277 ? 17.772  -17.482 -61.164  1.00 10.32 ? 297  LEU B CD1 1 
ATOM   4406 C CD2 . LEU B 1 277 ? 18.377  -19.776 -60.375  1.00 11.47 ? 297  LEU B CD2 1 
ATOM   4407 N N   . GLN B 1 278 ? 13.807  -20.618 -57.995  1.00 11.43 ? 298  GLN B N   1 
ATOM   4408 C CA  . GLN B 1 278 ? 12.500  -20.575 -57.343  1.00 11.69 ? 298  GLN B CA  1 
ATOM   4409 C C   . GLN B 1 278 ? 12.432  -19.421 -56.346  1.00 11.17 ? 298  GLN B C   1 
ATOM   4410 O O   . GLN B 1 278 ? 13.390  -19.165 -55.618  1.00 11.93 ? 298  GLN B O   1 
ATOM   4411 C CB  . GLN B 1 278 ? 12.229  -21.899 -56.624  1.00 12.93 ? 298  GLN B CB  1 
ATOM   4412 C CG  . GLN B 1 278 ? 10.871  -21.972 -55.939  1.00 14.38 ? 298  GLN B CG  1 
ATOM   4413 C CD  . GLN B 1 278 ? 10.524  -23.369 -55.459  1.00 16.14 ? 298  GLN B CD  1 
ATOM   4414 O OE1 . GLN B 1 278 ? 9.458   -23.894 -55.772  1.00 18.89 ? 298  GLN B OE1 1 
ATOM   4415 N NE2 . GLN B 1 278 ? 11.425  -23.978 -54.697  1.00 16.51 ? 298  GLN B NE2 1 
ATOM   4416 N N   . GLY B 1 279 ? 11.290  -18.742 -56.309  1.00 10.09 ? 299  GLY B N   1 
ATOM   4417 C CA  . GLY B 1 279 ? 11.103  -17.600 -55.416  1.00 9.99  ? 299  GLY B CA  1 
ATOM   4418 C C   . GLY B 1 279 ? 9.873   -16.772 -55.736  1.00 9.61  ? 299  GLY B C   1 
ATOM   4419 O O   . GLY B 1 279 ? 9.131   -16.376 -54.837  1.00 10.03 ? 299  GLY B O   1 
ATOM   4420 N N   . HIS B 1 280 ? 9.661   -16.483 -57.016  1.00 9.11  ? 300  HIS B N   1 
ATOM   4421 C CA  . HIS B 1 280 ? 8.474   -15.737 -57.425  1.00 8.94  ? 300  HIS B CA  1 
ATOM   4422 C C   . HIS B 1 280 ? 7.211   -16.564 -57.214  1.00 8.94  ? 300  HIS B C   1 
ATOM   4423 O O   . HIS B 1 280 ? 7.255   -17.798 -57.196  1.00 9.63  ? 300  HIS B O   1 
ATOM   4424 C CB  . HIS B 1 280 ? 8.582   -15.284 -58.883  1.00 8.31  ? 300  HIS B CB  1 
ATOM   4425 C CG  . HIS B 1 280 ? 9.571   -14.181 -59.097  1.00 8.01  ? 300  HIS B CG  1 
ATOM   4426 N ND1 . HIS B 1 280 ? 9.371   -12.902 -58.622  1.00 7.78  ? 300  HIS B ND1 1 
ATOM   4427 C CD2 . HIS B 1 280 ? 10.766  -14.162 -59.734  1.00 7.97  ? 300  HIS B CD2 1 
ATOM   4428 C CE1 . HIS B 1 280 ? 10.400  -12.144 -58.957  1.00 7.75  ? 300  HIS B CE1 1 
ATOM   4429 N NE2 . HIS B 1 280 ? 11.258  -12.884 -59.634  1.00 7.85  ? 300  HIS B NE2 1 
ATOM   4430 N N   . THR B 1 281 ? 6.092   -15.870 -57.039  1.00 9.08  ? 301  THR B N   1 
ATOM   4431 C CA  . THR B 1 281 ? 4.803   -16.500 -56.765  1.00 9.24  ? 301  THR B CA  1 
ATOM   4432 C C   . THR B 1 281 ? 3.793   -16.237 -57.888  1.00 8.92  ? 301  THR B C   1 
ATOM   4433 O O   . THR B 1 281 ? 2.597   -16.477 -57.727  1.00 9.26  ? 301  THR B O   1 
ATOM   4434 C CB  . THR B 1 281 ? 4.227   -15.995 -55.430  1.00 9.67  ? 301  THR B CB  1 
ATOM   4435 O OG1 . THR B 1 281 ? 3.990   -14.585 -55.510  1.00 10.36 ? 301  THR B OG1 1 
ATOM   4436 C CG2 . THR B 1 281 ? 5.192   -16.283 -54.287  1.00 10.18 ? 301  THR B CG2 1 
ATOM   4437 N N   . ASP B 1 282 ? 4.281   -15.732 -59.020  1.00 8.66  ? 302  ASP B N   1 
ATOM   4438 C CA  . ASP B 1 282 ? 3.457   -15.538 -60.209  1.00 8.25  ? 302  ASP B CA  1 
ATOM   4439 C C   . ASP B 1 282 ? 4.372   -15.582 -61.426  1.00 7.83  ? 302  ASP B C   1 
ATOM   4440 O O   . ASP B 1 282 ? 5.591   -15.672 -61.286  1.00 7.62  ? 302  ASP B O   1 
ATOM   4441 C CB  . ASP B 1 282 ? 2.698   -14.202 -60.143  1.00 8.57  ? 302  ASP B CB  1 
ATOM   4442 C CG  . ASP B 1 282 ? 1.459   -14.170 -61.041  1.00 8.68  ? 302  ASP B CG  1 
ATOM   4443 O OD1 . ASP B 1 282 ? 1.241   -15.122 -61.824  1.00 9.21  ? 302  ASP B OD1 1 
ATOM   4444 O OD2 . ASP B 1 282 ? 0.700   -13.182 -60.972  1.00 9.49  ? 302  ASP B OD2 1 
ATOM   4445 N N   . VAL B 1 283 ? 3.770   -15.539 -62.610  1.00 8.00  ? 303  VAL B N   1 
ATOM   4446 C CA  . VAL B 1 283 ? 4.496   -15.582 -63.877  1.00 8.08  ? 303  VAL B CA  1 
ATOM   4447 C C   . VAL B 1 283 ? 5.686   -14.628 -63.853  1.00 7.65  ? 303  VAL B C   1 
ATOM   4448 O O   . VAL B 1 283 ? 5.531   -13.454 -63.518  1.00 7.65  ? 303  VAL B O   1 
ATOM   4449 C CB  . VAL B 1 283 ? 3.577   -15.178 -65.053  1.00 8.75  ? 303  VAL B CB  1 
ATOM   4450 C CG1 . VAL B 1 283 ? 4.361   -15.082 -66.357  1.00 8.95  ? 303  VAL B CG1 1 
ATOM   4451 C CG2 . VAL B 1 283 ? 2.413   -16.150 -65.202  1.00 8.99  ? 303  VAL B CG2 1 
ATOM   4452 N N   . VAL B 1 284 ? 6.863   -15.139 -64.206  1.00 7.66  ? 304  VAL B N   1 
ATOM   4453 C CA  . VAL B 1 284 ? 8.058   -14.308 -64.342  1.00 7.89  ? 304  VAL B CA  1 
ATOM   4454 C C   . VAL B 1 284 ? 8.044   -13.727 -65.756  1.00 8.06  ? 304  VAL B C   1 
ATOM   4455 O O   . VAL B 1 284 ? 8.463   -14.378 -66.715  1.00 9.06  ? 304  VAL B O   1 
ATOM   4456 C CB  . VAL B 1 284 ? 9.356   -15.102 -64.076  1.00 8.12  ? 304  VAL B CB  1 
ATOM   4457 C CG1 . VAL B 1 284 ? 10.578  -14.203 -64.198  1.00 8.22  ? 304  VAL B CG1 1 
ATOM   4458 C CG2 . VAL B 1 284 ? 9.313   -15.739 -62.694  1.00 8.22  ? 304  VAL B CG2 1 
ATOM   4459 N N   . ILE B 1 285 ? 7.541   -12.501 -65.864  1.00 7.78  ? 305  ILE B N   1 
ATOM   4460 C CA  . ILE B 1 285 ? 7.338   -11.832 -67.152  1.00 7.58  ? 305  ILE B CA  1 
ATOM   4461 C C   . ILE B 1 285 ? 8.642   -11.315 -67.753  1.00 7.59  ? 305  ILE B C   1 
ATOM   4462 O O   . ILE B 1 285 ? 8.773   -11.226 -68.974  1.00 8.09  ? 305  ILE B O   1 
ATOM   4463 C CB  . ILE B 1 285 ? 6.327   -10.662 -67.017  1.00 7.84  ? 305  ILE B CB  1 
ATOM   4464 C CG1 . ILE B 1 285 ? 5.895   -10.116 -68.385  1.00 7.96  ? 305  ILE B CG1 1 
ATOM   4465 C CG2 . ILE B 1 285 ? 6.896   -9.529  -66.173  1.00 7.95  ? 305  ILE B CG2 1 
ATOM   4466 C CD1 . ILE B 1 285 ? 5.151   -11.107 -69.253  1.00 7.61  ? 305  ILE B CD1 1 
ATOM   4467 N N   . SER B 1 286 ? 9.597   -10.967 -66.896  1.00 7.49  ? 306  SER B N   1 
ATOM   4468 C CA  . SER B 1 286 ? 10.810  -10.306 -67.347  1.00 7.53  ? 306  SER B CA  1 
ATOM   4469 C C   . SER B 1 286 ? 12.034  -10.797 -66.597  1.00 7.89  ? 306  SER B C   1 
ATOM   4470 O O   . SER B 1 286 ? 11.998  -10.990 -65.379  1.00 8.58  ? 306  SER B O   1 
ATOM   4471 C CB  . SER B 1 286 ? 10.678  -8.791  -67.169  1.00 7.35  ? 306  SER B CB  1 
ATOM   4472 O OG  . SER B 1 286 ? 11.868  -8.122  -67.552  1.00 7.32  ? 306  SER B OG  1 
ATOM   4473 N N   . THR B 1 287 ? 13.103  -11.023 -67.353  1.00 7.98  ? 307  THR B N   1 
ATOM   4474 C CA  . THR B 1 287 ? 14.431  -11.245 -66.807  1.00 8.33  ? 307  THR B CA  1 
ATOM   4475 C C   . THR B 1 287 ? 15.405  -10.318 -67.530  1.00 8.66  ? 307  THR B C   1 
ATOM   4476 O O   . THR B 1 287 ? 15.172  -9.933  -68.677  1.00 8.83  ? 307  THR B O   1 
ATOM   4477 C CB  . THR B 1 287 ? 14.880  -12.710 -66.971  1.00 8.82  ? 307  THR B CB  1 
ATOM   4478 O OG1 . THR B 1 287 ? 14.731  -13.116 -68.338  1.00 9.42  ? 307  THR B OG1 1 
ATOM   4479 C CG2 . THR B 1 287 ? 14.055  -13.621 -66.074  1.00 8.96  ? 307  THR B CG2 1 
ATOM   4480 N N   . ALA B 1 288 ? 16.477  -9.945  -66.840  1.00 8.76  ? 308  ALA B N   1 
ATOM   4481 C CA  . ALA B 1 288 ? 17.539  -9.131  -67.423  1.00 8.80  ? 308  ALA B CA  1 
ATOM   4482 C C   . ALA B 1 288 ? 18.875  -9.616  -66.895  1.00 9.25  ? 308  ALA B C   1 
ATOM   4483 O O   . ALA B 1 288 ? 18.965  -10.084 -65.760  1.00 9.59  ? 308  ALA B O   1 
ATOM   4484 C CB  . ALA B 1 288 ? 17.341  -7.666  -67.080  1.00 9.40  ? 308  ALA B CB  1 
ATOM   4485 N N   . CYS B 1 289 ? 19.906  -9.510  -67.728  1.00 9.48  ? 309  CYS B N   1 
ATOM   4486 C CA  . CYS B 1 289 ? 21.256  -9.920  -67.358  1.00 9.94  ? 309  CYS B CA  1 
ATOM   4487 C C   . CYS B 1 289 ? 22.166  -8.704  -67.280  1.00 10.10 ? 309  CYS B C   1 
ATOM   4488 O O   . CYS B 1 289 ? 22.206  -7.890  -68.201  1.00 10.63 ? 309  CYS B O   1 
ATOM   4489 C CB  . CYS B 1 289 ? 21.799  -10.919 -68.376  1.00 11.07 ? 309  CYS B CB  1 
ATOM   4490 S SG  . CYS B 1 289 ? 20.917  -12.493 -68.389  1.00 12.12 ? 309  CYS B SG  1 
ATOM   4491 N N   . HIS B 1 290 ? 22.897  -8.598  -66.174  1.00 10.53 ? 310  HIS B N   1 
ATOM   4492 C CA  . HIS B 1 290 ? 23.767  -7.454  -65.902  1.00 10.96 ? 310  HIS B CA  1 
ATOM   4493 C C   . HIS B 1 290 ? 24.917  -7.402  -66.921  1.00 11.19 ? 310  HIS B C   1 
ATOM   4494 O O   . HIS B 1 290 ? 25.419  -8.447  -67.338  1.00 11.25 ? 310  HIS B O   1 
ATOM   4495 C CB  . HIS B 1 290 ? 24.295  -7.560  -64.466  1.00 11.18 ? 310  HIS B CB  1 
ATOM   4496 C CG  . HIS B 1 290 ? 24.949  -6.315  -63.957  1.00 11.30 ? 310  HIS B CG  1 
ATOM   4497 N ND1 . HIS B 1 290 ? 26.273  -6.026  -64.190  1.00 11.37 ? 310  HIS B ND1 1 
ATOM   4498 C CD2 . HIS B 1 290 ? 24.468  -5.293  -63.211  1.00 11.44 ? 310  HIS B CD2 1 
ATOM   4499 C CE1 . HIS B 1 290 ? 26.581  -4.875  -63.623  1.00 11.44 ? 310  HIS B CE1 1 
ATOM   4500 N NE2 . HIS B 1 290 ? 25.502  -4.408  -63.023  1.00 11.72 ? 310  HIS B NE2 1 
ATOM   4501 N N   . PRO B 1 291 ? 25.321  -6.190  -67.348  1.00 11.19 ? 311  PRO B N   1 
ATOM   4502 C CA  . PRO B 1 291 ? 26.311  -6.088  -68.433  1.00 11.54 ? 311  PRO B CA  1 
ATOM   4503 C C   . PRO B 1 291 ? 27.726  -6.608  -68.118  1.00 12.69 ? 311  PRO B C   1 
ATOM   4504 O O   . PRO B 1 291 ? 28.368  -7.182  -68.999  1.00 13.90 ? 311  PRO B O   1 
ATOM   4505 C CB  . PRO B 1 291 ? 26.349  -4.582  -68.739  1.00 11.39 ? 311  PRO B CB  1 
ATOM   4506 C CG  . PRO B 1 291 ? 25.794  -3.918  -67.526  1.00 11.35 ? 311  PRO B CG  1 
ATOM   4507 C CD  . PRO B 1 291 ? 24.769  -4.870  -66.993  1.00 11.19 ? 311  PRO B CD  1 
ATOM   4508 N N   . THR B 1 292 ? 28.207  -6.383  -66.896  1.00 13.47 ? 312  THR B N   1 
ATOM   4509 C CA  . THR B 1 292 ? 29.581  -6.743  -66.509  1.00 14.78 ? 312  THR B CA  1 
ATOM   4510 C C   . THR B 1 292 ? 29.718  -7.800  -65.398  1.00 15.85 ? 312  THR B C   1 
ATOM   4511 O O   . THR B 1 292 ? 30.833  -8.227  -65.094  1.00 17.58 ? 312  THR B O   1 
ATOM   4512 C CB  . THR B 1 292 ? 30.342  -5.488  -66.041  1.00 15.17 ? 312  THR B CB  1 
ATOM   4513 O OG1 . THR B 1 292 ? 29.712  -4.953  -64.871  1.00 15.58 ? 312  THR B OG1 1 
ATOM   4514 C CG2 . THR B 1 292 ? 30.361  -4.428  -67.132  1.00 15.31 ? 312  THR B CG2 1 
ATOM   4515 N N   . GLU B 1 293 ? 28.603  -8.234  -64.813  1.00 15.90 ? 313  GLU B N   1 
ATOM   4516 C CA  . GLU B 1 293 ? 28.618  -9.099  -63.630  1.00 15.27 ? 313  GLU B CA  1 
ATOM   4517 C C   . GLU B 1 293 ? 27.608  -10.225 -63.794  1.00 13.87 ? 313  GLU B C   1 
ATOM   4518 O O   . GLU B 1 293 ? 26.640  -10.096 -64.544  1.00 14.16 ? 313  GLU B O   1 
ATOM   4519 C CB  . GLU B 1 293 ? 28.283  -8.298  -62.366  1.00 16.31 ? 313  GLU B CB  1 
ATOM   4520 C CG  . GLU B 1 293 ? 29.293  -7.216  -62.003  1.00 18.82 ? 313  GLU B CG  1 
ATOM   4521 C CD  . GLU B 1 293 ? 30.636  -7.763  -61.548  1.00 20.61 ? 313  GLU B CD  1 
ATOM   4522 O OE1 . GLU B 1 293 ? 30.716  -8.951  -61.172  1.00 22.89 ? 313  GLU B OE1 1 
ATOM   4523 O OE2 . GLU B 1 293 ? 31.619  -6.993  -61.567  1.00 24.01 ? 313  GLU B OE2 1 
ATOM   4524 N N   . ASN B 1 294 ? 27.829  -11.326 -63.082  1.00 13.76 ? 314  ASN B N   1 
ATOM   4525 C CA  . ASN B 1 294 ? 26.920  -12.467 -63.127  1.00 13.58 ? 314  ASN B CA  1 
ATOM   4526 C C   . ASN B 1 294 ? 25.716  -12.220 -62.225  1.00 12.99 ? 314  ASN B C   1 
ATOM   4527 O O   . ASN B 1 294 ? 25.592  -12.813 -61.152  1.00 13.34 ? 314  ASN B O   1 
ATOM   4528 C CB  . ASN B 1 294 ? 27.649  -13.750 -62.723  1.00 14.32 ? 314  ASN B CB  1 
ATOM   4529 C CG  . ASN B 1 294 ? 28.833  -14.058 -63.625  1.00 15.10 ? 314  ASN B CG  1 
ATOM   4530 O OD1 . ASN B 1 294 ? 28.771  -13.858 -64.838  1.00 15.34 ? 314  ASN B OD1 1 
ATOM   4531 N ND2 . ASN B 1 294 ? 29.919  -14.545 -63.035  1.00 16.62 ? 314  ASN B ND2 1 
ATOM   4532 N N   . ILE B 1 295 ? 24.836  -11.329 -62.676  1.00 11.70 ? 315  ILE B N   1 
ATOM   4533 C CA  . ILE B 1 295 ? 23.660  -10.926 -61.915  1.00 10.64 ? 315  ILE B CA  1 
ATOM   4534 C C   . ILE B 1 295 ? 22.440  -10.965 -62.829  1.00 10.44 ? 315  ILE B C   1 
ATOM   4535 O O   . ILE B 1 295 ? 22.462  -10.405 -63.927  1.00 10.69 ? 315  ILE B O   1 
ATOM   4536 C CB  . ILE B 1 295 ? 23.814  -9.502  -61.330  1.00 10.81 ? 315  ILE B CB  1 
ATOM   4537 C CG1 . ILE B 1 295 ? 25.102  -9.395  -60.498  1.00 10.96 ? 315  ILE B CG1 1 
ATOM   4538 C CG2 . ILE B 1 295 ? 22.592  -9.128  -60.497  1.00 10.24 ? 315  ILE B CG2 1 
ATOM   4539 C CD1 . ILE B 1 295 ? 25.393  -8.003  -59.979  1.00 11.61 ? 315  ILE B CD1 1 
ATOM   4540 N N   . ILE B 1 296 ? 21.385  -11.634 -62.369  1.00 9.93  ? 316  ILE B N   1 
ATOM   4541 C CA  . ILE B 1 296 ? 20.111  -11.662 -63.079  1.00 9.36  ? 316  ILE B CA  1 
ATOM   4542 C C   . ILE B 1 296 ? 19.083  -10.882 -62.270  1.00 9.23  ? 316  ILE B C   1 
ATOM   4543 O O   . ILE B 1 296 ? 18.996  -11.043 -61.055  1.00 9.67  ? 316  ILE B O   1 
ATOM   4544 C CB  . ILE B 1 296 ? 19.602  -13.105 -63.296  1.00 9.60  ? 316  ILE B CB  1 
ATOM   4545 C CG1 . ILE B 1 296 ? 20.516  -13.851 -64.272  1.00 9.70  ? 316  ILE B CG1 1 
ATOM   4546 C CG2 . ILE B 1 296 ? 18.173  -13.104 -63.831  1.00 9.61  ? 316  ILE B CG2 1 
ATOM   4547 C CD1 . ILE B 1 296 ? 20.293  -15.348 -64.321  1.00 9.87  ? 316  ILE B CD1 1 
ATOM   4548 N N   . ALA B 1 297 ? 18.325  -10.023 -62.948  1.00 8.88  ? 317  ALA B N   1 
ATOM   4549 C CA  . ALA B 1 297 ? 17.129  -9.426  -62.367  1.00 8.15  ? 317  ALA B CA  1 
ATOM   4550 C C   . ALA B 1 297 ? 15.919  -10.128 -62.960  1.00 8.14  ? 317  ALA B C   1 
ATOM   4551 O O   . ALA B 1 297 ? 15.893  -10.415 -64.156  1.00 7.96  ? 317  ALA B O   1 
ATOM   4552 C CB  . ALA B 1 297 ? 17.069  -7.935  -62.650  1.00 7.91  ? 317  ALA B CB  1 
ATOM   4553 N N   . SER B 1 298 ? 14.929  -10.414 -62.119  1.00 7.81  ? 318  SER B N   1 
ATOM   4554 C CA  . SER B 1 298 ? 13.675  -11.012 -62.568  1.00 7.59  ? 318  SER B CA  1 
ATOM   4555 C C   . SER B 1 298 ? 12.489  -10.277 -61.955  1.00 7.46  ? 318  SER B C   1 
ATOM   4556 O O   . SER B 1 298 ? 12.609  -9.688  -60.883  1.00 8.14  ? 318  SER B O   1 
ATOM   4557 C CB  . SER B 1 298 ? 13.623  -12.493 -62.192  1.00 7.85  ? 318  SER B CB  1 
ATOM   4558 O OG  . SER B 1 298 ? 13.695  -12.653 -60.787  1.00 8.58  ? 318  SER B OG  1 
ATOM   4559 N N   . ALA B 1 299 ? 11.350  -10.308 -62.637  1.00 7.25  ? 319  ALA B N   1 
ATOM   4560 C CA  . ALA B 1 299 ? 10.144  -9.640  -62.145  1.00 7.05  ? 319  ALA B CA  1 
ATOM   4561 C C   . ALA B 1 299 ? 8.893   -10.415 -62.525  1.00 7.02  ? 319  ALA B C   1 
ATOM   4562 O O   . ALA B 1 299 ? 8.864   -11.104 -63.548  1.00 7.08  ? 319  ALA B O   1 
ATOM   4563 C CB  . ALA B 1 299 ? 10.067  -8.221  -62.680  1.00 7.66  ? 319  ALA B CB  1 
ATOM   4564 N N   . ALA B 1 300 ? 7.856   -10.276 -61.704  1.00 6.94  ? 320  ALA B N   1 
ATOM   4565 C CA  . ALA B 1 300 ? 6.655   -11.097 -61.822  1.00 7.25  ? 320  ALA B CA  1 
ATOM   4566 C C   . ALA B 1 300 ? 5.358   -10.293 -61.911  1.00 7.16  ? 320  ALA B C   1 
ATOM   4567 O O   . ALA B 1 300 ? 5.322   -9.090  -61.628  1.00 7.27  ? 320  ALA B O   1 
ATOM   4568 C CB  . ALA B 1 300 ? 6.589   -12.079 -60.662  1.00 6.98  ? 320  ALA B CB  1 
ATOM   4569 N N   . LEU B 1 301 ? 4.294   -10.993 -62.299  1.00 7.57  ? 321  LEU B N   1 
ATOM   4570 C CA  . LEU B 1 301 ? 2.990   -10.389 -62.569  1.00 7.74  ? 321  LEU B CA  1 
ATOM   4571 C C   . LEU B 1 301 ? 2.160   -10.120 -61.298  1.00 8.06  ? 321  LEU B C   1 
ATOM   4572 O O   . LEU B 1 301 ? 2.680   -10.189 -60.183  1.00 8.13  ? 321  LEU B O   1 
ATOM   4573 C CB  . LEU B 1 301 ? 2.227   -11.255 -63.586  1.00 8.12  ? 321  LEU B CB  1 
ATOM   4574 C CG  . LEU B 1 301 ? 2.818   -11.331 -64.999  1.00 8.12  ? 321  LEU B CG  1 
ATOM   4575 C CD1 . LEU B 1 301 ? 1.868   -12.085 -65.917  1.00 8.09  ? 321  LEU B CD1 1 
ATOM   4576 C CD2 . LEU B 1 301 ? 3.106   -9.952  -65.579  1.00 8.22  ? 321  LEU B CD2 1 
ATOM   4577 N N   . GLU B 1 302 ? 0.875   -9.819  -61.493  1.00 8.46  ? 322  GLU B N   1 
ATOM   4578 C CA  . GLU B 1 302 ? -0.008  -9.199  -60.493  1.00 9.13  ? 322  GLU B CA  1 
ATOM   4579 C C   . GLU B 1 302 ? -0.031  -9.832  -59.101  1.00 9.33  ? 322  GLU B C   1 
ATOM   4580 O O   . GLU B 1 302 ? -0.114  -9.117  -58.105  1.00 9.24  ? 322  GLU B O   1 
ATOM   4581 C CB  . GLU B 1 302 ? -1.438  -9.157  -61.058  1.00 10.01 ? 322  GLU B CB  1 
ATOM   4582 C CG  . GLU B 1 302 ? -2.483  -8.474  -60.184  1.00 11.56 ? 322  GLU B CG  1 
ATOM   4583 C CD  . GLU B 1 302 ? -2.274  -6.980  -60.041  1.00 12.80 ? 322  GLU B CD  1 
ATOM   4584 O OE1 . GLU B 1 302 ? -1.495  -6.393  -60.824  1.00 14.15 ? 322  GLU B OE1 1 
ATOM   4585 O OE2 . GLU B 1 302 ? -2.912  -6.387  -59.148  1.00 14.84 ? 322  GLU B OE2 1 
ATOM   4586 N N   . ASN B 1 303 ? 0.028   -11.158 -59.025  1.00 9.34  ? 323  ASN B N   1 
ATOM   4587 C CA  . ASN B 1 303 ? -0.077  -11.844 -57.734  1.00 9.66  ? 323  ASN B CA  1 
ATOM   4588 C C   . ASN B 1 303 ? 1.215   -11.812 -56.914  1.00 9.61  ? 323  ASN B C   1 
ATOM   4589 O O   . ASN B 1 303 ? 1.226   -12.260 -55.767  1.00 10.39 ? 323  ASN B O   1 
ATOM   4590 C CB  . ASN B 1 303 ? -0.529  -13.298 -57.925  1.00 10.48 ? 323  ASN B CB  1 
ATOM   4591 C CG  . ASN B 1 303 ? -1.864  -13.426 -58.656  1.00 11.55 ? 323  ASN B CG  1 
ATOM   4592 O OD1 . ASN B 1 303 ? -2.151  -14.477 -59.230  1.00 14.56 ? 323  ASN B OD1 1 
ATOM   4593 N ND2 . ASN B 1 303 ? -2.686  -12.376 -58.635  1.00 12.30 ? 323  ASN B ND2 1 
ATOM   4594 N N   . ASP B 1 304 ? 2.291   -11.283 -57.500  1.00 9.30  ? 324  ASP B N   1 
ATOM   4595 C CA  . ASP B 1 304 ? 3.601   -11.214 -56.854  1.00 8.65  ? 324  ASP B CA  1 
ATOM   4596 C C   . ASP B 1 304 ? 4.078   -9.756  -56.800  1.00 8.82  ? 324  ASP B C   1 
ATOM   4597 O O   . ASP B 1 304 ? 4.215   -9.180  -55.716  1.00 8.74  ? 324  ASP B O   1 
ATOM   4598 C CB  . ASP B 1 304 ? 4.583   -12.103 -57.630  1.00 8.88  ? 324  ASP B CB  1 
ATOM   4599 C CG  . ASP B 1 304 ? 5.982   -12.115 -57.041  1.00 9.13  ? 324  ASP B CG  1 
ATOM   4600 O OD1 . ASP B 1 304 ? 6.350   -11.181 -56.301  1.00 9.21  ? 324  ASP B OD1 1 
ATOM   4601 O OD2 . ASP B 1 304 ? 6.723   -13.075 -57.337  1.00 9.51  ? 324  ASP B OD2 1 
ATOM   4602 N N   . LYS B 1 305 ? 4.342   -9.178  -57.972  1.00 8.71  ? 325  LYS B N   1 
ATOM   4603 C CA  . LYS B 1 305 ? 4.729   -7.765  -58.127  1.00 9.18  ? 325  LYS B CA  1 
ATOM   4604 C C   . LYS B 1 305 ? 6.124   -7.399  -57.607  1.00 8.79  ? 325  LYS B C   1 
ATOM   4605 O O   . LYS B 1 305 ? 6.474   -6.216  -57.589  1.00 8.94  ? 325  LYS B O   1 
ATOM   4606 C CB  . LYS B 1 305 ? 3.684   -6.836  -57.495  1.00 10.20 ? 325  LYS B CB  1 
ATOM   4607 C CG  . LYS B 1 305 ? 2.279   -7.055  -58.023  1.00 11.00 ? 325  LYS B CG  1 
ATOM   4608 C CD  . LYS B 1 305 ? 1.254   -6.186  -57.312  1.00 11.61 ? 325  LYS B CD  1 
ATOM   4609 C CE  . LYS B 1 305 ? 0.942   -6.711  -55.919  1.00 12.91 ? 325  LYS B CE  1 
ATOM   4610 N NZ  . LYS B 1 305 ? -0.262  -6.072  -55.319  1.00 13.27 ? 325  LYS B NZ  1 
ATOM   4611 N N   . THR B 1 306 ? 6.922   -8.386  -57.201  1.00 8.66  ? 326  THR B N   1 
ATOM   4612 C CA  . THR B 1 306 ? 8.274   -8.115  -56.720  1.00 8.22  ? 326  THR B CA  1 
ATOM   4613 C C   . THR B 1 306 ? 9.314   -8.383  -57.801  1.00 7.91  ? 326  THR B C   1 
ATOM   4614 O O   . THR B 1 306 ? 9.069   -9.108  -58.773  1.00 7.31  ? 326  THR B O   1 
ATOM   4615 C CB  . THR B 1 306 ? 8.638   -8.914  -55.445  1.00 8.59  ? 326  THR B CB  1 
ATOM   4616 O OG1 . THR B 1 306 ? 8.729   -10.313 -55.741  1.00 9.01  ? 326  THR B OG1 1 
ATOM   4617 C CG2 . THR B 1 306 ? 7.613   -8.676  -54.345  1.00 8.70  ? 326  THR B CG2 1 
ATOM   4618 N N   . ILE B 1 307 ? 10.472  -7.765  -57.608  1.00 7.52  ? 327  ILE B N   1 
ATOM   4619 C CA  . ILE B 1 307 ? 11.620  -7.907  -58.482  1.00 7.34  ? 327  ILE B CA  1 
ATOM   4620 C C   . ILE B 1 307 ? 12.701  -8.584  -57.654  1.00 7.42  ? 327  ILE B C   1 
ATOM   4621 O O   . ILE B 1 307 ? 12.841  -8.295  -56.467  1.00 7.78  ? 327  ILE B O   1 
ATOM   4622 C CB  . ILE B 1 307 ? 12.113  -6.525  -58.959  1.00 7.61  ? 327  ILE B CB  1 
ATOM   4623 C CG1 . ILE B 1 307 ? 11.017  -5.810  -59.754  1.00 7.85  ? 327  ILE B CG1 1 
ATOM   4624 C CG2 . ILE B 1 307 ? 13.378  -6.646  -59.799  1.00 7.74  ? 327  ILE B CG2 1 
ATOM   4625 C CD1 . ILE B 1 307 ? 11.192  -4.307  -59.803  1.00 8.43  ? 327  ILE B CD1 1 
ATOM   4626 N N   . LYS B 1 308 ? 13.459  -9.489  -58.265  1.00 7.34  ? 328  LYS B N   1 
ATOM   4627 C CA  . LYS B 1 308 ? 14.490  -10.219 -57.536  1.00 7.38  ? 328  LYS B CA  1 
ATOM   4628 C C   . LYS B 1 308 ? 15.843  -10.121 -58.220  1.00 7.92  ? 328  LYS B C   1 
ATOM   4629 O O   . LYS B 1 308 ? 15.931  -10.121 -59.449  1.00 8.49  ? 328  LYS B O   1 
ATOM   4630 C CB  . LYS B 1 308 ? 14.074  -11.679 -57.351  1.00 7.21  ? 328  LYS B CB  1 
ATOM   4631 C CG  . LYS B 1 308 ? 12.869  -11.818 -56.435  1.00 6.94  ? 328  LYS B CG  1 
ATOM   4632 C CD  . LYS B 1 308 ? 12.425  -13.259 -56.253  1.00 7.16  ? 328  LYS B CD  1 
ATOM   4633 C CE  . LYS B 1 308 ? 11.197  -13.336 -55.361  1.00 7.58  ? 328  LYS B CE  1 
ATOM   4634 N NZ  . LYS B 1 308 ? 11.517  -13.164 -53.917  1.00 8.11  ? 328  LYS B NZ  1 
ATOM   4635 N N   . LEU B 1 309 ? 16.888  -10.003 -57.402  1.00 8.18  ? 329  LEU B N   1 
ATOM   4636 C CA  . LEU B 1 309 ? 18.267  -9.992  -57.873  1.00 8.71  ? 329  LEU B CA  1 
ATOM   4637 C C   . LEU B 1 309 ? 18.946  -11.291 -57.451  1.00 9.30  ? 329  LEU B C   1 
ATOM   4638 O O   . LEU B 1 309 ? 18.988  -11.620 -56.262  1.00 9.31  ? 329  LEU B O   1 
ATOM   4639 C CB  . LEU B 1 309 ? 19.027  -8.783  -57.315  1.00 9.09  ? 329  LEU B CB  1 
ATOM   4640 C CG  . LEU B 1 309 ? 18.596  -7.400  -57.819  1.00 9.68  ? 329  LEU B CG  1 
ATOM   4641 C CD1 . LEU B 1 309 ? 19.285  -6.304  -57.020  1.00 9.95  ? 329  LEU B CD1 1 
ATOM   4642 C CD2 . LEU B 1 309 ? 18.869  -7.229  -59.308  1.00 10.12 ? 329  LEU B CD2 1 
ATOM   4643 N N   . TRP B 1 310 ? 19.470  -12.020 -58.435  1.00 9.46  ? 330  TRP B N   1 
ATOM   4644 C CA  . TRP B 1 310 ? 20.156  -13.289 -58.206  1.00 10.13 ? 330  TRP B CA  1 
ATOM   4645 C C   . TRP B 1 310 ? 21.597  -13.140 -58.667  1.00 10.54 ? 330  TRP B C   1 
ATOM   4646 O O   . TRP B 1 310 ? 21.848  -12.504 -59.688  1.00 11.21 ? 330  TRP B O   1 
ATOM   4647 C CB  . TRP B 1 310 ? 19.501  -14.426 -58.998  1.00 10.15 ? 330  TRP B CB  1 
ATOM   4648 C CG  . TRP B 1 310 ? 17.995  -14.412 -59.035  1.00 9.55  ? 330  TRP B CG  1 
ATOM   4649 C CD1 . TRP B 1 310 ? 17.202  -13.588 -59.780  1.00 9.79  ? 330  TRP B CD1 1 
ATOM   4650 C CD2 . TRP B 1 310 ? 17.107  -15.285 -58.325  1.00 9.21  ? 330  TRP B CD2 1 
ATOM   4651 N NE1 . TRP B 1 310 ? 15.880  -13.882 -59.569  1.00 9.30  ? 330  TRP B NE1 1 
ATOM   4652 C CE2 . TRP B 1 310 ? 15.792  -14.923 -58.683  1.00 9.13  ? 330  TRP B CE2 1 
ATOM   4653 C CE3 . TRP B 1 310 ? 17.295  -16.339 -57.423  1.00 9.02  ? 330  TRP B CE3 1 
ATOM   4654 C CZ2 . TRP B 1 310 ? 14.668  -15.567 -58.162  1.00 9.21  ? 330  TRP B CZ2 1 
ATOM   4655 C CZ3 . TRP B 1 310 ? 16.178  -16.981 -56.906  1.00 9.15  ? 330  TRP B CZ3 1 
ATOM   4656 C CH2 . TRP B 1 310 ? 14.881  -16.592 -57.278  1.00 9.15  ? 330  TRP B CH2 1 
ATOM   4657 N N   . LYS B 1 311 ? 22.535  -13.740 -57.935  1.00 11.06 ? 331  LYS B N   1 
ATOM   4658 C CA  . LYS B 1 311 ? 23.957  -13.641 -58.270  1.00 11.72 ? 331  LYS B CA  1 
ATOM   4659 C C   . LYS B 1 311 ? 24.637  -15.005 -58.311  1.00 12.10 ? 331  LYS B C   1 
ATOM   4660 O O   . LYS B 1 311 ? 24.311  -15.895 -57.526  1.00 12.47 ? 331  LYS B O   1 
ATOM   4661 C CB  . LYS B 1 311 ? 24.675  -12.739 -57.270  1.00 12.21 ? 331  LYS B CB  1 
ATOM   4662 C CG  . LYS B 1 311 ? 24.096  -11.337 -57.185  1.00 13.26 ? 331  LYS B CG  1 
ATOM   4663 C CD  . LYS B 1 311 ? 25.019  -10.405 -56.421  1.00 13.66 ? 331  LYS B CD  1 
ATOM   4664 C CE  . LYS B 1 311 ? 24.398  -9.031  -56.230  1.00 14.62 ? 331  LYS B CE  1 
ATOM   4665 N NZ  . LYS B 1 311 ? 25.287  -8.134  -55.444  1.00 15.06 ? 331  LYS B NZ  1 
ATOM   4666 N N   . SER B 1 312 ? 25.596  -15.143 -59.226  1.00 12.45 ? 332  SER B N   1 
ATOM   4667 C CA  . SER B 1 312 ? 26.319  -16.393 -59.450  1.00 14.02 ? 332  SER B CA  1 
ATOM   4668 C C   . SER B 1 312 ? 27.819  -16.134 -59.503  1.00 15.07 ? 332  SER B C   1 
ATOM   4669 O O   . SER B 1 312 ? 28.258  -15.004 -59.724  1.00 15.09 ? 332  SER B O   1 
ATOM   4670 C CB  . SER B 1 312 ? 25.858  -17.034 -60.763  1.00 14.04 ? 332  SER B CB  1 
ATOM   4671 O OG  . SER B 1 312 ? 26.530  -18.255 -61.031  1.00 15.15 ? 332  SER B OG  1 
ATOM   4672 N N   . ASP B 1 313 ? 28.598  -17.191 -59.292  1.00 16.19 ? 333  ASP B N   1 
ATOM   4673 C CA  . ASP B 1 313 ? 30.054  -17.121 -59.408  1.00 17.80 ? 333  ASP B CA  1 
ATOM   4674 C C   . ASP B 1 313 ? 30.519  -17.328 -60.853  1.00 19.58 ? 333  ASP B C   1 
ATOM   4675 O O   . ASP B 1 313 ? 31.665  -17.025 -61.185  1.00 21.53 ? 333  ASP B O   1 
ATOM   4676 C CB  . ASP B 1 313 ? 30.711  -18.155 -58.488  1.00 17.77 ? 333  ASP B CB  1 
ATOM   4677 C CG  . ASP B 1 313 ? 30.418  -17.904 -57.014  1.00 17.93 ? 333  ASP B CG  1 
ATOM   4678 O OD1 . ASP B 1 313 ? 30.188  -16.737 -56.626  1.00 18.25 ? 333  ASP B OD1 1 
ATOM   4679 O OD2 . ASP B 1 313 ? 30.423  -18.882 -56.235  1.00 18.84 ? 333  ASP B OD2 1 
ATOM   4680 N N   . CYS B 1 314 ? 29.631  -17.845 -61.703  1.00 20.45 ? 334  CYS B N   1 
ATOM   4681 C CA  . CYS B 1 314 ? 29.921  -18.023 -63.126  1.00 20.53 ? 334  CYS B CA  1 
ATOM   4682 C C   . CYS B 1 314 ? 28.637  -17.982 -63.951  1.00 20.48 ? 334  CYS B C   1 
ATOM   4683 O O   . CYS B 1 314 ? 28.637  -18.278 -65.147  1.00 19.57 ? 334  CYS B O   1 
ATOM   4684 C CB  . CYS B 1 314 ? 30.642  -19.350 -63.360  1.00 22.33 ? 334  CYS B CB  1 
ATOM   4685 S SG  . CYS B 1 314 ? 29.620  -20.811 -63.066  1.00 23.49 ? 334  CYS B SG  1 
ATOM   4686 O OXT . CYS B 1 314 ? 27.569  -17.649 -63.439  1.00 19.36 ? 334  CYS B OXT 1 
ATOM   4687 N N   . GLY C 2 2   ? -9.259  2.553   -62.825  1.00 18.73 ? 586  GLY C N   1 
ATOM   4688 C CA  . GLY C 2 2   ? -9.083  1.668   -64.018  1.00 17.35 ? 586  GLY C CA  1 
ATOM   4689 C C   . GLY C 2 2   ? -7.985  2.046   -65.001  1.00 15.33 ? 586  GLY C C   1 
ATOM   4690 O O   . GLY C 2 2   ? -7.987  1.569   -66.139  1.00 16.81 ? 586  GLY C O   1 
ATOM   4691 N N   . THR C 2 3   ? -7.041  2.885   -64.577  1.00 13.54 ? 587  THR C N   1 
ATOM   4692 C CA  . THR C 2 3   ? -5.975  3.353   -65.460  1.00 12.09 ? 587  THR C CA  1 
ATOM   4693 C C   . THR C 2 3   ? -4.709  2.510   -65.335  1.00 11.41 ? 587  THR C C   1 
ATOM   4694 O O   . THR C 2 3   ? -3.797  2.642   -66.150  1.00 10.64 ? 587  THR C O   1 
ATOM   4695 C CB  . THR C 2 3   ? -5.613  4.826   -65.181  1.00 12.22 ? 587  THR C CB  1 
ATOM   4696 O OG1 . THR C 2 3   ? -5.091  4.960   -63.853  1.00 11.52 ? 587  THR C OG1 1 
ATOM   4697 C CG2 . THR C 2 3   ? -6.831  5.725   -65.352  1.00 13.31 ? 587  THR C CG2 1 
ATOM   4698 N N   . CYS C 2 4   ? -4.652  1.641   -64.328  1.00 11.10 ? 588  CYS C N   1 
ATOM   4699 C CA  . CYS C 2 4   ? -3.460  0.831   -64.087  1.00 10.95 ? 588  CYS C CA  1 
ATOM   4700 C C   . CYS C 2 4   ? -3.501  -0.462  -64.899  1.00 10.82 ? 588  CYS C C   1 
ATOM   4701 O O   . CYS C 2 4   ? -3.661  -1.561  -64.356  1.00 10.74 ? 588  CYS C O   1 
ATOM   4702 C CB  . CYS C 2 4   ? -3.292  0.547   -62.595  1.00 11.98 ? 588  CYS C CB  1 
ATOM   4703 S SG  . CYS C 2 4   ? -3.003  2.039   -61.621  1.00 13.69 ? 588  CYS C SG  1 
ATOM   4704 N N   . VAL C 2 5   ? -3.332  -0.305  -66.209  1.00 10.44 ? 589  VAL C N   1 
ATOM   4705 C CA  . VAL C 2 5   ? -3.406  -1.407  -67.160  1.00 10.31 ? 589  VAL C CA  1 
ATOM   4706 C C   . VAL C 2 5   ? -2.236  -1.343  -68.141  1.00 9.96  ? 589  VAL C C   1 
ATOM   4707 O O   . VAL C 2 5   ? -1.858  -0.264  -68.597  1.00 10.04 ? 589  VAL C O   1 
ATOM   4708 C CB  . VAL C 2 5   ? -4.746  -1.398  -67.937  1.00 10.65 ? 589  VAL C CB  1 
ATOM   4709 C CG1 . VAL C 2 5   ? -5.911  -1.671  -66.996  1.00 11.37 ? 589  VAL C CG1 1 
ATOM   4710 C CG2 . VAL C 2 5   ? -4.958  -0.083  -68.682  1.00 10.97 ? 589  VAL C CG2 1 
ATOM   4711 N N   . ALA C 2 6   ? -1.662  -2.504  -68.445  1.00 9.32  ? 590  ALA C N   1 
ATOM   4712 C CA  . ALA C 2 6   ? -0.572  -2.608  -69.411  1.00 9.00  ? 590  ALA C CA  1 
ATOM   4713 C C   . ALA C 2 6   ? -0.709  -3.908  -70.192  1.00 8.80  ? 590  ALA C C   1 
ATOM   4714 O O   . ALA C 2 6   ? -0.882  -4.975  -69.606  1.00 8.52  ? 590  ALA C O   1 
ATOM   4715 C CB  . ALA C 2 6   ? 0.771   -2.550  -68.704  1.00 9.28  ? 590  ALA C CB  1 
ATOM   4716 N N   . ALA C 2 7   ? -0.628  -3.812  -71.515  1.00 8.70  ? 591  ALA C N   1 
ATOM   4717 C CA  . ALA C 2 7   ? -0.868  -4.952  -72.398  1.00 9.18  ? 591  ALA C CA  1 
ATOM   4718 C C   . ALA C 2 7   ? 0.003   -6.168  -72.092  1.00 9.01  ? 591  ALA C C   1 
ATOM   4719 O O   . ALA C 2 7   ? -0.479  -7.300  -72.155  1.00 9.24  ? 591  ALA C O   1 
ATOM   4720 C CB  . ALA C 2 7   ? -0.692  -4.536  -73.849  1.00 9.92  ? 591  ALA C CB  1 
ATOM   4721 N N   . ARG C 2 8   ? 1.274   -5.948  -71.754  1.00 8.95  ? 592  ARG C N   1 
ATOM   4722 C CA  . ARG C 2 8   ? 2.175   -7.074  -71.491  1.00 8.92  ? 592  ARG C CA  1 
ATOM   4723 C C   . ARG C 2 8   ? 1.778   -7.882  -70.255  1.00 8.77  ? 592  ARG C C   1 
ATOM   4724 O O   . ARG C 2 8   ? 2.106   -9.059  -70.169  1.00 8.96  ? 592  ARG C O   1 
ATOM   4725 C CB  . ARG C 2 8   ? 3.634   -6.627  -71.361  1.00 9.17  ? 592  ARG C CB  1 
ATOM   4726 C CG  . ARG C 2 8   ? 4.622   -7.788  -71.437  1.00 9.30  ? 592  ARG C CG  1 
ATOM   4727 C CD  . ARG C 2 8   ? 6.043   -7.341  -71.177  1.00 8.85  ? 592  ARG C CD  1 
ATOM   4728 N NE  . ARG C 2 8   ? 6.521   -6.439  -72.220  1.00 8.65  ? 592  ARG C NE  1 
ATOM   4729 C CZ  . ARG C 2 8   ? 7.127   -6.814  -73.345  1.00 8.45  ? 592  ARG C CZ  1 
ATOM   4730 N NH1 . ARG C 2 8   ? 7.354   -8.096  -73.613  1.00 8.59  ? 592  ARG C NH1 1 
ATOM   4731 N NH2 . ARG C 2 8   ? 7.515   -5.889  -74.214  1.00 8.40  ? 592  ARG C NH2 1 
ATOM   4732 N N   . THR C 2 9   ? 1.066   -7.265  -69.311  1.00 8.74  ? 593  THR C N   1 
ATOM   4733 C CA  . THR C 2 9   ? 0.673   -7.962  -68.079  1.00 9.26  ? 593  THR C CA  1 
ATOM   4734 C C   . THR C 2 9   ? -0.652  -8.725  -68.209  1.00 9.79  ? 593  THR C C   1 
ATOM   4735 O O   . THR C 2 9   ? -1.100  -9.357  -67.247  1.00 10.33 ? 593  THR C O   1 
ATOM   4736 C CB  . THR C 2 9   ? 0.611   -6.993  -66.874  1.00 9.95  ? 593  THR C CB  1 
ATOM   4737 O OG1 . THR C 2 9   ? -0.466  -6.062  -67.038  1.00 11.27 ? 593  THR C OG1 1 
ATOM   4738 C CG2 . THR C 2 9   ? 1.930   -6.243  -66.721  1.00 10.31 ? 593  THR C CG2 1 
ATOM   4739 N N   . ARG C 2 10  ? -1.269  -8.669  -69.391  1.00 10.33 ? 594  ARG C N   1 
ATOM   4740 C CA  . ARG C 2 10  ? -2.479  -9.434  -69.697  1.00 11.34 ? 594  ARG C CA  1 
ATOM   4741 C C   . ARG C 2 10  ? -2.131  -10.588 -70.642  1.00 11.83 ? 594  ARG C C   1 
ATOM   4742 O O   . ARG C 2 10  ? -1.265  -10.436 -71.504  1.00 11.47 ? 594  ARG C O   1 
ATOM   4743 C CB  . ARG C 2 10  ? -3.521  -8.533  -70.364  1.00 11.55 ? 594  ARG C CB  1 
ATOM   4744 C CG  . ARG C 2 10  ? -3.874  -7.285  -69.568  1.00 12.22 ? 594  ARG C CG  1 
ATOM   4745 C CD  . ARG C 2 10  ? -5.088  -6.575  -70.147  1.00 12.13 ? 594  ARG C CD  1 
ATOM   4746 N NE  . ARG C 2 10  ? -4.807  -5.883  -71.408  1.00 11.85 ? 594  ARG C NE  1 
ATOM   4747 C CZ  . ARG C 2 10  ? -4.318  -4.645  -71.518  1.00 11.79 ? 594  ARG C CZ  1 
ATOM   4748 N NH1 . ARG C 2 10  ? -4.015  -3.924  -70.441  1.00 11.60 ? 594  ARG C NH1 1 
ATOM   4749 N NH2 . ARG C 2 10  ? -4.114  -4.124  -72.723  1.00 12.10 ? 594  ARG C NH2 1 
ATOM   4750 N N   . PRO C 2 11  ? -2.816  -11.739 -70.497  1.00 12.76 ? 595  PRO C N   1 
ATOM   4751 C CA  . PRO C 2 11  ? -2.511  -12.905 -71.325  1.00 12.87 ? 595  PRO C CA  1 
ATOM   4752 C C   . PRO C 2 11  ? -3.067  -12.757 -72.738  1.00 14.14 ? 595  PRO C C   1 
ATOM   4753 O O   . PRO C 2 11  ? -4.035  -12.025 -72.938  1.00 15.06 ? 595  PRO C O   1 
ATOM   4754 C CB  . PRO C 2 11  ? -3.232  -14.037 -70.595  1.00 13.13 ? 595  PRO C CB  1 
ATOM   4755 C CG  . PRO C 2 11  ? -4.420  -13.374 -69.989  1.00 13.18 ? 595  PRO C CG  1 
ATOM   4756 C CD  . PRO C 2 11  ? -3.986  -11.976 -69.631  1.00 13.25 ? 595  PRO C CD  1 
ATOM   4757 N N   . VAL C 2 12  ? -2.461  -13.444 -73.704  1.00 15.34 ? 596  VAL C N   1 
ATOM   4758 C CA  . VAL C 2 12  ? -2.986  -13.444 -75.074  1.00 16.95 ? 596  VAL C CA  1 
ATOM   4759 C C   . VAL C 2 12  ? -4.376  -14.074 -75.088  1.00 18.28 ? 596  VAL C C   1 
ATOM   4760 O O   . VAL C 2 12  ? -4.628  -15.054 -74.384  1.00 18.52 ? 596  VAL C O   1 
ATOM   4761 C CB  . VAL C 2 12  ? -2.076  -14.181 -76.090  1.00 18.18 ? 596  VAL C CB  1 
ATOM   4762 C CG1 . VAL C 2 12  ? -0.723  -13.492 -76.205  1.00 19.16 ? 596  VAL C CG1 1 
ATOM   4763 C CG2 . VAL C 2 12  ? -1.920  -15.658 -75.746  1.00 19.06 ? 596  VAL C CG2 1 
ATOM   4764 N N   . LEU C 2 13  ? -5.272  -13.496 -75.883  1.00 20.36 ? 597  LEU C N   1 
ATOM   4765 C CA  . LEU C 2 13  ? -6.654  -13.956 -75.956  1.00 22.73 ? 597  LEU C CA  1 
ATOM   4766 C C   . LEU C 2 13  ? -6.918  -14.624 -77.302  1.00 23.87 ? 597  LEU C C   1 
ATOM   4767 O O   . LEU C 2 13  ? -7.464  -14.009 -78.221  1.00 26.97 ? 597  LEU C O   1 
ATOM   4768 C CB  . LEU C 2 13  ? -7.615  -12.786 -75.723  1.00 23.49 ? 597  LEU C CB  1 
ATOM   4769 C CG  . LEU C 2 13  ? -7.401  -11.972 -74.441  1.00 23.49 ? 597  LEU C CG  1 
ATOM   4770 C CD1 . LEU C 2 13  ? -8.468  -10.896 -74.322  1.00 25.09 ? 597  LEU C CD1 1 
ATOM   4771 C CD2 . LEU C 2 13  ? -7.398  -12.854 -73.201  1.00 24.18 ? 597  LEU C CD2 1 
ATOM   4772 N N   . SER C 2 14  ? -6.512  -15.887 -77.405  1.00 25.13 ? 598  SER C N   1 
ATOM   4773 C CA  . SER C 2 14  ? -6.719  -16.686 -78.610  1.00 25.40 ? 598  SER C CA  1 
ATOM   4774 C C   . SER C 2 14  ? -7.795  -17.736 -78.352  1.00 25.40 ? 598  SER C C   1 
ATOM   4775 O O   . SER C 2 14  ? -7.612  -18.631 -77.525  1.00 27.73 ? 598  SER C O   1 
ATOM   4776 C CB  . SER C 2 14  ? -5.413  -17.362 -79.031  1.00 26.03 ? 598  SER C CB  1 
ATOM   4777 O OG  . SER C 2 14  ? -4.893  -18.162 -77.984  1.00 27.87 ? 598  SER C OG  1 
ATOM   4778 N N   . TYR C 2 15  ? -8.918  -17.615 -79.055  1.00 23.57 ? 599  TYR C N   1 
ATOM   4779 C CA  . TYR C 2 15  ? -10.048 -18.526 -78.875  1.00 21.30 ? 599  TYR C CA  1 
ATOM   4780 C C   . TYR C 2 15  ? -10.966 -18.513 -80.092  1.00 18.99 ? 599  TYR C C   1 
ATOM   4781 O O   . TYR C 2 15  ? -10.796 -17.701 -81.003  1.00 19.66 ? 599  TYR C O   1 
ATOM   4782 C CB  . TYR C 2 15  ? -10.842 -18.152 -77.619  1.00 22.34 ? 599  TYR C CB  1 
ATOM   4783 C CG  . TYR C 2 15  ? -11.357 -16.727 -77.610  1.00 22.02 ? 599  TYR C CG  1 
ATOM   4784 C CD1 . TYR C 2 15  ? -10.575 -15.687 -77.115  1.00 21.81 ? 599  TYR C CD1 1 
ATOM   4785 C CD2 . TYR C 2 15  ? -12.628 -16.419 -78.093  1.00 22.05 ? 599  TYR C CD2 1 
ATOM   4786 C CE1 . TYR C 2 15  ? -11.041 -14.383 -77.104  1.00 21.40 ? 599  TYR C CE1 1 
ATOM   4787 C CE2 . TYR C 2 15  ? -13.102 -15.117 -78.087  1.00 21.36 ? 599  TYR C CE2 1 
ATOM   4788 C CZ  . TYR C 2 15  ? -12.306 -14.104 -77.588  1.00 20.99 ? 599  TYR C CZ  1 
ATOM   4789 O OH  . TYR C 2 15  ? -12.763 -12.806 -77.582  1.00 20.35 ? 599  TYR C OH  1 
ATOM   4790 O OXT . TYR C 2 15  ? -11.898 -19.309 -80.184  1.00 18.31 ? 599  TYR C OXT 1 
ATOM   4791 N N   . GLY D 2 2   ? 20.560  -25.032 -21.982  1.00 17.62 ? 586  GLY D N   1 
ATOM   4792 C CA  . GLY D 2 2   ? 20.713  -24.529 -23.379  1.00 16.19 ? 586  GLY D CA  1 
ATOM   4793 C C   . GLY D 2 2   ? 19.570  -24.825 -24.340  1.00 15.32 ? 586  GLY D C   1 
ATOM   4794 O O   . GLY D 2 2   ? 19.480  -24.205 -25.400  1.00 16.99 ? 586  GLY D O   1 
ATOM   4795 N N   . THR D 2 3   ? 18.701  -25.771 -23.991  1.00 13.86 ? 587  THR D N   1 
ATOM   4796 C CA  . THR D 2 3   ? 17.600  -26.165 -24.868  1.00 12.69 ? 587  THR D CA  1 
ATOM   4797 C C   . THR D 2 3   ? 16.363  -25.277 -24.738  1.00 11.58 ? 587  THR D C   1 
ATOM   4798 O O   . THR D 2 3   ? 15.457  -25.361 -25.566  1.00 10.57 ? 587  THR D O   1 
ATOM   4799 C CB  . THR D 2 3   ? 17.166  -27.619 -24.601  1.00 12.69 ? 587  THR D CB  1 
ATOM   4800 O OG1 . THR D 2 3   ? 16.654  -27.737 -23.268  1.00 12.19 ? 587  THR D OG1 1 
ATOM   4801 C CG2 . THR D 2 3   ? 18.337  -28.578 -24.794  1.00 13.72 ? 587  THR D CG2 1 
ATOM   4802 N N   . CYS D 2 4   ? 16.311  -24.436 -23.708  1.00 11.71 ? 588  CYS D N   1 
ATOM   4803 C CA  . CYS D 2 4   ? 15.121  -23.619 -23.465  1.00 11.47 ? 588  CYS D CA  1 
ATOM   4804 C C   . CYS D 2 4   ? 15.166  -22.317 -24.267  1.00 11.41 ? 588  CYS D C   1 
ATOM   4805 O O   . CYS D 2 4   ? 15.317  -21.225 -23.713  1.00 11.80 ? 588  CYS D O   1 
ATOM   4806 C CB  . CYS D 2 4   ? 14.946  -23.354 -21.969  1.00 12.27 ? 588  CYS D CB  1 
ATOM   4807 S SG  . CYS D 2 4   ? 14.578  -24.853 -21.030  1.00 13.56 ? 588  CYS D SG  1 
ATOM   4808 N N   . VAL D 2 5   ? 15.009  -22.462 -25.581  1.00 11.09 ? 589  VAL D N   1 
ATOM   4809 C CA  . VAL D 2 5   ? 15.089  -21.350 -26.526  1.00 10.81 ? 589  VAL D CA  1 
ATOM   4810 C C   . VAL D 2 5   ? 13.918  -21.399 -27.505  1.00 10.37 ? 589  VAL D C   1 
ATOM   4811 O O   . VAL D 2 5   ? 13.513  -22.477 -27.942  1.00 10.68 ? 589  VAL D O   1 
ATOM   4812 C CB  . VAL D 2 5   ? 16.422  -21.365 -27.314  1.00 11.25 ? 589  VAL D CB  1 
ATOM   4813 C CG1 . VAL D 2 5   ? 17.590  -21.076 -26.383  1.00 12.04 ? 589  VAL D CG1 1 
ATOM   4814 C CG2 . VAL D 2 5   ? 16.642  -22.693 -28.033  1.00 11.94 ? 589  VAL D CG2 1 
ATOM   4815 N N   . ALA D 2 6   ? 13.381  -20.229 -27.840  1.00 9.74  ? 590  ALA D N   1 
ATOM   4816 C CA  . ALA D 2 6   ? 12.285  -20.114 -28.801  1.00 9.31  ? 590  ALA D CA  1 
ATOM   4817 C C   . ALA D 2 6   ? 12.405  -18.805 -29.568  1.00 9.07  ? 590  ALA D C   1 
ATOM   4818 O O   . ALA D 2 6   ? 12.568  -17.743 -28.969  1.00 9.65  ? 590  ALA D O   1 
ATOM   4819 C CB  . ALA D 2 6   ? 10.946  -20.190 -28.094  1.00 9.36  ? 590  ALA D CB  1 
ATOM   4820 N N   . ALA D 2 7   ? 12.303  -18.884 -30.892  1.00 8.93  ? 591  ALA D N   1 
ATOM   4821 C CA  . ALA D 2 7   ? 12.550  -17.732 -31.756  1.00 8.95  ? 591  ALA D CA  1 
ATOM   4822 C C   . ALA D 2 7   ? 11.676  -16.523 -31.419  1.00 8.97  ? 591  ALA D C   1 
ATOM   4823 O O   . ALA D 2 7   ? 12.159  -15.392 -31.438  1.00 9.38  ? 591  ALA D O   1 
ATOM   4824 C CB  . ALA D 2 7   ? 12.380  -18.123 -33.215  1.00 9.49  ? 591  ALA D CB  1 
ATOM   4825 N N   . ARG D 2 8   ? 10.404  -16.750 -31.092  1.00 9.01  ? 592  ARG D N   1 
ATOM   4826 C CA  . ARG D 2 8   ? 9.493   -15.631 -30.818  1.00 9.21  ? 592  ARG D CA  1 
ATOM   4827 C C   . ARG D 2 8   ? 9.903   -14.817 -29.588  1.00 9.45  ? 592  ARG D C   1 
ATOM   4828 O O   . ARG D 2 8   ? 9.581   -13.633 -29.498  1.00 9.94  ? 592  ARG D O   1 
ATOM   4829 C CB  . ARG D 2 8   ? 8.043   -16.101 -30.663  1.00 9.78  ? 592  ARG D CB  1 
ATOM   4830 C CG  . ARG D 2 8   ? 7.034   -14.956 -30.687  1.00 9.96  ? 592  ARG D CG  1 
ATOM   4831 C CD  . ARG D 2 8   ? 5.609   -15.433 -30.492  1.00 9.50  ? 592  ARG D CD  1 
ATOM   4832 N NE  . ARG D 2 8   ? 5.150   -16.283 -31.588  1.00 9.50  ? 592  ARG D NE  1 
ATOM   4833 C CZ  . ARG D 2 8   ? 4.553   -15.858 -32.701  1.00 8.78  ? 592  ARG D CZ  1 
ATOM   4834 N NH1 . ARG D 2 8   ? 4.328   -14.563 -32.915  1.00 8.59  ? 592  ARG D NH1 1 
ATOM   4835 N NH2 . ARG D 2 8   ? 4.179   -16.745 -33.615  1.00 8.49  ? 592  ARG D NH2 1 
ATOM   4836 N N   . THR D 2 9   ? 10.616  -15.442 -28.652  1.00 9.67  ? 593  THR D N   1 
ATOM   4837 C CA  . THR D 2 9   ? 11.001  -14.768 -27.407  1.00 10.20 ? 593  THR D CA  1 
ATOM   4838 C C   . THR D 2 9   ? 12.320  -13.995 -27.524  1.00 10.80 ? 593  THR D C   1 
ATOM   4839 O O   . THR D 2 9   ? 12.749  -13.360 -26.558  1.00 11.17 ? 593  THR D O   1 
ATOM   4840 C CB  . THR D 2 9   ? 11.080  -15.766 -26.230  1.00 10.52 ? 593  THR D CB  1 
ATOM   4841 O OG1 . THR D 2 9   ? 12.108  -16.733 -26.476  1.00 11.16 ? 593  THR D OG1 1 
ATOM   4842 C CG2 . THR D 2 9   ? 9.740   -16.474 -26.035  1.00 10.74 ? 593  THR D CG2 1 
ATOM   4843 N N   . ARG D 2 10  ? 12.945  -14.041 -28.702  1.00 11.19 ? 594  ARG D N   1 
ATOM   4844 C CA  . ARG D 2 10  ? 14.158  -13.277 -28.996  1.00 12.10 ? 594  ARG D CA  1 
ATOM   4845 C C   . ARG D 2 10  ? 13.828  -12.138 -29.961  1.00 12.40 ? 594  ARG D C   1 
ATOM   4846 O O   . ARG D 2 10  ? 12.987  -12.305 -30.842  1.00 11.60 ? 594  ARG D O   1 
ATOM   4847 C CB  . ARG D 2 10  ? 15.210  -14.183 -29.636  1.00 12.52 ? 594  ARG D CB  1 
ATOM   4848 C CG  . ARG D 2 10  ? 15.495  -15.466 -28.869  1.00 12.58 ? 594  ARG D CG  1 
ATOM   4849 C CD  . ARG D 2 10  ? 16.731  -16.175 -29.407  1.00 13.29 ? 594  ARG D CD  1 
ATOM   4850 N NE  . ARG D 2 10  ? 16.503  -16.838 -30.695  1.00 13.51 ? 594  ARG D NE  1 
ATOM   4851 C CZ  . ARG D 2 10  ? 16.005  -18.067 -30.849  1.00 13.30 ? 594  ARG D CZ  1 
ATOM   4852 N NH1 . ARG D 2 10  ? 15.643  -18.798 -29.797  1.00 13.47 ? 594  ARG D NH1 1 
ATOM   4853 N NH2 . ARG D 2 10  ? 15.854  -18.569 -32.071  1.00 13.83 ? 594  ARG D NH2 1 
ATOM   4854 N N   . PRO D 2 11  ? 14.498  -10.980 -29.813  1.00 13.25 ? 595  PRO D N   1 
ATOM   4855 C CA  . PRO D 2 11  ? 14.212  -9.833  -30.677  1.00 14.19 ? 595  PRO D CA  1 
ATOM   4856 C C   . PRO D 2 11  ? 14.763  -10.012 -32.091  1.00 15.29 ? 595  PRO D C   1 
ATOM   4857 O O   . PRO D 2 11  ? 15.702  -10.784 -32.290  1.00 16.12 ? 595  PRO D O   1 
ATOM   4858 C CB  . PRO D 2 11  ? 14.934  -8.684  -29.972  1.00 14.48 ? 595  PRO D CB  1 
ATOM   4859 C CG  . PRO D 2 11  ? 16.085  -9.338  -29.290  1.00 14.49 ? 595  PRO D CG  1 
ATOM   4860 C CD  . PRO D 2 11  ? 15.595  -10.696 -28.868  1.00 13.86 ? 595  PRO D CD  1 
ATOM   4861 N N   . VAL D 2 12  ? 14.180  -9.310  -33.060  1.00 16.52 ? 596  VAL D N   1 
ATOM   4862 C CA  . VAL D 2 12  ? 14.707  -9.331  -34.428  1.00 18.22 ? 596  VAL D CA  1 
ATOM   4863 C C   . VAL D 2 12  ? 16.096  -8.701  -34.454  1.00 19.28 ? 596  VAL D C   1 
ATOM   4864 O O   . VAL D 2 12  ? 16.362  -7.736  -33.736  1.00 19.24 ? 596  VAL D O   1 
ATOM   4865 C CB  . VAL D 2 12  ? 13.803  -8.604  -35.455  1.00 19.69 ? 596  VAL D CB  1 
ATOM   4866 C CG1 . VAL D 2 12  ? 12.451  -9.292  -35.569  1.00 21.07 ? 596  VAL D CG1 1 
ATOM   4867 C CG2 . VAL D 2 12  ? 13.648  -7.123  -35.127  1.00 20.18 ? 596  VAL D CG2 1 
ATOM   4868 N N   . LEU D 2 13  ? 16.974  -9.261  -35.282  1.00 20.83 ? 597  LEU D N   1 
ATOM   4869 C CA  . LEU D 2 13  ? 18.345  -8.784  -35.400  1.00 23.12 ? 597  LEU D CA  1 
ATOM   4870 C C   . LEU D 2 13  ? 18.545  -8.133  -36.766  1.00 25.02 ? 597  LEU D C   1 
ATOM   4871 O O   . LEU D 2 13  ? 18.958  -8.786  -37.727  1.00 27.25 ? 597  LEU D O   1 
ATOM   4872 C CB  . LEU D 2 13  ? 19.329  -9.941  -35.189  1.00 24.38 ? 597  LEU D CB  1 
ATOM   4873 C CG  . LEU D 2 13  ? 19.133  -10.769 -33.912  1.00 24.62 ? 597  LEU D CG  1 
ATOM   4874 C CD1 . LEU D 2 13  ? 20.205  -11.841 -33.806  1.00 26.85 ? 597  LEU D CD1 1 
ATOM   4875 C CD2 . LEU D 2 13  ? 19.142  -9.893  -32.669  1.00 25.86 ? 597  LEU D CD2 1 
ATOM   4876 N N   . SER D 2 14  ? 18.229  -6.842  -36.841  1.00 25.98 ? 598  SER D N   1 
ATOM   4877 C CA  . SER D 2 14  ? 18.382  -6.064  -38.069  1.00 26.13 ? 598  SER D CA  1 
ATOM   4878 C C   . SER D 2 14  ? 19.461  -5.002  -37.880  1.00 26.63 ? 598  SER D C   1 
ATOM   4879 O O   . SER D 2 14  ? 19.293  -4.070  -37.093  1.00 29.52 ? 598  SER D O   1 
ATOM   4880 C CB  . SER D 2 14  ? 17.057  -5.403  -38.452  1.00 27.90 ? 598  SER D CB  1 
ATOM   4881 O OG  . SER D 2 14  ? 16.607  -4.529  -37.432  1.00 30.47 ? 598  SER D OG  1 
ATOM   4882 N N   . TYR D 2 15  ? 20.566  -5.154  -38.605  1.00 24.44 ? 599  TYR D N   1 
ATOM   4883 C CA  . TYR D 2 15  ? 21.706  -4.247  -38.495  1.00 22.67 ? 599  TYR D CA  1 
ATOM   4884 C C   . TYR D 2 15  ? 22.583  -4.349  -39.736  1.00 22.25 ? 599  TYR D C   1 
ATOM   4885 O O   . TYR D 2 15  ? 22.372  -5.219  -40.581  1.00 21.33 ? 599  TYR D O   1 
ATOM   4886 C CB  . TYR D 2 15  ? 22.531  -4.580  -37.250  1.00 22.32 ? 599  TYR D CB  1 
ATOM   4887 C CG  . TYR D 2 15  ? 23.045  -6.003  -37.229  1.00 21.77 ? 599  TYR D CG  1 
ATOM   4888 C CD1 . TYR D 2 15  ? 22.248  -7.043  -36.758  1.00 21.47 ? 599  TYR D CD1 1 
ATOM   4889 C CD2 . TYR D 2 15  ? 24.322  -6.312  -37.688  1.00 21.26 ? 599  TYR D CD2 1 
ATOM   4890 C CE1 . TYR D 2 15  ? 22.709  -8.347  -36.742  1.00 20.63 ? 599  TYR D CE1 1 
ATOM   4891 C CE2 . TYR D 2 15  ? 24.791  -7.616  -37.677  1.00 20.52 ? 599  TYR D CE2 1 
ATOM   4892 C CZ  . TYR D 2 15  ? 23.981  -8.628  -37.201  1.00 20.00 ? 599  TYR D CZ  1 
ATOM   4893 O OH  . TYR D 2 15  ? 24.439  -9.924  -37.187  1.00 19.22 ? 599  TYR D OH  1 
ATOM   4894 O OXT . TYR D 2 15  ? 23.524  -3.577  -39.916  1.00 23.03 ? 599  TYR D OXT 1 
HETATM 4895 C C1  . GOL E 3 .   ? -11.018 -28.435 -47.247  1.00 22.57 ? 1335 GOL A C1  1 
HETATM 4896 O O1  . GOL E 3 .   ? -10.492 -29.754 -47.046  1.00 26.19 ? 1335 GOL A O1  1 
HETATM 4897 C C2  . GOL E 3 .   ? -10.613 -27.533 -46.083  1.00 21.30 ? 1335 GOL A C2  1 
HETATM 4898 O O2  . GOL E 3 .   ? -11.704 -27.392 -45.164  1.00 22.11 ? 1335 GOL A O2  1 
HETATM 4899 C C3  . GOL E 3 .   ? -10.195 -26.146 -46.561  1.00 19.54 ? 1335 GOL A C3  1 
HETATM 4900 O O3  . GOL E 3 .   ? -9.184  -25.648 -45.681  1.00 18.86 ? 1335 GOL A O3  1 
HETATM 4901 C C1  . GOL F 3 .   ? 21.097  4.332   -88.296  1.00 21.74 ? 1335 GOL B C1  1 
HETATM 4902 O O1  . GOL F 3 .   ? 21.283  3.427   -89.396  1.00 25.74 ? 1335 GOL B O1  1 
HETATM 4903 C C2  . GOL F 3 .   ? 21.923  3.935   -87.070  1.00 19.96 ? 1335 GOL B C2  1 
HETATM 4904 O O2  . GOL F 3 .   ? 21.087  3.263   -86.117  1.00 16.83 ? 1335 GOL B O2  1 
HETATM 4905 C C3  . GOL F 3 .   ? 22.529  5.181   -86.434  1.00 20.91 ? 1335 GOL B C3  1 
HETATM 4906 O O3  . GOL F 3 .   ? 23.342  4.813   -85.316  1.00 21.24 ? 1335 GOL B O3  1 
HETATM 4907 C C1  . GOL G 3 .   ? 25.968  -30.006 -23.450  1.00 21.37 ? 1000 GOL D C1  1 
HETATM 4908 O O1  . GOL G 3 .   ? 26.859  -28.888 -23.553  1.00 21.34 ? 1000 GOL D O1  1 
HETATM 4909 C C2  . GOL G 3 .   ? 26.313  -30.828 -22.212  1.00 21.26 ? 1000 GOL D C2  1 
HETATM 4910 O O2  . GOL G 3 .   ? 26.268  -29.986 -21.054  1.00 20.98 ? 1000 GOL D O2  1 
HETATM 4911 C C3  . GOL G 3 .   ? 25.326  -31.983 -22.062  1.00 21.30 ? 1000 GOL D C3  1 
HETATM 4912 O O3  . GOL G 3 .   ? 25.890  -33.004 -21.228  1.00 21.56 ? 1000 GOL D O3  1 
HETATM 4913 O O   . HOH H 4 .   ? -19.786 -1.238  -16.534  1.00 26.35 ? 2001 HOH A O   1 
HETATM 4914 O O   . HOH H 4 .   ? -11.796 -9.453  -25.753  1.00 11.50 ? 2002 HOH A O   1 
HETATM 4915 O O   . HOH H 4 .   ? -14.458 -6.309  -24.895  1.00 14.45 ? 2003 HOH A O   1 
HETATM 4916 O O   . HOH H 4 .   ? -6.727  -3.920  -13.556  1.00 18.03 ? 2004 HOH A O   1 
HETATM 4917 O O   . HOH H 4 .   ? -10.364 -12.025 -9.254   1.00 20.84 ? 2005 HOH A O   1 
HETATM 4918 O O   . HOH H 4 .   ? -6.625  -13.094 -8.245   1.00 31.60 ? 2006 HOH A O   1 
HETATM 4919 O O   . HOH H 4 .   ? -3.699  -11.358 -10.246  1.00 15.13 ? 2007 HOH A O   1 
HETATM 4920 O O   . HOH H 4 .   ? -4.682  -17.335 -10.029  1.00 30.35 ? 2008 HOH A O   1 
HETATM 4921 O O   . HOH H 4 .   ? -1.038  -15.067 -8.917   1.00 22.02 ? 2009 HOH A O   1 
HETATM 4922 O O   . HOH H 4 .   ? 3.127   -18.576 -16.627  1.00 11.19 ? 2010 HOH A O   1 
HETATM 4923 O O   . HOH H 4 .   ? -0.599  -19.523 -11.155  1.00 21.76 ? 2011 HOH A O   1 
HETATM 4924 O O   . HOH H 4 .   ? 1.039   -23.462 -11.686  1.00 29.65 ? 2012 HOH A O   1 
HETATM 4925 O O   . HOH H 4 .   ? 6.821   -26.069 -15.018  1.00 26.70 ? 2013 HOH A O   1 
HETATM 4926 O O   . HOH H 4 .   ? 7.020   -24.063 -12.195  1.00 25.00 ? 2014 HOH A O   1 
HETATM 4927 O O   . HOH H 4 .   ? 9.041   -24.753 -16.598  1.00 20.67 ? 2015 HOH A O   1 
HETATM 4928 O O   . HOH H 4 .   ? 14.085  -17.526 -15.819  1.00 33.02 ? 2016 HOH A O   1 
HETATM 4929 O O   . HOH H 4 .   ? -1.251  -15.857 -29.012  1.00 9.52  ? 2017 HOH A O   1 
HETATM 4930 O O   . HOH H 4 .   ? -4.686  -19.530 -33.223  1.00 11.27 ? 2018 HOH A O   1 
HETATM 4931 O O   . HOH H 4 .   ? -1.001  -18.688 -34.505  1.00 9.87  ? 2019 HOH A O   1 
HETATM 4932 O O   . HOH H 4 .   ? -7.362  -17.451 -28.700  1.00 11.77 ? 2020 HOH A O   1 
HETATM 4933 O O   . HOH H 4 .   ? -7.933  -19.832 -30.400  1.00 17.36 ? 2021 HOH A O   1 
HETATM 4934 O O   . HOH H 4 .   ? -12.892 -25.536 -15.567  1.00 26.11 ? 2022 HOH A O   1 
HETATM 4935 O O   . HOH H 4 .   ? -14.858 -26.506 -29.612  1.00 11.94 ? 2023 HOH A O   1 
HETATM 4936 O O   . HOH H 4 .   ? -16.959 -24.566 -29.623  1.00 23.25 ? 2024 HOH A O   1 
HETATM 4937 O O   . HOH H 4 .   ? -16.994 -21.905 -22.147  1.00 16.49 ? 2025 HOH A O   1 
HETATM 4938 O O   . HOH H 4 .   ? -13.464 -23.675 -17.657  1.00 23.56 ? 2026 HOH A O   1 
HETATM 4939 O O   . HOH H 4 .   ? 6.414   -29.651 -25.632  1.00 10.18 ? 2027 HOH A O   1 
HETATM 4940 O O   . HOH H 4 .   ? 9.347   -30.438 -23.836  1.00 12.66 ? 2028 HOH A O   1 
HETATM 4941 O O   . HOH H 4 .   ? 13.206  -31.665 -24.165  1.00 19.90 ? 2029 HOH A O   1 
HETATM 4942 O O   . HOH H 4 .   ? 3.037   -24.835 -13.461  1.00 19.65 ? 2030 HOH A O   1 
HETATM 4943 O O   . HOH H 4 .   ? 6.507   -38.572 -29.653  1.00 32.90 ? 2031 HOH A O   1 
HETATM 4944 O O   . HOH H 4 .   ? -12.181 -21.692 -15.704  1.00 13.34 ? 2032 HOH A O   1 
HETATM 4945 O O   . HOH H 4 .   ? -9.135  -18.823 -9.296   1.00 26.13 ? 2033 HOH A O   1 
HETATM 4946 O O   . HOH H 4 .   ? -10.642 -24.322 -13.957  1.00 17.81 ? 2034 HOH A O   1 
HETATM 4947 O O   . HOH H 4 .   ? -3.402  -19.506 -11.618  1.00 21.79 ? 2035 HOH A O   1 
HETATM 4948 O O   . HOH H 4 .   ? -8.275  -25.841 -14.401  1.00 24.70 ? 2036 HOH A O   1 
HETATM 4949 O O   . HOH H 4 .   ? -7.204  -28.627 -11.796  1.00 19.92 ? 2038 HOH A O   1 
HETATM 4950 O O   . HOH H 4 .   ? -4.135  -26.069 -9.889   1.00 25.30 ? 2039 HOH A O   1 
HETATM 4951 O O   . HOH H 4 .   ? -3.563  -22.585 -10.349  1.00 19.84 ? 2040 HOH A O   1 
HETATM 4952 O O   . HOH H 4 .   ? 3.630   -29.110 -14.022  1.00 30.47 ? 2041 HOH A O   1 
HETATM 4953 O O   . HOH H 4 .   ? -0.285  -33.724 -18.048  1.00 22.24 ? 2042 HOH A O   1 
HETATM 4954 O O   . HOH H 4 .   ? 2.892   -34.521 -22.069  1.00 18.21 ? 2043 HOH A O   1 
HETATM 4955 O O   . HOH H 4 .   ? 5.626   -36.190 -25.570  1.00 17.08 ? 2044 HOH A O   1 
HETATM 4956 O O   . HOH H 4 .   ? 16.596  -31.524 -25.759  1.00 24.05 ? 2045 HOH A O   1 
HETATM 4957 O O   . HOH H 4 .   ? 13.672  -17.525 -52.124  1.00 23.56 ? 2046 HOH A O   1 
HETATM 4958 O O   . HOH H 4 .   ? 9.890   -21.862 -32.174  1.00 12.80 ? 2047 HOH A O   1 
HETATM 4959 O O   . HOH H 4 .   ? -5.878  -21.440 -31.384  1.00 9.68  ? 2048 HOH A O   1 
HETATM 4960 O O   . HOH H 4 .   ? -5.956  -23.058 -34.882  1.00 9.30  ? 2049 HOH A O   1 
HETATM 4961 O O   . HOH H 4 .   ? -9.644  -31.803 -34.540  1.00 26.70 ? 2050 HOH A O   1 
HETATM 4962 O O   . HOH H 4 .   ? -11.973 -29.956 -34.776  1.00 22.60 ? 2051 HOH A O   1 
HETATM 4963 O O   . HOH H 4 .   ? -15.275 -24.108 -33.317  1.00 26.36 ? 2052 HOH A O   1 
HETATM 4964 O O   . HOH H 4 .   ? -9.567  -35.080 -30.952  1.00 32.73 ? 2053 HOH A O   1 
HETATM 4965 O O   . HOH H 4 .   ? -8.695  -33.549 -26.121  1.00 17.79 ? 2054 HOH A O   1 
HETATM 4966 O O   . HOH H 4 .   ? 3.975   -19.888 -55.171  1.00 19.76 ? 2055 HOH A O   1 
HETATM 4967 O O   . HOH H 4 .   ? 17.212  -26.052 -34.481  1.00 21.71 ? 2056 HOH A O   1 
HETATM 4968 O O   . HOH H 4 .   ? 17.485  -21.732 -31.072  1.00 18.21 ? 2057 HOH A O   1 
HETATM 4969 O O   . HOH H 4 .   ? 10.773  -32.815 -32.119  1.00 25.85 ? 2058 HOH A O   1 
HETATM 4970 O O   . HOH H 4 .   ? 8.547   -29.101 -39.645  1.00 10.04 ? 2059 HOH A O   1 
HETATM 4971 O O   . HOH H 4 .   ? 11.706  -30.728 -39.529  1.00 15.62 ? 2060 HOH A O   1 
HETATM 4972 O O   . HOH H 4 .   ? 6.820   -35.992 -28.124  1.00 17.00 ? 2061 HOH A O   1 
HETATM 4973 O O   . HOH H 4 .   ? -4.256  -39.751 -27.127  1.00 24.78 ? 2062 HOH A O   1 
HETATM 4974 O O   . HOH H 4 .   ? -10.867 -36.895 -24.843  1.00 11.64 ? 2063 HOH A O   1 
HETATM 4975 O O   . HOH H 4 .   ? 3.410   -37.892 -25.734  1.00 15.62 ? 2064 HOH A O   1 
HETATM 4976 O O   . HOH H 4 .   ? 5.596   -38.321 -32.549  1.00 22.14 ? 2065 HOH A O   1 
HETATM 4977 O O   . HOH H 4 .   ? 4.671   -38.546 -36.042  1.00 20.10 ? 2066 HOH A O   1 
HETATM 4978 O O   . HOH H 4 .   ? 5.873   -35.337 -40.739  1.00 25.55 ? 2067 HOH A O   1 
HETATM 4979 O O   . HOH H 4 .   ? 7.893   -33.348 -45.017  1.00 20.53 ? 2068 HOH A O   1 
HETATM 4980 O O   . HOH H 4 .   ? 16.736  -20.963 -43.091  1.00 26.25 ? 2069 HOH A O   1 
HETATM 4981 O O   . HOH H 4 .   ? -20.852 -1.454  -31.723  1.00 25.28 ? 2070 HOH A O   1 
HETATM 4982 O O   . HOH H 4 .   ? -3.155  -16.765 -34.992  1.00 17.20 ? 2071 HOH A O   1 
HETATM 4983 O O   . HOH H 4 .   ? -6.485  -20.600 -38.760  1.00 12.62 ? 2072 HOH A O   1 
HETATM 4984 O O   . HOH H 4 .   ? -11.825 -25.574 -43.095  1.00 13.65 ? 2073 HOH A O   1 
HETATM 4985 O O   . HOH H 4 .   ? -6.505  -34.815 -41.766  1.00 15.49 ? 2074 HOH A O   1 
HETATM 4986 O O   . HOH H 4 .   ? 9.592   -17.448 -38.992  1.00 18.79 ? 2075 HOH A O   1 
HETATM 4987 O O   . HOH H 4 .   ? 15.614  -16.757 -43.160  1.00 20.57 ? 2076 HOH A O   1 
HETATM 4988 O O   . HOH H 4 .   ? 11.644  -21.623 -48.608  1.00 23.76 ? 2077 HOH A O   1 
HETATM 4989 O O   . HOH H 4 .   ? 10.145  -25.954 -45.976  1.00 25.36 ? 2078 HOH A O   1 
HETATM 4990 O O   . HOH H 4 .   ? 10.557  -19.383 -49.963  1.00 17.93 ? 2079 HOH A O   1 
HETATM 4991 O O   . HOH H 4 .   ? 13.391  -18.845 -49.651  1.00 17.80 ? 2080 HOH A O   1 
HETATM 4992 O O   . HOH H 4 .   ? 16.039  -16.300 -49.607  1.00 18.26 ? 2081 HOH A O   1 
HETATM 4993 O O   . HOH H 4 .   ? 16.844  -14.059 -46.155  1.00 23.48 ? 2082 HOH A O   1 
HETATM 4994 O O   . HOH H 4 .   ? 5.671   -35.333 -44.968  1.00 22.64 ? 2083 HOH A O   1 
HETATM 4995 O O   . HOH H 4 .   ? 5.399   -30.564 -49.545  1.00 28.22 ? 2084 HOH A O   1 
HETATM 4996 O O   . HOH H 4 .   ? -0.919  -31.524 -52.303  1.00 22.27 ? 2085 HOH A O   1 
HETATM 4997 O O   . HOH H 4 .   ? 4.412   -28.605 -52.562  1.00 23.66 ? 2086 HOH A O   1 
HETATM 4998 O O   . HOH H 4 .   ? 8.867   -15.801 -52.125  1.00 15.47 ? 2087 HOH A O   1 
HETATM 4999 O O   . HOH H 4 .   ? 16.684  -13.390 -49.646  1.00 20.12 ? 2088 HOH A O   1 
HETATM 5000 O O   . HOH H 4 .   ? 13.700  -10.294 -48.507  1.00 15.77 ? 2089 HOH A O   1 
HETATM 5001 O O   . HOH H 4 .   ? 9.724   -11.281 -50.676  1.00 12.22 ? 2090 HOH A O   1 
HETATM 5002 O O   . HOH H 4 .   ? 15.185  -11.331 -50.838  1.00 14.92 ? 2091 HOH A O   1 
HETATM 5003 O O   . HOH H 4 .   ? 2.266   -15.641 -35.264  1.00 13.22 ? 2092 HOH A O   1 
HETATM 5004 O O   . HOH H 4 .   ? 3.648   -13.411 -35.268  1.00 16.74 ? 2093 HOH A O   1 
HETATM 5005 O O   . HOH H 4 .   ? 0.297   -17.020 -36.698  1.00 10.50 ? 2094 HOH A O   1 
HETATM 5006 O O   . HOH H 4 .   ? -2.075  -15.644 -37.352  1.00 11.51 ? 2095 HOH A O   1 
HETATM 5007 O O   . HOH H 4 .   ? -10.718 -17.438 -39.556  1.00 24.03 ? 2096 HOH A O   1 
HETATM 5008 O O   . HOH H 4 .   ? -11.880 -15.367 -41.378  1.00 20.06 ? 2097 HOH A O   1 
HETATM 5009 O O   . HOH H 4 .   ? -14.981 -20.815 -38.907  1.00 26.91 ? 2098 HOH A O   1 
HETATM 5010 O O   . HOH H 4 .   ? -8.945  -23.277 -51.510  1.00 15.48 ? 2099 HOH A O   1 
HETATM 5011 O O   . HOH H 4 .   ? 11.375  -5.807  -45.091  1.00 19.12 ? 2100 HOH A O   1 
HETATM 5012 O O   . HOH H 4 .   ? 9.332   -14.848 -37.599  1.00 24.15 ? 2101 HOH A O   1 
HETATM 5013 O O   . HOH H 4 .   ? 12.759  -12.727 -35.072  1.00 15.74 ? 2102 HOH A O   1 
HETATM 5014 O O   . HOH H 4 .   ? 9.972   -8.346  -50.341  1.00 15.80 ? 2103 HOH A O   1 
HETATM 5015 O O   . HOH H 4 .   ? 5.241   -4.004  -44.827  1.00 14.22 ? 2104 HOH A O   1 
HETATM 5016 O O   . HOH H 4 .   ? 2.503   -5.986  -46.495  1.00 30.67 ? 2105 HOH A O   1 
HETATM 5017 O O   . HOH H 4 .   ? 8.831   -11.901 -53.421  1.00 14.10 ? 2106 HOH A O   1 
HETATM 5018 O O   . HOH H 4 .   ? -5.946  -21.348 -57.364  1.00 25.47 ? 2107 HOH A O   1 
HETATM 5019 O O   . HOH H 4 .   ? 3.060   -22.368 -53.983  1.00 17.90 ? 2108 HOH A O   1 
HETATM 5020 O O   . HOH H 4 .   ? -0.072  -16.597 -58.675  1.00 13.19 ? 2109 HOH A O   1 
HETATM 5021 O O   . HOH H 4 .   ? 1.701   -18.949 -56.582  1.00 13.48 ? 2110 HOH A O   1 
HETATM 5022 O O   . HOH H 4 .   ? -6.148  -13.435 -57.551  1.00 22.15 ? 2111 HOH A O   1 
HETATM 5023 O O   . HOH H 4 .   ? -4.057  -8.261  -57.084  1.00 22.66 ? 2112 HOH A O   1 
HETATM 5024 O O   . HOH H 4 .   ? -1.482  -8.982  -55.603  1.00 13.28 ? 2113 HOH A O   1 
HETATM 5025 O O   . HOH H 4 .   ? 4.081   1.367   -53.014  1.00 26.40 ? 2114 HOH A O   1 
HETATM 5026 O O   . HOH H 4 .   ? 12.243  -3.147  -51.643  1.00 20.07 ? 2115 HOH A O   1 
HETATM 5027 O O   . HOH H 4 .   ? 3.967   -7.704  -33.880  1.00 9.90  ? 2116 HOH A O   1 
HETATM 5028 O O   . HOH H 4 .   ? -8.764  -11.982 -33.469  1.00 14.74 ? 2117 HOH A O   1 
HETATM 5029 O O   . HOH H 4 .   ? -4.049  -13.516 -32.659  1.00 10.72 ? 2118 HOH A O   1 
HETATM 5030 O O   . HOH H 4 .   ? -9.740  -12.960 -35.949  1.00 15.06 ? 2119 HOH A O   1 
HETATM 5031 O O   . HOH H 4 .   ? -17.405 -11.582 -36.520  1.00 22.19 ? 2120 HOH A O   1 
HETATM 5032 O O   . HOH H 4 .   ? -11.285 -8.316  -48.289  1.00 28.84 ? 2121 HOH A O   1 
HETATM 5033 O O   . HOH H 4 .   ? 1.162   -2.981  -40.480  1.00 22.35 ? 2122 HOH A O   1 
HETATM 5034 O O   . HOH H 4 .   ? 8.388   1.985   -41.789  1.00 33.61 ? 2123 HOH A O   1 
HETATM 5035 O O   . HOH H 4 .   ? 2.854   3.442   -32.328  1.00 15.56 ? 2124 HOH A O   1 
HETATM 5036 O O   . HOH H 4 .   ? -13.350 -0.352  -54.936  1.00 28.84 ? 2125 HOH A O   1 
HETATM 5037 O O   . HOH H 4 .   ? -3.887  1.451   -49.197  1.00 20.26 ? 2126 HOH A O   1 
HETATM 5038 O O   . HOH H 4 .   ? -6.314  5.343   -40.972  1.00 34.10 ? 2127 HOH A O   1 
HETATM 5039 O O   . HOH H 4 .   ? -4.207  4.953   -33.723  1.00 18.09 ? 2128 HOH A O   1 
HETATM 5040 O O   . HOH H 4 .   ? -3.150  6.640   -31.537  1.00 22.24 ? 2129 HOH A O   1 
HETATM 5041 O O   . HOH H 4 .   ? 1.885   -4.078  -33.543  1.00 19.43 ? 2130 HOH A O   1 
HETATM 5042 O O   . HOH H 4 .   ? 12.890  -0.229  -29.918  1.00 39.12 ? 2131 HOH A O   1 
HETATM 5043 O O   . HOH H 4 .   ? 11.550  -11.174 -32.891  1.00 16.93 ? 2132 HOH A O   1 
HETATM 5044 O O   . HOH H 4 .   ? 9.197   -12.372 -32.025  1.00 10.74 ? 2133 HOH A O   1 
HETATM 5045 O O   . HOH H 4 .   ? 0.688   -6.545  -32.673  1.00 17.77 ? 2134 HOH A O   1 
HETATM 5046 O O   . HOH H 4 .   ? -0.050  -9.306  -27.805  1.00 20.87 ? 2135 HOH A O   1 
HETATM 5047 O O   . HOH H 4 .   ? -6.008  -15.857 -30.569  1.00 13.28 ? 2136 HOH A O   1 
HETATM 5048 O O   . HOH H 4 .   ? -8.089  -13.884 -30.107  1.00 12.31 ? 2137 HOH A O   1 
HETATM 5049 O O   . HOH H 4 .   ? -3.458  -14.658 -30.123  1.00 12.79 ? 2138 HOH A O   1 
HETATM 5050 O O   . HOH H 4 .   ? -13.780 -11.421 -29.527  1.00 14.92 ? 2139 HOH A O   1 
HETATM 5051 O O   . HOH H 4 .   ? -10.590 -13.047 -31.539  1.00 22.59 ? 2140 HOH A O   1 
HETATM 5052 O O   . HOH H 4 .   ? -15.378 -7.165  -27.510  1.00 15.66 ? 2141 HOH A O   1 
HETATM 5053 O O   . HOH H 4 .   ? -13.556 -11.394 -26.645  1.00 10.97 ? 2142 HOH A O   1 
HETATM 5054 O O   . HOH H 4 .   ? -17.915 -0.870  -30.641  1.00 24.91 ? 2143 HOH A O   1 
HETATM 5055 O O   . HOH H 4 .   ? -15.294 -0.012  -33.268  1.00 24.64 ? 2144 HOH A O   1 
HETATM 5056 O O   . HOH H 4 .   ? 10.347  -3.458  -21.391  1.00 29.83 ? 2145 HOH A O   1 
HETATM 5057 O O   . HOH H 4 .   ? 4.681   1.256   -19.319  1.00 25.81 ? 2146 HOH A O   1 
HETATM 5058 O O   . HOH H 4 .   ? 0.408   -5.195  -18.817  1.00 10.09 ? 2147 HOH A O   1 
HETATM 5059 O O   . HOH H 4 .   ? 2.570   -3.034  -17.263  1.00 13.17 ? 2148 HOH A O   1 
HETATM 5060 O O   . HOH H 4 .   ? 6.103   -2.479  -16.523  1.00 21.30 ? 2149 HOH A O   1 
HETATM 5061 O O   . HOH H 4 .   ? -5.353  7.306   -29.623  1.00 20.14 ? 2150 HOH A O   1 
HETATM 5062 O O   . HOH H 4 .   ? -6.363  3.070   -19.849  1.00 23.35 ? 2151 HOH A O   1 
HETATM 5063 O O   . HOH H 4 .   ? -4.487  -0.907  -16.089  1.00 22.73 ? 2152 HOH A O   1 
HETATM 5064 O O   . HOH H 4 .   ? -3.816  -3.780  -13.042  1.00 20.22 ? 2153 HOH A O   1 
HETATM 5065 O O   . HOH H 4 .   ? 3.996   -0.396  -16.894  1.00 21.69 ? 2154 HOH A O   1 
HETATM 5066 O O   . HOH H 4 .   ? -0.250  -7.048  -12.161  1.00 15.06 ? 2155 HOH A O   1 
HETATM 5067 O O   . HOH H 4 .   ? 13.104  -7.069  -22.432  1.00 28.68 ? 2156 HOH A O   1 
HETATM 5068 O O   . HOH H 4 .   ? 13.055  -10.250 -22.216  1.00 24.70 ? 2157 HOH A O   1 
HETATM 5069 O O   . HOH H 4 .   ? -10.258 -17.025 -29.227  1.00 22.40 ? 2158 HOH A O   1 
HETATM 5070 O O   . HOH H 4 .   ? -19.290 -8.854  -19.881  1.00 24.03 ? 2159 HOH A O   1 
HETATM 5071 O O   . HOH H 4 .   ? 12.506  -13.096 -23.573  1.00 18.50 ? 2160 HOH A O   1 
HETATM 5072 O O   . HOH H 4 .   ? 13.346  -13.564 -15.041  1.00 12.61 ? 2161 HOH A O   1 
HETATM 5073 O O   . HOH H 4 .   ? 2.745   -10.802 -12.884  1.00 14.69 ? 2162 HOH A O   1 
HETATM 5074 O O   . HOH H 4 .   ? -15.968 -14.913 -16.378  1.00 23.08 ? 2163 HOH A O   1 
HETATM 5075 O O   . HOH H 4 .   ? -13.744 -13.012 -12.659  1.00 19.61 ? 2164 HOH A O   1 
HETATM 5076 O O   . HOH H 4 .   ? -18.270 -3.539  -12.968  1.00 20.89 ? 2165 HOH A O   1 
HETATM 5077 O O   . HOH I 4 .   ? 26.065  -18.563 -55.122  1.00 28.18 ? 2001 HOH B O   1 
HETATM 5078 O O   . HOH I 4 .   ? 23.370  -13.155 -66.236  1.00 13.49 ? 2002 HOH B O   1 
HETATM 5079 O O   . HOH I 4 .   ? 26.121  -16.250 -65.395  1.00 16.82 ? 2003 HOH B O   1 
HETATM 5080 O O   . HOH I 4 .   ? 18.302  -18.792 -54.170  1.00 16.32 ? 2004 HOH B O   1 
HETATM 5081 O O   . HOH I 4 .   ? 22.011  -10.760 -49.833  1.00 20.18 ? 2005 HOH B O   1 
HETATM 5082 O O   . HOH I 4 .   ? 15.739  -7.806  -50.056  1.00 15.47 ? 2006 HOH B O   1 
HETATM 5083 O O   . HOH I 4 .   ? 12.700  -7.771  -49.498  1.00 21.86 ? 2007 HOH B O   1 
HETATM 5084 O O   . HOH I 4 .   ? 8.377   -4.053  -57.170  1.00 11.49 ? 2008 HOH B O   1 
HETATM 5085 O O   . HOH I 4 .   ? 6.144   -4.648  -55.210  1.00 14.26 ? 2009 HOH B O   1 
HETATM 5086 O O   . HOH I 4 .   ? 2.301   1.991   -57.541  1.00 18.87 ? 2010 HOH B O   1 
HETATM 5087 O O   . HOH I 4 .   ? -2.384  -5.302  -56.676  1.00 25.54 ? 2011 HOH B O   1 
HETATM 5088 O O   . HOH I 4 .   ? -0.407  -3.557  -54.402  1.00 23.41 ? 2012 HOH B O   1 
HETATM 5089 O O   . HOH I 4 .   ? 12.806  -6.766  -69.599  1.00 10.37 ? 2013 HOH B O   1 
HETATM 5090 O O   . HOH I 4 .   ? 12.629  -3.930  -75.050  1.00 10.61 ? 2014 HOH B O   1 
HETATM 5091 O O   . HOH I 4 .   ? 16.429  -2.978  -73.642  1.00 11.72 ? 2015 HOH B O   1 
HETATM 5092 O O   . HOH I 4 .   ? 19.058  -5.184  -69.135  1.00 13.33 ? 2016 HOH B O   1 
HETATM 5093 O O   . HOH I 4 .   ? 19.515  -2.718  -70.828  1.00 20.27 ? 2017 HOH B O   1 
HETATM 5094 O O   . HOH I 4 .   ? 22.764  -3.291  -69.647  1.00 21.49 ? 2018 HOH B O   1 
HETATM 5095 O O   . HOH I 4 .   ? 26.366  4.034   -69.923  1.00 10.99 ? 2019 HOH B O   1 
HETATM 5096 O O   . HOH I 4 .   ? 28.515  -0.555  -62.532  1.00 16.49 ? 2020 HOH B O   1 
HETATM 5097 O O   . HOH I 4 .   ? 8.559   4.846   -52.872  1.00 24.42 ? 2021 HOH B O   1 
HETATM 5098 O O   . HOH I 4 .   ? 24.271  1.523   -57.680  1.00 18.82 ? 2022 HOH B O   1 
HETATM 5099 O O   . HOH I 4 .   ? 4.730   6.944   -66.457  1.00 8.78  ? 2023 HOH B O   1 
HETATM 5100 O O   . HOH I 4 .   ? 2.057   7.713   -64.478  1.00 11.87 ? 2024 HOH B O   1 
HETATM 5101 O O   . HOH I 4 .   ? -1.489  8.704   -64.469  1.00 21.19 ? 2025 HOH B O   1 
HETATM 5102 O O   . HOH I 4 .   ? 5.251   4.350   -55.822  1.00 18.41 ? 2026 HOH B O   1 
HETATM 5103 O O   . HOH I 4 .   ? 8.715   2.078   -54.025  1.00 21.37 ? 2027 HOH B O   1 
HETATM 5104 O O   . HOH I 4 .   ? 23.681  -0.895  -56.111  1.00 13.71 ? 2028 HOH B O   1 
HETATM 5105 O O   . HOH I 4 .   ? 25.698  -5.573  -52.949  1.00 23.01 ? 2029 HOH B O   1 
HETATM 5106 O O   . HOH I 4 .   ? 23.386  1.918   -53.296  1.00 27.38 ? 2030 HOH B O   1 
HETATM 5107 O O   . HOH I 4 .   ? 15.103  -3.091  -51.981  1.00 25.10 ? 2031 HOH B O   1 
HETATM 5108 O O   . HOH I 4 .   ? 15.401  0.179   -50.823  1.00 19.80 ? 2032 HOH B O   1 
HETATM 5109 O O   . HOH I 4 .   ? 16.075  3.451   -50.506  1.00 26.28 ? 2033 HOH B O   1 
HETATM 5110 O O   . HOH I 4 .   ? 12.033  11.332  -59.545  1.00 20.18 ? 2034 HOH B O   1 
HETATM 5111 O O   . HOH I 4 .   ? 8.789   7.104   -54.854  1.00 14.72 ? 2035 HOH B O   1 
HETATM 5112 O O   . HOH I 4 .   ? 7.439   6.788   -66.116  1.00 11.74 ? 2036 HOH B O   1 
HETATM 5113 O O   . HOH I 4 .   ? 8.001   11.863  -62.373  1.00 13.69 ? 2037 HOH B O   1 
HETATM 5114 O O   . HOH I 4 .   ? 5.611   13.543  -66.267  1.00 13.15 ? 2038 HOH B O   1 
HETATM 5115 O O   . HOH I 4 .   ? 8.219   13.601  -64.585  1.00 16.59 ? 2039 HOH B O   1 
HETATM 5116 O O   . HOH I 4 .   ? -0.408  11.548  -65.669  1.00 31.71 ? 2040 HOH B O   1 
HETATM 5117 O O   . HOH I 4 .   ? 4.193   13.086  -68.731  1.00 13.79 ? 2041 HOH B O   1 
HETATM 5118 O O   . HOH I 4 .   ? -4.557  8.785   -65.838  1.00 21.69 ? 2042 HOH B O   1 
HETATM 5119 O O   . HOH I 4 .   ? -0.287  14.457  -65.794  1.00 16.19 ? 2043 HOH B O   1 
HETATM 5120 O O   . HOH I 4 .   ? 17.700  14.160  -75.478  1.00 21.85 ? 2044 HOH B O   1 
HETATM 5121 O O   . HOH I 4 .   ? 1.609   -0.881  -72.915  1.00 14.14 ? 2045 HOH B O   1 
HETATM 5122 O O   . HOH I 4 .   ? 17.550  -0.992  -71.826  1.00 12.15 ? 2046 HOH B O   1 
HETATM 5123 O O   . HOH I 4 .   ? 17.580  0.579   -75.389  1.00 12.10 ? 2047 HOH B O   1 
HETATM 5124 O O   . HOH I 4 .   ? 23.387  7.639   -75.136  1.00 15.20 ? 2048 HOH B O   1 
HETATM 5125 O O   . HOH I 4 .   ? 26.489  1.581   -73.791  1.00 24.20 ? 2049 HOH B O   1 
HETATM 5126 O O   . HOH I 4 .   ? 19.877  12.000  -66.781  1.00 19.10 ? 2050 HOH B O   1 
HETATM 5127 O O   . HOH I 4 .   ? -5.617  3.227   -75.335  1.00 30.49 ? 2051 HOH B O   1 
HETATM 5128 O O   . HOH I 4 .   ? -5.958  -0.918  -71.759  1.00 20.58 ? 2052 HOH B O   1 
HETATM 5129 O O   . HOH I 4 .   ? 0.244   10.303  -72.325  1.00 19.69 ? 2053 HOH B O   1 
HETATM 5130 O O   . HOH I 4 .   ? -0.073  7.974   -80.237  1.00 10.23 ? 2054 HOH B O   1 
HETATM 5131 O O   . HOH I 4 .   ? 3.107   6.417   -80.302  1.00 9.24  ? 2055 HOH B O   1 
HETATM 5132 O O   . HOH I 4 .   ? 19.706  16.448  -66.012  1.00 34.08 ? 2056 HOH B O   1 
HETATM 5133 O O   . HOH I 4 .   ? 19.432  16.646  -63.014  1.00 30.03 ? 2057 HOH B O   1 
HETATM 5134 O O   . HOH I 4 .   ? 7.887   16.888  -72.843  1.00 21.71 ? 2058 HOH B O   1 
HETATM 5135 O O   . HOH I 4 .   ? 11.874  18.683  -72.916  1.00 21.48 ? 2059 HOH B O   1 
HETATM 5136 O O   . HOH I 4 .   ? 5.347   15.676  -73.455  1.00 19.10 ? 2060 HOH B O   1 
HETATM 5137 O O   . HOH I 4 .   ? 6.831   15.840  -76.760  1.00 18.99 ? 2061 HOH B O   1 
HETATM 5138 O O   . HOH I 4 .   ? 5.723   12.711  -81.316  1.00 17.81 ? 2062 HOH B O   1 
HETATM 5139 O O   . HOH I 4 .   ? 7.472   14.602  -79.390  1.00 21.31 ? 2063 HOH B O   1 
HETATM 5140 O O   . HOH I 4 .   ? -7.308  -0.313  -78.166  1.00 30.42 ? 2064 HOH B O   1 
HETATM 5141 O O   . HOH I 4 .   ? -5.001  -1.470  -83.746  1.00 23.57 ? 2065 HOH B O   1 
HETATM 5142 O O   . HOH I 4 .   ? 14.821  -5.894  -75.339  1.00 17.74 ? 2066 HOH B O   1 
HETATM 5143 O O   . HOH I 4 .   ? 18.236  -2.015  -79.115  1.00 14.68 ? 2067 HOH B O   1 
HETATM 5144 O O   . HOH I 4 .   ? 23.554  2.987   -83.374  1.00 17.86 ? 2068 HOH B O   1 
HETATM 5145 O O   . HOH I 4 .   ? 22.986  10.375  -79.745  1.00 26.86 ? 2069 HOH B O   1 
HETATM 5146 O O   . HOH I 4 .   ? -3.644  -5.972  -83.910  1.00 14.75 ? 2070 HOH B O   1 
HETATM 5147 O O   . HOH I 4 .   ? 0.110   -1.086  -89.165  1.00 21.08 ? 2071 HOH B O   1 
HETATM 5148 O O   . HOH I 4 .   ? 1.338   -3.218  -90.477  1.00 17.50 ? 2072 HOH B O   1 
HETATM 5149 O O   . HOH I 4 .   ? -4.442  -6.498  -90.064  1.00 18.22 ? 2073 HOH B O   1 
HETATM 5150 O O   . HOH I 4 .   ? -1.541  -3.771  -90.437  1.00 17.33 ? 2074 HOH B O   1 
HETATM 5151 O O   . HOH I 4 .   ? -5.059  -8.618  -86.645  1.00 19.29 ? 2075 HOH B O   1 
HETATM 5152 O O   . HOH I 4 .   ? 14.729  13.805  -75.685  1.00 23.34 ? 2076 HOH B O   1 
HETATM 5153 O O   . HOH I 4 .   ? 16.248  17.604  -77.337  1.00 21.19 ? 2077 HOH B O   1 
HETATM 5154 O O   . HOH I 4 .   ? 2.958   -6.836  -92.780  1.00 12.97 ? 2078 HOH B O   1 
HETATM 5155 O O   . HOH I 4 .   ? -1.816  -12.529 -89.167  1.00 15.29 ? 2079 HOH B O   1 
HETATM 5156 O O   . HOH I 4 .   ? 2.251   -11.478 -91.367  1.00 11.50 ? 2080 HOH B O   1 
HETATM 5157 O O   . HOH I 4 .   ? 9.502   -7.042  -75.859  1.00 12.93 ? 2081 HOH B O   1 
HETATM 5158 O O   . HOH I 4 .   ? 8.121   -9.343  -75.923  1.00 15.14 ? 2082 HOH B O   1 
HETATM 5159 O O   . HOH I 4 .   ? 11.465  -5.568  -77.257  1.00 9.80  ? 2083 HOH B O   1 
HETATM 5160 O O   . HOH I 4 .   ? 13.903  -6.997  -77.822  1.00 11.06 ? 2084 HOH B O   1 
HETATM 5161 O O   . HOH I 4 .   ? 22.465  -5.278  -80.124  1.00 20.58 ? 2085 HOH B O   1 
HETATM 5162 O O   . HOH I 4 .   ? 23.864  -7.611  -87.177  1.00 20.66 ? 2086 HOH B O   1 
HETATM 5163 O O   . HOH I 4 .   ? 23.762  -7.271  -81.793  1.00 21.70 ? 2087 HOH B O   1 
HETATM 5164 O O   . HOH I 4 .   ? 20.717  0.716   -91.908  1.00 18.62 ? 2088 HOH B O   1 
HETATM 5165 O O   . HOH I 4 .   ? 24.295  -4.394  -91.307  1.00 29.59 ? 2089 HOH B O   1 
HETATM 5166 O O   . HOH I 4 .   ? 0.479   -17.081 -85.648  1.00 21.90 ? 2090 HOH B O   1 
HETATM 5167 O O   . HOH I 4 .   ? -1.073  -10.096 -75.608  1.00 18.57 ? 2091 HOH B O   1 
HETATM 5168 O O   . HOH I 4 .   ? 2.226   -7.680  -78.323  1.00 22.82 ? 2092 HOH B O   1 
HETATM 5169 O O   . HOH I 4 .   ? 1.937   -14.347 -90.995  1.00 13.78 ? 2093 HOH B O   1 
HETATM 5170 O O   . HOH I 4 .   ? 6.796   -18.809 -85.487  1.00 15.19 ? 2094 HOH B O   1 
HETATM 5171 O O   . HOH I 4 .   ? 20.621  1.477   -96.497  1.00 30.85 ? 2095 HOH B O   1 
HETATM 5172 O O   . HOH I 4 .   ? 17.417  -1.097  -97.941  1.00 19.76 ? 2096 HOH B O   1 
HETATM 5173 O O   . HOH I 4 .   ? 12.000  -6.177  -99.261  1.00 13.38 ? 2097 HOH B O   1 
HETATM 5174 O O   . HOH I 4 .   ? 10.086  -3.638  -97.168  1.00 12.94 ? 2098 HOH B O   1 
HETATM 5175 O O   . HOH I 4 .   ? 7.821   -15.031 -74.534  1.00 10.49 ? 2099 HOH B O   1 
HETATM 5176 O O   . HOH I 4 .   ? 15.686  -9.155  -73.134  1.00 10.08 ? 2100 HOH B O   1 
HETATM 5177 O O   . HOH I 4 .   ? 20.600  -10.534 -73.942  1.00 14.82 ? 2101 HOH B O   1 
HETATM 5178 O O   . HOH I 4 .   ? 21.578  -9.524  -76.406  1.00 15.27 ? 2102 HOH B O   1 
HETATM 5179 O O   . HOH I 4 .   ? 23.011  -14.235 -88.994  1.00 27.51 ? 2103 HOH B O   1 
HETATM 5180 O O   . HOH I 4 .   ? 10.646  -19.815 -80.858  1.00 17.78 ? 2104 HOH B O   1 
HETATM 5181 O O   . HOH I 4 .   ? 8.630   -19.560 -75.282  1.00 20.37 ? 2105 HOH B O   1 
HETATM 5182 O O   . HOH I 4 .   ? 8.964   -26.210 -72.922  1.00 18.94 ? 2106 HOH B O   1 
HETATM 5183 O O   . HOH I 4 .   ? 11.371  -19.046 -83.551  1.00 20.53 ? 2107 HOH B O   1 
HETATM 5184 O O   . HOH I 4 .   ? 22.936  -28.464 -79.177  1.00 21.29 ? 2108 HOH B O   1 
HETATM 5185 O O   . HOH I 4 .   ? 27.060  -26.511 -81.325  1.00 26.75 ? 2109 HOH B O   1 
HETATM 5186 O O   . HOH I 4 .   ? 16.076  -27.573 -73.964  1.00 15.02 ? 2110 HOH B O   1 
HETATM 5187 O O   . HOH I 4 .   ? 10.332  -18.458 -73.624  1.00 28.03 ? 2111 HOH B O   1 
HETATM 5188 O O   . HOH I 4 .   ? -1.453  -21.837 -70.789  1.00 35.03 ? 2112 HOH B O   1 
HETATM 5189 O O   . HOH I 4 .   ? 0.207   -11.582 -73.518  1.00 14.10 ? 2113 HOH B O   1 
HETATM 5190 O O   . HOH I 4 .   ? 2.460   -10.310 -72.663  1.00 10.87 ? 2114 HOH B O   1 
HETATM 5191 O O   . HOH I 4 .   ? 11.117  -15.990 -73.185  1.00 18.05 ? 2115 HOH B O   1 
HETATM 5192 O O   . HOH I 4 .   ? 11.604  -13.221 -68.343  1.00 22.94 ? 2116 HOH B O   1 
HETATM 5193 O O   . HOH I 4 .   ? 15.125  -7.923  -70.647  1.00 13.36 ? 2117 HOH B O   1 
HETATM 5194 O O   . HOH I 4 .   ? 17.700  -6.724  -71.149  1.00 16.80 ? 2118 HOH B O   1 
HETATM 5195 O O   . HOH I 4 .   ? 19.826  -8.580  -70.524  1.00 13.28 ? 2119 HOH B O   1 
HETATM 5196 O O   . HOH I 4 .   ? 22.503  -9.436  -71.891  1.00 31.91 ? 2120 HOH B O   1 
HETATM 5197 O O   . HOH I 4 .   ? 25.355  -11.102 -69.917  1.00 15.56 ? 2121 HOH B O   1 
HETATM 5198 O O   . HOH I 4 .   ? 27.086  -15.479 -67.880  1.00 13.20 ? 2122 HOH B O   1 
HETATM 5199 O O   . HOH I 4 .   ? 25.286  -11.204 -67.011  1.00 14.96 ? 2123 HOH B O   1 
HETATM 5200 O O   . HOH I 4 .   ? 29.403  -22.029 -71.012  1.00 27.07 ? 2124 HOH B O   1 
HETATM 5201 O O   . HOH I 4 .   ? 27.337  -22.457 -73.669  1.00 22.95 ? 2125 HOH B O   1 
HETATM 5202 O O   . HOH I 4 .   ? -0.165  -20.008 -68.644  1.00 44.23 ? 2126 HOH B O   1 
HETATM 5203 O O   . HOH I 4 .   ? 11.351  -17.476 -59.393  1.00 8.79  ? 2127 HOH B O   1 
HETATM 5204 O O   . HOH I 4 .   ? 9.089   -19.741 -57.941  1.00 12.21 ? 2128 HOH B O   1 
HETATM 5205 O O   . HOH I 4 .   ? 5.583   -20.300 -57.431  1.00 24.37 ? 2129 HOH B O   1 
HETATM 5206 O O   . HOH I 4 .   ? 1.134   -20.468 -58.957  1.00 20.87 ? 2130 HOH B O   1 
HETATM 5207 O O   . HOH I 4 .   ? 22.632  -30.861 -77.592  1.00 19.18 ? 2131 HOH B O   1 
HETATM 5208 O O   . HOH I 4 .   ? 24.029  -32.712 -73.878  1.00 28.72 ? 2132 HOH B O   1 
HETATM 5209 O O   . HOH I 4 .   ? 17.438  -29.993 -70.097  1.00 21.60 ? 2133 HOH B O   1 
HETATM 5210 O O   . HOH I 4 .   ? 18.170  -25.548 -60.266  1.00 22.09 ? 2134 HOH B O   1 
HETATM 5211 O O   . HOH I 4 .   ? 15.978  -21.540 -56.459  1.00 19.94 ? 2135 HOH B O   1 
HETATM 5212 O O   . HOH I 4 .   ? 11.777  -19.796 -52.700  1.00 19.54 ? 2136 HOH B O   1 
HETATM 5213 O O   . HOH I 4 .   ? 15.487  -19.098 -53.728  1.00 21.42 ? 2137 HOH B O   1 
HETATM 5214 O O   . HOH I 4 .   ? 7.694   -22.273 -57.529  1.00 21.69 ? 2138 HOH B O   1 
HETATM 5215 O O   . HOH I 4 .   ? 11.740  -15.597 -52.662  1.00 15.54 ? 2139 HOH B O   1 
HETATM 5216 O O   . HOH I 4 .   ? -1.238  -15.807 -63.177  1.00 26.72 ? 2140 HOH B O   1 
HETATM 5217 O O   . HOH I 4 .   ? -1.286  -12.556 -63.014  1.00 25.57 ? 2141 HOH B O   1 
HETATM 5218 O O   . HOH I 4 .   ? -0.783  -9.696  -64.283  1.00 15.70 ? 2142 HOH B O   1 
HETATM 5219 O O   . HOH I 4 .   ? 27.221  -15.806 -55.349  1.00 29.87 ? 2143 HOH B O   1 
HETATM 5220 O O   . HOH I 4 .   ? 27.568  -7.791  -56.889  1.00 26.61 ? 2144 HOH B O   1 
HETATM 5221 O O   . HOH I 4 .   ? 25.268  -9.627  -53.136  1.00 22.24 ? 2145 HOH B O   1 
HETATM 5222 O O   . HOH J 4 .   ? -6.653  0.667   -62.283  1.00 22.76 ? 2001 HOH C O   1 
HETATM 5223 O O   . HOH J 4 .   ? -7.056  4.727   -62.041  1.00 26.55 ? 2002 HOH C O   1 
HETATM 5224 O O   . HOH J 4 .   ? -3.366  -4.837  -67.551  1.00 17.03 ? 2003 HOH C O   1 
HETATM 5225 O O   . HOH J 4 .   ? -2.203  -7.895  -74.186  1.00 18.28 ? 2004 HOH C O   1 
HETATM 5226 O O   . HOH J 4 .   ? -4.489  -6.114  -74.683  1.00 25.46 ? 2005 HOH C O   1 
HETATM 5227 O O   . HOH J 4 .   ? -4.667  -9.415  -74.025  1.00 28.66 ? 2006 HOH C O   1 
HETATM 5228 O O   . HOH J 4 .   ? -8.482  -14.718 -80.972  1.00 36.70 ? 2007 HOH C O   1 
HETATM 5229 O O   . HOH K 4 .   ? 18.355  -22.929 -21.939  1.00 29.28 ? 2001 HOH D O   1 
HETATM 5230 O O   . HOH K 4 .   ? 21.041  -21.835 -25.733  1.00 20.67 ? 2002 HOH D O   1 
HETATM 5231 O O   . HOH K 4 .   ? 14.854  -17.906 -26.797  1.00 15.40 ? 2003 HOH D O   1 
HETATM 5232 O O   . HOH K 4 .   ? 14.040  -14.668 -33.435  1.00 13.57 ? 2004 HOH D O   1 
HETATM 5233 O O   . HOH K 4 .   ? 17.631  -14.520 -32.499  1.00 27.42 ? 2005 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 11  ? 0.3503 0.3840 0.3663 -0.0010 0.0118  0.0217  31   VAL A N   
2    C CA  . VAL A 11  ? 0.3209 0.3486 0.3537 0.0160  0.0050  0.0027  31   VAL A CA  
3    C C   . VAL A 11  ? 0.3299 0.3304 0.3090 0.0235  0.0005  0.0142  31   VAL A C   
4    O O   . VAL A 11  ? 0.3407 0.3525 0.3227 0.0376  0.0102  0.0170  31   VAL A O   
5    C CB  . VAL A 11  ? 0.3198 0.3490 0.3665 0.0178  0.0051  0.0011  31   VAL A CB  
6    C CG1 . VAL A 11  ? 0.3247 0.3600 0.3649 0.0302  0.0181  -0.0013 31   VAL A CG1 
7    C CG2 . VAL A 11  ? 0.3267 0.3832 0.3635 0.0232  -0.0115 0.0055  31   VAL A CG2 
8    N N   . LYS A 12  ? 0.2866 0.2936 0.3125 0.0297  0.0075  0.0205  32   LYS A N   
9    C CA  . LYS A 12  ? 0.2797 0.2664 0.2777 0.0164  0.0102  0.0199  32   LYS A CA  
10   C C   . LYS A 12  ? 0.2508 0.2360 0.2699 0.0251  0.0104  -0.0022 32   LYS A C   
11   O O   . LYS A 12  ? 0.2762 0.2426 0.2593 0.0154  0.0222  0.0023  32   LYS A O   
12   C CB  . LYS A 12  ? 0.2898 0.2695 0.3009 0.0199  0.0054  0.0085  32   LYS A CB  
13   C CG  . LYS A 12  ? 0.2981 0.2741 0.3130 0.0136  0.0134  0.0143  32   LYS A CG  
14   C CD  . LYS A 12  ? 0.3149 0.2824 0.3213 0.0066  0.0010  0.0118  32   LYS A CD  
15   C CE  . LYS A 12  ? 0.3446 0.2894 0.3297 0.0031  0.0027  0.0015  32   LYS A CE  
16   N NZ  . LYS A 12  ? 0.3446 0.2924 0.3611 0.0062  0.0023  0.0032  32   LYS A NZ  
17   N N   . PRO A 13  ? 0.2281 0.2125 0.2202 0.0087  0.0112  0.0135  33   PRO A N   
18   C CA  . PRO A 13  ? 0.2122 0.2038 0.2054 0.0154  0.0102  0.0017  33   PRO A CA  
19   C C   . PRO A 13  ? 0.2028 0.1940 0.1974 0.0131  0.0194  0.0020  33   PRO A C   
20   O O   . PRO A 13  ? 0.2199 0.1947 0.2020 0.0088  0.0211  0.0052  33   PRO A O   
21   C CB  . PRO A 13  ? 0.2168 0.1964 0.2040 0.0108  0.0064  -0.0024 33   PRO A CB  
22   C CG  . PRO A 13  ? 0.2133 0.2048 0.2130 0.0065  0.0041  0.0002  33   PRO A CG  
23   C CD  . PRO A 13  ? 0.2194 0.2075 0.2126 0.0098  0.0007  0.0049  33   PRO A CD  
24   N N   . ASN A 14  ? 0.1845 0.1746 0.1868 0.0262  0.0068  -0.0070 34   ASN A N   
25   C CA  . ASN A 14  ? 0.1816 0.1718 0.1846 0.0183  0.0085  -0.0012 34   ASN A CA  
26   C C   . ASN A 14  ? 0.1689 0.1655 0.1701 0.0177  0.0120  -0.0096 34   ASN A C   
27   O O   . ASN A 14  ? 0.1845 0.1465 0.1759 0.0240  0.0110  -0.0066 34   ASN A O   
28   C CB  . ASN A 14  ? 0.1893 0.1782 0.1819 0.0189  0.0081  -0.0114 34   ASN A CB  
29   C CG  . ASN A 14  ? 0.1818 0.1910 0.1758 0.0186  0.0069  -0.0093 34   ASN A CG  
30   O OD1 . ASN A 14  ? 0.1845 0.2070 0.1879 0.0171  0.0122  -0.0267 34   ASN A OD1 
31   N ND2 . ASN A 14  ? 0.1889 0.2083 0.1847 0.0127  0.0185  -0.0174 34   ASN A ND2 
32   N N   . TYR A 15  ? 0.1687 0.1593 0.1590 0.0146  0.0102  -0.0008 35   TYR A N   
33   C CA  . TYR A 15  ? 0.1577 0.1527 0.1455 0.0078  0.0141  -0.0002 35   TYR A CA  
34   C C   . TYR A 15  ? 0.1616 0.1468 0.1452 0.0090  0.0143  -0.0053 35   TYR A C   
35   O O   . TYR A 15  ? 0.1888 0.1468 0.1551 -0.0011 0.0091  0.0036  35   TYR A O   
36   C CB  . TYR A 15  ? 0.1556 0.1426 0.1405 0.0051  0.0110  -0.0004 35   TYR A CB  
37   C CG  . TYR A 15  ? 0.1458 0.1363 0.1358 0.0071  0.0175  0.0014  35   TYR A CG  
38   C CD1 . TYR A 15  ? 0.1380 0.1345 0.1271 0.0107  0.0156  0.0014  35   TYR A CD1 
39   C CD2 . TYR A 15  ? 0.1501 0.1329 0.1357 0.0106  0.0128  -0.0025 35   TYR A CD2 
40   C CE1 . TYR A 15  ? 0.1495 0.1323 0.1272 0.0100  0.0129  0.0035  35   TYR A CE1 
41   C CE2 . TYR A 15  ? 0.1502 0.1322 0.1289 0.0143  0.0134  0.0011  35   TYR A CE2 
42   C CZ  . TYR A 15  ? 0.1491 0.1342 0.1273 0.0073  0.0100  0.0045  35   TYR A CZ  
43   O OH  . TYR A 15  ? 0.1848 0.1341 0.1211 0.0089  0.0041  0.0039  35   TYR A OH  
44   N N   . ALA A 16  ? 0.1590 0.1483 0.1372 0.0072  0.0057  -0.0061 36   ALA A N   
45   C CA  . ALA A 16  ? 0.1543 0.1403 0.1390 0.0074  0.0043  -0.0027 36   ALA A CA  
46   C C   . ALA A 16  ? 0.1475 0.1377 0.1220 0.0055  0.0089  -0.0061 36   ALA A C   
47   O O   . ALA A 16  ? 0.1519 0.1414 0.1171 0.0075  0.0047  -0.0119 36   ALA A O   
48   C CB  . ALA A 16  ? 0.1600 0.1447 0.1390 0.0171  0.0037  -0.0045 36   ALA A CB  
49   N N   . LEU A 17  ? 0.1447 0.1362 0.1073 0.0132  0.0144  -0.0079 37   LEU A N   
50   C CA  . LEU A 17  ? 0.1513 0.1317 0.1245 0.0066  0.0065  -0.0018 37   LEU A CA  
51   C C   . LEU A 17  ? 0.1457 0.1380 0.1316 0.0020  0.0145  -0.0068 37   LEU A C   
52   O O   . LEU A 17  ? 0.1757 0.1422 0.1355 0.0014  0.0177  -0.0128 37   LEU A O   
53   C CB  . LEU A 17  ? 0.1492 0.1311 0.1168 0.0078  0.0079  -0.0041 37   LEU A CB  
54   C CG  . LEU A 17  ? 0.1380 0.1363 0.1238 0.0034  0.0028  0.0006  37   LEU A CG  
55   C CD1 . LEU A 17  ? 0.1273 0.1346 0.1189 -0.0038 0.0023  0.0020  37   LEU A CD1 
56   C CD2 . LEU A 17  ? 0.1420 0.1410 0.1174 0.0053  -0.0011 -0.0071 37   LEU A CD2 
57   N N   . LYS A 18  ? 0.1470 0.1360 0.1328 0.0069  0.0137  -0.0067 38   LYS A N   
58   C CA  . LYS A 18  ? 0.1502 0.1445 0.1326 0.0045  0.0110  -0.0013 38   LYS A CA  
59   C C   . LYS A 18  ? 0.1370 0.1487 0.1342 0.0036  0.0065  -0.0088 38   LYS A C   
60   O O   . LYS A 18  ? 0.1522 0.1508 0.1306 -0.0018 0.0002  -0.0127 38   LYS A O   
61   C CB  . LYS A 18  ? 0.1514 0.1581 0.1459 0.0000  0.0124  -0.0079 38   LYS A CB  
62   C CG  . LYS A 18  ? 0.1576 0.1766 0.1603 0.0094  0.0029  -0.0039 38   LYS A CG  
63   C CD  . LYS A 18  ? 0.1718 0.1793 0.1576 0.0019  -0.0027 -0.0088 38   LYS A CD  
64   C CE  . LYS A 18  ? 0.1702 0.1968 0.1838 0.0094  -0.0104 -0.0147 38   LYS A CE  
65   N NZ  . LYS A 18  ? 0.1855 0.2163 0.1887 0.0132  0.0235  -0.0056 38   LYS A NZ  
66   N N   . PHE A 19  ? 0.1317 0.1409 0.1183 0.0015  0.0016  -0.0029 39   PHE A N   
67   C CA  . PHE A 19  ? 0.1236 0.1321 0.1196 -0.0032 0.0094  -0.0056 39   PHE A CA  
68   C C   . PHE A 19  ? 0.1192 0.1232 0.1148 -0.0038 0.0034  -0.0004 39   PHE A C   
69   O O   . PHE A 19  ? 0.1241 0.1252 0.1105 -0.0094 0.0104  -0.0077 39   PHE A O   
70   C CB  . PHE A 19  ? 0.1254 0.1339 0.1262 -0.0070 0.0084  -0.0034 39   PHE A CB  
71   C CG  . PHE A 19  ? 0.1200 0.1381 0.1305 -0.0048 0.0035  -0.0018 39   PHE A CG  
72   C CD1 . PHE A 19  ? 0.1378 0.1489 0.1271 -0.0028 -0.0004 -0.0036 39   PHE A CD1 
73   C CD2 . PHE A 19  ? 0.1347 0.1445 0.1294 -0.0041 -0.0067 -0.0025 39   PHE A CD2 
74   C CE1 . PHE A 19  ? 0.1371 0.1528 0.1326 -0.0041 -0.0003 -0.0067 39   PHE A CE1 
75   C CE2 . PHE A 19  ? 0.1352 0.1432 0.1388 -0.0086 -0.0052 -0.0110 39   PHE A CE2 
76   C CZ  . PHE A 19  ? 0.1438 0.1584 0.1412 -0.0055 -0.0074 -0.0044 39   PHE A CZ  
77   N N   . THR A 20  ? 0.1155 0.1218 0.1154 -0.0069 0.0028  -0.0029 40   THR A N   
78   C CA  . THR A 20  ? 0.1178 0.1140 0.1008 -0.0065 0.0031  -0.0017 40   THR A CA  
79   C C   . THR A 20  ? 0.1235 0.1147 0.1005 -0.0054 0.0071  0.0034  40   THR A C   
80   O O   . THR A 20  ? 0.1315 0.1186 0.0939 -0.0038 0.0117  -0.0010 40   THR A O   
81   C CB  . THR A 20  ? 0.1215 0.1158 0.0982 -0.0065 0.0014  -0.0029 40   THR A CB  
82   O OG1 . THR A 20  ? 0.1312 0.1069 0.0843 -0.0191 0.0044  -0.0045 40   THR A OG1 
83   C CG2 . THR A 20  ? 0.1236 0.1194 0.1048 -0.0098 0.0060  0.0006  40   THR A CG2 
84   N N   . LEU A 21  ? 0.1103 0.1120 0.1007 -0.0056 0.0045  0.0022  41   LEU A N   
85   C CA  . LEU A 21  ? 0.1157 0.1122 0.1011 -0.0050 0.0050  0.0050  41   LEU A CA  
86   C C   . LEU A 21  ? 0.1163 0.1193 0.1022 -0.0042 0.0089  0.0002  41   LEU A C   
87   O O   . LEU A 21  ? 0.1343 0.1424 0.1133 -0.0081 0.0116  0.0210  41   LEU A O   
88   C CB  . LEU A 21  ? 0.1189 0.1166 0.1112 -0.0057 -0.0011 -0.0019 41   LEU A CB  
89   C CG  . LEU A 21  ? 0.1181 0.1141 0.1149 -0.0024 -0.0039 -0.0026 41   LEU A CG  
90   C CD1 . LEU A 21  ? 0.1241 0.1215 0.1017 -0.0042 -0.0096 -0.0126 41   LEU A CD1 
91   C CD2 . LEU A 21  ? 0.1224 0.1177 0.1186 -0.0088 -0.0119 0.0020  41   LEU A CD2 
92   N N   . ALA A 22  ? 0.1253 0.1182 0.1008 -0.0028 0.0079  -0.0015 42   ALA A N   
93   C CA  . ALA A 22  ? 0.1264 0.1237 0.1152 0.0004  0.0092  -0.0046 42   ALA A CA  
94   C C   . ALA A 22  ? 0.1293 0.1226 0.1169 0.0000  0.0021  -0.0020 42   ALA A C   
95   O O   . ALA A 22  ? 0.1462 0.1237 0.1271 -0.0023 0.0097  0.0035  42   ALA A O   
96   C CB  . ALA A 22  ? 0.1404 0.1381 0.1199 -0.0021 0.0055  -0.0121 42   ALA A CB  
97   N N   . GLY A 23  ? 0.1332 0.1237 0.1150 0.0013  0.0018  -0.0032 43   GLY A N   
98   C CA  . GLY A 23  ? 0.1287 0.1205 0.1058 -0.0003 -0.0009 0.0040  43   GLY A CA  
99   C C   . GLY A 23  ? 0.1234 0.1279 0.1093 -0.0030 -0.0017 0.0074  43   GLY A C   
100  O O   . GLY A 23  ? 0.1187 0.1347 0.1083 -0.0029 -0.0087 -0.0002 43   GLY A O   
101  N N   . HIS A 24  ? 0.1060 0.1198 0.1044 -0.0049 -0.0070 0.0027  44   HIS A N   
102  C CA  . HIS A 24  ? 0.1154 0.1180 0.1026 -0.0002 -0.0026 0.0041  44   HIS A CA  
103  C C   . HIS A 24  ? 0.1152 0.1167 0.1070 -0.0015 -0.0015 0.0055  44   HIS A C   
104  O O   . HIS A 24  ? 0.1124 0.1254 0.1006 -0.0031 -0.0019 0.0001  44   HIS A O   
105  C CB  . HIS A 24  ? 0.1238 0.1164 0.1078 -0.0038 -0.0066 0.0075  44   HIS A CB  
106  C CG  . HIS A 24  ? 0.1190 0.1119 0.1056 -0.0018 -0.0032 0.0035  44   HIS A CG  
107  N ND1 . HIS A 24  ? 0.1241 0.1176 0.1124 0.0024  -0.0053 -0.0004 44   HIS A ND1 
108  C CD2 . HIS A 24  ? 0.1207 0.1171 0.1113 -0.0030 -0.0073 0.0025  44   HIS A CD2 
109  C CE1 . HIS A 24  ? 0.1227 0.1149 0.1120 -0.0022 -0.0034 0.0023  44   HIS A CE1 
110  N NE2 . HIS A 24  ? 0.1250 0.1182 0.1116 -0.0007 -0.0037 0.0008  44   HIS A NE2 
111  N N   . THR A 25  ? 0.1176 0.1261 0.1168 0.0027  0.0006  0.0024  45   THR A N   
112  C CA  . THR A 25  ? 0.1285 0.1330 0.1249 -0.0068 -0.0057 0.0010  45   THR A CA  
113  C C   . THR A 25  ? 0.1238 0.1350 0.1126 -0.0038 -0.0118 0.0027  45   THR A C   
114  O O   . THR A 25  ? 0.1294 0.1371 0.1235 -0.0114 -0.0108 0.0019  45   THR A O   
115  C CB  . THR A 25  ? 0.1409 0.1358 0.1325 -0.0030 -0.0071 0.0036  45   THR A CB  
116  O OG1 . THR A 25  ? 0.1618 0.1435 0.1453 0.0113  -0.0095 -0.0046 45   THR A OG1 
117  C CG2 . THR A 25  ? 0.1513 0.1395 0.1356 -0.0093 0.0028  -0.0024 45   THR A CG2 
118  N N   . LYS A 26  ? 0.1238 0.1269 0.1130 -0.0039 -0.0127 0.0034  46   LYS A N   
119  C CA  . LYS A 26  ? 0.1257 0.1221 0.1182 -0.0043 -0.0092 0.0008  46   LYS A CA  
120  C C   . LYS A 26  ? 0.1180 0.1130 0.1044 -0.0097 -0.0044 -0.0009 46   LYS A C   
121  O O   . LYS A 26  ? 0.1151 0.1121 0.1122 -0.0086 -0.0103 0.0010  46   LYS A O   
122  C CB  . LYS A 26  ? 0.1352 0.1288 0.1250 -0.0012 -0.0014 0.0004  46   LYS A CB  
123  C CG  . LYS A 26  ? 0.1418 0.1443 0.1444 0.0112  -0.0004 0.0027  46   LYS A CG  
124  C CD  . LYS A 26  ? 0.1501 0.1732 0.1716 -0.0005 -0.0083 0.0052  46   LYS A CD  
125  C CE  . LYS A 26  ? 0.1822 0.1865 0.1963 0.0107  -0.0178 0.0209  46   LYS A CE  
126  N NZ  . LYS A 26  ? 0.1865 0.2392 0.2376 0.0004  -0.0209 0.0238  46   LYS A NZ  
127  N N   . ALA A 27  ? 0.1162 0.1090 0.1029 -0.0109 -0.0131 0.0011  47   ALA A N   
128  C CA  . ALA A 27  ? 0.1147 0.1056 0.1012 -0.0092 -0.0080 -0.0010 47   ALA A CA  
129  C C   . ALA A 27  ? 0.1059 0.0987 0.0919 -0.0056 -0.0051 0.0062  47   ALA A C   
130  O O   . ALA A 27  ? 0.1204 0.1032 0.0948 -0.0050 -0.0119 -0.0003 47   ALA A O   
131  C CB  . ALA A 27  ? 0.1128 0.1051 0.0955 -0.0111 -0.0110 -0.0015 47   ALA A CB  
132  N N   . VAL A 28  ? 0.1056 0.0887 0.0844 -0.0078 -0.0055 0.0051  48   VAL A N   
133  C CA  . VAL A 28  ? 0.1034 0.0920 0.0883 -0.0049 -0.0086 0.0078  48   VAL A CA  
134  C C   . VAL A 28  ? 0.1050 0.0930 0.0851 -0.0076 -0.0044 0.0029  48   VAL A C   
135  O O   . VAL A 28  ? 0.1231 0.0919 0.0929 -0.0092 -0.0076 0.0033  48   VAL A O   
136  C CB  . VAL A 28  ? 0.1024 0.1044 0.0911 -0.0045 -0.0087 0.0077  48   VAL A CB  
137  C CG1 . VAL A 28  ? 0.0936 0.1063 0.0954 -0.0063 -0.0061 0.0115  48   VAL A CG1 
138  C CG2 . VAL A 28  ? 0.1118 0.1116 0.0910 -0.0047 -0.0035 0.0085  48   VAL A CG2 
139  N N   . SER A 29  ? 0.0945 0.0888 0.0830 -0.0061 -0.0033 0.0053  49   SER A N   
140  C CA  . SER A 29  ? 0.0921 0.0905 0.0834 -0.0071 -0.0056 0.0055  49   SER A CA  
141  C C   . SER A 29  ? 0.0888 0.0859 0.0856 -0.0047 -0.0012 0.0033  49   SER A C   
142  O O   . SER A 29  ? 0.0930 0.0948 0.0836 -0.0074 -0.0056 0.0074  49   SER A O   
143  C CB  . SER A 29  ? 0.0919 0.0871 0.0845 -0.0087 -0.0076 0.0043  49   SER A CB  
144  O OG  . SER A 29  ? 0.0907 0.0902 0.0946 -0.0120 -0.0051 0.0014  49   SER A OG  
145  N N   . SER A 30  ? 0.0891 0.0884 0.0827 -0.0046 -0.0047 0.0097  50   SER A N   
146  C CA  . SER A 30  ? 0.0877 0.0928 0.0911 0.0007  -0.0037 0.0071  50   SER A CA  
147  C C   . SER A 30  ? 0.0898 0.0894 0.0917 0.0006  -0.0038 0.0116  50   SER A C   
148  O O   . SER A 30  ? 0.0981 0.0998 0.1098 0.0004  -0.0072 0.0215  50   SER A O   
149  C CB  . SER A 30  ? 0.0903 0.1044 0.0896 0.0063  -0.0026 0.0041  50   SER A CB  
150  O OG  . SER A 30  ? 0.0887 0.1307 0.1090 0.0058  -0.0066 0.0024  50   SER A OG  
151  N N   . VAL A 31  ? 0.0895 0.0897 0.0862 -0.0009 -0.0038 0.0049  51   VAL A N   
152  C CA  . VAL A 31  ? 0.0875 0.0885 0.0891 -0.0013 -0.0025 -0.0013 51   VAL A CA  
153  C C   . VAL A 31  ? 0.0838 0.0862 0.0903 -0.0025 -0.0009 0.0019  51   VAL A C   
154  O O   . VAL A 31  ? 0.0793 0.0959 0.0889 -0.0063 0.0000  0.0074  51   VAL A O   
155  C CB  . VAL A 31  ? 0.0908 0.0837 0.0888 0.0003  -0.0021 0.0006  51   VAL A CB  
156  C CG1 . VAL A 31  ? 0.0931 0.0898 0.0913 0.0044  -0.0054 -0.0048 51   VAL A CG1 
157  C CG2 . VAL A 31  ? 0.0911 0.0830 0.0987 0.0046  -0.0060 -0.0020 51   VAL A CG2 
158  N N   . LYS A 32  ? 0.0907 0.0870 0.0899 -0.0056 -0.0017 0.0014  52   LYS A N   
159  C CA  . LYS A 32  ? 0.0888 0.0841 0.0862 -0.0026 0.0000  0.0003  52   LYS A CA  
160  C C   . LYS A 32  ? 0.0911 0.0847 0.0820 -0.0032 0.0000  0.0001  52   LYS A C   
161  O O   . LYS A 32  ? 0.0965 0.0836 0.0842 -0.0088 -0.0044 0.0017  52   LYS A O   
162  C CB  . LYS A 32  ? 0.0894 0.0853 0.0860 -0.0002 0.0010  -0.0009 52   LYS A CB  
163  C CG  . LYS A 32  ? 0.0936 0.0965 0.0924 -0.0002 0.0047  0.0007  52   LYS A CG  
164  C CD  . LYS A 32  ? 0.1009 0.0950 0.0994 0.0031  0.0026  -0.0013 52   LYS A CD  
165  C CE  . LYS A 32  ? 0.1022 0.0986 0.0949 0.0017  0.0040  -0.0017 52   LYS A CE  
166  N NZ  . LYS A 32  ? 0.1156 0.1032 0.0996 0.0032  0.0095  -0.0010 52   LYS A NZ  
167  N N   . PHE A 33  ? 0.0945 0.0851 0.0841 -0.0018 -0.0078 0.0009  53   PHE A N   
168  C CA  . PHE A 33  ? 0.1020 0.0942 0.0891 -0.0043 -0.0005 0.0020  53   PHE A CA  
169  C C   . PHE A 33  ? 0.1102 0.0940 0.0957 -0.0079 -0.0019 0.0013  53   PHE A C   
170  O O   . PHE A 33  ? 0.1160 0.0974 0.0957 -0.0056 -0.0078 0.0002  53   PHE A O   
171  C CB  . PHE A 33  ? 0.1077 0.0943 0.0929 -0.0021 0.0028  -0.0006 53   PHE A CB  
172  C CG  . PHE A 33  ? 0.1144 0.0927 0.0918 -0.0025 0.0017  0.0006  53   PHE A CG  
173  C CD1 . PHE A 33  ? 0.1232 0.0927 0.0910 -0.0043 0.0071  -0.0030 53   PHE A CD1 
174  C CD2 . PHE A 33  ? 0.1201 0.0921 0.0907 -0.0036 0.0054  -0.0019 53   PHE A CD2 
175  C CE1 . PHE A 33  ? 0.1215 0.0960 0.0876 -0.0040 0.0050  -0.0023 53   PHE A CE1 
176  C CE2 . PHE A 33  ? 0.1248 0.0932 0.0930 -0.0021 0.0060  -0.0043 53   PHE A CE2 
177  C CZ  . PHE A 33  ? 0.1202 0.0933 0.0915 -0.0008 0.0064  -0.0064 53   PHE A CZ  
178  N N   . SER A 34  ? 0.1132 0.0967 0.1086 -0.0105 -0.0012 0.0052  54   SER A N   
179  C CA  . SER A 34  ? 0.1119 0.1006 0.1023 -0.0066 -0.0021 0.0032  54   SER A CA  
180  C C   . SER A 34  ? 0.1086 0.1082 0.1090 -0.0039 0.0001  0.0013  54   SER A C   
181  O O   . SER A 34  ? 0.1027 0.1154 0.1117 -0.0047 0.0002  -0.0040 54   SER A O   
182  C CB  . SER A 34  ? 0.1123 0.0997 0.1049 -0.0059 0.0018  0.0043  54   SER A CB  
183  O OG  . SER A 34  ? 0.1164 0.1011 0.0991 -0.0045 -0.0002 0.0052  54   SER A OG  
184  N N   . PRO A 35  ? 0.1155 0.1194 0.1119 -0.0020 -0.0021 -0.0042 55   PRO A N   
185  C CA  . PRO A 35  ? 0.1171 0.1153 0.1134 -0.0027 -0.0037 -0.0026 55   PRO A CA  
186  C C   . PRO A 35  ? 0.1215 0.1201 0.1156 -0.0045 -0.0003 -0.0026 55   PRO A C   
187  O O   . PRO A 35  ? 0.1307 0.1288 0.1348 0.0026  -0.0020 0.0036  55   PRO A O   
188  C CB  . PRO A 35  ? 0.1152 0.1264 0.1106 -0.0032 -0.0060 -0.0043 55   PRO A CB  
189  C CG  . PRO A 35  ? 0.1157 0.1302 0.1144 0.0017  -0.0089 -0.0086 55   PRO A CG  
190  C CD  . PRO A 35  ? 0.1195 0.1251 0.1088 -0.0004 -0.0026 -0.0040 55   PRO A CD  
191  N N   . ASN A 36  ? 0.1162 0.1258 0.1086 -0.0066 -0.0020 -0.0014 56   ASN A N   
192  C CA  . ASN A 36  ? 0.1190 0.1283 0.1081 -0.0087 -0.0009 -0.0020 56   ASN A CA  
193  C C   . ASN A 36  ? 0.1196 0.1325 0.1128 -0.0081 0.0073  -0.0085 56   ASN A C   
194  O O   . ASN A 36  ? 0.1126 0.1547 0.1151 -0.0146 0.0034  -0.0104 56   ASN A O   
195  C CB  . ASN A 36  ? 0.1177 0.1275 0.1068 -0.0127 -0.0022 -0.0042 56   ASN A CB  
196  C CG  . ASN A 36  ? 0.1243 0.1251 0.1165 -0.0105 -0.0037 0.0021  56   ASN A CG  
197  O OD1 . ASN A 36  ? 0.1312 0.1312 0.1373 -0.0223 -0.0035 -0.0037 56   ASN A OD1 
198  N ND2 . ASN A 36  ? 0.1336 0.1238 0.1107 -0.0137 -0.0130 -0.0006 56   ASN A ND2 
199  N N   . GLY A 37  ? 0.1234 0.1250 0.1070 -0.0080 0.0150  -0.0056 57   GLY A N   
200  C CA  . GLY A 37  ? 0.1211 0.1183 0.1149 -0.0087 0.0065  -0.0070 57   GLY A CA  
201  C C   . GLY A 37  ? 0.1220 0.1167 0.1188 -0.0078 0.0047  -0.0053 57   GLY A C   
202  O O   . GLY A 37  ? 0.1138 0.1234 0.1125 -0.0039 0.0109  -0.0062 57   GLY A O   
203  N N   . GLU A 38  ? 0.1099 0.1168 0.1229 -0.0069 -0.0013 -0.0027 58   GLU A N   
204  C CA  . GLU A 38  ? 0.1231 0.1245 0.1254 -0.0112 0.0025  0.0029  58   GLU A CA  
205  C C   . GLU A 38  ? 0.1249 0.1100 0.1155 -0.0101 0.0001  0.0055  58   GLU A C   
206  O O   . GLU A 38  ? 0.1231 0.1086 0.1122 -0.0093 0.0019  0.0176  58   GLU A O   
207  C CB  . GLU A 38  ? 0.1287 0.1271 0.1440 -0.0146 -0.0009 0.0006  58   GLU A CB  
208  C CG  . GLU A 38  ? 0.1315 0.1554 0.1604 -0.0195 -0.0072 0.0047  58   GLU A CG  
209  C CD  . GLU A 38  ? 0.1397 0.1642 0.1650 -0.0172 -0.0042 -0.0041 58   GLU A CD  
210  O OE1 . GLU A 38  ? 0.1949 0.1933 0.1844 -0.0133 -0.0103 0.0201  58   GLU A OE1 
211  O OE2 . GLU A 38  ? 0.1503 0.1540 0.1719 -0.0254 0.0029  0.0043  58   GLU A OE2 
212  N N   . TRP A 39  ? 0.1248 0.1122 0.1117 -0.0141 -0.0015 0.0080  59   TRP A N   
213  C CA  . TRP A 39  ? 0.1238 0.1172 0.1096 -0.0147 -0.0002 0.0094  59   TRP A CA  
214  C C   . TRP A 39  ? 0.1139 0.1129 0.1013 -0.0100 -0.0008 0.0057  59   TRP A C   
215  O O   . TRP A 39  ? 0.1255 0.1196 0.1006 -0.0079 -0.0057 0.0039  59   TRP A O   
216  C CB  . TRP A 39  ? 0.1303 0.1235 0.1209 -0.0074 -0.0042 0.0047  59   TRP A CB  
217  C CG  . TRP A 39  ? 0.1439 0.1247 0.1435 -0.0125 -0.0015 0.0091  59   TRP A CG  
218  C CD1 . TRP A 39  ? 0.1440 0.1393 0.1411 -0.0107 -0.0060 0.0083  59   TRP A CD1 
219  C CD2 . TRP A 39  ? 0.1575 0.1428 0.1452 -0.0123 -0.0047 0.0119  59   TRP A CD2 
220  N NE1 . TRP A 39  ? 0.1641 0.1426 0.1577 -0.0237 -0.0090 0.0142  59   TRP A NE1 
221  C CE2 . TRP A 39  ? 0.1570 0.1476 0.1527 -0.0155 -0.0053 0.0158  59   TRP A CE2 
222  C CE3 . TRP A 39  ? 0.1601 0.1551 0.1567 -0.0115 -0.0161 0.0146  59   TRP A CE3 
223  C CZ2 . TRP A 39  ? 0.1660 0.1591 0.1598 -0.0159 -0.0046 0.0240  59   TRP A CZ2 
224  C CZ3 . TRP A 39  ? 0.1752 0.1697 0.1590 -0.0162 -0.0165 0.0194  59   TRP A CZ3 
225  C CH2 . TRP A 39  ? 0.1748 0.1679 0.1710 -0.0163 -0.0140 0.0201  59   TRP A CH2 
226  N N   . LEU A 40  ? 0.1108 0.1072 0.0902 -0.0104 0.0044  0.0061  60   LEU A N   
227  C CA  . LEU A 40  ? 0.1060 0.1005 0.0925 -0.0080 0.0009  0.0010  60   LEU A CA  
228  C C   . LEU A 40  ? 0.1084 0.1020 0.0880 -0.0044 0.0001  0.0034  60   LEU A C   
229  O O   . LEU A 40  ? 0.1158 0.1066 0.0957 -0.0017 0.0004  0.0080  60   LEU A O   
230  C CB  . LEU A 40  ? 0.1147 0.0964 0.0949 -0.0047 0.0020  -0.0014 60   LEU A CB  
231  C CG  . LEU A 40  ? 0.1158 0.1066 0.1040 -0.0078 0.0065  -0.0053 60   LEU A CG  
232  C CD1 . LEU A 40  ? 0.1256 0.1065 0.1102 -0.0034 -0.0007 -0.0056 60   LEU A CD1 
233  C CD2 . LEU A 40  ? 0.1151 0.1019 0.1085 -0.0093 0.0057  -0.0075 60   LEU A CD2 
234  N N   . ALA A 41  ? 0.0968 0.0928 0.0887 -0.0098 -0.0017 0.0056  61   ALA A N   
235  C CA  . ALA A 41  ? 0.1047 0.0873 0.0853 -0.0043 -0.0021 0.0045  61   ALA A CA  
236  C C   . ALA A 41  ? 0.0994 0.0861 0.0896 -0.0010 -0.0064 0.0057  61   ALA A C   
237  O O   . ALA A 41  ? 0.1110 0.0887 0.0894 -0.0017 -0.0129 0.0090  61   ALA A O   
238  C CB  . ALA A 41  ? 0.1094 0.0907 0.0856 -0.0112 -0.0022 0.0030  61   ALA A CB  
239  N N   . SER A 42  ? 0.0948 0.0883 0.0875 -0.0029 -0.0045 0.0005  62   SER A N   
240  C CA  . SER A 42  ? 0.0928 0.0875 0.0874 -0.0001 -0.0017 0.0020  62   SER A CA  
241  C C   . SER A 42  ? 0.0926 0.0861 0.0810 0.0000  -0.0033 0.0021  62   SER A C   
242  O O   . SER A 42  ? 0.0989 0.0837 0.0817 0.0068  -0.0038 -0.0042 62   SER A O   
243  C CB  . SER A 42  ? 0.0979 0.0828 0.0835 0.0001  -0.0023 0.0057  62   SER A CB  
244  O OG  . SER A 42  ? 0.1027 0.0896 0.0816 -0.0059 -0.0009 0.0073  62   SER A OG  
245  N N   . SER A 43  ? 0.0939 0.0800 0.0858 -0.0025 -0.0042 0.0028  63   SER A N   
246  C CA  . SER A 43  ? 0.0966 0.0854 0.0937 0.0018  -0.0041 0.0043  63   SER A CA  
247  C C   . SER A 43  ? 0.0998 0.0846 0.0924 0.0017  -0.0061 0.0030  63   SER A C   
248  O O   . SER A 43  ? 0.1034 0.0822 0.0929 -0.0024 -0.0056 0.0040  63   SER A O   
249  C CB  . SER A 43  ? 0.0972 0.0856 0.0931 0.0024  -0.0010 0.0059  63   SER A CB  
250  O OG  . SER A 43  ? 0.1031 0.0888 0.0894 -0.0014 0.0018  0.0087  63   SER A OG  
251  N N   . SER A 44  ? 0.0975 0.0933 0.0999 0.0018  -0.0068 -0.0038 64   SER A N   
252  C CA  . SER A 44  ? 0.0991 0.1048 0.0999 -0.0025 -0.0093 0.0008  64   SER A CA  
253  C C   . SER A 44  ? 0.1016 0.1010 0.1040 -0.0014 -0.0098 -0.0029 64   SER A C   
254  O O   . SER A 44  ? 0.1001 0.0998 0.1073 -0.0063 -0.0110 -0.0044 64   SER A O   
255  C CB  . SER A 44  ? 0.1016 0.1086 0.0996 -0.0001 -0.0073 0.0000  64   SER A CB  
256  O OG  . SER A 44  ? 0.0998 0.1173 0.1030 0.0072  -0.0100 0.0002  64   SER A OG  
257  N N   . ALA A 45  ? 0.0994 0.1023 0.1100 -0.0029 -0.0053 0.0022  65   ALA A N   
258  C CA  . ALA A 45  ? 0.0999 0.1075 0.1153 -0.0011 -0.0075 0.0019  65   ALA A CA  
259  C C   . ALA A 45  ? 0.1032 0.1094 0.1074 -0.0022 -0.0069 0.0008  65   ALA A C   
260  O O   . ALA A 45  ? 0.1048 0.1203 0.1130 0.0067  -0.0183 0.0013  65   ALA A O   
261  C CB  . ALA A 45  ? 0.1046 0.1076 0.1085 -0.0033 -0.0081 0.0000  65   ALA A CB  
262  N N   . ASP A 46  ? 0.1057 0.1077 0.1033 0.0005  -0.0090 0.0021  66   ASP A N   
263  C CA  . ASP A 46  ? 0.1117 0.1045 0.1095 0.0017  -0.0064 0.0031  66   ASP A CA  
264  C C   . ASP A 46  ? 0.1037 0.1053 0.1059 -0.0012 -0.0049 0.0042  66   ASP A C   
265  O O   . ASP A 46  ? 0.1072 0.1092 0.1163 -0.0048 -0.0113 0.0099  66   ASP A O   
266  C CB  . ASP A 46  ? 0.1210 0.1120 0.1089 0.0047  -0.0061 0.0039  66   ASP A CB  
267  C CG  . ASP A 46  ? 0.1218 0.1130 0.1164 0.0018  -0.0093 0.0040  66   ASP A CG  
268  O OD1 . ASP A 46  ? 0.1220 0.1217 0.1252 0.0002  -0.0191 0.0061  66   ASP A OD1 
269  O OD2 . ASP A 46  ? 0.1556 0.1324 0.1160 0.0020  -0.0049 -0.0020 66   ASP A OD2 
270  N N   . LYS A 47  ? 0.1077 0.1078 0.1092 -0.0034 -0.0091 0.0046  67   LYS A N   
271  C CA  . LYS A 47  ? 0.1176 0.1068 0.1178 -0.0043 -0.0013 0.0021  67   LYS A CA  
272  C C   . LYS A 47  ? 0.1139 0.1017 0.1193 -0.0027 -0.0056 0.0001  67   LYS A C   
273  O O   . LYS A 47  ? 0.1196 0.1053 0.1198 -0.0096 -0.0100 0.0006  67   LYS A O   
274  C CB  . LYS A 47  ? 0.1156 0.1194 0.1215 0.0002  0.0005  0.0000  67   LYS A CB  
275  C CG  . LYS A 47  ? 0.1178 0.1223 0.1245 -0.0043 -0.0041 0.0023  67   LYS A CG  
276  C CD  . LYS A 47  ? 0.1308 0.1306 0.1376 0.0051  0.0034  -0.0018 67   LYS A CD  
277  C CE  . LYS A 47  ? 0.1440 0.1432 0.1460 -0.0027 -0.0015 0.0083  67   LYS A CE  
278  N NZ  . LYS A 47  ? 0.1593 0.1469 0.1938 0.0079  -0.0081 0.0056  67   LYS A NZ  
279  N N   . LEU A 48  ? 0.1083 0.1012 0.1089 -0.0067 -0.0074 0.0024  68   LEU A N   
280  C CA  . LEU A 48  ? 0.1063 0.0987 0.1089 -0.0034 -0.0073 0.0039  68   LEU A CA  
281  C C   . LEU A 48  ? 0.1104 0.0927 0.1082 -0.0056 -0.0116 0.0067  68   LEU A C   
282  O O   . LEU A 48  ? 0.1074 0.0958 0.0946 -0.0079 -0.0189 0.0112  68   LEU A O   
283  C CB  . LEU A 48  ? 0.1231 0.1036 0.1101 -0.0066 -0.0002 -0.0002 68   LEU A CB  
284  C CG  . LEU A 48  ? 0.1235 0.0999 0.1148 -0.0044 0.0023  -0.0021 68   LEU A CG  
285  C CD1 . LEU A 48  ? 0.1449 0.1171 0.1120 -0.0061 0.0049  0.0074  68   LEU A CD1 
286  C CD2 . LEU A 48  ? 0.1221 0.1011 0.1072 0.0004  0.0078  -0.0034 68   LEU A CD2 
287  N N   . ILE A 49  ? 0.1049 0.0978 0.1024 -0.0043 0.0013  0.0068  69   ILE A N   
288  C CA  . ILE A 49  ? 0.1060 0.0976 0.0974 -0.0041 0.0001  0.0063  69   ILE A CA  
289  C C   . ILE A 49  ? 0.1079 0.0916 0.0940 -0.0019 -0.0013 0.0034  69   ILE A C   
290  O O   . ILE A 49  ? 0.1177 0.0887 0.0966 -0.0043 -0.0039 0.0022  69   ILE A O   
291  C CB  . ILE A 49  ? 0.1099 0.1052 0.1015 -0.0079 0.0021  0.0005  69   ILE A CB  
292  C CG1 . ILE A 49  ? 0.1210 0.1075 0.0978 -0.0050 0.0017  0.0001  69   ILE A CG1 
293  C CG2 . ILE A 49  ? 0.1115 0.1180 0.0968 -0.0037 0.0065  -0.0076 69   ILE A CG2 
294  C CD1 . ILE A 49  ? 0.1282 0.1033 0.1079 -0.0027 0.0024  -0.0030 69   ILE A CD1 
295  N N   . LYS A 50  ? 0.1002 0.0903 0.0882 -0.0048 -0.0019 0.0053  70   LYS A N   
296  C CA  . LYS A 50  ? 0.0988 0.0874 0.0901 -0.0051 -0.0005 0.0031  70   LYS A CA  
297  C C   . LYS A 50  ? 0.1008 0.0862 0.0886 -0.0022 -0.0009 0.0061  70   LYS A C   
298  O O   . LYS A 50  ? 0.1061 0.0873 0.0949 0.0058  -0.0070 0.0064  70   LYS A O   
299  C CB  . LYS A 50  ? 0.1074 0.0927 0.0897 -0.0092 0.0000  0.0018  70   LYS A CB  
300  C CG  . LYS A 50  ? 0.1082 0.1027 0.1049 -0.0069 -0.0002 0.0030  70   LYS A CG  
301  C CD  . LYS A 50  ? 0.1180 0.1043 0.1038 -0.0104 -0.0022 -0.0043 70   LYS A CD  
302  C CE  . LYS A 50  ? 0.1206 0.1063 0.1133 -0.0101 -0.0060 -0.0083 70   LYS A CE  
303  N NZ  . LYS A 50  ? 0.1396 0.1104 0.1241 -0.0068 -0.0120 0.0016  70   LYS A NZ  
304  N N   . ILE A 51  ? 0.0993 0.0812 0.0859 -0.0039 -0.0042 0.0041  71   ILE A N   
305  C CA  . ILE A 51  ? 0.0989 0.0851 0.0897 -0.0037 -0.0018 0.0061  71   ILE A CA  
306  C C   . ILE A 51  ? 0.1030 0.0846 0.0863 -0.0048 -0.0023 0.0076  71   ILE A C   
307  O O   . ILE A 51  ? 0.1078 0.0814 0.0837 -0.0031 0.0025  0.0074  71   ILE A O   
308  C CB  . ILE A 51  ? 0.1029 0.0889 0.0938 -0.0058 -0.0030 0.0018  71   ILE A CB  
309  C CG1 . ILE A 51  ? 0.1100 0.0926 0.0942 -0.0048 0.0029  0.0045  71   ILE A CG1 
310  C CG2 . ILE A 51  ? 0.1025 0.0998 0.0865 -0.0056 -0.0026 -0.0001 71   ILE A CG2 
311  C CD1 . ILE A 51  ? 0.1077 0.1037 0.0889 -0.0043 0.0051  0.0025  71   ILE A CD1 
312  N N   . TRP A 52  ? 0.1033 0.0886 0.0865 -0.0030 -0.0006 0.0046  72   TRP A N   
313  C CA  . TRP A 52  ? 0.1027 0.0862 0.0896 -0.0023 0.0019  0.0052  72   TRP A CA  
314  C C   . TRP A 52  ? 0.1031 0.0874 0.0914 -0.0062 -0.0010 0.0067  72   TRP A C   
315  O O   . TRP A 52  ? 0.1128 0.0957 0.0944 -0.0059 -0.0069 0.0129  72   TRP A O   
316  C CB  . TRP A 52  ? 0.0999 0.0896 0.0923 -0.0038 -0.0016 0.0020  72   TRP A CB  
317  C CG  . TRP A 52  ? 0.0999 0.0906 0.0902 -0.0029 -0.0001 0.0038  72   TRP A CG  
318  C CD1 . TRP A 52  ? 0.0971 0.0839 0.0890 -0.0016 -0.0017 0.0039  72   TRP A CD1 
319  C CD2 . TRP A 52  ? 0.0979 0.0915 0.0915 -0.0023 -0.0005 0.0055  72   TRP A CD2 
320  N NE1 . TRP A 52  ? 0.0982 0.0907 0.0895 -0.0039 -0.0018 0.0027  72   TRP A NE1 
321  C CE2 . TRP A 52  ? 0.0983 0.0892 0.0884 0.0005  -0.0003 0.0037  72   TRP A CE2 
322  C CE3 . TRP A 52  ? 0.1054 0.0999 0.0921 -0.0023 0.0002  0.0049  72   TRP A CE3 
323  C CZ2 . TRP A 52  ? 0.0981 0.1027 0.0954 -0.0019 -0.0002 0.0018  72   TRP A CZ2 
324  C CZ3 . TRP A 52  ? 0.1050 0.0981 0.0967 -0.0002 -0.0009 0.0022  72   TRP A CZ3 
325  C CH2 . TRP A 52  ? 0.1016 0.1055 0.0947 -0.0013 -0.0047 0.0046  72   TRP A CH2 
326  N N   . GLY A 53  ? 0.1097 0.0847 0.0901 -0.0064 0.0019  0.0149  73   GLY A N   
327  C CA  . GLY A 53  ? 0.1079 0.0941 0.0879 -0.0080 0.0074  0.0116  73   GLY A CA  
328  C C   . GLY A 53  ? 0.1125 0.0948 0.0973 -0.0064 0.0024  0.0117  73   GLY A C   
329  O O   . GLY A 53  ? 0.1289 0.1008 0.1075 -0.0118 -0.0041 0.0043  73   GLY A O   
330  N N   . ALA A 54  ? 0.1097 0.1029 0.0988 -0.0111 -0.0022 0.0035  74   ALA A N   
331  C CA  . ALA A 54  ? 0.1175 0.1077 0.1061 -0.0099 -0.0063 0.0075  74   ALA A CA  
332  C C   . ALA A 54  ? 0.1222 0.1158 0.1159 -0.0032 -0.0098 0.0005  74   ALA A C   
333  O O   . ALA A 54  ? 0.1325 0.1210 0.1222 -0.0057 -0.0111 0.0120  74   ALA A O   
334  C CB  . ALA A 54  ? 0.1245 0.1094 0.1036 -0.0118 -0.0073 0.0090  74   ALA A CB  
335  N N   . TYR A 55  ? 0.1405 0.1252 0.1247 -0.0022 -0.0007 0.0050  75   TYR A N   
336  C CA  . TYR A 55  ? 0.1499 0.1362 0.1401 0.0077  -0.0013 -0.0029 75   TYR A CA  
337  C C   . TYR A 55  ? 0.1695 0.1532 0.1499 0.0041  -0.0106 -0.0121 75   TYR A C   
338  O O   . TYR A 55  ? 0.1976 0.1685 0.1730 0.0219  -0.0113 -0.0290 75   TYR A O   
339  C CB  . TYR A 55  ? 0.1506 0.1420 0.1303 0.0053  0.0024  -0.0064 75   TYR A CB  
340  C CG  . TYR A 55  ? 0.1412 0.1354 0.1296 -0.0060 0.0030  0.0055  75   TYR A CG  
341  C CD1 . TYR A 55  ? 0.1375 0.1389 0.1291 -0.0070 -0.0027 0.0056  75   TYR A CD1 
342  C CD2 . TYR A 55  ? 0.1420 0.1388 0.1241 -0.0114 0.0015  0.0058  75   TYR A CD2 
343  C CE1 . TYR A 55  ? 0.1359 0.1420 0.1299 -0.0134 -0.0006 0.0001  75   TYR A CE1 
344  C CE2 . TYR A 55  ? 0.1475 0.1385 0.1302 -0.0178 -0.0051 0.0040  75   TYR A CE2 
345  C CZ  . TYR A 55  ? 0.1362 0.1432 0.1207 -0.0203 -0.0038 0.0046  75   TYR A CZ  
346  O OH  . TYR A 55  ? 0.1435 0.1641 0.1285 -0.0314 -0.0170 0.0167  75   TYR A OH  
347  N N   . ASP A 56  ? 0.1814 0.1690 0.1491 0.0096  -0.0146 -0.0068 76   ASP A N   
348  C CA  . ASP A 56  ? 0.1717 0.1727 0.1570 0.0002  -0.0191 -0.0083 76   ASP A CA  
349  C C   . ASP A 56  ? 0.1703 0.1536 0.1431 -0.0019 -0.0063 -0.0104 76   ASP A C   
350  O O   . ASP A 56  ? 0.1793 0.1629 0.1505 0.0037  -0.0185 -0.0067 76   ASP A O   
351  C CB  . ASP A 56  ? 0.1799 0.1880 0.1753 -0.0041 -0.0030 -0.0027 76   ASP A CB  
352  C CG  . ASP A 56  ? 0.1843 0.1876 0.1969 -0.0064 0.0095  -0.0039 76   ASP A CG  
353  O OD1 . ASP A 56  ? 0.1660 0.1793 0.2019 -0.0117 0.0005  -0.0158 76   ASP A OD1 
354  O OD2 . ASP A 56  ? 0.2090 0.2132 0.2542 -0.0207 0.0235  0.0075  76   ASP A OD2 
355  N N   . GLY A 57  ? 0.1510 0.1398 0.1428 -0.0046 -0.0098 -0.0069 77   GLY A N   
356  C CA  . GLY A 57  ? 0.1507 0.1320 0.1224 -0.0032 -0.0112 -0.0054 77   GLY A CA  
357  C C   . GLY A 57  ? 0.1411 0.1364 0.1229 0.0011  -0.0059 0.0009  77   GLY A C   
358  O O   . GLY A 57  ? 0.1417 0.1406 0.1323 -0.0029 -0.0067 0.0054  77   GLY A O   
359  N N   . LYS A 58  ? 0.1452 0.1363 0.1251 0.0049  0.0036  -0.0018 78   LYS A N   
360  C CA  . LYS A 58  ? 0.1481 0.1473 0.1236 0.0038  -0.0023 0.0039  78   LYS A CA  
361  C C   . LYS A 58  ? 0.1361 0.1360 0.1259 -0.0036 -0.0022 0.0083  78   LYS A C   
362  O O   . LYS A 58  ? 0.1466 0.1466 0.1119 -0.0067 -0.0030 0.0191  78   LYS A O   
363  C CB  . LYS A 58  ? 0.1602 0.1555 0.1415 -0.0085 0.0077  -0.0051 78   LYS A CB  
364  C CG  . LYS A 58  ? 0.1945 0.1737 0.1632 0.0118  0.0052  0.0034  78   LYS A CG  
365  C CD  . LYS A 58  ? 0.2013 0.2055 0.2008 -0.0025 0.0110  0.0018  78   LYS A CD  
366  C CE  . LYS A 58  ? 0.2321 0.2172 0.2050 -0.0052 0.0058  0.0153  78   LYS A CE  
367  N NZ  . LYS A 58  ? 0.2269 0.2142 0.2205 -0.0132 -0.0047 0.0138  78   LYS A NZ  
368  N N   . PHE A 59  ? 0.1307 0.1318 0.1145 -0.0081 0.0011  0.0063  79   PHE A N   
369  C CA  . PHE A 59  ? 0.1319 0.1286 0.1190 -0.0056 -0.0055 0.0027  79   PHE A CA  
370  C C   . PHE A 59  ? 0.1417 0.1272 0.1130 -0.0081 0.0025  0.0050  79   PHE A C   
371  O O   . PHE A 59  ? 0.1581 0.1186 0.1178 -0.0126 0.0083  0.0028  79   PHE A O   
372  C CB  . PHE A 59  ? 0.1356 0.1299 0.1111 -0.0076 -0.0084 0.0000  79   PHE A CB  
373  C CG  . PHE A 59  ? 0.1404 0.1216 0.1186 -0.0073 -0.0081 0.0029  79   PHE A CG  
374  C CD1 . PHE A 59  ? 0.1442 0.1333 0.1142 -0.0068 -0.0098 0.0018  79   PHE A CD1 
375  C CD2 . PHE A 59  ? 0.1511 0.1306 0.1092 -0.0035 -0.0108 0.0071  79   PHE A CD2 
376  C CE1 . PHE A 59  ? 0.1472 0.1295 0.1212 -0.0068 -0.0140 0.0006  79   PHE A CE1 
377  C CE2 . PHE A 59  ? 0.1517 0.1287 0.1187 0.0000  -0.0107 0.0067  79   PHE A CE2 
378  C CZ  . PHE A 59  ? 0.1431 0.1310 0.1262 -0.0055 -0.0082 0.0036  79   PHE A CZ  
379  N N   . GLU A 60  ? 0.1387 0.1272 0.1183 -0.0096 0.0058  -0.0004 80   GLU A N   
380  C CA  . GLU A 60  ? 0.1471 0.1196 0.1123 -0.0073 0.0005  0.0132  80   GLU A CA  
381  C C   . GLU A 60  ? 0.1500 0.1162 0.1164 -0.0074 0.0002  0.0143  80   GLU A C   
382  O O   . GLU A 60  ? 0.1779 0.1176 0.1253 -0.0073 -0.0015 0.0213  80   GLU A O   
383  C CB  . GLU A 60  ? 0.1437 0.1195 0.1177 -0.0037 -0.0014 0.0098  80   GLU A CB  
384  C CG  . GLU A 60  ? 0.1530 0.1290 0.1316 -0.0140 0.0024  0.0112  80   GLU A CG  
385  C CD  . GLU A 60  ? 0.1567 0.1311 0.1378 -0.0178 0.0053  0.0172  80   GLU A CD  
386  O OE1 . GLU A 60  ? 0.1611 0.1528 0.1395 -0.0151 0.0101  0.0069  80   GLU A OE1 
387  O OE2 . GLU A 60  ? 0.1585 0.1319 0.1396 -0.0206 0.0034  0.0187  80   GLU A OE2 
388  N N   . LYS A 61  ? 0.1371 0.1144 0.1223 -0.0065 0.0009  0.0092  81   LYS A N   
389  C CA  . LYS A 61  ? 0.1343 0.1137 0.1182 -0.0090 -0.0006 0.0054  81   LYS A CA  
390  C C   . LYS A 61  ? 0.1312 0.1073 0.1122 -0.0028 -0.0017 0.0069  81   LYS A C   
391  O O   . LYS A 61  ? 0.1275 0.1078 0.1040 -0.0103 -0.0089 0.0061  81   LYS A O   
392  C CB  . LYS A 61  ? 0.1286 0.1157 0.1208 -0.0124 0.0011  0.0049  81   LYS A CB  
393  C CG  . LYS A 61  ? 0.1392 0.1237 0.1208 -0.0122 -0.0005 0.0051  81   LYS A CG  
394  C CD  . LYS A 61  ? 0.1435 0.1260 0.1279 -0.0079 -0.0068 -0.0004 81   LYS A CD  
395  C CE  . LYS A 61  ? 0.1514 0.1273 0.1364 -0.0148 -0.0021 0.0002  81   LYS A CE  
396  N NZ  . LYS A 61  ? 0.1616 0.1409 0.1304 -0.0261 0.0030  -0.0002 81   LYS A NZ  
397  N N   . THR A 62  ? 0.1270 0.1073 0.1160 -0.0061 -0.0069 0.0038  82   THR A N   
398  C CA  . THR A 62  ? 0.1283 0.1036 0.1108 -0.0029 -0.0061 0.0012  82   THR A CA  
399  C C   . THR A 62  ? 0.1359 0.1033 0.1128 -0.0024 -0.0041 0.0009  82   THR A C   
400  O O   . THR A 62  ? 0.1602 0.1054 0.1295 -0.0076 -0.0082 0.0050  82   THR A O   
401  C CB  . THR A 62  ? 0.1354 0.1096 0.1149 0.0064  -0.0128 0.0011  82   THR A CB  
402  O OG1 . THR A 62  ? 0.1631 0.1118 0.1243 0.0002  -0.0257 -0.0086 82   THR A OG1 
403  C CG2 . THR A 62  ? 0.1335 0.1038 0.1170 0.0072  -0.0117 -0.0074 82   THR A CG2 
404  N N   . ILE A 63  ? 0.1277 0.1106 0.1144 -0.0085 0.0053  -0.0052 83   ILE A N   
405  C CA  . ILE A 63  ? 0.1227 0.1048 0.1141 -0.0062 0.0064  -0.0014 83   ILE A CA  
406  C C   . ILE A 63  ? 0.1191 0.1093 0.1249 -0.0022 0.0055  0.0000  83   ILE A C   
407  O O   . ILE A 63  ? 0.1367 0.1128 0.1402 -0.0059 0.0131  0.0067  83   ILE A O   
408  C CB  . ILE A 63  ? 0.1186 0.1087 0.1190 -0.0034 0.0055  -0.0033 83   ILE A CB  
409  C CG1 . ILE A 63  ? 0.1150 0.1156 0.1140 -0.0056 -0.0005 -0.0042 83   ILE A CG1 
410  C CG2 . ILE A 63  ? 0.1095 0.1060 0.1095 -0.0033 0.0052  0.0056  83   ILE A CG2 
411  C CD1 . ILE A 63  ? 0.1281 0.1309 0.1163 0.0045  -0.0024 0.0034  83   ILE A CD1 
412  N N   . SER A 64  ? 0.1238 0.1039 0.1261 -0.0030 0.0017  0.0022  84   SER A N   
413  C CA  . SER A 64  ? 0.1226 0.1108 0.1260 0.0041  0.0016  0.0018  84   SER A CA  
414  C C   . SER A 64  ? 0.1248 0.1102 0.1270 0.0040  -0.0033 0.0000  84   SER A C   
415  O O   . SER A 64  ? 0.1356 0.1036 0.1403 0.0005  -0.0065 0.0177  84   SER A O   
416  C CB  . SER A 64  ? 0.1264 0.1297 0.1379 0.0036  -0.0090 -0.0044 84   SER A CB  
417  O OG  . SER A 64  ? 0.1490 0.1393 0.1443 0.0109  -0.0246 0.0106  84   SER A OG  
418  N N   . GLY A 65  ? 0.1257 0.1076 0.1287 -0.0018 -0.0045 0.0016  85   GLY A N   
419  C CA  . GLY A 65  ? 0.1283 0.1124 0.1351 0.0032  -0.0040 -0.0002 85   GLY A CA  
420  C C   . GLY A 65  ? 0.1375 0.1133 0.1381 0.0002  -0.0018 0.0056  85   GLY A C   
421  O O   . GLY A 65  ? 0.1470 0.1309 0.1569 0.0049  0.0090  0.0009  85   GLY A O   
422  N N   . HIS A 66  ? 0.1280 0.1141 0.1347 0.0044  -0.0061 0.0020  86   HIS A N   
423  C CA  . HIS A 66  ? 0.1226 0.1127 0.1330 0.0059  -0.0089 0.0036  86   HIS A CA  
424  C C   . HIS A 66  ? 0.1249 0.1145 0.1296 0.0010  -0.0113 0.0037  86   HIS A C   
425  O O   . HIS A 66  ? 0.1279 0.1168 0.1294 0.0021  -0.0061 -0.0012 86   HIS A O   
426  C CB  . HIS A 66  ? 0.1183 0.1105 0.1164 0.0031  -0.0086 0.0016  86   HIS A CB  
427  C CG  . HIS A 66  ? 0.1123 0.1055 0.1101 0.0029  -0.0031 -0.0023 86   HIS A CG  
428  N ND1 . HIS A 66  ? 0.1151 0.0979 0.1092 0.0028  -0.0048 -0.0011 86   HIS A ND1 
429  C CD2 . HIS A 66  ? 0.1126 0.1006 0.1056 0.0034  -0.0046 -0.0025 86   HIS A CD2 
430  C CE1 . HIS A 66  ? 0.1122 0.0963 0.1096 0.0004  -0.0034 0.0026  86   HIS A CE1 
431  N NE2 . HIS A 66  ? 0.1239 0.1035 0.1040 0.0055  -0.0034 -0.0006 86   HIS A NE2 
432  N N   . LYS A 67  ? 0.1272 0.1206 0.1326 0.0007  -0.0087 0.0029  87   LYS A N   
433  C CA  . LYS A 67  ? 0.1273 0.1283 0.1476 0.0024  -0.0098 -0.0013 87   LYS A CA  
434  C C   . LYS A 67  ? 0.1168 0.1254 0.1353 0.0060  -0.0132 0.0006  87   LYS A C   
435  O O   . LYS A 67  ? 0.1285 0.1402 0.1413 0.0115  -0.0214 -0.0074 87   LYS A O   
436  C CB  . LYS A 67  ? 0.1457 0.1441 0.1482 0.0073  0.0006  -0.0007 87   LYS A CB  
437  C CG  . LYS A 67  ? 0.1708 0.1511 0.1835 -0.0053 0.0093  -0.0048 87   LYS A CG  
438  C CD  . LYS A 67  ? 0.1840 0.1928 0.1888 0.0004  0.0002  0.0105  87   LYS A CD  
439  C CE  . LYS A 67  ? 0.2101 0.2077 0.1990 0.0006  0.0107  -0.0050 87   LYS A CE  
440  N NZ  . LYS A 67  ? 0.2294 0.2286 0.2288 -0.0020 0.0009  0.0165  87   LYS A NZ  
441  N N   . LEU A 68  ? 0.1218 0.1148 0.1328 0.0037  -0.0159 -0.0074 88   LEU A N   
442  C CA  . LEU A 68  ? 0.1141 0.1148 0.1170 0.0034  -0.0077 -0.0073 88   LEU A CA  
443  C C   . LEU A 68  ? 0.1155 0.1055 0.1188 0.0035  -0.0123 -0.0089 88   LEU A C   
444  O O   . LEU A 68  ? 0.1202 0.1022 0.1237 0.0016  -0.0083 -0.0097 88   LEU A O   
445  C CB  . LEU A 68  ? 0.1179 0.1170 0.1253 -0.0022 -0.0026 -0.0075 88   LEU A CB  
446  C CG  . LEU A 68  ? 0.1232 0.1303 0.1338 0.0036  0.0010  -0.0115 88   LEU A CG  
447  C CD1 . LEU A 68  ? 0.1309 0.1485 0.1390 -0.0043 0.0009  -0.0047 88   LEU A CD1 
448  C CD2 . LEU A 68  ? 0.1220 0.1427 0.1367 0.0068  0.0002  -0.0096 88   LEU A CD2 
449  N N   . GLY A 69  ? 0.1160 0.0995 0.1125 0.0119  -0.0130 0.0032  89   GLY A N   
450  C CA  . GLY A 69  ? 0.1087 0.1084 0.0963 0.0049  -0.0072 0.0014  89   GLY A CA  
451  C C   . GLY A 69  ? 0.1004 0.1036 0.0986 0.0106  -0.0042 -0.0037 89   GLY A C   
452  O O   . GLY A 69  ? 0.1216 0.0997 0.1010 0.0144  -0.0028 -0.0063 89   GLY A O   
453  N N   . ILE A 70  ? 0.0918 0.0875 0.0809 0.0038  -0.0107 -0.0029 90   ILE A N   
454  C CA  . ILE A 70  ? 0.0860 0.0825 0.0798 0.0032  -0.0067 -0.0025 90   ILE A CA  
455  C C   . ILE A 70  ? 0.0916 0.0816 0.0820 0.0005  -0.0087 -0.0003 90   ILE A C   
456  O O   . ILE A 70  ? 0.0854 0.0842 0.0822 0.0045  -0.0035 -0.0012 90   ILE A O   
457  C CB  . ILE A 70  ? 0.0886 0.0822 0.0817 0.0020  -0.0059 -0.0009 90   ILE A CB  
458  C CG1 . ILE A 70  ? 0.0877 0.0812 0.0823 0.0002  -0.0069 -0.0007 90   ILE A CG1 
459  C CG2 . ILE A 70  ? 0.0897 0.0870 0.0800 0.0000  -0.0059 0.0046  90   ILE A CG2 
460  C CD1 . ILE A 70  ? 0.0888 0.0838 0.0945 0.0014  -0.0056 0.0006  90   ILE A CD1 
461  N N   . SER A 71  ? 0.0863 0.0828 0.0835 0.0017  -0.0089 0.0013  91   SER A N   
462  C CA  . SER A 71  ? 0.0871 0.0811 0.0884 -0.0008 -0.0057 0.0013  91   SER A CA  
463  C C   . SER A 71  ? 0.0874 0.0793 0.0922 -0.0015 -0.0071 -0.0003 91   SER A C   
464  O O   . SER A 71  ? 0.1049 0.0855 0.1051 0.0096  -0.0060 -0.0046 91   SER A O   
465  C CB  . SER A 71  ? 0.0795 0.0831 0.0892 -0.0011 -0.0061 0.0003  91   SER A CB  
466  O OG  . SER A 71  ? 0.0873 0.0933 0.0939 -0.0104 -0.0217 -0.0008 91   SER A OG  
467  N N   . ASP A 72  ? 0.0864 0.0783 0.0864 -0.0015 -0.0062 0.0025  92   ASP A N   
468  C CA  . ASP A 72  ? 0.0858 0.0785 0.0804 0.0000  -0.0031 -0.0006 92   ASP A CA  
469  C C   . ASP A 72  ? 0.0863 0.0800 0.0829 0.0003  -0.0013 0.0013  92   ASP A C   
470  O O   . ASP A 72  ? 0.0911 0.0778 0.0856 -0.0003 0.0076  0.0041  92   ASP A O   
471  C CB  . ASP A 72  ? 0.0914 0.0870 0.0792 -0.0038 -0.0050 -0.0014 92   ASP A CB  
472  C CG  . ASP A 72  ? 0.0916 0.0878 0.0761 -0.0048 -0.0071 -0.0014 92   ASP A CG  
473  O OD1 . ASP A 72  ? 0.0846 0.0911 0.0783 -0.0038 -0.0089 -0.0019 92   ASP A OD1 
474  O OD2 . ASP A 72  ? 0.1103 0.0987 0.0741 -0.0017 -0.0075 -0.0036 92   ASP A OD2 
475  N N   . VAL A 73  ? 0.0871 0.0872 0.0853 -0.0017 0.0001  0.0002  93   VAL A N   
476  C CA  . VAL A 73  ? 0.0901 0.0880 0.0901 -0.0022 -0.0014 0.0037  93   VAL A CA  
477  C C   . VAL A 73  ? 0.0911 0.0854 0.0960 -0.0001 -0.0025 0.0048  93   VAL A C   
478  O O   . VAL A 73  ? 0.0963 0.0867 0.1145 0.0030  -0.0062 0.0019  93   VAL A O   
479  C CB  . VAL A 73  ? 0.1016 0.0950 0.0880 0.0010  -0.0018 0.0006  93   VAL A CB  
480  C CG1 . VAL A 73  ? 0.1137 0.0883 0.0943 0.0000  -0.0036 -0.0018 93   VAL A CG1 
481  C CG2 . VAL A 73  ? 0.1200 0.0970 0.1024 -0.0030 -0.0001 0.0088  93   VAL A CG2 
482  N N   . ALA A 74  ? 0.0915 0.0802 0.0889 0.0011  0.0021  0.0057  94   ALA A N   
483  C CA  . ALA A 74  ? 0.0901 0.0815 0.0895 0.0002  0.0022  0.0012  94   ALA A CA  
484  C C   . ALA A 74  ? 0.0919 0.0841 0.0876 -0.0020 0.0018  0.0020  94   ALA A C   
485  O O   . ALA A 74  ? 0.0872 0.0891 0.0954 0.0035  0.0051  -0.0010 94   ALA A O   
486  C CB  . ALA A 74  ? 0.0967 0.0870 0.0898 0.0048  -0.0022 0.0048  94   ALA A CB  
487  N N   . TRP A 75  ? 0.0921 0.0883 0.0910 -0.0026 0.0016  0.0003  95   TRP A N   
488  C CA  . TRP A 75  ? 0.0998 0.0899 0.0922 -0.0065 -0.0004 0.0037  95   TRP A CA  
489  C C   . TRP A 75  ? 0.1034 0.0939 0.0924 -0.0064 -0.0022 0.0031  95   TRP A C   
490  O O   . TRP A 75  ? 0.1159 0.0988 0.1039 -0.0071 0.0011  0.0128  95   TRP A O   
491  C CB  . TRP A 75  ? 0.1005 0.0814 0.0827 -0.0106 -0.0015 0.0047  95   TRP A CB  
492  C CG  . TRP A 75  ? 0.1112 0.0862 0.0851 -0.0090 -0.0047 0.0000  95   TRP A CG  
493  C CD1 . TRP A 75  ? 0.1114 0.0838 0.0833 -0.0073 -0.0067 0.0024  95   TRP A CD1 
494  C CD2 . TRP A 75  ? 0.1155 0.0842 0.0844 -0.0096 -0.0022 -0.0016 95   TRP A CD2 
495  N NE1 . TRP A 75  ? 0.1195 0.0843 0.0830 -0.0107 -0.0091 -0.0006 95   TRP A NE1 
496  C CE2 . TRP A 75  ? 0.1140 0.0856 0.0824 -0.0101 -0.0046 0.0010  95   TRP A CE2 
497  C CE3 . TRP A 75  ? 0.1209 0.0841 0.0854 -0.0095 -0.0002 -0.0005 95   TRP A CE3 
498  C CZ2 . TRP A 75  ? 0.1124 0.0876 0.0804 -0.0088 -0.0031 -0.0005 95   TRP A CZ2 
499  C CZ3 . TRP A 75  ? 0.1243 0.0882 0.0840 -0.0131 -0.0005 -0.0011 95   TRP A CZ3 
500  C CH2 . TRP A 75  ? 0.1224 0.0881 0.0815 -0.0104 0.0008  -0.0010 95   TRP A CH2 
501  N N   . SER A 76  ? 0.1031 0.0940 0.0942 -0.0070 -0.0061 0.0054  96   SER A N   
502  C CA  . SER A 76  ? 0.1135 0.1031 0.1012 -0.0105 -0.0110 0.0020  96   SER A CA  
503  C C   . SER A 76  ? 0.1171 0.1066 0.1089 -0.0097 -0.0043 0.0009  96   SER A C   
504  O O   . SER A 76  ? 0.1246 0.1065 0.1056 -0.0066 -0.0066 0.0058  96   SER A O   
505  C CB  . SER A 76  ? 0.1338 0.1027 0.1081 -0.0078 -0.0144 0.0025  96   SER A CB  
506  O OG  . SER A 76  ? 0.1647 0.1208 0.1166 -0.0165 -0.0124 0.0148  96   SER A OG  
507  N N   . SER A 77  ? 0.1254 0.1196 0.1088 -0.0189 -0.0080 0.0105  97   SER A N   
508  C CA  A SER A 77  ? 0.1210 0.1188 0.1181 -0.0122 0.0001  0.0047  97   SER A CA  
509  C CA  B SER A 77  ? 0.1138 0.1143 0.0627 -0.0118 -0.0475 0.0302  97   SER A CA  
510  C C   . SER A 77  ? 0.1349 0.1377 0.1212 -0.0074 -0.0082 0.0013  97   SER A C   
511  O O   . SER A 77  ? 0.1402 0.1534 0.1262 -0.0034 0.0140  0.0034  97   SER A O   
512  C CB  A SER A 77  ? 0.1234 0.1393 0.1269 -0.0121 -0.0028 -0.0018 97   SER A CB  
513  C CB  B SER A 77  ? 0.1376 0.1523 0.1159 -0.0309 -0.0422 0.0411  97   SER A CB  
514  O OG  A SER A 77  ? 0.1281 0.1417 0.1405 -0.0144 -0.0022 -0.0095 97   SER A OG  
515  O OG  B SER A 77  ? 0.1164 0.0977 0.0314 -0.0812 -0.0237 0.0211  97   SER A OG  
516  N N   . ASP A 78  ? 0.1428 0.1322 0.1195 -0.0065 -0.0051 -0.0041 98   ASP A N   
517  C CA  . ASP A 78  ? 0.1497 0.1520 0.1323 -0.0143 0.0023  0.0017  98   ASP A CA  
518  C C   . ASP A 78  ? 0.1587 0.1447 0.1337 -0.0154 -0.0012 0.0033  98   ASP A C   
519  O O   . ASP A 78  ? 0.1824 0.1662 0.1226 -0.0188 -0.0021 0.0036  98   ASP A O   
520  C CB  . ASP A 78  ? 0.1837 0.1545 0.1585 -0.0141 -0.0004 -0.0031 98   ASP A CB  
521  C CG  . ASP A 78  ? 0.1860 0.1663 0.1709 -0.0109 0.0074  -0.0069 98   ASP A CG  
522  O OD1 . ASP A 78  ? 0.1800 0.1887 0.2008 -0.0110 -0.0025 -0.0134 98   ASP A OD1 
523  O OD2 . ASP A 78  ? 0.2474 0.1765 0.1852 -0.0077 0.0086  -0.0275 98   ASP A OD2 
524  N N   . SER A 79  ? 0.1500 0.1453 0.1351 -0.0097 0.0040  0.0116  99   SER A N   
525  C CA  . SER A 79  ? 0.1574 0.1425 0.1400 -0.0088 -0.0020 0.0087  99   SER A CA  
526  C C   . SER A 79  ? 0.1620 0.1462 0.1447 -0.0101 -0.0079 0.0135  99   SER A C   
527  O O   . SER A 79  ? 0.1782 0.1452 0.1478 -0.0006 -0.0162 0.0230  99   SER A O   
528  C CB  . SER A 79  ? 0.1599 0.1471 0.1392 -0.0034 -0.0052 0.0079  99   SER A CB  
529  O OG  . SER A 79  ? 0.1647 0.1406 0.1220 -0.0016 0.0043  0.0035  99   SER A OG  
530  N N   . ASN A 80  ? 0.1648 0.1615 0.1578 0.0079  0.0042  0.0086  100  ASN A N   
531  C CA  . ASN A 80  ? 0.1616 0.1734 0.1728 0.0102  -0.0032 0.0182  100  ASN A CA  
532  C C   . ASN A 80  ? 0.1640 0.1682 0.1463 0.0015  0.0042  0.0140  100  ASN A C   
533  O O   . ASN A 80  ? 0.1831 0.2154 0.1634 0.0223  -0.0177 0.0082  100  ASN A O   
534  C CB  . ASN A 80  ? 0.1738 0.1923 0.1945 -0.0099 0.0062  0.0111  100  ASN A CB  
535  C CG  . ASN A 80  ? 0.1747 0.2338 0.2096 -0.0195 0.0042  0.0118  100  ASN A CG  
536  O OD1 . ASN A 80  ? 0.2106 0.2694 0.2193 -0.0285 0.0283  0.0107  100  ASN A OD1 
537  N ND2 . ASN A 80  ? 0.1944 0.2604 0.2239 -0.0274 -0.0094 -0.0018 100  ASN A ND2 
538  N N   . LEU A 81  ? 0.1256 0.1401 0.1343 0.0020  -0.0084 0.0034  101  LEU A N   
539  C CA  . LEU A 81  ? 0.1276 0.1267 0.1287 -0.0054 -0.0045 0.0063  101  LEU A CA  
540  C C   . LEU A 81  ? 0.1179 0.1209 0.1173 0.0008  0.0004  0.0113  101  LEU A C   
541  O O   . LEU A 81  ? 0.1244 0.1216 0.0995 0.0018  0.0029  0.0177  101  LEU A O   
542  C CB  . LEU A 81  ? 0.1559 0.1443 0.1322 -0.0043 -0.0046 -0.0002 101  LEU A CB  
543  C CG  . LEU A 81  ? 0.1750 0.1435 0.1422 -0.0053 -0.0090 -0.0036 101  LEU A CG  
544  C CD1 . LEU A 81  ? 0.1792 0.1576 0.1447 -0.0042 -0.0037 -0.0065 101  LEU A CD1 
545  C CD2 . LEU A 81  ? 0.1803 0.1453 0.1542 -0.0113 -0.0207 -0.0001 101  LEU A CD2 
546  N N   . LEU A 82  ? 0.1161 0.1084 0.1128 -0.0056 0.0012  0.0110  102  LEU A N   
547  C CA  . LEU A 82  ? 0.1105 0.1085 0.1068 -0.0037 0.0017  0.0079  102  LEU A CA  
548  C C   . LEU A 82  ? 0.1043 0.0989 0.1084 -0.0071 0.0009  0.0102  102  LEU A C   
549  O O   . LEU A 82  ? 0.1072 0.1008 0.1016 -0.0083 0.0115  0.0054  102  LEU A O   
550  C CB  . LEU A 82  ? 0.1282 0.1236 0.1102 -0.0019 -0.0070 0.0088  102  LEU A CB  
551  C CG  . LEU A 82  ? 0.1392 0.1372 0.1144 -0.0003 -0.0055 -0.0001 102  LEU A CG  
552  C CD1 . LEU A 82  ? 0.1587 0.1605 0.1177 -0.0011 -0.0129 0.0000  102  LEU A CD1 
553  C CD2 . LEU A 82  ? 0.1659 0.1360 0.1271 0.0104  -0.0094 -0.0099 102  LEU A CD2 
554  N N   . VAL A 83  ? 0.0962 0.0915 0.0985 -0.0068 -0.0040 0.0025  103  VAL A N   
555  C CA  . VAL A 83  ? 0.0960 0.0926 0.1023 -0.0024 -0.0040 -0.0052 103  VAL A CA  
556  C C   . VAL A 83  ? 0.0955 0.0940 0.1029 0.0001  -0.0061 -0.0080 103  VAL A C   
557  O O   . VAL A 83  ? 0.0877 0.0924 0.1027 0.0026  -0.0126 -0.0060 103  VAL A O   
558  C CB  . VAL A 83  ? 0.1000 0.1001 0.1021 -0.0003 -0.0036 -0.0061 103  VAL A CB  
559  C CG1 . VAL A 83  ? 0.0921 0.1039 0.1036 0.0014  -0.0092 -0.0020 103  VAL A CG1 
560  C CG2 . VAL A 83  ? 0.0904 0.0995 0.1045 0.0004  -0.0090 -0.0017 103  VAL A CG2 
561  N N   . SER A 84  ? 0.0946 0.0958 0.1013 -0.0005 -0.0004 -0.0077 104  SER A N   
562  C CA  . SER A 84  ? 0.0905 0.0882 0.0914 0.0044  -0.0004 -0.0036 104  SER A CA  
563  C C   . SER A 84  ? 0.0971 0.0829 0.0895 0.0002  0.0019  -0.0043 104  SER A C   
564  O O   . SER A 84  ? 0.1092 0.0803 0.0885 -0.0016 0.0030  -0.0044 104  SER A O   
565  C CB  . SER A 84  ? 0.0906 0.0952 0.0906 0.0044  -0.0040 -0.0065 104  SER A CB  
566  O OG  . SER A 84  ? 0.0912 0.0981 0.0945 0.0108  -0.0135 -0.0029 104  SER A OG  
567  N N   . ALA A 85  ? 0.0927 0.0848 0.0842 -0.0014 0.0014  -0.0060 105  ALA A N   
568  C CA  . ALA A 85  ? 0.0964 0.0814 0.0803 -0.0005 0.0001  -0.0002 105  ALA A CA  
569  C C   . ALA A 85  ? 0.0987 0.0806 0.0787 -0.0024 -0.0009 -0.0021 105  ALA A C   
570  O O   . ALA A 85  ? 0.1091 0.0850 0.0788 -0.0065 -0.0048 -0.0032 105  ALA A O   
571  C CB  . ALA A 85  ? 0.1024 0.0799 0.0665 -0.0050 0.0041  -0.0009 105  ALA A CB  
572  N N   . SER A 86  ? 0.0967 0.0926 0.0864 -0.0014 -0.0010 -0.0030 106  SER A N   
573  C CA  . SER A 86  ? 0.0952 0.0951 0.0970 -0.0001 -0.0037 -0.0036 106  SER A CA  
574  C C   . SER A 86  ? 0.0988 0.0995 0.0999 -0.0022 -0.0001 -0.0045 106  SER A C   
575  O O   . SER A 86  ? 0.1021 0.1062 0.0995 -0.0002 -0.0033 -0.0039 106  SER A O   
576  C CB  . SER A 86  ? 0.0929 0.0978 0.0972 0.0015  -0.0083 -0.0001 106  SER A CB  
577  O OG  . SER A 86  ? 0.1032 0.0974 0.0974 0.0131  -0.0121 0.0056  106  SER A OG  
578  N N   . ASP A 87  ? 0.1028 0.1067 0.0984 -0.0007 -0.0049 -0.0032 107  ASP A N   
579  C CA  . ASP A 87  ? 0.1077 0.1115 0.1106 0.0016  0.0031  -0.0044 107  ASP A CA  
580  C C   . ASP A 87  ? 0.1120 0.1121 0.1078 0.0020  0.0020  -0.0066 107  ASP A C   
581  O O   . ASP A 87  ? 0.1227 0.1263 0.1202 0.0005  0.0139  -0.0112 107  ASP A O   
582  C CB  . ASP A 87  ? 0.1170 0.1129 0.1198 -0.0017 -0.0061 -0.0043 107  ASP A CB  
583  C CG  . ASP A 87  ? 0.1257 0.1137 0.1297 -0.0034 -0.0055 -0.0022 107  ASP A CG  
584  O OD1 . ASP A 87  ? 0.1264 0.1382 0.1254 -0.0027 -0.0109 -0.0056 107  ASP A OD1 
585  O OD2 . ASP A 87  ? 0.1350 0.1179 0.1385 -0.0064 -0.0144 -0.0013 107  ASP A OD2 
586  N N   . ASP A 88  ? 0.1174 0.1086 0.1215 0.0028  0.0016  -0.0064 108  ASP A N   
587  C CA  . ASP A 88  ? 0.1203 0.1145 0.1203 0.0064  0.0014  -0.0119 108  ASP A CA  
588  C C   . ASP A 88  ? 0.1281 0.1211 0.1205 -0.0005 -0.0011 -0.0088 108  ASP A C   
589  O O   . ASP A 88  ? 0.1334 0.1266 0.1288 0.0035  -0.0033 -0.0157 108  ASP A O   
590  C CB  . ASP A 88  ? 0.1190 0.1171 0.1173 0.0078  0.0008  -0.0119 108  ASP A CB  
591  C CG  . ASP A 88  ? 0.1196 0.1182 0.1144 0.0067  -0.0005 -0.0111 108  ASP A CG  
592  O OD1 . ASP A 88  ? 0.1287 0.1246 0.1117 0.0033  -0.0069 -0.0135 108  ASP A OD1 
593  O OD2 . ASP A 88  ? 0.1281 0.1266 0.1177 0.0018  0.0001  -0.0084 108  ASP A OD2 
594  N N   . LYS A 89  ? 0.1329 0.1227 0.1219 -0.0009 -0.0019 -0.0076 109  LYS A N   
595  C CA  . LYS A 89  ? 0.1313 0.1279 0.1231 -0.0016 -0.0082 -0.0008 109  LYS A CA  
596  C C   . LYS A 89  ? 0.1281 0.1293 0.1120 -0.0017 -0.0004 -0.0055 109  LYS A C   
597  O O   . LYS A 89  ? 0.1472 0.1438 0.1164 -0.0032 -0.0058 -0.0119 109  LYS A O   
598  C CB  . LYS A 89  ? 0.1377 0.1406 0.1353 -0.0004 -0.0025 -0.0081 109  LYS A CB  
599  C CG  . LYS A 89  ? 0.1378 0.1583 0.1625 -0.0048 -0.0075 -0.0018 109  LYS A CG  
600  C CD  . LYS A 89  ? 0.1678 0.1818 0.1671 0.0125  0.0010  -0.0083 109  LYS A CD  
601  C CE  . LYS A 89  ? 0.1836 0.2217 0.2242 -0.0078 -0.0041 -0.0102 109  LYS A CE  
602  N NZ  . LYS A 89  ? 0.2197 0.2393 0.2292 0.0110  0.0084  -0.0359 109  LYS A NZ  
603  N N   . THR A 90  ? 0.1204 0.1143 0.1097 -0.0038 -0.0063 -0.0053 110  THR A N   
604  C CA  . THR A 90  ? 0.1153 0.1069 0.1112 0.0013  -0.0036 -0.0031 110  THR A CA  
605  C C   . THR A 90  ? 0.1133 0.1023 0.1025 -0.0041 -0.0065 -0.0118 110  THR A C   
606  O O   . THR A 90  ? 0.1138 0.1040 0.1036 -0.0007 -0.0012 -0.0152 110  THR A O   
607  C CB  . THR A 90  ? 0.1264 0.1083 0.1196 0.0012  -0.0055 0.0001  110  THR A CB  
608  O OG1 . THR A 90  ? 0.1477 0.1034 0.1175 0.0007  -0.0114 0.0060  110  THR A OG1 
609  C CG2 . THR A 90  ? 0.1304 0.1115 0.1336 0.0071  -0.0032 -0.0006 110  THR A CG2 
610  N N   . LEU A 91  ? 0.1050 0.0964 0.1010 0.0006  -0.0025 -0.0057 111  LEU A N   
611  C CA  . LEU A 91  ? 0.1049 0.0920 0.0959 -0.0019 -0.0029 -0.0033 111  LEU A CA  
612  C C   . LEU A 91  ? 0.1042 0.0938 0.0974 -0.0024 -0.0042 -0.0003 111  LEU A C   
613  O O   . LEU A 91  ? 0.1236 0.0992 0.1082 0.0037  -0.0054 -0.0065 111  LEU A O   
614  C CB  . LEU A 91  ? 0.1064 0.0920 0.0921 -0.0022 -0.0034 -0.0047 111  LEU A CB  
615  C CG  . LEU A 91  ? 0.1090 0.0983 0.0932 -0.0005 -0.0037 0.0012  111  LEU A CG  
616  C CD1 . LEU A 91  ? 0.1177 0.1013 0.0997 0.0049  0.0029  -0.0049 111  LEU A CD1 
617  C CD2 . LEU A 91  ? 0.1071 0.1031 0.1012 0.0002  -0.0008 0.0039  111  LEU A CD2 
618  N N   . LYS A 92  ? 0.1102 0.0887 0.0978 -0.0027 -0.0022 -0.0035 112  LYS A N   
619  C CA  . LYS A 92  ? 0.0986 0.0959 0.0946 -0.0051 0.0020  -0.0027 112  LYS A CA  
620  C C   . LYS A 92  ? 0.1000 0.0972 0.0974 -0.0023 0.0061  -0.0028 112  LYS A C   
621  O O   . LYS A 92  ? 0.1029 0.0988 0.1001 -0.0019 0.0127  -0.0023 112  LYS A O   
622  C CB  . LYS A 92  ? 0.1024 0.0938 0.1006 -0.0040 -0.0022 0.0019  112  LYS A CB  
623  C CG  . LYS A 92  ? 0.1028 0.0930 0.1069 -0.0046 -0.0007 -0.0016 112  LYS A CG  
624  C CD  . LYS A 92  ? 0.1122 0.1005 0.1084 -0.0037 -0.0041 -0.0022 112  LYS A CD  
625  C CE  . LYS A 92  ? 0.1149 0.1038 0.1186 -0.0009 0.0008  0.0001  112  LYS A CE  
626  N NZ  . LYS A 92  ? 0.1393 0.1074 0.1426 0.0031  -0.0062 -0.0116 112  LYS A NZ  
627  N N   . ILE A 93  ? 0.0989 0.0996 0.0983 -0.0036 0.0050  -0.0028 113  ILE A N   
628  C CA  . ILE A 93  ? 0.0985 0.0954 0.0951 -0.0039 0.0034  0.0015  113  ILE A CA  
629  C C   . ILE A 93  ? 0.1099 0.0960 0.0994 -0.0020 0.0013  0.0065  113  ILE A C   
630  O O   . ILE A 93  ? 0.1151 0.0982 0.1046 -0.0002 -0.0066 0.0103  113  ILE A O   
631  C CB  . ILE A 93  ? 0.0959 0.0985 0.0967 -0.0037 0.0047  -0.0009 113  ILE A CB  
632  C CG1 . ILE A 93  ? 0.1096 0.1011 0.0961 -0.0059 0.0045  -0.0006 113  ILE A CG1 
633  C CG2 . ILE A 93  ? 0.0938 0.1115 0.0951 -0.0075 -0.0007 0.0002  113  ILE A CG2 
634  C CD1 . ILE A 93  ? 0.1258 0.0958 0.0900 -0.0014 0.0071  -0.0001 113  ILE A CD1 
635  N N   . TRP A 94  ? 0.1175 0.0945 0.0970 -0.0031 0.0048  0.0081  114  TRP A N   
636  C CA  . TRP A 94  ? 0.1115 0.0942 0.0909 -0.0032 0.0020  0.0019  114  TRP A CA  
637  C C   . TRP A 94  ? 0.1139 0.1024 0.1025 -0.0082 0.0025  -0.0030 114  TRP A C   
638  O O   . TRP A 94  ? 0.1228 0.1107 0.0993 -0.0053 0.0054  0.0088  114  TRP A O   
639  C CB  . TRP A 94  ? 0.1022 0.0926 0.0907 -0.0035 0.0036  0.0024  114  TRP A CB  
640  C CG  . TRP A 94  ? 0.0992 0.0905 0.0899 -0.0022 0.0000  0.0032  114  TRP A CG  
641  C CD1 . TRP A 94  ? 0.0976 0.0877 0.0908 0.0052  -0.0012 0.0027  114  TRP A CD1 
642  C CD2 . TRP A 94  ? 0.1002 0.0940 0.0917 0.0000  -0.0019 0.0032  114  TRP A CD2 
643  N NE1 . TRP A 94  ? 0.0979 0.0876 0.0910 -0.0001 0.0016  -0.0006 114  TRP A NE1 
644  C CE2 . TRP A 94  ? 0.1008 0.0911 0.0950 0.0009  -0.0021 0.0023  114  TRP A CE2 
645  C CE3 . TRP A 94  ? 0.1022 0.0904 0.0943 -0.0007 -0.0031 -0.0016 114  TRP A CE3 
646  C CZ2 . TRP A 94  ? 0.1018 0.0988 0.1030 -0.0023 -0.0053 -0.0019 114  TRP A CZ2 
647  C CZ3 . TRP A 94  ? 0.1011 0.0967 0.0976 -0.0035 -0.0056 -0.0005 114  TRP A CZ3 
648  C CH2 . TRP A 94  ? 0.1008 0.0997 0.1026 -0.0043 -0.0032 0.0020  114  TRP A CH2 
649  N N   . ASP A 95  ? 0.1264 0.1037 0.1079 -0.0070 -0.0027 0.0036  115  ASP A N   
650  C CA  . ASP A 95  ? 0.1286 0.1132 0.1207 -0.0045 0.0012  0.0009  115  ASP A CA  
651  C C   . ASP A 95  ? 0.1379 0.1175 0.1224 -0.0032 0.0003  -0.0021 115  ASP A C   
652  O O   . ASP A 95  ? 0.1382 0.1057 0.1258 -0.0016 0.0036  -0.0004 115  ASP A O   
653  C CB  . ASP A 95  ? 0.1383 0.1142 0.1286 -0.0068 -0.0007 0.0029  115  ASP A CB  
654  C CG  . ASP A 95  ? 0.1348 0.1276 0.1395 -0.0057 -0.0008 0.0079  115  ASP A CG  
655  O OD1 . ASP A 95  ? 0.1421 0.1342 0.1465 -0.0096 0.0195  0.0130  115  ASP A OD1 
656  O OD2 . ASP A 95  ? 0.1672 0.1326 0.1901 -0.0152 -0.0014 0.0060  115  ASP A OD2 
657  N N   . VAL A 96  ? 0.1416 0.1185 0.1273 -0.0016 -0.0040 0.0029  116  VAL A N   
658  C CA  . VAL A 96  ? 0.1524 0.1262 0.1270 -0.0070 -0.0056 0.0010  116  VAL A CA  
659  C C   . VAL A 96  ? 0.1389 0.1289 0.1285 -0.0093 -0.0056 0.0008  116  VAL A C   
660  O O   . VAL A 96  ? 0.1511 0.1399 0.1308 -0.0207 -0.0114 0.0026  116  VAL A O   
661  C CB  . VAL A 96  ? 0.1597 0.1350 0.1504 0.0017  -0.0066 -0.0010 116  VAL A CB  
662  C CG1 . VAL A 96  ? 0.1788 0.1409 0.1508 0.0000  0.0027  -0.0010 116  VAL A CG1 
663  C CG2 . VAL A 96  ? 0.1725 0.1468 0.1613 0.0018  0.0030  0.0054  116  VAL A CG2 
664  N N   . SER A 97  ? 0.1375 0.1187 0.1144 -0.0076 -0.0045 0.0059  117  SER A N   
665  C CA  . SER A 97  ? 0.1290 0.1269 0.1122 -0.0053 0.0004  0.0026  117  SER A CA  
666  C C   . SER A 97  ? 0.1348 0.1235 0.1224 -0.0029 0.0056  0.0064  117  SER A C   
667  O O   . SER A 97  ? 0.1255 0.1481 0.1238 -0.0032 0.0121  0.0120  117  SER A O   
668  C CB  . SER A 97  ? 0.1267 0.1222 0.1169 -0.0039 0.0008  0.0035  117  SER A CB  
669  O OG  . SER A 97  ? 0.1363 0.1093 0.1186 0.0004  -0.0040 0.0101  117  SER A OG  
670  N N   . SER A 98  ? 0.1374 0.1255 0.1225 -0.0080 0.0092  0.0067  118  SER A N   
671  C CA  . SER A 98  ? 0.1492 0.1204 0.1272 -0.0043 0.0093  0.0054  118  SER A CA  
672  C C   . SER A 98  ? 0.1490 0.1281 0.1309 -0.0043 0.0050  0.0080  118  SER A C   
673  O O   . SER A 98  ? 0.1580 0.1088 0.1280 -0.0099 0.0045  0.0091  118  SER A O   
674  C CB  . SER A 98  ? 0.1576 0.1207 0.1299 -0.0082 0.0108  0.0034  118  SER A CB  
675  O OG  . SER A 98  ? 0.1742 0.1061 0.1320 -0.0096 0.0047  0.0186  118  SER A OG  
676  N N   . GLY A 99  ? 0.1636 0.1336 0.1489 -0.0042 -0.0013 0.0201  119  GLY A N   
677  C CA  . GLY A 99  ? 0.1664 0.1478 0.1900 -0.0088 -0.0047 0.0237  119  GLY A CA  
678  C C   . GLY A 99  ? 0.1795 0.1660 0.2039 -0.0085 0.0071  0.0176  119  GLY A C   
679  O O   . GLY A 99  ? 0.1759 0.1908 0.2566 -0.0013 -0.0123 0.0210  119  GLY A O   
680  N N   . LYS A 100 ? 0.1858 0.1661 0.1882 -0.0099 0.0077  0.0257  120  LYS A N   
681  C CA  . LYS A 100 ? 0.1991 0.1809 0.1943 -0.0033 0.0093  0.0154  120  LYS A CA  
682  C C   . LYS A 100 ? 0.1775 0.1690 0.1902 0.0014  0.0050  0.0110  120  LYS A C   
683  O O   . LYS A 100 ? 0.1712 0.1575 0.2236 0.0033  0.0047  0.0054  120  LYS A O   
684  C CB  . LYS A 100 ? 0.2149 0.1961 0.2107 -0.0117 0.0071  -0.0001 120  LYS A CB  
685  C CG  . LYS A 100 ? 0.2411 0.2165 0.2215 -0.0087 0.0043  0.0160  120  LYS A CG  
686  C CD  . LYS A 100 ? 0.2533 0.2461 0.2687 0.0097  0.0053  0.0133  120  LYS A CD  
687  C CE  . LYS A 100 ? 0.2870 0.2641 0.2651 -0.0090 0.0175  0.0164  120  LYS A CE  
688  N NZ  . LYS A 100 ? 0.3165 0.2901 0.3257 0.0154  0.0177  0.0069  120  LYS A NZ  
689  N N   . CYS A 101 ? 0.1736 0.1447 0.1654 -0.0001 -0.0018 0.0105  121  CYS A N   
690  C CA  . CYS A 101 ? 0.1732 0.1387 0.1623 0.0050  0.0040  0.0015  121  CYS A CA  
691  C C   . CYS A 101 ? 0.1688 0.1529 0.1647 0.0040  -0.0059 -0.0030 121  CYS A C   
692  O O   . CYS A 101 ? 0.1828 0.1622 0.1800 0.0168  -0.0099 -0.0107 121  CYS A O   
693  C CB  . CYS A 101 ? 0.1705 0.1289 0.1558 0.0122  0.0006  -0.0028 121  CYS A CB  
694  S SG  . CYS A 101 ? 0.1828 0.1439 0.1586 0.0106  0.0108  -0.0078 121  CYS A SG  
695  N N   . LEU A 102 ? 0.1670 0.1466 0.1554 0.0046  0.0011  -0.0098 122  LEU A N   
696  C CA  . LEU A 102 ? 0.1656 0.1327 0.1618 -0.0066 0.0032  -0.0053 122  LEU A CA  
697  C C   . LEU A 102 ? 0.1767 0.1404 0.1716 -0.0054 0.0128  -0.0107 122  LEU A C   
698  O O   . LEU A 102 ? 0.2080 0.1542 0.1764 -0.0041 0.0224  -0.0268 122  LEU A O   
699  C CB  . LEU A 102 ? 0.1673 0.1414 0.1589 -0.0059 -0.0014 -0.0010 122  LEU A CB  
700  C CG  . LEU A 102 ? 0.1646 0.1509 0.1551 -0.0022 -0.0066 -0.0015 122  LEU A CG  
701  C CD1 . LEU A 102 ? 0.1606 0.1631 0.1682 0.0043  -0.0065 0.0012  122  LEU A CD1 
702  C CD2 . LEU A 102 ? 0.1720 0.1525 0.1673 -0.0027 -0.0013 0.0048  122  LEU A CD2 
703  N N   . LYS A 103 ? 0.1799 0.1439 0.1697 -0.0073 0.0108  -0.0069 123  LYS A N   
704  C CA  . LYS A 103 ? 0.1754 0.1554 0.1744 -0.0051 0.0134  -0.0151 123  LYS A CA  
705  C C   . LYS A 103 ? 0.1680 0.1426 0.1564 0.0041  0.0119  -0.0125 123  LYS A C   
706  O O   . LYS A 103 ? 0.1636 0.1404 0.1606 0.0047  0.0171  -0.0123 123  LYS A O   
707  C CB  . LYS A 103 ? 0.1990 0.1793 0.1862 0.0063  0.0043  -0.0076 123  LYS A CB  
708  C CG  . LYS A 103 ? 0.1958 0.1973 0.2008 -0.0069 0.0019  -0.0118 123  LYS A CG  
709  C CD  . LYS A 103 ? 0.2439 0.2087 0.2084 0.0107  0.0030  -0.0129 123  LYS A CD  
710  C CE  . LYS A 103 ? 0.2504 0.2335 0.2443 -0.0112 -0.0034 -0.0105 123  LYS A CE  
711  N NZ  . LYS A 103 ? 0.2932 0.2272 0.2441 -0.0074 0.0000  -0.0131 123  LYS A NZ  
712  N N   . THR A 104 ? 0.1615 0.1368 0.1530 0.0000  0.0069  -0.0101 124  THR A N   
713  C CA  . THR A 104 ? 0.1620 0.1389 0.1456 -0.0003 0.0077  -0.0112 124  THR A CA  
714  C C   . THR A 104 ? 0.1653 0.1286 0.1435 0.0041  0.0036  -0.0117 124  THR A C   
715  O O   . THR A 104 ? 0.1870 0.1279 0.1469 -0.0004 0.0027  -0.0172 124  THR A O   
716  C CB  . THR A 104 ? 0.1648 0.1369 0.1388 0.0037  0.0088  -0.0086 124  THR A CB  
717  O OG1 . THR A 104 ? 0.1793 0.1287 0.1351 0.0136  0.0028  -0.0112 124  THR A OG1 
718  C CG2 . THR A 104 ? 0.1735 0.1421 0.1514 -0.0024 0.0066  -0.0131 124  THR A CG2 
719  N N   . LEU A 105 ? 0.1717 0.1293 0.1502 -0.0018 0.0021  -0.0049 125  LEU A N   
720  C CA  . LEU A 105 ? 0.1597 0.1344 0.1466 0.0023  0.0033  -0.0116 125  LEU A CA  
721  C C   . LEU A 105 ? 0.1636 0.1332 0.1547 -0.0030 0.0034  -0.0130 125  LEU A C   
722  O O   . LEU A 105 ? 0.1639 0.1375 0.1554 -0.0071 -0.0039 -0.0154 125  LEU A O   
723  C CB  . LEU A 105 ? 0.1578 0.1383 0.1492 0.0021  -0.0010 -0.0053 125  LEU A CB  
724  C CG  . LEU A 105 ? 0.1608 0.1479 0.1618 0.0029  0.0051  -0.0015 125  LEU A CG  
725  C CD1 . LEU A 105 ? 0.1511 0.1493 0.1629 0.0015  0.0012  -0.0066 125  LEU A CD1 
726  C CD2 . LEU A 105 ? 0.1568 0.1560 0.1799 -0.0008 0.0094  -0.0098 125  LEU A CD2 
727  N N   . LYS A 106 ? 0.1659 0.1381 0.1635 0.0054  0.0094  -0.0089 126  LYS A N   
728  C CA  . LYS A 106 ? 0.1697 0.1500 0.1598 0.0009  0.0137  -0.0121 126  LYS A CA  
729  C C   . LYS A 106 ? 0.1619 0.1435 0.1575 0.0026  0.0148  -0.0170 126  LYS A C   
730  O O   . LYS A 106 ? 0.1786 0.1431 0.1672 0.0003  0.0098  -0.0267 126  LYS A O   
731  C CB  . LYS A 106 ? 0.1933 0.1553 0.1734 0.0100  0.0115  -0.0056 126  LYS A CB  
732  C CG  . LYS A 106 ? 0.2169 0.1767 0.1781 0.0109  0.0071  0.0055  126  LYS A CG  
733  C CD  . LYS A 106 ? 0.2323 0.1875 0.2038 0.0246  0.0102  -0.0044 126  LYS A CD  
734  C CE  . LYS A 106 ? 0.2619 0.2451 0.2094 0.0153  0.0044  0.0106  126  LYS A CE  
735  N NZ  . LYS A 106 ? 0.2746 0.2521 0.2316 0.0074  -0.0062 0.0007  126  LYS A NZ  
736  N N   . GLY A 107 ? 0.1715 0.1334 0.1492 -0.0003 0.0137  -0.0213 127  GLY A N   
737  C CA  . GLY A 107 ? 0.1754 0.1359 0.1522 -0.0014 0.0102  -0.0154 127  GLY A CA  
738  C C   . GLY A 107 ? 0.1651 0.1343 0.1438 0.0040  0.0106  -0.0141 127  GLY A C   
739  O O   . GLY A 107 ? 0.1760 0.1497 0.1520 0.0016  0.0168  -0.0003 127  GLY A O   
740  N N   . HIS A 108 ? 0.1486 0.1363 0.1311 -0.0007 0.0124  -0.0095 128  HIS A N   
741  C CA  . HIS A 108 ? 0.1329 0.1351 0.1218 0.0035  0.0118  -0.0058 128  HIS A CA  
742  C C   . HIS A 108 ? 0.1315 0.1381 0.1355 0.0041  0.0144  -0.0086 128  HIS A C   
743  O O   . HIS A 108 ? 0.1448 0.1525 0.1411 0.0100  0.0168  0.0017  128  HIS A O   
744  C CB  . HIS A 108 ? 0.1278 0.1209 0.1218 0.0002  0.0039  -0.0095 128  HIS A CB  
745  C CG  . HIS A 108 ? 0.1247 0.1224 0.1138 -0.0010 0.0074  -0.0115 128  HIS A CG  
746  N ND1 . HIS A 108 ? 0.1253 0.1241 0.1203 -0.0017 0.0039  -0.0075 128  HIS A ND1 
747  C CD2 . HIS A 108 ? 0.1200 0.1176 0.1145 -0.0057 0.0013  -0.0161 128  HIS A CD2 
748  C CE1 . HIS A 108 ? 0.1251 0.1193 0.1133 0.0002  0.0071  -0.0122 128  HIS A CE1 
749  N NE2 . HIS A 108 ? 0.1238 0.1147 0.1123 -0.0032 0.0048  -0.0087 128  HIS A NE2 
750  N N   . SER A 109 ? 0.1306 0.1419 0.1380 0.0021  0.0182  -0.0096 129  SER A N   
751  C CA  . SER A 109 ? 0.1316 0.1402 0.1427 0.0017  0.0118  -0.0071 129  SER A CA  
752  C C   . SER A 109 ? 0.1344 0.1463 0.1312 0.0007  0.0171  -0.0091 129  SER A C   
753  O O   . SER A 109 ? 0.1346 0.1501 0.1454 -0.0053 0.0261  -0.0190 129  SER A O   
754  C CB  . SER A 109 ? 0.1500 0.1605 0.1480 0.0024  0.0219  -0.0072 129  SER A CB  
755  O OG  . SER A 109 ? 0.1757 0.1746 0.1740 0.0067  0.0213  0.0133  129  SER A OG  
756  N N   . ASN A 110 ? 0.1242 0.1373 0.1342 -0.0047 0.0127  -0.0034 130  ASN A N   
757  C CA  . ASN A 110 ? 0.1257 0.1425 0.1315 -0.0017 0.0091  -0.0064 130  ASN A CA  
758  C C   . ASN A 110 ? 0.1233 0.1362 0.1293 -0.0045 0.0059  -0.0049 130  ASN A C   
759  O O   . ASN A 110 ? 0.1342 0.1379 0.1397 -0.0134 0.0086  -0.0156 130  ASN A O   
760  C CB  . ASN A 110 ? 0.1463 0.1484 0.1360 -0.0026 0.0099  -0.0005 130  ASN A CB  
761  C CG  . ASN A 110 ? 0.1512 0.1588 0.1477 -0.0073 0.0043  -0.0056 130  ASN A CG  
762  O OD1 . ASN A 110 ? 0.1571 0.1804 0.1476 -0.0203 0.0017  -0.0090 130  ASN A OD1 
763  N ND2 . ASN A 110 ? 0.1658 0.1764 0.1490 -0.0140 0.0048  -0.0015 130  ASN A ND2 
764  N N   . TYR A 111 ? 0.1158 0.1389 0.1209 -0.0023 0.0120  -0.0047 131  TYR A N   
765  C CA  . TYR A 111 ? 0.1119 0.1297 0.1160 -0.0026 0.0073  0.0017  131  TYR A CA  
766  C C   . TYR A 111 ? 0.1110 0.1122 0.0994 -0.0073 0.0085  0.0026  131  TYR A C   
767  O O   . TYR A 111 ? 0.1168 0.1251 0.1012 -0.0051 0.0033  0.0023  131  TYR A O   
768  C CB  . TYR A 111 ? 0.1232 0.1302 0.1321 -0.0028 0.0078  -0.0043 131  TYR A CB  
769  C CG  . TYR A 111 ? 0.1263 0.1376 0.1545 -0.0054 0.0006  0.0034  131  TYR A CG  
770  C CD1 . TYR A 111 ? 0.1376 0.1414 0.1756 0.0019  -0.0009 0.0074  131  TYR A CD1 
771  C CD2 . TYR A 111 ? 0.1328 0.1376 0.1730 -0.0041 -0.0003 0.0144  131  TYR A CD2 
772  C CE1 . TYR A 111 ? 0.1383 0.1550 0.1922 -0.0004 -0.0027 0.0108  131  TYR A CE1 
773  C CE2 . TYR A 111 ? 0.1314 0.1510 0.1958 -0.0096 0.0010  0.0145  131  TYR A CE2 
774  C CZ  . TYR A 111 ? 0.1443 0.1556 0.2096 -0.0014 -0.0022 0.0157  131  TYR A CZ  
775  O OH  . TYR A 111 ? 0.1485 0.2096 0.2711 -0.0135 -0.0090 -0.0037 131  TYR A OH  
776  N N   . VAL A 112 ? 0.1007 0.1006 0.0933 -0.0010 -0.0026 0.0014  132  VAL A N   
777  C CA  . VAL A 112 ? 0.0981 0.0932 0.0903 -0.0013 0.0020  -0.0016 132  VAL A CA  
778  C C   . VAL A 112 ? 0.1022 0.0901 0.0861 -0.0019 -0.0009 -0.0008 132  VAL A C   
779  O O   . VAL A 112 ? 0.1187 0.0933 0.0847 -0.0021 0.0035  -0.0013 132  VAL A O   
780  C CB  . VAL A 112 ? 0.0974 0.0927 0.0925 -0.0010 -0.0004 -0.0006 132  VAL A CB  
781  C CG1 . VAL A 112 ? 0.0956 0.0944 0.0968 0.0000  0.0021  0.0031  132  VAL A CG1 
782  C CG2 . VAL A 112 ? 0.0895 0.0915 0.0969 -0.0062 -0.0013 -0.0019 132  VAL A CG2 
783  N N   . PHE A 113 ? 0.0896 0.0853 0.0835 -0.0041 0.0025  -0.0054 133  PHE A N   
784  C CA  . PHE A 113 ? 0.0851 0.0826 0.0816 -0.0026 -0.0003 -0.0022 133  PHE A CA  
785  C C   . PHE A 113 ? 0.0869 0.0844 0.0828 -0.0032 0.0044  -0.0027 133  PHE A C   
786  O O   . PHE A 113 ? 0.0947 0.0874 0.0798 -0.0061 0.0008  -0.0036 133  PHE A O   
787  C CB  . PHE A 113 ? 0.0798 0.0827 0.0860 -0.0032 0.0005  -0.0017 133  PHE A CB  
788  C CG  . PHE A 113 ? 0.0860 0.0855 0.0850 -0.0026 -0.0025 -0.0035 133  PHE A CG  
789  C CD1 . PHE A 113 ? 0.0849 0.0851 0.0930 0.0000  -0.0047 -0.0015 133  PHE A CD1 
790  C CD2 . PHE A 113 ? 0.0914 0.0840 0.0906 -0.0013 -0.0003 -0.0054 133  PHE A CD2 
791  C CE1 . PHE A 113 ? 0.0930 0.0871 0.0915 -0.0007 -0.0080 -0.0029 133  PHE A CE1 
792  C CE2 . PHE A 113 ? 0.0944 0.0851 0.0916 -0.0026 -0.0040 -0.0046 133  PHE A CE2 
793  C CZ  . PHE A 113 ? 0.0901 0.0911 0.0963 0.0002  -0.0060 -0.0032 133  PHE A CZ  
794  N N   . CYS A 114 ? 0.0957 0.0858 0.0850 -0.0033 -0.0009 0.0004  134  CYS A N   
795  C CA  . CYS A 114 ? 0.0954 0.0877 0.0879 -0.0056 -0.0004 0.0020  134  CYS A CA  
796  C C   . CYS A 114 ? 0.0958 0.0900 0.0893 -0.0067 -0.0008 0.0006  134  CYS A C   
797  O O   . CYS A 114 ? 0.0956 0.0901 0.0879 -0.0135 -0.0054 -0.0058 134  CYS A O   
798  C CB  . CYS A 114 ? 0.1158 0.0931 0.0852 -0.0019 0.0035  0.0056  134  CYS A CB  
799  S SG  . CYS A 114 ? 0.1301 0.1062 0.0788 -0.0036 -0.0004 0.0037  134  CYS A SG  
800  N N   . CYS A 115 ? 0.0967 0.0926 0.0913 -0.0034 0.0019  -0.0012 135  CYS A N   
801  C CA  . CYS A 115 ? 0.1042 0.0972 0.0944 -0.0075 -0.0009 -0.0026 135  CYS A CA  
802  C C   . CYS A 115 ? 0.1044 0.0926 0.0918 -0.0070 -0.0003 0.0004  135  CYS A C   
803  O O   . CYS A 115 ? 0.1246 0.0959 0.0957 -0.0018 0.0035  -0.0029 135  CYS A O   
804  C CB  . CYS A 115 ? 0.1142 0.0934 0.0986 -0.0096 -0.0064 -0.0044 135  CYS A CB  
805  S SG  . CYS A 115 ? 0.1338 0.1007 0.0989 -0.0191 -0.0067 0.0002  135  CYS A SG  
806  N N   . ASN A 116 ? 0.1011 0.0953 0.0901 -0.0043 0.0017  -0.0049 136  ASN A N   
807  C CA  . ASN A 116 ? 0.1015 0.0978 0.0981 -0.0064 0.0034  -0.0041 136  ASN A CA  
808  C C   . ASN A 116 ? 0.1043 0.1020 0.1010 -0.0089 0.0040  -0.0075 136  ASN A C   
809  O O   . ASN A 116 ? 0.1206 0.0995 0.0985 -0.0172 0.0015  -0.0133 136  ASN A O   
810  C CB  . ASN A 116 ? 0.1140 0.0973 0.0980 -0.0067 0.0022  -0.0027 136  ASN A CB  
811  C CG  . ASN A 116 ? 0.1207 0.0995 0.0933 -0.0083 0.0053  -0.0011 136  ASN A CG  
812  O OD1 . ASN A 116 ? 0.1260 0.1048 0.0966 -0.0118 0.0091  -0.0004 136  ASN A OD1 
813  N ND2 . ASN A 116 ? 0.1351 0.0993 0.0892 -0.0112 0.0022  -0.0032 136  ASN A ND2 
814  N N   . PHE A 117 ? 0.1073 0.1034 0.0943 -0.0083 0.0048  -0.0043 137  PHE A N   
815  C CA  . PHE A 117 ? 0.1096 0.1077 0.0994 -0.0107 0.0013  -0.0013 137  PHE A CA  
816  C C   . PHE A 117 ? 0.1236 0.1126 0.1053 -0.0070 -0.0042 0.0018  137  PHE A C   
817  O O   . PHE A 117 ? 0.1357 0.1154 0.0968 -0.0045 -0.0022 -0.0032 137  PHE A O   
818  C CB  . PHE A 117 ? 0.1035 0.1034 0.0946 -0.0067 0.0007  -0.0018 137  PHE A CB  
819  C CG  . PHE A 117 ? 0.1025 0.0962 0.0926 -0.0102 0.0046  -0.0024 137  PHE A CG  
820  C CD1 . PHE A 117 ? 0.1112 0.0968 0.0919 -0.0056 -0.0006 0.0012  137  PHE A CD1 
821  C CD2 . PHE A 117 ? 0.1037 0.0953 0.0914 -0.0069 0.0029  -0.0015 137  PHE A CD2 
822  C CE1 . PHE A 117 ? 0.1040 0.0946 0.1001 -0.0034 -0.0015 -0.0031 137  PHE A CE1 
823  C CE2 . PHE A 117 ? 0.1106 0.0944 0.0916 -0.0080 -0.0030 -0.0025 137  PHE A CE2 
824  C CZ  . PHE A 117 ? 0.1093 0.0949 0.0927 -0.0023 -0.0048 -0.0023 137  PHE A CZ  
825  N N   . ASN A 118 ? 0.1325 0.1160 0.1055 -0.0120 -0.0017 -0.0008 138  ASN A N   
826  C CA  . ASN A 118 ? 0.1330 0.1245 0.1179 -0.0111 -0.0073 -0.0012 138  ASN A CA  
827  C C   . ASN A 118 ? 0.1370 0.1289 0.1175 -0.0120 -0.0061 0.0024  138  ASN A C   
828  O O   . ASN A 118 ? 0.1389 0.1328 0.1098 -0.0126 -0.0131 0.0002  138  ASN A O   
829  C CB  . ASN A 118 ? 0.1319 0.1282 0.1171 -0.0082 -0.0055 -0.0009 138  ASN A CB  
830  C CG  . ASN A 118 ? 0.1331 0.1314 0.1216 -0.0154 -0.0057 -0.0010 138  ASN A CG  
831  O OD1 . ASN A 118 ? 0.1396 0.1328 0.1275 -0.0087 -0.0107 0.0007  138  ASN A OD1 
832  N ND2 . ASN A 118 ? 0.1594 0.1446 0.1301 -0.0194 -0.0121 -0.0095 138  ASN A ND2 
833  N N   . PRO A 119 ? 0.1406 0.1380 0.1254 -0.0114 -0.0099 0.0111  139  PRO A N   
834  C CA  . PRO A 119 ? 0.1452 0.1509 0.1240 -0.0077 -0.0048 0.0067  139  PRO A CA  
835  C C   . PRO A 119 ? 0.1552 0.1548 0.1367 -0.0153 -0.0006 0.0085  139  PRO A C   
836  O O   . PRO A 119 ? 0.1768 0.1649 0.1154 -0.0256 -0.0173 0.0101  139  PRO A O   
837  C CB  . PRO A 119 ? 0.1506 0.1584 0.1287 -0.0058 -0.0052 0.0126  139  PRO A CB  
838  C CG  . PRO A 119 ? 0.1506 0.1496 0.1260 -0.0061 -0.0163 0.0117  139  PRO A CG  
839  C CD  . PRO A 119 ? 0.1460 0.1444 0.1200 -0.0095 -0.0173 0.0137  139  PRO A CD  
840  N N   . GLN A 120 ? 0.1621 0.1575 0.1374 -0.0178 -0.0068 0.0062  140  GLN A N   
841  C CA  . GLN A 120 ? 0.1618 0.1593 0.1503 -0.0212 -0.0057 0.0036  140  GLN A CA  
842  C C   . GLN A 120 ? 0.1589 0.1572 0.1591 -0.0209 -0.0018 0.0089  140  GLN A C   
843  O O   . GLN A 120 ? 0.1755 0.1550 0.1771 -0.0282 -0.0084 0.0117  140  GLN A O   
844  C CB  . GLN A 120 ? 0.1872 0.1827 0.1565 -0.0201 -0.0056 -0.0074 140  GLN A CB  
845  C CG  . GLN A 120 ? 0.2062 0.1862 0.1893 -0.0277 -0.0133 -0.0023 140  GLN A CG  
846  C CD  . GLN A 120 ? 0.2361 0.2068 0.1918 -0.0274 -0.0248 -0.0106 140  GLN A CD  
847  O OE1 . GLN A 120 ? 0.2436 0.2101 0.2187 -0.0406 -0.0115 0.0050  140  GLN A OE1 
848  N NE2 . GLN A 120 ? 0.2552 0.2086 0.2146 -0.0211 -0.0284 -0.0146 140  GLN A NE2 
849  N N   . SER A 121 ? 0.1522 0.1504 0.1476 -0.0136 -0.0030 0.0088  141  SER A N   
850  C CA  . SER A 121 ? 0.1543 0.1463 0.1361 -0.0114 -0.0005 0.0023  141  SER A CA  
851  C C   . SER A 121 ? 0.1551 0.1431 0.1358 -0.0152 -0.0017 0.0015  141  SER A C   
852  O O   . SER A 121 ? 0.2069 0.1484 0.1505 -0.0070 -0.0070 0.0102  141  SER A O   
853  C CB  . SER A 121 ? 0.1528 0.1369 0.1377 -0.0100 0.0031  0.0023  141  SER A CB  
854  O OG  . SER A 121 ? 0.1608 0.1338 0.1264 0.0035  0.0105  0.0150  141  SER A OG  
855  N N   . ASN A 122 ? 0.1457 0.1296 0.1391 -0.0155 -0.0074 -0.0074 142  ASN A N   
856  C CA  . ASN A 122 ? 0.1369 0.1379 0.1218 -0.0159 -0.0054 -0.0076 142  ASN A CA  
857  C C   . ASN A 122 ? 0.1318 0.1333 0.1132 -0.0128 -0.0113 -0.0088 142  ASN A C   
858  O O   . ASN A 122 ? 0.1466 0.1283 0.1148 -0.0095 -0.0201 -0.0185 142  ASN A O   
859  C CB  . ASN A 122 ? 0.1394 0.1423 0.1232 -0.0228 -0.0016 -0.0095 142  ASN A CB  
860  C CG  . ASN A 122 ? 0.1586 0.1455 0.1324 -0.0168 -0.0043 -0.0040 142  ASN A CG  
861  O OD1 . ASN A 122 ? 0.1696 0.1417 0.1283 -0.0218 -0.0062 -0.0039 142  ASN A OD1 
862  N ND2 . ASN A 122 ? 0.1992 0.1628 0.1327 -0.0325 -0.0020 -0.0096 142  ASN A ND2 
863  N N   . LEU A 123 ? 0.1272 0.1324 0.1075 -0.0097 -0.0058 -0.0081 143  LEU A N   
864  C CA  . LEU A 123 ? 0.1280 0.1293 0.1126 -0.0097 -0.0072 -0.0036 143  LEU A CA  
865  C C   . LEU A 123 ? 0.1245 0.1162 0.1110 -0.0086 -0.0037 -0.0006 143  LEU A C   
866  O O   . LEU A 123 ? 0.1207 0.1307 0.1057 -0.0090 -0.0081 -0.0050 143  LEU A O   
867  C CB  . LEU A 123 ? 0.1405 0.1340 0.1209 -0.0132 -0.0077 0.0048  143  LEU A CB  
868  C CG  . LEU A 123 ? 0.1481 0.1378 0.1260 -0.0149 -0.0111 0.0021  143  LEU A CG  
869  C CD1 . LEU A 123 ? 0.1465 0.1376 0.1294 -0.0127 -0.0135 0.0029  143  LEU A CD1 
870  C CD2 . LEU A 123 ? 0.1578 0.1464 0.1217 -0.0098 -0.0102 -0.0078 143  LEU A CD2 
871  N N   . ILE A 124 ? 0.1248 0.1075 0.1004 -0.0089 -0.0050 0.0015  144  ILE A N   
872  C CA  . ILE A 124 ? 0.1300 0.1065 0.1057 -0.0100 -0.0004 -0.0035 144  ILE A CA  
873  C C   . ILE A 124 ? 0.1190 0.1002 0.0982 -0.0037 -0.0036 -0.0062 144  ILE A C   
874  O O   . ILE A 124 ? 0.1313 0.1062 0.0920 -0.0062 0.0014  -0.0032 144  ILE A O   
875  C CB  . ILE A 124 ? 0.1322 0.1175 0.1132 -0.0056 -0.0051 -0.0026 144  ILE A CB  
876  C CG1 . ILE A 124 ? 0.1394 0.1198 0.1245 -0.0095 0.0041  -0.0073 144  ILE A CG1 
877  C CG2 . ILE A 124 ? 0.1361 0.1236 0.1139 -0.0063 -0.0107 0.0042  144  ILE A CG2 
878  C CD1 . ILE A 124 ? 0.1463 0.1242 0.1160 -0.0080 -0.0062 -0.0060 144  ILE A CD1 
879  N N   . VAL A 125 ? 0.1088 0.0988 0.0838 -0.0054 -0.0025 -0.0029 145  VAL A N   
880  C CA  . VAL A 125 ? 0.1081 0.1019 0.0846 -0.0042 0.0016  -0.0041 145  VAL A CA  
881  C C   . VAL A 125 ? 0.0971 0.1073 0.0908 -0.0016 0.0030  -0.0011 145  VAL A C   
882  O O   . VAL A 125 ? 0.1125 0.1088 0.0931 0.0001  -0.0013 -0.0120 145  VAL A O   
883  C CB  . VAL A 125 ? 0.1007 0.1067 0.0880 -0.0023 -0.0009 -0.0045 145  VAL A CB  
884  C CG1 . VAL A 125 ? 0.1048 0.1039 0.0800 -0.0019 -0.0033 -0.0003 145  VAL A CG1 
885  C CG2 . VAL A 125 ? 0.1048 0.1052 0.0815 -0.0009 -0.0008 -0.0042 145  VAL A CG2 
886  N N   . SER A 126 ? 0.0956 0.1009 0.0819 -0.0024 0.0001  -0.0018 146  SER A N   
887  C CA  . SER A 126 ? 0.0997 0.0974 0.0821 -0.0045 0.0011  -0.0061 146  SER A CA  
888  C C   . SER A 126 ? 0.1019 0.0919 0.0901 -0.0058 0.0000  -0.0046 146  SER A C   
889  O O   . SER A 126 ? 0.1048 0.0988 0.0903 -0.0029 -0.0051 -0.0060 146  SER A O   
890  C CB  . SER A 126 ? 0.1072 0.0983 0.0805 0.0012  0.0017  -0.0084 146  SER A CB  
891  O OG  . SER A 126 ? 0.1130 0.0961 0.0834 0.0054  0.0055  -0.0034 146  SER A OG  
892  N N   . GLY A 127 ? 0.1029 0.0947 0.0917 -0.0055 -0.0003 -0.0060 147  GLY A N   
893  C CA  . GLY A 127 ? 0.1032 0.0962 0.0940 -0.0076 -0.0001 -0.0058 147  GLY A CA  
894  C C   . GLY A 127 ? 0.1021 0.1005 0.0942 -0.0086 0.0013  -0.0021 147  GLY A C   
895  O O   . GLY A 127 ? 0.1154 0.1027 0.0926 -0.0095 0.0062  -0.0047 147  GLY A O   
896  N N   . SER A 128 ? 0.1059 0.1003 0.1010 -0.0068 0.0069  -0.0016 148  SER A N   
897  C CA  . SER A 128 ? 0.1092 0.1042 0.1009 -0.0011 0.0057  -0.0044 148  SER A CA  
898  C C   . SER A 128 ? 0.1195 0.1038 0.1060 -0.0029 0.0072  0.0014  148  SER A C   
899  O O   . SER A 128 ? 0.1490 0.1069 0.1013 -0.0072 0.0061  0.0013  148  SER A O   
900  C CB  . SER A 128 ? 0.1111 0.1017 0.1101 -0.0044 0.0020  -0.0056 148  SER A CB  
901  O OG  . SER A 128 ? 0.1081 0.1069 0.1238 0.0022  0.0149  -0.0071 148  SER A OG  
902  N N   . PHE A 129 ? 0.1215 0.1142 0.1004 -0.0017 0.0076  -0.0020 149  PHE A N   
903  C CA  . PHE A 129 ? 0.1236 0.1189 0.1199 -0.0073 0.0032  -0.0024 149  PHE A CA  
904  C C   . PHE A 129 ? 0.1360 0.1243 0.1153 -0.0096 0.0048  -0.0006 149  PHE A C   
905  O O   . PHE A 129 ? 0.1442 0.1506 0.1265 -0.0207 0.0185  -0.0065 149  PHE A O   
906  C CB  . PHE A 129 ? 0.1331 0.1289 0.1202 -0.0075 -0.0011 -0.0007 149  PHE A CB  
907  C CG  . PHE A 129 ? 0.1446 0.1365 0.1278 -0.0065 0.0011  -0.0072 149  PHE A CG  
908  C CD1 . PHE A 129 ? 0.1382 0.1510 0.1428 -0.0091 0.0011  -0.0051 149  PHE A CD1 
909  C CD2 . PHE A 129 ? 0.1498 0.1517 0.1489 -0.0139 -0.0012 -0.0114 149  PHE A CD2 
910  C CE1 . PHE A 129 ? 0.1513 0.1580 0.1456 -0.0117 0.0050  -0.0096 149  PHE A CE1 
911  C CE2 . PHE A 129 ? 0.1541 0.1638 0.1451 -0.0130 0.0017  -0.0160 149  PHE A CE2 
912  C CZ  . PHE A 129 ? 0.1465 0.1677 0.1518 -0.0094 -0.0029 -0.0158 149  PHE A CZ  
913  N N   . ASP A 130 ? 0.1382 0.1258 0.1194 -0.0103 0.0077  -0.0017 150  ASP A N   
914  C CA  . ASP A 130 ? 0.1327 0.1271 0.1211 -0.0045 0.0102  0.0000  150  ASP A CA  
915  C C   . ASP A 130 ? 0.1316 0.1313 0.1211 -0.0035 0.0081  -0.0013 150  ASP A C   
916  O O   . ASP A 130 ? 0.1523 0.1428 0.1221 -0.0043 0.0083  -0.0046 150  ASP A O   
917  C CB  . ASP A 130 ? 0.1194 0.1267 0.1217 -0.0002 0.0135  -0.0031 150  ASP A CB  
918  C CG  . ASP A 130 ? 0.1238 0.1214 0.1271 -0.0050 0.0044  0.0008  150  ASP A CG  
919  O OD1 . ASP A 130 ? 0.1120 0.1333 0.1227 -0.0042 0.0163  0.0033  150  ASP A OD1 
920  O OD2 . ASP A 130 ? 0.1188 0.1212 0.1277 -0.0033 -0.0008 0.0011  150  ASP A OD2 
921  N N   . GLU A 131 ? 0.1382 0.1327 0.1227 -0.0010 0.0059  -0.0027 151  GLU A N   
922  C CA  . GLU A 131 ? 0.1225 0.1285 0.1234 -0.0053 0.0080  -0.0021 151  GLU A CA  
923  C C   . GLU A 131 ? 0.1349 0.1222 0.1198 -0.0062 0.0022  -0.0004 151  GLU A C   
924  O O   . GLU A 131 ? 0.1237 0.1301 0.1205 -0.0181 -0.0031 0.0050  151  GLU A O   
925  C CB  . GLU A 131 ? 0.1357 0.1395 0.1179 -0.0034 0.0115  0.0016  151  GLU A CB  
926  C CG  . GLU A 131 ? 0.1360 0.1580 0.1316 -0.0061 0.0069  0.0001  151  GLU A CG  
927  C CD  . GLU A 131 ? 0.1434 0.1631 0.1410 -0.0075 0.0085  0.0076  151  GLU A CD  
928  O OE1 . GLU A 131 ? 0.1539 0.1722 0.1393 -0.0065 0.0137  0.0114  151  GLU A OE1 
929  O OE2 . GLU A 131 ? 0.1490 0.2024 0.1622 -0.0197 -0.0022 0.0139  151  GLU A OE2 
930  N N   . SER A 132 ? 0.1247 0.1243 0.1134 -0.0119 -0.0013 -0.0017 152  SER A N   
931  C CA  . SER A 132 ? 0.1228 0.1228 0.1147 -0.0057 -0.0034 -0.0041 152  SER A CA  
932  C C   . SER A 132 ? 0.1255 0.1158 0.1080 -0.0095 -0.0030 -0.0036 152  SER A C   
933  O O   . SER A 132 ? 0.1327 0.1173 0.1037 -0.0131 0.0085  0.0062  152  SER A O   
934  C CB  . SER A 132 ? 0.1182 0.1257 0.1172 -0.0012 -0.0022 -0.0054 152  SER A CB  
935  O OG  . SER A 132 ? 0.1289 0.1381 0.1272 0.0003  -0.0053 0.0045  152  SER A OG  
936  N N   . VAL A 133 ? 0.1211 0.1104 0.1039 -0.0100 0.0023  -0.0034 153  VAL A N   
937  C CA  . VAL A 133 ? 0.1213 0.1169 0.1021 -0.0101 0.0027  -0.0072 153  VAL A CA  
938  C C   . VAL A 133 ? 0.1308 0.1133 0.1077 -0.0130 0.0084  -0.0014 153  VAL A C   
939  O O   . VAL A 133 ? 0.1411 0.1257 0.1092 -0.0166 0.0060  -0.0062 153  VAL A O   
940  C CB  . VAL A 133 ? 0.1204 0.1154 0.1023 -0.0079 0.0080  -0.0075 153  VAL A CB  
941  C CG1 . VAL A 133 ? 0.1223 0.1183 0.1023 -0.0116 0.0104  -0.0116 153  VAL A CG1 
942  C CG2 . VAL A 133 ? 0.1283 0.1150 0.1006 -0.0116 0.0092  -0.0050 153  VAL A CG2 
943  N N   . ARG A 134 ? 0.1376 0.1113 0.1062 -0.0126 0.0030  -0.0014 154  ARG A N   
944  C CA  . ARG A 134 ? 0.1315 0.1158 0.1101 -0.0108 0.0006  -0.0119 154  ARG A CA  
945  C C   . ARG A 134 ? 0.1321 0.1117 0.1043 -0.0156 0.0014  -0.0119 154  ARG A C   
946  O O   . ARG A 134 ? 0.1350 0.1170 0.1016 -0.0195 0.0014  -0.0081 154  ARG A O   
947  C CB  . ARG A 134 ? 0.1282 0.1224 0.1204 -0.0038 0.0005  -0.0155 154  ARG A CB  
948  C CG  . ARG A 134 ? 0.1301 0.1410 0.1260 -0.0110 0.0063  -0.0098 154  ARG A CG  
949  C CD  . ARG A 134 ? 0.1498 0.1500 0.1380 -0.0041 -0.0054 -0.0096 154  ARG A CD  
950  N NE  . ARG A 134 ? 0.1564 0.1839 0.1761 0.0000  0.0077  -0.0122 154  ARG A NE  
951  C CZ  . ARG A 134 ? 0.1662 0.1842 0.1869 -0.0041 0.0015  -0.0202 154  ARG A CZ  
952  N NH1 . ARG A 134 ? 0.1813 0.1884 0.2352 -0.0166 0.0047  -0.0113 154  ARG A NH1 
953  N NH2 . ARG A 134 ? 0.1733 0.2128 0.1813 -0.0061 0.0083  -0.0228 154  ARG A NH2 
954  N N   . ILE A 135 ? 0.1298 0.1123 0.1045 -0.0107 0.0003  -0.0074 155  ILE A N   
955  C CA  . ILE A 135 ? 0.1267 0.1146 0.1077 -0.0115 -0.0039 -0.0048 155  ILE A CA  
956  C C   . ILE A 135 ? 0.1352 0.1145 0.1116 -0.0065 -0.0058 -0.0067 155  ILE A C   
957  O O   . ILE A 135 ? 0.1611 0.1235 0.1148 -0.0012 0.0007  -0.0105 155  ILE A O   
958  C CB  . ILE A 135 ? 0.1237 0.1156 0.1085 -0.0109 -0.0034 -0.0054 155  ILE A CB  
959  C CG1 . ILE A 135 ? 0.1334 0.1185 0.1100 -0.0106 -0.0034 0.0004  155  ILE A CG1 
960  C CG2 . ILE A 135 ? 0.1262 0.1258 0.1098 -0.0156 -0.0053 0.0010  155  ILE A CG2 
961  C CD1 . ILE A 135 ? 0.1375 0.1258 0.1098 -0.0120 -0.0043 0.0047  155  ILE A CD1 
962  N N   . TRP A 136 ? 0.1307 0.1200 0.1122 -0.0075 -0.0052 -0.0072 156  TRP A N   
963  C CA  . TRP A 136 ? 0.1370 0.1176 0.1198 -0.0023 -0.0030 -0.0110 156  TRP A CA  
964  C C   . TRP A 136 ? 0.1388 0.1282 0.1306 -0.0060 -0.0086 -0.0069 156  TRP A C   
965  O O   . TRP A 136 ? 0.1389 0.1204 0.1169 -0.0092 -0.0066 -0.0038 156  TRP A O   
966  C CB  . TRP A 136 ? 0.1323 0.1221 0.1230 -0.0011 -0.0057 -0.0118 156  TRP A CB  
967  C CG  . TRP A 136 ? 0.1298 0.1225 0.1261 0.0003  -0.0026 -0.0146 156  TRP A CG  
968  C CD1 . TRP A 136 ? 0.1319 0.1218 0.1258 0.0041  0.0000  -0.0144 156  TRP A CD1 
969  C CD2 . TRP A 136 ? 0.1310 0.1208 0.1217 0.0014  0.0012  -0.0191 156  TRP A CD2 
970  N NE1 . TRP A 136 ? 0.1331 0.1162 0.1222 0.0012  0.0051  -0.0159 156  TRP A NE1 
971  C CE2 . TRP A 136 ? 0.1238 0.1235 0.1335 0.0032  0.0000  -0.0193 156  TRP A CE2 
972  C CE3 . TRP A 136 ? 0.1231 0.1181 0.1059 -0.0027 -0.0060 -0.0229 156  TRP A CE3 
973  C CZ2 . TRP A 136 ? 0.1228 0.1197 0.1220 0.0032  -0.0019 -0.0181 156  TRP A CZ2 
974  C CZ3 . TRP A 136 ? 0.1242 0.1180 0.1131 -0.0013 0.0010  -0.0227 156  TRP A CZ3 
975  C CH2 . TRP A 136 ? 0.1163 0.1191 0.1122 0.0004  -0.0050 -0.0199 156  TRP A CH2 
976  N N   . ASP A 137 ? 0.1583 0.1293 0.1466 -0.0029 -0.0085 -0.0122 157  ASP A N   
977  C CA  . ASP A 137 ? 0.1677 0.1433 0.1580 -0.0101 -0.0007 -0.0055 157  ASP A CA  
978  C C   . ASP A 137 ? 0.1693 0.1451 0.1620 -0.0164 0.0044  0.0006  157  ASP A C   
979  O O   . ASP A 137 ? 0.1879 0.1427 0.1658 -0.0205 -0.0099 0.0107  157  ASP A O   
980  C CB  . ASP A 137 ? 0.1916 0.1580 0.1910 -0.0169 -0.0012 -0.0257 157  ASP A CB  
981  C CG  . ASP A 137 ? 0.2043 0.1910 0.2316 -0.0352 0.0041  -0.0231 157  ASP A CG  
982  O OD1 . ASP A 137 ? 0.2204 0.2029 0.2731 -0.0226 -0.0082 -0.0279 157  ASP A OD1 
983  O OD2 . ASP A 137 ? 0.2568 0.2119 0.2840 -0.0350 -0.0019 0.0067  157  ASP A OD2 
984  N N   . VAL A 138 ? 0.1676 0.1436 0.1574 -0.0160 0.0021  0.0032  158  VAL A N   
985  C CA  . VAL A 138 ? 0.1781 0.1495 0.1584 -0.0194 -0.0021 0.0087  158  VAL A CA  
986  C C   . VAL A 138 ? 0.1929 0.1499 0.1793 -0.0150 0.0080  0.0092  158  VAL A C   
987  O O   . VAL A 138 ? 0.2049 0.1376 0.1829 -0.0243 -0.0005 0.0096  158  VAL A O   
988  C CB  . VAL A 138 ? 0.1740 0.1489 0.1519 -0.0223 -0.0048 0.0068  158  VAL A CB  
989  C CG1 . VAL A 138 ? 0.1752 0.1603 0.1539 -0.0247 0.0025  0.0076  158  VAL A CG1 
990  C CG2 . VAL A 138 ? 0.1827 0.1488 0.1389 -0.0243 -0.0061 0.0043  158  VAL A CG2 
991  N N   . LYS A 139 ? 0.1951 0.1706 0.1971 -0.0211 -0.0026 0.0076  159  LYS A N   
992  C CA  . LYS A 139 ? 0.2168 0.1721 0.2311 -0.0155 0.0116  0.0124  159  LYS A CA  
993  C C   . LYS A 139 ? 0.2156 0.1908 0.2271 -0.0121 0.0128  0.0066  159  LYS A C   
994  O O   . LYS A 139 ? 0.2272 0.1852 0.2655 -0.0101 0.0172  0.0236  159  LYS A O   
995  C CB  . LYS A 139 ? 0.2250 0.2090 0.2392 -0.0114 -0.0013 0.0079  159  LYS A CB  
996  C CG  . LYS A 139 ? 0.2624 0.2069 0.2615 -0.0048 0.0021  -0.0029 159  LYS A CG  
997  C CD  . LYS A 139 ? 0.2690 0.2543 0.2597 0.0083  0.0113  -0.0022 159  LYS A CD  
998  C CE  . LYS A 139 ? 0.2805 0.2565 0.2779 0.0047  0.0139  -0.0100 159  LYS A CE  
999  N NZ  . LYS A 139 ? 0.3128 0.3065 0.2823 0.0096  0.0126  0.0064  159  LYS A NZ  
1000 N N   . THR A 140 ? 0.2284 0.1946 0.2194 -0.0098 0.0165  -0.0086 160  THR A N   
1001 C CA  . THR A 140 ? 0.2219 0.2057 0.2355 -0.0059 0.0106  0.0021  160  THR A CA  
1002 C C   . THR A 140 ? 0.2261 0.1930 0.2164 -0.0003 0.0098  -0.0044 160  THR A C   
1003 O O   . THR A 140 ? 0.2202 0.2243 0.2328 0.0018  0.0004  0.0001  160  THR A O   
1004 C CB  . THR A 140 ? 0.2359 0.2250 0.2366 -0.0117 0.0044  -0.0052 160  THR A CB  
1005 O OG1 . THR A 140 ? 0.2259 0.2262 0.2377 -0.0225 0.0087  -0.0043 160  THR A OG1 
1006 C CG2 . THR A 140 ? 0.2349 0.2280 0.2334 -0.0144 0.0207  -0.0172 160  THR A CG2 
1007 N N   . GLY A 141 ? 0.2123 0.1865 0.1991 -0.0004 0.0039  0.0119  161  GLY A N   
1008 C CA  . GLY A 141 ? 0.2082 0.1619 0.1843 0.0105  0.0045  0.0104  161  GLY A CA  
1009 C C   . GLY A 141 ? 0.1922 0.1567 0.1804 0.0092  -0.0005 -0.0018 161  GLY A C   
1010 O O   . GLY A 141 ? 0.1946 0.1599 0.1822 0.0047  0.0059  -0.0035 161  GLY A O   
1011 N N   . LYS A 142 ? 0.1966 0.1540 0.1757 0.0008  0.0055  -0.0050 162  LYS A N   
1012 C CA  . LYS A 142 ? 0.1886 0.1692 0.1762 -0.0016 0.0025  -0.0068 162  LYS A CA  
1013 C C   . LYS A 142 ? 0.1772 0.1618 0.1620 -0.0029 0.0016  -0.0185 162  LYS A C   
1014 O O   . LYS A 142 ? 0.1769 0.1541 0.1587 -0.0047 -0.0050 -0.0134 162  LYS A O   
1015 C CB  . LYS A 142 ? 0.1843 0.1801 0.1843 -0.0052 -0.0061 -0.0111 162  LYS A CB  
1016 C CG  . LYS A 142 ? 0.1995 0.1834 0.2131 -0.0021 -0.0138 -0.0048 162  LYS A CG  
1017 C CD  . LYS A 142 ? 0.2019 0.1962 0.2272 0.0005  -0.0075 -0.0087 162  LYS A CD  
1018 C CE  . LYS A 142 ? 0.2268 0.1919 0.2448 -0.0184 -0.0173 0.0021  162  LYS A CE  
1019 N NZ  . LYS A 142 ? 0.2318 0.2020 0.2773 -0.0084 -0.0204 -0.0067 162  LYS A NZ  
1020 N N   . CYS A 143 ? 0.1873 0.1573 0.1565 -0.0064 0.0046  -0.0164 163  CYS A N   
1021 C CA  . CYS A 143 ? 0.1877 0.1589 0.1608 -0.0069 0.0035  -0.0138 163  CYS A CA  
1022 C C   . CYS A 143 ? 0.1914 0.1654 0.1621 -0.0046 0.0009  -0.0161 163  CYS A C   
1023 O O   . CYS A 143 ? 0.1993 0.1766 0.1702 0.0079  -0.0020 -0.0205 163  CYS A O   
1024 C CB  . CYS A 143 ? 0.1887 0.1621 0.1716 -0.0067 0.0127  -0.0198 163  CYS A CB  
1025 S SG  . CYS A 143 ? 0.2221 0.1646 0.1913 -0.0301 0.0309  -0.0172 163  CYS A SG  
1026 N N   . LEU A 144 ? 0.1867 0.1568 0.1501 -0.0119 0.0007  -0.0143 164  LEU A N   
1027 C CA  . LEU A 144 ? 0.1838 0.1573 0.1568 -0.0140 -0.0040 -0.0161 164  LEU A CA  
1028 C C   . LEU A 144 ? 0.1851 0.1553 0.1599 -0.0170 -0.0030 -0.0168 164  LEU A C   
1029 O O   . LEU A 144 ? 0.1876 0.1638 0.1533 -0.0210 -0.0087 -0.0081 164  LEU A O   
1030 C CB  . LEU A 144 ? 0.1838 0.1551 0.1642 -0.0149 -0.0033 -0.0166 164  LEU A CB  
1031 C CG  . LEU A 144 ? 0.1926 0.1705 0.1822 -0.0183 0.0034  -0.0068 164  LEU A CG  
1032 C CD1 . LEU A 144 ? 0.1908 0.1779 0.1805 -0.0192 0.0005  -0.0086 164  LEU A CD1 
1033 C CD2 . LEU A 144 ? 0.2088 0.1751 0.1888 -0.0236 0.0101  -0.0148 164  LEU A CD2 
1034 N N   . LYS A 145 ? 0.1894 0.1516 0.1571 -0.0160 0.0024  -0.0127 165  LYS A N   
1035 C CA  . LYS A 145 ? 0.1753 0.1597 0.1548 -0.0128 0.0017  -0.0083 165  LYS A CA  
1036 C C   . LYS A 145 ? 0.1771 0.1571 0.1390 -0.0118 0.0109  -0.0130 165  LYS A C   
1037 O O   . LYS A 145 ? 0.1803 0.1656 0.1392 -0.0082 0.0222  -0.0129 165  LYS A O   
1038 C CB  . LYS A 145 ? 0.1796 0.1713 0.1598 -0.0062 0.0070  -0.0076 165  LYS A CB  
1039 C CG  . LYS A 145 ? 0.1778 0.1739 0.1711 -0.0136 -0.0027 -0.0114 165  LYS A CG  
1040 C CD  . LYS A 145 ? 0.1940 0.1903 0.1977 -0.0097 -0.0008 0.0040  165  LYS A CD  
1041 C CE  . LYS A 145 ? 0.1993 0.2069 0.1954 -0.0038 -0.0036 -0.0009 165  LYS A CE  
1042 N NZ  . LYS A 145 ? 0.2271 0.1806 0.2114 -0.0129 -0.0106 0.0088  165  LYS A NZ  
1043 N N   . THR A 146 ? 0.1727 0.1633 0.1487 -0.0114 0.0106  -0.0084 166  THR A N   
1044 C CA  . THR A 146 ? 0.1782 0.1486 0.1418 -0.0089 0.0079  0.0005  166  THR A CA  
1045 C C   . THR A 146 ? 0.1864 0.1470 0.1346 -0.0070 0.0072  -0.0024 166  THR A C   
1046 O O   . THR A 146 ? 0.2079 0.1671 0.1364 -0.0166 0.0155  -0.0013 166  THR A O   
1047 C CB  . THR A 146 ? 0.1853 0.1508 0.1544 0.0003  0.0109  0.0041  166  THR A CB  
1048 O OG1 . THR A 146 ? 0.2163 0.1515 0.1491 0.0029  -0.0045 0.0047  166  THR A OG1 
1049 C CG2 . THR A 146 ? 0.1822 0.1653 0.1684 -0.0043 0.0053  -0.0033 166  THR A CG2 
1050 N N   . LEU A 147 ? 0.1740 0.1384 0.1213 -0.0123 0.0011  0.0050  167  LEU A N   
1051 C CA  . LEU A 147 ? 0.1539 0.1367 0.1084 -0.0092 -0.0025 -0.0014 167  LEU A CA  
1052 C C   . LEU A 147 ? 0.1483 0.1397 0.1118 -0.0063 -0.0031 -0.0028 167  LEU A C   
1053 O O   . LEU A 147 ? 0.1560 0.1290 0.1099 -0.0101 -0.0008 -0.0101 167  LEU A O   
1054 C CB  . LEU A 147 ? 0.1472 0.1393 0.1176 -0.0082 -0.0076 0.0016  167  LEU A CB  
1055 C CG  . LEU A 147 ? 0.1361 0.1613 0.1260 -0.0035 -0.0026 0.0039  167  LEU A CG  
1056 C CD1 . LEU A 147 ? 0.1482 0.1568 0.1227 -0.0015 -0.0038 0.0011  167  LEU A CD1 
1057 C CD2 . LEU A 147 ? 0.1492 0.1684 0.1329 -0.0124 0.0007  -0.0007 167  LEU A CD2 
1058 N N   . PRO A 148 ? 0.1470 0.1433 0.1130 -0.0107 0.0000  -0.0058 168  PRO A N   
1059 C CA  . PRO A 148 ? 0.1406 0.1468 0.1238 -0.0065 -0.0022 -0.0072 168  PRO A CA  
1060 C C   . PRO A 148 ? 0.1341 0.1450 0.1213 -0.0047 0.0019  0.0011  168  PRO A C   
1061 O O   . PRO A 148 ? 0.1458 0.1587 0.1225 -0.0031 -0.0119 0.0109  168  PRO A O   
1062 C CB  . PRO A 148 ? 0.1413 0.1521 0.1226 -0.0091 -0.0027 -0.0031 168  PRO A CB  
1063 C CG  . PRO A 148 ? 0.1401 0.1551 0.1217 -0.0053 -0.0028 -0.0029 168  PRO A CG  
1064 C CD  . PRO A 148 ? 0.1424 0.1538 0.1187 -0.0103 -0.0088 -0.0047 168  PRO A CD  
1065 N N   . ALA A 149 ? 0.1377 0.1360 0.1155 -0.0023 -0.0031 -0.0024 169  ALA A N   
1066 C CA  . ALA A 149 ? 0.1370 0.1308 0.1111 -0.0047 -0.0014 0.0037  169  ALA A CA  
1067 C C   . ALA A 149 ? 0.1317 0.1295 0.1056 -0.0033 0.0036  0.0042  169  ALA A C   
1068 O O   . ALA A 149 ? 0.1432 0.1254 0.1067 -0.0050 -0.0030 0.0007  169  ALA A O   
1069 C CB  . ALA A 149 ? 0.1413 0.1225 0.1151 -0.0121 0.0034  0.0058  169  ALA A CB  
1070 N N   . HIS A 150 ? 0.1314 0.1250 0.1090 -0.0092 0.0035  0.0080  170  HIS A N   
1071 C CA  . HIS A 150 ? 0.1254 0.1264 0.1118 -0.0061 0.0036  -0.0002 170  HIS A CA  
1072 C C   . HIS A 150 ? 0.1256 0.1308 0.1168 -0.0031 0.0008  0.0049  170  HIS A C   
1073 O O   . HIS A 150 ? 0.1322 0.1337 0.1174 0.0034  -0.0043 0.0090  170  HIS A O   
1074 C CB  . HIS A 150 ? 0.1212 0.1268 0.1101 -0.0103 -0.0028 -0.0034 170  HIS A CB  
1075 C CG  . HIS A 150 ? 0.1264 0.1219 0.1024 -0.0043 0.0042  -0.0028 170  HIS A CG  
1076 N ND1 . HIS A 150 ? 0.1211 0.1321 0.0968 0.0016  -0.0029 0.0005  170  HIS A ND1 
1077 C CD2 . HIS A 150 ? 0.1284 0.1294 0.1001 -0.0066 0.0043  -0.0022 170  HIS A CD2 
1078 C CE1 . HIS A 150 ? 0.1230 0.1287 0.1031 -0.0098 0.0042  0.0018  170  HIS A CE1 
1079 N NE2 . HIS A 150 ? 0.1238 0.1321 0.0975 -0.0076 0.0093  0.0001  170  HIS A NE2 
1080 N N   . SER A 151 ? 0.1324 0.1292 0.1193 -0.0027 0.0047  -0.0004 171  SER A N   
1081 C CA  . SER A 151 ? 0.1339 0.1370 0.1298 -0.0119 0.0087  0.0002  171  SER A CA  
1082 C C   . SER A 151 ? 0.1413 0.1486 0.1221 -0.0049 0.0128  -0.0003 171  SER A C   
1083 O O   . SER A 151 ? 0.1457 0.1744 0.1357 -0.0101 -0.0007 -0.0131 171  SER A O   
1084 C CB  . SER A 151 ? 0.1479 0.1345 0.1267 -0.0079 0.0138  -0.0014 171  SER A CB  
1085 O OG  . SER A 151 ? 0.1411 0.1421 0.1334 -0.0013 0.0153  -0.0054 171  SER A OG  
1086 N N   . ASP A 152 ? 0.1389 0.1448 0.1224 -0.0109 0.0106  -0.0008 172  ASP A N   
1087 C CA  . ASP A 152 ? 0.1338 0.1379 0.1242 -0.0147 0.0084  0.0030  172  ASP A CA  
1088 C C   . ASP A 152 ? 0.1266 0.1325 0.1113 -0.0075 0.0028  0.0029  172  ASP A C   
1089 O O   . ASP A 152 ? 0.1255 0.1318 0.1081 -0.0060 0.0069  -0.0030 172  ASP A O   
1090 C CB  . ASP A 152 ? 0.1518 0.1413 0.1371 -0.0083 0.0018  -0.0038 172  ASP A CB  
1091 C CG  . ASP A 152 ? 0.1620 0.1576 0.1681 -0.0159 0.0122  -0.0028 172  ASP A CG  
1092 O OD1 . ASP A 152 ? 0.1597 0.1809 0.1888 -0.0211 0.0007  -0.0099 172  ASP A OD1 
1093 O OD2 . ASP A 152 ? 0.2032 0.1639 0.1818 -0.0189 0.0193  0.0068  172  ASP A OD2 
1094 N N   . PRO A 153 ? 0.1205 0.1294 0.1111 -0.0076 0.0033  0.0054  173  PRO A N   
1095 C CA  . PRO A 153 ? 0.1104 0.1181 0.1115 -0.0067 -0.0006 0.0022  173  PRO A CA  
1096 C C   . PRO A 153 ? 0.1102 0.1068 0.1013 -0.0060 0.0031  0.0004  173  PRO A C   
1097 O O   . PRO A 153 ? 0.0878 0.1120 0.0960 -0.0067 -0.0044 0.0092  173  PRO A O   
1098 C CB  . PRO A 153 ? 0.1140 0.1295 0.1103 -0.0059 -0.0028 0.0050  173  PRO A CB  
1099 C CG  . PRO A 153 ? 0.1163 0.1328 0.1195 -0.0098 0.0011  0.0035  173  PRO A CG  
1100 C CD  . PRO A 153 ? 0.1245 0.1274 0.1217 -0.0093 -0.0016 0.0054  173  PRO A CD  
1101 N N   . VAL A 154 ? 0.1044 0.1013 0.0914 -0.0017 -0.0018 -0.0002 174  VAL A N   
1102 C CA  . VAL A 154 ? 0.1036 0.1009 0.0953 -0.0065 0.0020  -0.0009 174  VAL A CA  
1103 C C   . VAL A 154 ? 0.1082 0.0964 0.0929 -0.0036 0.0003  0.0002  174  VAL A C   
1104 O O   . VAL A 154 ? 0.1295 0.1025 0.0957 -0.0034 0.0049  0.0045  174  VAL A O   
1105 C CB  . VAL A 154 ? 0.1040 0.0988 0.0942 -0.0057 0.0021  -0.0001 174  VAL A CB  
1106 C CG1 . VAL A 154 ? 0.1026 0.0992 0.0943 -0.0095 0.0012  -0.0029 174  VAL A CG1 
1107 C CG2 . VAL A 154 ? 0.1037 0.1094 0.0984 -0.0125 0.0073  -0.0034 174  VAL A CG2 
1108 N N   . SER A 155 ? 0.1061 0.0948 0.0878 -0.0062 -0.0029 0.0004  175  SER A N   
1109 C CA  . SER A 155 ? 0.1057 0.0929 0.0911 -0.0021 0.0017  0.0001  175  SER A CA  
1110 C C   . SER A 155 ? 0.1055 0.0889 0.0909 -0.0027 -0.0001 0.0023  175  SER A C   
1111 O O   . SER A 155 ? 0.1230 0.1044 0.0925 -0.0025 0.0005  0.0077  175  SER A O   
1112 C CB  . SER A 155 ? 0.1069 0.0925 0.0892 -0.0034 -0.0032 0.0018  175  SER A CB  
1113 O OG  . SER A 155 ? 0.1237 0.0930 0.0818 -0.0087 -0.0102 0.0006  175  SER A OG  
1114 N N   . ALA A 156 ? 0.1047 0.0956 0.0917 -0.0022 -0.0002 0.0029  176  ALA A N   
1115 C CA  . ALA A 156 ? 0.1060 0.0976 0.0852 -0.0027 -0.0010 0.0036  176  ALA A CA  
1116 C C   . ALA A 156 ? 0.1119 0.0992 0.0846 -0.0083 0.0003  0.0028  176  ALA A C   
1117 O O   . ALA A 156 ? 0.1238 0.0915 0.0872 -0.0066 -0.0030 0.0118  176  ALA A O   
1118 C CB  . ALA A 156 ? 0.1039 0.0974 0.0801 0.0017  0.0029  0.0041  176  ALA A CB  
1119 N N   . VAL A 157 ? 0.1069 0.0992 0.0852 -0.0064 -0.0029 0.0035  177  VAL A N   
1120 C CA  . VAL A 157 ? 0.1021 0.0963 0.0891 -0.0038 -0.0013 0.0012  177  VAL A CA  
1121 C C   . VAL A 157 ? 0.0990 0.1038 0.0919 -0.0038 -0.0028 0.0007  177  VAL A C   
1122 O O   . VAL A 157 ? 0.1148 0.1193 0.1001 -0.0102 0.0026  0.0155  177  VAL A O   
1123 C CB  . VAL A 157 ? 0.1031 0.0990 0.0920 -0.0008 0.0000  -0.0014 177  VAL A CB  
1124 C CG1 . VAL A 157 ? 0.1023 0.1077 0.1021 -0.0093 0.0003  0.0019  177  VAL A CG1 
1125 C CG2 . VAL A 157 ? 0.1048 0.1011 0.0903 -0.0038 -0.0020 -0.0021 177  VAL A CG2 
1126 N N   . HIS A 158 ? 0.1007 0.1058 0.0901 -0.0048 -0.0032 0.0033  178  HIS A N   
1127 C CA  . HIS A 158 ? 0.1044 0.1103 0.0920 -0.0043 0.0010  0.0061  178  HIS A CA  
1128 C C   . HIS A 158 ? 0.1100 0.1212 0.1032 -0.0073 -0.0058 0.0028  178  HIS A C   
1129 O O   . HIS A 158 ? 0.1173 0.1277 0.1082 -0.0128 0.0029  0.0060  178  HIS A O   
1130 C CB  . HIS A 158 ? 0.1129 0.1121 0.0964 -0.0019 -0.0006 0.0048  178  HIS A CB  
1131 C CG  . HIS A 158 ? 0.1161 0.1295 0.1066 -0.0053 0.0046  0.0077  178  HIS A CG  
1132 N ND1 . HIS A 158 ? 0.1214 0.1315 0.1214 -0.0023 0.0059  0.0151  178  HIS A ND1 
1133 C CD2 . HIS A 158 ? 0.1207 0.1378 0.1127 -0.0053 0.0131  0.0110  178  HIS A CD2 
1134 C CE1 . HIS A 158 ? 0.1202 0.1431 0.1232 0.0000  0.0078  0.0113  178  HIS A CE1 
1135 N NE2 . HIS A 158 ? 0.1160 0.1502 0.1201 -0.0063 0.0031  0.0108  178  HIS A NE2 
1136 N N   . PHE A 159 ? 0.1180 0.1186 0.1023 -0.0086 -0.0050 0.0083  179  PHE A N   
1137 C CA  . PHE A 159 ? 0.1279 0.1213 0.1042 -0.0114 -0.0092 0.0045  179  PHE A CA  
1138 C C   . PHE A 159 ? 0.1311 0.1259 0.1179 -0.0084 -0.0045 0.0051  179  PHE A C   
1139 O O   . PHE A 159 ? 0.1494 0.1264 0.1127 -0.0078 -0.0148 0.0051  179  PHE A O   
1140 C CB  . PHE A 159 ? 0.1237 0.1161 0.1103 -0.0064 -0.0064 -0.0013 179  PHE A CB  
1141 C CG  . PHE A 159 ? 0.1207 0.1173 0.1093 -0.0077 -0.0079 -0.0033 179  PHE A CG  
1142 C CD1 . PHE A 159 ? 0.1187 0.1155 0.1086 -0.0017 -0.0064 -0.0031 179  PHE A CD1 
1143 C CD2 . PHE A 159 ? 0.1217 0.1181 0.1127 -0.0019 -0.0078 -0.0028 179  PHE A CD2 
1144 C CE1 . PHE A 159 ? 0.1175 0.1182 0.1027 -0.0016 -0.0064 -0.0037 179  PHE A CE1 
1145 C CE2 . PHE A 159 ? 0.1238 0.1223 0.1091 -0.0012 -0.0078 0.0003  179  PHE A CE2 
1146 C CZ  . PHE A 159 ? 0.1199 0.1224 0.1113 0.0022  -0.0125 -0.0056 179  PHE A CZ  
1147 N N   . ASN A 160 ? 0.1404 0.1322 0.1148 -0.0053 -0.0053 0.0055  180  ASN A N   
1148 C CA  . ASN A 160 ? 0.1434 0.1479 0.1344 0.0016  -0.0060 0.0148  180  ASN A CA  
1149 C C   . ASN A 160 ? 0.1500 0.1593 0.1457 -0.0072 -0.0064 0.0163  180  ASN A C   
1150 O O   . ASN A 160 ? 0.1465 0.1612 0.1416 -0.0087 -0.0114 0.0213  180  ASN A O   
1151 C CB  . ASN A 160 ? 0.1364 0.1531 0.1359 0.0033  -0.0103 0.0147  180  ASN A CB  
1152 C CG  . ASN A 160 ? 0.1244 0.1502 0.1335 0.0048  -0.0147 0.0183  180  ASN A CG  
1153 O OD1 . ASN A 160 ? 0.1128 0.1482 0.1499 -0.0015 -0.0050 0.0064  180  ASN A OD1 
1154 N ND2 . ASN A 160 ? 0.1385 0.1686 0.1482 0.0000  -0.0301 0.0164  180  ASN A ND2 
1155 N N   . ARG A 161 ? 0.1660 0.1812 0.1712 0.0108  -0.0042 0.0155  181  ARG A N   
1156 C CA  . ARG A 161 ? 0.1881 0.2031 0.1907 -0.0063 0.0063  0.0174  181  ARG A CA  
1157 C C   . ARG A 161 ? 0.1652 0.2053 0.1901 -0.0013 -0.0053 0.0154  181  ARG A C   
1158 O O   . ARG A 161 ? 0.1639 0.2230 0.2051 -0.0059 -0.0065 0.0270  181  ARG A O   
1159 C CB  . ARG A 161 ? 0.1959 0.2324 0.2353 0.0091  0.0198  0.0097  181  ARG A CB  
1160 C CG  . ARG A 161 ? 0.2354 0.2547 0.2344 0.0046  0.0147  0.0177  181  ARG A CG  
1161 C CD  . ARG A 161 ? 0.2719 0.2715 0.2872 0.0284  0.0173  0.0078  181  ARG A CD  
1162 N NE  . ARG A 161 ? 0.3099 0.3101 0.2998 0.0174  0.0371  -0.0044 181  ARG A NE  
1163 C CZ  . ARG A 161 ? 0.2996 0.3252 0.3222 0.0256  0.0158  -0.0010 181  ARG A CZ  
1164 N NH1 . ARG A 161 ? 0.3432 0.3390 0.3285 0.0249  0.0271  0.0072  181  ARG A NH1 
1165 N NH2 . ARG A 161 ? 0.3434 0.3681 0.3202 0.0291  0.0279  0.0057  181  ARG A NH2 
1166 N N   . ASP A 162 ? 0.1573 0.2000 0.1916 -0.0168 0.0027  0.0132  182  ASP A N   
1167 C CA  . ASP A 162 ? 0.1753 0.2096 0.1727 -0.0156 -0.0063 0.0097  182  ASP A CA  
1168 C C   . ASP A 162 ? 0.1614 0.1902 0.1529 -0.0276 -0.0163 0.0098  182  ASP A C   
1169 O O   . ASP A 162 ? 0.1541 0.1892 0.1462 -0.0308 -0.0152 0.0125  182  ASP A O   
1170 C CB  . ASP A 162 ? 0.1779 0.2492 0.1884 -0.0128 -0.0188 0.0102  182  ASP A CB  
1171 C CG  . ASP A 162 ? 0.2089 0.2753 0.1862 -0.0207 -0.0240 0.0188  182  ASP A CG  
1172 O OD1 . ASP A 162 ? 0.1988 0.2847 0.2017 -0.0171 -0.0256 0.0221  182  ASP A OD1 
1173 O OD2 . ASP A 162 ? 0.2135 0.3177 0.2050 -0.0095 -0.0452 0.0200  182  ASP A OD2 
1174 N N   . GLY A 163 ? 0.1536 0.1891 0.1339 -0.0211 -0.0130 0.0140  183  GLY A N   
1175 C CA  . GLY A 163 ? 0.1660 0.1720 0.1401 -0.0192 -0.0144 0.0024  183  GLY A CA  
1176 C C   . GLY A 163 ? 0.1554 0.1591 0.1452 -0.0205 -0.0092 0.0015  183  GLY A C   
1177 O O   . GLY A 163 ? 0.1701 0.1553 0.1461 -0.0160 -0.0013 0.0002  183  GLY A O   
1178 N N   . SER A 164 ? 0.1634 0.1520 0.1463 -0.0174 -0.0039 0.0040  184  SER A N   
1179 C CA  . SER A 164 ? 0.1460 0.1517 0.1444 -0.0188 -0.0085 0.0018  184  SER A CA  
1180 C C   . SER A 164 ? 0.1417 0.1454 0.1327 -0.0138 -0.0074 0.0006  184  SER A C   
1181 O O   . SER A 164 ? 0.1361 0.1611 0.1374 -0.0178 -0.0065 -0.0038 184  SER A O   
1182 C CB  . SER A 164 ? 0.1511 0.1718 0.1397 -0.0175 -0.0124 0.0025  184  SER A CB  
1183 O OG  . SER A 164 ? 0.1667 0.1619 0.1771 -0.0130 -0.0354 0.0170  184  SER A OG  
1184 N N   . LEU A 165 ? 0.1327 0.1475 0.1182 -0.0167 -0.0047 0.0066  185  LEU A N   
1185 C CA  . LEU A 165 ? 0.1257 0.1314 0.1113 -0.0078 -0.0082 0.0029  185  LEU A CA  
1186 C C   . LEU A 165 ? 0.1222 0.1294 0.1067 -0.0170 -0.0040 0.0034  185  LEU A C   
1187 O O   . LEU A 165 ? 0.1481 0.1337 0.1106 -0.0289 0.0000  0.0091  185  LEU A O   
1188 C CB  . LEU A 165 ? 0.1217 0.1305 0.1133 -0.0089 -0.0119 0.0021  185  LEU A CB  
1189 C CG  . LEU A 165 ? 0.1158 0.1415 0.1218 -0.0085 -0.0184 -0.0027 185  LEU A CG  
1190 C CD1 . LEU A 165 ? 0.1282 0.1401 0.1212 -0.0103 -0.0255 0.0017  185  LEU A CD1 
1191 C CD2 . LEU A 165 ? 0.1155 0.1542 0.1180 -0.0106 -0.0196 -0.0017 185  LEU A CD2 
1192 N N   . ILE A 166 ? 0.1200 0.1185 0.0913 -0.0151 -0.0074 0.0060  186  ILE A N   
1193 C CA  . ILE A 166 ? 0.1128 0.1130 0.0989 -0.0113 -0.0075 0.0057  186  ILE A CA  
1194 C C   . ILE A 166 ? 0.1227 0.1116 0.0955 -0.0130 -0.0096 0.0056  186  ILE A C   
1195 O O   . ILE A 166 ? 0.1397 0.1226 0.1039 -0.0149 -0.0049 0.0159  186  ILE A O   
1196 C CB  . ILE A 166 ? 0.1138 0.1100 0.1023 -0.0108 -0.0107 0.0042  186  ILE A CB  
1197 C CG1 . ILE A 166 ? 0.1231 0.1104 0.0981 -0.0117 -0.0143 0.0055  186  ILE A CG1 
1198 C CG2 . ILE A 166 ? 0.1129 0.1097 0.1037 -0.0147 -0.0095 0.0152  186  ILE A CG2 
1199 C CD1 . ILE A 166 ? 0.1124 0.1221 0.1057 -0.0022 -0.0203 0.0024  186  ILE A CD1 
1200 N N   . VAL A 167 ? 0.1174 0.1115 0.0891 -0.0111 -0.0056 0.0090  187  VAL A N   
1201 C CA  . VAL A 167 ? 0.1082 0.1091 0.0832 -0.0066 -0.0073 0.0065  187  VAL A CA  
1202 C C   . VAL A 167 ? 0.1025 0.1096 0.0924 -0.0100 -0.0053 0.0058  187  VAL A C   
1203 O O   . VAL A 167 ? 0.1149 0.1186 0.0984 -0.0136 0.0007  0.0144  187  VAL A O   
1204 C CB  . VAL A 167 ? 0.1054 0.1069 0.0959 -0.0023 -0.0126 0.0087  187  VAL A CB  
1205 C CG1 . VAL A 167 ? 0.1118 0.1100 0.0993 -0.0084 -0.0070 0.0122  187  VAL A CG1 
1206 C CG2 . VAL A 167 ? 0.1123 0.1064 0.0969 -0.0014 -0.0097 0.0101  187  VAL A CG2 
1207 N N   . SER A 168 ? 0.1018 0.1071 0.0899 -0.0089 -0.0048 0.0044  188  SER A N   
1208 C CA  . SER A 168 ? 0.1050 0.1004 0.0869 -0.0090 -0.0066 0.0065  188  SER A CA  
1209 C C   . SER A 168 ? 0.1074 0.1012 0.0898 -0.0109 -0.0049 0.0035  188  SER A C   
1210 O O   . SER A 168 ? 0.1237 0.0976 0.0954 -0.0083 -0.0056 0.0014  188  SER A O   
1211 C CB  . SER A 168 ? 0.1090 0.1037 0.0914 -0.0087 0.0009  0.0084  188  SER A CB  
1212 O OG  . SER A 168 ? 0.1243 0.1062 0.0849 -0.0076 -0.0035 0.0029  188  SER A OG  
1213 N N   . SER A 169 ? 0.1098 0.0992 0.0907 -0.0133 -0.0054 0.0083  189  SER A N   
1214 C CA  . SER A 169 ? 0.1070 0.0947 0.0907 -0.0094 -0.0035 0.0045  189  SER A CA  
1215 C C   . SER A 169 ? 0.1059 0.0986 0.0886 -0.0062 0.0026  0.0017  189  SER A C   
1216 O O   . SER A 169 ? 0.1084 0.1026 0.0889 -0.0088 0.0010  0.0073  189  SER A O   
1217 C CB  . SER A 169 ? 0.1028 0.0967 0.0877 -0.0088 -0.0055 0.0049  189  SER A CB  
1218 O OG  . SER A 169 ? 0.1120 0.0967 0.0886 -0.0074 -0.0097 0.0050  189  SER A OG  
1219 N N   . SER A 170 ? 0.1071 0.0982 0.0970 -0.0091 -0.0012 -0.0018 190  SER A N   
1220 C CA  . SER A 170 ? 0.1085 0.1056 0.0915 -0.0042 -0.0015 -0.0011 190  SER A CA  
1221 C C   . SER A 170 ? 0.1086 0.1081 0.0986 -0.0049 -0.0009 -0.0027 190  SER A C   
1222 O O   . SER A 170 ? 0.1015 0.1067 0.0787 -0.0076 -0.0031 -0.0061 190  SER A O   
1223 C CB  . SER A 170 ? 0.1128 0.1108 0.0989 -0.0042 0.0027  -0.0052 190  SER A CB  
1224 O OG  . SER A 170 ? 0.1101 0.1252 0.1061 -0.0055 -0.0102 -0.0072 190  SER A OG  
1225 N N   . TYR A 171 ? 0.1148 0.1221 0.0911 -0.0066 -0.0081 -0.0018 191  TYR A N   
1226 C CA  . TYR A 171 ? 0.1211 0.1210 0.1052 -0.0092 0.0003  -0.0006 191  TYR A CA  
1227 C C   . TYR A 171 ? 0.1309 0.1197 0.1042 -0.0139 -0.0015 -0.0009 191  TYR A C   
1228 O O   . TYR A 171 ? 0.1228 0.1308 0.1199 -0.0225 -0.0050 -0.0104 191  TYR A O   
1229 C CB  . TYR A 171 ? 0.1300 0.1382 0.1118 -0.0087 -0.0092 0.0015  191  TYR A CB  
1230 C CG  . TYR A 171 ? 0.1385 0.1417 0.1210 -0.0113 0.0015  0.0079  191  TYR A CG  
1231 C CD1 . TYR A 171 ? 0.1425 0.1658 0.1251 -0.0022 0.0032  0.0095  191  TYR A CD1 
1232 C CD2 . TYR A 171 ? 0.1383 0.1528 0.1223 -0.0047 0.0059  0.0138  191  TYR A CD2 
1233 C CE1 . TYR A 171 ? 0.1552 0.1845 0.1412 -0.0071 0.0099  0.0288  191  TYR A CE1 
1234 C CE2 . TYR A 171 ? 0.1575 0.1640 0.1265 -0.0074 -0.0018 0.0226  191  TYR A CE2 
1235 C CZ  . TYR A 171 ? 0.1532 0.1882 0.1413 -0.0056 0.0021  0.0267  191  TYR A CZ  
1236 O OH  . TYR A 171 ? 0.1852 0.2318 0.1517 -0.0134 0.0134  0.0403  191  TYR A OH  
1237 N N   . ASP A 172 ? 0.1247 0.1094 0.1041 -0.0113 0.0022  -0.0008 192  ASP A N   
1238 C CA  . ASP A 172 ? 0.1299 0.1149 0.1071 -0.0068 0.0063  0.0028  192  ASP A CA  
1239 C C   . ASP A 172 ? 0.1281 0.1184 0.1111 -0.0048 0.0073  0.0032  192  ASP A C   
1240 O O   . ASP A 172 ? 0.1480 0.1208 0.1151 -0.0085 0.0087  0.0070  192  ASP A O   
1241 C CB  . ASP A 172 ? 0.1320 0.1157 0.1155 -0.0087 0.0041  -0.0012 192  ASP A CB  
1242 C CG  . ASP A 172 ? 0.1321 0.1207 0.1222 -0.0100 0.0081  -0.0032 192  ASP A CG  
1243 O OD1 . ASP A 172 ? 0.1202 0.1245 0.1277 -0.0121 0.0061  0.0002  192  ASP A OD1 
1244 O OD2 . ASP A 172 ? 0.1384 0.1142 0.1266 -0.0217 0.0075  0.0011  192  ASP A OD2 
1245 N N   . GLY A 173 ? 0.1232 0.1173 0.1053 -0.0001 0.0011  0.0049  193  GLY A N   
1246 C CA  . GLY A 173 ? 0.1228 0.1122 0.1093 -0.0019 0.0025  -0.0003 193  GLY A CA  
1247 C C   . GLY A 173 ? 0.1221 0.1101 0.1046 0.0006  0.0027  -0.0001 193  GLY A C   
1248 O O   . GLY A 173 ? 0.1255 0.1099 0.1049 -0.0019 -0.0006 0.0082  193  GLY A O   
1249 N N   . LEU A 174 ? 0.1188 0.1129 0.1040 -0.0042 0.0013  -0.0018 194  LEU A N   
1250 C CA  . LEU A 174 ? 0.1191 0.1225 0.1073 -0.0050 0.0013  -0.0027 194  LEU A CA  
1251 C C   . LEU A 174 ? 0.1308 0.1235 0.1052 -0.0048 0.0044  0.0005  194  LEU A C   
1252 O O   . LEU A 174 ? 0.1361 0.1348 0.0976 -0.0026 0.0014  0.0004  194  LEU A O   
1253 C CB  . LEU A 174 ? 0.1325 0.1256 0.1105 -0.0028 0.0025  -0.0047 194  LEU A CB  
1254 C CG  . LEU A 174 ? 0.1317 0.1304 0.1255 -0.0084 0.0060  -0.0013 194  LEU A CG  
1255 C CD1 . LEU A 174 ? 0.1624 0.1204 0.1330 -0.0057 0.0022  -0.0012 194  LEU A CD1 
1256 C CD2 . LEU A 174 ? 0.1537 0.1297 0.1356 -0.0096 -0.0015 0.0013  194  LEU A CD2 
1257 N N   . CYS A 175 ? 0.1321 0.1307 0.1128 -0.0046 0.0016  -0.0056 195  CYS A N   
1258 C CA  . CYS A 175 ? 0.1348 0.1309 0.1083 -0.0041 -0.0011 -0.0005 195  CYS A CA  
1259 C C   . CYS A 175 ? 0.1415 0.1141 0.1085 -0.0028 -0.0048 0.0040  195  CYS A C   
1260 O O   . CYS A 175 ? 0.1444 0.1185 0.1067 0.0069  -0.0084 0.0035  195  CYS A O   
1261 C CB  . CYS A 175 ? 0.1410 0.1439 0.1149 0.0014  0.0045  -0.0060 195  CYS A CB  
1262 S SG  . CYS A 175 ? 0.1885 0.1878 0.1214 -0.0018 0.0137  -0.0273 195  CYS A SG  
1263 N N   . ARG A 176 ? 0.1337 0.1152 0.0970 -0.0061 -0.0092 0.0081  196  ARG A N   
1264 C CA  . ARG A 176 ? 0.1216 0.1133 0.1016 -0.0068 -0.0083 0.0069  196  ARG A CA  
1265 C C   . ARG A 176 ? 0.1252 0.1177 0.1101 -0.0095 -0.0054 0.0086  196  ARG A C   
1266 O O   . ARG A 176 ? 0.1307 0.1278 0.1049 -0.0179 -0.0090 0.0070  196  ARG A O   
1267 C CB  . ARG A 176 ? 0.1210 0.1107 0.0925 -0.0097 -0.0080 0.0049  196  ARG A CB  
1268 C CG  . ARG A 176 ? 0.1255 0.1146 0.0961 -0.0121 -0.0093 0.0060  196  ARG A CG  
1269 C CD  . ARG A 176 ? 0.1234 0.1208 0.1042 -0.0113 -0.0055 0.0112  196  ARG A CD  
1270 N NE  . ARG A 176 ? 0.1189 0.1246 0.0903 -0.0130 -0.0097 0.0048  196  ARG A NE  
1271 C CZ  . ARG A 176 ? 0.1222 0.1334 0.1109 -0.0086 -0.0037 0.0001  196  ARG A CZ  
1272 N NH1 . ARG A 176 ? 0.1215 0.1373 0.1234 0.0003  0.0032  0.0025  196  ARG A NH1 
1273 N NH2 . ARG A 176 ? 0.1311 0.1478 0.1201 -0.0159 -0.0048 0.0101  196  ARG A NH2 
1274 N N   . ILE A 177 ? 0.1228 0.1250 0.1073 -0.0055 -0.0027 0.0044  197  ILE A N   
1275 C CA  . ILE A 177 ? 0.1297 0.1300 0.1178 -0.0119 -0.0037 0.0002  197  ILE A CA  
1276 C C   . ILE A 177 ? 0.1334 0.1284 0.1171 -0.0099 -0.0027 0.0019  197  ILE A C   
1277 O O   . ILE A 177 ? 0.1427 0.1381 0.1176 -0.0095 -0.0014 0.0029  197  ILE A O   
1278 C CB  . ILE A 177 ? 0.1293 0.1418 0.1295 -0.0081 -0.0008 0.0042  197  ILE A CB  
1279 C CG1 . ILE A 177 ? 0.1463 0.1480 0.1371 -0.0063 0.0017  -0.0009 197  ILE A CG1 
1280 C CG2 . ILE A 177 ? 0.1264 0.1537 0.1444 -0.0104 -0.0008 0.0034  197  ILE A CG2 
1281 C CD1 . ILE A 177 ? 0.1445 0.1684 0.1331 -0.0003 -0.0062 -0.0029 197  ILE A CD1 
1282 N N   . TRP A 178 ? 0.1354 0.1270 0.1104 -0.0094 -0.0058 0.0008  198  TRP A N   
1283 C CA  . TRP A 178 ? 0.1315 0.1339 0.1092 -0.0058 -0.0014 -0.0020 198  TRP A CA  
1284 C C   . TRP A 178 ? 0.1331 0.1448 0.1187 -0.0103 -0.0037 -0.0008 198  TRP A C   
1285 O O   . TRP A 178 ? 0.1460 0.1676 0.1139 -0.0090 -0.0025 0.0004  198  TRP A O   
1286 C CB  . TRP A 178 ? 0.1265 0.1350 0.1135 -0.0046 -0.0030 -0.0071 198  TRP A CB  
1287 C CG  . TRP A 178 ? 0.1245 0.1303 0.1168 -0.0048 0.0009  -0.0030 198  TRP A CG  
1288 C CD1 . TRP A 178 ? 0.1264 0.1337 0.1156 -0.0050 -0.0018 -0.0009 198  TRP A CD1 
1289 C CD2 . TRP A 178 ? 0.1225 0.1283 0.1205 -0.0095 0.0010  0.0006  198  TRP A CD2 
1290 N NE1 . TRP A 178 ? 0.1258 0.1344 0.1235 -0.0051 -0.0017 -0.0025 198  TRP A NE1 
1291 C CE2 . TRP A 178 ? 0.1230 0.1329 0.1205 -0.0054 -0.0042 -0.0013 198  TRP A CE2 
1292 C CE3 . TRP A 178 ? 0.1232 0.1326 0.1176 -0.0086 -0.0029 0.0014  198  TRP A CE3 
1293 C CZ2 . TRP A 178 ? 0.1262 0.1385 0.1341 -0.0048 0.0031  -0.0042 198  TRP A CZ2 
1294 C CZ3 . TRP A 178 ? 0.1249 0.1478 0.1248 -0.0082 0.0016  -0.0020 198  TRP A CZ3 
1295 C CH2 . TRP A 178 ? 0.1372 0.1490 0.1265 -0.0075 -0.0063 -0.0036 198  TRP A CH2 
1296 N N   . ASP A 179 ? 0.1431 0.1459 0.1131 -0.0123 -0.0055 0.0053  199  ASP A N   
1297 C CA  . ASP A 179 ? 0.1427 0.1534 0.1279 -0.0107 -0.0168 -0.0020 199  ASP A CA  
1298 C C   . ASP A 179 ? 0.1367 0.1490 0.1187 -0.0133 -0.0123 -0.0045 199  ASP A C   
1299 O O   . ASP A 179 ? 0.1328 0.1549 0.1327 -0.0091 -0.0231 -0.0041 199  ASP A O   
1300 C CB  . ASP A 179 ? 0.1570 0.1638 0.1257 -0.0048 -0.0199 0.0041  199  ASP A CB  
1301 C CG  . ASP A 179 ? 0.1543 0.1861 0.1439 -0.0101 -0.0250 0.0035  199  ASP A CG  
1302 O OD1 . ASP A 179 ? 0.1532 0.1934 0.1562 -0.0069 -0.0276 0.0075  199  ASP A OD1 
1303 O OD2 . ASP A 179 ? 0.1935 0.1801 0.1774 -0.0061 -0.0248 0.0088  199  ASP A OD2 
1304 N N   . THR A 180 ? 0.1365 0.1448 0.1217 -0.0158 -0.0131 -0.0064 200  THR A N   
1305 C CA  . THR A 180 ? 0.1536 0.1434 0.1288 -0.0160 -0.0028 -0.0027 200  THR A CA  
1306 C C   . THR A 180 ? 0.1543 0.1436 0.1250 -0.0185 -0.0030 -0.0018 200  THR A C   
1307 O O   . THR A 180 ? 0.1630 0.1501 0.1232 -0.0125 0.0002  -0.0058 200  THR A O   
1308 C CB  . THR A 180 ? 0.1582 0.1404 0.1343 -0.0219 0.0007  -0.0003 200  THR A CB  
1309 O OG1 . THR A 180 ? 0.1640 0.1355 0.1201 -0.0223 0.0025  0.0078  200  THR A OG1 
1310 C CG2 . THR A 180 ? 0.1566 0.1374 0.1294 -0.0273 -0.0036 -0.0025 200  THR A CG2 
1311 N N   . ALA A 181 ? 0.1484 0.1464 0.1321 -0.0208 -0.0023 0.0024  201  ALA A N   
1312 C CA  . ALA A 181 ? 0.1579 0.1433 0.1470 -0.0164 -0.0051 -0.0009 201  ALA A CA  
1313 C C   . ALA A 181 ? 0.1610 0.1565 0.1460 -0.0130 -0.0052 -0.0038 201  ALA A C   
1314 O O   . ALA A 181 ? 0.1978 0.1525 0.1599 -0.0108 -0.0105 -0.0111 201  ALA A O   
1315 C CB  . ALA A 181 ? 0.1557 0.1382 0.1426 -0.0159 -0.0029 -0.0032 201  ALA A CB  
1316 N N   . SER A 182 ? 0.1662 0.1617 0.1421 -0.0149 -0.0117 -0.0008 202  SER A N   
1317 C CA  . SER A 182 ? 0.1699 0.1631 0.1541 -0.0064 -0.0035 -0.0058 202  SER A CA  
1318 C C   . SER A 182 ? 0.1698 0.1679 0.1619 -0.0078 -0.0021 -0.0041 202  SER A C   
1319 O O   . SER A 182 ? 0.1848 0.1818 0.1718 -0.0001 0.0050  -0.0191 202  SER A O   
1320 C CB  . SER A 182 ? 0.1757 0.1735 0.1448 -0.0094 -0.0118 -0.0088 202  SER A CB  
1321 O OG  . SER A 182 ? 0.1771 0.1734 0.1467 -0.0104 -0.0085 -0.0084 202  SER A OG  
1322 N N   . GLY A 183 ? 0.1664 0.1710 0.1577 -0.0137 -0.0093 -0.0050 203  GLY A N   
1323 C CA  . GLY A 183 ? 0.1606 0.1658 0.1597 -0.0100 0.0015  0.0004  203  GLY A CA  
1324 C C   . GLY A 183 ? 0.1621 0.1614 0.1517 -0.0106 0.0026  -0.0018 203  GLY A C   
1325 O O   . GLY A 183 ? 0.1687 0.1811 0.1747 -0.0196 0.0010  -0.0046 203  GLY A O   
1326 N N   . GLN A 184 ? 0.1671 0.1545 0.1570 -0.0136 0.0005  0.0033  204  GLN A N   
1327 C CA  . GLN A 184 ? 0.1721 0.1580 0.1540 -0.0185 0.0031  0.0018  204  GLN A CA  
1328 C C   . GLN A 184 ? 0.1574 0.1588 0.1418 -0.0151 0.0028  0.0044  204  GLN A C   
1329 O O   . GLN A 184 ? 0.1707 0.1494 0.1084 -0.0204 -0.0027 0.0085  204  GLN A O   
1330 C CB  . GLN A 184 ? 0.1780 0.1881 0.1722 -0.0132 -0.0111 -0.0048 204  GLN A CB  
1331 C CG  . GLN A 184 ? 0.2098 0.2087 0.1975 -0.0269 -0.0025 0.0125  204  GLN A CG  
1332 C CD  . GLN A 184 ? 0.2339 0.2509 0.2248 -0.0265 -0.0244 0.0190  204  GLN A CD  
1333 O OE1 . GLN A 184 ? 0.2463 0.2755 0.2581 -0.0447 -0.0077 0.0269  204  GLN A OE1 
1334 N NE2 . GLN A 184 ? 0.2629 0.2602 0.2485 -0.0424 -0.0152 0.0309  204  GLN A NE2 
1335 N N   . CYS A 185 ? 0.1569 0.1458 0.1234 -0.0104 -0.0003 0.0010  205  CYS A N   
1336 C CA  . CYS A 185 ? 0.1511 0.1409 0.1306 -0.0125 0.0008  0.0062  205  CYS A CA  
1337 C C   . CYS A 185 ? 0.1563 0.1491 0.1296 -0.0047 0.0047  0.0103  205  CYS A C   
1338 O O   . CYS A 185 ? 0.1685 0.1735 0.1272 0.0034  -0.0061 0.0137  205  CYS A O   
1339 C CB  . CYS A 185 ? 0.1521 0.1391 0.1348 -0.0133 -0.0025 0.0128  205  CYS A CB  
1340 S SG  . CYS A 185 ? 0.1813 0.1289 0.1189 -0.0239 -0.0141 0.0283  205  CYS A SG  
1341 N N   . LEU A 186 ? 0.1530 0.1530 0.1233 -0.0038 -0.0001 0.0097  206  LEU A N   
1342 C CA  . LEU A 186 ? 0.1562 0.1496 0.1227 -0.0011 -0.0048 0.0022  206  LEU A CA  
1343 C C   . LEU A 186 ? 0.1535 0.1489 0.1297 -0.0060 -0.0024 0.0097  206  LEU A C   
1344 O O   . LEU A 186 ? 0.1790 0.1622 0.1646 0.0056  -0.0106 0.0147  206  LEU A O   
1345 C CB  . LEU A 186 ? 0.1537 0.1540 0.1255 -0.0059 -0.0106 0.0047  206  LEU A CB  
1346 C CG  . LEU A 186 ? 0.1705 0.1507 0.1504 -0.0047 -0.0123 0.0146  206  LEU A CG  
1347 C CD1 . LEU A 186 ? 0.1708 0.1708 0.1599 -0.0101 -0.0101 0.0146  206  LEU A CD1 
1348 C CD2 . LEU A 186 ? 0.1783 0.1723 0.1547 -0.0038 -0.0054 -0.0002 206  LEU A CD2 
1349 N N   . LYS A 187 ? 0.1552 0.1340 0.1251 -0.0047 0.0041  0.0083  207  LYS A N   
1350 C CA  . LYS A 187 ? 0.1426 0.1342 0.1150 -0.0047 0.0069  0.0077  207  LYS A CA  
1351 C C   . LYS A 187 ? 0.1494 0.1265 0.1151 -0.0031 0.0013  0.0109  207  LYS A C   
1352 O O   . LYS A 187 ? 0.1650 0.1251 0.1078 -0.0060 0.0003  0.0137  207  LYS A O   
1353 C CB  . LYS A 187 ? 0.1418 0.1574 0.1372 0.0028  0.0116  0.0075  207  LYS A CB  
1354 C CG  . LYS A 187 ? 0.1545 0.1585 0.1666 -0.0003 0.0203  0.0062  207  LYS A CG  
1355 C CD  . LYS A 187 ? 0.1950 0.1817 0.1782 0.0114  0.0092  0.0178  207  LYS A CD  
1356 C CE  . LYS A 187 ? 0.2087 0.1831 0.2104 0.0147  0.0101  0.0024  207  LYS A CE  
1357 N NZ  . LYS A 187 ? 0.2247 0.2294 0.2207 0.0344  0.0154  0.0145  207  LYS A NZ  
1358 N N   . THR A 188 ? 0.1326 0.1328 0.1020 -0.0047 0.0038  0.0082  208  THR A N   
1359 C CA  . THR A 188 ? 0.1348 0.1322 0.1058 -0.0054 0.0027  0.0096  208  THR A CA  
1360 C C   . THR A 188 ? 0.1451 0.1329 0.1246 -0.0006 0.0065  0.0105  208  THR A C   
1361 O O   . THR A 188 ? 0.1636 0.1348 0.1101 -0.0075 0.0195  0.0119  208  THR A O   
1362 C CB  . THR A 188 ? 0.1344 0.1288 0.1009 -0.0029 0.0012  0.0088  208  THR A CB  
1363 O OG1 . THR A 188 ? 0.1362 0.1301 0.0917 -0.0048 0.0050  0.0054  208  THR A OG1 
1364 C CG2 . THR A 188 ? 0.1261 0.1349 0.1101 -0.0013 0.0031  0.0045  208  THR A CG2 
1365 N N   . LEU A 189 ? 0.1575 0.1514 0.1267 -0.0019 0.0127  0.0075  209  LEU A N   
1366 C CA  . LEU A 189 ? 0.1788 0.1564 0.1616 0.0072  0.0003  -0.0002 209  LEU A CA  
1367 C C   . LEU A 189 ? 0.1916 0.1779 0.1869 -0.0074 0.0061  -0.0040 209  LEU A C   
1368 O O   . LEU A 189 ? 0.2021 0.1539 0.2094 -0.0081 -0.0110 -0.0093 209  LEU A O   
1369 C CB  . LEU A 189 ? 0.1827 0.1863 0.1676 0.0104  0.0071  -0.0080 209  LEU A CB  
1370 C CG  . LEU A 189 ? 0.1945 0.2058 0.2057 -0.0019 -0.0041 -0.0078 209  LEU A CG  
1371 C CD1 . LEU A 189 ? 0.2249 0.2339 0.2029 0.0087  -0.0057 0.0009  209  LEU A CD1 
1372 C CD2 . LEU A 189 ? 0.1992 0.2358 0.2217 0.0029  -0.0134 -0.0048 209  LEU A CD2 
1373 N N   . ILE A 190 ? 0.2267 0.1839 0.2096 0.0105  0.0135  0.0076  210  ILE A N   
1374 C CA  . ILE A 190 ? 0.2470 0.2227 0.2487 -0.0132 0.0044  0.0033  210  ILE A CA  
1375 C C   . ILE A 190 ? 0.2696 0.2266 0.2673 0.0031  0.0021  0.0088  210  ILE A C   
1376 O O   . ILE A 190 ? 0.2788 0.2555 0.2990 0.0110  -0.0078 0.0107  210  ILE A O   
1377 C CB  . ILE A 190 ? 0.2773 0.2473 0.2606 -0.0125 0.0230  0.0091  210  ILE A CB  
1378 C CG1 . ILE A 190 ? 0.2857 0.2521 0.2778 -0.0075 0.0181  0.0170  210  ILE A CG1 
1379 C CG2 . ILE A 190 ? 0.2888 0.2521 0.2818 -0.0177 0.0166  0.0025  210  ILE A CG2 
1380 C CD1 . ILE A 190 ? 0.3274 0.2854 0.2727 -0.0294 -0.0020 0.0188  210  ILE A CD1 
1381 N N   . ASP A 191 ? 0.2976 0.2616 0.2554 0.0060  0.0036  -0.0008 211  ASP A N   
1382 C CA  . ASP A 191 ? 0.3117 0.2617 0.2908 0.0068  0.0120  -0.0026 211  ASP A CA  
1383 C C   . ASP A 191 ? 0.3210 0.2886 0.2956 -0.0040 0.0137  0.0000  211  ASP A C   
1384 O O   . ASP A 191 ? 0.3258 0.2640 0.2594 -0.0097 0.0060  -0.0042 211  ASP A O   
1385 C CB  . ASP A 191 ? 0.3311 0.3028 0.2922 0.0029  0.0004  0.0101  211  ASP A CB  
1386 C CG  . ASP A 191 ? 0.3303 0.3128 0.3051 0.0086  0.0166  0.0156  211  ASP A CG  
1387 O OD1 . ASP A 191 ? 0.3434 0.3322 0.3051 0.0042  0.0251  0.0335  211  ASP A OD1 
1388 O OD2 . ASP A 191 ? 0.3683 0.3535 0.2917 0.0028  -0.0054 -0.0006 211  ASP A OD2 
1389 N N   . ASP A 192 ? 0.3417 0.2920 0.2956 -0.0081 0.0270  -0.0113 212  ASP A N   
1390 C CA  . ASP A 192 ? 0.3370 0.2985 0.2853 -0.0107 0.0170  -0.0054 212  ASP A CA  
1391 C C   . ASP A 192 ? 0.3313 0.2852 0.3124 -0.0028 0.0180  -0.0284 212  ASP A C   
1392 O O   . ASP A 192 ? 0.3538 0.3023 0.2946 -0.0245 0.0320  -0.0567 212  ASP A O   
1393 C CB  . ASP A 192 ? 0.3355 0.3040 0.2800 0.0025  0.0306  0.0059  212  ASP A CB  
1394 C CG  . ASP A 192 ? 0.3475 0.3266 0.2900 0.0077  0.0226  0.0134  212  ASP A CG  
1395 O OD1 . ASP A 192 ? 0.3922 0.3369 0.2830 0.0105  0.0295  0.0305  212  ASP A OD1 
1396 O OD2 . ASP A 192 ? 0.3574 0.3381 0.3367 0.0214  0.0475  0.0206  212  ASP A OD2 
1397 N N   . ASN A 194 ? 0.2747 0.2776 0.1774 -0.0078 0.0091  0.0084  214  ASN A N   
1398 C CA  . ASN A 194 ? 0.2644 0.2784 0.2471 -0.0033 0.0007  0.0076  214  ASN A CA  
1399 C C   . ASN A 194 ? 0.2404 0.2206 0.2173 -0.0034 0.0309  -0.0031 214  ASN A C   
1400 O O   . ASN A 194 ? 0.2486 0.2215 0.2030 -0.0016 0.0241  0.0255  214  ASN A O   
1401 C CB  . ASN A 194 ? 0.2905 0.3117 0.2608 -0.0064 0.0112  -0.0084 214  ASN A CB  
1402 C CG  . ASN A 194 ? 0.2824 0.3254 0.2759 -0.0116 -0.0011 0.0018  214  ASN A CG  
1403 O OD1 . ASN A 194 ? 0.2795 0.3470 0.3261 -0.0410 0.0091  -0.0145 214  ASN A OD1 
1404 N ND2 . ASN A 194 ? 0.2715 0.3136 0.2881 -0.0168 0.0067  -0.0218 214  ASN A ND2 
1405 N N   . PRO A 195 ? 0.2123 0.1735 0.1779 -0.0083 -0.0039 0.0190  215  PRO A N   
1406 C CA  . PRO A 195 ? 0.1814 0.1487 0.1719 -0.0106 0.0007  0.0073  215  PRO A CA  
1407 C C   . PRO A 195 ? 0.1570 0.1494 0.1503 -0.0073 -0.0002 0.0089  215  PRO A C   
1408 O O   . PRO A 195 ? 0.1740 0.1451 0.1476 -0.0177 -0.0032 0.0056  215  PRO A O   
1409 C CB  . PRO A 195 ? 0.1864 0.1619 0.1602 -0.0150 -0.0041 0.0015  215  PRO A CB  
1410 C CG  . PRO A 195 ? 0.1848 0.1589 0.1849 -0.0110 -0.0026 0.0137  215  PRO A CG  
1411 C CD  . PRO A 195 ? 0.1990 0.1815 0.1828 -0.0143 -0.0031 0.0091  215  PRO A CD  
1412 N N   . PRO A 196 ? 0.1474 0.1335 0.1241 -0.0159 0.0087  0.0058  216  PRO A N   
1413 C CA  . PRO A 196 ? 0.1312 0.1285 0.1243 -0.0113 0.0056  0.0000  216  PRO A CA  
1414 C C   . PRO A 196 ? 0.1313 0.1177 0.1155 -0.0091 0.0041  0.0011  216  PRO A C   
1415 O O   . PRO A 196 ? 0.1459 0.1134 0.1214 -0.0085 0.0037  -0.0043 216  PRO A O   
1416 C CB  . PRO A 196 ? 0.1406 0.1337 0.1246 -0.0075 0.0041  0.0060  216  PRO A CB  
1417 C CG  . PRO A 196 ? 0.1385 0.1480 0.1233 -0.0117 0.0072  0.0045  216  PRO A CG  
1418 C CD  . PRO A 196 ? 0.1437 0.1407 0.1292 -0.0136 0.0102  0.0025  216  PRO A CD  
1419 N N   . VAL A 197 ? 0.1167 0.1180 0.1023 -0.0036 0.0084  -0.0033 217  VAL A N   
1420 C CA  . VAL A 197 ? 0.1163 0.1050 0.1017 -0.0058 0.0040  0.0019  217  VAL A CA  
1421 C C   . VAL A 197 ? 0.1190 0.1042 0.1033 -0.0037 0.0108  0.0026  217  VAL A C   
1422 O O   . VAL A 197 ? 0.1372 0.1025 0.1064 -0.0029 0.0069  -0.0018 217  VAL A O   
1423 C CB  . VAL A 197 ? 0.1094 0.1022 0.1017 -0.0032 0.0057  0.0025  217  VAL A CB  
1424 C CG1 . VAL A 197 ? 0.1101 0.1094 0.1006 0.0001  0.0074  0.0049  217  VAL A CG1 
1425 C CG2 . VAL A 197 ? 0.1271 0.1146 0.1039 -0.0076 0.0003  0.0102  217  VAL A CG2 
1426 N N   . SER A 198 ? 0.1241 0.1072 0.0981 -0.0046 0.0060  0.0044  218  SER A N   
1427 C CA  . SER A 198 ? 0.1157 0.1087 0.0980 -0.0038 0.0049  0.0039  218  SER A CA  
1428 C C   . SER A 198 ? 0.1099 0.1093 0.0969 -0.0009 0.0016  0.0041  218  SER A C   
1429 O O   . SER A 198 ? 0.1107 0.1135 0.1073 -0.0010 0.0028  0.0126  218  SER A O   
1430 C CB  . SER A 198 ? 0.1262 0.1131 0.0981 -0.0042 0.0011  0.0028  218  SER A CB  
1431 O OG  . SER A 198 ? 0.1318 0.1223 0.1099 0.0019  -0.0003 -0.0057 218  SER A OG  
1432 N N   . PHE A 199 ? 0.1107 0.1075 0.0893 0.0033  0.0056  0.0043  219  PHE A N   
1433 C CA  . PHE A 199 ? 0.1127 0.1081 0.0973 0.0002  0.0014  0.0015  219  PHE A CA  
1434 C C   . PHE A 199 ? 0.1104 0.1017 0.0961 0.0014  0.0039  0.0034  219  PHE A C   
1435 O O   . PHE A 199 ? 0.1224 0.1082 0.0785 0.0028  0.0059  0.0077  219  PHE A O   
1436 C CB  . PHE A 199 ? 0.1139 0.1125 0.0981 0.0021  0.0012  0.0000  219  PHE A CB  
1437 C CG  . PHE A 199 ? 0.1190 0.1138 0.1084 0.0000  0.0032  0.0072  219  PHE A CG  
1438 C CD1 . PHE A 199 ? 0.1213 0.1134 0.1138 0.0058  0.0007  0.0050  219  PHE A CD1 
1439 C CD2 . PHE A 199 ? 0.1179 0.1215 0.1145 0.0006  0.0047  0.0034  219  PHE A CD2 
1440 C CE1 . PHE A 199 ? 0.1239 0.1218 0.1156 0.0012  -0.0019 0.0119  219  PHE A CE1 
1441 C CE2 . PHE A 199 ? 0.1233 0.1194 0.1218 -0.0025 0.0050  0.0026  219  PHE A CE2 
1442 C CZ  . PHE A 199 ? 0.1198 0.1222 0.1112 -0.0016 0.0040  0.0060  219  PHE A CZ  
1443 N N   . VAL A 200 ? 0.1134 0.1031 0.0986 -0.0032 0.0097  0.0077  220  VAL A N   
1444 C CA  . VAL A 200 ? 0.1132 0.1036 0.1066 -0.0022 0.0065  0.0051  220  VAL A CA  
1445 C C   . VAL A 200 ? 0.1117 0.1120 0.1061 -0.0031 0.0097  0.0073  220  VAL A C   
1446 O O   . VAL A 200 ? 0.1173 0.1180 0.1021 0.0028  0.0130  0.0106  220  VAL A O   
1447 C CB  . VAL A 200 ? 0.1175 0.1058 0.1054 -0.0021 0.0031  0.0060  220  VAL A CB  
1448 C CG1 . VAL A 200 ? 0.1095 0.1058 0.0996 -0.0041 0.0006  0.0060  220  VAL A CG1 
1449 C CG2 . VAL A 200 ? 0.1212 0.1058 0.1108 -0.0040 0.0021  0.0088  220  VAL A CG2 
1450 N N   . LYS A 201 ? 0.1130 0.1286 0.1105 0.0006  0.0088  0.0087  221  LYS A N   
1451 C CA  . LYS A 201 ? 0.1197 0.1201 0.1088 -0.0005 0.0000  0.0037  221  LYS A CA  
1452 C C   . LYS A 201 ? 0.1161 0.1230 0.1076 0.0006  0.0033  0.0021  221  LYS A C   
1453 O O   . LYS A 201 ? 0.1190 0.1240 0.1024 0.0034  0.0003  0.0098  221  LYS A O   
1454 C CB  . LYS A 201 ? 0.1242 0.1300 0.1061 0.0023  -0.0017 0.0015  221  LYS A CB  
1455 C CG  . LYS A 201 ? 0.1347 0.1249 0.1085 0.0030  -0.0062 0.0056  221  LYS A CG  
1456 C CD  . LYS A 201 ? 0.1450 0.1265 0.1093 -0.0006 -0.0004 0.0068  221  LYS A CD  
1457 C CE  . LYS A 201 ? 0.1434 0.1232 0.1122 0.0000  -0.0086 -0.0010 221  LYS A CE  
1458 N NZ  . LYS A 201 ? 0.1493 0.1201 0.1167 -0.0115 -0.0027 0.0062  221  LYS A NZ  
1459 N N   . PHE A 202 ? 0.1262 0.1183 0.1062 0.0012  0.0009  0.0002  222  PHE A N   
1460 C CA  . PHE A 202 ? 0.1283 0.1256 0.1207 0.0016  -0.0037 0.0045  222  PHE A CA  
1461 C C   . PHE A 202 ? 0.1342 0.1287 0.1207 0.0040  0.0016  0.0114  222  PHE A C   
1462 O O   . PHE A 202 ? 0.1327 0.1407 0.1202 0.0050  0.0009  0.0127  222  PHE A O   
1463 C CB  . PHE A 202 ? 0.1293 0.1236 0.1148 0.0002  -0.0025 0.0038  222  PHE A CB  
1464 C CG  . PHE A 202 ? 0.1306 0.1334 0.1179 0.0017  0.0014  0.0034  222  PHE A CG  
1465 C CD1 . PHE A 202 ? 0.1281 0.1325 0.1240 0.0078  0.0070  0.0071  222  PHE A CD1 
1466 C CD2 . PHE A 202 ? 0.1296 0.1365 0.1180 0.0016  -0.0004 -0.0003 222  PHE A CD2 
1467 C CE1 . PHE A 202 ? 0.1352 0.1329 0.1121 0.0013  -0.0034 0.0039  222  PHE A CE1 
1468 C CE2 . PHE A 202 ? 0.1328 0.1370 0.1200 0.0073  0.0040  0.0013  222  PHE A CE2 
1469 C CZ  . PHE A 202 ? 0.1276 0.1437 0.1200 0.0012  0.0025  0.0023  222  PHE A CZ  
1470 N N   . SER A 203 ? 0.1311 0.1309 0.1244 0.0014  -0.0016 0.0153  223  SER A N   
1471 C CA  . SER A 203 ? 0.1435 0.1416 0.1397 0.0040  0.0089  0.0102  223  SER A CA  
1472 C C   . SER A 203 ? 0.1513 0.1491 0.1565 -0.0036 0.0049  0.0125  223  SER A C   
1473 O O   . SER A 203 ? 0.1478 0.1434 0.1702 -0.0057 0.0084  0.0086  223  SER A O   
1474 C CB  . SER A 203 ? 0.1473 0.1504 0.1464 0.0096  0.0112  0.0155  223  SER A CB  
1475 O OG  . SER A 203 ? 0.1601 0.1466 0.1348 0.0129  0.0168  0.0283  223  SER A OG  
1476 N N   . PRO A 204 ? 0.1573 0.1703 0.1668 0.0000  0.0121  0.0111  224  PRO A N   
1477 C CA  . PRO A 204 ? 0.1777 0.1657 0.1806 -0.0077 0.0081  0.0156  224  PRO A CA  
1478 C C   . PRO A 204 ? 0.1703 0.1819 0.1960 -0.0016 0.0051  0.0130  224  PRO A C   
1479 O O   . PRO A 204 ? 0.2009 0.1865 0.2278 -0.0157 0.0031  0.0161  224  PRO A O   
1480 C CB  . PRO A 204 ? 0.1838 0.1874 0.1794 -0.0109 0.0113  0.0167  224  PRO A CB  
1481 C CG  . PRO A 204 ? 0.1941 0.1859 0.1632 -0.0059 0.0177  0.0073  224  PRO A CG  
1482 C CD  . PRO A 204 ? 0.1756 0.1727 0.1694 -0.0104 0.0143  0.0078  224  PRO A CD  
1483 N N   . ASN A 205 ? 0.1650 0.1924 0.1907 -0.0012 0.0011  0.0213  225  ASN A N   
1484 C CA  . ASN A 205 ? 0.1857 0.2034 0.1925 -0.0068 -0.0093 0.0168  225  ASN A CA  
1485 C C   . ASN A 205 ? 0.1825 0.2196 0.1984 -0.0138 -0.0071 0.0085  225  ASN A C   
1486 O O   . ASN A 205 ? 0.2189 0.2384 0.2057 -0.0157 -0.0258 0.0287  225  ASN A O   
1487 C CB  . ASN A 205 ? 0.1881 0.2058 0.1761 -0.0030 -0.0001 0.0230  225  ASN A CB  
1488 C CG  . ASN A 205 ? 0.1891 0.2060 0.1861 -0.0022 0.0029  0.0232  225  ASN A CG  
1489 O OD1 . ASN A 205 ? 0.1911 0.1991 0.1814 -0.0049 0.0131  0.0265  225  ASN A OD1 
1490 N ND2 . ASN A 205 ? 0.1768 0.2176 0.1759 0.0041  0.0061  0.0252  225  ASN A ND2 
1491 N N   . GLY A 206 ? 0.1806 0.2242 0.2048 -0.0198 -0.0077 0.0081  226  GLY A N   
1492 C CA  . GLY A 206 ? 0.1556 0.2382 0.2016 -0.0293 -0.0211 -0.0007 226  GLY A CA  
1493 C C   . GLY A 206 ? 0.1700 0.2424 0.2058 -0.0245 -0.0126 0.0049  226  GLY A C   
1494 O O   . GLY A 206 ? 0.1873 0.2913 0.2096 -0.0358 -0.0044 0.0019  226  GLY A O   
1495 N N   . LYS A 207 ? 0.1734 0.2413 0.2047 -0.0263 -0.0071 0.0100  227  LYS A N   
1496 C CA  . LYS A 207 ? 0.2164 0.2475 0.2198 -0.0205 -0.0065 0.0220  227  LYS A CA  
1497 C C   . LYS A 207 ? 0.2136 0.2281 0.1897 -0.0101 -0.0099 0.0293  227  LYS A C   
1498 O O   . LYS A 207 ? 0.2441 0.2529 0.1845 -0.0188 -0.0027 0.0420  227  LYS A O   
1499 C CB  . LYS A 207 ? 0.2360 0.2700 0.2659 -0.0016 0.0054  0.0181  227  LYS A CB  
1500 C CG  . LYS A 207 ? 0.2456 0.2817 0.2703 -0.0042 0.0115  0.0148  227  LYS A CG  
1501 C CD  . LYS A 207 ? 0.2527 0.3116 0.2977 0.0108  0.0181  0.0127  227  LYS A CD  
1502 C CE  . LYS A 207 ? 0.2785 0.3228 0.3165 0.0161  0.0095  0.0203  227  LYS A CE  
1503 N NZ  . LYS A 207 ? 0.2824 0.3495 0.3669 0.0280  0.0098  0.0177  227  LYS A NZ  
1504 N N   . TYR A 208 ? 0.1812 0.1920 0.1714 -0.0060 0.0094  0.0222  228  TYR A N   
1505 C CA  . TYR A 208 ? 0.1780 0.1659 0.1652 0.0061  0.0015  0.0233  228  TYR A CA  
1506 C C   . TYR A 208 ? 0.1677 0.1526 0.1279 -0.0054 -0.0006 0.0165  228  TYR A C   
1507 O O   . TYR A 208 ? 0.1658 0.1518 0.1109 -0.0006 0.0006  0.0175  228  TYR A O   
1508 C CB  . TYR A 208 ? 0.1879 0.1774 0.1727 -0.0019 0.0083  0.0158  228  TYR A CB  
1509 C CG  . TYR A 208 ? 0.1925 0.1918 0.2074 0.0067  0.0090  0.0213  228  TYR A CG  
1510 C CD1 . TYR A 208 ? 0.1945 0.2074 0.2057 0.0014  0.0154  0.0285  228  TYR A CD1 
1511 C CD2 . TYR A 208 ? 0.1977 0.2115 0.2170 0.0031  0.0140  0.0268  228  TYR A CD2 
1512 C CE1 . TYR A 208 ? 0.2089 0.2146 0.2340 0.0139  0.0153  0.0329  228  TYR A CE1 
1513 C CE2 . TYR A 208 ? 0.2167 0.2132 0.2415 0.0181  0.0260  0.0287  228  TYR A CE2 
1514 C CZ  . TYR A 208 ? 0.2153 0.2213 0.2465 0.0086  0.0237  0.0381  228  TYR A CZ  
1515 O OH  . TYR A 208 ? 0.2167 0.2355 0.2854 0.0129  0.0478  0.0438  228  TYR A OH  
1516 N N   . ILE A 209 ? 0.1590 0.1351 0.1052 0.0058  -0.0063 0.0141  229  ILE A N   
1517 C CA  . ILE A 209 ? 0.1520 0.1428 0.1252 0.0052  -0.0106 0.0074  229  ILE A CA  
1518 C C   . ILE A 209 ? 0.1498 0.1300 0.1190 0.0098  -0.0115 0.0146  229  ILE A C   
1519 O O   . ILE A 209 ? 0.1546 0.1292 0.1006 0.0169  -0.0270 0.0091  229  ILE A O   
1520 C CB  . ILE A 209 ? 0.1560 0.1487 0.1343 0.0002  -0.0015 0.0060  229  ILE A CB  
1521 C CG1 . ILE A 209 ? 0.1697 0.1635 0.1442 -0.0104 -0.0017 0.0116  229  ILE A CG1 
1522 C CG2 . ILE A 209 ? 0.1445 0.1561 0.1310 0.0021  -0.0058 0.0026  229  ILE A CG2 
1523 C CD1 . ILE A 209 ? 0.1764 0.1906 0.1569 0.0042  0.0013  0.0155  229  ILE A CD1 
1524 N N   . LEU A 210 ? 0.1358 0.1264 0.1127 0.0112  -0.0028 0.0114  230  LEU A N   
1525 C CA  . LEU A 210 ? 0.1341 0.1144 0.1212 0.0080  0.0024  0.0127  230  LEU A CA  
1526 C C   . LEU A 210 ? 0.1321 0.1189 0.1127 0.0055  0.0029  0.0141  230  LEU A C   
1527 O O   . LEU A 210 ? 0.1348 0.1209 0.1209 0.0160  0.0130  0.0112  230  LEU A O   
1528 C CB  . LEU A 210 ? 0.1477 0.1268 0.1215 0.0046  0.0031  0.0168  230  LEU A CB  
1529 C CG  . LEU A 210 ? 0.1464 0.1383 0.1264 0.0008  0.0007  0.0129  230  LEU A CG  
1530 C CD1 . LEU A 210 ? 0.1637 0.1396 0.1366 0.0037  0.0001  0.0132  230  LEU A CD1 
1531 C CD2 . LEU A 210 ? 0.1631 0.1484 0.1212 0.0064  -0.0037 0.0164  230  LEU A CD2 
1532 N N   . ALA A 211 ? 0.1306 0.1167 0.1181 0.0020  -0.0027 0.0051  231  ALA A N   
1533 C CA  . ALA A 211 ? 0.1307 0.1133 0.1151 0.0002  0.0006  0.0048  231  ALA A CA  
1534 C C   . ALA A 211 ? 0.1301 0.1185 0.1143 0.0041  -0.0017 0.0001  231  ALA A C   
1535 O O   . ALA A 211 ? 0.1365 0.1223 0.1323 0.0129  -0.0114 -0.0042 231  ALA A O   
1536 C CB  . ALA A 211 ? 0.1369 0.1229 0.1140 0.0046  0.0010  0.0031  231  ALA A CB  
1537 N N   . ALA A 212 ? 0.1247 0.1172 0.1139 0.0029  0.0034  0.0000  232  ALA A N   
1538 C CA  . ALA A 212 ? 0.1339 0.1225 0.1100 0.0012  -0.0019 0.0010  232  ALA A CA  
1539 C C   . ALA A 212 ? 0.1356 0.1217 0.1008 0.0083  -0.0001 -0.0002 232  ALA A C   
1540 O O   . ALA A 212 ? 0.1507 0.1141 0.1058 0.0167  -0.0002 0.0102  232  ALA A O   
1541 C CB  . ALA A 212 ? 0.1389 0.1256 0.1042 -0.0001 -0.0073 -0.0051 232  ALA A CB  
1542 N N   . THR A 213 ? 0.1416 0.1258 0.1115 0.0047  0.0012  -0.0034 233  THR A N   
1543 C CA  . THR A 213 ? 0.1443 0.1300 0.1232 0.0004  0.0044  0.0022  233  THR A CA  
1544 C C   . THR A 213 ? 0.1409 0.1334 0.1287 -0.0040 0.0069  -0.0014 233  THR A C   
1545 O O   . THR A 213 ? 0.1386 0.1510 0.1344 -0.0112 0.0090  -0.0130 233  THR A O   
1546 C CB  . THR A 213 ? 0.1590 0.1364 0.1343 -0.0021 0.0145  0.0121  233  THR A CB  
1547 O OG1 . THR A 213 ? 0.1649 0.1528 0.1459 0.0078  0.0204  0.0140  233  THR A OG1 
1548 C CG2 . THR A 213 ? 0.1658 0.1449 0.1379 0.0006  0.0058  0.0108  233  THR A CG2 
1549 N N   . LEU A 214 ? 0.1376 0.1320 0.1180 -0.0085 0.0000  0.0015  234  LEU A N   
1550 C CA  . LEU A 214 ? 0.1331 0.1420 0.1260 -0.0092 -0.0026 0.0020  234  LEU A CA  
1551 C C   . LEU A 214 ? 0.1442 0.1430 0.1353 -0.0115 0.0033  -0.0036 234  LEU A C   
1552 O O   . LEU A 214 ? 0.1532 0.1724 0.1518 -0.0150 -0.0166 -0.0107 234  LEU A O   
1553 C CB  . LEU A 214 ? 0.1401 0.1342 0.1252 -0.0085 0.0014  -0.0024 234  LEU A CB  
1554 C CG  . LEU A 214 ? 0.1402 0.1363 0.1325 -0.0127 0.0012  -0.0001 234  LEU A CG  
1555 C CD1 . LEU A 214 ? 0.1424 0.1462 0.1413 -0.0081 -0.0017 0.0053  234  LEU A CD1 
1556 C CD2 . LEU A 214 ? 0.1459 0.1372 0.1345 -0.0142 0.0010  0.0101  234  LEU A CD2 
1557 N N   . ASP A 215 ? 0.1512 0.1446 0.1496 -0.0075 0.0059  0.0036  235  ASP A N   
1558 C CA  . ASP A 215 ? 0.1643 0.1448 0.1669 -0.0060 0.0032  -0.0018 235  ASP A CA  
1559 C C   . ASP A 215 ? 0.1682 0.1449 0.1557 -0.0026 0.0044  0.0091  235  ASP A C   
1560 O O   . ASP A 215 ? 0.1761 0.1430 0.1717 0.0011  0.0104  0.0083  235  ASP A O   
1561 C CB  . ASP A 215 ? 0.1836 0.1657 0.1735 -0.0032 0.0027  0.0075  235  ASP A CB  
1562 C CG  . ASP A 215 ? 0.1882 0.1727 0.1814 -0.0072 -0.0012 0.0048  235  ASP A CG  
1563 O OD1 . ASP A 215 ? 0.1771 0.1669 0.1930 -0.0080 0.0018  -0.0076 235  ASP A OD1 
1564 O OD2 . ASP A 215 ? 0.2213 0.2176 0.1890 -0.0049 -0.0062 0.0218  235  ASP A OD2 
1565 N N   . ASN A 216 ? 0.1580 0.1470 0.1591 -0.0060 0.0052  0.0095  236  ASN A N   
1566 C CA  . ASN A 216 ? 0.1619 0.1495 0.1403 -0.0078 -0.0020 0.0068  236  ASN A CA  
1567 C C   . ASN A 216 ? 0.1597 0.1462 0.1424 -0.0048 0.0005  0.0058  236  ASN A C   
1568 O O   . ASN A 216 ? 0.1639 0.1525 0.1334 -0.0032 0.0012  0.0006  236  ASN A O   
1569 C CB  . ASN A 216 ? 0.1661 0.1385 0.1469 -0.0139 -0.0016 0.0151  236  ASN A CB  
1570 C CG  . ASN A 216 ? 0.1630 0.1416 0.1492 -0.0108 0.0035  0.0037  236  ASN A CG  
1571 O OD1 . ASN A 216 ? 0.1684 0.1435 0.1425 -0.0110 0.0072  0.0099  236  ASN A OD1 
1572 N ND2 . ASN A 216 ? 0.1738 0.1442 0.1530 -0.0170 -0.0016 0.0326  236  ASN A ND2 
1573 N N   . THR A 217 ? 0.1647 0.1534 0.1433 -0.0044 -0.0017 0.0022  237  THR A N   
1574 C CA  . THR A 217 ? 0.1540 0.1512 0.1501 -0.0033 0.0056  0.0049  237  THR A CA  
1575 C C   . THR A 217 ? 0.1479 0.1469 0.1411 0.0013  0.0038  0.0089  237  THR A C   
1576 O O   . THR A 217 ? 0.1319 0.1540 0.1647 0.0052  0.0048  0.0081  237  THR A O   
1577 C CB  . THR A 217 ? 0.1788 0.1574 0.1572 -0.0131 0.0030  0.0131  237  THR A CB  
1578 O OG1 . THR A 217 ? 0.1831 0.1714 0.1856 -0.0241 0.0006  0.0112  237  THR A OG1 
1579 C CG2 . THR A 217 ? 0.1768 0.1768 0.1728 -0.0141 -0.0008 0.0141  237  THR A CG2 
1580 N N   . LEU A 218 ? 0.1449 0.1364 0.1323 0.0090  -0.0037 0.0160  238  LEU A N   
1581 C CA  . LEU A 218 ? 0.1553 0.1454 0.1456 0.0034  -0.0043 0.0091  238  LEU A CA  
1582 C C   . LEU A 218 ? 0.1557 0.1542 0.1462 0.0047  -0.0063 0.0092  238  LEU A C   
1583 O O   . LEU A 218 ? 0.1580 0.1576 0.1591 0.0097  -0.0088 0.0204  238  LEU A O   
1584 C CB  . LEU A 218 ? 0.1535 0.1543 0.1435 0.0035  -0.0006 0.0024  238  LEU A CB  
1585 C CG  . LEU A 218 ? 0.1525 0.1521 0.1464 0.0024  0.0029  0.0047  238  LEU A CG  
1586 C CD1 . LEU A 218 ? 0.1601 0.1655 0.1522 0.0000  0.0092  -0.0035 238  LEU A CD1 
1587 C CD2 . LEU A 218 ? 0.1482 0.1507 0.1444 0.0066  -0.0031 0.0070  238  LEU A CD2 
1588 N N   . LYS A 219 ? 0.1578 0.1479 0.1548 -0.0007 -0.0039 0.0085  239  LYS A N   
1589 C CA  . LYS A 219 ? 0.1767 0.1638 0.1626 0.0003  -0.0148 0.0103  239  LYS A CA  
1590 C C   . LYS A 219 ? 0.1743 0.1541 0.1500 0.0060  -0.0188 0.0147  239  LYS A C   
1591 O O   . LYS A 219 ? 0.1825 0.1538 0.1419 0.0112  -0.0244 0.0138  239  LYS A O   
1592 C CB  . LYS A 219 ? 0.1927 0.1876 0.1738 -0.0013 -0.0045 0.0181  239  LYS A CB  
1593 C CG  . LYS A 219 ? 0.2073 0.2048 0.2030 -0.0130 -0.0031 0.0096  239  LYS A CG  
1594 C CD  . LYS A 219 ? 0.2263 0.2310 0.2072 -0.0013 0.0073  0.0141  239  LYS A CD  
1595 C CE  . LYS A 219 ? 0.2372 0.2644 0.2644 -0.0202 0.0106  0.0033  239  LYS A CE  
1596 N NZ  . LYS A 219 ? 0.2656 0.2930 0.2775 0.0023  0.0075  0.0279  239  LYS A NZ  
1597 N N   . LEU A 220 ? 0.1726 0.1500 0.1544 0.0041  -0.0179 0.0174  240  LEU A N   
1598 C CA  . LEU A 220 ? 0.1709 0.1560 0.1497 0.0024  -0.0184 0.0223  240  LEU A CA  
1599 C C   . LEU A 220 ? 0.1704 0.1659 0.1498 0.0044  -0.0263 0.0140  240  LEU A C   
1600 O O   . LEU A 220 ? 0.1785 0.1594 0.1638 0.0028  -0.0299 0.0104  240  LEU A O   
1601 C CB  . LEU A 220 ? 0.1785 0.1557 0.1382 0.0104  -0.0221 0.0196  240  LEU A CB  
1602 C CG  . LEU A 220 ? 0.1867 0.1653 0.1438 0.0009  -0.0183 0.0201  240  LEU A CG  
1603 C CD1 . LEU A 220 ? 0.1976 0.1547 0.1515 0.0128  -0.0278 0.0133  240  LEU A CD1 
1604 C CD2 . LEU A 220 ? 0.1873 0.1868 0.1460 0.0056  -0.0158 0.0151  240  LEU A CD2 
1605 N N   . TRP A 221 ? 0.1787 0.1675 0.1532 -0.0014 -0.0283 0.0122  241  TRP A N   
1606 C CA  . TRP A 221 ? 0.1952 0.1820 0.1543 -0.0022 -0.0168 0.0218  241  TRP A CA  
1607 C C   . TRP A 221 ? 0.1990 0.1766 0.1647 -0.0040 -0.0140 0.0113  241  TRP A C   
1608 O O   . TRP A 221 ? 0.1935 0.1782 0.1492 -0.0021 -0.0124 0.0063  241  TRP A O   
1609 C CB  . TRP A 221 ? 0.1910 0.2034 0.1667 -0.0016 -0.0148 0.0159  241  TRP A CB  
1610 C CG  . TRP A 221 ? 0.1889 0.2276 0.1876 -0.0081 -0.0119 0.0256  241  TRP A CG  
1611 C CD1 . TRP A 221 ? 0.1935 0.2459 0.1901 -0.0078 -0.0166 0.0327  241  TRP A CD1 
1612 C CD2 . TRP A 221 ? 0.1993 0.2520 0.1981 -0.0184 -0.0112 0.0352  241  TRP A CD2 
1613 N NE1 . TRP A 221 ? 0.1952 0.2679 0.2062 -0.0159 -0.0164 0.0307  241  TRP A NE1 
1614 C CE2 . TRP A 221 ? 0.2021 0.2700 0.2058 -0.0201 -0.0171 0.0315  241  TRP A CE2 
1615 C CE3 . TRP A 221 ? 0.2086 0.2702 0.1976 -0.0233 -0.0149 0.0274  241  TRP A CE3 
1616 C CZ2 . TRP A 221 ? 0.2107 0.2924 0.2041 -0.0234 -0.0131 0.0314  241  TRP A CZ2 
1617 C CZ3 . TRP A 221 ? 0.2189 0.2892 0.2032 -0.0253 -0.0139 0.0283  241  TRP A CZ3 
1618 C CH2 . TRP A 221 ? 0.2073 0.2973 0.2048 -0.0212 -0.0211 0.0315  241  TRP A CH2 
1619 N N   . ASP A 222 ? 0.2069 0.1802 0.1678 0.0073  -0.0123 0.0110  242  ASP A N   
1620 C CA  . ASP A 222 ? 0.2110 0.2032 0.1799 0.0025  -0.0123 -0.0009 242  ASP A CA  
1621 C C   . ASP A 222 ? 0.2207 0.2187 0.1790 0.0063  -0.0122 -0.0071 242  ASP A C   
1622 O O   . ASP A 222 ? 0.2419 0.2279 0.1760 0.0002  -0.0125 0.0010  242  ASP A O   
1623 C CB  . ASP A 222 ? 0.2165 0.2141 0.1810 0.0093  -0.0226 -0.0057 242  ASP A CB  
1624 C CG  . ASP A 222 ? 0.2317 0.2269 0.1794 0.0139  -0.0253 -0.0205 242  ASP A CG  
1625 O OD1 . ASP A 222 ? 0.2186 0.2396 0.1678 0.0287  -0.0353 -0.0227 242  ASP A OD1 
1626 O OD2 . ASP A 222 ? 0.2488 0.2690 0.2194 0.0311  -0.0644 -0.0360 242  ASP A OD2 
1627 N N   . TYR A 223 ? 0.2283 0.2226 0.1965 0.0066  -0.0035 0.0024  243  TYR A N   
1628 C CA  . TYR A 223 ? 0.2250 0.2270 0.2164 0.0125  -0.0026 0.0068  243  TYR A CA  
1629 C C   . TYR A 223 ? 0.2462 0.2562 0.2174 0.0098  -0.0048 0.0052  243  TYR A C   
1630 O O   . TYR A 223 ? 0.2480 0.3089 0.2489 0.0280  0.0058  -0.0084 243  TYR A O   
1631 C CB  . TYR A 223 ? 0.2137 0.2178 0.2017 0.0047  -0.0032 0.0004  243  TYR A CB  
1632 C CG  . TYR A 223 ? 0.2091 0.2197 0.2106 0.0060  -0.0037 -0.0018 243  TYR A CG  
1633 C CD1 . TYR A 223 ? 0.2033 0.2222 0.2149 0.0083  -0.0160 -0.0011 243  TYR A CD1 
1634 C CD2 . TYR A 223 ? 0.2044 0.2233 0.2098 0.0094  -0.0075 -0.0016 243  TYR A CD2 
1635 C CE1 . TYR A 223 ? 0.2247 0.2118 0.2192 0.0057  -0.0074 0.0073  243  TYR A CE1 
1636 C CE2 . TYR A 223 ? 0.2248 0.2143 0.2267 -0.0003 -0.0106 0.0032  243  TYR A CE2 
1637 C CZ  . TYR A 223 ? 0.2162 0.2171 0.2188 0.0068  -0.0115 0.0038  243  TYR A CZ  
1638 O OH  . TYR A 223 ? 0.2353 0.2164 0.2689 -0.0107 -0.0242 0.0158  243  TYR A OH  
1639 N N   . SER A 224 ? 0.2471 0.2687 0.2240 0.0017  -0.0159 0.0030  244  SER A N   
1640 C CA  . SER A 224 ? 0.2630 0.2732 0.2211 0.0120  -0.0159 0.0061  244  SER A CA  
1641 C C   . SER A 224 ? 0.2527 0.2658 0.2334 0.0134  -0.0061 0.0015  244  SER A C   
1642 O O   . SER A 224 ? 0.2665 0.2777 0.2375 0.0250  0.0028  0.0107  244  SER A O   
1643 C CB  . SER A 224 ? 0.2676 0.2772 0.2372 -0.0086 -0.0122 0.0051  244  SER A CB  
1644 O OG  . SER A 224 ? 0.3301 0.2919 0.2437 -0.0163 -0.0286 -0.0010 244  SER A OG  
1645 N N   . LYS A 225 ? 0.2519 0.2579 0.2175 0.0078  -0.0288 0.0059  245  LYS A N   
1646 C CA  . LYS A 225 ? 0.2561 0.2639 0.2343 0.0064  -0.0150 0.0111  245  LYS A CA  
1647 C C   . LYS A 225 ? 0.2546 0.2772 0.2306 0.0098  -0.0167 0.0194  245  LYS A C   
1648 O O   . LYS A 225 ? 0.2465 0.3161 0.2606 -0.0089 -0.0198 0.0413  245  LYS A O   
1649 C CB  . LYS A 225 ? 0.2631 0.2541 0.2638 0.0096  -0.0197 0.0123  245  LYS A CB  
1650 C CG  . LYS A 225 ? 0.2654 0.2626 0.3000 0.0080  -0.0275 -0.0079 245  LYS A CG  
1651 C CD  . LYS A 225 ? 0.2868 0.2668 0.3404 0.0134  -0.0396 -0.0167 245  LYS A CD  
1652 C CE  . LYS A 225 ? 0.2880 0.2868 0.3604 0.0124  -0.0373 -0.0181 245  LYS A CE  
1653 N NZ  . LYS A 225 ? 0.3229 0.2688 0.3753 0.0034  -0.0597 -0.0223 245  LYS A NZ  
1654 N N   . GLY A 226 ? 0.2603 0.2864 0.2305 0.0144  -0.0166 0.0210  246  GLY A N   
1655 C CA  . GLY A 226 ? 0.2621 0.2848 0.2361 0.0008  -0.0026 0.0222  246  GLY A CA  
1656 C C   . GLY A 226 ? 0.2714 0.2856 0.2479 -0.0035 -0.0092 0.0194  246  GLY A C   
1657 O O   . GLY A 226 ? 0.2970 0.3047 0.2797 -0.0115 0.0020  0.0384  246  GLY A O   
1658 N N   . LYS A 227 ? 0.2813 0.2643 0.2375 -0.0060 -0.0172 0.0140  247  LYS A N   
1659 C CA  . LYS A 227 ? 0.2880 0.2623 0.2394 -0.0007 -0.0161 0.0148  247  LYS A CA  
1660 C C   . LYS A 227 ? 0.2675 0.2487 0.2378 -0.0095 -0.0134 0.0232  247  LYS A C   
1661 O O   . LYS A 227 ? 0.2724 0.2308 0.1696 0.0165  -0.0391 0.0414  247  LYS A O   
1662 C CB  . LYS A 227 ? 0.2884 0.2921 0.2757 0.0085  -0.0195 0.0159  247  LYS A CB  
1663 C CG  . LYS A 227 ? 0.3202 0.3138 0.2891 0.0084  -0.0094 -0.0036 247  LYS A CG  
1664 C CD  . LYS A 227 ? 0.3294 0.3285 0.3343 0.0201  -0.0183 0.0024  247  LYS A CD  
1665 C CE  . LYS A 227 ? 0.3368 0.3434 0.3495 0.0122  -0.0064 -0.0089 247  LYS A CE  
1666 N NZ  . LYS A 227 ? 0.3597 0.3517 0.3868 0.0124  -0.0351 0.0018  247  LYS A NZ  
1667 N N   . CYS A 228 ? 0.2770 0.2520 0.2398 -0.0138 -0.0083 0.0189  248  CYS A N   
1668 C CA  . CYS A 228 ? 0.2594 0.2442 0.2366 -0.0089 -0.0175 0.0293  248  CYS A CA  
1669 C C   . CYS A 228 ? 0.2587 0.2324 0.2302 -0.0113 -0.0168 0.0298  248  CYS A C   
1670 O O   . CYS A 228 ? 0.2713 0.2285 0.2601 -0.0065 -0.0149 0.0310  248  CYS A O   
1671 C CB  . CYS A 228 ? 0.2801 0.2573 0.2135 -0.0203 -0.0358 0.0387  248  CYS A CB  
1672 S SG  . CYS A 228 ? 0.3235 0.3080 0.2103 -0.0547 -0.0466 0.0653  248  CYS A SG  
1673 N N   . LEU A 229 ? 0.2382 0.2231 0.2023 0.0006  -0.0295 0.0215  249  LEU A N   
1674 C CA  . LEU A 229 ? 0.2503 0.2196 0.2162 0.0005  -0.0193 0.0101  249  LEU A CA  
1675 C C   . LEU A 229 ? 0.2481 0.2087 0.2190 0.0079  -0.0241 0.0105  249  LEU A C   
1676 O O   . LEU A 229 ? 0.3069 0.2060 0.2457 0.0137  -0.0396 0.0087  249  LEU A O   
1677 C CB  . LEU A 229 ? 0.2416 0.2257 0.2232 0.0020  -0.0143 0.0078  249  LEU A CB  
1678 C CG  . LEU A 229 ? 0.2495 0.2364 0.2228 0.0022  -0.0089 0.0021  249  LEU A CG  
1679 C CD1 . LEU A 229 ? 0.2528 0.2417 0.2114 -0.0013 0.0022  0.0030  249  LEU A CD1 
1680 C CD2 . LEU A 229 ? 0.2425 0.2530 0.2299 0.0104  -0.0126 0.0064  249  LEU A CD2 
1681 N N   . LYS A 230 ? 0.2427 0.1913 0.2162 0.0070  -0.0114 0.0143  250  LYS A N   
1682 C CA  . LYS A 230 ? 0.2221 0.2137 0.2179 0.0073  -0.0107 0.0093  250  LYS A CA  
1683 C C   . LYS A 230 ? 0.2220 0.2003 0.1951 0.0093  -0.0041 0.0141  250  LYS A C   
1684 O O   . LYS A 230 ? 0.2057 0.2056 0.1991 0.0214  0.0051  0.0331  250  LYS A O   
1685 C CB  . LYS A 230 ? 0.2228 0.2128 0.2194 -0.0024 -0.0142 0.0077  250  LYS A CB  
1686 C CG  . LYS A 230 ? 0.2296 0.2388 0.2412 0.0068  -0.0265 0.0068  250  LYS A CG  
1687 C CD  . LYS A 230 ? 0.2226 0.2413 0.2487 0.0090  -0.0293 0.0120  250  LYS A CD  
1688 C CE  . LYS A 230 ? 0.2247 0.2491 0.2405 0.0157  -0.0356 0.0197  250  LYS A CE  
1689 N NZ  . LYS A 230 ? 0.2279 0.2561 0.2553 0.0252  -0.0476 0.0155  250  LYS A NZ  
1690 N N   . THR A 231 ? 0.2108 0.1940 0.1951 0.0053  -0.0066 0.0242  251  THR A N   
1691 C CA  . THR A 231 ? 0.2128 0.1972 0.1738 0.0060  -0.0035 0.0148  251  THR A CA  
1692 C C   . THR A 231 ? 0.1983 0.1678 0.1707 0.0116  0.0011  0.0228  251  THR A C   
1693 O O   . THR A 231 ? 0.2048 0.1655 0.1628 0.0173  0.0036  0.0414  251  THR A O   
1694 C CB  . THR A 231 ? 0.2194 0.2209 0.1914 -0.0016 0.0050  0.0211  251  THR A CB  
1695 O OG1 . THR A 231 ? 0.2693 0.2134 0.2239 -0.0171 0.0061  0.0259  251  THR A OG1 
1696 C CG2 . THR A 231 ? 0.2361 0.2321 0.1887 0.0007  -0.0164 0.0240  251  THR A CG2 
1697 N N   . TYR A 232 ? 0.1843 0.1624 0.1426 0.0078  0.0064  0.0065  252  TYR A N   
1698 C CA  . TYR A 232 ? 0.1636 0.1424 0.1417 0.0007  0.0061  0.0122  252  TYR A CA  
1699 C C   . TYR A 232 ? 0.1631 0.1346 0.1379 0.0081  0.0037  0.0099  252  TYR A C   
1700 O O   . TYR A 232 ? 0.1468 0.1541 0.1416 0.0089  0.0056  0.0137  252  TYR A O   
1701 C CB  . TYR A 232 ? 0.1575 0.1345 0.1354 -0.0003 0.0004  0.0085  252  TYR A CB  
1702 C CG  . TYR A 232 ? 0.1556 0.1298 0.1361 0.0013  0.0018  0.0096  252  TYR A CG  
1703 C CD1 . TYR A 232 ? 0.1519 0.1246 0.1341 -0.0003 -0.0015 0.0117  252  TYR A CD1 
1704 C CD2 . TYR A 232 ? 0.1493 0.1234 0.1406 0.0031  -0.0016 0.0082  252  TYR A CD2 
1705 C CE1 . TYR A 232 ? 0.1488 0.1263 0.1417 -0.0019 0.0002  0.0102  252  TYR A CE1 
1706 C CE2 . TYR A 232 ? 0.1478 0.1290 0.1463 -0.0017 -0.0016 0.0129  252  TYR A CE2 
1707 C CZ  . TYR A 232 ? 0.1418 0.1340 0.1458 -0.0034 -0.0090 0.0052  252  TYR A CZ  
1708 O OH  . TYR A 232 ? 0.1427 0.1389 0.1627 -0.0113 -0.0128 0.0086  252  TYR A OH  
1709 N N   . THR A 233 ? 0.1552 0.1296 0.1425 0.0082  -0.0038 0.0130  253  THR A N   
1710 C CA  . THR A 233 ? 0.1609 0.1329 0.1540 0.0045  -0.0079 0.0025  253  THR A CA  
1711 C C   . THR A 233 ? 0.1675 0.1185 0.1589 0.0016  -0.0029 -0.0017 253  THR A C   
1712 O O   . THR A 233 ? 0.1649 0.1149 0.1695 0.0049  -0.0049 0.0016  253  THR A O   
1713 C CB  . THR A 233 ? 0.1715 0.1456 0.1623 -0.0030 -0.0058 0.0077  253  THR A CB  
1714 O OG1 . THR A 233 ? 0.2097 0.1477 0.1986 0.0114  -0.0144 0.0054  253  THR A OG1 
1715 C CG2 . THR A 233 ? 0.1796 0.1529 0.1659 -0.0028 -0.0034 0.0015  253  THR A CG2 
1716 N N   . GLY A 234 ? 0.1634 0.1261 0.1590 0.0125  -0.0042 -0.0044 254  GLY A N   
1717 C CA  . GLY A 234 ? 0.1775 0.1411 0.1537 -0.0045 0.0013  -0.0005 254  GLY A CA  
1718 C C   . GLY A 234 ? 0.1759 0.1466 0.1470 -0.0020 0.0050  0.0008  254  GLY A C   
1719 O O   . GLY A 234 ? 0.1824 0.1550 0.1593 -0.0117 -0.0110 0.0067  254  GLY A O   
1720 N N   . HIS A 235 ? 0.1718 0.1425 0.1423 0.0041  0.0113  0.0085  255  HIS A N   
1721 C CA  . HIS A 235 ? 0.1637 0.1388 0.1359 -0.0002 0.0103  0.0051  255  HIS A CA  
1722 C C   . HIS A 235 ? 0.1615 0.1378 0.1357 -0.0011 0.0073  0.0058  255  HIS A C   
1723 O O   . HIS A 235 ? 0.1764 0.1266 0.1381 0.0096  0.0028  0.0133  255  HIS A O   
1724 C CB  . HIS A 235 ? 0.1676 0.1334 0.1362 0.0026  0.0079  0.0096  255  HIS A CB  
1725 C CG  . HIS A 235 ? 0.1786 0.1426 0.1394 0.0079  0.0005  0.0025  255  HIS A CG  
1726 N ND1 . HIS A 235 ? 0.1783 0.1183 0.1419 0.0026  0.0058  0.0042  255  HIS A ND1 
1727 C CD2 . HIS A 235 ? 0.1885 0.1356 0.1457 0.0017  0.0017  0.0028  255  HIS A CD2 
1728 C CE1 . HIS A 235 ? 0.1888 0.1464 0.1376 0.0044  -0.0005 -0.0029 255  HIS A CE1 
1729 N NE2 . HIS A 235 ? 0.2008 0.1515 0.1532 0.0065  -0.0168 -0.0005 255  HIS A NE2 
1730 N N   . LYS A 236 ? 0.1718 0.1286 0.1213 -0.0003 0.0114  0.0029  256  LYS A N   
1731 C CA  . LYS A 236 ? 0.1677 0.1337 0.1413 0.0022  0.0042  0.0027  256  LYS A CA  
1732 C C   . LYS A 236 ? 0.1706 0.1360 0.1346 -0.0090 0.0033  -0.0013 256  LYS A C   
1733 O O   . LYS A 236 ? 0.1724 0.1506 0.1358 -0.0120 0.0072  0.0094  256  LYS A O   
1734 C CB  . LYS A 236 ? 0.1863 0.1487 0.1574 0.0026  -0.0100 -0.0080 256  LYS A CB  
1735 C CG  . LYS A 236 ? 0.1966 0.1837 0.2000 0.0065  0.0100  -0.0053 256  LYS A CG  
1736 C CD  . LYS A 236 ? 0.2061 0.2328 0.2292 0.0061  -0.0093 -0.0097 256  LYS A CD  
1737 C CE  . LYS A 236 ? 0.2167 0.2524 0.2743 0.0054  0.0166  -0.0051 256  LYS A CE  
1738 N NZ  . LYS A 236 ? 0.2658 0.2551 0.3122 0.0000  0.0050  -0.0026 256  LYS A NZ  
1739 N N   . ASN A 237 ? 0.1644 0.1295 0.1439 -0.0129 0.0149  0.0004  257  ASN A N   
1740 C CA  . ASN A 237 ? 0.1548 0.1314 0.1319 -0.0088 0.0106  0.0020  257  ASN A CA  
1741 C C   . ASN A 237 ? 0.1502 0.1177 0.1294 -0.0112 0.0065  0.0043  257  ASN A C   
1742 O O   . ASN A 237 ? 0.1624 0.1045 0.1334 -0.0106 0.0009  0.0064  257  ASN A O   
1743 C CB  . ASN A 237 ? 0.1531 0.1234 0.1247 -0.0057 0.0122  0.0027  257  ASN A CB  
1744 C CG  . ASN A 237 ? 0.1506 0.1226 0.1297 -0.0108 0.0094  0.0021  257  ASN A CG  
1745 O OD1 . ASN A 237 ? 0.1570 0.1088 0.1417 -0.0117 0.0104  0.0020  257  ASN A OD1 
1746 N ND2 . ASN A 237 ? 0.1497 0.1115 0.1198 -0.0057 0.0123  -0.0023 257  ASN A ND2 
1747 N N   . GLU A 238 ? 0.1507 0.1237 0.1395 -0.0062 0.0058  0.0038  258  GLU A N   
1748 C CA  . GLU A 238 ? 0.1556 0.1527 0.1454 -0.0018 0.0105  0.0046  258  GLU A CA  
1749 C C   . GLU A 238 ? 0.1551 0.1428 0.1373 -0.0086 0.0104  0.0105  258  GLU A C   
1750 O O   . GLU A 238 ? 0.1622 0.1772 0.1379 0.0027  0.0117  0.0071  258  GLU A O   
1751 C CB  . GLU A 238 ? 0.1742 0.1545 0.1763 -0.0102 0.0107  0.0067  258  GLU A CB  
1752 C CG  . GLU A 238 ? 0.1858 0.1659 0.2048 0.0021  -0.0051 0.0044  258  GLU A CG  
1753 C CD  . GLU A 238 ? 0.1960 0.1760 0.2476 -0.0065 -0.0107 -0.0012 258  GLU A CD  
1754 O OE1 . GLU A 238 ? 0.2054 0.1897 0.2999 -0.0141 -0.0341 -0.0148 258  GLU A OE1 
1755 O OE2 . GLU A 238 ? 0.1976 0.1787 0.2686 -0.0043 -0.0080 0.0015  258  GLU A OE2 
1756 N N   . LYS A 239 ? 0.1391 0.1379 0.1240 -0.0084 0.0084  0.0018  259  LYS A N   
1757 C CA  . LYS A 239 ? 0.1420 0.1309 0.1329 -0.0109 0.0115  0.0013  259  LYS A CA  
1758 C C   . LYS A 239 ? 0.1293 0.1259 0.1200 -0.0040 0.0160  0.0008  259  LYS A C   
1759 O O   . LYS A 239 ? 0.1262 0.1338 0.1257 -0.0050 0.0278  -0.0043 259  LYS A O   
1760 C CB  . LYS A 239 ? 0.1542 0.1498 0.1438 -0.0126 0.0006  -0.0033 259  LYS A CB  
1761 C CG  . LYS A 239 ? 0.1893 0.1424 0.1761 -0.0155 0.0032  0.0056  259  LYS A CG  
1762 C CD  . LYS A 239 ? 0.2190 0.1874 0.1869 -0.0106 -0.0126 -0.0073 259  LYS A CD  
1763 C CE  . LYS A 239 ? 0.2696 0.1869 0.2318 -0.0145 -0.0054 -0.0111 259  LYS A CE  
1764 N NZ  . LYS A 239 ? 0.3155 0.2403 0.2236 0.0066  -0.0035 -0.0251 259  LYS A NZ  
1765 N N   . TYR A 240 ? 0.1222 0.1044 0.1112 -0.0045 0.0052  -0.0001 260  TYR A N   
1766 C CA  . TYR A 240 ? 0.1209 0.1069 0.1011 -0.0056 0.0053  0.0034  260  TYR A CA  
1767 C C   . TYR A 240 ? 0.1158 0.1046 0.1068 -0.0071 0.0084  -0.0009 260  TYR A C   
1768 O O   . TYR A 240 ? 0.1198 0.1023 0.1123 -0.0069 0.0093  -0.0019 260  TYR A O   
1769 C CB  . TYR A 240 ? 0.1133 0.1057 0.1027 -0.0075 0.0079  0.0043  260  TYR A CB  
1770 C CG  . TYR A 240 ? 0.1185 0.1076 0.0950 -0.0051 0.0062  0.0065  260  TYR A CG  
1771 C CD1 . TYR A 240 ? 0.1142 0.1104 0.0942 -0.0062 0.0050  0.0110  260  TYR A CD1 
1772 C CD2 . TYR A 240 ? 0.1243 0.1100 0.0993 -0.0069 -0.0015 0.0069  260  TYR A CD2 
1773 C CE1 . TYR A 240 ? 0.1201 0.1192 0.0942 -0.0063 0.0006  0.0086  260  TYR A CE1 
1774 C CE2 . TYR A 240 ? 0.1208 0.1193 0.1032 -0.0092 -0.0012 0.0032  260  TYR A CE2 
1775 C CZ  . TYR A 240 ? 0.1248 0.1232 0.0968 -0.0058 -0.0002 0.0042  260  TYR A CZ  
1776 O OH  . TYR A 240 ? 0.1322 0.1561 0.1089 -0.0016 -0.0094 -0.0005 260  TYR A OH  
1777 N N   . CYS A 241 ? 0.1113 0.1011 0.1010 -0.0059 0.0046  0.0068  261  CYS A N   
1778 C CA  . CYS A 241 ? 0.1172 0.1002 0.0980 -0.0052 0.0004  0.0065  261  CYS A CA  
1779 C C   . CYS A 241 ? 0.1177 0.0960 0.0957 -0.0062 -0.0009 0.0080  261  CYS A C   
1780 O O   . CYS A 241 ? 0.1350 0.0969 0.1084 -0.0121 0.0063  0.0085  261  CYS A O   
1781 C CB  . CYS A 241 ? 0.1227 0.1071 0.1003 -0.0016 0.0007  0.0017  261  CYS A CB  
1782 S SG  . CYS A 241 ? 0.1559 0.1258 0.0797 -0.0095 -0.0006 0.0128  261  CYS A SG  
1783 N N   . ILE A 242 ? 0.1177 0.1024 0.0904 -0.0020 0.0010  0.0053  262  ILE A N   
1784 C CA  . ILE A 242 ? 0.1114 0.0948 0.0965 -0.0018 0.0003  0.0048  262  ILE A CA  
1785 C C   . ILE A 242 ? 0.1133 0.1066 0.0946 0.0015  -0.0031 0.0046  262  ILE A C   
1786 O O   . ILE A 242 ? 0.1242 0.1122 0.0921 0.0041  -0.0058 0.0025  262  ILE A O   
1787 C CB  . ILE A 242 ? 0.1082 0.0948 0.0978 -0.0030 -0.0042 0.0037  262  ILE A CB  
1788 C CG1 . ILE A 242 ? 0.1049 0.0901 0.0959 -0.0037 0.0010  0.0003  262  ILE A CG1 
1789 C CG2 . ILE A 242 ? 0.1141 0.0935 0.0977 -0.0029 -0.0024 -0.0018 262  ILE A CG2 
1790 C CD1 . ILE A 242 ? 0.1003 0.0900 0.0914 -0.0090 -0.0034 0.0015  262  ILE A CD1 
1791 N N   . PHE A 243 ? 0.1107 0.1120 0.1098 -0.0061 -0.0025 0.0008  263  PHE A N   
1792 C CA  . PHE A 243 ? 0.1089 0.1118 0.1083 -0.0008 -0.0037 0.0012  263  PHE A CA  
1793 C C   . PHE A 243 ? 0.1193 0.1172 0.1173 0.0053  -0.0012 -0.0074 263  PHE A C   
1794 O O   . PHE A 243 ? 0.1288 0.1384 0.1365 0.0094  -0.0168 -0.0240 263  PHE A O   
1795 C CB  . PHE A 243 ? 0.1086 0.1056 0.1033 0.0022  -0.0055 -0.0008 263  PHE A CB  
1796 C CG  . PHE A 243 ? 0.0988 0.1025 0.0944 -0.0027 -0.0017 0.0022  263  PHE A CG  
1797 C CD1 . PHE A 243 ? 0.0997 0.1012 0.0915 0.0011  0.0000  0.0031  263  PHE A CD1 
1798 C CD2 . PHE A 243 ? 0.0988 0.1025 0.0894 -0.0012 -0.0016 0.0036  263  PHE A CD2 
1799 C CE1 . PHE A 243 ? 0.1111 0.0991 0.0898 0.0008  0.0000  0.0023  263  PHE A CE1 
1800 C CE2 . PHE A 243 ? 0.0982 0.1004 0.0885 -0.0027 -0.0035 0.0018  263  PHE A CE2 
1801 C CZ  . PHE A 243 ? 0.1019 0.0987 0.0946 -0.0002 -0.0042 0.0040  263  PHE A CZ  
1802 N N   . ALA A 244 ? 0.1253 0.1156 0.1222 0.0015  -0.0046 -0.0028 264  ALA A N   
1803 C CA  . ALA A 244 ? 0.1294 0.1226 0.1297 0.0050  0.0047  -0.0033 264  ALA A CA  
1804 C C   . ALA A 244 ? 0.1311 0.1230 0.1208 0.0024  0.0068  -0.0028 264  ALA A C   
1805 O O   . ALA A 244 ? 0.1404 0.1284 0.1179 -0.0011 0.0070  -0.0075 264  ALA A O   
1806 C CB  . ALA A 244 ? 0.1411 0.1316 0.1213 0.0047  0.0071  -0.0021 264  ALA A CB  
1807 N N   . ASN A 245 ? 0.1381 0.1237 0.1189 0.0052  0.0127  -0.0009 265  ASN A N   
1808 C CA  . ASN A 245 ? 0.1447 0.1279 0.1333 0.0003  0.0074  -0.0039 265  ASN A CA  
1809 C C   . ASN A 245 ? 0.1427 0.1200 0.1316 -0.0037 0.0094  0.0013  265  ASN A C   
1810 O O   . ASN A 245 ? 0.1411 0.1190 0.1150 -0.0005 0.0090  -0.0003 265  ASN A O   
1811 C CB  . ASN A 245 ? 0.1624 0.1468 0.1376 -0.0037 0.0166  0.0008  265  ASN A CB  
1812 C CG  . ASN A 245 ? 0.1731 0.1475 0.1453 -0.0038 0.0112  0.0067  265  ASN A CG  
1813 O OD1 . ASN A 245 ? 0.2050 0.1431 0.1657 -0.0098 0.0234  0.0130  265  ASN A OD1 
1814 N ND2 . ASN A 245 ? 0.1756 0.1684 0.1527 -0.0059 -0.0005 0.0098  265  ASN A ND2 
1815 N N   . PHE A 246 ? 0.1512 0.1238 0.1315 -0.0047 0.0020  0.0015  266  PHE A N   
1816 C CA  . PHE A 246 ? 0.1544 0.1301 0.1385 0.0000  0.0039  0.0040  266  PHE A CA  
1817 C C   . PHE A 246 ? 0.1591 0.1421 0.1442 0.0031  0.0136  0.0009  266  PHE A C   
1818 O O   . PHE A 246 ? 0.1777 0.1484 0.1551 0.0050  0.0262  0.0123  266  PHE A O   
1819 C CB  . PHE A 246 ? 0.1484 0.1370 0.1376 0.0004  0.0038  0.0066  266  PHE A CB  
1820 C CG  . PHE A 246 ? 0.1458 0.1340 0.1382 0.0020  0.0035  0.0062  266  PHE A CG  
1821 C CD1 . PHE A 246 ? 0.1382 0.1322 0.1328 0.0028  -0.0018 0.0078  266  PHE A CD1 
1822 C CD2 . PHE A 246 ? 0.1468 0.1382 0.1347 0.0072  0.0047  0.0082  266  PHE A CD2 
1823 C CE1 . PHE A 246 ? 0.1458 0.1360 0.1401 0.0054  0.0077  0.0085  266  PHE A CE1 
1824 C CE2 . PHE A 246 ? 0.1462 0.1464 0.1392 0.0012  0.0066  0.0091  266  PHE A CE2 
1825 C CZ  . PHE A 246 ? 0.1528 0.1372 0.1380 0.0053  0.0109  0.0135  266  PHE A CZ  
1826 N N   . SER A 247 ? 0.1706 0.1471 0.1482 0.0132  0.0094  0.0007  267  SER A N   
1827 C CA  . SER A 247 ? 0.1524 0.1545 0.1506 0.0138  0.0032  0.0071  267  SER A CA  
1828 C C   . SER A 247 ? 0.1565 0.1655 0.1548 0.0182  0.0008  0.0144  267  SER A C   
1829 O O   . SER A 247 ? 0.1461 0.1722 0.1632 0.0197  0.0077  0.0306  267  SER A O   
1830 C CB  . SER A 247 ? 0.1455 0.1577 0.1402 0.0198  0.0106  0.0087  267  SER A CB  
1831 O OG  . SER A 247 ? 0.1488 0.1723 0.1374 0.0255  0.0159  0.0044  267  SER A OG  
1832 N N   . VAL A 248 ? 0.1614 0.1794 0.1666 0.0113  -0.0114 0.0151  268  VAL A N   
1833 C CA  . VAL A 248 ? 0.1623 0.2051 0.1836 0.0157  -0.0160 0.0106  268  VAL A CA  
1834 C C   . VAL A 248 ? 0.1718 0.2171 0.1903 0.0094  -0.0096 0.0094  268  VAL A C   
1835 O O   . VAL A 248 ? 0.1624 0.2471 0.2043 0.0046  -0.0019 0.0093  268  VAL A O   
1836 C CB  . VAL A 248 ? 0.1849 0.2003 0.1865 0.0110  -0.0161 0.0091  268  VAL A CB  
1837 C CG1 . VAL A 248 ? 0.1849 0.2085 0.1841 0.0122  -0.0177 0.0146  268  VAL A CG1 
1838 C CG2 . VAL A 248 ? 0.1797 0.2010 0.1807 0.0131  -0.0214 0.0100  268  VAL A CG2 
1839 N N   . THR A 249 ? 0.1759 0.2195 0.1874 0.0077  0.0026  0.0138  269  THR A N   
1840 C CA  . THR A 249 ? 0.1835 0.2080 0.1946 0.0039  0.0012  0.0189  269  THR A CA  
1841 C C   . THR A 249 ? 0.1854 0.2035 0.2117 0.0017  0.0042  0.0166  269  THR A C   
1842 O O   . THR A 249 ? 0.1837 0.2166 0.2428 0.0023  0.0018  0.0285  269  THR A O   
1843 C CB  . THR A 249 ? 0.1919 0.1985 0.1804 0.0041  0.0028  0.0090  269  THR A CB  
1844 O OG1 . THR A 249 ? 0.1832 0.1870 0.1684 0.0168  -0.0074 0.0181  269  THR A OG1 
1845 C CG2 . THR A 249 ? 0.1964 0.1926 0.1751 0.0118  -0.0024 0.0207  269  THR A CG2 
1846 N N   . GLY A 250 ? 0.1857 0.2052 0.2065 0.0012  -0.0014 0.0173  270  GLY A N   
1847 C CA  . GLY A 250 ? 0.1894 0.2058 0.1984 0.0052  -0.0076 0.0195  270  GLY A CA  
1848 C C   . GLY A 250 ? 0.1861 0.1969 0.1984 0.0105  -0.0015 0.0154  270  GLY A C   
1849 O O   . GLY A 250 ? 0.1833 0.2102 0.2063 0.0100  -0.0051 0.0008  270  GLY A O   
1850 N N   . GLY A 251 ? 0.1868 0.1974 0.1823 0.0079  0.0044  0.0193  271  GLY A N   
1851 C CA  . GLY A 251 ? 0.1833 0.1907 0.1959 0.0093  0.0041  0.0211  271  GLY A CA  
1852 C C   . GLY A 251 ? 0.2023 0.1984 0.1851 0.0150  0.0073  0.0178  271  GLY A C   
1853 O O   . GLY A 251 ? 0.2070 0.2107 0.1889 0.0222  0.0194  0.0327  271  GLY A O   
1854 N N   . LYS A 252 ? 0.1919 0.2007 0.1918 0.0047  0.0102  0.0206  272  LYS A N   
1855 C CA  . LYS A 252 ? 0.1791 0.1892 0.1913 0.0003  0.0002  0.0101  272  LYS A CA  
1856 C C   . LYS A 252 ? 0.1709 0.1720 0.1703 0.0124  -0.0100 0.0202  272  LYS A C   
1857 O O   . LYS A 252 ? 0.1400 0.1681 0.1799 0.0199  -0.0233 0.0200  272  LYS A O   
1858 C CB  . LYS A 252 ? 0.1991 0.2120 0.1997 0.0033  -0.0098 0.0168  272  LYS A CB  
1859 C CG  . LYS A 252 ? 0.2285 0.2260 0.2452 -0.0061 -0.0207 0.0032  272  LYS A CG  
1860 C CD  . LYS A 252 ? 0.2427 0.2537 0.2504 0.0020  -0.0044 -0.0041 272  LYS A CD  
1861 C CE  . LYS A 252 ? 0.2418 0.2587 0.2744 -0.0009 -0.0042 -0.0071 272  LYS A CE  
1862 N NZ  . LYS A 252 ? 0.2569 0.3262 0.2658 -0.0047 0.0099  -0.0142 272  LYS A NZ  
1863 N N   . TRP A 253 ? 0.1507 0.1632 0.1600 0.0039  -0.0049 0.0110  273  TRP A N   
1864 C CA  . TRP A 253 ? 0.1502 0.1449 0.1521 0.0063  -0.0021 0.0094  273  TRP A CA  
1865 C C   . TRP A 253 ? 0.1426 0.1314 0.1334 -0.0022 -0.0086 0.0101  273  TRP A C   
1866 O O   . TRP A 253 ? 0.1444 0.1283 0.1378 -0.0039 -0.0030 0.0119  273  TRP A O   
1867 C CB  . TRP A 253 ? 0.1572 0.1565 0.1507 0.0079  0.0017  0.0085  273  TRP A CB  
1868 C CG  . TRP A 253 ? 0.1562 0.1619 0.1620 0.0066  0.0038  -0.0001 273  TRP A CG  
1869 C CD1 . TRP A 253 ? 0.1697 0.1647 0.1705 0.0047  0.0063  0.0030  273  TRP A CD1 
1870 C CD2 . TRP A 253 ? 0.1628 0.1567 0.1719 0.0039  0.0015  0.0000  273  TRP A CD2 
1871 N NE1 . TRP A 253 ? 0.1736 0.1622 0.1734 0.0077  0.0077  0.0002  273  TRP A NE1 
1872 C CE2 . TRP A 253 ? 0.1695 0.1633 0.1703 0.0037  0.0042  0.0044  273  TRP A CE2 
1873 C CE3 . TRP A 253 ? 0.1695 0.1586 0.1816 0.0029  0.0049  0.0036  273  TRP A CE3 
1874 C CZ2 . TRP A 253 ? 0.1733 0.1622 0.1800 0.0050  0.0035  0.0027  273  TRP A CZ2 
1875 C CZ3 . TRP A 253 ? 0.1723 0.1625 0.1820 0.0010  0.0031  0.0014  273  TRP A CZ3 
1876 C CH2 . TRP A 253 ? 0.1618 0.1628 0.1864 0.0044  0.0024  0.0055  273  TRP A CH2 
1877 N N   . ILE A 254 ? 0.1364 0.1217 0.1240 0.0038  -0.0121 0.0071  274  ILE A N   
1878 C CA  . ILE A 254 ? 0.1374 0.1177 0.1226 0.0003  -0.0079 0.0028  274  ILE A CA  
1879 C C   . ILE A 254 ? 0.1394 0.1111 0.1175 0.0036  -0.0057 -0.0050 274  ILE A C   
1880 O O   . ILE A 254 ? 0.1453 0.1021 0.1153 0.0125  -0.0004 0.0000  274  ILE A O   
1881 C CB  . ILE A 254 ? 0.1382 0.1336 0.1230 -0.0072 -0.0055 0.0007  274  ILE A CB  
1882 C CG1 . ILE A 254 ? 0.1301 0.1361 0.1309 0.0004  -0.0089 0.0048  274  ILE A CG1 
1883 C CG2 . ILE A 254 ? 0.1426 0.1288 0.1453 -0.0022 -0.0058 0.0032  274  ILE A CG2 
1884 C CD1 . ILE A 254 ? 0.1441 0.1402 0.1368 -0.0024 -0.0081 0.0022  274  ILE A CD1 
1885 N N   . VAL A 255 ? 0.1319 0.1166 0.1154 0.0048  -0.0080 -0.0012 275  VAL A N   
1886 C CA  . VAL A 255 ? 0.1264 0.1111 0.1154 -0.0001 -0.0065 0.0013  275  VAL A CA  
1887 C C   . VAL A 255 ? 0.1271 0.1172 0.1132 -0.0003 -0.0036 0.0011  275  VAL A C   
1888 O O   . VAL A 255 ? 0.1351 0.1247 0.1226 0.0052  -0.0035 -0.0081 275  VAL A O   
1889 C CB  . VAL A 255 ? 0.1240 0.1130 0.1120 -0.0069 -0.0071 -0.0034 275  VAL A CB  
1890 C CG1 . VAL A 255 ? 0.1332 0.1147 0.1134 -0.0046 -0.0084 0.0023  275  VAL A CG1 
1891 C CG2 . VAL A 255 ? 0.1236 0.1065 0.1177 -0.0021 -0.0123 0.0042  275  VAL A CG2 
1892 N N   . SER A 256 ? 0.1267 0.1135 0.1073 0.0047  -0.0067 0.0039  276  SER A N   
1893 C CA  . SER A 256 ? 0.1240 0.1270 0.1092 -0.0003 -0.0044 -0.0007 276  SER A CA  
1894 C C   . SER A 256 ? 0.1187 0.1164 0.1108 0.0053  -0.0037 -0.0032 276  SER A C   
1895 O O   . SER A 256 ? 0.1342 0.1364 0.1166 0.0154  -0.0096 -0.0170 276  SER A O   
1896 C CB  . SER A 256 ? 0.1285 0.1350 0.1160 -0.0037 -0.0040 0.0058  276  SER A CB  
1897 O OG  . SER A 256 ? 0.1343 0.1503 0.1216 0.0019  0.0008  0.0066  276  SER A OG  
1898 N N   . GLY A 257 ? 0.1175 0.1071 0.1064 0.0020  -0.0028 -0.0032 277  GLY A N   
1899 C CA  . GLY A 257 ? 0.1165 0.0964 0.1132 0.0001  -0.0049 0.0029  277  GLY A CA  
1900 C C   . GLY A 257 ? 0.1189 0.0981 0.1102 -0.0041 -0.0036 0.0017  277  GLY A C   
1901 O O   . GLY A 257 ? 0.1370 0.1027 0.1093 -0.0018 -0.0117 -0.0033 277  GLY A O   
1902 N N   . SER A 258 ? 0.1158 0.0989 0.1052 -0.0063 -0.0006 0.0100  278  SER A N   
1903 C CA  . SER A 258 ? 0.1164 0.0998 0.0999 -0.0088 -0.0029 0.0084  278  SER A CA  
1904 C C   . SER A 258 ? 0.1138 0.1001 0.1067 -0.0066 -0.0020 0.0034  278  SER A C   
1905 O O   . SER A 258 ? 0.1277 0.0977 0.1079 -0.0055 -0.0091 0.0030  278  SER A O   
1906 C CB  . SER A 258 ? 0.1191 0.1101 0.1124 -0.0001 -0.0027 0.0039  278  SER A CB  
1907 O OG  . SER A 258 ? 0.1398 0.1010 0.1044 0.0033  -0.0023 0.0137  278  SER A OG  
1908 N N   . GLU A 259 ? 0.1124 0.1014 0.1048 -0.0056 -0.0004 0.0000  279  GLU A N   
1909 C CA  . GLU A 259 ? 0.1101 0.1036 0.1046 -0.0099 0.0026  0.0002  279  GLU A CA  
1910 C C   . GLU A 259 ? 0.1170 0.1047 0.1016 -0.0102 0.0034  0.0013  279  GLU A C   
1911 O O   . GLU A 259 ? 0.1213 0.1252 0.1021 -0.0095 0.0007  -0.0084 279  GLU A O   
1912 C CB  . GLU A 259 ? 0.1204 0.1117 0.1049 -0.0121 0.0072  -0.0011 279  GLU A CB  
1913 C CG  . GLU A 259 ? 0.1350 0.1111 0.1090 -0.0069 0.0054  -0.0018 279  GLU A CG  
1914 C CD  . GLU A 259 ? 0.1419 0.1186 0.1139 -0.0132 0.0113  -0.0024 279  GLU A CD  
1915 O OE1 . GLU A 259 ? 0.1560 0.1222 0.1262 -0.0182 0.0100  0.0042  279  GLU A OE1 
1916 O OE2 . GLU A 259 ? 0.1521 0.1182 0.1014 -0.0127 0.0207  0.0016  279  GLU A OE2 
1917 N N   . ASP A 260 ? 0.1223 0.1124 0.0996 -0.0062 0.0040  -0.0010 280  ASP A N   
1918 C CA  . ASP A 260 ? 0.1283 0.1092 0.1057 -0.0054 0.0030  -0.0049 280  ASP A CA  
1919 C C   . ASP A 260 ? 0.1369 0.1084 0.1090 -0.0071 0.0045  -0.0027 280  ASP A C   
1920 O O   . ASP A 260 ? 0.1510 0.1245 0.1105 -0.0057 0.0044  -0.0108 280  ASP A O   
1921 C CB  . ASP A 260 ? 0.1311 0.1108 0.1092 -0.0075 -0.0071 0.0035  280  ASP A CB  
1922 C CG  . ASP A 260 ? 0.1344 0.1116 0.1139 -0.0012 -0.0123 0.0046  280  ASP A CG  
1923 O OD1 . ASP A 260 ? 0.1411 0.1213 0.1122 -0.0103 -0.0187 0.0027  280  ASP A OD1 
1924 O OD2 . ASP A 260 ? 0.1553 0.1209 0.1324 0.0101  -0.0210 0.0091  280  ASP A OD2 
1925 N N   . ASN A 261 ? 0.1346 0.1082 0.1044 -0.0068 0.0103  -0.0054 281  ASN A N   
1926 C CA  . ASN A 261 ? 0.1158 0.1088 0.1068 -0.0067 0.0013  -0.0004 281  ASN A CA  
1927 C C   . ASN A 261 ? 0.1151 0.1042 0.0998 -0.0047 0.0036  0.0010  281  ASN A C   
1928 O O   . ASN A 261 ? 0.1300 0.1011 0.1015 -0.0096 0.0016  0.0015  281  ASN A O   
1929 C CB  . ASN A 261 ? 0.1248 0.1091 0.1037 -0.0107 0.0009  0.0026  281  ASN A CB  
1930 C CG  . ASN A 261 ? 0.1251 0.1179 0.1017 -0.0058 -0.0032 0.0081  281  ASN A CG  
1931 O OD1 . ASN A 261 ? 0.1413 0.1260 0.1079 0.0082  -0.0023 0.0036  281  ASN A OD1 
1932 N ND2 . ASN A 261 ? 0.1387 0.1280 0.1142 -0.0142 -0.0081 -0.0013 281  ASN A ND2 
1933 N N   . LEU A 262 ? 0.1118 0.1066 0.1046 -0.0018 0.0053  -0.0007 282  LEU A N   
1934 C CA  . LEU A 262 ? 0.1101 0.1054 0.1052 -0.0023 0.0003  0.0011  282  LEU A CA  
1935 C C   . LEU A 262 ? 0.1107 0.1098 0.1094 -0.0016 0.0001  -0.0022 282  LEU A C   
1936 O O   . LEU A 262 ? 0.1182 0.1235 0.1185 -0.0083 0.0109  -0.0082 282  LEU A O   
1937 C CB  . LEU A 262 ? 0.1217 0.1074 0.1093 0.0024  -0.0033 0.0013  282  LEU A CB  
1938 C CG  . LEU A 262 ? 0.1349 0.1042 0.1144 -0.0045 -0.0012 0.0011  282  LEU A CG  
1939 C CD1 . LEU A 262 ? 0.1392 0.1056 0.1270 -0.0027 -0.0127 0.0037  282  LEU A CD1 
1940 C CD2 . LEU A 262 ? 0.1358 0.1073 0.1123 -0.0030 -0.0042 0.0054  282  LEU A CD2 
1941 N N   . VAL A 263 ? 0.1106 0.1055 0.1117 -0.0021 -0.0010 0.0012  283  VAL A N   
1942 C CA  . VAL A 263 ? 0.1202 0.1081 0.1059 0.0005  0.0005  -0.0054 283  VAL A CA  
1943 C C   . VAL A 263 ? 0.1278 0.1090 0.1063 0.0058  0.0061  -0.0032 283  VAL A C   
1944 O O   . VAL A 263 ? 0.1411 0.1188 0.1069 0.0111  0.0139  -0.0003 283  VAL A O   
1945 C CB  . VAL A 263 ? 0.1179 0.1146 0.1167 0.0000  0.0048  -0.0048 283  VAL A CB  
1946 C CG1 . VAL A 263 ? 0.1204 0.1160 0.1260 -0.0024 -0.0063 0.0016  283  VAL A CG1 
1947 C CG2 . VAL A 263 ? 0.1118 0.1212 0.1118 0.0000  -0.0011 -0.0031 283  VAL A CG2 
1948 N N   . TYR A 264 ? 0.1303 0.1139 0.1058 0.0062  0.0114  -0.0049 284  TYR A N   
1949 C CA  . TYR A 264 ? 0.1342 0.1132 0.1042 0.0056  0.0111  -0.0053 284  TYR A CA  
1950 C C   . TYR A 264 ? 0.1366 0.1109 0.1080 0.0051  0.0073  -0.0031 284  TYR A C   
1951 O O   . TYR A 264 ? 0.1501 0.1082 0.0993 0.0101  0.0119  -0.0013 284  TYR A O   
1952 C CB  . TYR A 264 ? 0.1321 0.1161 0.1067 0.0033  0.0087  0.0003  284  TYR A CB  
1953 C CG  . TYR A 264 ? 0.1305 0.1156 0.1146 0.0048  0.0115  -0.0037 284  TYR A CG  
1954 C CD1 . TYR A 264 ? 0.1367 0.1172 0.1074 0.0066  0.0113  0.0020  284  TYR A CD1 
1955 C CD2 . TYR A 264 ? 0.1336 0.1183 0.1169 0.0080  0.0084  0.0045  284  TYR A CD2 
1956 C CE1 . TYR A 264 ? 0.1338 0.1188 0.1184 0.0069  0.0118  0.0012  284  TYR A CE1 
1957 C CE2 . TYR A 264 ? 0.1354 0.1237 0.1347 0.0039  0.0066  0.0025  284  TYR A CE2 
1958 C CZ  . TYR A 264 ? 0.1394 0.1189 0.1271 0.0053  0.0090  0.0021  284  TYR A CZ  
1959 O OH  . TYR A 264 ? 0.1564 0.1314 0.1584 -0.0051 -0.0053 -0.0037 284  TYR A OH  
1960 N N   . ILE A 265 ? 0.1369 0.1146 0.1006 0.0065  0.0086  -0.0061 285  ILE A N   
1961 C CA  . ILE A 265 ? 0.1379 0.1147 0.1189 0.0057  0.0036  -0.0037 285  ILE A CA  
1962 C C   . ILE A 265 ? 0.1544 0.1188 0.1238 0.0063  0.0020  0.0016  285  ILE A C   
1963 O O   . ILE A 265 ? 0.1748 0.1192 0.1284 0.0096  -0.0032 0.0008  285  ILE A O   
1964 C CB  . ILE A 265 ? 0.1363 0.1175 0.1234 0.0016  0.0047  -0.0057 285  ILE A CB  
1965 C CG1 . ILE A 265 ? 0.1375 0.1170 0.1329 0.0036  0.0000  -0.0062 285  ILE A CG1 
1966 C CG2 . ILE A 265 ? 0.1340 0.1212 0.1315 0.0064  0.0015  0.0002  285  ILE A CG2 
1967 C CD1 . ILE A 265 ? 0.1491 0.1288 0.1347 0.0052  0.0081  -0.0104 285  ILE A CD1 
1968 N N   . TRP A 266 ? 0.1559 0.1204 0.1258 0.0069  -0.0059 0.0082  286  TRP A N   
1969 C CA  . TRP A 266 ? 0.1505 0.1246 0.1348 0.0103  -0.0019 0.0096  286  TRP A CA  
1970 C C   . TRP A 266 ? 0.1512 0.1339 0.1459 0.0079  -0.0038 0.0137  286  TRP A C   
1971 O O   . TRP A 266 ? 0.1515 0.1307 0.1459 0.0120  -0.0066 0.0149  286  TRP A O   
1972 C CB  . TRP A 266 ? 0.1354 0.1207 0.1373 0.0052  -0.0039 0.0108  286  TRP A CB  
1973 C CG  . TRP A 266 ? 0.1336 0.1115 0.1235 0.0072  -0.0047 0.0070  286  TRP A CG  
1974 C CD1 . TRP A 266 ? 0.1267 0.1145 0.1269 0.0052  -0.0085 0.0095  286  TRP A CD1 
1975 C CD2 . TRP A 266 ? 0.1308 0.1132 0.1255 0.0050  -0.0096 0.0087  286  TRP A CD2 
1976 N NE1 . TRP A 266 ? 0.1266 0.1053 0.1277 0.0070  -0.0094 0.0095  286  TRP A NE1 
1977 C CE2 . TRP A 266 ? 0.1310 0.1034 0.1208 0.0072  -0.0093 0.0046  286  TRP A CE2 
1978 C CE3 . TRP A 266 ? 0.1298 0.1099 0.1212 0.0015  -0.0077 0.0025  286  TRP A CE3 
1979 C CZ2 . TRP A 266 ? 0.1272 0.1081 0.1228 0.0017  -0.0123 0.0040  286  TRP A CZ2 
1980 C CZ3 . TRP A 266 ? 0.1305 0.1114 0.1111 0.0012  -0.0115 0.0040  286  TRP A CZ3 
1981 C CH2 . TRP A 266 ? 0.1243 0.1092 0.1085 0.0063  -0.0124 0.0046  286  TRP A CH2 
1982 N N   . ASN A 267 ? 0.1595 0.1371 0.1740 0.0153  -0.0037 0.0085  287  ASN A N   
1983 C CA  . ASN A 267 ? 0.1708 0.1585 0.1749 0.0187  -0.0148 0.0123  287  ASN A CA  
1984 C C   . ASN A 267 ? 0.1870 0.1637 0.1772 0.0164  -0.0115 0.0100  287  ASN A C   
1985 O O   . ASN A 267 ? 0.1969 0.1577 0.1810 0.0195  -0.0089 0.0138  287  ASN A O   
1986 C CB  . ASN A 267 ? 0.1811 0.1693 0.1875 0.0268  -0.0010 0.0000  287  ASN A CB  
1987 C CG  . ASN A 267 ? 0.1838 0.1847 0.1986 0.0325  -0.0061 0.0043  287  ASN A CG  
1988 O OD1 . ASN A 267 ? 0.1943 0.1815 0.1984 0.0429  -0.0069 0.0114  287  ASN A OD1 
1989 N ND2 . ASN A 267 ? 0.1842 0.2251 0.2085 0.0335  -0.0018 0.0029  287  ASN A ND2 
1990 N N   . LEU A 268 ? 0.1972 0.1716 0.1844 0.0056  -0.0163 0.0115  288  LEU A N   
1991 C CA  . LEU A 268 ? 0.2093 0.1845 0.1905 0.0067  -0.0083 0.0057  288  LEU A CA  
1992 C C   . LEU A 268 ? 0.2082 0.1980 0.1930 0.0035  -0.0125 0.0126  288  LEU A C   
1993 O O   . LEU A 268 ? 0.2035 0.2046 0.2067 0.0079  -0.0070 0.0178  288  LEU A O   
1994 C CB  . LEU A 268 ? 0.2020 0.1934 0.2024 -0.0004 -0.0091 0.0164  288  LEU A CB  
1995 C CG  . LEU A 268 ? 0.2033 0.1960 0.2014 -0.0099 -0.0104 0.0137  288  LEU A CG  
1996 C CD1 . LEU A 268 ? 0.2087 0.1895 0.2081 -0.0034 -0.0084 -0.0023 288  LEU A CD1 
1997 C CD2 . LEU A 268 ? 0.1991 0.2124 0.2039 -0.0063 -0.0054 0.0203  288  LEU A CD2 
1998 N N   . GLN A 269 ? 0.2200 0.2056 0.2143 0.0160  -0.0059 0.0184  289  GLN A N   
1999 C CA  . GLN A 269 ? 0.2288 0.2051 0.2168 0.0161  -0.0055 0.0195  289  GLN A CA  
2000 C C   . GLN A 269 ? 0.2195 0.2061 0.2125 0.0170  0.0002  0.0184  289  GLN A C   
2001 O O   . GLN A 269 ? 0.2320 0.1973 0.2207 0.0197  -0.0093 0.0372  289  GLN A O   
2002 C CB  . GLN A 269 ? 0.2343 0.2358 0.2406 0.0259  0.0095  0.0284  289  GLN A CB  
2003 C CG  . GLN A 269 ? 0.2821 0.2807 0.2626 0.0105  0.0082  -0.0066 289  GLN A CG  
2004 C CD  . GLN A 269 ? 0.3201 0.2899 0.2784 0.0382  0.0241  0.0088  289  GLN A CD  
2005 O OE1 . GLN A 269 ? 0.3440 0.3527 0.2875 0.0460  0.0373  -0.0140 289  GLN A OE1 
2006 N NE2 . GLN A 269 ? 0.3211 0.3372 0.2641 0.0453  0.0464  -0.0005 289  GLN A NE2 
2007 N N   . THR A 270 ? 0.2272 0.2058 0.2155 0.0046  -0.0121 0.0178  290  THR A N   
2008 C CA  . THR A 270 ? 0.2107 0.2018 0.2143 0.0103  0.0016  0.0130  290  THR A CA  
2009 C C   . THR A 270 ? 0.2092 0.1908 0.2071 0.0088  0.0044  0.0118  290  THR A C   
2010 O O   . THR A 270 ? 0.2057 0.1855 0.2107 0.0119  0.0114  0.0007  290  THR A O   
2011 C CB  . THR A 270 ? 0.2197 0.2024 0.2080 0.0077  -0.0035 0.0117  290  THR A CB  
2012 O OG1 . THR A 270 ? 0.2180 0.2087 0.2156 0.0221  -0.0036 0.0134  290  THR A OG1 
2013 C CG2 . THR A 270 ? 0.2192 0.2008 0.2098 0.0171  -0.0112 0.0158  290  THR A CG2 
2014 N N   . LYS A 271 ? 0.2131 0.1840 0.2052 0.0063  0.0053  0.0070  291  LYS A N   
2015 C CA  . LYS A 271 ? 0.2098 0.1792 0.2022 -0.0042 0.0077  0.0107  291  LYS A CA  
2016 C C   . LYS A 271 ? 0.2126 0.1683 0.1939 0.0018  0.0079  0.0188  291  LYS A C   
2017 O O   . LYS A 271 ? 0.2082 0.1472 0.1775 0.0188  0.0176  0.0237  291  LYS A O   
2018 C CB  . LYS A 271 ? 0.2293 0.1868 0.2054 -0.0059 0.0135  0.0148  291  LYS A CB  
2019 C CG  . LYS A 271 ? 0.2405 0.2036 0.2153 -0.0027 0.0010  0.0079  291  LYS A CG  
2020 C CD  . LYS A 271 ? 0.2625 0.2238 0.2123 -0.0060 -0.0013 0.0160  291  LYS A CD  
2021 C CE  . LYS A 271 ? 0.2749 0.2354 0.2460 0.0045  -0.0122 0.0141  291  LYS A CE  
2022 N NZ  . LYS A 271 ? 0.2912 0.2539 0.2481 -0.0079 -0.0040 0.0188  291  LYS A NZ  
2023 N N   . GLU A 272 ? 0.2123 0.1719 0.2079 0.0121  0.0100  0.0201  292  GLU A N   
2024 C CA  . GLU A 272 ? 0.2292 0.1902 0.2116 0.0052  0.0017  0.0192  292  GLU A CA  
2025 C C   . GLU A 272 ? 0.2093 0.1751 0.2011 0.0114  0.0081  0.0060  292  GLU A C   
2026 O O   . GLU A 272 ? 0.2052 0.1841 0.2150 0.0086  0.0193  0.0126  292  GLU A O   
2027 C CB  . GLU A 272 ? 0.2377 0.2159 0.2582 0.0114  0.0131  -0.0002 292  GLU A CB  
2028 C CG  . GLU A 272 ? 0.2873 0.2452 0.2868 0.0177  0.0027  0.0211  292  GLU A CG  
2029 C CD  . GLU A 272 ? 0.2949 0.2801 0.3357 0.0222  0.0134  -0.0002 292  GLU A CD  
2030 O OE1 . GLU A 272 ? 0.3023 0.3093 0.3699 0.0017  0.0010  -0.0096 292  GLU A OE1 
2031 O OE2 . GLU A 272 ? 0.3615 0.2829 0.3795 0.0231  0.0016  -0.0274 292  GLU A OE2 
2032 N N   . ILE A 273 ? 0.2088 0.1569 0.1922 0.0161  0.0067  0.0151  293  ILE A N   
2033 C CA  . ILE A 273 ? 0.2063 0.1592 0.1882 0.0145  0.0057  0.0105  293  ILE A CA  
2034 C C   . ILE A 273 ? 0.2079 0.1600 0.1875 0.0112  0.0062  0.0034  293  ILE A C   
2035 O O   . ILE A 273 ? 0.2238 0.1601 0.1971 0.0259  0.0046  0.0072  293  ILE A O   
2036 C CB  . ILE A 273 ? 0.2067 0.1588 0.1818 0.0153  0.0065  0.0105  293  ILE A CB  
2037 C CG1 . ILE A 273 ? 0.1922 0.1804 0.1887 0.0112  0.0055  0.0134  293  ILE A CG1 
2038 C CG2 . ILE A 273 ? 0.2176 0.1849 0.1599 0.0139  0.0089  0.0037  293  ILE A CG2 
2039 C CD1 . ILE A 273 ? 0.1954 0.1817 0.1975 0.0038  0.0061  0.0094  293  ILE A CD1 
2040 N N   . VAL A 274 ? 0.1916 0.1582 0.1826 0.0206  0.0067  0.0054  294  VAL A N   
2041 C CA  . VAL A 274 ? 0.1956 0.1512 0.1779 0.0197  0.0078  0.0058  294  VAL A CA  
2042 C C   . VAL A 274 ? 0.1952 0.1548 0.1783 0.0201  0.0061  0.0050  294  VAL A C   
2043 O O   . VAL A 274 ? 0.2018 0.1681 0.1826 0.0337  0.0130  0.0108  294  VAL A O   
2044 C CB  . VAL A 274 ? 0.1945 0.1610 0.1661 0.0191  0.0084  0.0044  294  VAL A CB  
2045 C CG1 . VAL A 274 ? 0.2064 0.1546 0.1671 0.0287  0.0094  -0.0012 294  VAL A CG1 
2046 C CG2 . VAL A 274 ? 0.2001 0.1628 0.1805 0.0202  0.0290  0.0040  294  VAL A CG2 
2047 N N   . GLN A 275 ? 0.1873 0.1546 0.1760 0.0170  0.0055  0.0002  295  GLN A N   
2048 C CA  . GLN A 275 ? 0.1779 0.1534 0.1758 0.0070  0.0053  0.0000  295  GLN A CA  
2049 C C   . GLN A 275 ? 0.1823 0.1464 0.1557 0.0152  0.0057  -0.0065 295  GLN A C   
2050 O O   . GLN A 275 ? 0.1678 0.1355 0.1636 0.0183  0.0120  -0.0076 295  GLN A O   
2051 C CB  . GLN A 275 ? 0.2032 0.1540 0.1819 0.0020  0.0053  0.0100  295  GLN A CB  
2052 C CG  . GLN A 275 ? 0.2204 0.1628 0.1866 -0.0010 0.0132  0.0090  295  GLN A CG  
2053 C CD  . GLN A 275 ? 0.2313 0.1586 0.1767 -0.0014 0.0109  0.0092  295  GLN A CD  
2054 O OE1 . GLN A 275 ? 0.2537 0.1521 0.1533 0.0134  0.0085  0.0059  295  GLN A OE1 
2055 N NE2 . GLN A 275 ? 0.2240 0.1709 0.1818 -0.0009 -0.0019 -0.0063 295  GLN A NE2 
2056 N N   . LYS A 276 ? 0.1895 0.1307 0.1536 0.0050  0.0054  -0.0079 296  LYS A N   
2057 C CA  . LYS A 276 ? 0.1915 0.1525 0.1547 0.0098  0.0065  -0.0083 296  LYS A CA  
2058 C C   . LYS A 276 ? 0.2000 0.1453 0.1538 0.0052  0.0056  -0.0095 296  LYS A C   
2059 O O   . LYS A 276 ? 0.2522 0.1404 0.1686 0.0159  0.0183  -0.0202 296  LYS A O   
2060 C CB  . LYS A 276 ? 0.2010 0.1608 0.1681 0.0013  0.0078  -0.0058 296  LYS A CB  
2061 C CG  . LYS A 276 ? 0.2231 0.1842 0.1725 0.0044  0.0087  0.0022  296  LYS A CG  
2062 C CD  . LYS A 276 ? 0.2338 0.2017 0.2109 -0.0102 0.0078  0.0026  296  LYS A CD  
2063 C CE  . LYS A 276 ? 0.2587 0.2154 0.2282 0.0030  -0.0022 -0.0083 296  LYS A CE  
2064 N NZ  . LYS A 276 ? 0.2812 0.2391 0.2776 -0.0194 -0.0020 0.0052  296  LYS A NZ  
2065 N N   . LEU A 277 ? 0.1607 0.1442 0.1413 0.0048  0.0043  0.0004  297  LEU A N   
2066 C CA  . LEU A 277 ? 0.1484 0.1432 0.1334 0.0039  0.0045  -0.0047 297  LEU A CA  
2067 C C   . LEU A 277 ? 0.1514 0.1374 0.1230 0.0037  0.0024  0.0002  297  LEU A C   
2068 O O   . LEU A 277 ? 0.1562 0.1241 0.1168 0.0103  -0.0024 0.0023  297  LEU A O   
2069 C CB  . LEU A 277 ? 0.1428 0.1432 0.1219 0.0031  0.0041  0.0009  297  LEU A CB  
2070 C CG  . LEU A 277 ? 0.1436 0.1502 0.1197 0.0046  0.0036  0.0019  297  LEU A CG  
2071 C CD1 . LEU A 277 ? 0.1501 0.1519 0.1345 0.0004  0.0016  0.0083  297  LEU A CD1 
2072 C CD2 . LEU A 277 ? 0.1489 0.1472 0.1361 0.0060  0.0044  0.0025  297  LEU A CD2 
2073 N N   . GLN A 278 ? 0.1607 0.1424 0.1281 -0.0021 -0.0012 -0.0058 298  GLN A N   
2074 C CA  . GLN A 278 ? 0.1499 0.1402 0.1402 -0.0006 0.0053  0.0007  298  GLN A CA  
2075 C C   . GLN A 278 ? 0.1457 0.1333 0.1339 0.0010  -0.0030 -0.0064 298  GLN A C   
2076 O O   . GLN A 278 ? 0.1554 0.1401 0.1309 -0.0041 -0.0022 0.0006  298  GLN A O   
2077 C CB  . GLN A 278 ? 0.1646 0.1424 0.1612 0.0002  0.0095  -0.0076 298  GLN A CB  
2078 C CG  . GLN A 278 ? 0.1705 0.1645 0.1866 -0.0056 -0.0008 -0.0050 298  GLN A CG  
2079 C CD  . GLN A 278 ? 0.1930 0.1685 0.2216 -0.0124 -0.0058 -0.0086 298  GLN A CD  
2080 O OE1 . GLN A 278 ? 0.2227 0.1883 0.2534 -0.0287 0.0139  0.0051  298  GLN A OE1 
2081 N NE2 . GLN A 278 ? 0.2105 0.1891 0.2222 -0.0116 -0.0055 -0.0299 298  GLN A NE2 
2082 N N   . GLY A 279 ? 0.1492 0.1157 0.1211 -0.0011 0.0057  -0.0003 299  GLY A N   
2083 C CA  . GLY A 279 ? 0.1457 0.1279 0.1077 0.0083  0.0040  0.0023  299  GLY A CA  
2084 C C   . GLY A 279 ? 0.1387 0.1259 0.1066 -0.0017 0.0077  -0.0001 299  GLY A C   
2085 O O   . GLY A 279 ? 0.1470 0.1319 0.1065 0.0037  0.0071  0.0006  299  GLY A O   
2086 N N   . HIS A 280 ? 0.1209 0.1132 0.1040 -0.0051 0.0015  -0.0001 300  HIS A N   
2087 C CA  . HIS A 280 ? 0.1212 0.1132 0.0960 -0.0048 0.0000  -0.0018 300  HIS A CA  
2088 C C   . HIS A 280 ? 0.1192 0.1099 0.0991 -0.0032 0.0012  -0.0004 300  HIS A C   
2089 O O   . HIS A 280 ? 0.1305 0.1105 0.1046 -0.0040 0.0044  -0.0005 300  HIS A O   
2090 C CB  . HIS A 280 ? 0.1139 0.1101 0.0951 -0.0071 0.0050  -0.0024 300  HIS A CB  
2091 C CG  . HIS A 280 ? 0.1130 0.1077 0.0915 -0.0048 0.0034  -0.0038 300  HIS A CG  
2092 N ND1 . HIS A 280 ? 0.1130 0.1087 0.0980 -0.0023 0.0030  -0.0034 300  HIS A ND1 
2093 C CD2 . HIS A 280 ? 0.1123 0.1085 0.0863 -0.0024 0.0056  -0.0012 300  HIS A CD2 
2094 C CE1 . HIS A 280 ? 0.1153 0.1064 0.0946 -0.0030 0.0085  -0.0082 300  HIS A CE1 
2095 N NE2 . HIS A 280 ? 0.1173 0.1090 0.0923 -0.0039 0.0067  -0.0066 300  HIS A NE2 
2096 N N   . THR A 281 ? 0.1156 0.1168 0.1078 -0.0050 0.0001  0.0000  301  THR A N   
2097 C CA  . THR A 281 ? 0.1123 0.1250 0.1068 -0.0039 0.0000  -0.0006 301  THR A CA  
2098 C C   . THR A 281 ? 0.1143 0.1191 0.0974 -0.0089 -0.0029 -0.0033 301  THR A C   
2099 O O   . THR A 281 ? 0.1179 0.1391 0.1071 -0.0169 0.0026  -0.0046 301  THR A O   
2100 C CB  . THR A 281 ? 0.1095 0.1266 0.1064 -0.0095 -0.0058 -0.0047 301  THR A CB  
2101 O OG1 . THR A 281 ? 0.1224 0.1286 0.1201 -0.0069 -0.0089 -0.0065 301  THR A OG1 
2102 C CG2 . THR A 281 ? 0.1135 0.1348 0.1017 -0.0049 -0.0070 -0.0016 301  THR A CG2 
2103 N N   . ASP A 282 ? 0.1100 0.1139 0.0935 -0.0117 0.0025  -0.0006 302  ASP A N   
2104 C CA  . ASP A 282 ? 0.1034 0.1037 0.0965 -0.0048 0.0000  -0.0045 302  ASP A CA  
2105 C C   . ASP A 282 ? 0.1003 0.0936 0.0943 -0.0028 0.0023  -0.0004 302  ASP A C   
2106 O O   . ASP A 282 ? 0.1001 0.0960 0.1006 -0.0025 -0.0014 -0.0055 302  ASP A O   
2107 C CB  . ASP A 282 ? 0.1136 0.1007 0.0903 -0.0048 0.0019  0.0006  302  ASP A CB  
2108 C CG  . ASP A 282 ? 0.1132 0.1055 0.0951 -0.0038 0.0022  0.0000  302  ASP A CG  
2109 O OD1 . ASP A 282 ? 0.1239 0.1129 0.1011 -0.0069 0.0021  0.0072  302  ASP A OD1 
2110 O OD2 . ASP A 282 ? 0.1400 0.1077 0.0973 0.0064  -0.0047 0.0029  302  ASP A OD2 
2111 N N   . VAL A 283 ? 0.0978 0.0917 0.0896 -0.0041 -0.0025 0.0010  303  VAL A N   
2112 C CA  . VAL A 283 ? 0.0990 0.0989 0.0902 -0.0006 -0.0026 0.0009  303  VAL A CA  
2113 C C   . VAL A 283 ? 0.0982 0.0943 0.0854 0.0015  -0.0066 0.0033  303  VAL A C   
2114 O O   . VAL A 283 ? 0.1015 0.0930 0.0813 0.0025  -0.0130 -0.0008 303  VAL A O   
2115 C CB  . VAL A 283 ? 0.1078 0.1016 0.0916 0.0003  0.0023  0.0022  303  VAL A CB  
2116 C CG1 . VAL A 283 ? 0.1017 0.0972 0.0945 -0.0097 0.0021  0.0027  303  VAL A CG1 
2117 C CG2 . VAL A 283 ? 0.1105 0.1050 0.0872 -0.0035 -0.0034 -0.0026 303  VAL A CG2 
2118 N N   . VAL A 284 ? 0.0994 0.0944 0.0829 0.0025  -0.0068 0.0041  304  VAL A N   
2119 C CA  . VAL A 284 ? 0.1071 0.0954 0.0842 -0.0033 0.0000  0.0014  304  VAL A CA  
2120 C C   . VAL A 284 ? 0.1130 0.0907 0.0837 -0.0001 -0.0009 0.0026  304  VAL A C   
2121 O O   . VAL A 284 ? 0.1310 0.0964 0.0830 0.0042  0.0015  0.0053  304  VAL A O   
2122 C CB  . VAL A 284 ? 0.1061 0.0920 0.0811 -0.0043 -0.0017 0.0008  304  VAL A CB  
2123 C CG1 . VAL A 284 ? 0.1025 0.0953 0.0910 -0.0033 0.0027  -0.0036 304  VAL A CG1 
2124 C CG2 . VAL A 284 ? 0.1077 0.0921 0.0849 -0.0029 0.0085  -0.0048 304  VAL A CG2 
2125 N N   . ILE A 285 ? 0.1067 0.0904 0.0800 -0.0023 0.0029  0.0028  305  ILE A N   
2126 C CA  . ILE A 285 ? 0.1005 0.0860 0.0811 -0.0024 0.0014  0.0031  305  ILE A CA  
2127 C C   . ILE A 285 ? 0.0985 0.0882 0.0847 -0.0005 -0.0006 0.0060  305  ILE A C   
2128 O O   . ILE A 285 ? 0.1157 0.0910 0.0835 -0.0016 -0.0007 0.0173  305  ILE A O   
2129 C CB  . ILE A 285 ? 0.0992 0.0875 0.0814 -0.0013 0.0021  -0.0003 305  ILE A CB  
2130 C CG1 . ILE A 285 ? 0.1058 0.0916 0.0814 0.0037  -0.0028 -0.0009 305  ILE A CG1 
2131 C CG2 . ILE A 285 ? 0.1114 0.0897 0.0824 -0.0016 -0.0009 0.0046  305  ILE A CG2 
2132 C CD1 . ILE A 285 ? 0.0986 0.0730 0.0803 -0.0044 -0.0035 0.0048  305  ILE A CD1 
2133 N N   . SER A 286 ? 0.0999 0.0877 0.0868 -0.0028 0.0001  0.0063  306  SER A N   
2134 C CA  . SER A 286 ? 0.1024 0.0908 0.0925 -0.0024 -0.0051 0.0067  306  SER A CA  
2135 C C   . SER A 286 ? 0.1045 0.0953 0.0968 -0.0031 -0.0023 0.0047  306  SER A C   
2136 O O   . SER A 286 ? 0.1134 0.1056 0.0975 -0.0085 -0.0004 0.0031  306  SER A O   
2137 C CB  . SER A 286 ? 0.1076 0.0912 0.0984 0.0051  -0.0024 0.0055  306  SER A CB  
2138 O OG  . SER A 286 ? 0.1073 0.0914 0.1062 0.0083  -0.0085 0.0029  306  SER A OG  
2139 N N   . THR A 287 ? 0.1068 0.0974 0.0945 -0.0021 -0.0028 0.0057  307  THR A N   
2140 C CA  . THR A 287 ? 0.1113 0.1067 0.1009 0.0003  0.0014  0.0035  307  THR A CA  
2141 C C   . THR A 287 ? 0.1202 0.1041 0.1075 0.0000  0.0004  -0.0017 307  THR A C   
2142 O O   . THR A 287 ? 0.1318 0.1127 0.1069 -0.0033 0.0082  0.0026  307  THR A O   
2143 C CB  . THR A 287 ? 0.1249 0.1075 0.1020 0.0019  0.0014  0.0044  307  THR A CB  
2144 O OG1 . THR A 287 ? 0.1443 0.1120 0.1003 0.0027  -0.0074 0.0077  307  THR A OG1 
2145 C CG2 . THR A 287 ? 0.1267 0.1059 0.1116 -0.0039 -0.0046 0.0049  307  THR A CG2 
2146 N N   . ALA A 288 ? 0.1204 0.1117 0.1094 -0.0014 0.0012  -0.0036 308  ALA A N   
2147 C CA  . ALA A 288 ? 0.1189 0.1119 0.1068 -0.0012 0.0005  0.0000  308  ALA A CA  
2148 C C   . ALA A 288 ? 0.1212 0.1184 0.1087 0.0022  0.0002  -0.0040 308  ALA A C   
2149 O O   . ALA A 288 ? 0.1324 0.1256 0.1081 -0.0001 0.0015  -0.0042 308  ALA A O   
2150 C CB  . ALA A 288 ? 0.1377 0.1104 0.1114 0.0028  -0.0062 -0.0061 308  ALA A CB  
2151 N N   . CYS A 289 ? 0.1216 0.1240 0.1109 0.0041  -0.0012 0.0001  309  CYS A N   
2152 C CA  . CYS A 289 ? 0.1271 0.1259 0.1106 0.0069  0.0016  -0.0021 309  CYS A CA  
2153 C C   . CYS A 289 ? 0.1389 0.1262 0.1160 0.0019  -0.0009 -0.0053 309  CYS A C   
2154 O O   . CYS A 289 ? 0.1590 0.1391 0.1116 -0.0078 -0.0017 -0.0089 309  CYS A O   
2155 C CB  . CYS A 289 ? 0.1430 0.1316 0.1191 0.0132  -0.0060 0.0019  309  CYS A CB  
2156 S SG  . CYS A 289 ? 0.1555 0.1247 0.1264 0.0173  -0.0026 0.0296  309  CYS A SG  
2157 N N   . HIS A 290 ? 0.1403 0.1387 0.1212 -0.0044 0.0033  -0.0060 310  HIS A N   
2158 C CA  . HIS A 290 ? 0.1438 0.1327 0.1232 -0.0010 -0.0025 -0.0028 310  HIS A CA  
2159 C C   . HIS A 290 ? 0.1419 0.1410 0.1286 -0.0020 -0.0036 -0.0036 310  HIS A C   
2160 O O   . HIS A 290 ? 0.1512 0.1435 0.1145 0.0000  -0.0093 -0.0039 310  HIS A O   
2161 C CB  . HIS A 290 ? 0.1434 0.1376 0.1288 -0.0004 0.0066  0.0055  310  HIS A CB  
2162 C CG  . HIS A 290 ? 0.1394 0.1382 0.1325 -0.0028 0.0047  0.0030  310  HIS A CG  
2163 N ND1 . HIS A 290 ? 0.1384 0.1387 0.1296 -0.0035 0.0055  0.0097  310  HIS A ND1 
2164 C CD2 . HIS A 290 ? 0.1417 0.1417 0.1372 -0.0003 0.0009  0.0053  310  HIS A CD2 
2165 C CE1 . HIS A 290 ? 0.1481 0.1394 0.1315 -0.0043 0.0030  0.0111  310  HIS A CE1 
2166 N NE2 . HIS A 290 ? 0.1437 0.1445 0.1202 -0.0016 0.0075  0.0075  310  HIS A NE2 
2167 N N   . PRO A 291 ? 0.1478 0.1466 0.1282 -0.0018 -0.0132 -0.0097 311  PRO A N   
2168 C CA  . PRO A 291 ? 0.1448 0.1519 0.1276 -0.0004 -0.0130 -0.0011 311  PRO A CA  
2169 C C   . PRO A 291 ? 0.1499 0.1737 0.1573 0.0057  -0.0043 0.0016  311  PRO A C   
2170 O O   . PRO A 291 ? 0.1571 0.2083 0.1669 0.0033  -0.0271 -0.0052 311  PRO A O   
2171 C CB  . PRO A 291 ? 0.1450 0.1525 0.1312 -0.0012 -0.0133 -0.0045 311  PRO A CB  
2172 C CG  . PRO A 291 ? 0.1497 0.1567 0.1301 -0.0052 -0.0066 0.0027  311  PRO A CG  
2173 C CD  . PRO A 291 ? 0.1528 0.1481 0.1293 -0.0001 -0.0037 -0.0042 311  PRO A CD  
2174 N N   . THR A 292 ? 0.1717 0.1991 0.1557 0.0018  -0.0043 0.0011  312  THR A N   
2175 C CA  . THR A 292 ? 0.1730 0.2045 0.1870 0.0046  -0.0012 -0.0004 312  THR A CA  
2176 C C   . THR A 292 ? 0.1816 0.2102 0.1925 0.0044  0.0008  -0.0069 312  THR A C   
2177 O O   . THR A 292 ? 0.1816 0.2717 0.2231 0.0179  0.0058  -0.0135 312  THR A O   
2178 C CB  . THR A 292 ? 0.2062 0.2063 0.2015 -0.0083 -0.0012 0.0012  312  THR A CB  
2179 O OG1 . THR A 292 ? 0.2179 0.2156 0.2181 0.0000  -0.0065 0.0059  312  THR A OG1 
2180 C CG2 . THR A 292 ? 0.2176 0.1978 0.2123 -0.0042 0.0013  0.0004  312  THR A CG2 
2181 N N   . GLU A 293 ? 0.1750 0.2005 0.1909 0.0065  0.0049  -0.0039 313  GLU A N   
2182 C CA  . GLU A 293 ? 0.1779 0.1901 0.1888 0.0013  0.0018  0.0012  313  GLU A CA  
2183 C C   . GLU A 293 ? 0.1620 0.1775 0.1672 0.0116  0.0020  -0.0063 313  GLU A C   
2184 O O   . GLU A 293 ? 0.1493 0.1666 0.1771 0.0080  -0.0055 -0.0136 313  GLU A O   
2185 C CB  . GLU A 293 ? 0.1977 0.1998 0.2013 0.0128  -0.0095 0.0070  313  GLU A CB  
2186 C CG  . GLU A 293 ? 0.2209 0.2177 0.2537 -0.0019 0.0010  0.0157  313  GLU A CG  
2187 C CD  . GLU A 293 ? 0.2293 0.2448 0.2792 -0.0032 0.0214  0.0098  313  GLU A CD  
2188 O OE1 . GLU A 293 ? 0.2913 0.2557 0.3161 0.0023  0.0229  -0.0073 313  GLU A OE1 
2189 O OE2 . GLU A 293 ? 0.2573 0.2807 0.3259 -0.0323 0.0207  0.0119  313  GLU A OE2 
2190 N N   . ASN A 294 ? 0.1638 0.1707 0.1649 0.0002  -0.0088 -0.0034 314  ASN A N   
2191 C CA  . ASN A 294 ? 0.1538 0.1666 0.1503 0.0068  -0.0045 -0.0057 314  ASN A CA  
2192 C C   . ASN A 294 ? 0.1492 0.1468 0.1379 0.0113  0.0041  -0.0068 314  ASN A C   
2193 O O   . ASN A 294 ? 0.1504 0.1564 0.1336 0.0150  0.0094  -0.0081 314  ASN A O   
2194 C CB  . ASN A 294 ? 0.1638 0.1676 0.1683 0.0093  0.0028  -0.0025 314  ASN A CB  
2195 C CG  . ASN A 294 ? 0.1720 0.1942 0.1756 0.0135  -0.0054 -0.0048 314  ASN A CG  
2196 O OD1 . ASN A 294 ? 0.1981 0.2043 0.1753 0.0212  -0.0144 -0.0027 314  ASN A OD1 
2197 N ND2 . ASN A 294 ? 0.1916 0.2196 0.1745 0.0214  0.0050  -0.0142 314  ASN A ND2 
2198 N N   . ILE A 295 ? 0.1389 0.1325 0.1165 0.0015  0.0007  -0.0050 315  ILE A N   
2199 C CA  . ILE A 295 ? 0.1316 0.1269 0.1146 -0.0017 0.0048  -0.0081 315  ILE A CA  
2200 C C   . ILE A 295 ? 0.1316 0.1280 0.1113 0.0003  0.0032  -0.0049 315  ILE A C   
2201 O O   . ILE A 295 ? 0.1626 0.1414 0.1123 0.0023  0.0024  -0.0092 315  ILE A O   
2202 C CB  . ILE A 295 ? 0.1306 0.1337 0.1181 -0.0032 0.0041  -0.0001 315  ILE A CB  
2203 C CG1 . ILE A 295 ? 0.1253 0.1361 0.1316 -0.0035 0.0037  0.0035  315  ILE A CG1 
2204 C CG2 . ILE A 295 ? 0.1275 0.1285 0.1159 0.0025  0.0116  0.0052  315  ILE A CG2 
2205 C CD1 . ILE A 295 ? 0.1342 0.1383 0.1410 -0.0092 0.0081  0.0064  315  ILE A CD1 
2206 N N   . ILE A 296 ? 0.1222 0.1229 0.0978 0.0063  0.0057  0.0015  316  ILE A N   
2207 C CA  . ILE A 296 ? 0.1191 0.1186 0.1030 0.0020  0.0036  0.0014  316  ILE A CA  
2208 C C   . ILE A 296 ? 0.1151 0.1155 0.1004 0.0020  0.0055  -0.0013 316  ILE A C   
2209 O O   . ILE A 296 ? 0.1335 0.1300 0.0954 -0.0011 0.0221  0.0076  316  ILE A O   
2210 C CB  . ILE A 296 ? 0.1234 0.1155 0.1058 0.0054  0.0004  0.0020  316  ILE A CB  
2211 C CG1 . ILE A 296 ? 0.1214 0.1179 0.1123 0.0101  0.0031  0.0017  316  ILE A CG1 
2212 C CG2 . ILE A 296 ? 0.1228 0.1215 0.1128 0.0081  -0.0008 0.0064  316  ILE A CG2 
2213 C CD1 . ILE A 296 ? 0.1275 0.1173 0.1027 0.0109  0.0112  0.0001  316  ILE A CD1 
2214 N N   . ALA A 297 ? 0.1107 0.1102 0.0980 -0.0004 0.0037  0.0015  317  ALA A N   
2215 C CA  . ALA A 297 ? 0.1087 0.1032 0.0981 -0.0018 0.0029  -0.0006 317  ALA A CA  
2216 C C   . ALA A 297 ? 0.1015 0.0973 0.1011 0.0018  -0.0022 0.0006  317  ALA A C   
2217 O O   . ALA A 297 ? 0.1100 0.1080 0.1047 -0.0015 -0.0100 0.0074  317  ALA A O   
2218 C CB  . ALA A 297 ? 0.1125 0.1017 0.1036 0.0073  0.0020  0.0032  317  ALA A CB  
2219 N N   . SER A 298 ? 0.1011 0.0947 0.0988 -0.0008 -0.0004 0.0028  318  SER A N   
2220 C CA  . SER A 298 ? 0.1022 0.0892 0.0908 0.0006  0.0007  0.0002  318  SER A CA  
2221 C C   . SER A 298 ? 0.0980 0.0887 0.0847 0.0006  0.0071  0.0036  318  SER A C   
2222 O O   . SER A 298 ? 0.1056 0.0913 0.0879 0.0061  0.0016  0.0100  318  SER A O   
2223 C CB  . SER A 298 ? 0.1085 0.0895 0.0869 0.0017  0.0022  -0.0009 318  SER A CB  
2224 O OG  . SER A 298 ? 0.1252 0.0887 0.0861 0.0025  -0.0043 -0.0033 318  SER A OG  
2225 N N   . ALA A 299 ? 0.0987 0.0828 0.0794 -0.0011 0.0059  0.0032  319  ALA A N   
2226 C CA  . ALA A 299 ? 0.0961 0.0893 0.0829 -0.0020 0.0015  -0.0032 319  ALA A CA  
2227 C C   . ALA A 299 ? 0.0964 0.0801 0.0794 -0.0001 0.0005  -0.0017 319  ALA A C   
2228 O O   . ALA A 299 ? 0.0945 0.0831 0.0781 -0.0015 -0.0061 -0.0012 319  ALA A O   
2229 C CB  . ALA A 299 ? 0.1143 0.0875 0.0931 0.0029  0.0003  -0.0028 319  ALA A CB  
2230 N N   . ALA A 300 ? 0.0984 0.0838 0.0807 0.0009  -0.0010 -0.0030 320  ALA A N   
2231 C CA  . ALA A 300 ? 0.1033 0.0906 0.0906 -0.0038 -0.0003 -0.0012 320  ALA A CA  
2232 C C   . ALA A 300 ? 0.1066 0.0910 0.0822 -0.0006 -0.0056 -0.0032 320  ALA A C   
2233 O O   . ALA A 300 ? 0.1129 0.0881 0.0803 0.0080  -0.0055 -0.0081 320  ALA A O   
2234 C CB  . ALA A 300 ? 0.1079 0.0846 0.0906 -0.0011 0.0032  -0.0018 320  ALA A CB  
2235 N N   . LEU A 301 ? 0.1067 0.0943 0.0769 -0.0031 -0.0073 -0.0047 321  LEU A N   
2236 C CA  . LEU A 301 ? 0.1044 0.1014 0.0910 -0.0048 -0.0021 -0.0034 321  LEU A CA  
2237 C C   . LEU A 301 ? 0.1095 0.1127 0.0903 -0.0023 -0.0039 -0.0070 321  LEU A C   
2238 O O   . LEU A 301 ? 0.1071 0.1129 0.0929 0.0028  -0.0015 -0.0094 321  LEU A O   
2239 C CB  . LEU A 301 ? 0.1068 0.1050 0.0940 -0.0037 0.0027  -0.0018 321  LEU A CB  
2240 C CG  . LEU A 301 ? 0.1025 0.0988 0.0957 -0.0010 0.0018  -0.0058 321  LEU A CG  
2241 C CD1 . LEU A 301 ? 0.1091 0.1035 0.0932 0.0046  0.0095  -0.0055 321  LEU A CD1 
2242 C CD2 . LEU A 301 ? 0.1163 0.0966 0.0965 -0.0014 0.0074  -0.0047 321  LEU A CD2 
2243 N N   . GLU A 302 ? 0.1103 0.1182 0.1053 -0.0024 -0.0002 -0.0090 322  GLU A N   
2244 C CA  . GLU A 302 ? 0.1186 0.1226 0.1123 -0.0030 -0.0063 -0.0062 322  GLU A CA  
2245 C C   . GLU A 302 ? 0.1193 0.1149 0.1147 -0.0058 -0.0036 -0.0060 322  GLU A C   
2246 O O   . GLU A 302 ? 0.1069 0.1311 0.1138 -0.0125 -0.0060 -0.0010 322  GLU A O   
2247 C CB  . GLU A 302 ? 0.1272 0.1412 0.1215 0.0017  0.0041  -0.0186 322  GLU A CB  
2248 C CG  . GLU A 302 ? 0.1449 0.1595 0.1416 0.0143  0.0017  -0.0079 322  GLU A CG  
2249 C CD  . GLU A 302 ? 0.1600 0.1587 0.1713 0.0213  0.0086  -0.0072 322  GLU A CD  
2250 O OE1 . GLU A 302 ? 0.1837 0.1771 0.1837 0.0257  -0.0006 -0.0303 322  GLU A OE1 
2251 O OE2 . GLU A 302 ? 0.2030 0.2081 0.1861 0.0339  -0.0011 0.0168  322  GLU A OE2 
2252 N N   . ASN A 303 ? 0.1195 0.1132 0.1076 -0.0116 0.0004  -0.0068 323  ASN A N   
2253 C CA  . ASN A 303 ? 0.1276 0.1191 0.1074 -0.0125 0.0021  -0.0077 323  ASN A CA  
2254 C C   . ASN A 303 ? 0.1319 0.1200 0.1062 -0.0158 0.0062  -0.0078 323  ASN A C   
2255 O O   . ASN A 303 ? 0.1514 0.1362 0.1030 -0.0239 0.0084  -0.0089 323  ASN A O   
2256 C CB  . ASN A 303 ? 0.1415 0.1173 0.1198 -0.0124 0.0052  -0.0089 323  ASN A CB  
2257 C CG  . ASN A 303 ? 0.1460 0.1353 0.1351 -0.0106 0.0124  -0.0118 323  ASN A CG  
2258 O OD1 . ASN A 303 ? 0.1720 0.1411 0.1794 0.0011  0.0050  -0.0050 323  ASN A OD1 
2259 N ND2 . ASN A 303 ? 0.1798 0.1344 0.1663 -0.0182 0.0258  -0.0101 323  ASN A ND2 
2260 N N   . ASP A 304 ? 0.1253 0.1237 0.1013 -0.0105 0.0064  -0.0054 324  ASP A N   
2261 C CA  . ASP A 304 ? 0.1214 0.1194 0.1001 -0.0136 0.0020  -0.0061 324  ASP A CA  
2262 C C   . ASP A 304 ? 0.1151 0.1201 0.1073 -0.0138 0.0021  -0.0017 324  ASP A C   
2263 O O   . ASP A 304 ? 0.1213 0.1204 0.1019 -0.0170 -0.0120 -0.0044 324  ASP A O   
2264 C CB  . ASP A 304 ? 0.1210 0.1187 0.1042 -0.0125 0.0081  -0.0004 324  ASP A CB  
2265 C CG  . ASP A 304 ? 0.1209 0.1239 0.1105 -0.0070 0.0079  -0.0049 324  ASP A CG  
2266 O OD1 . ASP A 304 ? 0.1348 0.1255 0.1159 -0.0137 0.0074  -0.0036 324  ASP A OD1 
2267 O OD2 . ASP A 304 ? 0.1350 0.1211 0.1169 -0.0066 0.0089  0.0002  324  ASP A OD2 
2268 N N   . LYS A 305 ? 0.1139 0.1187 0.1081 -0.0111 -0.0003 -0.0017 325  LYS A N   
2269 C CA  . LYS A 305 ? 0.1232 0.1224 0.1248 -0.0166 -0.0009 -0.0039 325  LYS A CA  
2270 C C   . LYS A 305 ? 0.1160 0.1121 0.1165 -0.0108 -0.0098 0.0008  325  LYS A C   
2271 O O   . LYS A 305 ? 0.1132 0.1177 0.1338 -0.0213 -0.0239 -0.0058 325  LYS A O   
2272 C CB  . LYS A 305 ? 0.1389 0.1281 0.1384 -0.0091 -0.0014 0.0024  325  LYS A CB  
2273 C CG  . LYS A 305 ? 0.1421 0.1370 0.1430 -0.0140 0.0033  -0.0107 325  LYS A CG  
2274 C CD  . LYS A 305 ? 0.1519 0.1407 0.1504 -0.0117 0.0085  0.0006  325  LYS A CD  
2275 C CE  . LYS A 305 ? 0.1671 0.1563 0.1565 -0.0133 -0.0022 -0.0063 325  LYS A CE  
2276 N NZ  . LYS A 305 ? 0.1806 0.1766 0.1679 -0.0063 -0.0108 0.0094  325  LYS A NZ  
2277 N N   . THR A 306 ? 0.1073 0.1098 0.1028 -0.0139 -0.0097 0.0047  326  THR A N   
2278 C CA  . THR A 306 ? 0.1064 0.1073 0.1046 -0.0087 -0.0076 0.0008  326  THR A CA  
2279 C C   . THR A 306 ? 0.1042 0.1060 0.0999 -0.0071 -0.0021 0.0066  326  THR A C   
2280 O O   . THR A 306 ? 0.1096 0.0996 0.1027 -0.0147 -0.0109 0.0072  326  THR A O   
2281 C CB  . THR A 306 ? 0.1047 0.1123 0.1071 -0.0103 0.0009  0.0016  326  THR A CB  
2282 O OG1 . THR A 306 ? 0.1109 0.1106 0.1201 -0.0067 -0.0027 -0.0020 326  THR A OG1 
2283 C CG2 . THR A 306 ? 0.1093 0.1054 0.1041 -0.0108 -0.0026 -0.0048 326  THR A CG2 
2284 N N   . ILE A 307 ? 0.1020 0.0952 0.0965 -0.0041 -0.0070 0.0034  327  ILE A N   
2285 C CA  . ILE A 307 ? 0.0974 0.0883 0.0878 -0.0037 -0.0003 0.0023  327  ILE A CA  
2286 C C   . ILE A 307 ? 0.0973 0.0932 0.0876 0.0004  0.0006  0.0053  327  ILE A C   
2287 O O   . ILE A 307 ? 0.1056 0.0982 0.0844 -0.0004 0.0000  -0.0010 327  ILE A O   
2288 C CB  . ILE A 307 ? 0.0994 0.0875 0.0920 -0.0060 -0.0029 0.0040  327  ILE A CB  
2289 C CG1 . ILE A 307 ? 0.0957 0.0830 0.0942 -0.0037 -0.0090 0.0032  327  ILE A CG1 
2290 C CG2 . ILE A 307 ? 0.1010 0.0878 0.0925 -0.0062 -0.0041 0.0025  327  ILE A CG2 
2291 C CD1 . ILE A 307 ? 0.1018 0.0832 0.0968 -0.0069 -0.0162 -0.0015 327  ILE A CD1 
2292 N N   . LYS A 308 ? 0.0968 0.0994 0.0765 0.0008  0.0010  0.0043  328  LYS A N   
2293 C CA  . LYS A 308 ? 0.0974 0.0890 0.0780 0.0022  -0.0005 0.0069  328  LYS A CA  
2294 C C   . LYS A 308 ? 0.0969 0.1012 0.0863 -0.0001 -0.0006 0.0036  328  LYS A C   
2295 O O   . LYS A 308 ? 0.1132 0.1053 0.0851 0.0004  0.0037  -0.0013 328  LYS A O   
2296 C CB  . LYS A 308 ? 0.0896 0.0921 0.0751 0.0002  -0.0028 0.0015  328  LYS A CB  
2297 C CG  . LYS A 308 ? 0.0875 0.0873 0.0772 -0.0030 -0.0012 0.0013  328  LYS A CG  
2298 C CD  . LYS A 308 ? 0.0917 0.0857 0.0891 -0.0009 0.0023  -0.0015 328  LYS A CD  
2299 C CE  . LYS A 308 ? 0.0999 0.0887 0.0916 -0.0047 -0.0035 -0.0058 328  LYS A CE  
2300 N NZ  . LYS A 308 ? 0.1111 0.0941 0.0908 -0.0068 0.0000  -0.0129 328  LYS A NZ  
2301 N N   . LEU A 309 ? 0.1043 0.0972 0.0881 0.0009  0.0042  0.0084  329  LEU A N   
2302 C CA  . LEU A 309 ? 0.1088 0.1014 0.0945 0.0003  -0.0020 0.0022  329  LEU A CA  
2303 C C   . LEU A 309 ? 0.1214 0.1014 0.1035 0.0018  0.0027  0.0002  329  LEU A C   
2304 O O   . LEU A 309 ? 0.1238 0.1089 0.1011 -0.0048 0.0021  0.0043  329  LEU A O   
2305 C CB  . LEU A 309 ? 0.1171 0.1029 0.0939 -0.0023 -0.0032 0.0031  329  LEU A CB  
2306 C CG  . LEU A 309 ? 0.1252 0.1039 0.0982 0.0002  -0.0048 0.0016  329  LEU A CG  
2307 C CD1 . LEU A 309 ? 0.1339 0.0986 0.1050 -0.0044 -0.0006 0.0024  329  LEU A CD1 
2308 C CD2 . LEU A 309 ? 0.1297 0.1039 0.0981 -0.0062 -0.0023 0.0000  329  LEU A CD2 
2309 N N   . TRP A 310 ? 0.1239 0.1069 0.1064 -0.0012 0.0026  0.0052  330  TRP A N   
2310 C CA  . TRP A 310 ? 0.1215 0.1137 0.1077 0.0011  0.0051  -0.0010 330  TRP A CA  
2311 C C   . TRP A 310 ? 0.1226 0.1195 0.1155 -0.0024 0.0035  -0.0018 330  TRP A C   
2312 O O   . TRP A 310 ? 0.1220 0.1371 0.1079 -0.0021 0.0033  -0.0015 330  TRP A O   
2313 C CB  . TRP A 310 ? 0.1091 0.1116 0.1125 0.0016  0.0023  -0.0008 330  TRP A CB  
2314 C CG  . TRP A 310 ? 0.1090 0.1115 0.1011 0.0024  0.0008  0.0006  330  TRP A CG  
2315 C CD1 . TRP A 310 ? 0.1136 0.1121 0.0992 0.0030  -0.0034 -0.0051 330  TRP A CD1 
2316 C CD2 . TRP A 310 ? 0.1126 0.1154 0.1040 0.0010  -0.0014 -0.0020 330  TRP A CD2 
2317 N NE1 . TRP A 310 ? 0.1105 0.1143 0.1025 0.0049  0.0022  -0.0061 330  TRP A NE1 
2318 C CE2 . TRP A 310 ? 0.1145 0.1132 0.0985 0.0013  0.0008  -0.0027 330  TRP A CE2 
2319 C CE3 . TRP A 310 ? 0.1088 0.1183 0.1028 0.0036  0.0042  0.0004  330  TRP A CE3 
2320 C CZ2 . TRP A 310 ? 0.1138 0.1194 0.1027 0.0007  0.0009  -0.0042 330  TRP A CZ2 
2321 C CZ3 . TRP A 310 ? 0.1245 0.1148 0.0938 0.0000  -0.0022 -0.0044 330  TRP A CZ3 
2322 C CH2 . TRP A 310 ? 0.1199 0.1144 0.0997 -0.0024 -0.0055 -0.0037 330  TRP A CH2 
2323 N N   . LYS A 311 ? 0.1441 0.1257 0.1189 0.0010  0.0166  0.0003  331  LYS A N   
2324 C CA  . LYS A 311 ? 0.1515 0.1367 0.1340 0.0014  0.0034  -0.0029 331  LYS A CA  
2325 C C   . LYS A 311 ? 0.1612 0.1368 0.1441 0.0034  0.0057  -0.0097 331  LYS A C   
2326 O O   . LYS A 311 ? 0.1715 0.1331 0.1462 0.0030  0.0055  -0.0108 331  LYS A O   
2327 C CB  . LYS A 311 ? 0.1560 0.1478 0.1424 -0.0044 0.0125  -0.0041 331  LYS A CB  
2328 C CG  . LYS A 311 ? 0.1675 0.1585 0.1548 0.0087  0.0054  -0.0017 331  LYS A CG  
2329 C CD  . LYS A 311 ? 0.1758 0.1733 0.1633 -0.0021 0.0074  0.0028  331  LYS A CD  
2330 C CE  . LYS A 311 ? 0.1744 0.1812 0.1754 0.0015  -0.0062 0.0018  331  LYS A CE  
2331 N NZ  . LYS A 311 ? 0.1652 0.1932 0.1810 -0.0071 0.0114  0.0209  331  LYS A NZ  
2332 N N   . SER A 312 ? 0.1631 0.1454 0.1512 0.0068  0.0024  -0.0015 332  SER A N   
2333 C CA  . SER A 312 ? 0.1728 0.1587 0.1700 0.0167  0.0010  0.0027  332  SER A CA  
2334 C C   . SER A 312 ? 0.1747 0.1797 0.1852 0.0088  0.0010  0.0019  332  SER A C   
2335 O O   . SER A 312 ? 0.1746 0.1775 0.1784 0.0125  0.0042  -0.0006 332  SER A O   
2336 C CB  . SER A 312 ? 0.1992 0.1563 0.1695 0.0256  -0.0009 0.0074  332  SER A CB  
2337 O OG  . SER A 312 ? 0.2071 0.1614 0.1600 0.0335  -0.0187 0.0353  332  SER A OG  
2338 N N   . ASP A 313 ? 0.1873 0.1892 0.1969 0.0161  0.0101  -0.0016 333  ASP A N   
2339 C CA  . ASP A 313 ? 0.1887 0.2159 0.2166 0.0103  0.0113  0.0010  333  ASP A CA  
2340 C C   . ASP A 313 ? 0.2113 0.2312 0.2198 0.0116  0.0021  -0.0009 333  ASP A C   
2341 O O   . ASP A 313 ? 0.2157 0.2633 0.2433 0.0052  -0.0026 -0.0026 333  ASP A O   
2342 C CB  . ASP A 313 ? 0.2052 0.2275 0.2227 0.0158  0.0156  -0.0057 333  ASP A CB  
2343 C CG  . ASP A 313 ? 0.2051 0.2305 0.2240 0.0132  0.0193  0.0004  333  ASP A CG  
2344 O OD1 . ASP A 313 ? 0.2063 0.2339 0.2510 0.0238  0.0278  0.0071  333  ASP A OD1 
2345 O OD2 . ASP A 313 ? 0.1893 0.2510 0.2332 0.0156  0.0237  -0.0166 333  ASP A OD2 
2346 N N   . CYS A 314 ? 0.2092 0.2412 0.2221 0.0138  0.0036  -0.0009 334  CYS A N   
2347 C CA  . CYS A 314 ? 0.2208 0.2502 0.2202 0.0231  0.0116  0.0018  334  CYS A CA  
2348 C C   . CYS A 314 ? 0.2161 0.2595 0.2212 0.0262  0.0071  -0.0017 334  CYS A C   
2349 O O   . CYS A 314 ? 0.2082 0.2906 0.2230 0.0260  0.0288  0.0056  334  CYS A O   
2350 C CB  . CYS A 314 ? 0.2485 0.2509 0.2641 0.0256  0.0081  0.0156  334  CYS A CB  
2351 S SG  . CYS A 314 ? 0.2804 0.2297 0.2775 0.0341  0.0089  0.0080  334  CYS A SG  
2352 O OXT . CYS A 314 ? 0.2258 0.2130 0.1924 0.0389  0.0084  -0.0204 334  CYS A OXT 
2353 N N   . LYS B 12  ? 0.2955 0.3072 0.3380 0.0265  -0.0260 0.0041  32   LYS B N   
2354 C CA  . LYS B 12  ? 0.2950 0.2782 0.2929 0.0165  -0.0238 -0.0093 32   LYS B CA  
2355 C C   . LYS B 12  ? 0.2606 0.2536 0.2790 0.0309  -0.0100 0.0082  32   LYS B C   
2356 O O   . LYS B 12  ? 0.2698 0.2548 0.2813 0.0285  -0.0167 0.0107  32   LYS B O   
2357 C CB  . LYS B 12  ? 0.3009 0.3044 0.3238 0.0068  -0.0220 0.0021  32   LYS B CB  
2358 C CG  . LYS B 12  ? 0.3142 0.3189 0.3305 0.0120  -0.0396 -0.0097 32   LYS B CG  
2359 C CD  . LYS B 12  ? 0.3320 0.3402 0.3618 0.0047  -0.0184 -0.0024 32   LYS B CD  
2360 C CE  . LYS B 12  ? 0.3666 0.3400 0.3586 0.0080  -0.0239 -0.0091 32   LYS B CE  
2361 N NZ  . LYS B 12  ? 0.3682 0.3392 0.3944 0.0161  -0.0506 -0.0045 32   LYS B NZ  
2362 N N   . PRO B 13  ? 0.2541 0.2346 0.2418 0.0222  -0.0101 -0.0053 33   PRO B N   
2363 C CA  . PRO B 13  ? 0.2332 0.2298 0.2168 0.0248  -0.0059 0.0052  33   PRO B CA  
2364 C C   . PRO B 13  ? 0.2205 0.2136 0.2076 0.0159  -0.0174 0.0019  33   PRO B C   
2365 O O   . PRO B 13  ? 0.2511 0.1974 0.1908 0.0230  -0.0201 0.0030  33   PRO B O   
2366 C CB  . PRO B 13  ? 0.2448 0.2278 0.2225 0.0210  -0.0058 0.0107  33   PRO B CB  
2367 C CG  . PRO B 13  ? 0.2373 0.2272 0.2270 0.0186  -0.0015 0.0090  33   PRO B CG  
2368 C CD  . PRO B 13  ? 0.2509 0.2259 0.2315 0.0179  -0.0030 -0.0016 33   PRO B CD  
2369 N N   . ASN B 14  ? 0.2103 0.2001 0.2024 0.0270  -0.0072 0.0063  34   ASN B N   
2370 C CA  . ASN B 14  ? 0.1992 0.1917 0.1978 0.0257  -0.0141 0.0063  34   ASN B CA  
2371 C C   . ASN B 14  ? 0.2036 0.1880 0.1833 0.0259  -0.0192 0.0077  34   ASN B C   
2372 O O   . ASN B 14  ? 0.2132 0.1837 0.1846 0.0317  -0.0290 0.0108  34   ASN B O   
2373 C CB  . ASN B 14  ? 0.2059 0.2062 0.2007 0.0203  -0.0184 0.0165  34   ASN B CB  
2374 C CG  . ASN B 14  ? 0.2027 0.2161 0.2016 0.0170  -0.0174 0.0205  34   ASN B CG  
2375 O OD1 . ASN B 14  ? 0.2066 0.2140 0.2063 0.0236  -0.0197 0.0214  34   ASN B OD1 
2376 N ND2 . ASN B 14  ? 0.2045 0.2502 0.2149 0.0045  -0.0289 0.0168  34   ASN B ND2 
2377 N N   . TYR B 15  ? 0.1818 0.1700 0.1692 0.0200  -0.0120 -0.0087 35   TYR B N   
2378 C CA  . TYR B 15  ? 0.1736 0.1658 0.1609 0.0194  -0.0163 -0.0009 35   TYR B CA  
2379 C C   . TYR B 15  ? 0.1754 0.1633 0.1643 0.0158  -0.0147 0.0039  35   TYR B C   
2380 O O   . TYR B 15  ? 0.2066 0.1582 0.1780 0.0103  -0.0144 0.0044  35   TYR B O   
2381 C CB  . TYR B 15  ? 0.1669 0.1672 0.1566 0.0179  -0.0107 0.0008  35   TYR B CB  
2382 C CG  . TYR B 15  ? 0.1504 0.1550 0.1580 0.0234  -0.0122 -0.0008 35   TYR B CG  
2383 C CD1 . TYR B 15  ? 0.1401 0.1540 0.1513 0.0284  -0.0140 -0.0025 35   TYR B CD1 
2384 C CD2 . TYR B 15  ? 0.1547 0.1564 0.1490 0.0250  -0.0143 0.0041  35   TYR B CD2 
2385 C CE1 . TYR B 15  ? 0.1430 0.1536 0.1500 0.0324  -0.0102 0.0003  35   TYR B CE1 
2386 C CE2 . TYR B 15  ? 0.1384 0.1538 0.1392 0.0294  -0.0222 0.0035  35   TYR B CE2 
2387 C CZ  . TYR B 15  ? 0.1446 0.1560 0.1419 0.0261  -0.0178 0.0014  35   TYR B CZ  
2388 O OH  . TYR B 15  ? 0.1759 0.1768 0.1447 0.0204  -0.0145 0.0172  35   TYR B OH  
2389 N N   . ALA B 16  ? 0.1765 0.1731 0.1479 0.0176  -0.0072 0.0066  36   ALA B N   
2390 C CA  . ALA B 16  ? 0.1702 0.1576 0.1491 0.0133  -0.0061 0.0038  36   ALA B CA  
2391 C C   . ALA B 16  ? 0.1586 0.1581 0.1262 0.0121  -0.0085 0.0079  36   ALA B C   
2392 O O   . ALA B 16  ? 0.1707 0.1638 0.1287 0.0076  -0.0080 0.0133  36   ALA B O   
2393 C CB  . ALA B 16  ? 0.1664 0.1690 0.1466 0.0101  -0.0051 -0.0037 36   ALA B CB  
2394 N N   . LEU B 17  ? 0.1456 0.1507 0.1068 0.0124  -0.0228 0.0095  37   LEU B N   
2395 C CA  . LEU B 17  ? 0.1536 0.1445 0.1214 0.0073  -0.0125 0.0084  37   LEU B CA  
2396 C C   . LEU B 17  ? 0.1556 0.1532 0.1341 0.0027  -0.0117 0.0012  37   LEU B C   
2397 O O   . LEU B 17  ? 0.1650 0.1737 0.1439 0.0163  -0.0215 0.0036  37   LEU B O   
2398 C CB  . LEU B 17  ? 0.1507 0.1437 0.1214 0.0128  -0.0120 0.0063  37   LEU B CB  
2399 C CG  . LEU B 17  ? 0.1477 0.1431 0.1217 0.0079  -0.0067 -0.0011 37   LEU B CG  
2400 C CD1 . LEU B 17  ? 0.1474 0.1440 0.1248 0.0119  0.0000  0.0044  37   LEU B CD1 
2401 C CD2 . LEU B 17  ? 0.1485 0.1490 0.1235 0.0112  -0.0006 0.0001  37   LEU B CD2 
2402 N N   . LYS B 18  ? 0.1583 0.1509 0.1430 0.0059  -0.0164 -0.0003 38   LYS B N   
2403 C CA  . LYS B 18  ? 0.1541 0.1551 0.1434 -0.0017 -0.0150 0.0019  38   LYS B CA  
2404 C C   . LYS B 18  ? 0.1475 0.1542 0.1410 -0.0044 -0.0103 0.0085  38   LYS B C   
2405 O O   . LYS B 18  ? 0.1711 0.1663 0.1364 -0.0100 -0.0182 0.0168  38   LYS B O   
2406 C CB  . LYS B 18  ? 0.1582 0.1659 0.1344 -0.0033 -0.0170 0.0043  38   LYS B CB  
2407 C CG  . LYS B 18  ? 0.1709 0.1800 0.1534 0.0056  -0.0081 -0.0018 38   LYS B CG  
2408 C CD  . LYS B 18  ? 0.1816 0.1896 0.1572 0.0009  -0.0191 -0.0018 38   LYS B CD  
2409 C CE  . LYS B 18  ? 0.1986 0.2067 0.1865 0.0168  -0.0107 0.0004  38   LYS B CE  
2410 N NZ  . LYS B 18  ? 0.2306 0.2402 0.1956 0.0072  -0.0268 0.0150  38   LYS B NZ  
2411 N N   . PHE B 19  ? 0.1400 0.1398 0.1377 0.0008  -0.0050 0.0025  39   PHE B N   
2412 C CA  . PHE B 19  ? 0.1312 0.1351 0.1201 -0.0061 -0.0056 0.0052  39   PHE B CA  
2413 C C   . PHE B 19  ? 0.1285 0.1274 0.1115 -0.0034 -0.0007 -0.0003 39   PHE B C   
2414 O O   . PHE B 19  ? 0.1446 0.1312 0.1126 -0.0103 -0.0007 -0.0022 39   PHE B O   
2415 C CB  . PHE B 19  ? 0.1315 0.1362 0.1221 -0.0077 -0.0048 0.0052  39   PHE B CB  
2416 C CG  . PHE B 19  ? 0.1312 0.1485 0.1322 -0.0090 -0.0054 0.0060  39   PHE B CG  
2417 C CD1 . PHE B 19  ? 0.1368 0.1501 0.1318 -0.0080 -0.0030 0.0051  39   PHE B CD1 
2418 C CD2 . PHE B 19  ? 0.1341 0.1531 0.1391 -0.0064 -0.0025 0.0046  39   PHE B CD2 
2419 C CE1 . PHE B 19  ? 0.1435 0.1589 0.1234 -0.0120 -0.0070 0.0070  39   PHE B CE1 
2420 C CE2 . PHE B 19  ? 0.1342 0.1476 0.1351 -0.0139 0.0020  0.0012  39   PHE B CE2 
2421 C CZ  . PHE B 19  ? 0.1383 0.1551 0.1351 -0.0103 -0.0090 0.0013  39   PHE B CZ  
2422 N N   . THR B 20  ? 0.1178 0.1203 0.1090 -0.0060 -0.0045 0.0059  40   THR B N   
2423 C CA  . THR B 20  ? 0.1192 0.1191 0.1019 -0.0013 -0.0042 0.0042  40   THR B CA  
2424 C C   . THR B 20  ? 0.1208 0.1197 0.1062 -0.0017 -0.0055 -0.0029 40   THR B C   
2425 O O   . THR B 20  ? 0.1327 0.1269 0.1123 0.0023  -0.0145 -0.0091 40   THR B O   
2426 C CB  . THR B 20  ? 0.1203 0.1194 0.0996 -0.0025 -0.0069 0.0056  40   THR B CB  
2427 O OG1 . THR B 20  ? 0.1363 0.1137 0.0986 -0.0063 -0.0097 0.0162  40   THR B OG1 
2428 C CG2 . THR B 20  ? 0.1206 0.1188 0.0876 0.0000  -0.0037 0.0116  40   THR B CG2 
2429 N N   . LEU B 21  ? 0.1230 0.1184 0.1168 0.0064  -0.0122 -0.0014 41   LEU B N   
2430 C CA  . LEU B 21  ? 0.1296 0.1181 0.1148 0.0040  -0.0081 -0.0014 41   LEU B CA  
2431 C C   . LEU B 21  ? 0.1302 0.1301 0.1170 0.0045  -0.0058 -0.0039 41   LEU B C   
2432 O O   . LEU B 21  ? 0.1455 0.1584 0.1286 -0.0008 -0.0132 -0.0187 41   LEU B O   
2433 C CB  . LEU B 21  ? 0.1326 0.1217 0.1265 -0.0027 -0.0069 0.0099  41   LEU B CB  
2434 C CG  . LEU B 21  ? 0.1317 0.1310 0.1326 0.0020  -0.0061 0.0109  41   LEU B CG  
2435 C CD1 . LEU B 21  ? 0.1330 0.1320 0.1316 0.0015  -0.0061 0.0124  41   LEU B CD1 
2436 C CD2 . LEU B 21  ? 0.1325 0.1440 0.1309 -0.0050 -0.0149 0.0164  41   LEU B CD2 
2437 N N   . ALA B 22  ? 0.1270 0.1244 0.1124 0.0056  -0.0111 -0.0047 42   ALA B N   
2438 C CA  . ALA B 22  ? 0.1275 0.1177 0.1157 0.0052  -0.0036 -0.0033 42   ALA B CA  
2439 C C   . ALA B 22  ? 0.1227 0.1159 0.1114 0.0018  -0.0013 -0.0060 42   ALA B C   
2440 O O   . ALA B 22  ? 0.1317 0.1230 0.1067 0.0015  -0.0089 -0.0146 42   ALA B O   
2441 C CB  . ALA B 22  ? 0.1375 0.1288 0.1176 0.0041  0.0021  -0.0036 42   ALA B CB  
2442 N N   . GLY B 23  ? 0.1291 0.1127 0.1088 0.0060  -0.0052 -0.0067 43   GLY B N   
2443 C CA  . GLY B 23  ? 0.1264 0.1102 0.1185 -0.0004 -0.0070 -0.0018 43   GLY B CA  
2444 C C   . GLY B 23  ? 0.1258 0.1145 0.1097 -0.0014 -0.0032 -0.0045 43   GLY B C   
2445 O O   . GLY B 23  ? 0.1184 0.1355 0.1249 0.0021  0.0065  0.0000  43   GLY B O   
2446 N N   . HIS B 24  ? 0.1107 0.1104 0.1107 0.0020  0.0018  -0.0044 44   HIS B N   
2447 C CA  . HIS B 24  ? 0.1182 0.1088 0.1004 0.0008  0.0018  -0.0081 44   HIS B CA  
2448 C C   . HIS B 24  ? 0.1204 0.1052 0.1066 0.0024  0.0050  -0.0055 44   HIS B C   
2449 O O   . HIS B 24  ? 0.1229 0.1175 0.0927 0.0002  0.0084  -0.0001 44   HIS B O   
2450 C CB  . HIS B 24  ? 0.1108 0.1081 0.0968 -0.0038 0.0054  -0.0052 44   HIS B CB  
2451 C CG  . HIS B 24  ? 0.1073 0.1056 0.0941 -0.0046 -0.0019 -0.0039 44   HIS B CG  
2452 N ND1 . HIS B 24  ? 0.1129 0.1061 0.0946 -0.0034 0.0038  -0.0021 44   HIS B ND1 
2453 C CD2 . HIS B 24  ? 0.1087 0.1067 0.0967 -0.0045 0.0024  0.0004  44   HIS B CD2 
2454 C CE1 . HIS B 24  ? 0.1110 0.1084 0.1003 -0.0046 0.0032  -0.0017 44   HIS B CE1 
2455 N NE2 . HIS B 24  ? 0.1097 0.1074 0.0969 -0.0056 0.0015  0.0007  44   HIS B NE2 
2456 N N   . THR B 25  ? 0.1170 0.1112 0.1147 0.0018  0.0039  -0.0065 45   THR B N   
2457 C CA  . THR B 25  ? 0.1248 0.1228 0.1262 -0.0024 0.0111  -0.0037 45   THR B CA  
2458 C C   . THR B 25  ? 0.1231 0.1269 0.1218 -0.0060 0.0128  -0.0025 45   THR B C   
2459 O O   . THR B 25  ? 0.1347 0.1244 0.1362 -0.0184 0.0183  -0.0061 45   THR B O   
2460 C CB  . THR B 25  ? 0.1381 0.1278 0.1377 0.0038  0.0137  -0.0081 45   THR B CB  
2461 O OG1 . THR B 25  ? 0.1506 0.1329 0.1420 0.0093  0.0130  -0.0062 45   THR B OG1 
2462 C CG2 . THR B 25  ? 0.1550 0.1394 0.1451 0.0000  0.0118  -0.0187 45   THR B CG2 
2463 N N   . LYS B 26  ? 0.1253 0.1172 0.1207 -0.0079 0.0107  -0.0070 46   LYS B N   
2464 C CA  . LYS B 26  ? 0.1225 0.1195 0.1129 -0.0031 0.0057  -0.0008 46   LYS B CA  
2465 C C   . LYS B 26  ? 0.1146 0.1123 0.0970 -0.0079 0.0001  0.0002  46   LYS B C   
2466 O O   . LYS B 26  ? 0.1118 0.1133 0.1029 -0.0014 0.0004  -0.0058 46   LYS B O   
2467 C CB  . LYS B 26  ? 0.1368 0.1258 0.1280 0.0012  -0.0037 0.0032  46   LYS B CB  
2468 C CG  . LYS B 26  ? 0.1471 0.1454 0.1390 0.0092  0.0081  0.0000  46   LYS B CG  
2469 C CD  . LYS B 26  ? 0.1603 0.1894 0.1741 -0.0091 0.0139  0.0070  46   LYS B CD  
2470 C CE  . LYS B 26  ? 0.1876 0.2174 0.2102 0.0116  0.0167  -0.0059 46   LYS B CE  
2471 N NZ  . LYS B 26  ? 0.1908 0.2829 0.2415 0.0017  0.0141  -0.0173 46   LYS B NZ  
2472 N N   . ALA B 27  ? 0.1090 0.1044 0.0924 -0.0032 0.0060  0.0025  47   ALA B N   
2473 C CA  . ALA B 27  ? 0.1057 0.1035 0.0851 -0.0028 0.0013  0.0024  47   ALA B CA  
2474 C C   . ALA B 27  ? 0.1003 0.0988 0.0800 -0.0008 -0.0022 -0.0016 47   ALA B C   
2475 O O   . ALA B 27  ? 0.1141 0.1010 0.0844 0.0002  -0.0028 0.0017  47   ALA B O   
2476 C CB  . ALA B 27  ? 0.1068 0.0985 0.0906 -0.0029 -0.0010 0.0013  47   ALA B CB  
2477 N N   . VAL B 28  ? 0.0996 0.1003 0.0726 -0.0010 -0.0004 0.0025  48   VAL B N   
2478 C CA  . VAL B 28  ? 0.0962 0.0943 0.0801 -0.0021 0.0012  -0.0068 48   VAL B CA  
2479 C C   . VAL B 28  ? 0.0996 0.0908 0.0776 -0.0055 -0.0028 -0.0024 48   VAL B C   
2480 O O   . VAL B 28  ? 0.1118 0.0916 0.0869 -0.0025 -0.0009 -0.0117 48   VAL B O   
2481 C CB  . VAL B 28  ? 0.0944 0.0972 0.0885 -0.0005 0.0023  -0.0053 48   VAL B CB  
2482 C CG1 . VAL B 28  ? 0.0924 0.1105 0.0841 -0.0008 -0.0006 -0.0057 48   VAL B CG1 
2483 C CG2 . VAL B 28  ? 0.1049 0.1102 0.0869 -0.0014 0.0006  -0.0034 48   VAL B CG2 
2484 N N   . SER B 29  ? 0.0873 0.0838 0.0797 -0.0039 -0.0028 -0.0056 49   SER B N   
2485 C CA  . SER B 29  ? 0.0855 0.0878 0.0802 -0.0047 0.0001  -0.0060 49   SER B CA  
2486 C C   . SER B 29  ? 0.0848 0.0858 0.0841 -0.0045 0.0000  -0.0064 49   SER B C   
2487 O O   . SER B 29  ? 0.0874 0.0945 0.0762 -0.0078 0.0013  -0.0083 49   SER B O   
2488 C CB  . SER B 29  ? 0.0857 0.0907 0.0777 -0.0052 -0.0040 -0.0060 49   SER B CB  
2489 O OG  . SER B 29  ? 0.0864 0.0891 0.0928 -0.0036 -0.0069 -0.0030 49   SER B OG  
2490 N N   . SER B 30  ? 0.0846 0.0872 0.0783 -0.0039 0.0037  -0.0115 50   SER B N   
2491 C CA  . SER B 30  ? 0.0840 0.0859 0.0861 0.0000  0.0035  -0.0078 50   SER B CA  
2492 C C   . SER B 30  ? 0.0858 0.0808 0.0847 0.0006  0.0040  -0.0099 50   SER B C   
2493 O O   . SER B 30  ? 0.0908 0.0875 0.0931 -0.0047 -0.0057 -0.0209 50   SER B O   
2494 C CB  . SER B 30  ? 0.0936 0.0910 0.0896 0.0037  0.0068  -0.0038 50   SER B CB  
2495 O OG  . SER B 30  ? 0.0940 0.0928 0.1035 0.0039  0.0105  -0.0029 50   SER B OG  
2496 N N   . VAL B 31  ? 0.0855 0.0803 0.0797 -0.0008 0.0045  -0.0058 51   VAL B N   
2497 C CA  . VAL B 31  ? 0.0837 0.0824 0.0825 0.0000  0.0027  -0.0011 51   VAL B CA  
2498 C C   . VAL B 31  ? 0.0889 0.0788 0.0772 0.0004  0.0053  -0.0021 51   VAL B C   
2499 O O   . VAL B 31  ? 0.1085 0.0837 0.0801 0.0018  0.0104  -0.0027 51   VAL B O   
2500 C CB  . VAL B 31  ? 0.0888 0.0827 0.0840 -0.0002 0.0016  -0.0003 51   VAL B CB  
2501 C CG1 . VAL B 31  ? 0.0880 0.0900 0.0904 0.0002  0.0043  -0.0002 51   VAL B CG1 
2502 C CG2 . VAL B 31  ? 0.0911 0.0840 0.0892 0.0030  0.0056  -0.0011 51   VAL B CG2 
2503 N N   . LYS B 32  ? 0.0871 0.0845 0.0787 -0.0008 0.0033  -0.0028 52   LYS B N   
2504 C CA  . LYS B 32  ? 0.0881 0.0879 0.0820 -0.0001 0.0052  -0.0014 52   LYS B CA  
2505 C C   . LYS B 32  ? 0.0893 0.0914 0.0840 -0.0023 0.0043  -0.0001 52   LYS B C   
2506 O O   . LYS B 32  ? 0.0901 0.0919 0.0878 0.0024  0.0056  -0.0008 52   LYS B O   
2507 C CB  . LYS B 32  ? 0.0921 0.0843 0.0805 0.0013  0.0041  -0.0036 52   LYS B CB  
2508 C CG  . LYS B 32  ? 0.0911 0.0888 0.0842 0.0027  0.0023  0.0003  52   LYS B CG  
2509 C CD  . LYS B 32  ? 0.0969 0.0829 0.0894 0.0036  0.0005  -0.0002 52   LYS B CD  
2510 C CE  . LYS B 32  ? 0.0949 0.0913 0.0999 0.0018  -0.0025 -0.0010 52   LYS B CE  
2511 N NZ  . LYS B 32  ? 0.1164 0.0943 0.0963 0.0012  -0.0044 -0.0028 52   LYS B NZ  
2512 N N   . PHE B 33  ? 0.0919 0.0947 0.0940 0.0003  0.0063  0.0021  53   PHE B N   
2513 C CA  . PHE B 33  ? 0.0986 0.1033 0.0982 -0.0043 0.0013  0.0039  53   PHE B CA  
2514 C C   . PHE B 33  ? 0.1073 0.1050 0.1031 -0.0072 0.0028  0.0055  53   PHE B C   
2515 O O   . PHE B 33  ? 0.1041 0.1212 0.1036 -0.0067 0.0107  0.0045  53   PHE B O   
2516 C CB  . PHE B 33  ? 0.0980 0.1057 0.1005 -0.0031 0.0008  0.0001  53   PHE B CB  
2517 C CG  . PHE B 33  ? 0.0988 0.1062 0.0953 0.0005  -0.0031 -0.0008 53   PHE B CG  
2518 C CD1 . PHE B 33  ? 0.1064 0.1075 0.0952 -0.0029 -0.0019 -0.0010 53   PHE B CD1 
2519 C CD2 . PHE B 33  ? 0.1074 0.1050 0.0966 0.0004  -0.0044 0.0005  53   PHE B CD2 
2520 C CE1 . PHE B 33  ? 0.1072 0.1088 0.0914 0.0015  -0.0020 -0.0012 53   PHE B CE1 
2521 C CE2 . PHE B 33  ? 0.1187 0.1050 0.0980 -0.0022 -0.0046 0.0010  53   PHE B CE2 
2522 C CZ  . PHE B 33  ? 0.1161 0.1079 0.0946 -0.0022 -0.0046 0.0059  53   PHE B CZ  
2523 N N   . SER B 34  ? 0.1142 0.1096 0.1017 -0.0055 0.0011  0.0015  54   SER B N   
2524 C CA  . SER B 34  ? 0.1109 0.1113 0.1108 -0.0060 0.0045  0.0019  54   SER B CA  
2525 C C   . SER B 34  ? 0.1163 0.1255 0.1132 -0.0003 0.0086  0.0034  54   SER B C   
2526 O O   . SER B 34  ? 0.1087 0.1309 0.1104 0.0018  0.0131  0.0036  54   SER B O   
2527 C CB  . SER B 34  ? 0.1026 0.1237 0.1066 -0.0049 0.0016  -0.0035 54   SER B CB  
2528 O OG  . SER B 34  ? 0.0952 0.1431 0.1035 -0.0069 -0.0017 -0.0062 54   SER B OG  
2529 N N   . PRO B 35  ? 0.1222 0.1322 0.1159 -0.0010 0.0097  0.0081  55   PRO B N   
2530 C CA  . PRO B 35  ? 0.1208 0.1334 0.1266 0.0016  0.0098  0.0072  55   PRO B CA  
2531 C C   . PRO B 35  ? 0.1287 0.1419 0.1299 -0.0044 0.0044  0.0121  55   PRO B C   
2532 O O   . PRO B 35  ? 0.1271 0.1612 0.1593 0.0002  0.0263  0.0154  55   PRO B O   
2533 C CB  . PRO B 35  ? 0.1259 0.1399 0.1264 -0.0015 0.0113  0.0088  55   PRO B CB  
2534 C CG  . PRO B 35  ? 0.1259 0.1465 0.1269 0.0052  0.0154  0.0077  55   PRO B CG  
2535 C CD  . PRO B 35  ? 0.1197 0.1307 0.1186 0.0002  0.0080  0.0069  55   PRO B CD  
2536 N N   . ASN B 36  ? 0.1280 0.1495 0.1271 -0.0089 0.0014  0.0088  56   ASN B N   
2537 C CA  . ASN B 36  ? 0.1298 0.1573 0.1326 -0.0118 -0.0010 0.0036  56   ASN B CA  
2538 C C   . ASN B 36  ? 0.1377 0.1667 0.1395 -0.0100 -0.0046 0.0104  56   ASN B C   
2539 O O   . ASN B 36  ? 0.1493 0.2032 0.1435 -0.0179 -0.0129 0.0108  56   ASN B O   
2540 C CB  . ASN B 36  ? 0.1364 0.1536 0.1298 -0.0132 -0.0058 0.0119  56   ASN B CB  
2541 C CG  . ASN B 36  ? 0.1444 0.1529 0.1461 -0.0127 -0.0043 0.0062  56   ASN B CG  
2542 O OD1 . ASN B 36  ? 0.1509 0.1694 0.1388 -0.0203 0.0062  0.0195  56   ASN B OD1 
2543 N ND2 . ASN B 36  ? 0.1564 0.1513 0.1561 -0.0098 -0.0035 0.0145  56   ASN B ND2 
2544 N N   . GLY B 37  ? 0.1480 0.1585 0.1443 -0.0152 -0.0036 0.0096  57   GLY B N   
2545 C CA  . GLY B 37  ? 0.1570 0.1612 0.1460 -0.0141 -0.0069 0.0097  57   GLY B CA  
2546 C C   . GLY B 37  ? 0.1414 0.1494 0.1519 -0.0138 -0.0055 0.0059  57   GLY B C   
2547 O O   . GLY B 37  ? 0.1565 0.1575 0.1562 -0.0105 0.0057  0.0109  57   GLY B O   
2548 N N   . GLU B 38  ? 0.1375 0.1496 0.1493 -0.0140 -0.0079 0.0036  58   GLU B N   
2549 C CA  . GLU B 38  ? 0.1384 0.1546 0.1504 -0.0118 -0.0035 0.0039  58   GLU B CA  
2550 C C   . GLU B 38  ? 0.1362 0.1497 0.1365 -0.0113 -0.0071 -0.0003 58   GLU B C   
2551 O O   . GLU B 38  ? 0.1426 0.1647 0.1393 -0.0167 -0.0043 0.0060  58   GLU B O   
2552 C CB  . GLU B 38  ? 0.1555 0.1559 0.1691 -0.0151 -0.0062 -0.0027 58   GLU B CB  
2553 C CG  . GLU B 38  ? 0.1577 0.1841 0.1844 -0.0179 0.0025  -0.0037 58   GLU B CG  
2554 C CD  . GLU B 38  ? 0.1644 0.2066 0.2014 -0.0164 -0.0106 0.0008  58   GLU B CD  
2555 O OE1 . GLU B 38  ? 0.2134 0.2454 0.2370 -0.0280 -0.0140 -0.0316 58   GLU B OE1 
2556 O OE2 . GLU B 38  ? 0.1978 0.2045 0.2234 -0.0186 -0.0153 0.0125  58   GLU B OE2 
2557 N N   . TRP B 39  ? 0.1284 0.1353 0.1221 -0.0144 0.0027  -0.0036 59   TRP B N   
2558 C CA  . TRP B 39  ? 0.1274 0.1391 0.1274 -0.0120 -0.0001 -0.0102 59   TRP B CA  
2559 C C   . TRP B 39  ? 0.1146 0.1360 0.1188 -0.0079 0.0024  -0.0073 59   TRP B C   
2560 O O   . TRP B 39  ? 0.1127 0.1335 0.1186 0.0039  -0.0109 -0.0110 59   TRP B O   
2561 C CB  . TRP B 39  ? 0.1390 0.1461 0.1384 -0.0085 0.0014  -0.0007 59   TRP B CB  
2562 C CG  . TRP B 39  ? 0.1620 0.1525 0.1599 -0.0166 0.0037  -0.0105 59   TRP B CG  
2563 C CD1 . TRP B 39  ? 0.1683 0.1678 0.1670 -0.0162 0.0150  -0.0071 59   TRP B CD1 
2564 C CD2 . TRP B 39  ? 0.1688 0.1696 0.1603 -0.0113 0.0058  -0.0138 59   TRP B CD2 
2565 N NE1 . TRP B 39  ? 0.1901 0.1835 0.1750 -0.0233 0.0123  -0.0169 59   TRP B NE1 
2566 C CE2 . TRP B 39  ? 0.1868 0.1706 0.1699 -0.0183 0.0068  -0.0186 59   TRP B CE2 
2567 C CE3 . TRP B 39  ? 0.1713 0.1758 0.1668 -0.0109 0.0087  -0.0076 59   TRP B CE3 
2568 C CZ2 . TRP B 39  ? 0.1886 0.1860 0.1710 -0.0214 0.0093  -0.0254 59   TRP B CZ2 
2569 C CZ3 . TRP B 39  ? 0.1742 0.1713 0.1653 -0.0082 0.0148  -0.0084 59   TRP B CZ3 
2570 C CH2 . TRP B 39  ? 0.1925 0.1779 0.1755 -0.0207 0.0077  -0.0155 59   TRP B CH2 
2571 N N   . LEU B 40  ? 0.1097 0.1224 0.1006 -0.0048 -0.0037 -0.0110 60   LEU B N   
2572 C CA  . LEU B 40  ? 0.1044 0.1065 0.0946 -0.0031 0.0007  -0.0011 60   LEU B CA  
2573 C C   . LEU B 40  ? 0.1062 0.1034 0.0899 -0.0025 -0.0036 -0.0034 60   LEU B C   
2574 O O   . LEU B 40  ? 0.1138 0.1039 0.0902 0.0007  -0.0064 -0.0054 60   LEU B O   
2575 C CB  . LEU B 40  ? 0.1055 0.1043 0.0971 -0.0027 -0.0040 0.0029  60   LEU B CB  
2576 C CG  . LEU B 40  ? 0.1072 0.1009 0.0989 -0.0037 0.0003  0.0078  60   LEU B CG  
2577 C CD1 . LEU B 40  ? 0.1182 0.0878 0.1014 -0.0009 -0.0017 0.0100  60   LEU B CD1 
2578 C CD2 . LEU B 40  ? 0.1158 0.1018 0.1045 -0.0074 -0.0003 0.0131  60   LEU B CD2 
2579 N N   . ALA B 41  ? 0.0969 0.0929 0.0871 -0.0050 0.0005  -0.0066 61   ALA B N   
2580 C CA  . ALA B 41  ? 0.0996 0.0912 0.0878 -0.0036 -0.0025 -0.0085 61   ALA B CA  
2581 C C   . ALA B 41  ? 0.0875 0.0868 0.0850 0.0040  -0.0010 -0.0086 61   ALA B C   
2582 O O   . ALA B 41  ? 0.0859 0.0837 0.0923 -0.0020 -0.0102 -0.0124 61   ALA B O   
2583 C CB  . ALA B 41  ? 0.0991 0.0935 0.0969 -0.0019 -0.0055 -0.0004 61   ALA B CB  
2584 N N   . SER B 42  ? 0.0834 0.0867 0.0856 0.0007  -0.0025 -0.0081 62   SER B N   
2585 C CA  . SER B 42  ? 0.0841 0.0803 0.0853 0.0024  -0.0023 -0.0083 62   SER B CA  
2586 C C   . SER B 42  ? 0.0842 0.0802 0.0848 0.0017  -0.0036 -0.0085 62   SER B C   
2587 O O   . SER B 42  ? 0.0918 0.0794 0.0916 -0.0004 -0.0054 -0.0101 62   SER B O   
2588 C CB  . SER B 42  ? 0.0790 0.0786 0.0822 0.0033  -0.0050 -0.0095 62   SER B CB  
2589 O OG  . SER B 42  ? 0.0811 0.0811 0.0744 -0.0009 -0.0062 -0.0069 62   SER B OG  
2590 N N   . SER B 43  ? 0.0797 0.0742 0.0848 -0.0005 0.0011  -0.0085 63   SER B N   
2591 C CA  . SER B 43  ? 0.0803 0.0769 0.0795 0.0000  0.0011  -0.0070 63   SER B CA  
2592 C C   . SER B 43  ? 0.0807 0.0752 0.0779 0.0018  0.0014  -0.0041 63   SER B C   
2593 O O   . SER B 43  ? 0.0799 0.0734 0.0714 0.0018  0.0000  -0.0085 63   SER B O   
2594 C CB  . SER B 43  ? 0.0740 0.0799 0.0801 0.0016  -0.0028 -0.0061 63   SER B CB  
2595 O OG  . SER B 43  ? 0.0746 0.0821 0.0940 0.0009  -0.0012 -0.0115 63   SER B OG  
2596 N N   . SER B 44  ? 0.0801 0.0792 0.0797 0.0014  0.0059  -0.0007 64   SER B N   
2597 C CA  . SER B 44  ? 0.0818 0.0858 0.0789 -0.0020 0.0054  -0.0011 64   SER B CA  
2598 C C   . SER B 44  ? 0.0833 0.0821 0.0749 -0.0025 0.0061  0.0038  64   SER B C   
2599 O O   . SER B 44  ? 0.0810 0.0858 0.0685 -0.0047 0.0042  0.0067  64   SER B O   
2600 C CB  . SER B 44  ? 0.0754 0.0876 0.0788 -0.0037 0.0078  -0.0009 64   SER B CB  
2601 O OG  . SER B 44  ? 0.0757 0.0916 0.0848 -0.0017 0.0110  -0.0038 64   SER B OG  
2602 N N   . ALA B 45  ? 0.0899 0.0875 0.0751 -0.0086 0.0015  0.0050  65   ALA B N   
2603 C CA  . ALA B 45  ? 0.0908 0.0898 0.0802 -0.0054 0.0032  0.0024  65   ALA B CA  
2604 C C   . ALA B 45  ? 0.0978 0.0940 0.0845 -0.0020 0.0016  -0.0012 65   ALA B C   
2605 O O   . ALA B 45  ? 0.0960 0.1081 0.0904 0.0039  0.0033  -0.0099 65   ALA B O   
2606 C CB  . ALA B 45  ? 0.0944 0.0909 0.0865 -0.0084 -0.0003 0.0001  65   ALA B CB  
2607 N N   . ASP B 46  ? 0.0931 0.0975 0.0860 -0.0032 0.0025  -0.0028 66   ASP B N   
2608 C CA  . ASP B 46  ? 0.1026 0.0931 0.0946 0.0046  -0.0009 -0.0016 66   ASP B CA  
2609 C C   . ASP B 46  ? 0.1010 0.0948 0.0948 0.0026  0.0002  -0.0016 66   ASP B C   
2610 O O   . ASP B 46  ? 0.1129 0.0999 0.1012 0.0044  -0.0053 -0.0077 66   ASP B O   
2611 C CB  . ASP B 46  ? 0.1068 0.0984 0.0950 0.0052  -0.0040 -0.0072 66   ASP B CB  
2612 C CG  . ASP B 46  ? 0.1072 0.1076 0.0980 0.0053  0.0010  -0.0040 66   ASP B CG  
2613 O OD1 . ASP B 46  ? 0.1026 0.1074 0.1130 -0.0004 0.0055  0.0049  66   ASP B OD1 
2614 O OD2 . ASP B 46  ? 0.1200 0.1238 0.1099 0.0058  -0.0135 -0.0027 66   ASP B OD2 
2615 N N   . LYS B 47  ? 0.1027 0.0957 0.1009 -0.0005 0.0089  -0.0004 67   LYS B N   
2616 C CA  . LYS B 47  ? 0.1045 0.0968 0.1038 -0.0022 0.0042  0.0012  67   LYS B CA  
2617 C C   . LYS B 47  ? 0.1016 0.0923 0.1012 0.0011  0.0038  0.0012  67   LYS B C   
2618 O O   . LYS B 47  ? 0.0987 0.0947 0.1074 -0.0035 0.0067  0.0021  67   LYS B O   
2619 C CB  . LYS B 47  ? 0.1082 0.1079 0.1109 0.0044  0.0027  0.0000  67   LYS B CB  
2620 C CG  . LYS B 47  ? 0.1096 0.1141 0.1170 0.0019  0.0033  -0.0035 67   LYS B CG  
2621 C CD  . LYS B 47  ? 0.1116 0.1205 0.1279 0.0064  0.0020  -0.0013 67   LYS B CD  
2622 C CE  . LYS B 47  ? 0.1303 0.1322 0.1283 0.0009  0.0016  -0.0028 67   LYS B CE  
2623 N NZ  . LYS B 47  ? 0.1384 0.1517 0.1713 0.0175  0.0054  -0.0029 67   LYS B NZ  
2624 N N   . LEU B 48  ? 0.0986 0.0905 0.0959 -0.0028 0.0017  -0.0039 68   LEU B N   
2625 C CA  . LEU B 48  ? 0.0959 0.0891 0.0958 -0.0022 0.0026  -0.0020 68   LEU B CA  
2626 C C   . LEU B 48  ? 0.1025 0.0834 0.0920 -0.0011 0.0028  -0.0072 68   LEU B C   
2627 O O   . LEU B 48  ? 0.0988 0.0809 0.0911 -0.0058 0.0064  -0.0039 68   LEU B O   
2628 C CB  . LEU B 48  ? 0.1080 0.0986 0.0960 -0.0030 -0.0052 -0.0049 68   LEU B CB  
2629 C CG  . LEU B 48  ? 0.1073 0.0948 0.0966 -0.0033 -0.0052 -0.0040 68   LEU B CG  
2630 C CD1 . LEU B 48  ? 0.1277 0.1034 0.0987 -0.0017 -0.0057 0.0014  68   LEU B CD1 
2631 C CD2 . LEU B 48  ? 0.1044 0.0956 0.1011 -0.0018 -0.0007 -0.0015 68   LEU B CD2 
2632 N N   . ILE B 49  ? 0.1043 0.0851 0.0846 -0.0021 0.0046  -0.0010 69   ILE B N   
2633 C CA  . ILE B 49  ? 0.1032 0.0852 0.0879 -0.0028 -0.0007 -0.0014 69   ILE B CA  
2634 C C   . ILE B 49  ? 0.1061 0.0864 0.0841 -0.0002 0.0022  -0.0046 69   ILE B C   
2635 O O   . ILE B 49  ? 0.1100 0.0784 0.0852 -0.0016 -0.0039 0.0002  69   ILE B O   
2636 C CB  . ILE B 49  ? 0.1080 0.0999 0.0899 -0.0061 0.0011  0.0021  69   ILE B CB  
2637 C CG1 . ILE B 49  ? 0.1164 0.1030 0.0946 -0.0045 -0.0066 0.0034  69   ILE B CG1 
2638 C CG2 . ILE B 49  ? 0.1083 0.1056 0.0907 -0.0052 0.0025  0.0110  69   ILE B CG2 
2639 C CD1 . ILE B 49  ? 0.1310 0.1044 0.1070 -0.0150 -0.0019 0.0080  69   ILE B CD1 
2640 N N   . LYS B 50  ? 0.1058 0.0869 0.0816 -0.0016 -0.0005 -0.0064 70   LYS B N   
2641 C CA  . LYS B 50  ? 0.1026 0.0866 0.0824 -0.0011 -0.0008 -0.0031 70   LYS B CA  
2642 C C   . LYS B 50  ? 0.1063 0.0920 0.0838 0.0001  0.0026  -0.0077 70   LYS B C   
2643 O O   . LYS B 50  ? 0.1060 0.0918 0.0777 -0.0004 0.0097  -0.0109 70   LYS B O   
2644 C CB  . LYS B 50  ? 0.1079 0.0878 0.0841 -0.0034 -0.0017 -0.0011 70   LYS B CB  
2645 C CG  . LYS B 50  ? 0.1045 0.0914 0.0837 -0.0084 0.0003  0.0039  70   LYS B CG  
2646 C CD  . LYS B 50  ? 0.1116 0.0849 0.0839 -0.0125 0.0028  0.0049  70   LYS B CD  
2647 C CE  . LYS B 50  ? 0.1166 0.0989 0.0935 -0.0058 0.0067  0.0095  70   LYS B CE  
2648 N NZ  . LYS B 50  ? 0.1392 0.1037 0.1027 -0.0079 0.0078  0.0045  70   LYS B NZ  
2649 N N   . ILE B 51  ? 0.1087 0.0919 0.0814 -0.0042 -0.0002 -0.0046 71   ILE B N   
2650 C CA  . ILE B 51  ? 0.1096 0.1017 0.0910 -0.0011 -0.0022 -0.0060 71   ILE B CA  
2651 C C   . ILE B 51  ? 0.1120 0.1044 0.0921 -0.0030 -0.0014 -0.0024 71   ILE B C   
2652 O O   . ILE B 51  ? 0.1210 0.1126 0.1050 0.0005  0.0080  -0.0113 71   ILE B O   
2653 C CB  . ILE B 51  ? 0.1102 0.1103 0.0941 -0.0062 -0.0002 -0.0014 71   ILE B CB  
2654 C CG1 . ILE B 51  ? 0.1153 0.1175 0.1107 0.0006  -0.0052 0.0075  71   ILE B CG1 
2655 C CG2 . ILE B 51  ? 0.1112 0.1142 0.0964 -0.0071 0.0021  -0.0020 71   ILE B CG2 
2656 C CD1 . ILE B 51  ? 0.1245 0.1240 0.1226 0.0002  0.0019  -0.0019 71   ILE B CD1 
2657 N N   . TRP B 52  ? 0.1043 0.1090 0.0922 -0.0027 -0.0032 0.0005  72   TRP B N   
2658 C CA  . TRP B 52  ? 0.1028 0.1042 0.0938 -0.0020 -0.0063 -0.0029 72   TRP B CA  
2659 C C   . TRP B 52  ? 0.1034 0.1154 0.1054 -0.0034 -0.0044 -0.0044 72   TRP B C   
2660 O O   . TRP B 52  ? 0.1037 0.1299 0.1066 -0.0040 -0.0038 -0.0080 72   TRP B O   
2661 C CB  . TRP B 52  ? 0.0986 0.1052 0.0940 -0.0005 0.0002  0.0013  72   TRP B CB  
2662 C CG  . TRP B 52  ? 0.1001 0.0998 0.0914 -0.0027 -0.0037 -0.0015 72   TRP B CG  
2663 C CD1 . TRP B 52  ? 0.0977 0.0927 0.0891 -0.0030 -0.0009 -0.0026 72   TRP B CD1 
2664 C CD2 . TRP B 52  ? 0.1025 0.1020 0.0905 -0.0031 -0.0028 -0.0004 72   TRP B CD2 
2665 N NE1 . TRP B 52  ? 0.0974 0.0969 0.0895 -0.0092 -0.0055 -0.0018 72   TRP B NE1 
2666 C CE2 . TRP B 52  ? 0.1000 0.0973 0.0921 -0.0023 -0.0007 -0.0006 72   TRP B CE2 
2667 C CE3 . TRP B 52  ? 0.1058 0.1028 0.0905 -0.0043 -0.0063 -0.0002 72   TRP B CE3 
2668 C CZ2 . TRP B 52  ? 0.0984 0.1021 0.0997 -0.0064 -0.0020 0.0025  72   TRP B CZ2 
2669 C CZ3 . TRP B 52  ? 0.1040 0.0986 0.0998 -0.0028 -0.0058 0.0027  72   TRP B CZ3 
2670 C CH2 . TRP B 52  ? 0.0979 0.0958 0.0992 -0.0050 0.0000  -0.0008 72   TRP B CH2 
2671 N N   . GLY B 53  ? 0.1161 0.1217 0.1042 -0.0005 -0.0081 -0.0101 73   GLY B N   
2672 C CA  . GLY B 53  ? 0.1173 0.1238 0.1132 0.0011  -0.0076 -0.0062 73   GLY B CA  
2673 C C   . GLY B 53  ? 0.1183 0.1258 0.1131 0.0031  -0.0088 -0.0083 73   GLY B C   
2674 O O   . GLY B 53  ? 0.1288 0.1358 0.1178 -0.0001 -0.0094 0.0036  73   GLY B O   
2675 N N   . ALA B 54  ? 0.1227 0.1328 0.1101 -0.0006 -0.0057 -0.0016 74   ALA B N   
2676 C CA  . ALA B 54  ? 0.1303 0.1288 0.1299 0.0002  -0.0020 -0.0013 74   ALA B CA  
2677 C C   . ALA B 54  ? 0.1246 0.1379 0.1330 0.0067  0.0042  0.0019  74   ALA B C   
2678 O O   . ALA B 54  ? 0.1210 0.1446 0.1441 -0.0017 0.0019  -0.0036 74   ALA B O   
2679 C CB  . ALA B 54  ? 0.1346 0.1435 0.1261 0.0006  -0.0021 -0.0096 74   ALA B CB  
2680 N N   . TYR B 55  ? 0.1366 0.1474 0.1401 0.0038  -0.0012 -0.0046 75   TYR B N   
2681 C CA  . TYR B 55  ? 0.1504 0.1580 0.1538 0.0087  -0.0065 0.0009  75   TYR B CA  
2682 C C   . TYR B 55  ? 0.1620 0.1676 0.1580 0.0066  -0.0013 0.0058  75   TYR B C   
2683 O O   . TYR B 55  ? 0.1862 0.1808 0.1954 0.0298  0.0086  0.0182  75   TYR B O   
2684 C CB  . TYR B 55  ? 0.1466 0.1703 0.1534 0.0084  -0.0009 -0.0007 75   TYR B CB  
2685 C CG  . TYR B 55  ? 0.1464 0.1541 0.1471 0.0015  -0.0067 -0.0047 75   TYR B CG  
2686 C CD1 . TYR B 55  ? 0.1484 0.1565 0.1491 -0.0003 -0.0056 -0.0067 75   TYR B CD1 
2687 C CD2 . TYR B 55  ? 0.1390 0.1620 0.1370 -0.0056 -0.0028 0.0001  75   TYR B CD2 
2688 C CE1 . TYR B 55  ? 0.1465 0.1642 0.1483 -0.0091 -0.0103 0.0004  75   TYR B CE1 
2689 C CE2 . TYR B 55  ? 0.1452 0.1684 0.1389 -0.0128 -0.0044 0.0061  75   TYR B CE2 
2690 C CZ  . TYR B 55  ? 0.1366 0.1660 0.1440 -0.0122 -0.0152 0.0022  75   TYR B CZ  
2691 O OH  . TYR B 55  ? 0.1458 0.1998 0.1541 -0.0235 -0.0094 0.0108  75   TYR B OH  
2692 N N   . ASP B 56  ? 0.1610 0.1847 0.1553 0.0085  -0.0010 0.0020  76   ASP B N   
2693 C CA  . ASP B 56  ? 0.1700 0.1935 0.1638 0.0073  0.0075  0.0092  76   ASP B CA  
2694 C C   . ASP B 56  ? 0.1702 0.1980 0.1627 0.0043  -0.0051 0.0136  76   ASP B C   
2695 O O   . ASP B 56  ? 0.1889 0.2007 0.1804 0.0070  0.0110  0.0286  76   ASP B O   
2696 C CB  . ASP B 56  ? 0.1834 0.2102 0.1705 0.0051  -0.0013 0.0038  76   ASP B CB  
2697 C CG  . ASP B 56  ? 0.1892 0.2093 0.1782 0.0098  -0.0046 -0.0024 76   ASP B CG  
2698 O OD1 . ASP B 56  ? 0.1721 0.2233 0.1686 0.0067  0.0010  -0.0030 76   ASP B OD1 
2699 O OD2 . ASP B 56  ? 0.2162 0.2582 0.1903 -0.0074 -0.0146 -0.0279 76   ASP B OD2 
2700 N N   . GLY B 57  ? 0.1643 0.1845 0.1600 -0.0039 -0.0037 0.0127  77   GLY B N   
2701 C CA  . GLY B 57  ? 0.1632 0.1648 0.1414 -0.0010 0.0054  0.0062  77   GLY B CA  
2702 C C   . GLY B 57  ? 0.1636 0.1733 0.1480 0.0034  0.0033  0.0014  77   GLY B C   
2703 O O   . GLY B 57  ? 0.1658 0.1810 0.1519 0.0038  0.0128  -0.0007 77   GLY B O   
2704 N N   . LYS B 58  ? 0.1582 0.1730 0.1484 0.0100  -0.0034 0.0002  78   LYS B N   
2705 C CA  . LYS B 58  ? 0.1714 0.1708 0.1574 0.0094  -0.0031 -0.0017 78   LYS B CA  
2706 C C   . LYS B 58  ? 0.1576 0.1659 0.1469 0.0041  -0.0008 -0.0046 78   LYS B C   
2707 O O   . LYS B 58  ? 0.1436 0.1700 0.1464 0.0078  -0.0036 -0.0031 78   LYS B O   
2708 C CB  . LYS B 58  ? 0.1833 0.1837 0.1662 0.0000  -0.0131 -0.0022 78   LYS B CB  
2709 C CG  . LYS B 58  ? 0.2175 0.2009 0.1996 0.0154  -0.0050 -0.0135 78   LYS B CG  
2710 C CD  . LYS B 58  ? 0.2267 0.2403 0.2402 -0.0054 -0.0130 -0.0057 78   LYS B CD  
2711 C CE  . LYS B 58  ? 0.2699 0.2596 0.2786 0.0049  0.0026  -0.0226 78   LYS B CE  
2712 N NZ  . LYS B 58  ? 0.2699 0.3014 0.3079 -0.0159 -0.0220 -0.0219 78   LYS B NZ  
2713 N N   . PHE B 59  ? 0.1535 0.1600 0.1305 -0.0022 -0.0051 -0.0029 79   PHE B N   
2714 C CA  . PHE B 59  ? 0.1591 0.1540 0.1391 -0.0013 -0.0057 0.0012  79   PHE B CA  
2715 C C   . PHE B 59  ? 0.1652 0.1522 0.1460 -0.0019 -0.0125 0.0000  79   PHE B C   
2716 O O   . PHE B 59  ? 0.1821 0.1380 0.1437 -0.0051 -0.0180 0.0079  79   PHE B O   
2717 C CB  . PHE B 59  ? 0.1591 0.1497 0.1269 -0.0055 -0.0086 -0.0097 79   PHE B CB  
2718 C CG  . PHE B 59  ? 0.1663 0.1456 0.1409 -0.0001 0.0004  -0.0058 79   PHE B CG  
2719 C CD1 . PHE B 59  ? 0.1679 0.1437 0.1373 -0.0007 0.0033  -0.0073 79   PHE B CD1 
2720 C CD2 . PHE B 59  ? 0.1721 0.1451 0.1369 0.0003  0.0021  -0.0048 79   PHE B CD2 
2721 C CE1 . PHE B 59  ? 0.1712 0.1536 0.1374 0.0112  0.0077  -0.0082 79   PHE B CE1 
2722 C CE2 . PHE B 59  ? 0.1631 0.1536 0.1496 0.0063  0.0037  -0.0049 79   PHE B CE2 
2723 C CZ  . PHE B 59  ? 0.1728 0.1423 0.1498 0.0028  0.0022  -0.0041 79   PHE B CZ  
2724 N N   . GLU B 60  ? 0.1480 0.1564 0.1364 -0.0030 -0.0168 -0.0092 80   GLU B N   
2725 C CA  . GLU B 60  ? 0.1672 0.1566 0.1463 -0.0042 -0.0163 -0.0046 80   GLU B CA  
2726 C C   . GLU B 60  ? 0.1625 0.1525 0.1397 -0.0069 -0.0116 -0.0079 80   GLU B C   
2727 O O   . GLU B 60  ? 0.1695 0.1510 0.1557 0.0065  -0.0175 -0.0117 80   GLU B O   
2728 C CB  . GLU B 60  ? 0.1607 0.1770 0.1713 -0.0059 -0.0038 -0.0045 80   GLU B CB  
2729 C CG  . GLU B 60  ? 0.1771 0.1833 0.2094 -0.0174 -0.0093 -0.0009 80   GLU B CG  
2730 C CD  . GLU B 60  ? 0.1918 0.1941 0.2248 -0.0189 -0.0149 -0.0163 80   GLU B CD  
2731 O OE1 . GLU B 60  ? 0.1778 0.2061 0.2341 -0.0173 -0.0138 -0.0075 80   GLU B OE1 
2732 O OE2 . GLU B 60  ? 0.2086 0.2059 0.2900 -0.0386 -0.0105 -0.0109 80   GLU B OE2 
2733 N N   . LYS B 61  ? 0.1552 0.1342 0.1356 -0.0005 -0.0084 -0.0079 81   LYS B N   
2734 C CA  . LYS B 61  ? 0.1503 0.1321 0.1254 -0.0007 -0.0043 -0.0121 81   LYS B CA  
2735 C C   . LYS B 61  ? 0.1423 0.1165 0.1197 0.0062  -0.0026 -0.0061 81   LYS B C   
2736 O O   . LYS B 61  ? 0.1568 0.1197 0.1138 0.0059  -0.0033 -0.0079 81   LYS B O   
2737 C CB  . LYS B 61  ? 0.1586 0.1348 0.1395 -0.0034 -0.0008 -0.0087 81   LYS B CB  
2738 C CG  . LYS B 61  ? 0.1566 0.1480 0.1370 -0.0077 0.0006  -0.0047 81   LYS B CG  
2739 C CD  . LYS B 61  ? 0.1779 0.1589 0.1488 -0.0129 0.0054  0.0036  81   LYS B CD  
2740 C CE  . LYS B 61  ? 0.1767 0.1791 0.1708 -0.0141 0.0010  0.0049  81   LYS B CE  
2741 N NZ  . LYS B 61  ? 0.2077 0.1744 0.1849 -0.0332 -0.0036 0.0006  81   LYS B NZ  
2742 N N   . THR B 62  ? 0.1357 0.1096 0.1129 -0.0001 -0.0002 -0.0042 82   THR B N   
2743 C CA  . THR B 62  ? 0.1318 0.1052 0.1160 0.0000  0.0001  -0.0025 82   THR B CA  
2744 C C   . THR B 62  ? 0.1322 0.1105 0.1120 -0.0026 0.0046  -0.0009 82   THR B C   
2745 O O   . THR B 62  ? 0.1350 0.1136 0.1066 -0.0007 0.0038  -0.0095 82   THR B O   
2746 C CB  . THR B 62  ? 0.1346 0.0975 0.1128 0.0050  0.0016  -0.0030 82   THR B CB  
2747 O OG1 . THR B 62  ? 0.1437 0.1039 0.1066 -0.0020 0.0017  0.0004  82   THR B OG1 
2748 C CG2 . THR B 62  ? 0.1436 0.0989 0.1104 -0.0001 -0.0028 -0.0018 82   THR B CG2 
2749 N N   . ILE B 63  ? 0.1306 0.1099 0.1153 -0.0008 -0.0006 -0.0001 83   ILE B N   
2750 C CA  . ILE B 63  ? 0.1316 0.1079 0.1192 -0.0001 -0.0029 0.0008  83   ILE B CA  
2751 C C   . ILE B 63  ? 0.1354 0.1155 0.1297 -0.0029 -0.0080 0.0025  83   ILE B C   
2752 O O   . ILE B 63  ? 0.1605 0.1187 0.1254 -0.0024 -0.0222 -0.0079 83   ILE B O   
2753 C CB  . ILE B 63  ? 0.1338 0.1184 0.1148 -0.0037 -0.0036 0.0009  83   ILE B CB  
2754 C CG1 . ILE B 63  ? 0.1253 0.1218 0.1189 -0.0049 0.0074  0.0009  83   ILE B CG1 
2755 C CG2 . ILE B 63  ? 0.1421 0.1210 0.1181 -0.0020 -0.0033 0.0047  83   ILE B CG2 
2756 C CD1 . ILE B 63  ? 0.1245 0.1386 0.1164 -0.0023 0.0096  -0.0013 83   ILE B CD1 
2757 N N   . SER B 64  ? 0.1428 0.1177 0.1300 0.0024  -0.0010 0.0038  84   SER B N   
2758 C CA  . SER B 64  ? 0.1402 0.1179 0.1338 -0.0004 0.0046  0.0006  84   SER B CA  
2759 C C   . SER B 64  ? 0.1347 0.1218 0.1210 -0.0026 0.0098  -0.0006 84   SER B C   
2760 O O   . SER B 64  ? 0.1321 0.1258 0.1192 -0.0039 0.0239  0.0007  84   SER B O   
2761 C CB  . SER B 64  ? 0.1609 0.1262 0.1407 -0.0066 0.0147  0.0130  84   SER B CB  
2762 O OG  . SER B 64  ? 0.1878 0.1500 0.1394 -0.0095 0.0382  -0.0151 84   SER B OG  
2763 N N   . GLY B 65  ? 0.1231 0.1146 0.1148 -0.0023 0.0193  0.0034  85   GLY B N   
2764 C CA  . GLY B 65  ? 0.1175 0.1178 0.1140 0.0025  0.0121  -0.0036 85   GLY B CA  
2765 C C   . GLY B 65  ? 0.1193 0.1053 0.1172 0.0000  0.0123  -0.0022 85   GLY B C   
2766 O O   . GLY B 65  ? 0.1208 0.1287 0.1446 0.0116  0.0085  -0.0005 85   GLY B O   
2767 N N   . HIS B 66  ? 0.1146 0.1025 0.1049 0.0033  0.0043  0.0037  86   HIS B N   
2768 C CA  . HIS B 66  ? 0.1169 0.0955 0.1075 0.0061  0.0033  0.0026  86   HIS B CA  
2769 C C   . HIS B 66  ? 0.1180 0.1018 0.1121 0.0039  0.0057  0.0047  86   HIS B C   
2770 O O   . HIS B 66  ? 0.1233 0.1260 0.1168 0.0087  0.0163  0.0099  86   HIS B O   
2771 C CB  . HIS B 66  ? 0.1097 0.0964 0.0923 0.0045  0.0060  -0.0018 86   HIS B CB  
2772 C CG  . HIS B 66  ? 0.1010 0.0926 0.0950 -0.0006 0.0045  0.0067  86   HIS B CG  
2773 N ND1 . HIS B 66  ? 0.0960 0.0962 0.0931 0.0016  0.0047  0.0015  86   HIS B ND1 
2774 C CD2 . HIS B 66  ? 0.0992 0.0892 0.0919 -0.0035 0.0087  0.0025  86   HIS B CD2 
2775 C CE1 . HIS B 66  ? 0.0947 0.0848 0.0924 -0.0034 0.0061  0.0032  86   HIS B CE1 
2776 N NE2 . HIS B 66  ? 0.0976 0.0898 0.0910 -0.0022 0.0069  0.0058  86   HIS B NE2 
2777 N N   . LYS B 67  ? 0.1161 0.1134 0.1237 0.0074  0.0032  0.0081  87   LYS B N   
2778 C CA  . LYS B 67  ? 0.1210 0.1230 0.1334 0.0037  0.0110  0.0084  87   LYS B CA  
2779 C C   . LYS B 67  ? 0.1149 0.1223 0.1272 0.0074  0.0133  0.0096  87   LYS B C   
2780 O O   . LYS B 67  ? 0.1240 0.1403 0.1453 0.0127  0.0261  0.0208  87   LYS B O   
2781 C CB  . LYS B 67  ? 0.1306 0.1428 0.1463 0.0051  0.0009  0.0138  87   LYS B CB  
2782 C CG  . LYS B 67  ? 0.1549 0.1443 0.1785 0.0027  -0.0137 0.0165  87   LYS B CG  
2783 C CD  . LYS B 67  ? 0.1861 0.1889 0.1921 0.0076  -0.0140 -0.0047 87   LYS B CD  
2784 C CE  . LYS B 67  ? 0.2298 0.1913 0.2271 0.0102  -0.0191 0.0039  87   LYS B CE  
2785 N NZ  . LYS B 67  ? 0.3087 0.2502 0.2257 0.0105  -0.0157 -0.0080 87   LYS B NZ  
2786 N N   . LEU B 68  ? 0.1067 0.1102 0.1282 0.0056  0.0068  0.0142  88   LEU B N   
2787 C CA  . LEU B 68  ? 0.1004 0.1102 0.1172 0.0086  0.0084  0.0153  88   LEU B CA  
2788 C C   . LEU B 68  ? 0.1036 0.0957 0.1078 0.0061  0.0053  0.0139  88   LEU B C   
2789 O O   . LEU B 68  ? 0.0973 0.0944 0.1130 0.0127  0.0047  0.0136  88   LEU B O   
2790 C CB  . LEU B 68  ? 0.1065 0.1162 0.1226 0.0032  0.0060  0.0127  88   LEU B CB  
2791 C CG  . LEU B 68  ? 0.1080 0.1267 0.1159 0.0020  -0.0032 0.0153  88   LEU B CG  
2792 C CD1 . LEU B 68  ? 0.1061 0.1205 0.1156 -0.0031 0.0010  0.0155  88   LEU B CD1 
2793 C CD2 . LEU B 68  ? 0.1042 0.1384 0.1216 0.0046  -0.0009 0.0093  88   LEU B CD2 
2794 N N   . GLY B 69  ? 0.1015 0.0941 0.0961 0.0112  0.0056  0.0109  89   GLY B N   
2795 C CA  . GLY B 69  ? 0.0875 0.0981 0.0858 0.0033  0.0062  0.0078  89   GLY B CA  
2796 C C   . GLY B 69  ? 0.0824 0.0954 0.0799 0.0106  0.0001  0.0094  89   GLY B C   
2797 O O   . GLY B 69  ? 0.0806 0.1038 0.0789 0.0121  0.0070  0.0130  89   GLY B O   
2798 N N   . ILE B 70  ? 0.0709 0.0865 0.0719 0.0046  0.0068  0.0030  90   ILE B N   
2799 C CA  . ILE B 70  ? 0.0697 0.0745 0.0705 0.0058  0.0049  0.0027  90   ILE B CA  
2800 C C   . ILE B 70  ? 0.0732 0.0733 0.0683 0.0037  0.0082  0.0027  90   ILE B C   
2801 O O   . ILE B 70  ? 0.0686 0.0749 0.0698 0.0068  0.0090  0.0045  90   ILE B O   
2802 C CB  . ILE B 70  ? 0.0722 0.0771 0.0729 0.0067  0.0006  0.0008  90   ILE B CB  
2803 C CG1 . ILE B 70  ? 0.0728 0.0762 0.0753 0.0058  -0.0005 0.0020  90   ILE B CG1 
2804 C CG2 . ILE B 70  ? 0.0717 0.0798 0.0729 0.0055  0.0004  0.0022  90   ILE B CG2 
2805 C CD1 . ILE B 70  ? 0.0763 0.0778 0.0786 0.0019  0.0006  -0.0043 90   ILE B CD1 
2806 N N   . SER B 71  ? 0.0728 0.0712 0.0695 0.0061  0.0066  -0.0005 91   SER B N   
2807 C CA  . SER B 71  ? 0.0745 0.0679 0.0663 0.0006  0.0051  0.0001  91   SER B CA  
2808 C C   . SER B 71  ? 0.0750 0.0674 0.0700 0.0003  0.0066  0.0004  91   SER B C   
2809 O O   . SER B 71  ? 0.0829 0.0709 0.0776 0.0067  0.0115  0.0025  91   SER B O   
2810 C CB  . SER B 71  ? 0.0743 0.0677 0.0680 0.0038  0.0051  -0.0049 91   SER B CB  
2811 O OG  . SER B 71  ? 0.0784 0.0748 0.0683 -0.0017 0.0105  -0.0026 91   SER B OG  
2812 N N   . ASP B 72  ? 0.0759 0.0669 0.0687 0.0004  0.0085  0.0008  92   ASP B N   
2813 C CA  . ASP B 72  ? 0.0741 0.0722 0.0709 -0.0015 0.0060  0.0016  92   ASP B CA  
2814 C C   . ASP B 72  ? 0.0749 0.0707 0.0739 -0.0007 0.0063  0.0017  92   ASP B C   
2815 O O   . ASP B 72  ? 0.0669 0.0757 0.0721 0.0018  0.0068  0.0018  92   ASP B O   
2816 C CB  . ASP B 72  ? 0.0828 0.0757 0.0710 -0.0019 0.0037  -0.0007 92   ASP B CB  
2817 C CG  . ASP B 72  ? 0.0813 0.0847 0.0709 -0.0022 0.0036  -0.0013 92   ASP B CG  
2818 O OD1 . ASP B 72  ? 0.0843 0.0836 0.0739 0.0035  0.0039  0.0025  92   ASP B OD1 
2819 O OD2 . ASP B 72  ? 0.0918 0.0919 0.0733 0.0007  0.0050  -0.0076 92   ASP B OD2 
2820 N N   . VAL B 73  ? 0.0760 0.0758 0.0760 -0.0005 0.0040  0.0036  93   VAL B N   
2821 C CA  . VAL B 73  ? 0.0820 0.0762 0.0819 -0.0014 0.0031  0.0005  93   VAL B CA  
2822 C C   . VAL B 73  ? 0.0822 0.0780 0.0841 -0.0001 0.0037  0.0000  93   VAL B C   
2823 O O   . VAL B 73  ? 0.0893 0.0803 0.1012 0.0052  0.0054  0.0045  93   VAL B O   
2824 C CB  . VAL B 73  ? 0.0887 0.0853 0.0820 -0.0023 0.0025  0.0000  93   VAL B CB  
2825 C CG1 . VAL B 73  ? 0.1013 0.0818 0.0937 0.0013  0.0007  -0.0017 93   VAL B CG1 
2826 C CG2 . VAL B 73  ? 0.1060 0.0842 0.0941 -0.0044 0.0015  -0.0057 93   VAL B CG2 
2827 N N   . ALA B 74  ? 0.0856 0.0791 0.0870 -0.0027 0.0025  -0.0017 94   ALA B N   
2828 C CA  . ALA B 74  ? 0.0865 0.0802 0.0879 -0.0011 0.0025  -0.0024 94   ALA B CA  
2829 C C   . ALA B 74  ? 0.0893 0.0807 0.0819 -0.0027 0.0020  -0.0017 94   ALA B C   
2830 O O   . ALA B 74  ? 0.0846 0.0834 0.0872 0.0002  -0.0064 0.0005  94   ALA B O   
2831 C CB  . ALA B 74  ? 0.0931 0.0800 0.0871 -0.0030 0.0069  -0.0013 94   ALA B CB  
2832 N N   . TRP B 75  ? 0.0902 0.0851 0.0902 -0.0028 0.0018  0.0025  95   TRP B N   
2833 C CA  . TRP B 75  ? 0.0980 0.0912 0.0880 -0.0061 0.0014  -0.0040 95   TRP B CA  
2834 C C   . TRP B 75  ? 0.1053 0.0900 0.0878 -0.0072 0.0035  -0.0042 95   TRP B C   
2835 O O   . TRP B 75  ? 0.1073 0.0823 0.0853 -0.0109 0.0000  -0.0032 95   TRP B O   
2836 C CB  . TRP B 75  ? 0.1022 0.0898 0.0883 -0.0053 -0.0001 -0.0014 95   TRP B CB  
2837 C CG  . TRP B 75  ? 0.1001 0.0884 0.0879 -0.0048 0.0024  -0.0040 95   TRP B CG  
2838 C CD1 . TRP B 75  ? 0.1041 0.0876 0.0811 -0.0027 0.0055  -0.0048 95   TRP B CD1 
2839 C CD2 . TRP B 75  ? 0.1053 0.0880 0.0822 -0.0027 0.0010  0.0000  95   TRP B CD2 
2840 N NE1 . TRP B 75  ? 0.1061 0.0874 0.0804 -0.0048 0.0048  0.0000  95   TRP B NE1 
2841 C CE2 . TRP B 75  ? 0.1028 0.0872 0.0846 -0.0038 0.0058  -0.0019 95   TRP B CE2 
2842 C CE3 . TRP B 75  ? 0.1111 0.0899 0.0887 -0.0055 0.0029  -0.0014 95   TRP B CE3 
2843 C CZ2 . TRP B 75  ? 0.1077 0.0891 0.0804 -0.0060 -0.0013 0.0021  95   TRP B CZ2 
2844 C CZ3 . TRP B 75  ? 0.1123 0.0888 0.0876 -0.0055 0.0017  0.0006  95   TRP B CZ3 
2845 C CH2 . TRP B 75  ? 0.1132 0.0876 0.0862 -0.0055 -0.0002 0.0020  95   TRP B CH2 
2846 N N   . SER B 76  ? 0.1051 0.0927 0.0958 -0.0115 0.0042  -0.0069 96   SER B N   
2847 C CA  . SER B 76  ? 0.1098 0.1049 0.1003 -0.0086 0.0101  -0.0049 96   SER B CA  
2848 C C   . SER B 76  ? 0.1123 0.1133 0.1067 -0.0095 0.0040  0.0009  96   SER B C   
2849 O O   . SER B 76  ? 0.1089 0.1147 0.1042 -0.0025 0.0065  -0.0025 96   SER B O   
2850 C CB  . SER B 76  ? 0.1052 0.1046 0.1053 -0.0078 0.0054  -0.0047 96   SER B CB  
2851 O OG  . SER B 76  ? 0.1244 0.1101 0.1088 -0.0106 0.0108  -0.0141 96   SER B OG  
2852 N N   . SER B 77  ? 0.1275 0.1253 0.1103 -0.0128 0.0126  -0.0031 97   SER B N   
2853 C CA  . SER B 77  ? 0.1318 0.1410 0.1237 -0.0082 0.0058  0.0013  97   SER B CA  
2854 C C   . SER B 77  ? 0.1342 0.1400 0.1247 -0.0077 0.0061  0.0007  97   SER B C   
2855 O O   . SER B 77  ? 0.1422 0.1516 0.1506 0.0002  -0.0100 0.0055  97   SER B O   
2856 C CB  . SER B 77  ? 0.1479 0.1588 0.1272 -0.0103 0.0126  -0.0034 97   SER B CB  
2857 O OG  . SER B 77  ? 0.1948 0.1527 0.1881 -0.0058 0.0097  -0.0009 97   SER B OG  
2858 N N   . ASP B 78  ? 0.1283 0.1361 0.1162 -0.0113 0.0018  0.0069  98   ASP B N   
2859 C CA  . ASP B 78  ? 0.1276 0.1459 0.1361 -0.0131 -0.0023 -0.0040 98   ASP B CA  
2860 C C   . ASP B 78  ? 0.1356 0.1463 0.1328 -0.0161 -0.0053 -0.0009 98   ASP B C   
2861 O O   . ASP B 78  ? 0.1392 0.1519 0.1374 -0.0267 -0.0098 0.0003  98   ASP B O   
2862 C CB  . ASP B 78  ? 0.1527 0.1511 0.1358 -0.0095 0.0041  0.0053  98   ASP B CB  
2863 C CG  . ASP B 78  ? 0.1542 0.1549 0.1496 -0.0086 -0.0011 0.0035  98   ASP B CG  
2864 O OD1 . ASP B 78  ? 0.1538 0.1780 0.1577 -0.0130 0.0025  0.0059  98   ASP B OD1 
2865 O OD2 . ASP B 78  ? 0.1895 0.1595 0.1747 -0.0082 0.0014  0.0171  98   ASP B OD2 
2866 N N   . SER B 79  ? 0.1271 0.1412 0.1264 -0.0117 -0.0109 -0.0064 99   SER B N   
2867 C CA  . SER B 79  ? 0.1309 0.1458 0.1304 -0.0041 -0.0078 0.0009  99   SER B CA  
2868 C C   . SER B 79  ? 0.1340 0.1477 0.1341 -0.0048 -0.0057 -0.0029 99   SER B C   
2869 O O   . SER B 79  ? 0.1360 0.1568 0.1460 -0.0008 0.0109  -0.0008 99   SER B O   
2870 C CB  . SER B 79  ? 0.1262 0.1539 0.1262 -0.0041 -0.0080 -0.0045 99   SER B CB  
2871 O OG  . SER B 79  ? 0.1423 0.1457 0.1442 0.0056  -0.0189 0.0006  99   SER B OG  
2872 N N   . ASN B 80  ? 0.1338 0.1391 0.1389 -0.0017 0.0041  -0.0052 100  ASN B N   
2873 C CA  . ASN B 80  ? 0.1421 0.1404 0.1338 -0.0014 -0.0027 -0.0132 100  ASN B CA  
2874 C C   . ASN B 80  ? 0.1372 0.1303 0.1262 -0.0099 0.0019  -0.0177 100  ASN B C   
2875 O O   . ASN B 80  ? 0.1467 0.1293 0.1557 0.0014  -0.0023 -0.0168 100  ASN B O   
2876 C CB  . ASN B 80  ? 0.1558 0.1538 0.1568 -0.0095 0.0064  -0.0064 100  ASN B CB  
2877 C CG  . ASN B 80  ? 0.1562 0.1753 0.1693 -0.0055 0.0034  -0.0056 100  ASN B CG  
2878 O OD1 . ASN B 80  ? 0.1740 0.1910 0.1673 -0.0031 0.0073  -0.0103 100  ASN B OD1 
2879 N ND2 . ASN B 80  ? 0.1607 0.1964 0.1849 -0.0157 0.0074  0.0012  100  ASN B ND2 
2880 N N   . LEU B 81  ? 0.1266 0.1231 0.1179 -0.0035 -0.0010 -0.0083 101  LEU B N   
2881 C CA  . LEU B 81  ? 0.1242 0.1170 0.1178 -0.0047 0.0021  -0.0061 101  LEU B CA  
2882 C C   . LEU B 81  ? 0.1121 0.1168 0.1020 -0.0016 -0.0050 -0.0044 101  LEU B C   
2883 O O   . LEU B 81  ? 0.1149 0.1184 0.0983 -0.0001 -0.0051 -0.0084 101  LEU B O   
2884 C CB  . LEU B 81  ? 0.1324 0.1265 0.1195 -0.0039 -0.0053 -0.0048 101  LEU B CB  
2885 C CG  . LEU B 81  ? 0.1406 0.1321 0.1255 -0.0076 0.0000  0.0002  101  LEU B CG  
2886 C CD1 . LEU B 81  ? 0.1498 0.1408 0.1261 -0.0173 -0.0049 -0.0005 101  LEU B CD1 
2887 C CD2 . LEU B 81  ? 0.1516 0.1262 0.1270 -0.0089 -0.0024 0.0011  101  LEU B CD2 
2888 N N   . LEU B 82  ? 0.1106 0.1086 0.1038 -0.0010 -0.0043 -0.0075 102  LEU B N   
2889 C CA  . LEU B 82  ? 0.0996 0.1089 0.1043 0.0012  -0.0014 -0.0011 102  LEU B CA  
2890 C C   . LEU B 82  ? 0.0901 0.1030 0.0972 -0.0039 0.0036  -0.0047 102  LEU B C   
2891 O O   . LEU B 82  ? 0.0833 0.1074 0.0957 -0.0024 -0.0014 -0.0017 102  LEU B O   
2892 C CB  . LEU B 82  ? 0.1116 0.1120 0.1040 0.0006  0.0010  -0.0022 102  LEU B CB  
2893 C CG  . LEU B 82  ? 0.1164 0.1241 0.1039 0.0003  -0.0018 0.0015  102  LEU B CG  
2894 C CD1 . LEU B 82  ? 0.1327 0.1267 0.1141 0.0028  0.0103  -0.0048 102  LEU B CD1 
2895 C CD2 . LEU B 82  ? 0.1259 0.1230 0.1064 0.0014  -0.0064 0.0044  102  LEU B CD2 
2896 N N   . VAL B 83  ? 0.0849 0.0913 0.0966 -0.0001 0.0105  0.0007  103  VAL B N   
2897 C CA  . VAL B 83  ? 0.0937 0.0907 0.0929 -0.0004 0.0048  0.0004  103  VAL B CA  
2898 C C   . VAL B 83  ? 0.0860 0.0902 0.0941 0.0025  0.0037  -0.0002 103  VAL B C   
2899 O O   . VAL B 83  ? 0.0870 0.0954 0.0903 0.0098  0.0030  -0.0006 103  VAL B O   
2900 C CB  . VAL B 83  ? 0.0983 0.0911 0.0937 0.0006  0.0078  0.0018  103  VAL B CB  
2901 C CG1 . VAL B 83  ? 0.0997 0.0899 0.0984 0.0041  0.0065  0.0047  103  VAL B CG1 
2902 C CG2 . VAL B 83  ? 0.1036 0.0898 0.0957 0.0001  0.0026  -0.0002 103  VAL B CG2 
2903 N N   . SER B 84  ? 0.0844 0.0895 0.0933 0.0006  0.0001  0.0021  104  SER B N   
2904 C CA  . SER B 84  ? 0.0860 0.0859 0.0857 0.0028  -0.0005 0.0040  104  SER B CA  
2905 C C   . SER B 84  ? 0.0897 0.0816 0.0819 0.0018  -0.0003 0.0025  104  SER B C   
2906 O O   . SER B 84  ? 0.1043 0.0840 0.0892 0.0020  0.0006  0.0075  104  SER B O   
2907 C CB  . SER B 84  ? 0.0813 0.0847 0.0897 0.0015  0.0062  0.0073  104  SER B CB  
2908 O OG  . SER B 84  ? 0.0707 0.0885 0.0922 0.0052  0.0057  0.0101  104  SER B OG  
2909 N N   . ALA B 85  ? 0.0854 0.0840 0.0782 -0.0001 -0.0025 0.0038  105  ALA B N   
2910 C CA  . ALA B 85  ? 0.0860 0.0804 0.0772 0.0001  -0.0006 0.0027  105  ALA B CA  
2911 C C   . ALA B 85  ? 0.0863 0.0813 0.0746 0.0029  0.0013  0.0041  105  ALA B C   
2912 O O   . ALA B 85  ? 0.0934 0.0842 0.0787 0.0015  -0.0002 0.0050  105  ALA B O   
2913 C CB  . ALA B 85  ? 0.0997 0.0763 0.0804 -0.0015 -0.0023 -0.0034 105  ALA B CB  
2914 N N   . SER B 86  ? 0.0864 0.0882 0.0756 0.0029  0.0010  0.0053  106  SER B N   
2915 C CA  . SER B 86  ? 0.0833 0.0912 0.0869 0.0043  0.0023  0.0075  106  SER B CA  
2916 C C   . SER B 86  ? 0.0867 0.0936 0.0886 0.0039  -0.0002 0.0039  106  SER B C   
2917 O O   . SER B 86  ? 0.0895 0.0983 0.0901 0.0059  0.0061  0.0100  106  SER B O   
2918 C CB  . SER B 86  ? 0.0827 0.0953 0.0888 0.0036  0.0001  0.0015  106  SER B CB  
2919 O OG  . SER B 86  ? 0.0885 0.1057 0.0917 0.0107  0.0025  -0.0044 106  SER B OG  
2920 N N   . ASP B 87  ? 0.0887 0.0963 0.0927 0.0029  0.0001  0.0074  107  ASP B N   
2921 C CA  . ASP B 87  ? 0.0955 0.0982 0.0949 0.0029  -0.0082 0.0030  107  ASP B CA  
2922 C C   . ASP B 87  ? 0.0959 0.0960 0.0989 0.0022  -0.0064 0.0024  107  ASP B C   
2923 O O   . ASP B 87  ? 0.1063 0.0996 0.1056 0.0025  -0.0170 0.0058  107  ASP B O   
2924 C CB  . ASP B 87  ? 0.0986 0.1000 0.0924 0.0008  -0.0093 0.0025  107  ASP B CB  
2925 C CG  . ASP B 87  ? 0.1055 0.1016 0.0849 -0.0010 -0.0117 -0.0038 107  ASP B CG  
2926 O OD1 . ASP B 87  ? 0.1059 0.1111 0.0827 0.0075  -0.0187 -0.0045 107  ASP B OD1 
2927 O OD2 . ASP B 87  ? 0.1047 0.1174 0.0880 -0.0103 -0.0173 -0.0071 107  ASP B OD2 
2928 N N   . ASP B 88  ? 0.0941 0.1023 0.0964 -0.0021 -0.0052 -0.0002 108  ASP B N   
2929 C CA  . ASP B 88  ? 0.1001 0.1021 0.0995 -0.0002 -0.0030 -0.0006 108  ASP B CA  
2930 C C   . ASP B 88  ? 0.1114 0.1055 0.1026 -0.0009 0.0005  0.0024  108  ASP B C   
2931 O O   . ASP B 88  ? 0.1208 0.1093 0.1056 -0.0009 -0.0092 0.0059  108  ASP B O   
2932 C CB  . ASP B 88  ? 0.0975 0.1099 0.1000 0.0002  0.0002  -0.0059 108  ASP B CB  
2933 C CG  . ASP B 88  ? 0.0996 0.1155 0.0895 -0.0035 -0.0024 -0.0089 108  ASP B CG  
2934 O OD1 . ASP B 88  ? 0.0993 0.1214 0.0882 0.0019  -0.0050 -0.0127 108  ASP B OD1 
2935 O OD2 . ASP B 88  ? 0.1018 0.1263 0.0845 -0.0104 0.0007  -0.0144 108  ASP B OD2 
2936 N N   . LYS B 89  ? 0.1095 0.1070 0.1032 -0.0038 0.0003  0.0000  109  LYS B N   
2937 C CA  . LYS B 89  ? 0.1097 0.1161 0.1051 -0.0066 0.0030  0.0013  109  LYS B CA  
2938 C C   . LYS B 89  ? 0.1071 0.1106 0.0973 -0.0041 -0.0041 0.0059  109  LYS B C   
2939 O O   . LYS B 89  ? 0.1007 0.1260 0.1073 -0.0139 0.0071  0.0109  109  LYS B O   
2940 C CB  . LYS B 89  ? 0.1222 0.1332 0.1170 0.0002  -0.0037 0.0064  109  LYS B CB  
2941 C CG  . LYS B 89  ? 0.1254 0.1415 0.1274 -0.0028 0.0055  -0.0003 109  LYS B CG  
2942 C CD  . LYS B 89  ? 0.1404 0.1600 0.1489 0.0074  -0.0066 0.0054  109  LYS B CD  
2943 C CE  . LYS B 89  ? 0.1503 0.1856 0.1787 -0.0061 0.0010  0.0018  109  LYS B CE  
2944 N NZ  . LYS B 89  ? 0.1869 0.2176 0.1923 0.0164  -0.0138 0.0082  109  LYS B NZ  
2945 N N   . THR B 90  ? 0.1032 0.0965 0.0964 -0.0015 -0.0013 0.0055  110  THR B N   
2946 C CA  . THR B 90  ? 0.0947 0.0983 0.0936 0.0041  0.0004  0.0031  110  THR B CA  
2947 C C   . THR B 90  ? 0.0943 0.0918 0.0864 0.0004  0.0008  0.0052  110  THR B C   
2948 O O   . THR B 90  ? 0.0907 0.0901 0.0887 0.0033  -0.0034 0.0076  110  THR B O   
2949 C CB  . THR B 90  ? 0.1091 0.0994 0.0994 0.0060  0.0061  0.0008  110  THR B CB  
2950 O OG1 . THR B 90  ? 0.1154 0.1000 0.0990 0.0147  0.0141  0.0019  110  THR B OG1 
2951 C CG2 . THR B 90  ? 0.1062 0.1114 0.1132 0.0079  0.0116  0.0000  110  THR B CG2 
2952 N N   . LEU B 91  ? 0.0888 0.0906 0.0779 0.0041  -0.0015 0.0010  111  LEU B N   
2953 C CA  . LEU B 91  ? 0.0871 0.0868 0.0840 0.0026  -0.0020 -0.0003 111  LEU B CA  
2954 C C   . LEU B 91  ? 0.0914 0.0877 0.0835 0.0013  -0.0011 -0.0012 111  LEU B C   
2955 O O   . LEU B 91  ? 0.1081 0.0918 0.0823 0.0050  -0.0051 0.0002  111  LEU B O   
2956 C CB  . LEU B 91  ? 0.0877 0.0852 0.0830 0.0021  -0.0015 -0.0018 111  LEU B CB  
2957 C CG  . LEU B 91  ? 0.0868 0.0875 0.0835 -0.0005 -0.0065 -0.0006 111  LEU B CG  
2958 C CD1 . LEU B 91  ? 0.0881 0.0860 0.0816 -0.0022 -0.0064 -0.0021 111  LEU B CD1 
2959 C CD2 . LEU B 91  ? 0.0886 0.0848 0.0807 0.0007  -0.0118 -0.0039 111  LEU B CD2 
2960 N N   . LYS B 92  ? 0.0936 0.0880 0.0847 0.0024  -0.0027 0.0008  112  LYS B N   
2961 C CA  . LYS B 92  ? 0.0950 0.0929 0.0930 -0.0024 -0.0001 -0.0013 112  LYS B CA  
2962 C C   . LYS B 92  ? 0.0959 0.0988 0.0932 0.0018  0.0019  0.0013  112  LYS B C   
2963 O O   . LYS B 92  ? 0.1043 0.1006 0.1017 0.0015  0.0005  0.0069  112  LYS B O   
2964 C CB  . LYS B 92  ? 0.0985 0.0890 0.0943 -0.0026 0.0019  -0.0014 112  LYS B CB  
2965 C CG  . LYS B 92  ? 0.0964 0.0960 0.0918 -0.0042 -0.0008 -0.0013 112  LYS B CG  
2966 C CD  . LYS B 92  ? 0.0995 0.0951 0.0950 0.0000  0.0036  0.0031  112  LYS B CD  
2967 C CE  . LYS B 92  ? 0.1003 0.1008 0.1015 0.0001  -0.0015 0.0003  112  LYS B CE  
2968 N NZ  . LYS B 92  ? 0.1192 0.1027 0.0977 0.0107  -0.0021 0.0024  112  LYS B NZ  
2969 N N   . ILE B 93  ? 0.1035 0.0976 0.0969 -0.0003 0.0003  0.0017  113  ILE B N   
2970 C CA  . ILE B 93  ? 0.1030 0.0930 0.1001 -0.0009 0.0022  0.0023  113  ILE B CA  
2971 C C   . ILE B 93  ? 0.1093 0.0985 0.0965 0.0048  0.0023  0.0022  113  ILE B C   
2972 O O   . ILE B 93  ? 0.1128 0.0994 0.0980 0.0051  0.0073  0.0031  113  ILE B O   
2973 C CB  . ILE B 93  ? 0.1058 0.0968 0.1000 -0.0023 0.0026  0.0038  113  ILE B CB  
2974 C CG1 . ILE B 93  ? 0.1134 0.1050 0.0991 -0.0029 -0.0007 0.0051  113  ILE B CG1 
2975 C CG2 . ILE B 93  ? 0.1079 0.0994 0.1044 -0.0069 -0.0034 0.0019  113  ILE B CG2 
2976 C CD1 . ILE B 93  ? 0.1332 0.1051 0.1011 -0.0089 0.0000  0.0124  113  ILE B CD1 
2977 N N   . TRP B 94  ? 0.1093 0.0945 0.0955 0.0031  -0.0001 -0.0032 114  TRP B N   
2978 C CA  . TRP B 94  ? 0.1132 0.0970 0.0960 0.0019  -0.0022 -0.0034 114  TRP B CA  
2979 C C   . TRP B 94  ? 0.1152 0.1078 0.1039 -0.0059 0.0003  -0.0006 114  TRP B C   
2980 O O   . TRP B 94  ? 0.1300 0.0998 0.1031 0.0021  -0.0037 0.0059  114  TRP B O   
2981 C CB  . TRP B 94  ? 0.1045 0.0974 0.0927 -0.0009 -0.0009 -0.0065 114  TRP B CB  
2982 C CG  . TRP B 94  ? 0.1005 0.0949 0.0923 0.0013  0.0044  -0.0030 114  TRP B CG  
2983 C CD1 . TRP B 94  ? 0.0963 0.0905 0.0952 0.0039  0.0016  -0.0024 114  TRP B CD1 
2984 C CD2 . TRP B 94  ? 0.0978 0.0947 0.0881 0.0026  0.0015  0.0001  114  TRP B CD2 
2985 N NE1 . TRP B 94  ? 0.0980 0.0877 0.1025 0.0007  0.0021  0.0012  114  TRP B NE1 
2986 C CE2 . TRP B 94  ? 0.0993 0.0959 0.0910 0.0008  0.0032  0.0003  114  TRP B CE2 
2987 C CE3 . TRP B 94  ? 0.1000 0.0933 0.0857 -0.0002 -0.0013 0.0018  114  TRP B CE3 
2988 C CZ2 . TRP B 94  ? 0.0967 0.0955 0.0913 0.0013  -0.0024 -0.0008 114  TRP B CZ2 
2989 C CZ3 . TRP B 94  ? 0.1022 0.0980 0.0835 0.0027  0.0023  0.0027  114  TRP B CZ3 
2990 C CH2 . TRP B 94  ? 0.1035 0.0976 0.0862 0.0028  0.0005  0.0002  114  TRP B CH2 
2991 N N   . ASP B 95  ? 0.1379 0.1114 0.1173 0.0031  0.0023  -0.0122 115  ASP B N   
2992 C CA  . ASP B 95  ? 0.1432 0.1472 0.1380 -0.0045 -0.0033 -0.0131 115  ASP B CA  
2993 C C   . ASP B 95  ? 0.1651 0.1492 0.1430 -0.0046 0.0019  -0.0094 115  ASP B C   
2994 O O   . ASP B 95  ? 0.1757 0.1540 0.1346 -0.0050 0.0030  -0.0144 115  ASP B O   
2995 C CB  . ASP B 95  ? 0.1672 0.1518 0.1540 -0.0151 -0.0041 -0.0103 115  ASP B CB  
2996 C CG  . ASP B 95  ? 0.1653 0.2082 0.1850 -0.0275 0.0003  -0.0168 115  ASP B CG  
2997 O OD1 . ASP B 95  ? 0.1768 0.2496 0.1981 -0.0281 0.0134  0.0005  115  ASP B OD1 
2998 O OD2 . ASP B 95  ? 0.2009 0.2482 0.1824 -0.0351 -0.0139 -0.0090 115  ASP B OD2 
2999 N N   . VAL B 96  ? 0.1707 0.1518 0.1531 0.0001  -0.0002 -0.0100 116  VAL B N   
3000 C CA  . VAL B 96  ? 0.2006 0.1757 0.1566 -0.0050 0.0011  -0.0014 116  VAL B CA  
3001 C C   . VAL B 96  ? 0.2048 0.1817 0.1722 -0.0094 0.0029  -0.0138 116  VAL B C   
3002 O O   . VAL B 96  ? 0.2202 0.2001 0.1754 -0.0142 0.0105  -0.0135 116  VAL B O   
3003 C CB  . VAL B 96  ? 0.2011 0.1798 0.1798 -0.0013 -0.0022 -0.0014 116  VAL B CB  
3004 C CG1 . VAL B 96  ? 0.2119 0.1856 0.1811 0.0028  -0.0094 -0.0014 116  VAL B CG1 
3005 C CG2 . VAL B 96  ? 0.2153 0.1871 0.1810 -0.0002 -0.0014 -0.0044 116  VAL B CG2 
3006 N N   . SER B 97  ? 0.2013 0.1786 0.1624 -0.0099 0.0020  -0.0186 117  SER B N   
3007 C CA  . SER B 97  ? 0.2013 0.1949 0.1655 -0.0128 -0.0073 -0.0187 117  SER B CA  
3008 C C   . SER B 97  ? 0.1943 0.1879 0.1774 -0.0060 -0.0172 -0.0092 117  SER B C   
3009 O O   . SER B 97  ? 0.2017 0.1903 0.1768 -0.0138 -0.0218 -0.0175 117  SER B O   
3010 C CB  . SER B 97  ? 0.2179 0.2095 0.1770 -0.0155 -0.0026 -0.0135 117  SER B CB  
3011 O OG  . SER B 97  ? 0.2456 0.2195 0.1960 -0.0447 -0.0252 -0.0350 117  SER B OG  
3012 N N   . SER B 98  ? 0.1924 0.1770 0.1644 -0.0122 -0.0137 -0.0137 118  SER B N   
3013 C CA  . SER B 98  ? 0.1871 0.1714 0.1436 -0.0110 -0.0274 -0.0153 118  SER B CA  
3014 C C   . SER B 98  ? 0.1851 0.1734 0.1544 -0.0056 -0.0137 -0.0183 118  SER B C   
3015 O O   . SER B 98  ? 0.1965 0.1808 0.1496 0.0025  -0.0195 -0.0278 118  SER B O   
3016 C CB  . SER B 98  ? 0.1976 0.1726 0.1671 -0.0068 -0.0246 -0.0065 118  SER B CB  
3017 O OG  . SER B 98  ? 0.1750 0.1542 0.1718 -0.0052 -0.0238 -0.0119 118  SER B OG  
3018 N N   . GLY B 99  ? 0.1776 0.1737 0.1458 -0.0014 -0.0093 -0.0193 119  GLY B N   
3019 C CA  . GLY B 99  ? 0.1789 0.1617 0.1417 0.0005  -0.0037 -0.0201 119  GLY B CA  
3020 C C   . GLY B 99  ? 0.1693 0.1574 0.1388 -0.0040 0.0041  -0.0142 119  GLY B C   
3021 O O   . GLY B 99  ? 0.1722 0.1482 0.1340 -0.0044 0.0019  -0.0215 119  GLY B O   
3022 N N   . LYS B 100 ? 0.1677 0.1502 0.1368 -0.0031 0.0013  -0.0176 120  LYS B N   
3023 C CA  . LYS B 100 ? 0.1735 0.1541 0.1412 -0.0043 0.0034  -0.0087 120  LYS B CA  
3024 C C   . LYS B 100 ? 0.1614 0.1312 0.1354 -0.0011 0.0029  0.0016  120  LYS B C   
3025 O O   . LYS B 100 ? 0.1583 0.1008 0.1323 -0.0054 -0.0047 0.0118  120  LYS B O   
3026 C CB  . LYS B 100 ? 0.1806 0.1624 0.1593 -0.0139 0.0087  -0.0117 120  LYS B CB  
3027 C CG  . LYS B 100 ? 0.1931 0.1877 0.1761 -0.0059 0.0029  -0.0007 120  LYS B CG  
3028 C CD  . LYS B 100 ? 0.2178 0.1959 0.2206 -0.0166 0.0162  0.0016  120  LYS B CD  
3029 C CE  . LYS B 100 ? 0.2226 0.2215 0.2240 -0.0101 0.0169  0.0062  120  LYS B CE  
3030 N NZ  . LYS B 100 ? 0.2551 0.2111 0.2563 -0.0156 0.0194  0.0016  120  LYS B NZ  
3031 N N   . CYS B 101 ? 0.1612 0.1099 0.1252 -0.0064 0.0028  -0.0052 121  CYS B N   
3032 C CA  . CYS B 101 ? 0.1619 0.1149 0.1256 0.0026  0.0000  -0.0060 121  CYS B CA  
3033 C C   . CYS B 101 ? 0.1539 0.1203 0.1279 0.0074  0.0063  -0.0033 121  CYS B C   
3034 O O   . CYS B 101 ? 0.1500 0.1262 0.1198 0.0110  0.0029  -0.0004 121  CYS B O   
3035 C CB  . CYS B 101 ? 0.1634 0.1177 0.1250 0.0001  -0.0016 -0.0082 121  CYS B CB  
3036 S SG  . CYS B 101 ? 0.1988 0.1410 0.1250 0.0042  -0.0168 -0.0044 121  CYS B SG  
3037 N N   . LEU B 102 ? 0.1494 0.1156 0.1143 -0.0001 0.0036  0.0017  122  LEU B N   
3038 C CA  . LEU B 102 ? 0.1474 0.1107 0.1218 -0.0036 0.0039  0.0025  122  LEU B CA  
3039 C C   . LEU B 102 ? 0.1589 0.1183 0.1246 -0.0012 -0.0019 -0.0001 122  LEU B C   
3040 O O   . LEU B 102 ? 0.1848 0.1165 0.1179 -0.0066 0.0000  -0.0005 122  LEU B O   
3041 C CB  . LEU B 102 ? 0.1439 0.1138 0.1238 -0.0043 -0.0007 -0.0016 122  LEU B CB  
3042 C CG  . LEU B 102 ? 0.1481 0.1287 0.1263 -0.0033 -0.0037 0.0014  122  LEU B CG  
3043 C CD1 . LEU B 102 ? 0.1536 0.1375 0.1337 0.0025  -0.0039 -0.0082 122  LEU B CD1 
3044 C CD2 . LEU B 102 ? 0.1542 0.1318 0.1360 0.0025  0.0093  -0.0094 122  LEU B CD2 
3045 N N   . LYS B 103 ? 0.1599 0.1162 0.1279 -0.0022 0.0028  0.0021  123  LYS B N   
3046 C CA  . LYS B 103 ? 0.1520 0.1193 0.1319 -0.0015 0.0028  0.0001  123  LYS B CA  
3047 C C   . LYS B 103 ? 0.1423 0.1168 0.1130 0.0043  0.0014  0.0042  123  LYS B C   
3048 O O   . LYS B 103 ? 0.1509 0.1079 0.1098 0.0035  0.0106  -0.0014 123  LYS B O   
3049 C CB  . LYS B 103 ? 0.1588 0.1257 0.1359 0.0011  0.0056  -0.0031 123  LYS B CB  
3050 C CG  . LYS B 103 ? 0.1511 0.1545 0.1461 -0.0102 0.0165  -0.0044 123  LYS B CG  
3051 C CD  . LYS B 103 ? 0.1771 0.1651 0.1605 -0.0007 0.0125  0.0020  123  LYS B CD  
3052 C CE  . LYS B 103 ? 0.1948 0.1825 0.1901 -0.0209 0.0109  0.0070  123  LYS B CE  
3053 N NZ  . LYS B 103 ? 0.2383 0.1859 0.2124 -0.0308 0.0155  -0.0015 123  LYS B NZ  
3054 N N   . THR B 104 ? 0.1338 0.1117 0.1146 0.0030  0.0078  0.0000  124  THR B N   
3055 C CA  . THR B 104 ? 0.1332 0.1151 0.1142 0.0027  -0.0046 0.0022  124  THR B CA  
3056 C C   . THR B 104 ? 0.1338 0.1114 0.1161 0.0048  -0.0010 -0.0022 124  THR B C   
3057 O O   . THR B 104 ? 0.1432 0.1095 0.1264 0.0049  0.0016  0.0034  124  THR B O   
3058 C CB  . THR B 104 ? 0.1405 0.1176 0.1085 0.0015  0.0003  -0.0040 124  THR B CB  
3059 O OG1 . THR B 104 ? 0.1482 0.1157 0.1096 0.0065  -0.0019 -0.0064 124  THR B OG1 
3060 C CG2 . THR B 104 ? 0.1353 0.1267 0.1001 0.0008  -0.0023 0.0004  124  THR B CG2 
3061 N N   . LEU B 105 ? 0.1317 0.1092 0.1176 0.0036  -0.0013 -0.0012 125  LEU B N   
3062 C CA  . LEU B 105 ? 0.1345 0.1140 0.1157 0.0020  -0.0024 0.0025  125  LEU B CA  
3063 C C   . LEU B 105 ? 0.1355 0.1119 0.1170 -0.0004 -0.0007 0.0013  125  LEU B C   
3064 O O   . LEU B 105 ? 0.1295 0.1061 0.1180 0.0018  -0.0124 0.0031  125  LEU B O   
3065 C CB  . LEU B 105 ? 0.1345 0.1158 0.1280 0.0017  0.0034  -0.0016 125  LEU B CB  
3066 C CG  . LEU B 105 ? 0.1356 0.1331 0.1542 0.0091  -0.0066 -0.0026 125  LEU B CG  
3067 C CD1 . LEU B 105 ? 0.1302 0.1345 0.1468 0.0040  -0.0003 -0.0068 125  LEU B CD1 
3068 C CD2 . LEU B 105 ? 0.1249 0.1417 0.1546 0.0054  -0.0018 0.0013  125  LEU B CD2 
3069 N N   . LYS B 106 ? 0.1483 0.1143 0.1202 0.0028  -0.0060 0.0006  126  LYS B N   
3070 C CA  . LYS B 106 ? 0.1540 0.1283 0.1248 -0.0024 -0.0123 -0.0021 126  LYS B CA  
3071 C C   . LYS B 106 ? 0.1483 0.1186 0.1224 -0.0018 -0.0087 0.0022  126  LYS B C   
3072 O O   . LYS B 106 ? 0.1607 0.1173 0.1129 -0.0097 -0.0078 -0.0039 126  LYS B O   
3073 C CB  . LYS B 106 ? 0.1543 0.1400 0.1443 0.0069  -0.0126 0.0029  126  LYS B CB  
3074 C CG  . LYS B 106 ? 0.1792 0.1597 0.1500 0.0037  -0.0132 -0.0074 126  LYS B CG  
3075 C CD  . LYS B 106 ? 0.1977 0.1697 0.1850 0.0153  -0.0108 0.0015  126  LYS B CD  
3076 C CE  . LYS B 106 ? 0.2256 0.2025 0.1894 0.0011  -0.0144 -0.0081 126  LYS B CE  
3077 N NZ  . LYS B 106 ? 0.2547 0.2333 0.2467 0.0154  0.0060  -0.0191 126  LYS B NZ  
3078 N N   . GLY B 107 ? 0.1520 0.1113 0.1100 -0.0016 -0.0129 0.0070  127  GLY B N   
3079 C CA  . GLY B 107 ? 0.1461 0.1165 0.1109 -0.0018 -0.0131 0.0048  127  GLY B CA  
3080 C C   . GLY B 107 ? 0.1327 0.1179 0.1100 -0.0011 -0.0099 0.0101  127  GLY B C   
3081 O O   . GLY B 107 ? 0.1451 0.1359 0.1062 0.0009  -0.0093 -0.0066 127  GLY B O   
3082 N N   . HIS B 108 ? 0.1321 0.1201 0.1065 -0.0015 -0.0110 0.0093  128  HIS B N   
3083 C CA  . HIS B 108 ? 0.1147 0.1212 0.1061 0.0014  -0.0101 0.0096  128  HIS B CA  
3084 C C   . HIS B 108 ? 0.1178 0.1255 0.1090 0.0058  -0.0040 0.0075  128  HIS B C   
3085 O O   . HIS B 108 ? 0.1186 0.1258 0.1181 0.0043  -0.0091 0.0020  128  HIS B O   
3086 C CB  . HIS B 108 ? 0.1109 0.1079 0.1053 -0.0006 -0.0032 0.0124  128  HIS B CB  
3087 C CG  . HIS B 108 ? 0.1096 0.0988 0.0978 -0.0065 -0.0029 0.0094  128  HIS B CG  
3088 N ND1 . HIS B 108 ? 0.1042 0.0938 0.1048 -0.0056 -0.0001 0.0071  128  HIS B ND1 
3089 C CD2 . HIS B 108 ? 0.1053 0.0897 0.0931 -0.0040 0.0011  0.0095  128  HIS B CD2 
3090 C CE1 . HIS B 108 ? 0.1034 0.0932 0.0963 -0.0074 -0.0031 0.0075  128  HIS B CE1 
3091 N NE2 . HIS B 108 ? 0.1043 0.0908 0.0924 -0.0068 -0.0001 0.0083  128  HIS B NE2 
3092 N N   . SER B 109 ? 0.1184 0.1268 0.1174 0.0022  -0.0053 0.0104  129  SER B N   
3093 C CA  . SER B 109 ? 0.1174 0.1285 0.1264 -0.0011 -0.0092 0.0076  129  SER B CA  
3094 C C   . SER B 109 ? 0.1267 0.1328 0.1230 0.0008  -0.0089 0.0107  129  SER B C   
3095 O O   . SER B 109 ? 0.1304 0.1390 0.1389 -0.0072 -0.0051 0.0249  129  SER B O   
3096 C CB  . SER B 109 ? 0.1302 0.1410 0.1277 0.0012  -0.0137 0.0068  129  SER B CB  
3097 O OG  . SER B 109 ? 0.1319 0.1448 0.1280 -0.0038 -0.0182 -0.0015 129  SER B OG  
3098 N N   . ASN B 110 ? 0.1280 0.1336 0.1245 -0.0018 -0.0112 0.0085  130  ASN B N   
3099 C CA  . ASN B 110 ? 0.1163 0.1389 0.1180 -0.0047 -0.0119 0.0075  130  ASN B CA  
3100 C C   . ASN B 110 ? 0.1224 0.1313 0.1115 -0.0016 -0.0110 0.0068  130  ASN B C   
3101 O O   . ASN B 110 ? 0.1198 0.1383 0.1157 -0.0016 -0.0123 0.0212  130  ASN B O   
3102 C CB  . ASN B 110 ? 0.1341 0.1402 0.1262 -0.0042 -0.0105 0.0039  130  ASN B CB  
3103 C CG  . ASN B 110 ? 0.1379 0.1618 0.1357 -0.0087 -0.0035 0.0058  130  ASN B CG  
3104 O OD1 . ASN B 110 ? 0.1476 0.1755 0.1337 -0.0105 -0.0098 0.0051  130  ASN B OD1 
3105 N ND2 . ASN B 110 ? 0.1405 0.1706 0.1519 -0.0171 -0.0039 -0.0006 130  ASN B ND2 
3106 N N   . TYR B 111 ? 0.1106 0.1287 0.1033 -0.0012 -0.0084 0.0021  131  TYR B N   
3107 C CA  . TYR B 111 ? 0.1083 0.1186 0.1036 0.0015  -0.0070 -0.0048 131  TYR B CA  
3108 C C   . TYR B 111 ? 0.1064 0.1055 0.0980 -0.0035 -0.0079 -0.0009 131  TYR B C   
3109 O O   . TYR B 111 ? 0.1099 0.1124 0.0982 -0.0011 -0.0044 -0.0005 131  TYR B O   
3110 C CB  . TYR B 111 ? 0.1123 0.1241 0.1069 -0.0024 -0.0070 0.0009  131  TYR B CB  
3111 C CG  . TYR B 111 ? 0.1152 0.1322 0.1143 -0.0001 -0.0011 0.0046  131  TYR B CG  
3112 C CD1 . TYR B 111 ? 0.1200 0.1316 0.1247 0.0025  0.0005  0.0036  131  TYR B CD1 
3113 C CD2 . TYR B 111 ? 0.1252 0.1305 0.1326 0.0005  0.0063  -0.0011 131  TYR B CD2 
3114 C CE1 . TYR B 111 ? 0.1236 0.1485 0.1432 0.0000  0.0075  0.0054  131  TYR B CE1 
3115 C CE2 . TYR B 111 ? 0.1260 0.1475 0.1568 -0.0055 0.0075  0.0001  131  TYR B CE2 
3116 C CZ  . TYR B 111 ? 0.1321 0.1479 0.1729 -0.0010 0.0136  0.0030  131  TYR B CZ  
3117 O OH  . TYR B 111 ? 0.1381 0.2097 0.2280 -0.0046 0.0302  0.0083  131  TYR B OH  
3118 N N   . VAL B 112 ? 0.1005 0.1039 0.0914 0.0014  -0.0046 -0.0007 132  VAL B N   
3119 C CA  . VAL B 112 ? 0.1016 0.0933 0.0907 0.0017  -0.0026 0.0018  132  VAL B CA  
3120 C C   . VAL B 112 ? 0.1000 0.0863 0.0878 0.0025  -0.0020 -0.0025 132  VAL B C   
3121 O O   . VAL B 112 ? 0.1163 0.0749 0.0863 0.0063  -0.0058 0.0001  132  VAL B O   
3122 C CB  . VAL B 112 ? 0.1004 0.0987 0.0994 -0.0013 0.0007  -0.0017 132  VAL B CB  
3123 C CG1 . VAL B 112 ? 0.0988 0.1024 0.1011 0.0015  -0.0001 -0.0007 132  VAL B CG1 
3124 C CG2 . VAL B 112 ? 0.1048 0.0937 0.1005 -0.0034 0.0001  -0.0011 132  VAL B CG2 
3125 N N   . PHE B 113 ? 0.0946 0.0777 0.0772 -0.0009 -0.0040 0.0042  133  PHE B N   
3126 C CA  . PHE B 113 ? 0.0848 0.0779 0.0733 -0.0007 0.0002  0.0037  133  PHE B CA  
3127 C C   . PHE B 113 ? 0.0844 0.0793 0.0701 -0.0005 0.0008  0.0023  133  PHE B C   
3128 O O   . PHE B 113 ? 0.0814 0.0922 0.0677 0.0010  0.0049  0.0070  133  PHE B O   
3129 C CB  . PHE B 113 ? 0.0911 0.0763 0.0745 0.0007  -0.0009 0.0029  133  PHE B CB  
3130 C CG  . PHE B 113 ? 0.0884 0.0779 0.0717 0.0010  -0.0039 0.0033  133  PHE B CG  
3131 C CD1 . PHE B 113 ? 0.0870 0.0799 0.0721 0.0009  -0.0041 0.0010  133  PHE B CD1 
3132 C CD2 . PHE B 113 ? 0.0865 0.0808 0.0768 0.0011  0.0000  0.0030  133  PHE B CD2 
3133 C CE1 . PHE B 113 ? 0.0877 0.0814 0.0741 -0.0005 -0.0028 0.0016  133  PHE B CE1 
3134 C CE2 . PHE B 113 ? 0.0869 0.0794 0.0773 0.0043  -0.0023 0.0024  133  PHE B CE2 
3135 C CZ  . PHE B 113 ? 0.0881 0.0825 0.0802 0.0009  -0.0006 0.0008  133  PHE B CZ  
3136 N N   . CYS B 114 ? 0.0834 0.0790 0.0736 -0.0001 0.0029  0.0016  134  CYS B N   
3137 C CA  . CYS B 114 ? 0.0839 0.0742 0.0704 -0.0004 0.0001  0.0005  134  CYS B CA  
3138 C C   . CYS B 114 ? 0.0787 0.0783 0.0773 -0.0002 0.0047  -0.0012 134  CYS B C   
3139 O O   . CYS B 114 ? 0.0837 0.0868 0.0690 0.0012  0.0066  0.0009  134  CYS B O   
3140 C CB  . CYS B 114 ? 0.0970 0.0721 0.0738 -0.0011 -0.0037 -0.0013 134  CYS B CB  
3141 S SG  . CYS B 114 ? 0.1371 0.0721 0.0728 -0.0023 -0.0091 -0.0089 134  CYS B SG  
3142 N N   . CYS B 115 ? 0.0835 0.0784 0.0801 0.0007  -0.0035 0.0019  135  CYS B N   
3143 C CA  . CYS B 115 ? 0.0861 0.0841 0.0837 -0.0027 0.0000  0.0016  135  CYS B CA  
3144 C C   . CYS B 115 ? 0.0877 0.0847 0.0832 -0.0003 -0.0017 0.0033  135  CYS B C   
3145 O O   . CYS B 115 ? 0.1040 0.0883 0.0836 0.0072  -0.0037 0.0034  135  CYS B O   
3146 C CB  . CYS B 115 ? 0.0931 0.0796 0.0957 -0.0028 -0.0002 0.0000  135  CYS B CB  
3147 S SG  . CYS B 115 ? 0.1150 0.0965 0.0964 -0.0102 -0.0013 -0.0064 135  CYS B SG  
3148 N N   . ASN B 116 ? 0.0887 0.0888 0.0873 -0.0003 -0.0002 0.0060  136  ASN B N   
3149 C CA  . ASN B 116 ? 0.0895 0.0900 0.0892 -0.0044 -0.0041 0.0044  136  ASN B CA  
3150 C C   . ASN B 116 ? 0.0904 0.0953 0.0895 -0.0080 -0.0023 0.0047  136  ASN B C   
3151 O O   . ASN B 116 ? 0.1094 0.1016 0.0884 -0.0143 -0.0046 0.0088  136  ASN B O   
3152 C CB  . ASN B 116 ? 0.0951 0.0962 0.0915 -0.0026 -0.0044 -0.0024 136  ASN B CB  
3153 C CG  . ASN B 116 ? 0.1027 0.0954 0.0920 -0.0032 -0.0013 -0.0018 136  ASN B CG  
3154 O OD1 . ASN B 116 ? 0.1093 0.1133 0.1043 -0.0125 -0.0122 -0.0049 136  ASN B OD1 
3155 N ND2 . ASN B 116 ? 0.1046 0.0947 0.0940 -0.0058 -0.0047 0.0024  136  ASN B ND2 
3156 N N   . PHE B 117 ? 0.0980 0.1009 0.0873 -0.0138 -0.0031 -0.0001 137  PHE B N   
3157 C CA  . PHE B 117 ? 0.0931 0.0980 0.0869 -0.0103 -0.0044 -0.0003 137  PHE B CA  
3158 C C   . PHE B 117 ? 0.1019 0.1012 0.0907 -0.0067 -0.0032 -0.0041 137  PHE B C   
3159 O O   . PHE B 117 ? 0.1057 0.1037 0.0887 -0.0041 -0.0043 -0.0036 137  PHE B O   
3160 C CB  . PHE B 117 ? 0.0875 0.0939 0.0827 -0.0086 -0.0008 0.0005  137  PHE B CB  
3161 C CG  . PHE B 117 ? 0.0826 0.0870 0.0866 -0.0093 -0.0038 0.0027  137  PHE B CG  
3162 C CD1 . PHE B 117 ? 0.0833 0.0912 0.0859 -0.0061 -0.0013 -0.0014 137  PHE B CD1 
3163 C CD2 . PHE B 117 ? 0.0811 0.0873 0.0807 -0.0067 -0.0023 0.0029  137  PHE B CD2 
3164 C CE1 . PHE B 117 ? 0.0800 0.0878 0.0862 -0.0047 -0.0023 0.0025  137  PHE B CE1 
3165 C CE2 . PHE B 117 ? 0.0825 0.0862 0.0873 -0.0063 -0.0034 0.0036  137  PHE B CE2 
3166 C CZ  . PHE B 117 ? 0.0775 0.0842 0.0873 -0.0027 -0.0003 -0.0019 137  PHE B CZ  
3167 N N   . ASN B 118 ? 0.1079 0.1046 0.0970 -0.0081 -0.0006 -0.0005 138  ASN B N   
3168 C CA  . ASN B 118 ? 0.1154 0.1023 0.1015 -0.0053 0.0042  -0.0001 138  ASN B CA  
3169 C C   . ASN B 118 ? 0.1213 0.1114 0.1103 -0.0109 0.0006  -0.0033 138  ASN B C   
3170 O O   . ASN B 118 ? 0.1234 0.1088 0.1061 -0.0113 0.0032  0.0000  138  ASN B O   
3171 C CB  . ASN B 118 ? 0.1213 0.1137 0.1014 -0.0095 0.0114  0.0005  138  ASN B CB  
3172 C CG  . ASN B 118 ? 0.1214 0.1137 0.1049 -0.0086 0.0116  -0.0002 138  ASN B CG  
3173 O OD1 . ASN B 118 ? 0.1288 0.1142 0.1034 -0.0122 0.0239  0.0028  138  ASN B OD1 
3174 N ND2 . ASN B 118 ? 0.1334 0.1163 0.1045 -0.0123 0.0146  -0.0014 138  ASN B ND2 
3175 N N   . PRO B 119 ? 0.1179 0.1262 0.1237 -0.0086 -0.0004 -0.0030 139  PRO B N   
3176 C CA  . PRO B 119 ? 0.1257 0.1382 0.1243 -0.0086 -0.0073 -0.0054 139  PRO B CA  
3177 C C   . PRO B 119 ? 0.1353 0.1397 0.1309 -0.0111 -0.0052 -0.0013 139  PRO B C   
3178 O O   . PRO B 119 ? 0.1650 0.1664 0.1337 -0.0210 -0.0091 -0.0095 139  PRO B O   
3179 C CB  . PRO B 119 ? 0.1282 0.1456 0.1396 -0.0062 -0.0022 -0.0078 139  PRO B CB  
3180 C CG  . PRO B 119 ? 0.1288 0.1386 0.1469 -0.0035 0.0027  -0.0105 139  PRO B CG  
3181 C CD  . PRO B 119 ? 0.1305 0.1288 0.1303 -0.0062 0.0009  -0.0072 139  PRO B CD  
3182 N N   . GLN B 120 ? 0.1451 0.1391 0.1297 -0.0095 0.0042  -0.0010 140  GLN B N   
3183 C CA  . GLN B 120 ? 0.1382 0.1416 0.1352 -0.0149 0.0041  -0.0032 140  GLN B CA  
3184 C C   . GLN B 120 ? 0.1394 0.1417 0.1339 -0.0141 0.0025  -0.0044 140  GLN B C   
3185 O O   . GLN B 120 ? 0.1557 0.1447 0.1502 -0.0229 0.0154  -0.0119 140  GLN B O   
3186 C CB  . GLN B 120 ? 0.1472 0.1564 0.1365 -0.0102 0.0100  0.0014  140  GLN B CB  
3187 C CG  . GLN B 120 ? 0.1767 0.1633 0.1704 -0.0204 0.0083  0.0075  140  GLN B CG  
3188 C CD  . GLN B 120 ? 0.1947 0.1947 0.1707 -0.0181 0.0146  0.0123  140  GLN B CD  
3189 O OE1 . GLN B 120 ? 0.2304 0.2104 0.2028 -0.0194 0.0069  -0.0090 140  GLN B OE1 
3190 N NE2 . GLN B 120 ? 0.2047 0.1959 0.2045 -0.0066 0.0081  0.0119  140  GLN B NE2 
3191 N N   . SER B 121 ? 0.1382 0.1342 0.1234 -0.0124 0.0019  -0.0061 141  SER B N   
3192 C CA  . SER B 121 ? 0.1362 0.1325 0.1231 -0.0075 -0.0009 -0.0009 141  SER B CA  
3193 C C   . SER B 121 ? 0.1402 0.1315 0.1233 -0.0093 0.0059  0.0016  141  SER B C   
3194 O O   . SER B 121 ? 0.1613 0.1376 0.1344 -0.0023 0.0117  -0.0036 141  SER B O   
3195 C CB  . SER B 121 ? 0.1403 0.1214 0.1234 -0.0030 -0.0040 0.0050  141  SER B CB  
3196 O OG  . SER B 121 ? 0.1490 0.1226 0.1203 -0.0105 -0.0075 0.0057  141  SER B OG  
3197 N N   . ASN B 122 ? 0.1325 0.1262 0.1219 -0.0094 -0.0002 0.0049  142  ASN B N   
3198 C CA  . ASN B 122 ? 0.1220 0.1251 0.1158 -0.0093 0.0039  0.0014  142  ASN B CA  
3199 C C   . ASN B 122 ? 0.1231 0.1132 0.1132 -0.0097 0.0049  0.0006  142  ASN B C   
3200 O O   . ASN B 122 ? 0.1251 0.1238 0.1142 -0.0076 0.0014  0.0057  142  ASN B O   
3201 C CB  . ASN B 122 ? 0.1312 0.1301 0.1208 -0.0113 0.0053  0.0093  142  ASN B CB  
3202 C CG  . ASN B 122 ? 0.1434 0.1379 0.1222 -0.0118 0.0086  0.0057  142  ASN B CG  
3203 O OD1 . ASN B 122 ? 0.1401 0.1410 0.1253 -0.0120 0.0183  0.0125  142  ASN B OD1 
3204 N ND2 . ASN B 122 ? 0.1778 0.1543 0.1238 -0.0196 0.0077  0.0115  142  ASN B ND2 
3205 N N   . LEU B 123 ? 0.1117 0.1109 0.0957 -0.0050 0.0020  0.0000  143  LEU B N   
3206 C CA  . LEU B 123 ? 0.1121 0.1024 0.0982 -0.0090 0.0076  0.0001  143  LEU B CA  
3207 C C   . LEU B 123 ? 0.1030 0.0964 0.0936 -0.0079 0.0054  -0.0052 143  LEU B C   
3208 O O   . LEU B 123 ? 0.1147 0.0951 0.0887 -0.0073 0.0034  -0.0075 143  LEU B O   
3209 C CB  . LEU B 123 ? 0.1178 0.1086 0.0996 -0.0098 0.0063  -0.0031 143  LEU B CB  
3210 C CG  . LEU B 123 ? 0.1226 0.1184 0.1049 -0.0089 0.0117  0.0008  143  LEU B CG  
3211 C CD1 . LEU B 123 ? 0.1280 0.1203 0.1184 -0.0113 0.0106  -0.0079 143  LEU B CD1 
3212 C CD2 . LEU B 123 ? 0.1212 0.1262 0.1117 -0.0024 0.0074  -0.0036 143  LEU B CD2 
3213 N N   . ILE B 124 ? 0.1038 0.0832 0.0855 -0.0115 -0.0023 -0.0041 144  ILE B N   
3214 C CA  . ILE B 124 ? 0.1011 0.0896 0.0899 -0.0085 0.0015  0.0002  144  ILE B CA  
3215 C C   . ILE B 124 ? 0.0988 0.0844 0.0922 -0.0070 0.0033  -0.0004 144  ILE B C   
3216 O O   . ILE B 124 ? 0.1094 0.0859 0.0922 -0.0112 0.0003  0.0013  144  ILE B O   
3217 C CB  . ILE B 124 ? 0.1013 0.0916 0.0881 -0.0059 0.0015  0.0033  144  ILE B CB  
3218 C CG1 . ILE B 124 ? 0.1066 0.0954 0.0907 -0.0112 0.0005  0.0033  144  ILE B CG1 
3219 C CG2 . ILE B 124 ? 0.1009 0.0881 0.0940 -0.0083 0.0006  -0.0019 144  ILE B CG2 
3220 C CD1 . ILE B 124 ? 0.1122 0.0984 0.0922 -0.0016 -0.0040 -0.0003 144  ILE B CD1 
3221 N N   . VAL B 125 ? 0.0933 0.0832 0.0850 -0.0089 0.0037  -0.0031 145  VAL B N   
3222 C CA  . VAL B 125 ? 0.0942 0.0849 0.0810 -0.0046 -0.0005 -0.0028 145  VAL B CA  
3223 C C   . VAL B 125 ? 0.0887 0.0800 0.0817 -0.0020 -0.0021 -0.0037 145  VAL B C   
3224 O O   . VAL B 125 ? 0.0896 0.0789 0.0811 0.0002  -0.0060 -0.0093 145  VAL B O   
3225 C CB  . VAL B 125 ? 0.0919 0.0882 0.0814 -0.0004 0.0021  0.0006  145  VAL B CB  
3226 C CG1 . VAL B 125 ? 0.0980 0.0898 0.0813 0.0000  0.0038  0.0017  145  VAL B CG1 
3227 C CG2 . VAL B 125 ? 0.0980 0.0904 0.0805 -0.0020 0.0019  0.0004  145  VAL B CG2 
3228 N N   . SER B 126 ? 0.0861 0.0787 0.0820 -0.0032 0.0014  -0.0032 146  SER B N   
3229 C CA  . SER B 126 ? 0.0889 0.0788 0.0803 -0.0016 0.0016  0.0005  146  SER B CA  
3230 C C   . SER B 126 ? 0.0889 0.0769 0.0792 -0.0043 0.0033  0.0028  146  SER B C   
3231 O O   . SER B 126 ? 0.0898 0.0808 0.0793 0.0016  -0.0007 -0.0028 146  SER B O   
3232 C CB  . SER B 126 ? 0.0921 0.0809 0.0796 0.0024  0.0028  0.0030  146  SER B CB  
3233 O OG  . SER B 126 ? 0.0982 0.0742 0.0839 0.0100  0.0043  0.0029  146  SER B OG  
3234 N N   . GLY B 127 ? 0.0904 0.0793 0.0781 -0.0052 0.0018  0.0037  147  GLY B N   
3235 C CA  . GLY B 127 ? 0.0891 0.0831 0.0810 -0.0077 -0.0009 0.0061  147  GLY B CA  
3236 C C   . GLY B 127 ? 0.0930 0.0860 0.0808 -0.0112 0.0022  0.0031  147  GLY B C   
3237 O O   . GLY B 127 ? 0.0990 0.0819 0.0776 -0.0150 0.0000  0.0087  147  GLY B O   
3238 N N   . SER B 128 ? 0.0938 0.0887 0.0908 -0.0069 -0.0024 0.0025  148  SER B N   
3239 C CA  . SER B 128 ? 0.0984 0.1006 0.0986 -0.0047 0.0031  0.0030  148  SER B CA  
3240 C C   . SER B 128 ? 0.1090 0.0971 0.0976 -0.0048 0.0003  -0.0023 148  SER B C   
3241 O O   . SER B 128 ? 0.1304 0.0942 0.0891 -0.0139 -0.0036 0.0009  148  SER B O   
3242 C CB  . SER B 128 ? 0.1067 0.0976 0.0976 -0.0071 -0.0005 0.0002  148  SER B CB  
3243 O OG  . SER B 128 ? 0.1053 0.1077 0.1107 -0.0058 -0.0078 -0.0066 148  SER B OG  
3244 N N   . PHE B 129 ? 0.1085 0.1109 0.1005 -0.0054 0.0006  -0.0018 149  PHE B N   
3245 C CA  . PHE B 129 ? 0.1100 0.1094 0.1042 -0.0077 0.0013  0.0049  149  PHE B CA  
3246 C C   . PHE B 129 ? 0.1109 0.1116 0.1054 -0.0105 -0.0048 -0.0009 149  PHE B C   
3247 O O   . PHE B 129 ? 0.1220 0.1212 0.0958 -0.0205 -0.0132 0.0013  149  PHE B O   
3248 C CB  . PHE B 129 ? 0.1137 0.1211 0.1110 -0.0097 0.0060  -0.0025 149  PHE B CB  
3249 C CG  . PHE B 129 ? 0.1245 0.1220 0.1269 -0.0021 -0.0015 0.0028  149  PHE B CG  
3250 C CD1 . PHE B 129 ? 0.1231 0.1338 0.1255 -0.0086 -0.0034 0.0029  149  PHE B CD1 
3251 C CD2 . PHE B 129 ? 0.1306 0.1395 0.1268 -0.0096 0.0003  0.0069  149  PHE B CD2 
3252 C CE1 . PHE B 129 ? 0.1319 0.1371 0.1347 -0.0064 -0.0009 0.0053  149  PHE B CE1 
3253 C CE2 . PHE B 129 ? 0.1399 0.1399 0.1462 -0.0118 -0.0057 0.0135  149  PHE B CE2 
3254 C CZ  . PHE B 129 ? 0.1333 0.1463 0.1362 -0.0115 0.0003  0.0138  149  PHE B CZ  
3255 N N   . ASP B 130 ? 0.1077 0.1127 0.0991 -0.0125 -0.0087 0.0006  150  ASP B N   
3256 C CA  . ASP B 130 ? 0.1055 0.1174 0.1022 -0.0055 -0.0094 0.0023  150  ASP B CA  
3257 C C   . ASP B 130 ? 0.1171 0.1206 0.1034 -0.0045 -0.0080 -0.0005 150  ASP B C   
3258 O O   . ASP B 130 ? 0.1347 0.1324 0.1074 -0.0040 -0.0180 0.0032  150  ASP B O   
3259 C CB  . ASP B 130 ? 0.1106 0.1167 0.1052 -0.0023 -0.0088 0.0001  150  ASP B CB  
3260 C CG  . ASP B 130 ? 0.1139 0.1137 0.1104 -0.0055 -0.0106 0.0022  150  ASP B CG  
3261 O OD1 . ASP B 130 ? 0.1190 0.1229 0.1142 -0.0009 -0.0042 0.0048  150  ASP B OD1 
3262 O OD2 . ASP B 130 ? 0.1252 0.1149 0.1242 -0.0033 -0.0126 -0.0046 150  ASP B OD2 
3263 N N   . GLU B 131 ? 0.1109 0.1260 0.1054 -0.0038 -0.0059 0.0001  151  GLU B N   
3264 C CA  . GLU B 131 ? 0.1137 0.1207 0.1053 -0.0035 -0.0079 0.0009  151  GLU B CA  
3265 C C   . GLU B 131 ? 0.1174 0.1135 0.1014 -0.0025 -0.0040 -0.0037 151  GLU B C   
3266 O O   . GLU B 131 ? 0.1114 0.1258 0.0947 -0.0089 -0.0028 -0.0058 151  GLU B O   
3267 C CB  . GLU B 131 ? 0.1238 0.1272 0.1109 -0.0052 -0.0137 -0.0031 151  GLU B CB  
3268 C CG  . GLU B 131 ? 0.1325 0.1461 0.1186 -0.0067 -0.0032 -0.0022 151  GLU B CG  
3269 C CD  . GLU B 131 ? 0.1438 0.1586 0.1321 -0.0092 -0.0119 -0.0075 151  GLU B CD  
3270 O OE1 . GLU B 131 ? 0.1725 0.1687 0.1315 -0.0068 -0.0115 -0.0217 151  GLU B OE1 
3271 O OE2 . GLU B 131 ? 0.1550 0.1787 0.1438 -0.0170 -0.0073 -0.0021 151  GLU B OE2 
3272 N N   . SER B 132 ? 0.1113 0.1127 0.0928 -0.0048 -0.0006 -0.0006 152  SER B N   
3273 C CA  . SER B 132 ? 0.1117 0.1155 0.1055 -0.0053 0.0050  -0.0012 152  SER B CA  
3274 C C   . SER B 132 ? 0.1130 0.1078 0.0985 -0.0024 0.0056  0.0045  152  SER B C   
3275 O O   . SER B 132 ? 0.1161 0.1095 0.0970 -0.0069 0.0044  0.0015  152  SER B O   
3276 C CB  . SER B 132 ? 0.1079 0.1211 0.1083 -0.0017 0.0058  0.0050  152  SER B CB  
3277 O OG  . SER B 132 ? 0.1346 0.1225 0.1335 -0.0014 0.0115  -0.0119 152  SER B OG  
3278 N N   . VAL B 133 ? 0.1097 0.0974 0.0959 -0.0069 -0.0001 0.0070  153  VAL B N   
3279 C CA  . VAL B 133 ? 0.1107 0.0986 0.0915 -0.0031 -0.0019 0.0066  153  VAL B CA  
3280 C C   . VAL B 133 ? 0.1193 0.0959 0.0978 -0.0070 -0.0041 0.0001  153  VAL B C   
3281 O O   . VAL B 133 ? 0.1266 0.0997 0.0980 -0.0061 -0.0122 -0.0004 153  VAL B O   
3282 C CB  . VAL B 133 ? 0.1077 0.0954 0.0890 -0.0043 -0.0078 0.0025  153  VAL B CB  
3283 C CG1 . VAL B 133 ? 0.1025 0.0990 0.1024 -0.0051 -0.0019 0.0020  153  VAL B CG1 
3284 C CG2 . VAL B 133 ? 0.1141 0.0949 0.0932 -0.0042 -0.0057 0.0018  153  VAL B CG2 
3285 N N   . ARG B 134 ? 0.1158 0.0948 0.1020 -0.0092 -0.0065 0.0003  154  ARG B N   
3286 C CA  . ARG B 134 ? 0.1131 0.0983 0.1009 -0.0089 0.0000  0.0071  154  ARG B CA  
3287 C C   . ARG B 134 ? 0.1126 0.0954 0.0979 -0.0057 0.0017  -0.0002 154  ARG B C   
3288 O O   . ARG B 134 ? 0.1189 0.0948 0.0886 -0.0041 0.0014  -0.0070 154  ARG B O   
3289 C CB  . ARG B 134 ? 0.1225 0.1002 0.1063 -0.0050 0.0035  0.0069  154  ARG B CB  
3290 C CG  . ARG B 134 ? 0.1206 0.1175 0.1172 -0.0103 0.0024  0.0121  154  ARG B CG  
3291 C CD  . ARG B 134 ? 0.1386 0.1294 0.1403 0.0026  0.0033  0.0028  154  ARG B CD  
3292 N NE  . ARG B 134 ? 0.1459 0.1612 0.1655 0.0041  -0.0082 0.0068  154  ARG B NE  
3293 C CZ  . ARG B 134 ? 0.1463 0.1658 0.1640 0.0031  -0.0063 0.0094  154  ARG B CZ  
3294 N NH1 . ARG B 134 ? 0.1639 0.1759 0.1873 -0.0115 -0.0205 0.0031  154  ARG B NH1 
3295 N NH2 . ARG B 134 ? 0.1487 0.1869 0.1718 0.0029  -0.0110 0.0052  154  ARG B NH2 
3296 N N   . ILE B 135 ? 0.1174 0.0970 0.0988 -0.0053 0.0040  0.0027  155  ILE B N   
3297 C CA  . ILE B 135 ? 0.1153 0.1013 0.1051 -0.0019 0.0027  0.0023  155  ILE B CA  
3298 C C   . ILE B 135 ? 0.1259 0.1020 0.1051 -0.0022 0.0012  0.0020  155  ILE B C   
3299 O O   . ILE B 135 ? 0.1380 0.1117 0.1006 0.0004  0.0009  0.0056  155  ILE B O   
3300 C CB  . ILE B 135 ? 0.1174 0.1005 0.1057 -0.0008 0.0034  0.0019  155  ILE B CB  
3301 C CG1 . ILE B 135 ? 0.1293 0.1023 0.1144 0.0021  0.0037  -0.0020 155  ILE B CG1 
3302 C CG2 . ILE B 135 ? 0.1189 0.1080 0.1123 -0.0020 0.0011  -0.0005 155  ILE B CG2 
3303 C CD1 . ILE B 135 ? 0.1390 0.1125 0.1170 0.0011  0.0071  -0.0060 155  ILE B CD1 
3304 N N   . TRP B 136 ? 0.1221 0.1093 0.0970 -0.0027 0.0063  0.0059  156  TRP B N   
3305 C CA  . TRP B 136 ? 0.1226 0.1089 0.1037 -0.0049 0.0044  0.0047  156  TRP B CA  
3306 C C   . TRP B 136 ? 0.1268 0.1157 0.1016 -0.0121 0.0116  0.0025  156  TRP B C   
3307 O O   . TRP B 136 ? 0.1294 0.0958 0.1019 -0.0200 0.0049  -0.0006 156  TRP B O   
3308 C CB  . TRP B 136 ? 0.1109 0.1022 0.1058 -0.0037 0.0041  0.0014  156  TRP B CB  
3309 C CG  . TRP B 136 ? 0.1071 0.0995 0.0975 -0.0005 0.0022  -0.0002 156  TRP B CG  
3310 C CD1 . TRP B 136 ? 0.1092 0.1004 0.1031 0.0014  0.0031  0.0016  156  TRP B CD1 
3311 C CD2 . TRP B 136 ? 0.1064 0.0982 0.0943 -0.0021 0.0026  -0.0015 156  TRP B CD2 
3312 N NE1 . TRP B 136 ? 0.1103 0.0938 0.0982 -0.0002 0.0014  -0.0022 156  TRP B NE1 
3313 C CE2 . TRP B 136 ? 0.1022 0.0985 0.0967 -0.0003 0.0028  0.0025  156  TRP B CE2 
3314 C CE3 . TRP B 136 ? 0.1027 0.0987 0.0806 -0.0044 -0.0006 0.0062  156  TRP B CE3 
3315 C CZ2 . TRP B 136 ? 0.1014 0.0972 0.0947 -0.0019 0.0035  0.0020  156  TRP B CZ2 
3316 C CZ3 . TRP B 136 ? 0.1038 0.0975 0.0828 -0.0001 0.0021  0.0068  156  TRP B CZ3 
3317 C CH2 . TRP B 136 ? 0.1036 0.0990 0.0945 -0.0012 0.0030  0.0044  156  TRP B CH2 
3318 N N   . ASP B 137 ? 0.1350 0.1177 0.1109 -0.0001 0.0153  0.0064  157  ASP B N   
3319 C CA  . ASP B 137 ? 0.1476 0.1265 0.1363 -0.0091 0.0068  0.0084  157  ASP B CA  
3320 C C   . ASP B 137 ? 0.1510 0.1218 0.1398 -0.0145 0.0062  0.0033  157  ASP B C   
3321 O O   . ASP B 137 ? 0.1560 0.1261 0.1297 -0.0153 0.0090  0.0008  157  ASP B O   
3322 C CB  . ASP B 137 ? 0.1619 0.1414 0.1486 -0.0182 0.0142  0.0254  157  ASP B CB  
3323 C CG  . ASP B 137 ? 0.1751 0.1684 0.1818 -0.0346 -0.0045 0.0309  157  ASP B CG  
3324 O OD1 . ASP B 137 ? 0.1979 0.1925 0.1967 -0.0407 -0.0202 0.0282  157  ASP B OD1 
3325 O OD2 . ASP B 137 ? 0.1904 0.2105 0.1803 -0.0464 0.0038  0.0365  157  ASP B OD2 
3326 N N   . VAL B 138 ? 0.1483 0.1132 0.1390 -0.0184 0.0066  -0.0001 158  VAL B N   
3327 C CA  . VAL B 138 ? 0.1596 0.1356 0.1395 -0.0142 0.0067  -0.0007 158  VAL B CA  
3328 C C   . VAL B 138 ? 0.1702 0.1357 0.1518 -0.0094 0.0052  -0.0003 158  VAL B C   
3329 O O   . VAL B 138 ? 0.1790 0.1440 0.1474 -0.0111 0.0058  0.0023  158  VAL B O   
3330 C CB  . VAL B 138 ? 0.1506 0.1303 0.1398 -0.0166 0.0128  -0.0049 158  VAL B CB  
3331 C CG1 . VAL B 138 ? 0.1620 0.1412 0.1406 -0.0146 0.0082  -0.0053 158  VAL B CG1 
3332 C CG2 . VAL B 138 ? 0.1584 0.1296 0.1429 -0.0126 0.0161  -0.0075 158  VAL B CG2 
3333 N N   . LYS B 139 ? 0.1883 0.1524 0.1537 -0.0152 0.0089  0.0062  159  LYS B N   
3334 C CA  . LYS B 139 ? 0.2013 0.1592 0.1628 -0.0088 0.0004  -0.0103 159  LYS B CA  
3335 C C   . LYS B 139 ? 0.2026 0.1547 0.1594 -0.0093 0.0016  -0.0094 159  LYS B C   
3336 O O   . LYS B 139 ? 0.2289 0.1615 0.1795 0.0011  -0.0049 -0.0196 159  LYS B O   
3337 C CB  . LYS B 139 ? 0.2107 0.1874 0.1912 -0.0185 0.0067  0.0052  159  LYS B CB  
3338 C CG  . LYS B 139 ? 0.2210 0.2250 0.2261 -0.0035 -0.0024 0.0062  159  LYS B CG  
3339 C CD  . LYS B 139 ? 0.2386 0.2854 0.2465 -0.0021 0.0132  0.0135  159  LYS B CD  
3340 C CE  . LYS B 139 ? 0.2510 0.3210 0.2813 0.0035  -0.0097 0.0069  159  LYS B CE  
3341 N NZ  . LYS B 139 ? 0.2774 0.3618 0.2802 0.0134  0.0016  0.0065  159  LYS B NZ  
3342 N N   . THR B 140 ? 0.1938 0.1378 0.1633 -0.0045 -0.0014 -0.0072 160  THR B N   
3343 C CA  . THR B 140 ? 0.1859 0.1486 0.1661 -0.0062 -0.0048 -0.0164 160  THR B CA  
3344 C C   . THR B 140 ? 0.1837 0.1445 0.1506 0.0015  -0.0020 -0.0117 160  THR B C   
3345 O O   . THR B 140 ? 0.1778 0.1531 0.1641 -0.0018 0.0022  -0.0165 160  THR B O   
3346 C CB  . THR B 140 ? 0.1924 0.1514 0.1681 -0.0077 -0.0007 -0.0101 160  THR B CB  
3347 O OG1 . THR B 140 ? 0.1914 0.1468 0.1462 -0.0211 -0.0061 0.0029  160  THR B OG1 
3348 C CG2 . THR B 140 ? 0.1931 0.1583 0.1798 -0.0108 -0.0028 -0.0073 160  THR B CG2 
3349 N N   . GLY B 141 ? 0.1759 0.1453 0.1418 -0.0041 -0.0032 -0.0063 161  GLY B N   
3350 C CA  . GLY B 141 ? 0.1704 0.1400 0.1513 0.0040  0.0071  -0.0092 161  GLY B CA  
3351 C C   . GLY B 141 ? 0.1682 0.1454 0.1611 0.0007  0.0010  -0.0029 161  GLY B C   
3352 O O   . GLY B 141 ? 0.1668 0.1485 0.1632 0.0022  -0.0032 0.0041  161  GLY B O   
3353 N N   . LYS B 142 ? 0.1876 0.1437 0.1635 -0.0092 0.0053  -0.0053 162  LYS B N   
3354 C CA  . LYS B 142 ? 0.1843 0.1463 0.1676 -0.0017 0.0025  -0.0089 162  LYS B CA  
3355 C C   . LYS B 142 ? 0.1598 0.1362 0.1438 -0.0102 0.0002  0.0066  162  LYS B C   
3356 O O   . LYS B 142 ? 0.1487 0.1261 0.1389 -0.0178 0.0161  0.0026  162  LYS B O   
3357 C CB  . LYS B 142 ? 0.1880 0.1652 0.1653 -0.0071 -0.0030 -0.0026 162  LYS B CB  
3358 C CG  . LYS B 142 ? 0.2198 0.1667 0.2237 -0.0078 -0.0020 -0.0110 162  LYS B CG  
3359 C CD  . LYS B 142 ? 0.2175 0.2092 0.2596 -0.0072 -0.0051 -0.0107 162  LYS B CD  
3360 C CE  . LYS B 142 ? 0.2424 0.2112 0.3074 -0.0043 -0.0037 -0.0178 162  LYS B CE  
3361 N NZ  . LYS B 142 ? 0.2555 0.2566 0.3465 0.0188  -0.0077 -0.0097 162  LYS B NZ  
3362 N N   . CYS B 143 ? 0.1583 0.1322 0.1287 -0.0052 0.0046  0.0001  163  CYS B N   
3363 C CA  . CYS B 143 ? 0.1551 0.1260 0.1417 0.0007  0.0015  0.0028  163  CYS B CA  
3364 C C   . CYS B 143 ? 0.1581 0.1390 0.1436 0.0012  0.0030  0.0014  163  CYS B C   
3365 O O   . CYS B 143 ? 0.1776 0.1544 0.1476 0.0120  -0.0049 0.0063  163  CYS B O   
3366 C CB  . CYS B 143 ? 0.1550 0.1308 0.1277 0.0034  -0.0035 -0.0013 163  CYS B CB  
3367 S SG  . CYS B 143 ? 0.1912 0.1328 0.1685 -0.0078 -0.0068 -0.0100 163  CYS B SG  
3368 N N   . LEU B 144 ? 0.1603 0.1298 0.1416 0.0022  0.0012  0.0041  164  LEU B N   
3369 C CA  . LEU B 144 ? 0.1552 0.1226 0.1376 -0.0023 -0.0034 0.0064  164  LEU B CA  
3370 C C   . LEU B 144 ? 0.1596 0.1224 0.1354 -0.0019 -0.0012 0.0053  164  LEU B C   
3371 O O   . LEU B 144 ? 0.1768 0.1315 0.1360 0.0017  -0.0113 0.0040  164  LEU B O   
3372 C CB  . LEU B 144 ? 0.1506 0.1255 0.1408 -0.0065 0.0050  0.0049  164  LEU B CB  
3373 C CG  . LEU B 144 ? 0.1518 0.1312 0.1476 -0.0145 0.0051  0.0052  164  LEU B CG  
3374 C CD1 . LEU B 144 ? 0.1499 0.1288 0.1630 -0.0162 0.0090  0.0042  164  LEU B CD1 
3375 C CD2 . LEU B 144 ? 0.1584 0.1336 0.1567 -0.0070 -0.0014 0.0099  164  LEU B CD2 
3376 N N   . LYS B 145 ? 0.1615 0.1278 0.1354 -0.0052 -0.0026 0.0097  165  LYS B N   
3377 C CA  . LYS B 145 ? 0.1556 0.1264 0.1284 -0.0067 -0.0012 0.0141  165  LYS B CA  
3378 C C   . LYS B 145 ? 0.1535 0.1199 0.1254 -0.0067 -0.0065 0.0133  165  LYS B C   
3379 O O   . LYS B 145 ? 0.1806 0.1210 0.1260 -0.0121 -0.0150 0.0138  165  LYS B O   
3380 C CB  . LYS B 145 ? 0.1627 0.1357 0.1423 -0.0012 -0.0024 0.0074  165  LYS B CB  
3381 C CG  . LYS B 145 ? 0.1629 0.1521 0.1442 -0.0068 0.0045  -0.0013 165  LYS B CG  
3382 C CD  . LYS B 145 ? 0.1701 0.1544 0.1682 -0.0009 0.0068  -0.0081 165  LYS B CD  
3383 C CE  . LYS B 145 ? 0.1818 0.1890 0.1769 0.0033  0.0142  -0.0051 165  LYS B CE  
3384 N NZ  . LYS B 145 ? 0.2029 0.1897 0.1810 -0.0110 0.0092  -0.0221 165  LYS B NZ  
3385 N N   . THR B 146 ? 0.1563 0.1207 0.1226 -0.0037 -0.0076 0.0085  166  THR B N   
3386 C CA  . THR B 146 ? 0.1422 0.1266 0.1149 -0.0027 -0.0078 -0.0003 166  THR B CA  
3387 C C   . THR B 146 ? 0.1548 0.1248 0.1169 0.0000  -0.0054 0.0000  166  THR B C   
3388 O O   . THR B 146 ? 0.1872 0.1271 0.1202 -0.0027 -0.0178 -0.0003 166  THR B O   
3389 C CB  . THR B 146 ? 0.1416 0.1345 0.1293 -0.0019 -0.0029 0.0003  166  THR B CB  
3390 O OG1 . THR B 146 ? 0.1514 0.1474 0.1217 0.0039  0.0022  -0.0061 166  THR B OG1 
3391 C CG2 . THR B 146 ? 0.1501 0.1336 0.1206 -0.0046 -0.0075 0.0040  166  THR B CG2 
3392 N N   . LEU B 147 ? 0.1516 0.1219 0.1102 -0.0041 -0.0007 -0.0013 167  LEU B N   
3393 C CA  . LEU B 147 ? 0.1454 0.1239 0.1104 -0.0112 0.0039  -0.0034 167  LEU B CA  
3394 C C   . LEU B 147 ? 0.1429 0.1265 0.1126 -0.0095 0.0031  0.0039  167  LEU B C   
3395 O O   . LEU B 147 ? 0.1449 0.1294 0.1168 -0.0098 0.0128  -0.0016 167  LEU B O   
3396 C CB  . LEU B 147 ? 0.1467 0.1224 0.1192 -0.0066 0.0082  -0.0053 167  LEU B CB  
3397 C CG  . LEU B 147 ? 0.1412 0.1426 0.1325 -0.0058 0.0044  -0.0034 167  LEU B CG  
3398 C CD1 . LEU B 147 ? 0.1483 0.1474 0.1341 0.0018  0.0101  -0.0039 167  LEU B CD1 
3399 C CD2 . LEU B 147 ? 0.1492 0.1403 0.1369 -0.0052 0.0114  -0.0043 167  LEU B CD2 
3400 N N   . PRO B 148 ? 0.1457 0.1342 0.1184 -0.0142 -0.0043 0.0057  168  PRO B N   
3401 C CA  . PRO B 148 ? 0.1367 0.1332 0.1200 -0.0086 -0.0021 0.0053  168  PRO B CA  
3402 C C   . PRO B 148 ? 0.1271 0.1311 0.1162 -0.0097 -0.0044 -0.0007 168  PRO B C   
3403 O O   . PRO B 148 ? 0.1302 0.1374 0.1217 -0.0159 0.0000  -0.0063 168  PRO B O   
3404 C CB  . PRO B 148 ? 0.1485 0.1361 0.1220 -0.0078 -0.0048 0.0113  168  PRO B CB  
3405 C CG  . PRO B 148 ? 0.1462 0.1531 0.1290 -0.0120 -0.0027 0.0081  168  PRO B CG  
3406 C CD  . PRO B 148 ? 0.1515 0.1456 0.1235 -0.0130 0.0027  0.0105  168  PRO B CD  
3407 N N   . ALA B 149 ? 0.1285 0.1248 0.1117 -0.0069 -0.0007 -0.0035 169  ALA B N   
3408 C CA  . ALA B 149 ? 0.1267 0.1195 0.1066 -0.0088 0.0002  -0.0053 169  ALA B CA  
3409 C C   . ALA B 149 ? 0.1226 0.1169 0.0941 -0.0059 -0.0045 -0.0056 169  ALA B C   
3410 O O   . ALA B 149 ? 0.1375 0.1126 0.0971 -0.0069 -0.0039 -0.0057 169  ALA B O   
3411 C CB  . ALA B 149 ? 0.1294 0.1094 0.1037 -0.0029 0.0044  -0.0148 169  ALA B CB  
3412 N N   . HIS B 150 ? 0.1175 0.1144 0.0908 -0.0084 -0.0108 -0.0094 170  HIS B N   
3413 C CA  . HIS B 150 ? 0.1190 0.1133 0.0987 -0.0065 -0.0094 -0.0048 170  HIS B CA  
3414 C C   . HIS B 150 ? 0.1198 0.1192 0.1064 -0.0053 -0.0130 -0.0073 170  HIS B C   
3415 O O   . HIS B 150 ? 0.1404 0.1167 0.1336 -0.0055 -0.0121 -0.0014 170  HIS B O   
3416 C CB  . HIS B 150 ? 0.1174 0.1146 0.0991 -0.0072 -0.0049 -0.0006 170  HIS B CB  
3417 C CG  . HIS B 150 ? 0.1179 0.1110 0.0879 -0.0047 -0.0030 -0.0005 170  HIS B CG  
3418 N ND1 . HIS B 150 ? 0.1127 0.1180 0.0933 0.0013  0.0008  -0.0024 170  HIS B ND1 
3419 C CD2 . HIS B 150 ? 0.1176 0.1127 0.0783 -0.0022 -0.0036 -0.0010 170  HIS B CD2 
3420 C CE1 . HIS B 150 ? 0.1142 0.1174 0.0967 -0.0016 -0.0029 0.0005  170  HIS B CE1 
3421 N NE2 . HIS B 150 ? 0.1122 0.1234 0.0897 -0.0020 -0.0052 0.0005  170  HIS B NE2 
3422 N N   . SER B 151 ? 0.1258 0.1206 0.1133 -0.0060 -0.0155 0.0043  171  SER B N   
3423 C CA  . SER B 151 ? 0.1244 0.1275 0.1214 -0.0005 -0.0124 0.0020  171  SER B CA  
3424 C C   . SER B 151 ? 0.1282 0.1394 0.1241 -0.0031 -0.0086 0.0026  171  SER B C   
3425 O O   . SER B 151 ? 0.1302 0.1512 0.1313 -0.0065 -0.0052 0.0024  171  SER B O   
3426 C CB  . SER B 151 ? 0.1422 0.1402 0.1154 -0.0043 -0.0206 0.0010  171  SER B CB  
3427 O OG  . SER B 151 ? 0.1375 0.1405 0.1062 -0.0021 -0.0371 -0.0101 171  SER B OG  
3428 N N   . ASP B 152 ? 0.1276 0.1392 0.1225 -0.0064 -0.0048 -0.0010 172  ASP B N   
3429 C CA  . ASP B 152 ? 0.1309 0.1354 0.1242 -0.0131 -0.0056 0.0022  172  ASP B CA  
3430 C C   . ASP B 152 ? 0.1230 0.1325 0.1125 -0.0077 -0.0011 0.0033  172  ASP B C   
3431 O O   . ASP B 152 ? 0.1430 0.1138 0.1069 -0.0167 -0.0081 0.0195  172  ASP B O   
3432 C CB  . ASP B 152 ? 0.1496 0.1385 0.1471 -0.0084 0.0032  0.0077  172  ASP B CB  
3433 C CG  . ASP B 152 ? 0.1606 0.1570 0.1747 -0.0164 -0.0078 0.0092  172  ASP B CG  
3434 O OD1 . ASP B 152 ? 0.1583 0.1806 0.1896 -0.0202 0.0064  0.0219  172  ASP B OD1 
3435 O OD2 . ASP B 152 ? 0.2136 0.1696 0.1882 -0.0158 -0.0075 -0.0057 172  ASP B OD2 
3436 N N   . PRO B 153 ? 0.1206 0.1251 0.1116 -0.0144 -0.0026 -0.0010 173  PRO B N   
3437 C CA  . PRO B 153 ? 0.1093 0.1135 0.1057 -0.0063 0.0016  0.0001  173  PRO B CA  
3438 C C   . PRO B 153 ? 0.1106 0.1016 0.1030 -0.0040 -0.0040 -0.0015 173  PRO B C   
3439 O O   . PRO B 153 ? 0.0951 0.1077 0.0987 -0.0013 0.0013  -0.0112 173  PRO B O   
3440 C CB  . PRO B 153 ? 0.1094 0.1221 0.1014 -0.0023 0.0001  -0.0020 173  PRO B CB  
3441 C CG  . PRO B 153 ? 0.1131 0.1241 0.1154 -0.0126 -0.0001 0.0020  173  PRO B CG  
3442 C CD  . PRO B 153 ? 0.1138 0.1321 0.1173 -0.0096 -0.0023 -0.0018 173  PRO B CD  
3443 N N   . VAL B 154 ? 0.1015 0.0980 0.0923 0.0010  0.0031  -0.0084 174  VAL B N   
3444 C CA  . VAL B 154 ? 0.1011 0.0947 0.0864 -0.0033 -0.0077 -0.0007 174  VAL B CA  
3445 C C   . VAL B 154 ? 0.1047 0.0905 0.0852 0.0000  -0.0088 -0.0049 174  VAL B C   
3446 O O   . VAL B 154 ? 0.1233 0.0912 0.0802 0.0007  -0.0129 -0.0030 174  VAL B O   
3447 C CB  . VAL B 154 ? 0.1038 0.0937 0.0883 -0.0050 -0.0079 -0.0009 174  VAL B CB  
3448 C CG1 . VAL B 154 ? 0.1038 0.0950 0.0935 -0.0055 -0.0036 0.0051  174  VAL B CG1 
3449 C CG2 . VAL B 154 ? 0.1074 0.0959 0.0890 -0.0053 -0.0084 0.0025  174  VAL B CG2 
3450 N N   . SER B 155 ? 0.1113 0.0891 0.0859 -0.0012 -0.0052 -0.0045 175  SER B N   
3451 C CA  . SER B 155 ? 0.1019 0.0842 0.0849 -0.0029 -0.0013 -0.0024 175  SER B CA  
3452 C C   . SER B 155 ? 0.0990 0.0827 0.0848 -0.0051 0.0053  -0.0029 175  SER B C   
3453 O O   . SER B 155 ? 0.1121 0.0849 0.0861 -0.0064 0.0026  -0.0046 175  SER B O   
3454 C CB  . SER B 155 ? 0.1034 0.0850 0.0907 -0.0063 0.0015  -0.0018 175  SER B CB  
3455 O OG  . SER B 155 ? 0.1205 0.0826 0.0975 -0.0087 0.0045  -0.0050 175  SER B OG  
3456 N N   . ALA B 156 ? 0.0952 0.0799 0.0806 -0.0051 0.0016  -0.0031 176  ALA B N   
3457 C CA  . ALA B 156 ? 0.0945 0.0812 0.0781 -0.0033 0.0019  -0.0031 176  ALA B CA  
3458 C C   . ALA B 156 ? 0.0961 0.0809 0.0784 -0.0025 0.0017  -0.0020 176  ALA B C   
3459 O O   . ALA B 156 ? 0.1106 0.0728 0.0855 -0.0104 -0.0073 -0.0075 176  ALA B O   
3460 C CB  . ALA B 156 ? 0.0909 0.0878 0.0756 -0.0003 0.0002  -0.0031 176  ALA B CB  
3461 N N   . VAL B 157 ? 0.0988 0.0801 0.0784 -0.0047 0.0043  -0.0042 177  VAL B N   
3462 C CA  . VAL B 157 ? 0.0959 0.0833 0.0817 -0.0012 0.0042  -0.0013 177  VAL B CA  
3463 C C   . VAL B 157 ? 0.0954 0.0908 0.0840 0.0000  0.0032  0.0008  177  VAL B C   
3464 O O   . VAL B 157 ? 0.1110 0.1127 0.0865 0.0002  0.0032  -0.0068 177  VAL B O   
3465 C CB  . VAL B 157 ? 0.0914 0.0832 0.0837 -0.0016 0.0013  -0.0025 177  VAL B CB  
3466 C CG1 . VAL B 157 ? 0.0946 0.0751 0.0784 -0.0004 0.0004  -0.0016 177  VAL B CG1 
3467 C CG2 . VAL B 157 ? 0.0938 0.0856 0.0818 -0.0005 0.0010  -0.0020 177  VAL B CG2 
3468 N N   . HIS B 158 ? 0.1005 0.0924 0.0867 -0.0006 0.0075  0.0012  178  HIS B N   
3469 C CA  . HIS B 158 ? 0.1029 0.0973 0.0871 0.0031  0.0045  -0.0067 178  HIS B CA  
3470 C C   . HIS B 158 ? 0.1041 0.1073 0.0889 -0.0018 0.0054  -0.0077 178  HIS B C   
3471 O O   . HIS B 158 ? 0.1168 0.1124 0.0924 -0.0096 -0.0066 -0.0101 178  HIS B O   
3472 C CB  . HIS B 158 ? 0.1016 0.1032 0.0904 0.0078  0.0014  -0.0053 178  HIS B CB  
3473 C CG  . HIS B 158 ? 0.1068 0.1229 0.0983 0.0071  -0.0043 -0.0083 178  HIS B CG  
3474 N ND1 . HIS B 158 ? 0.1070 0.1282 0.1141 0.0096  -0.0071 -0.0139 178  HIS B ND1 
3475 C CD2 . HIS B 158 ? 0.1071 0.1274 0.1073 0.0059  -0.0104 -0.0151 178  HIS B CD2 
3476 C CE1 . HIS B 158 ? 0.1087 0.1372 0.1122 0.0123  -0.0082 -0.0108 178  HIS B CE1 
3477 N NE2 . HIS B 158 ? 0.1083 0.1331 0.1112 0.0102  -0.0107 -0.0133 178  HIS B NE2 
3478 N N   . PHE B 159 ? 0.1022 0.1083 0.0935 -0.0001 0.0046  -0.0079 179  PHE B N   
3479 C CA  . PHE B 159 ? 0.1101 0.1168 0.0985 -0.0054 0.0080  -0.0034 179  PHE B CA  
3480 C C   . PHE B 159 ? 0.1186 0.1192 0.1132 0.0003  0.0045  -0.0061 179  PHE B C   
3481 O O   . PHE B 159 ? 0.1066 0.1233 0.1080 -0.0010 0.0124  -0.0069 179  PHE B O   
3482 C CB  . PHE B 159 ? 0.1069 0.1129 0.1043 0.0000  0.0097  -0.0029 179  PHE B CB  
3483 C CG  . PHE B 159 ? 0.1104 0.1107 0.1059 -0.0034 0.0050  -0.0003 179  PHE B CG  
3484 C CD1 . PHE B 159 ? 0.1136 0.1109 0.1036 0.0040  0.0054  -0.0032 179  PHE B CD1 
3485 C CD2 . PHE B 159 ? 0.1099 0.1129 0.1024 -0.0016 0.0032  0.0005  179  PHE B CD2 
3486 C CE1 . PHE B 159 ? 0.1100 0.1109 0.1009 -0.0044 0.0014  -0.0001 179  PHE B CE1 
3487 C CE2 . PHE B 159 ? 0.1136 0.1062 0.1016 -0.0022 0.0014  -0.0034 179  PHE B CE2 
3488 C CZ  . PHE B 159 ? 0.1107 0.1077 0.1026 0.0004  0.0017  0.0003  179  PHE B CZ  
3489 N N   . ASN B 160 ? 0.1317 0.1310 0.1156 -0.0020 0.0104  -0.0056 180  ASN B N   
3490 C CA  . ASN B 160 ? 0.1336 0.1477 0.1266 0.0039  0.0108  -0.0085 180  ASN B CA  
3491 C C   . ASN B 160 ? 0.1413 0.1550 0.1368 -0.0035 0.0102  -0.0117 180  ASN B C   
3492 O O   . ASN B 160 ? 0.1111 0.1599 0.1213 -0.0046 0.0146  -0.0179 180  ASN B O   
3493 C CB  . ASN B 160 ? 0.1396 0.1460 0.1289 0.0118  0.0138  -0.0072 180  ASN B CB  
3494 C CG  . ASN B 160 ? 0.1319 0.1495 0.1301 0.0114  0.0196  -0.0072 180  ASN B CG  
3495 O OD1 . ASN B 160 ? 0.1374 0.1518 0.1283 0.0154  0.0324  -0.0032 180  ASN B OD1 
3496 N ND2 . ASN B 160 ? 0.1563 0.1634 0.1322 0.0182  0.0229  -0.0117 180  ASN B ND2 
3497 N N   . ARG B 161 ? 0.1511 0.1763 0.1649 0.0101  0.0081  -0.0124 181  ARG B N   
3498 C CA  . ARG B 161 ? 0.1758 0.1947 0.1858 -0.0085 -0.0030 -0.0113 181  ARG B CA  
3499 C C   . ARG B 161 ? 0.1583 0.2002 0.1817 -0.0080 0.0080  -0.0078 181  ARG B C   
3500 O O   . ARG B 161 ? 0.1590 0.2062 0.1764 -0.0155 0.0236  -0.0089 181  ARG B O   
3501 C CB  . ARG B 161 ? 0.1890 0.2236 0.2378 0.0109  -0.0201 -0.0028 181  ARG B CB  
3502 C CG  . ARG B 161 ? 0.2395 0.2522 0.2449 0.0072  -0.0068 -0.0159 181  ARG B CG  
3503 C CD  . ARG B 161 ? 0.2837 0.2642 0.2994 0.0276  -0.0134 -0.0088 181  ARG B CD  
3504 N NE  . ARG B 161 ? 0.3146 0.3216 0.3159 0.0247  -0.0376 0.0022  181  ARG B NE  
3505 C CZ  . ARG B 161 ? 0.3164 0.3347 0.3191 0.0299  -0.0255 -0.0029 181  ARG B CZ  
3506 N NH1 . ARG B 161 ? 0.3499 0.3419 0.3409 0.0394  -0.0392 -0.0189 181  ARG B NH1 
3507 N NH2 . ARG B 161 ? 0.3198 0.3771 0.3333 0.0250  -0.0360 -0.0116 181  ARG B NH2 
3508 N N   . ASP B 162 ? 0.1676 0.2033 0.1805 -0.0177 0.0098  -0.0077 182  ASP B N   
3509 C CA  . ASP B 162 ? 0.1683 0.2024 0.1788 -0.0141 0.0106  -0.0069 182  ASP B CA  
3510 C C   . ASP B 162 ? 0.1623 0.1845 0.1656 -0.0226 0.0138  -0.0053 182  ASP B C   
3511 O O   . ASP B 162 ? 0.1540 0.1914 0.1608 -0.0267 0.0130  -0.0022 182  ASP B O   
3512 C CB  . ASP B 162 ? 0.1752 0.2391 0.1955 -0.0119 0.0232  -0.0111 182  ASP B CB  
3513 C CG  . ASP B 162 ? 0.1908 0.2624 0.1912 -0.0141 0.0241  -0.0157 182  ASP B CG  
3514 O OD1 . ASP B 162 ? 0.1915 0.2674 0.2177 -0.0177 0.0260  -0.0248 182  ASP B OD1 
3515 O OD2 . ASP B 162 ? 0.1985 0.3094 0.2165 -0.0197 0.0477  -0.0020 182  ASP B OD2 
3516 N N   . GLY B 163 ? 0.1556 0.1819 0.1512 -0.0118 0.0166  -0.0092 183  GLY B N   
3517 C CA  . GLY B 163 ? 0.1595 0.1550 0.1458 -0.0168 0.0127  -0.0119 183  GLY B CA  
3518 C C   . GLY B 163 ? 0.1495 0.1547 0.1485 -0.0102 0.0094  -0.0076 183  GLY B C   
3519 O O   . GLY B 163 ? 0.1381 0.1526 0.1559 -0.0222 0.0062  -0.0114 183  GLY B O   
3520 N N   . SER B 164 ? 0.1405 0.1534 0.1447 -0.0143 0.0076  -0.0068 184  SER B N   
3521 C CA  . SER B 164 ? 0.1393 0.1416 0.1398 -0.0071 0.0149  -0.0033 184  SER B CA  
3522 C C   . SER B 164 ? 0.1341 0.1404 0.1228 -0.0022 0.0127  0.0015  184  SER B C   
3523 O O   . SER B 164 ? 0.1218 0.1452 0.1266 -0.0040 0.0128  0.0055  184  SER B O   
3524 C CB  . SER B 164 ? 0.1331 0.1526 0.1450 -0.0138 0.0197  -0.0011 184  SER B CB  
3525 O OG  . SER B 164 ? 0.1534 0.1553 0.1834 0.0011  0.0246  -0.0072 184  SER B OG  
3526 N N   . LEU B 165 ? 0.1261 0.1279 0.1154 -0.0061 0.0075  -0.0059 185  LEU B N   
3527 C CA  . LEU B 165 ? 0.1196 0.1271 0.1053 -0.0011 0.0033  -0.0078 185  LEU B CA  
3528 C C   . LEU B 165 ? 0.1131 0.1145 0.0970 -0.0035 -0.0047 -0.0108 185  LEU B C   
3529 O O   . LEU B 165 ? 0.1186 0.1218 0.0949 -0.0096 -0.0004 -0.0167 185  LEU B O   
3530 C CB  . LEU B 165 ? 0.1280 0.1274 0.1176 -0.0008 -0.0022 -0.0074 185  LEU B CB  
3531 C CG  . LEU B 165 ? 0.1200 0.1391 0.1201 -0.0045 0.0010  -0.0018 185  LEU B CG  
3532 C CD1 . LEU B 165 ? 0.1288 0.1388 0.1202 -0.0058 -0.0052 0.0026  185  LEU B CD1 
3533 C CD2 . LEU B 165 ? 0.1332 0.1440 0.1192 -0.0042 -0.0018 -0.0025 185  LEU B CD2 
3534 N N   . ILE B 166 ? 0.1067 0.0975 0.0830 -0.0010 0.0064  -0.0091 186  ILE B N   
3535 C CA  . ILE B 166 ? 0.1027 0.1015 0.0893 -0.0044 0.0054  -0.0061 186  ILE B CA  
3536 C C   . ILE B 166 ? 0.1028 0.0980 0.0847 -0.0016 0.0063  -0.0046 186  ILE B C   
3537 O O   . ILE B 166 ? 0.1146 0.0922 0.0929 -0.0120 0.0033  -0.0122 186  ILE B O   
3538 C CB  . ILE B 166 ? 0.1060 0.1027 0.0865 -0.0021 0.0040  -0.0060 186  ILE B CB  
3539 C CG1 . ILE B 166 ? 0.1063 0.1028 0.0931 -0.0070 0.0091  0.0001  186  ILE B CG1 
3540 C CG2 . ILE B 166 ? 0.1024 0.1043 0.0866 -0.0045 -0.0009 -0.0036 186  ILE B CG2 
3541 C CD1 . ILE B 166 ? 0.1063 0.1013 0.0943 -0.0059 0.0140  -0.0038 186  ILE B CD1 
3542 N N   . VAL B 167 ? 0.1063 0.1004 0.0853 -0.0041 0.0042  -0.0032 187  VAL B N   
3543 C CA  . VAL B 167 ? 0.1001 0.0941 0.0842 0.0024  0.0019  -0.0058 187  VAL B CA  
3544 C C   . VAL B 167 ? 0.0994 0.0915 0.0842 -0.0030 0.0028  -0.0070 187  VAL B C   
3545 O O   . VAL B 167 ? 0.1055 0.0886 0.0934 0.0031  -0.0008 -0.0142 187  VAL B O   
3546 C CB  . VAL B 167 ? 0.1042 0.0989 0.0895 0.0062  0.0037  -0.0016 187  VAL B CB  
3547 C CG1 . VAL B 167 ? 0.1024 0.1023 0.0926 0.0040  -0.0008 -0.0073 187  VAL B CG1 
3548 C CG2 . VAL B 167 ? 0.1030 0.1061 0.0882 0.0047  0.0018  -0.0098 187  VAL B CG2 
3549 N N   . SER B 168 ? 0.0949 0.0961 0.0842 0.0009  0.0009  -0.0033 188  SER B N   
3550 C CA  . SER B 168 ? 0.0992 0.0954 0.0867 -0.0045 0.0062  -0.0057 188  SER B CA  
3551 C C   . SER B 168 ? 0.1016 0.0956 0.0895 -0.0058 0.0046  -0.0035 188  SER B C   
3552 O O   . SER B 168 ? 0.1012 0.0947 0.0940 -0.0008 0.0113  0.0012  188  SER B O   
3553 C CB  . SER B 168 ? 0.1091 0.1005 0.0908 -0.0048 -0.0035 -0.0041 188  SER B CB  
3554 O OG  . SER B 168 ? 0.1165 0.1122 0.0890 -0.0062 -0.0142 0.0019  188  SER B OG  
3555 N N   . SER B 169 ? 0.1058 0.0934 0.0907 -0.0054 0.0068  -0.0087 189  SER B N   
3556 C CA  . SER B 169 ? 0.1047 0.0929 0.0875 -0.0050 0.0073  -0.0055 189  SER B CA  
3557 C C   . SER B 169 ? 0.1033 0.0901 0.0878 -0.0037 0.0008  -0.0040 189  SER B C   
3558 O O   . SER B 169 ? 0.1015 0.0938 0.0728 -0.0021 0.0054  -0.0049 189  SER B O   
3559 C CB  . SER B 169 ? 0.1084 0.0936 0.0917 -0.0003 0.0055  -0.0044 189  SER B CB  
3560 O OG  . SER B 169 ? 0.1307 0.0926 0.0957 -0.0014 0.0101  -0.0058 189  SER B OG  
3561 N N   . SER B 170 ? 0.1016 0.0899 0.0799 -0.0033 -0.0021 -0.0012 190  SER B N   
3562 C CA  . SER B 170 ? 0.0999 0.0943 0.0824 -0.0064 -0.0076 -0.0008 190  SER B CA  
3563 C C   . SER B 170 ? 0.1027 0.0958 0.0826 -0.0073 -0.0097 0.0022  190  SER B C   
3564 O O   . SER B 170 ? 0.1031 0.0939 0.0787 -0.0090 -0.0110 0.0032  190  SER B O   
3565 C CB  . SER B 170 ? 0.0990 0.1012 0.0857 -0.0090 -0.0102 0.0039  190  SER B CB  
3566 O OG  . SER B 170 ? 0.0986 0.1012 0.0985 -0.0215 -0.0135 0.0075  190  SER B OG  
3567 N N   . TYR B 171 ? 0.1104 0.1078 0.0849 -0.0056 -0.0008 0.0001  191  TYR B N   
3568 C CA  . TYR B 171 ? 0.1153 0.1149 0.0985 -0.0122 -0.0031 -0.0003 191  TYR B CA  
3569 C C   . TYR B 171 ? 0.1282 0.1177 0.1023 -0.0162 -0.0050 -0.0027 191  TYR B C   
3570 O O   . TYR B 171 ? 0.1302 0.1187 0.1073 -0.0191 -0.0095 0.0002  191  TYR B O   
3571 C CB  . TYR B 171 ? 0.1185 0.1293 0.1090 -0.0146 0.0053  0.0015  191  TYR B CB  
3572 C CG  . TYR B 171 ? 0.1305 0.1351 0.1179 -0.0176 -0.0012 -0.0060 191  TYR B CG  
3573 C CD1 . TYR B 171 ? 0.1367 0.1502 0.1235 -0.0129 -0.0060 -0.0052 191  TYR B CD1 
3574 C CD2 . TYR B 171 ? 0.1347 0.1467 0.1259 -0.0098 -0.0014 -0.0066 191  TYR B CD2 
3575 C CE1 . TYR B 171 ? 0.1411 0.1704 0.1311 -0.0101 -0.0101 -0.0177 191  TYR B CE1 
3576 C CE2 . TYR B 171 ? 0.1396 0.1626 0.1258 -0.0078 0.0019  -0.0107 191  TYR B CE2 
3577 C CZ  . TYR B 171 ? 0.1398 0.1754 0.1372 -0.0098 -0.0038 -0.0148 191  TYR B CZ  
3578 O OH  . TYR B 171 ? 0.1533 0.2173 0.1435 -0.0129 -0.0231 -0.0242 191  TYR B OH  
3579 N N   . ASP B 172 ? 0.1318 0.1122 0.1073 -0.0164 -0.0070 0.0012  192  ASP B N   
3580 C CA  . ASP B 172 ? 0.1243 0.1183 0.1071 -0.0093 -0.0067 -0.0001 192  ASP B CA  
3581 C C   . ASP B 172 ? 0.1294 0.1147 0.1076 -0.0088 -0.0081 0.0000  192  ASP B C   
3582 O O   . ASP B 172 ? 0.1343 0.1196 0.1185 -0.0150 -0.0018 -0.0104 192  ASP B O   
3583 C CB  . ASP B 172 ? 0.1305 0.1171 0.1111 -0.0038 -0.0076 0.0019  192  ASP B CB  
3584 C CG  . ASP B 172 ? 0.1327 0.1165 0.1183 -0.0034 -0.0034 0.0110  192  ASP B CG  
3585 O OD1 . ASP B 172 ? 0.1302 0.1230 0.1320 -0.0013 -0.0092 0.0063  192  ASP B OD1 
3586 O OD2 . ASP B 172 ? 0.1447 0.1225 0.1225 -0.0138 -0.0028 0.0156  192  ASP B OD2 
3587 N N   . GLY B 173 ? 0.1203 0.1157 0.1034 -0.0074 -0.0028 -0.0040 193  GLY B N   
3588 C CA  . GLY B 173 ? 0.1239 0.1168 0.0916 -0.0045 -0.0074 -0.0040 193  GLY B CA  
3589 C C   . GLY B 173 ? 0.1148 0.1122 0.0788 -0.0031 -0.0181 -0.0027 193  GLY B C   
3590 O O   . GLY B 173 ? 0.1282 0.1136 0.0815 0.0022  -0.0183 -0.0041 193  GLY B O   
3591 N N   . LEU B 174 ? 0.1082 0.1119 0.0877 -0.0067 -0.0121 -0.0074 194  LEU B N   
3592 C CA  . LEU B 174 ? 0.1186 0.1138 0.0948 -0.0074 -0.0036 0.0001  194  LEU B CA  
3593 C C   . LEU B 174 ? 0.1211 0.1064 0.0962 -0.0069 0.0000  -0.0030 194  LEU B C   
3594 O O   . LEU B 174 ? 0.1328 0.1130 0.0913 -0.0103 -0.0030 -0.0075 194  LEU B O   
3595 C CB  . LEU B 174 ? 0.1229 0.1234 0.1008 -0.0053 -0.0040 0.0054  194  LEU B CB  
3596 C CG  . LEU B 174 ? 0.1244 0.1250 0.1115 -0.0104 -0.0065 0.0029  194  LEU B CG  
3597 C CD1 . LEU B 174 ? 0.1495 0.1280 0.1130 -0.0106 -0.0020 0.0060  194  LEU B CD1 
3598 C CD2 . LEU B 174 ? 0.1356 0.1254 0.1092 -0.0131 -0.0078 0.0003  194  LEU B CD2 
3599 N N   . CYS B 175 ? 0.1223 0.1117 0.1074 -0.0012 -0.0014 0.0011  195  CYS B N   
3600 C CA  . CYS B 175 ? 0.1300 0.1147 0.1066 -0.0049 0.0020  -0.0026 195  CYS B CA  
3601 C C   . CYS B 175 ? 0.1219 0.1037 0.1009 -0.0050 0.0011  -0.0095 195  CYS B C   
3602 O O   . CYS B 175 ? 0.1209 0.0982 0.0942 -0.0015 0.0027  -0.0032 195  CYS B O   
3603 C CB  . CYS B 175 ? 0.1405 0.1347 0.1200 0.0017  -0.0056 0.0083  195  CYS B CB  
3604 S SG  . CYS B 175 ? 0.1853 0.1851 0.1249 0.0043  -0.0206 0.0332  195  CYS B SG  
3605 N N   . ARG B 176 ? 0.1157 0.1029 0.0894 -0.0046 0.0009  -0.0072 196  ARG B N   
3606 C CA  . ARG B 176 ? 0.1160 0.1083 0.0917 -0.0038 0.0045  -0.0070 196  ARG B CA  
3607 C C   . ARG B 176 ? 0.1198 0.1104 0.0927 -0.0072 0.0053  -0.0111 196  ARG B C   
3608 O O   . ARG B 176 ? 0.1256 0.1070 0.0931 -0.0203 0.0020  -0.0098 196  ARG B O   
3609 C CB  . ARG B 176 ? 0.1151 0.1081 0.0934 -0.0059 -0.0003 -0.0058 196  ARG B CB  
3610 C CG  . ARG B 176 ? 0.1180 0.1209 0.0997 -0.0087 0.0012  -0.0090 196  ARG B CG  
3611 C CD  . ARG B 176 ? 0.1147 0.1162 0.1024 -0.0077 0.0075  -0.0064 196  ARG B CD  
3612 N NE  . ARG B 176 ? 0.1088 0.1130 0.1034 -0.0115 0.0076  -0.0036 196  ARG B NE  
3613 C CZ  . ARG B 176 ? 0.1178 0.1162 0.1005 -0.0079 -0.0033 0.0036  196  ARG B CZ  
3614 N NH1 . ARG B 176 ? 0.1163 0.1231 0.0945 -0.0023 -0.0095 -0.0009 196  ARG B NH1 
3615 N NH2 . ARG B 176 ? 0.1227 0.1240 0.1014 -0.0139 0.0001  -0.0037 196  ARG B NH2 
3616 N N   . ILE B 177 ? 0.1152 0.1137 0.0941 -0.0038 0.0039  -0.0052 197  ILE B N   
3617 C CA  . ILE B 177 ? 0.1183 0.1170 0.0996 -0.0066 0.0030  -0.0003 197  ILE B CA  
3618 C C   . ILE B 177 ? 0.1147 0.1135 0.0991 -0.0056 0.0009  -0.0028 197  ILE B C   
3619 O O   . ILE B 177 ? 0.1171 0.1249 0.0989 -0.0055 0.0004  -0.0019 197  ILE B O   
3620 C CB  . ILE B 177 ? 0.1206 0.1283 0.1220 0.0008  -0.0025 -0.0030 197  ILE B CB  
3621 C CG1 . ILE B 177 ? 0.1278 0.1279 0.1250 -0.0001 -0.0039 -0.0032 197  ILE B CG1 
3622 C CG2 . ILE B 177 ? 0.1164 0.1319 0.1332 0.0012  0.0041  -0.0052 197  ILE B CG2 
3623 C CD1 . ILE B 177 ? 0.1332 0.1320 0.1229 0.0038  0.0004  -0.0046 197  ILE B CD1 
3624 N N   . TRP B 178 ? 0.1124 0.1108 0.1019 -0.0093 0.0001  0.0010  198  TRP B N   
3625 C CA  . TRP B 178 ? 0.1186 0.1128 0.1034 0.0008  -0.0031 -0.0014 198  TRP B CA  
3626 C C   . TRP B 178 ? 0.1175 0.1189 0.1039 -0.0010 -0.0025 -0.0032 198  TRP B C   
3627 O O   . TRP B 178 ? 0.1360 0.1334 0.0992 -0.0040 -0.0066 0.0001  198  TRP B O   
3628 C CB  . TRP B 178 ? 0.1159 0.1154 0.1072 -0.0030 0.0039  0.0005  198  TRP B CB  
3629 C CG  . TRP B 178 ? 0.1146 0.1111 0.1080 -0.0035 0.0005  0.0006  198  TRP B CG  
3630 C CD1 . TRP B 178 ? 0.1190 0.1130 0.1054 0.0000  0.0028  -0.0021 198  TRP B CD1 
3631 C CD2 . TRP B 178 ? 0.1136 0.1073 0.1068 -0.0012 0.0018  0.0013  198  TRP B CD2 
3632 N NE1 . TRP B 178 ? 0.1194 0.1147 0.1107 -0.0023 0.0016  0.0016  198  TRP B NE1 
3633 C CE2 . TRP B 178 ? 0.1163 0.1068 0.1091 -0.0045 0.0015  -0.0005 198  TRP B CE2 
3634 C CE3 . TRP B 178 ? 0.1180 0.1035 0.1025 -0.0025 0.0039  -0.0018 198  TRP B CE3 
3635 C CZ2 . TRP B 178 ? 0.1128 0.1180 0.1144 -0.0027 0.0032  0.0012  198  TRP B CZ2 
3636 C CZ3 . TRP B 178 ? 0.1168 0.1076 0.1026 -0.0005 0.0030  -0.0003 198  TRP B CZ3 
3637 C CH2 . TRP B 178 ? 0.1242 0.1187 0.1114 -0.0086 0.0027  -0.0014 198  TRP B CH2 
3638 N N   . ASP B 179 ? 0.1278 0.1193 0.1094 -0.0047 0.0032  -0.0016 199  ASP B N   
3639 C CA  . ASP B 179 ? 0.1294 0.1249 0.1250 -0.0073 0.0069  -0.0013 199  ASP B CA  
3640 C C   . ASP B 179 ? 0.1244 0.1244 0.1165 -0.0081 0.0044  -0.0004 199  ASP B C   
3641 O O   . ASP B 179 ? 0.1259 0.1278 0.1173 -0.0068 0.0053  -0.0015 199  ASP B O   
3642 C CB  . ASP B 179 ? 0.1423 0.1386 0.1286 -0.0044 0.0127  0.0020  199  ASP B CB  
3643 C CG  . ASP B 179 ? 0.1431 0.1473 0.1596 -0.0066 0.0173  0.0082  199  ASP B CG  
3644 O OD1 . ASP B 179 ? 0.1495 0.1523 0.1929 0.0099  0.0313  0.0103  199  ASP B OD1 
3645 O OD2 . ASP B 179 ? 0.1640 0.1450 0.1976 0.0003  0.0198  0.0078  199  ASP B OD2 
3646 N N   . THR B 180 ? 0.1322 0.1177 0.1151 -0.0066 0.0053  -0.0022 200  THR B N   
3647 C CA  . THR B 180 ? 0.1340 0.1202 0.1166 -0.0060 0.0040  -0.0049 200  THR B CA  
3648 C C   . THR B 180 ? 0.1327 0.1233 0.1180 -0.0083 0.0005  -0.0020 200  THR B C   
3649 O O   . THR B 180 ? 0.1474 0.1279 0.1349 -0.0004 0.0055  -0.0029 200  THR B O   
3650 C CB  . THR B 180 ? 0.1389 0.1246 0.1175 -0.0062 0.0000  -0.0005 200  THR B CB  
3651 O OG1 . THR B 180 ? 0.1472 0.1216 0.0888 -0.0083 0.0015  -0.0129 200  THR B OG1 
3652 C CG2 . THR B 180 ? 0.1418 0.1221 0.1147 -0.0103 -0.0010 -0.0006 200  THR B CG2 
3653 N N   . ALA B 181 ? 0.1373 0.1306 0.1247 -0.0137 0.0033  0.0018  201  ALA B N   
3654 C CA  . ALA B 181 ? 0.1417 0.1274 0.1321 -0.0109 0.0010  0.0027  201  ALA B CA  
3655 C C   . ALA B 181 ? 0.1447 0.1310 0.1296 -0.0074 0.0013  -0.0004 201  ALA B C   
3656 O O   . ALA B 181 ? 0.1736 0.1306 0.1367 -0.0007 0.0005  -0.0033 201  ALA B O   
3657 C CB  . ALA B 181 ? 0.1346 0.1343 0.1349 -0.0176 -0.0049 0.0030  201  ALA B CB  
3658 N N   . SER B 182 ? 0.1483 0.1283 0.1330 -0.0069 0.0054  -0.0018 202  SER B N   
3659 C CA  . SER B 182 ? 0.1441 0.1328 0.1428 -0.0046 0.0027  0.0005  202  SER B CA  
3660 C C   . SER B 182 ? 0.1418 0.1359 0.1458 -0.0024 0.0029  0.0019  202  SER B C   
3661 O O   . SER B 182 ? 0.1521 0.1508 0.1620 -0.0015 -0.0067 0.0069  202  SER B O   
3662 C CB  . SER B 182 ? 0.1511 0.1357 0.1237 -0.0094 -0.0040 0.0052  202  SER B CB  
3663 O OG  . SER B 182 ? 0.1734 0.1384 0.1233 -0.0125 -0.0070 0.0079  202  SER B OG  
3664 N N   . GLY B 183 ? 0.1391 0.1513 0.1391 -0.0001 0.0022  0.0009  203  GLY B N   
3665 C CA  . GLY B 183 ? 0.1454 0.1490 0.1508 -0.0090 0.0034  0.0014  203  GLY B CA  
3666 C C   . GLY B 183 ? 0.1504 0.1558 0.1430 -0.0060 -0.0012 0.0003  203  GLY B C   
3667 O O   . GLY B 183 ? 0.1626 0.1615 0.1727 -0.0218 -0.0056 0.0043  203  GLY B O   
3668 N N   . GLN B 184 ? 0.1524 0.1501 0.1386 -0.0056 -0.0019 0.0010  204  GLN B N   
3669 C CA  . GLN B 184 ? 0.1613 0.1475 0.1425 -0.0083 -0.0020 0.0031  204  GLN B CA  
3670 C C   . GLN B 184 ? 0.1402 0.1429 0.1244 -0.0075 -0.0022 -0.0049 204  GLN B C   
3671 O O   . GLN B 184 ? 0.1450 0.1434 0.1082 -0.0188 -0.0012 -0.0065 204  GLN B O   
3672 C CB  . GLN B 184 ? 0.1832 0.1800 0.1586 -0.0056 0.0150  0.0018  204  GLN B CB  
3673 C CG  . GLN B 184 ? 0.2024 0.1953 0.1803 -0.0114 0.0085  -0.0132 204  GLN B CG  
3674 C CD  . GLN B 184 ? 0.2206 0.2324 0.1912 -0.0136 0.0238  -0.0111 204  GLN B CD  
3675 O OE1 . GLN B 184 ? 0.2363 0.2634 0.2508 -0.0297 0.0231  -0.0198 204  GLN B OE1 
3676 N NE2 . GLN B 184 ? 0.2711 0.2563 0.2167 -0.0281 0.0254  -0.0283 204  GLN B NE2 
3677 N N   . CYS B 185 ? 0.1435 0.1387 0.0966 -0.0068 -0.0062 0.0003  205  CYS B N   
3678 C CA  . CYS B 185 ? 0.1360 0.1286 0.1070 -0.0049 -0.0019 -0.0086 205  CYS B CA  
3679 C C   . CYS B 185 ? 0.1400 0.1308 0.1188 -0.0002 -0.0004 -0.0104 205  CYS B C   
3680 O O   . CYS B 185 ? 0.1581 0.1370 0.1222 0.0046  -0.0018 -0.0194 205  CYS B O   
3681 C CB  . CYS B 185 ? 0.1410 0.1229 0.1046 -0.0099 0.0065  -0.0037 205  CYS B CB  
3682 S SG  . CYS B 185 ? 0.1700 0.1213 0.1034 -0.0258 -0.0050 -0.0065 205  CYS B SG  
3683 N N   . LEU B 186 ? 0.1331 0.1321 0.1138 -0.0010 0.0054  -0.0101 206  LEU B N   
3684 C CA  . LEU B 186 ? 0.1307 0.1350 0.1161 0.0019  0.0041  -0.0067 206  LEU B CA  
3685 C C   . LEU B 186 ? 0.1413 0.1359 0.1219 0.0009  0.0092  -0.0061 206  LEU B C   
3686 O O   . LEU B 186 ? 0.1648 0.1461 0.1285 0.0041  0.0115  -0.0167 206  LEU B O   
3687 C CB  . LEU B 186 ? 0.1347 0.1379 0.1200 0.0013  -0.0015 -0.0079 206  LEU B CB  
3688 C CG  . LEU B 186 ? 0.1421 0.1412 0.1440 -0.0048 -0.0053 -0.0091 206  LEU B CG  
3689 C CD1 . LEU B 186 ? 0.1455 0.1548 0.1539 -0.0100 -0.0116 -0.0127 206  LEU B CD1 
3690 C CD2 . LEU B 186 ? 0.1476 0.1444 0.1471 0.0006  -0.0075 0.0004  206  LEU B CD2 
3691 N N   . LYS B 187 ? 0.1406 0.1414 0.1229 -0.0007 0.0054  -0.0031 207  LYS B N   
3692 C CA  . LYS B 187 ? 0.1406 0.1386 0.1204 -0.0064 -0.0010 -0.0109 207  LYS B CA  
3693 C C   . LYS B 187 ? 0.1424 0.1290 0.1166 -0.0023 0.0014  -0.0091 207  LYS B C   
3694 O O   . LYS B 187 ? 0.1625 0.1191 0.1241 -0.0091 -0.0019 -0.0142 207  LYS B O   
3695 C CB  . LYS B 187 ? 0.1516 0.1525 0.1404 0.0021  -0.0075 0.0000  207  LYS B CB  
3696 C CG  . LYS B 187 ? 0.1719 0.1536 0.1654 -0.0036 -0.0099 0.0032  207  LYS B CG  
3697 C CD  . LYS B 187 ? 0.1919 0.1779 0.1708 0.0058  -0.0028 -0.0048 207  LYS B CD  
3698 C CE  . LYS B 187 ? 0.2238 0.1813 0.2014 0.0054  -0.0074 0.0059  207  LYS B CE  
3699 N NZ  . LYS B 187 ? 0.2431 0.2308 0.2093 0.0258  0.0012  -0.0094 207  LYS B NZ  
3700 N N   . THR B 188 ? 0.1414 0.1336 0.1081 0.0008  -0.0005 -0.0178 208  THR B N   
3701 C CA  . THR B 188 ? 0.1383 0.1293 0.1117 -0.0028 -0.0052 -0.0154 208  THR B CA  
3702 C C   . THR B 188 ? 0.1536 0.1324 0.1384 0.0035  -0.0032 -0.0102 208  THR B C   
3703 O O   . THR B 188 ? 0.1758 0.1327 0.1245 0.0049  -0.0005 -0.0030 208  THR B O   
3704 C CB  . THR B 188 ? 0.1356 0.1272 0.1146 -0.0025 -0.0047 -0.0157 208  THR B CB  
3705 O OG1 . THR B 188 ? 0.1386 0.1230 0.0962 -0.0050 -0.0113 -0.0253 208  THR B OG1 
3706 C CG2 . THR B 188 ? 0.1411 0.1179 0.1059 -0.0017 -0.0051 -0.0182 208  THR B CG2 
3707 N N   . LEU B 189 ? 0.1591 0.1559 0.1415 0.0045  0.0028  -0.0059 209  LEU B N   
3708 C CA  . LEU B 189 ? 0.1828 0.1607 0.1629 0.0097  -0.0047 -0.0005 209  LEU B CA  
3709 C C   . LEU B 189 ? 0.1996 0.1736 0.1811 -0.0057 -0.0054 0.0035  209  LEU B C   
3710 O O   . LEU B 189 ? 0.1942 0.1658 0.1900 -0.0079 -0.0089 0.0188  209  LEU B O   
3711 C CB  . LEU B 189 ? 0.1849 0.1790 0.1655 0.0102  -0.0066 -0.0001 209  LEU B CB  
3712 C CG  . LEU B 189 ? 0.1892 0.2001 0.1899 0.0037  -0.0090 0.0086  209  LEU B CG  
3713 C CD1 . LEU B 189 ? 0.1909 0.2131 0.1914 0.0120  -0.0122 0.0027  209  LEU B CD1 
3714 C CD2 . LEU B 189 ? 0.1914 0.2066 0.2069 0.0100  -0.0068 -0.0092 209  LEU B CD2 
3715 N N   . ILE B 190 ? 0.2494 0.1928 0.2205 0.0043  -0.0074 -0.0119 210  ILE B N   
3716 C CA  . ILE B 190 ? 0.2515 0.2293 0.2647 -0.0166 -0.0024 -0.0030 210  ILE B CA  
3717 C C   . ILE B 190 ? 0.2799 0.2382 0.3047 -0.0077 0.0016  -0.0127 210  ILE B C   
3718 O O   . ILE B 190 ? 0.2730 0.2303 0.3209 0.0051  0.0412  -0.0034 210  ILE B O   
3719 C CB  . ILE B 190 ? 0.2923 0.2707 0.2769 -0.0070 -0.0163 -0.0103 210  ILE B CB  
3720 C CG1 . ILE B 190 ? 0.3226 0.2716 0.2865 0.0015  -0.0175 -0.0262 210  ILE B CG1 
3721 C CG2 . ILE B 190 ? 0.2894 0.2675 0.2608 -0.0053 -0.0177 -0.0141 210  ILE B CG2 
3722 C CD1 . ILE B 190 ? 0.3563 0.2983 0.2869 -0.0065 -0.0213 -0.0135 210  ILE B CD1 
3739 N N   . PRO B 195 ? 0.2031 0.1493 0.1594 -0.0180 -0.0092 0.0019  215  PRO B N   
3740 C CA  . PRO B 195 ? 0.1941 0.1500 0.1691 -0.0137 -0.0078 -0.0015 215  PRO B CA  
3741 C C   . PRO B 195 ? 0.1679 0.1508 0.1495 -0.0106 -0.0070 -0.0024 215  PRO B C   
3742 O O   . PRO B 195 ? 0.1910 0.1324 0.1435 -0.0219 -0.0018 0.0068  215  PRO B O   
3743 C CB  . PRO B 195 ? 0.2009 0.1568 0.1735 -0.0180 -0.0164 0.0013  215  PRO B CB  
3744 C CG  . PRO B 195 ? 0.2050 0.1515 0.1766 -0.0162 -0.0134 -0.0032 215  PRO B CG  
3745 C CD  . PRO B 195 ? 0.2024 0.1639 0.1766 -0.0093 -0.0097 -0.0072 215  PRO B CD  
3746 N N   . PRO B 196 ? 0.1550 0.1400 0.1409 -0.0185 -0.0065 0.0048  216  PRO B N   
3747 C CA  . PRO B 196 ? 0.1407 0.1382 0.1382 -0.0138 -0.0036 0.0045  216  PRO B CA  
3748 C C   . PRO B 196 ? 0.1426 0.1195 0.1249 -0.0115 -0.0043 0.0053  216  PRO B C   
3749 O O   . PRO B 196 ? 0.1607 0.1208 0.1299 -0.0111 -0.0088 0.0063  216  PRO B O   
3750 C CB  . PRO B 196 ? 0.1568 0.1431 0.1343 -0.0127 0.0029  0.0070  216  PRO B CB  
3751 C CG  . PRO B 196 ? 0.1578 0.1594 0.1481 -0.0134 -0.0092 0.0051  216  PRO B CG  
3752 C CD  . PRO B 196 ? 0.1463 0.1652 0.1428 -0.0116 -0.0071 0.0059  216  PRO B CD  
3753 N N   . VAL B 197 ? 0.1225 0.1168 0.1068 -0.0032 -0.0048 0.0005  217  VAL B N   
3754 C CA  . VAL B 197 ? 0.1213 0.1024 0.1067 -0.0060 -0.0011 0.0008  217  VAL B CA  
3755 C C   . VAL B 197 ? 0.1187 0.1037 0.1035 -0.0020 -0.0090 0.0009  217  VAL B C   
3756 O O   . VAL B 197 ? 0.1309 0.1027 0.1072 -0.0049 -0.0159 0.0039  217  VAL B O   
3757 C CB  . VAL B 197 ? 0.1235 0.1018 0.1084 -0.0053 0.0017  -0.0001 217  VAL B CB  
3758 C CG1 . VAL B 197 ? 0.1224 0.1096 0.1130 -0.0047 0.0023  0.0005  217  VAL B CG1 
3759 C CG2 . VAL B 197 ? 0.1283 0.1126 0.1004 -0.0084 0.0043  -0.0009 217  VAL B CG2 
3760 N N   . SER B 198 ? 0.1213 0.1005 0.0965 -0.0054 -0.0031 -0.0046 218  SER B N   
3761 C CA  . SER B 198 ? 0.1178 0.0974 0.0999 -0.0048 -0.0004 -0.0042 218  SER B CA  
3762 C C   . SER B 198 ? 0.1114 0.0956 0.0933 -0.0022 0.0049  -0.0034 218  SER B C   
3763 O O   . SER B 198 ? 0.1244 0.0866 0.0944 -0.0145 0.0052  -0.0034 218  SER B O   
3764 C CB  . SER B 198 ? 0.1239 0.1028 0.1028 -0.0064 0.0050  -0.0030 218  SER B CB  
3765 O OG  . SER B 198 ? 0.1395 0.0893 0.1177 -0.0076 0.0140  0.0090  218  SER B OG  
3766 N N   . PHE B 199 ? 0.1062 0.0924 0.0972 0.0029  -0.0023 0.0005  219  PHE B N   
3767 C CA  . PHE B 199 ? 0.1034 0.0967 0.0936 0.0035  -0.0001 -0.0010 219  PHE B CA  
3768 C C   . PHE B 199 ? 0.0978 0.0952 0.0884 0.0025  -0.0043 0.0007  219  PHE B C   
3769 O O   . PHE B 199 ? 0.1030 0.0954 0.0898 0.0073  -0.0019 0.0008  219  PHE B O   
3770 C CB  . PHE B 199 ? 0.1143 0.1048 0.0992 -0.0016 -0.0091 0.0007  219  PHE B CB  
3771 C CG  . PHE B 199 ? 0.1123 0.1070 0.1058 -0.0029 -0.0031 -0.0031 219  PHE B CG  
3772 C CD1 . PHE B 199 ? 0.1152 0.1077 0.1160 -0.0009 -0.0064 -0.0048 219  PHE B CD1 
3773 C CD2 . PHE B 199 ? 0.1104 0.1163 0.1084 -0.0037 -0.0077 -0.0009 219  PHE B CD2 
3774 C CE1 . PHE B 199 ? 0.1125 0.1121 0.1137 -0.0005 -0.0066 -0.0091 219  PHE B CE1 
3775 C CE2 . PHE B 199 ? 0.1082 0.1173 0.1087 -0.0022 -0.0076 0.0000  219  PHE B CE2 
3776 C CZ  . PHE B 199 ? 0.1064 0.1206 0.1099 -0.0059 -0.0088 -0.0085 219  PHE B CZ  
3777 N N   . VAL B 200 ? 0.1045 0.0907 0.0901 0.0029  -0.0024 -0.0011 220  VAL B N   
3778 C CA  . VAL B 200 ? 0.1005 0.0939 0.0912 0.0009  -0.0043 -0.0014 220  VAL B CA  
3779 C C   . VAL B 200 ? 0.1002 0.0953 0.0885 0.0011  -0.0033 -0.0051 220  VAL B C   
3780 O O   . VAL B 200 ? 0.1018 0.0971 0.0864 0.0039  -0.0043 -0.0059 220  VAL B O   
3781 C CB  . VAL B 200 ? 0.1022 0.0956 0.0895 0.0004  -0.0014 -0.0028 220  VAL B CB  
3782 C CG1 . VAL B 200 ? 0.1017 0.0924 0.0808 -0.0028 -0.0041 -0.0085 220  VAL B CG1 
3783 C CG2 . VAL B 200 ? 0.1077 0.0923 0.0885 0.0028  -0.0042 -0.0078 220  VAL B CG2 
3784 N N   . LYS B 201 ? 0.1041 0.1058 0.0922 0.0083  -0.0062 -0.0070 221  LYS B N   
3785 C CA  . LYS B 201 ? 0.1130 0.1025 0.1022 0.0039  -0.0015 -0.0041 221  LYS B CA  
3786 C C   . LYS B 201 ? 0.1112 0.1081 0.0994 0.0069  -0.0056 -0.0045 221  LYS B C   
3787 O O   . LYS B 201 ? 0.1243 0.1065 0.0998 0.0026  -0.0076 -0.0123 221  LYS B O   
3788 C CB  . LYS B 201 ? 0.1225 0.1171 0.1037 0.0030  -0.0042 -0.0050 221  LYS B CB  
3789 C CG  . LYS B 201 ? 0.1244 0.1243 0.1056 0.0066  -0.0022 -0.0025 221  LYS B CG  
3790 C CD  . LYS B 201 ? 0.1250 0.1250 0.1087 0.0046  -0.0145 -0.0072 221  LYS B CD  
3791 C CE  . LYS B 201 ? 0.1411 0.1183 0.1007 0.0062  -0.0083 -0.0022 221  LYS B CE  
3792 N NZ  . LYS B 201 ? 0.1413 0.1239 0.1017 0.0063  -0.0115 -0.0013 221  LYS B NZ  
3793 N N   . PHE B 202 ? 0.1136 0.1078 0.1041 0.0049  -0.0087 -0.0027 222  PHE B N   
3794 C CA  . PHE B 202 ? 0.1203 0.1206 0.1078 0.0079  -0.0023 -0.0101 222  PHE B CA  
3795 C C   . PHE B 202 ? 0.1274 0.1266 0.1140 0.0069  -0.0074 -0.0060 222  PHE B C   
3796 O O   . PHE B 202 ? 0.1388 0.1303 0.1221 0.0147  0.0054  -0.0120 222  PHE B O   
3797 C CB  . PHE B 202 ? 0.1094 0.1180 0.1081 0.0114  -0.0081 -0.0078 222  PHE B CB  
3798 C CG  . PHE B 202 ? 0.1176 0.1160 0.1053 0.0121  -0.0053 -0.0040 222  PHE B CG  
3799 C CD1 . PHE B 202 ? 0.1219 0.1198 0.1086 0.0174  -0.0088 -0.0068 222  PHE B CD1 
3800 C CD2 . PHE B 202 ? 0.1108 0.1221 0.1051 0.0119  -0.0072 -0.0092 222  PHE B CD2 
3801 C CE1 . PHE B 202 ? 0.1305 0.1237 0.1036 0.0169  -0.0028 -0.0024 222  PHE B CE1 
3802 C CE2 . PHE B 202 ? 0.1147 0.1263 0.1061 0.0185  -0.0072 -0.0047 222  PHE B CE2 
3803 C CZ  . PHE B 202 ? 0.1196 0.1289 0.1096 0.0153  -0.0082 -0.0081 222  PHE B CZ  
3804 N N   . SER B 203 ? 0.1375 0.1291 0.1268 0.0092  -0.0024 -0.0076 223  SER B N   
3805 C CA  . SER B 203 ? 0.1428 0.1437 0.1452 0.0123  -0.0124 -0.0049 223  SER B CA  
3806 C C   . SER B 203 ? 0.1554 0.1536 0.1591 0.0025  -0.0092 -0.0082 223  SER B C   
3807 O O   . SER B 203 ? 0.1543 0.1518 0.1687 -0.0042 -0.0097 -0.0036 223  SER B O   
3808 C CB  . SER B 203 ? 0.1366 0.1470 0.1553 0.0136  -0.0156 -0.0068 223  SER B CB  
3809 O OG  . SER B 203 ? 0.1457 0.1482 0.1559 0.0163  -0.0128 -0.0097 223  SER B OG  
3810 N N   . PRO B 204 ? 0.1713 0.1760 0.1673 -0.0011 -0.0205 -0.0048 224  PRO B N   
3811 C CA  . PRO B 204 ? 0.1845 0.1848 0.1886 -0.0079 -0.0204 -0.0131 224  PRO B CA  
3812 C C   . PRO B 204 ? 0.1832 0.2057 0.2077 0.0001  -0.0116 -0.0088 224  PRO B C   
3813 O O   . PRO B 204 ? 0.2029 0.2145 0.2497 -0.0133 -0.0002 -0.0030 224  PRO B O   
3814 C CB  . PRO B 204 ? 0.1831 0.1973 0.1827 -0.0060 -0.0160 -0.0111 224  PRO B CB  
3815 C CG  . PRO B 204 ? 0.2032 0.1868 0.1771 -0.0054 -0.0179 -0.0084 224  PRO B CG  
3816 C CD  . PRO B 204 ? 0.1708 0.1823 0.1739 -0.0081 -0.0166 0.0000  224  PRO B CD  
3817 N N   . ASN B 205 ? 0.1904 0.2200 0.2143 -0.0011 -0.0235 -0.0210 225  ASN B N   
3818 C CA  . ASN B 205 ? 0.2065 0.2432 0.2138 -0.0021 0.0039  -0.0080 225  ASN B CA  
3819 C C   . ASN B 205 ? 0.2284 0.2825 0.2384 0.0070  -0.0017 -0.0088 225  ASN B C   
3820 O O   . ASN B 205 ? 0.2043 0.2970 0.2263 -0.0551 0.0377  0.0199  225  ASN B O   
3821 C CB  . ASN B 205 ? 0.2212 0.2390 0.2264 0.0291  -0.0028 -0.0104 225  ASN B CB  
3822 C CG  . ASN B 205 ? 0.2509 0.2546 0.3121 0.0129  0.0273  -0.0182 225  ASN B CG  
3823 O OD1 . ASN B 205 ? 0.2234 0.2926 0.2691 -0.0521 -0.0275 -0.0534 225  ASN B OD1 
3824 N ND2 . ASN B 205 ? 0.2193 0.2393 0.2907 -0.0010 0.0070  -0.0387 225  ASN B ND2 
3825 N N   . GLY B 206 ? 0.2151 0.2761 0.2255 -0.0234 0.0010  -0.0014 226  GLY B N   
3826 C CA  . GLY B 206 ? 0.2200 0.2767 0.2358 -0.0174 -0.0021 -0.0002 226  GLY B CA  
3827 C C   . GLY B 206 ? 0.2113 0.2747 0.2327 -0.0191 -0.0017 -0.0024 226  GLY B C   
3828 O O   . GLY B 206 ? 0.2277 0.3246 0.2318 -0.0422 0.0024  0.0047  226  GLY B O   
3829 N N   . LYS B 207 ? 0.2235 0.2672 0.2138 -0.0181 0.0034  -0.0160 227  LYS B N   
3830 C CA  . LYS B 207 ? 0.2359 0.2738 0.2328 -0.0140 0.0052  -0.0287 227  LYS B CA  
3831 C C   . LYS B 207 ? 0.2279 0.2750 0.2141 -0.0029 0.0174  -0.0350 227  LYS B C   
3832 O O   . LYS B 207 ? 0.2382 0.3252 0.2270 -0.0066 -0.0037 -0.0479 227  LYS B O   
3833 C CB  . LYS B 207 ? 0.2679 0.2764 0.2418 -0.0068 0.0023  -0.0199 227  LYS B CB  
3834 C CG  . LYS B 207 ? 0.2691 0.2962 0.2739 0.0021  0.0031  -0.0115 227  LYS B CG  
3835 C CD  . LYS B 207 ? 0.2894 0.3268 0.3089 -0.0007 -0.0062 -0.0176 227  LYS B CD  
3836 C CE  . LYS B 207 ? 0.2950 0.3617 0.3284 -0.0019 0.0113  0.0012  227  LYS B CE  
3837 N NZ  . LYS B 207 ? 0.3175 0.3626 0.3204 0.0076  -0.0100 -0.0111 227  LYS B NZ  
3838 N N   . TYR B 208 ? 0.2020 0.2261 0.1953 0.0042  -0.0017 -0.0345 228  TYR B N   
3839 C CA  . TYR B 208 ? 0.1925 0.2038 0.1953 0.0212  0.0038  -0.0202 228  TYR B CA  
3840 C C   . TYR B 208 ? 0.1749 0.1738 0.1629 0.0047  -0.0028 -0.0080 228  TYR B C   
3841 O O   . TYR B 208 ? 0.1723 0.1747 0.1607 0.0184  -0.0112 -0.0158 228  TYR B O   
3842 C CB  . TYR B 208 ? 0.2035 0.2049 0.1939 0.0172  -0.0013 -0.0207 228  TYR B CB  
3843 C CG  . TYR B 208 ? 0.2128 0.2323 0.2431 0.0284  -0.0124 -0.0196 228  TYR B CG  
3844 C CD1 . TYR B 208 ? 0.2282 0.2366 0.2460 0.0248  -0.0078 -0.0252 228  TYR B CD1 
3845 C CD2 . TYR B 208 ? 0.2247 0.2352 0.2467 0.0201  -0.0179 -0.0291 228  TYR B CD2 
3846 C CE1 . TYR B 208 ? 0.2289 0.2570 0.2615 0.0308  -0.0214 -0.0277 228  TYR B CE1 
3847 C CE2 . TYR B 208 ? 0.2257 0.2494 0.2575 0.0248  -0.0450 -0.0352 228  TYR B CE2 
3848 C CZ  . TYR B 208 ? 0.2354 0.2564 0.2710 0.0261  -0.0258 -0.0403 228  TYR B CZ  
3849 O OH  . TYR B 208 ? 0.2563 0.2606 0.3283 0.0431  -0.0532 -0.0379 228  TYR B OH  
3850 N N   . ILE B 209 ? 0.1706 0.1439 0.1340 0.0118  0.0051  -0.0055 229  ILE B N   
3851 C CA  . ILE B 209 ? 0.1654 0.1549 0.1447 0.0132  0.0055  -0.0012 229  ILE B CA  
3852 C C   . ILE B 209 ? 0.1725 0.1392 0.1383 0.0150  0.0109  -0.0124 229  ILE B C   
3853 O O   . ILE B 209 ? 0.1952 0.1394 0.1520 0.0161  0.0210  -0.0139 229  ILE B O   
3854 C CB  . ILE B 209 ? 0.1555 0.1646 0.1592 0.0105  0.0003  -0.0016 229  ILE B CB  
3855 C CG1 . ILE B 209 ? 0.1797 0.1774 0.1566 0.0013  0.0008  -0.0023 229  ILE B CG1 
3856 C CG2 . ILE B 209 ? 0.1569 0.1692 0.1442 0.0103  -0.0090 0.0018  229  ILE B CG2 
3857 C CD1 . ILE B 209 ? 0.1817 0.2086 0.1862 0.0043  -0.0110 -0.0074 229  ILE B CD1 
3858 N N   . LEU B 210 ? 0.1632 0.1349 0.1318 0.0138  0.0091  -0.0023 230  LEU B N   
3859 C CA  . LEU B 210 ? 0.1472 0.1296 0.1322 0.0113  0.0049  -0.0079 230  LEU B CA  
3860 C C   . LEU B 210 ? 0.1477 0.1228 0.1231 0.0138  0.0042  -0.0122 230  LEU B C   
3861 O O   . LEU B 210 ? 0.1482 0.1220 0.1241 0.0190  -0.0002 -0.0097 230  LEU B O   
3862 C CB  . LEU B 210 ? 0.1597 0.1488 0.1352 0.0123  -0.0020 -0.0071 230  LEU B CB  
3863 C CG  . LEU B 210 ? 0.1552 0.1589 0.1450 0.0053  -0.0010 -0.0039 230  LEU B CG  
3864 C CD1 . LEU B 210 ? 0.1609 0.1649 0.1399 0.0126  -0.0009 -0.0117 230  LEU B CD1 
3865 C CD2 . LEU B 210 ? 0.1625 0.1727 0.1448 0.0164  -0.0026 -0.0118 230  LEU B CD2 
3866 N N   . ALA B 211 ? 0.1424 0.1174 0.1213 0.0147  0.0114  -0.0083 231  ALA B N   
3867 C CA  . ALA B 211 ? 0.1422 0.1154 0.1083 0.0051  -0.0019 -0.0014 231  ALA B CA  
3868 C C   . ALA B 211 ? 0.1387 0.1172 0.1080 0.0072  0.0022  -0.0003 231  ALA B C   
3869 O O   . ALA B 211 ? 0.1600 0.1187 0.1305 0.0109  0.0085  -0.0001 231  ALA B O   
3870 C CB  . ALA B 211 ? 0.1452 0.1138 0.1112 0.0093  -0.0081 -0.0037 231  ALA B CB  
3871 N N   . ALA B 212 ? 0.1307 0.1191 0.1017 0.0055  -0.0060 0.0038  232  ALA B N   
3872 C CA  . ALA B 212 ? 0.1241 0.1188 0.1069 0.0022  -0.0045 -0.0008 232  ALA B CA  
3873 C C   . ALA B 212 ? 0.1228 0.1181 0.1129 -0.0003 -0.0041 -0.0012 232  ALA B C   
3874 O O   . ALA B 212 ? 0.1285 0.1230 0.1013 0.0030  -0.0053 -0.0017 232  ALA B O   
3875 C CB  . ALA B 212 ? 0.1401 0.1304 0.1118 0.0004  0.0049  -0.0059 232  ALA B CB  
3876 N N   . THR B 213 ? 0.1376 0.1186 0.1172 -0.0041 -0.0035 -0.0020 233  THR B N   
3877 C CA  . THR B 213 ? 0.1379 0.1275 0.1287 -0.0097 -0.0042 0.0018  233  THR B CA  
3878 C C   . THR B 213 ? 0.1464 0.1255 0.1247 -0.0092 -0.0021 0.0027  233  THR B C   
3879 O O   . THR B 213 ? 0.1499 0.1368 0.1365 -0.0124 -0.0086 0.0082  233  THR B O   
3880 C CB  . THR B 213 ? 0.1635 0.1377 0.1334 -0.0125 -0.0081 -0.0049 233  THR B CB  
3881 O OG1 . THR B 213 ? 0.1856 0.1525 0.1645 0.0028  -0.0252 -0.0123 233  THR B OG1 
3882 C CG2 . THR B 213 ? 0.1725 0.1422 0.1346 -0.0172 -0.0024 -0.0070 233  THR B CG2 
3883 N N   . LEU B 214 ? 0.1478 0.1260 0.1186 -0.0111 -0.0093 -0.0006 234  LEU B N   
3884 C CA  . LEU B 214 ? 0.1456 0.1383 0.1304 -0.0112 -0.0054 0.0027  234  LEU B CA  
3885 C C   . LEU B 214 ? 0.1562 0.1435 0.1327 -0.0183 -0.0123 -0.0045 234  LEU B C   
3886 O O   . LEU B 214 ? 0.1582 0.1696 0.1568 -0.0204 -0.0078 -0.0032 234  LEU B O   
3887 C CB  . LEU B 214 ? 0.1481 0.1301 0.1281 -0.0121 -0.0040 -0.0032 234  LEU B CB  
3888 C CG  . LEU B 214 ? 0.1448 0.1289 0.1347 -0.0145 -0.0057 0.0015  234  LEU B CG  
3889 C CD1 . LEU B 214 ? 0.1497 0.1325 0.1451 -0.0087 0.0010  -0.0034 234  LEU B CD1 
3890 C CD2 . LEU B 214 ? 0.1563 0.1215 0.1302 -0.0136 -0.0041 0.0036  234  LEU B CD2 
3891 N N   . ASP B 215 ? 0.1670 0.1493 0.1502 -0.0137 0.0011  -0.0007 235  ASP B N   
3892 C CA  . ASP B 215 ? 0.1732 0.1482 0.1611 -0.0084 0.0006  -0.0030 235  ASP B CA  
3893 C C   . ASP B 215 ? 0.1830 0.1475 0.1499 -0.0039 0.0006  -0.0028 235  ASP B C   
3894 O O   . ASP B 215 ? 0.2019 0.1497 0.1595 0.0027  -0.0003 -0.0038 235  ASP B O   
3895 C CB  . ASP B 215 ? 0.1811 0.1655 0.1550 -0.0072 -0.0026 -0.0001 235  ASP B CB  
3896 C CG  . ASP B 215 ? 0.1876 0.1789 0.1635 -0.0064 0.0066  -0.0025 235  ASP B CG  
3897 O OD1 . ASP B 215 ? 0.2006 0.1787 0.1670 -0.0147 -0.0024 0.0136  235  ASP B OD1 
3898 O OD2 . ASP B 215 ? 0.2317 0.2178 0.1610 -0.0022 -0.0129 -0.0142 235  ASP B OD2 
3899 N N   . ASN B 216 ? 0.1694 0.1335 0.1529 -0.0103 -0.0008 0.0045  236  ASN B N   
3900 C CA  . ASN B 216 ? 0.1753 0.1363 0.1479 -0.0123 -0.0035 0.0040  236  ASN B CA  
3901 C C   . ASN B 216 ? 0.1812 0.1434 0.1466 -0.0008 -0.0002 0.0055  236  ASN B C   
3902 O O   . ASN B 216 ? 0.1941 0.1516 0.1661 0.0072  -0.0108 -0.0008 236  ASN B O   
3903 C CB  . ASN B 216 ? 0.1773 0.1350 0.1421 -0.0142 -0.0011 -0.0008 236  ASN B CB  
3904 C CG  . ASN B 216 ? 0.1795 0.1378 0.1359 -0.0170 0.0042  0.0076  236  ASN B CG  
3905 O OD1 . ASN B 216 ? 0.1941 0.1374 0.1188 -0.0310 -0.0022 0.0104  236  ASN B OD1 
3906 N ND2 . ASN B 216 ? 0.1757 0.1467 0.1484 -0.0216 0.0072  0.0096  236  ASN B ND2 
3907 N N   . THR B 217 ? 0.1862 0.1416 0.1513 -0.0044 -0.0023 0.0044  237  THR B N   
3908 C CA  . THR B 217 ? 0.1797 0.1555 0.1528 -0.0003 -0.0072 0.0056  237  THR B CA  
3909 C C   . THR B 217 ? 0.1735 0.1539 0.1520 0.0022  -0.0064 0.0007  237  THR B C   
3910 O O   . THR B 217 ? 0.1896 0.1511 0.1673 0.0219  -0.0034 -0.0159 237  THR B O   
3911 C CB  . THR B 217 ? 0.1859 0.1690 0.1611 -0.0120 -0.0011 -0.0068 237  THR B CB  
3912 O OG1 . THR B 217 ? 0.1975 0.1768 0.1625 -0.0192 0.0062  0.0002  237  THR B OG1 
3913 C CG2 . THR B 217 ? 0.1819 0.1791 0.1665 -0.0069 -0.0058 -0.0038 237  THR B CG2 
3914 N N   . LEU B 218 ? 0.1729 0.1529 0.1495 0.0164  -0.0003 -0.0090 238  LEU B N   
3915 C CA  . LEU B 218 ? 0.1875 0.1586 0.1627 0.0093  0.0008  -0.0056 238  LEU B CA  
3916 C C   . LEU B 218 ? 0.1936 0.1619 0.1658 0.0172  0.0041  -0.0025 238  LEU B C   
3917 O O   . LEU B 218 ? 0.2129 0.1594 0.1753 0.0158  0.0020  -0.0056 238  LEU B O   
3918 C CB  . LEU B 218 ? 0.1879 0.1619 0.1582 0.0084  0.0000  0.0010  238  LEU B CB  
3919 C CG  . LEU B 218 ? 0.1906 0.1619 0.1587 0.0129  -0.0055 -0.0026 238  LEU B CG  
3920 C CD1 . LEU B 218 ? 0.2149 0.1732 0.1657 0.0105  -0.0168 -0.0111 238  LEU B CD1 
3921 C CD2 . LEU B 218 ? 0.1975 0.1620 0.1431 0.0104  -0.0132 -0.0058 238  LEU B CD2 
3922 N N   . LYS B 219 ? 0.1971 0.1606 0.1717 0.0166  0.0092  -0.0022 239  LYS B N   
3923 C CA  . LYS B 219 ? 0.2027 0.1696 0.1845 0.0177  0.0184  -0.0056 239  LYS B CA  
3924 C C   . LYS B 219 ? 0.1958 0.1722 0.1691 0.0214  0.0196  -0.0038 239  LYS B C   
3925 O O   . LYS B 219 ? 0.1915 0.1726 0.1741 0.0271  0.0344  -0.0054 239  LYS B O   
3926 C CB  . LYS B 219 ? 0.2221 0.1980 0.1993 -0.0015 0.0075  -0.0130 239  LYS B CB  
3927 C CG  . LYS B 219 ? 0.2285 0.2146 0.2245 -0.0117 0.0054  -0.0090 239  LYS B CG  
3928 C CD  . LYS B 219 ? 0.2609 0.2623 0.2312 -0.0087 -0.0044 -0.0209 239  LYS B CD  
3929 C CE  . LYS B 219 ? 0.2562 0.2811 0.2740 -0.0142 0.0011  -0.0228 239  LYS B CE  
3930 N NZ  . LYS B 219 ? 0.2927 0.2866 0.3113 0.0056  -0.0016 -0.0392 239  LYS B NZ  
3931 N N   . LEU B 220 ? 0.1949 0.1699 0.1689 0.0231  0.0129  -0.0021 240  LEU B N   
3932 C CA  . LEU B 220 ? 0.1917 0.1788 0.1662 0.0181  0.0094  -0.0099 240  LEU B CA  
3933 C C   . LEU B 220 ? 0.1948 0.1815 0.1653 0.0197  0.0111  -0.0034 240  LEU B C   
3934 O O   . LEU B 220 ? 0.2212 0.1780 0.1703 0.0363  0.0136  0.0033  240  LEU B O   
3935 C CB  . LEU B 220 ? 0.1928 0.1756 0.1597 0.0181  0.0074  -0.0184 240  LEU B CB  
3936 C CG  . LEU B 220 ? 0.1913 0.1802 0.1661 0.0164  -0.0002 -0.0114 240  LEU B CG  
3937 C CD1 . LEU B 220 ? 0.1917 0.1766 0.1655 0.0318  -0.0002 -0.0086 240  LEU B CD1 
3938 C CD2 . LEU B 220 ? 0.1900 0.1943 0.1752 0.0236  -0.0066 -0.0214 240  LEU B CD2 
3939 N N   . TRP B 221 ? 0.2012 0.1796 0.1701 0.0144  0.0144  -0.0032 241  TRP B N   
3940 C CA  . TRP B 221 ? 0.2129 0.1917 0.1704 0.0068  0.0099  -0.0180 241  TRP B CA  
3941 C C   . TRP B 221 ? 0.2139 0.1847 0.1680 0.0043  0.0005  -0.0047 241  TRP B C   
3942 O O   . TRP B 221 ? 0.2206 0.1874 0.1560 0.0006  -0.0029 0.0035  241  TRP B O   
3943 C CB  . TRP B 221 ? 0.2017 0.1929 0.1714 -0.0031 0.0115  -0.0139 241  TRP B CB  
3944 C CG  . TRP B 221 ? 0.2053 0.2261 0.1941 -0.0147 0.0213  -0.0239 241  TRP B CG  
3945 C CD1 . TRP B 221 ? 0.2127 0.2329 0.1813 -0.0123 0.0158  -0.0293 241  TRP B CD1 
3946 C CD2 . TRP B 221 ? 0.2120 0.2444 0.1961 -0.0211 0.0232  -0.0319 241  TRP B CD2 
3947 N NE1 . TRP B 221 ? 0.2112 0.2550 0.2041 -0.0247 0.0270  -0.0268 241  TRP B NE1 
3948 C CE2 . TRP B 221 ? 0.2114 0.2581 0.2084 -0.0294 0.0200  -0.0344 241  TRP B CE2 
3949 C CE3 . TRP B 221 ? 0.2150 0.2591 0.1958 -0.0256 0.0156  -0.0403 241  TRP B CE3 
3950 C CZ2 . TRP B 221 ? 0.2101 0.2739 0.2112 -0.0250 0.0178  -0.0431 241  TRP B CZ2 
3951 C CZ3 . TRP B 221 ? 0.2126 0.2658 0.2018 -0.0235 0.0203  -0.0494 241  TRP B CZ3 
3952 C CH2 . TRP B 221 ? 0.2099 0.2767 0.2095 -0.0357 0.0112  -0.0437 241  TRP B CH2 
3953 N N   . ASP B 222 ? 0.2184 0.1877 0.1856 0.0180  0.0064  -0.0082 242  ASP B N   
3954 C CA  . ASP B 222 ? 0.2275 0.2079 0.1894 0.0123  0.0058  0.0045  242  ASP B CA  
3955 C C   . ASP B 222 ? 0.2355 0.2098 0.1905 0.0155  0.0115  0.0115  242  ASP B C   
3956 O O   . ASP B 222 ? 0.2705 0.1846 0.1934 0.0094  0.0148  0.0043  242  ASP B O   
3957 C CB  . ASP B 222 ? 0.2368 0.2284 0.2014 0.0205  0.0207  0.0072  242  ASP B CB  
3958 C CG  . ASP B 222 ? 0.2462 0.2602 0.2089 0.0131  0.0275  0.0121  242  ASP B CG  
3959 O OD1 . ASP B 222 ? 0.2433 0.2794 0.2098 0.0310  0.0297  0.0166  242  ASP B OD1 
3960 O OD2 . ASP B 222 ? 0.2634 0.3042 0.2486 0.0392  0.0250  0.0275  242  ASP B OD2 
3961 N N   . TYR B 223 ? 0.2372 0.2110 0.1951 0.0085  0.0013  0.0034  243  TYR B N   
3962 C CA  . TYR B 223 ? 0.2394 0.2120 0.2151 0.0171  0.0071  0.0062  243  TYR B CA  
3963 C C   . TYR B 223 ? 0.2495 0.2224 0.2142 0.0060  0.0069  0.0031  243  TYR B C   
3964 O O   . TYR B 223 ? 0.2715 0.2607 0.2135 0.0085  -0.0030 0.0138  243  TYR B O   
3965 C CB  . TYR B 223 ? 0.2313 0.2192 0.2124 0.0123  0.0128  -0.0012 243  TYR B CB  
3966 C CG  . TYR B 223 ? 0.2300 0.2206 0.2146 0.0166  0.0160  -0.0159 243  TYR B CG  
3967 C CD1 . TYR B 223 ? 0.2378 0.2243 0.2273 0.0161  0.0248  -0.0113 243  TYR B CD1 
3968 C CD2 . TYR B 223 ? 0.2126 0.2304 0.2250 0.0241  0.0122  -0.0188 243  TYR B CD2 
3969 C CE1 . TYR B 223 ? 0.2433 0.2206 0.2385 0.0190  0.0131  -0.0148 243  TYR B CE1 
3970 C CE2 . TYR B 223 ? 0.2229 0.2079 0.2309 0.0288  0.0179  -0.0256 243  TYR B CE2 
3971 C CZ  . TYR B 223 ? 0.2241 0.2218 0.2364 0.0246  0.0201  -0.0180 243  TYR B CZ  
3972 O OH  . TYR B 223 ? 0.2511 0.2322 0.2899 0.0103  -0.0003 -0.0236 243  TYR B OH  
3973 N N   . SER B 224 ? 0.2504 0.2218 0.2105 0.0083  0.0077  0.0106  244  SER B N   
3974 C CA  . SER B 224 ? 0.2698 0.2549 0.2155 0.0048  0.0180  0.0054  244  SER B CA  
3975 C C   . SER B 224 ? 0.2566 0.2578 0.2352 0.0050  0.0078  0.0019  244  SER B C   
3976 O O   . SER B 224 ? 0.2730 0.2785 0.2291 0.0158  0.0091  -0.0060 244  SER B O   
3977 C CB  . SER B 224 ? 0.2724 0.2683 0.2489 -0.0011 0.0094  0.0037  244  SER B CB  
3978 O OG  . SER B 224 ? 0.3336 0.3116 0.2422 -0.0097 0.0122  0.0017  244  SER B OG  
3979 N N   . LYS B 225 ? 0.2472 0.2549 0.2271 0.0046  0.0161  -0.0032 245  LYS B N   
3980 C CA  . LYS B 225 ? 0.2464 0.2518 0.2518 -0.0006 0.0135  -0.0035 245  LYS B CA  
3981 C C   . LYS B 225 ? 0.2444 0.2553 0.2463 -0.0040 -0.0006 -0.0147 245  LYS B C   
3982 O O   . LYS B 225 ? 0.2544 0.2903 0.2656 -0.0012 0.0028  -0.0359 245  LYS B O   
3983 C CB  . LYS B 225 ? 0.2570 0.2534 0.2585 0.0053  0.0062  -0.0098 245  LYS B CB  
3984 C CG  . LYS B 225 ? 0.2557 0.2674 0.2948 0.0055  -0.0016 -0.0049 245  LYS B CG  
3985 C CD  . LYS B 225 ? 0.2701 0.2624 0.3228 0.0083  0.0123  0.0107  245  LYS B CD  
3986 C CE  . LYS B 225 ? 0.2676 0.2776 0.3390 0.0251  -0.0017 0.0057  245  LYS B CE  
3987 N NZ  . LYS B 225 ? 0.2893 0.2649 0.3459 0.0091  0.0226  0.0053  245  LYS B NZ  
3988 N N   . GLY B 226 ? 0.2681 0.2547 0.2479 0.0042  -0.0042 -0.0147 246  GLY B N   
3989 C CA  . GLY B 226 ? 0.2721 0.2596 0.2354 0.0079  0.0071  -0.0124 246  GLY B CA  
3990 C C   . GLY B 226 ? 0.2836 0.2610 0.2437 0.0003  0.0043  -0.0093 246  GLY B C   
3991 O O   . GLY B 226 ? 0.3053 0.2731 0.2684 -0.0092 0.0033  -0.0126 246  GLY B O   
3992 N N   . LYS B 227 ? 0.3031 0.2638 0.2284 0.0029  0.0115  -0.0157 247  LYS B N   
3993 C CA  . LYS B 227 ? 0.3074 0.2658 0.2506 -0.0014 0.0201  -0.0074 247  LYS B CA  
3994 C C   . LYS B 227 ? 0.2906 0.2450 0.2494 -0.0011 0.0227  -0.0145 247  LYS B C   
3995 O O   . LYS B 227 ? 0.3007 0.1982 0.2279 0.0031  0.0510  -0.0189 247  LYS B O   
3996 C CB  . LYS B 227 ? 0.3065 0.3027 0.2911 0.0060  0.0170  -0.0128 247  LYS B CB  
3997 C CG  . LYS B 227 ? 0.3263 0.3187 0.3188 0.0263  0.0116  0.0083  247  LYS B CG  
3998 C CD  . LYS B 227 ? 0.3473 0.3666 0.3398 0.0103  0.0181  -0.0110 247  LYS B CD  
3999 C CE  . LYS B 227 ? 0.3297 0.3509 0.3283 0.0254  0.0232  0.0016  247  LYS B CE  
4000 N NZ  . LYS B 227 ? 0.3507 0.3944 0.3890 0.0003  0.0420  0.0098  247  LYS B NZ  
4001 N N   . CYS B 228 ? 0.3048 0.2246 0.2535 0.0006  0.0316  -0.0248 248  CYS B N   
4002 C CA  . CYS B 228 ? 0.2970 0.2406 0.2525 0.0068  0.0407  -0.0262 248  CYS B CA  
4003 C C   . CYS B 228 ? 0.2900 0.2420 0.2449 0.0048  0.0447  -0.0200 248  CYS B C   
4004 O O   . CYS B 228 ? 0.3089 0.2529 0.2526 0.0016  0.0422  -0.0353 248  CYS B O   
4005 C CB  . CYS B 228 ? 0.3157 0.2516 0.2396 -0.0004 0.0574  -0.0220 248  CYS B CB  
4006 S SG  . CYS B 228 ? 0.3852 0.2862 0.2407 -0.0061 0.1064  -0.0338 248  CYS B SG  
4007 N N   . LEU B 229 ? 0.2814 0.2439 0.2270 0.0087  0.0522  -0.0118 249  LEU B N   
4008 C CA  . LEU B 229 ? 0.2940 0.2510 0.2483 0.0156  0.0433  -0.0026 249  LEU B CA  
4009 C C   . LEU B 229 ? 0.3056 0.2545 0.2623 0.0259  0.0506  0.0082  249  LEU B C   
4010 O O   . LEU B 229 ? 0.3447 0.2555 0.2694 0.0348  0.0589  0.0139  249  LEU B O   
4011 C CB  . LEU B 229 ? 0.2808 0.2641 0.2529 0.0201  0.0391  -0.0113 249  LEU B CB  
4012 C CG  . LEU B 229 ? 0.2843 0.2664 0.2637 0.0157  0.0217  0.0001  249  LEU B CG  
4013 C CD1 . LEU B 229 ? 0.2665 0.2726 0.2513 0.0290  0.0078  -0.0049 249  LEU B CD1 
4014 C CD2 . LEU B 229 ? 0.2870 0.2803 0.2624 0.0215  0.0251  -0.0014 249  LEU B CD2 
4015 N N   . LYS B 230 ? 0.3004 0.2444 0.2650 0.0395  0.0327  0.0003  250  LYS B N   
4016 C CA  . LYS B 230 ? 0.2786 0.2575 0.2734 0.0294  0.0350  0.0051  250  LYS B CA  
4017 C C   . LYS B 230 ? 0.2762 0.2406 0.2346 0.0243  0.0292  0.0100  250  LYS B C   
4018 O O   . LYS B 230 ? 0.2635 0.2214 0.2358 0.0258  0.0389  -0.0063 250  LYS B O   
4019 C CB  . LYS B 230 ? 0.2822 0.2815 0.2802 0.0219  0.0232  0.0126  250  LYS B CB  
4020 C CG  . LYS B 230 ? 0.2949 0.3225 0.3174 0.0073  0.0436  0.0206  250  LYS B CG  
4021 C CD  . LYS B 230 ? 0.2920 0.3337 0.3212 0.0107  0.0352  0.0193  250  LYS B CD  
4022 C CE  . LYS B 230 ? 0.2948 0.3451 0.3004 0.0000  0.0458  0.0142  250  LYS B CE  
4023 N NZ  . LYS B 230 ? 0.3398 0.3361 0.3347 0.0076  0.0374  0.0211  250  LYS B NZ  
4024 N N   . THR B 231 ? 0.2740 0.1969 0.2213 0.0340  0.0228  -0.0098 251  THR B N   
4025 C CA  . THR B 231 ? 0.2605 0.2189 0.2149 0.0182  0.0100  0.0056  251  THR B CA  
4026 C C   . THR B 231 ? 0.2479 0.1946 0.2058 0.0221  0.0218  -0.0107 251  THR B C   
4027 O O   . THR B 231 ? 0.2737 0.2126 0.1913 0.0382  0.0236  -0.0044 251  THR B O   
4028 C CB  . THR B 231 ? 0.2619 0.2378 0.2355 0.0134  0.0037  -0.0026 251  THR B CB  
4029 O OG1 . THR B 231 ? 0.3032 0.2647 0.2390 0.0045  -0.0103 0.0051  251  THR B OG1 
4030 C CG2 . THR B 231 ? 0.2548 0.2547 0.2357 0.0081  -0.0040 -0.0083 251  THR B CG2 
4031 N N   . TYR B 232 ? 0.2128 0.1693 0.1678 0.0130  0.0043  0.0077  252  TYR B N   
4032 C CA  . TYR B 232 ? 0.1976 0.1593 0.1685 0.0056  0.0034  0.0110  252  TYR B CA  
4033 C C   . TYR B 232 ? 0.1913 0.1536 0.1663 0.0062  -0.0035 0.0098  252  TYR B C   
4034 O O   . TYR B 232 ? 0.1920 0.1581 0.1706 0.0143  0.0106  0.0103  252  TYR B O   
4035 C CB  . TYR B 232 ? 0.1908 0.1600 0.1671 0.0104  0.0065  0.0037  252  TYR B CB  
4036 C CG  . TYR B 232 ? 0.1849 0.1640 0.1750 0.0155  0.0064  0.0029  252  TYR B CG  
4037 C CD1 . TYR B 232 ? 0.1871 0.1669 0.1754 0.0147  0.0021  0.0009  252  TYR B CD1 
4038 C CD2 . TYR B 232 ? 0.1919 0.1731 0.1822 0.0167  0.0073  0.0092  252  TYR B CD2 
4039 C CE1 . TYR B 232 ? 0.1878 0.1595 0.1860 0.0234  0.0086  0.0052  252  TYR B CE1 
4040 C CE2 . TYR B 232 ? 0.1900 0.1662 0.1952 0.0136  0.0073  0.0097  252  TYR B CE2 
4041 C CZ  . TYR B 232 ? 0.1933 0.1781 0.1879 0.0172  0.0070  0.0143  252  TYR B CZ  
4042 O OH  . TYR B 232 ? 0.2039 0.1591 0.2042 0.0145  0.0152  0.0247  252  TYR B OH  
4043 N N   . THR B 233 ? 0.1872 0.1491 0.1596 0.0112  -0.0088 0.0074  253  THR B N   
4044 C CA  . THR B 233 ? 0.1943 0.1500 0.1691 0.0029  -0.0031 -0.0010 253  THR B CA  
4045 C C   . THR B 233 ? 0.1920 0.1246 0.1719 0.0061  -0.0067 -0.0015 253  THR B C   
4046 O O   . THR B 233 ? 0.1969 0.1298 0.1747 0.0004  -0.0109 -0.0222 253  THR B O   
4047 C CB  . THR B 233 ? 0.1993 0.1710 0.1696 -0.0034 -0.0137 -0.0049 253  THR B CB  
4048 O OG1 . THR B 233 ? 0.2417 0.1719 0.2052 0.0119  -0.0078 -0.0099 253  THR B OG1 
4049 C CG2 . THR B 233 ? 0.2079 0.1739 0.1716 -0.0025 -0.0200 -0.0051 253  THR B CG2 
4050 N N   . GLY B 234 ? 0.1997 0.1432 0.1601 0.0025  -0.0048 0.0032  254  GLY B N   
4051 C CA  . GLY B 234 ? 0.2026 0.1529 0.1621 -0.0019 0.0026  0.0061  254  GLY B CA  
4052 C C   . GLY B 234 ? 0.2067 0.1568 0.1614 -0.0014 -0.0030 -0.0020 254  GLY B C   
4053 O O   . GLY B 234 ? 0.2306 0.1857 0.1736 -0.0074 0.0090  0.0040  254  GLY B O   
4054 N N   . HIS B 235 ? 0.2030 0.1584 0.1458 0.0105  -0.0018 0.0015  255  HIS B N   
4055 C CA  . HIS B 235 ? 0.1816 0.1501 0.1401 0.0000  -0.0037 0.0037  255  HIS B CA  
4056 C C   . HIS B 235 ? 0.1792 0.1384 0.1348 0.0029  -0.0010 0.0065  255  HIS B C   
4057 O O   . HIS B 235 ? 0.2018 0.1341 0.1288 0.0013  0.0045  0.0093  255  HIS B O   
4058 C CB  . HIS B 235 ? 0.1916 0.1412 0.1400 0.0051  -0.0025 0.0014  255  HIS B CB  
4059 C CG  . HIS B 235 ? 0.2042 0.1549 0.1396 0.0100  0.0131  0.0043  255  HIS B CG  
4060 N ND1 . HIS B 235 ? 0.2122 0.1421 0.1490 0.0083  0.0132  0.0000  255  HIS B ND1 
4061 C CD2 . HIS B 235 ? 0.2190 0.1486 0.1535 0.0077  0.0091  0.0019  255  HIS B CD2 
4062 C CE1 . HIS B 235 ? 0.2108 0.1551 0.1504 0.0112  0.0155  0.0066  255  HIS B CE1 
4063 N NE2 . HIS B 235 ? 0.2096 0.1591 0.1565 0.0148  0.0233  0.0094  255  HIS B NE2 
4064 N N   . LYS B 236 ? 0.1750 0.1291 0.1345 0.0013  -0.0080 0.0104  256  LYS B N   
4065 C CA  . LYS B 236 ? 0.1717 0.1424 0.1477 -0.0050 -0.0096 0.0035  256  LYS B CA  
4066 C C   . LYS B 236 ? 0.1527 0.1451 0.1381 -0.0035 -0.0047 0.0041  256  LYS B C   
4067 O O   . LYS B 236 ? 0.1509 0.1449 0.1240 0.0007  -0.0077 0.0064  256  LYS B O   
4068 C CB  . LYS B 236 ? 0.1929 0.1561 0.1697 -0.0013 0.0116  0.0068  256  LYS B CB  
4069 C CG  . LYS B 236 ? 0.2007 0.1783 0.2084 -0.0062 -0.0069 0.0066  256  LYS B CG  
4070 C CD  . LYS B 236 ? 0.2260 0.2297 0.2341 -0.0110 0.0189  0.0141  256  LYS B CD  
4071 C CE  . LYS B 236 ? 0.2355 0.2587 0.2957 0.0017  -0.0091 0.0112  256  LYS B CE  
4072 N NZ  . LYS B 236 ? 0.2749 0.2699 0.3370 -0.0049 -0.0201 0.0087  256  LYS B NZ  
4073 N N   . ASN B 237 ? 0.1419 0.1363 0.1394 -0.0016 -0.0063 -0.0034 257  ASN B N   
4074 C CA  . ASN B 237 ? 0.1562 0.1355 0.1447 0.0028  -0.0075 -0.0057 257  ASN B CA  
4075 C C   . ASN B 237 ? 0.1602 0.1262 0.1421 -0.0055 -0.0073 -0.0029 257  ASN B C   
4076 O O   . ASN B 237 ? 0.1661 0.1144 0.1438 -0.0076 -0.0024 -0.0008 257  ASN B O   
4077 C CB  . ASN B 237 ? 0.1630 0.1382 0.1353 0.0006  -0.0039 -0.0062 257  ASN B CB  
4078 C CG  . ASN B 237 ? 0.1670 0.1371 0.1447 0.0066  -0.0091 -0.0095 257  ASN B CG  
4079 O OD1 . ASN B 237 ? 0.1706 0.1336 0.1412 0.0117  -0.0174 -0.0040 257  ASN B OD1 
4080 N ND2 . ASN B 237 ? 0.1711 0.1176 0.1445 0.0099  -0.0092 -0.0105 257  ASN B ND2 
4081 N N   . GLU B 238 ? 0.1605 0.1355 0.1573 -0.0033 -0.0076 0.0008  258  GLU B N   
4082 C CA  . GLU B 238 ? 0.1714 0.1504 0.1589 -0.0004 -0.0144 0.0027  258  GLU B CA  
4083 C C   . GLU B 238 ? 0.1655 0.1426 0.1539 -0.0078 -0.0052 -0.0039 258  GLU B C   
4084 O O   . GLU B 238 ? 0.1932 0.1587 0.1576 -0.0133 -0.0235 -0.0093 258  GLU B O   
4085 C CB  . GLU B 238 ? 0.1846 0.1745 0.1856 -0.0162 -0.0028 0.0087  258  GLU B CB  
4086 C CG  . GLU B 238 ? 0.2096 0.1759 0.2103 -0.0116 0.0090  0.0063  258  GLU B CG  
4087 C CD  . GLU B 238 ? 0.2114 0.1931 0.2358 -0.0226 0.0107  0.0135  258  GLU B CD  
4088 O OE1 . GLU B 238 ? 0.2309 0.2224 0.2653 -0.0255 0.0343  0.0193  258  GLU B OE1 
4089 O OE2 . GLU B 238 ? 0.2437 0.1952 0.2643 -0.0217 0.0109  0.0064  258  GLU B OE2 
4090 N N   . LYS B 239 ? 0.1638 0.1510 0.1498 -0.0125 -0.0139 -0.0032 259  LYS B N   
4091 C CA  . LYS B 239 ? 0.1591 0.1427 0.1627 -0.0200 -0.0112 -0.0043 259  LYS B CA  
4092 C C   . LYS B 239 ? 0.1403 0.1393 0.1385 -0.0133 -0.0119 -0.0015 259  LYS B C   
4093 O O   . LYS B 239 ? 0.1423 0.1444 0.1483 -0.0150 -0.0209 0.0024  259  LYS B O   
4094 C CB  . LYS B 239 ? 0.1714 0.1673 0.1616 -0.0109 -0.0056 -0.0066 259  LYS B CB  
4095 C CG  . LYS B 239 ? 0.1906 0.1776 0.1972 -0.0227 0.0077  -0.0049 259  LYS B CG  
4096 C CD  . LYS B 239 ? 0.2044 0.2144 0.2177 -0.0011 -0.0074 0.0080  259  LYS B CD  
4097 C CE  . LYS B 239 ? 0.2346 0.2264 0.2538 -0.0174 -0.0019 0.0055  259  LYS B CE  
4098 N NZ  . LYS B 239 ? 0.2468 0.3031 0.2963 -0.0187 -0.0270 0.0044  259  LYS B NZ  
4099 N N   . TYR B 240 ? 0.1392 0.1173 0.1138 -0.0051 -0.0114 -0.0012 260  TYR B N   
4100 C CA  . TYR B 240 ? 0.1243 0.1183 0.1060 -0.0013 -0.0075 -0.0043 260  TYR B CA  
4101 C C   . TYR B 240 ? 0.1196 0.1075 0.0937 -0.0006 -0.0137 -0.0071 260  TYR B C   
4102 O O   . TYR B 240 ? 0.1435 0.1033 0.0986 0.0008  -0.0122 -0.0150 260  TYR B O   
4103 C CB  . TYR B 240 ? 0.1297 0.1172 0.1063 -0.0014 -0.0097 -0.0029 260  TYR B CB  
4104 C CG  . TYR B 240 ? 0.1341 0.1212 0.1069 -0.0051 -0.0064 -0.0030 260  TYR B CG  
4105 C CD1 . TYR B 240 ? 0.1350 0.1219 0.1092 -0.0063 -0.0067 -0.0080 260  TYR B CD1 
4106 C CD2 . TYR B 240 ? 0.1349 0.1239 0.1102 -0.0081 -0.0001 -0.0010 260  TYR B CD2 
4107 C CE1 . TYR B 240 ? 0.1373 0.1395 0.1046 -0.0105 -0.0068 -0.0123 260  TYR B CE1 
4108 C CE2 . TYR B 240 ? 0.1366 0.1402 0.1104 -0.0094 -0.0016 -0.0093 260  TYR B CE2 
4109 C CZ  . TYR B 240 ? 0.1355 0.1390 0.1168 -0.0105 -0.0071 -0.0119 260  TYR B CZ  
4110 O OH  . TYR B 240 ? 0.1494 0.1787 0.1131 -0.0148 0.0020  -0.0134 260  TYR B OH  
4111 N N   . CYS B 241 ? 0.1091 0.1045 0.0854 0.0023  -0.0072 -0.0125 261  CYS B N   
4112 C CA  . CYS B 241 ? 0.1132 0.0970 0.0879 -0.0002 -0.0069 -0.0068 261  CYS B CA  
4113 C C   . CYS B 241 ? 0.1137 0.0934 0.0841 -0.0070 -0.0040 -0.0088 261  CYS B C   
4114 O O   . CYS B 241 ? 0.1271 0.0901 0.0905 -0.0091 -0.0109 -0.0059 261  CYS B O   
4115 C CB  . CYS B 241 ? 0.1218 0.1043 0.0894 -0.0028 -0.0071 0.0006  261  CYS B CB  
4116 S SG  . CYS B 241 ? 0.1472 0.1358 0.0929 0.0018  -0.0211 -0.0011 261  CYS B SG  
4117 N N   . ILE B 242 ? 0.1100 0.0988 0.0848 -0.0058 -0.0050 -0.0042 262  ILE B N   
4118 C CA  . ILE B 242 ? 0.1047 0.0938 0.0875 -0.0053 -0.0038 -0.0057 262  ILE B CA  
4119 C C   . ILE B 242 ? 0.1094 0.1030 0.0942 -0.0035 0.0031  -0.0031 262  ILE B C   
4120 O O   . ILE B 242 ? 0.1196 0.1027 0.0996 -0.0028 0.0056  -0.0066 262  ILE B O   
4121 C CB  . ILE B 242 ? 0.1023 0.0927 0.0851 -0.0077 -0.0012 -0.0067 262  ILE B CB  
4122 C CG1 . ILE B 242 ? 0.1021 0.0950 0.0941 -0.0070 0.0006  -0.0045 262  ILE B CG1 
4123 C CG2 . ILE B 242 ? 0.1038 0.0998 0.0863 -0.0096 -0.0017 -0.0024 262  ILE B CG2 
4124 C CD1 . ILE B 242 ? 0.1039 0.0984 0.0953 -0.0087 -0.0016 0.0000  262  ILE B CD1 
4125 N N   . PHE B 243 ? 0.1067 0.1062 0.0934 -0.0037 -0.0024 0.0044  263  PHE B N   
4126 C CA  . PHE B 243 ? 0.1089 0.1149 0.0967 -0.0019 0.0036  0.0033  263  PHE B CA  
4127 C C   . PHE B 243 ? 0.1141 0.1198 0.1019 0.0021  0.0060  0.0135  263  PHE B C   
4128 O O   . PHE B 243 ? 0.1227 0.1332 0.1103 0.0061  0.0170  0.0223  263  PHE B O   
4129 C CB  . PHE B 243 ? 0.1093 0.1096 0.1040 0.0022  0.0023  0.0017  263  PHE B CB  
4130 C CG  . PHE B 243 ? 0.1048 0.1036 0.0917 -0.0029 0.0024  -0.0017 263  PHE B CG  
4131 C CD1 . PHE B 243 ? 0.1005 0.1056 0.0922 0.0002  -0.0008 0.0003  263  PHE B CD1 
4132 C CD2 . PHE B 243 ? 0.1012 0.1041 0.0854 0.0012  0.0000  -0.0022 263  PHE B CD2 
4133 C CE1 . PHE B 243 ? 0.1084 0.0987 0.0873 -0.0010 0.0020  -0.0054 263  PHE B CE1 
4134 C CE2 . PHE B 243 ? 0.1010 0.0994 0.0830 -0.0015 0.0025  -0.0013 263  PHE B CE2 
4135 C CZ  . PHE B 243 ? 0.0993 0.0978 0.0938 0.0043  -0.0015 -0.0016 263  PHE B CZ  
4136 N N   . ALA B 244 ? 0.1217 0.1309 0.1029 0.0060  0.0066  0.0077  264  ALA B N   
4137 C CA  . ALA B 244 ? 0.1354 0.1305 0.1215 0.0120  0.0013  0.0092  264  ALA B CA  
4138 C C   . ALA B 244 ? 0.1317 0.1342 0.1173 0.0129  0.0002  0.0089  264  ALA B C   
4139 O O   . ALA B 244 ? 0.1408 0.1341 0.1176 0.0139  0.0068  0.0079  264  ALA B O   
4140 C CB  . ALA B 244 ? 0.1460 0.1325 0.1295 0.0025  -0.0069 0.0078  264  ALA B CB  
4141 N N   . ASN B 245 ? 0.1402 0.1282 0.1231 0.0199  0.0007  0.0088  265  ASN B N   
4142 C CA  . ASN B 245 ? 0.1462 0.1319 0.1367 0.0147  -0.0025 0.0080  265  ASN B CA  
4143 C C   . ASN B 245 ? 0.1536 0.1244 0.1393 0.0124  0.0036  0.0013  265  ASN B C   
4144 O O   . ASN B 245 ? 0.1761 0.1250 0.1386 0.0190  0.0073  0.0078  265  ASN B O   
4145 C CB  . ASN B 245 ? 0.1580 0.1513 0.1454 0.0100  -0.0107 -0.0009 265  ASN B CB  
4146 C CG  . ASN B 245 ? 0.1562 0.1596 0.1559 0.0093  -0.0116 -0.0054 265  ASN B CG  
4147 O OD1 . ASN B 245 ? 0.1731 0.1612 0.1849 0.0167  -0.0257 0.0020  265  ASN B OD1 
4148 N ND2 . ASN B 245 ? 0.1622 0.1791 0.1748 0.0071  0.0044  -0.0029 265  ASN B ND2 
4149 N N   . PHE B 246 ? 0.1506 0.1269 0.1381 0.0177  0.0062  0.0039  266  PHE B N   
4150 C CA  . PHE B 246 ? 0.1457 0.1291 0.1373 0.0134  0.0040  0.0012  266  PHE B CA  
4151 C C   . PHE B 246 ? 0.1503 0.1416 0.1377 0.0194  -0.0034 0.0033  266  PHE B C   
4152 O O   . PHE B 246 ? 0.1629 0.1425 0.1557 0.0287  -0.0173 -0.0008 266  PHE B O   
4153 C CB  . PHE B 246 ? 0.1441 0.1326 0.1388 0.0148  0.0049  0.0024  266  PHE B CB  
4154 C CG  . PHE B 246 ? 0.1589 0.1422 0.1414 0.0153  -0.0002 -0.0025 266  PHE B CG  
4155 C CD1 . PHE B 246 ? 0.1512 0.1419 0.1453 0.0133  0.0015  -0.0076 266  PHE B CD1 
4156 C CD2 . PHE B 246 ? 0.1654 0.1427 0.1423 0.0124  -0.0004 -0.0060 266  PHE B CD2 
4157 C CE1 . PHE B 246 ? 0.1652 0.1356 0.1483 0.0122  -0.0037 -0.0092 266  PHE B CE1 
4158 C CE2 . PHE B 246 ? 0.1754 0.1491 0.1520 0.0100  -0.0107 -0.0080 266  PHE B CE2 
4159 C CZ  . PHE B 246 ? 0.1668 0.1419 0.1551 0.0109  -0.0081 -0.0182 266  PHE B CZ  
4160 N N   . SER B 247 ? 0.1639 0.1479 0.1440 0.0230  0.0029  0.0059  267  SER B N   
4161 C CA  . SER B 247 ? 0.1573 0.1576 0.1554 0.0160  -0.0016 0.0034  267  SER B CA  
4162 C C   . SER B 247 ? 0.1613 0.1729 0.1674 0.0226  -0.0004 -0.0027 267  SER B C   
4163 O O   . SER B 247 ? 0.1671 0.1725 0.1688 0.0164  -0.0123 -0.0146 267  SER B O   
4164 C CB  . SER B 247 ? 0.1493 0.1598 0.1556 0.0216  -0.0045 0.0051  267  SER B CB  
4165 O OG  . SER B 247 ? 0.1379 0.1764 0.1768 0.0279  -0.0195 0.0033  267  SER B OG  
4166 N N   . VAL B 248 ? 0.1737 0.1841 0.1852 0.0135  0.0120  -0.0040 268  VAL B N   
4167 C CA  . VAL B 248 ? 0.1781 0.2012 0.1980 0.0235  0.0154  -0.0092 268  VAL B CA  
4168 C C   . VAL B 248 ? 0.1828 0.2255 0.2061 0.0132  0.0090  -0.0002 268  VAL B C   
4169 O O   . VAL B 248 ? 0.1780 0.2456 0.2391 0.0198  0.0081  0.0124  268  VAL B O   
4170 C CB  . VAL B 248 ? 0.1912 0.2123 0.2021 0.0192  0.0146  -0.0039 268  VAL B CB  
4171 C CG1 . VAL B 248 ? 0.2073 0.2178 0.2044 0.0149  0.0107  -0.0102 268  VAL B CG1 
4172 C CG2 . VAL B 248 ? 0.2025 0.2110 0.1946 0.0186  0.0133  -0.0053 268  VAL B CG2 
4173 N N   . THR B 249 ? 0.1761 0.2101 0.2079 0.0162  0.0027  -0.0052 269  THR B N   
4174 C CA  . THR B 249 ? 0.1897 0.2224 0.2181 0.0089  -0.0037 -0.0064 269  THR B CA  
4175 C C   . THR B 249 ? 0.1964 0.2250 0.2340 0.0127  -0.0088 -0.0069 269  THR B C   
4176 O O   . THR B 249 ? 0.2009 0.2570 0.2685 0.0224  -0.0295 -0.0180 269  THR B O   
4177 C CB  . THR B 249 ? 0.1948 0.2140 0.2205 0.0096  -0.0058 -0.0059 269  THR B CB  
4178 O OG1 . THR B 249 ? 0.1786 0.2066 0.2292 0.0220  -0.0011 -0.0023 269  THR B OG1 
4179 C CG2 . THR B 249 ? 0.1849 0.2030 0.2292 0.0071  -0.0054 -0.0130 269  THR B CG2 
4180 N N   . GLY B 250 ? 0.1937 0.2287 0.2235 0.0135  -0.0024 0.0016  270  GLY B N   
4181 C CA  . GLY B 250 ? 0.1967 0.2321 0.2230 0.0235  -0.0029 -0.0104 270  GLY B CA  
4182 C C   . GLY B 250 ? 0.1850 0.2277 0.2251 0.0232  -0.0009 -0.0089 270  GLY B C   
4183 O O   . GLY B 250 ? 0.1911 0.2625 0.2217 0.0256  0.0000  -0.0114 270  GLY B O   
4184 N N   . GLY B 251 ? 0.1795 0.2310 0.2167 0.0243  0.0071  -0.0108 271  GLY B N   
4185 C CA  . GLY B 251 ? 0.1821 0.2223 0.2205 0.0235  0.0110  -0.0078 271  GLY B CA  
4186 C C   . GLY B 251 ? 0.2048 0.2169 0.2112 0.0228  0.0025  -0.0128 271  GLY B C   
4187 O O   . GLY B 251 ? 0.2307 0.2279 0.2194 0.0410  0.0010  -0.0201 271  GLY B O   
4188 N N   . LYS B 252 ? 0.1989 0.2199 0.2030 0.0261  0.0156  -0.0129 272  LYS B N   
4189 C CA  . LYS B 252 ? 0.2032 0.2073 0.2076 0.0199  0.0121  -0.0098 272  LYS B CA  
4190 C C   . LYS B 252 ? 0.1944 0.1932 0.1923 0.0283  0.0122  -0.0194 272  LYS B C   
4191 O O   . LYS B 252 ? 0.1998 0.1892 0.2062 0.0392  0.0103  -0.0167 272  LYS B O   
4192 C CB  . LYS B 252 ? 0.2206 0.2173 0.2125 0.0215  0.0213  -0.0125 272  LYS B CB  
4193 C CG  . LYS B 252 ? 0.2499 0.2333 0.2617 0.0085  0.0142  0.0055  272  LYS B CG  
4194 C CD  . LYS B 252 ? 0.2641 0.2774 0.2728 -0.0033 -0.0012 0.0118  272  LYS B CD  
4195 C CE  . LYS B 252 ? 0.2834 0.2884 0.3067 -0.0124 -0.0080 0.0264  272  LYS B CE  
4196 N NZ  . LYS B 252 ? 0.2912 0.3737 0.3235 -0.0188 -0.0253 0.0283  272  LYS B NZ  
4197 N N   . TRP B 253 ? 0.1698 0.1777 0.1781 0.0167  0.0074  -0.0009 273  TRP B N   
4198 C CA  . TRP B 253 ? 0.1718 0.1625 0.1689 0.0120  0.0015  -0.0060 273  TRP B CA  
4199 C C   . TRP B 253 ? 0.1579 0.1505 0.1617 0.0087  0.0147  -0.0035 273  TRP B C   
4200 O O   . TRP B 253 ? 0.1712 0.1509 0.1674 0.0128  0.0159  0.0000  273  TRP B O   
4201 C CB  . TRP B 253 ? 0.1708 0.1666 0.1684 0.0099  0.0011  -0.0018 273  TRP B CB  
4202 C CG  . TRP B 253 ? 0.1751 0.1726 0.1712 0.0091  -0.0034 0.0020  273  TRP B CG  
4203 C CD1 . TRP B 253 ? 0.1786 0.1771 0.1726 0.0097  -0.0048 0.0009  273  TRP B CD1 
4204 C CD2 . TRP B 253 ? 0.1748 0.1791 0.1781 0.0136  -0.0033 0.0060  273  TRP B CD2 
4205 N NE1 . TRP B 253 ? 0.1868 0.1863 0.1754 0.0130  -0.0147 -0.0005 273  TRP B NE1 
4206 C CE2 . TRP B 253 ? 0.1864 0.1849 0.1735 0.0113  -0.0050 0.0022  273  TRP B CE2 
4207 C CE3 . TRP B 253 ? 0.1831 0.1883 0.1772 0.0100  -0.0067 -0.0016 273  TRP B CE3 
4208 C CZ2 . TRP B 253 ? 0.1850 0.1848 0.1880 0.0120  -0.0059 0.0040  273  TRP B CZ2 
4209 C CZ3 . TRP B 253 ? 0.1949 0.1742 0.1806 0.0157  -0.0059 0.0031  273  TRP B CZ3 
4210 C CH2 . TRP B 253 ? 0.1870 0.1881 0.1904 0.0213  -0.0031 -0.0026 273  TRP B CH2 
4211 N N   . ILE B 254 ? 0.1517 0.1320 0.1476 0.0176  0.0133  0.0011  274  ILE B N   
4212 C CA  . ILE B 254 ? 0.1479 0.1298 0.1284 0.0093  0.0088  0.0037  274  ILE B CA  
4213 C C   . ILE B 254 ? 0.1473 0.1141 0.1283 0.0127  0.0100  0.0109  274  ILE B C   
4214 O O   . ILE B 254 ? 0.1601 0.1061 0.1128 0.0223  0.0100  0.0024  274  ILE B O   
4215 C CB  . ILE B 254 ? 0.1520 0.1389 0.1379 0.0045  0.0048  0.0013  274  ILE B CB  
4216 C CG1 . ILE B 254 ? 0.1519 0.1482 0.1443 0.0090  0.0087  -0.0030 274  ILE B CG1 
4217 C CG2 . ILE B 254 ? 0.1552 0.1348 0.1434 0.0099  0.0088  -0.0031 274  ILE B CG2 
4218 C CD1 . ILE B 254 ? 0.1721 0.1563 0.1474 0.0073  0.0033  0.0055  274  ILE B CD1 
4219 N N   . VAL B 255 ? 0.1456 0.1210 0.1190 0.0159  0.0135  0.0066  275  VAL B N   
4220 C CA  . VAL B 255 ? 0.1338 0.1236 0.1148 0.0131  0.0074  0.0059  275  VAL B CA  
4221 C C   . VAL B 255 ? 0.1316 0.1259 0.1180 0.0117  0.0073  -0.0003 275  VAL B C   
4222 O O   . VAL B 255 ? 0.1443 0.1312 0.1282 0.0202  -0.0067 0.0061  275  VAL B O   
4223 C CB  . VAL B 255 ? 0.1235 0.1269 0.1200 0.0085  0.0046  0.0087  275  VAL B CB  
4224 C CG1 . VAL B 255 ? 0.1275 0.1281 0.1242 0.0171  0.0053  0.0082  275  VAL B CG1 
4225 C CG2 . VAL B 255 ? 0.1268 0.1280 0.1232 0.0154  0.0049  0.0033  275  VAL B CG2 
4226 N N   . SER B 256 ? 0.1289 0.1216 0.1161 0.0107  0.0039  -0.0014 276  SER B N   
4227 C CA  . SER B 256 ? 0.1268 0.1260 0.1211 0.0085  0.0058  0.0007  276  SER B CA  
4228 C C   . SER B 256 ? 0.1237 0.1256 0.1225 0.0105  0.0061  0.0045  276  SER B C   
4229 O O   . SER B 256 ? 0.1318 0.1393 0.1360 0.0199  0.0109  0.0153  276  SER B O   
4230 C CB  . SER B 256 ? 0.1374 0.1377 0.1153 0.0078  0.0097  -0.0039 276  SER B CB  
4231 O OG  . SER B 256 ? 0.1343 0.1491 0.1344 0.0080  0.0159  -0.0124 276  SER B OG  
4232 N N   . GLY B 257 ? 0.1273 0.1152 0.1219 0.0073  0.0011  0.0074  277  GLY B N   
4233 C CA  . GLY B 257 ? 0.1280 0.1087 0.1210 0.0053  0.0029  -0.0053 277  GLY B CA  
4234 C C   . GLY B 257 ? 0.1298 0.1102 0.1143 0.0013  0.0034  -0.0025 277  GLY B C   
4235 O O   . GLY B 257 ? 0.1352 0.1106 0.1119 -0.0016 0.0071  0.0015  277  GLY B O   
4236 N N   . SER B 258 ? 0.1259 0.1084 0.1170 -0.0007 0.0012  -0.0053 278  SER B N   
4237 C CA  . SER B 258 ? 0.1268 0.1081 0.1099 -0.0017 0.0029  -0.0046 278  SER B CA  
4238 C C   . SER B 258 ? 0.1271 0.1024 0.1028 -0.0027 0.0015  -0.0069 278  SER B C   
4239 O O   . SER B 258 ? 0.1245 0.0954 0.1046 0.0061  0.0098  -0.0063 278  SER B O   
4240 C CB  . SER B 258 ? 0.1247 0.1122 0.1104 -0.0006 0.0022  -0.0009 278  SER B CB  
4241 O OG  . SER B 258 ? 0.1391 0.1073 0.1164 -0.0019 0.0045  -0.0051 278  SER B OG  
4242 N N   . GLU B 259 ? 0.1208 0.1047 0.1094 -0.0015 0.0004  -0.0005 279  GLU B N   
4243 C CA  . GLU B 259 ? 0.1201 0.1090 0.1177 -0.0084 0.0010  0.0000  279  GLU B CA  
4244 C C   . GLU B 259 ? 0.1250 0.1157 0.1102 -0.0046 -0.0022 -0.0007 279  GLU B C   
4245 O O   . GLU B 259 ? 0.1362 0.1327 0.1072 -0.0055 0.0066  0.0052  279  GLU B O   
4246 C CB  . GLU B 259 ? 0.1405 0.1171 0.1177 -0.0125 -0.0072 0.0002  279  GLU B CB  
4247 C CG  . GLU B 259 ? 0.1484 0.1215 0.1228 -0.0063 -0.0145 0.0037  279  GLU B CG  
4248 C CD  . GLU B 259 ? 0.1566 0.1234 0.1246 -0.0083 -0.0161 0.0021  279  GLU B CD  
4249 O OE1 . GLU B 259 ? 0.1534 0.1282 0.1175 -0.0094 -0.0252 -0.0019 279  GLU B OE1 
4250 O OE2 . GLU B 259 ? 0.1704 0.1169 0.1260 0.0000  -0.0279 0.0039  279  GLU B OE2 
4251 N N   . ASP B 260 ? 0.1351 0.1142 0.1170 0.0026  0.0012  -0.0002 280  ASP B N   
4252 C CA  . ASP B 260 ? 0.1371 0.1202 0.1159 -0.0004 -0.0018 0.0006  280  ASP B CA  
4253 C C   . ASP B 260 ? 0.1376 0.1130 0.1192 -0.0003 -0.0016 -0.0002 280  ASP B C   
4254 O O   . ASP B 260 ? 0.1529 0.1327 0.1232 0.0059  -0.0054 0.0050  280  ASP B O   
4255 C CB  . ASP B 260 ? 0.1423 0.1228 0.1250 0.0001  -0.0007 -0.0083 280  ASP B CB  
4256 C CG  . ASP B 260 ? 0.1442 0.1266 0.1312 0.0000  0.0013  -0.0081 280  ASP B CG  
4257 O OD1 . ASP B 260 ? 0.1555 0.1350 0.1309 -0.0103 -0.0016 -0.0082 280  ASP B OD1 
4258 O OD2 . ASP B 260 ? 0.1755 0.1380 0.1626 0.0157  0.0125  -0.0125 280  ASP B OD2 
4259 N N   . ASN B 261 ? 0.1295 0.1131 0.1085 -0.0057 -0.0041 -0.0037 281  ASN B N   
4260 C CA  . ASN B 261 ? 0.1202 0.1062 0.1082 -0.0018 -0.0050 0.0001  281  ASN B CA  
4261 C C   . ASN B 261 ? 0.1191 0.0956 0.1017 0.0006  -0.0035 -0.0030 281  ASN B C   
4262 O O   . ASN B 261 ? 0.1228 0.1105 0.0938 0.0059  -0.0114 0.0051  281  ASN B O   
4263 C CB  . ASN B 261 ? 0.1237 0.1170 0.1138 -0.0045 0.0004  0.0013  281  ASN B CB  
4264 C CG  . ASN B 261 ? 0.1239 0.1216 0.1177 -0.0066 0.0017  -0.0039 281  ASN B CG  
4265 O OD1 . ASN B 261 ? 0.1365 0.1196 0.1264 0.0008  0.0029  0.0051  281  ASN B OD1 
4266 N ND2 . ASN B 261 ? 0.1408 0.1492 0.1260 -0.0141 0.0072  0.0063  281  ASN B ND2 
4267 N N   . LEU B 262 ? 0.1147 0.1037 0.1038 0.0029  -0.0037 -0.0022 282  LEU B N   
4268 C CA  . LEU B 262 ? 0.1141 0.1011 0.0979 0.0018  -0.0042 -0.0024 282  LEU B CA  
4269 C C   . LEU B 262 ? 0.1133 0.0984 0.1025 0.0059  -0.0010 -0.0005 282  LEU B C   
4270 O O   . LEU B 262 ? 0.1250 0.1077 0.1001 0.0001  -0.0021 0.0011  282  LEU B O   
4271 C CB  . LEU B 262 ? 0.1190 0.1018 0.0996 0.0043  -0.0034 -0.0006 282  LEU B CB  
4272 C CG  . LEU B 262 ? 0.1212 0.1002 0.1078 -0.0016 -0.0042 -0.0008 282  LEU B CG  
4273 C CD1 . LEU B 262 ? 0.1288 0.1007 0.1119 -0.0016 -0.0016 -0.0026 282  LEU B CD1 
4274 C CD2 . LEU B 262 ? 0.1315 0.1071 0.1062 -0.0001 -0.0045 0.0007  282  LEU B CD2 
4275 N N   . VAL B 263 ? 0.1127 0.1057 0.1033 0.0069  0.0002  -0.0010 283  VAL B N   
4276 C CA  . VAL B 263 ? 0.1154 0.1099 0.1060 0.0051  -0.0010 0.0052  283  VAL B CA  
4277 C C   . VAL B 263 ? 0.1317 0.1147 0.1093 0.0109  -0.0036 0.0008  283  VAL B C   
4278 O O   . VAL B 263 ? 0.1404 0.1220 0.1095 0.0271  -0.0051 -0.0034 283  VAL B O   
4279 C CB  . VAL B 263 ? 0.1118 0.1097 0.1075 0.0049  -0.0014 0.0087  283  VAL B CB  
4280 C CG1 . VAL B 263 ? 0.1085 0.1121 0.1084 0.0074  0.0018  0.0045  283  VAL B CG1 
4281 C CG2 . VAL B 263 ? 0.1044 0.1074 0.1102 0.0002  -0.0094 0.0009  283  VAL B CG2 
4282 N N   . TYR B 264 ? 0.1234 0.1110 0.1071 0.0165  -0.0010 0.0038  284  TYR B N   
4283 C CA  . TYR B 264 ? 0.1365 0.1095 0.1132 0.0153  -0.0026 0.0032  284  TYR B CA  
4284 C C   . TYR B 264 ? 0.1355 0.1113 0.1159 0.0126  -0.0059 0.0043  284  TYR B C   
4285 O O   . TYR B 264 ? 0.1562 0.1183 0.1037 0.0130  -0.0093 0.0086  284  TYR B O   
4286 C CB  . TYR B 264 ? 0.1317 0.1157 0.1137 0.0119  0.0016  -0.0015 284  TYR B CB  
4287 C CG  . TYR B 264 ? 0.1321 0.1179 0.1206 0.0083  -0.0054 0.0031  284  TYR B CG  
4288 C CD1 . TYR B 264 ? 0.1349 0.1196 0.1130 0.0101  -0.0073 0.0022  284  TYR B CD1 
4289 C CD2 . TYR B 264 ? 0.1424 0.1204 0.1238 0.0098  -0.0018 -0.0047 284  TYR B CD2 
4290 C CE1 . TYR B 264 ? 0.1417 0.1255 0.1205 0.0050  -0.0041 0.0022  284  TYR B CE1 
4291 C CE2 . TYR B 264 ? 0.1413 0.1261 0.1383 0.0073  -0.0017 -0.0025 284  TYR B CE2 
4292 C CZ  . TYR B 264 ? 0.1433 0.1269 0.1313 0.0086  -0.0022 0.0019  284  TYR B CZ  
4293 O OH  . TYR B 264 ? 0.1530 0.1366 0.1630 -0.0018 0.0022  0.0026  284  TYR B OH  
4294 N N   . ILE B 265 ? 0.1446 0.1199 0.1206 0.0196  -0.0081 0.0109  285  ILE B N   
4295 C CA  . ILE B 265 ? 0.1425 0.1232 0.1287 0.0200  -0.0080 0.0032  285  ILE B CA  
4296 C C   . ILE B 265 ? 0.1546 0.1243 0.1322 0.0225  -0.0057 0.0019  285  ILE B C   
4297 O O   . ILE B 265 ? 0.1748 0.1306 0.1362 0.0232  -0.0099 0.0083  285  ILE B O   
4298 C CB  . ILE B 265 ? 0.1430 0.1316 0.1344 0.0131  -0.0068 -0.0021 285  ILE B CB  
4299 C CG1 . ILE B 265 ? 0.1430 0.1338 0.1400 0.0164  -0.0055 -0.0038 285  ILE B CG1 
4300 C CG2 . ILE B 265 ? 0.1433 0.1418 0.1383 0.0182  -0.0029 -0.0036 285  ILE B CG2 
4301 C CD1 . ILE B 265 ? 0.1484 0.1509 0.1345 0.0189  -0.0050 -0.0011 285  ILE B CD1 
4302 N N   . TRP B 266 ? 0.1519 0.1266 0.1312 0.0298  -0.0013 -0.0065 286  TRP B N   
4303 C CA  . TRP B 266 ? 0.1513 0.1213 0.1334 0.0214  -0.0029 -0.0083 286  TRP B CA  
4304 C C   . TRP B 266 ? 0.1555 0.1378 0.1523 0.0138  0.0006  -0.0076 286  TRP B C   
4305 O O   . TRP B 266 ? 0.1542 0.1351 0.1369 0.0168  0.0081  -0.0083 286  TRP B O   
4306 C CB  . TRP B 266 ? 0.1423 0.1194 0.1325 0.0185  0.0004  -0.0137 286  TRP B CB  
4307 C CG  . TRP B 266 ? 0.1462 0.1285 0.1374 0.0093  0.0039  -0.0139 286  TRP B CG  
4308 C CD1 . TRP B 266 ? 0.1417 0.1283 0.1380 0.0071  0.0089  -0.0115 286  TRP B CD1 
4309 C CD2 . TRP B 266 ? 0.1488 0.1236 0.1390 0.0098  0.0009  -0.0167 286  TRP B CD2 
4310 N NE1 . TRP B 266 ? 0.1417 0.1189 0.1385 0.0134  0.0072  -0.0184 286  TRP B NE1 
4311 C CE2 . TRP B 266 ? 0.1474 0.1183 0.1404 0.0121  0.0071  -0.0168 286  TRP B CE2 
4312 C CE3 . TRP B 266 ? 0.1437 0.1217 0.1362 0.0023  0.0018  -0.0160 286  TRP B CE3 
4313 C CZ2 . TRP B 266 ? 0.1420 0.1229 0.1320 0.0074  0.0024  -0.0222 286  TRP B CZ2 
4314 C CZ3 . TRP B 266 ? 0.1475 0.1279 0.1248 0.0063  0.0046  -0.0152 286  TRP B CZ3 
4315 C CH2 . TRP B 266 ? 0.1422 0.1214 0.1261 0.0123  0.0003  -0.0154 286  TRP B CH2 
4316 N N   . ASN B 267 ? 0.1687 0.1406 0.1648 0.0220  0.0028  -0.0015 287  ASN B N   
4317 C CA  . ASN B 267 ? 0.1723 0.1593 0.1770 0.0263  0.0079  0.0019  287  ASN B CA  
4318 C C   . ASN B 267 ? 0.1856 0.1567 0.1756 0.0267  0.0108  0.0014  287  ASN B C   
4319 O O   . ASN B 267 ? 0.1999 0.1455 0.1785 0.0284  0.0101  0.0014  287  ASN B O   
4320 C CB  . ASN B 267 ? 0.1883 0.1631 0.1959 0.0321  0.0031  0.0093  287  ASN B CB  
4321 C CG  . ASN B 267 ? 0.1941 0.1876 0.2072 0.0266  0.0103  0.0072  287  ASN B CG  
4322 O OD1 . ASN B 267 ? 0.2222 0.1795 0.2121 0.0454  0.0148  0.0129  287  ASN B OD1 
4323 N ND2 . ASN B 267 ? 0.2038 0.2303 0.2255 0.0316  0.0002  0.0167  287  ASN B ND2 
4324 N N   . LEU B 268 ? 0.2021 0.1652 0.1809 0.0159  0.0108  0.0002  288  LEU B N   
4325 C CA  . LEU B 268 ? 0.2079 0.1623 0.1793 0.0146  0.0158  0.0006  288  LEU B CA  
4326 C C   . LEU B 268 ? 0.2038 0.1608 0.1827 0.0156  0.0167  0.0000  288  LEU B C   
4327 O O   . LEU B 268 ? 0.2130 0.1399 0.1761 0.0358  0.0120  0.0066  288  LEU B O   
4328 C CB  . LEU B 268 ? 0.1941 0.1725 0.1902 0.0092  0.0248  -0.0046 288  LEU B CB  
4329 C CG  . LEU B 268 ? 0.2144 0.1756 0.1915 0.0058  0.0225  -0.0027 288  LEU B CG  
4330 C CD1 . LEU B 268 ? 0.2121 0.1772 0.2058 0.0015  0.0317  -0.0079 288  LEU B CD1 
4331 C CD2 . LEU B 268 ? 0.2020 0.1931 0.1986 0.0084  0.0251  -0.0010 288  LEU B CD2 
4332 N N   . GLN B 269 ? 0.2054 0.1790 0.1888 0.0191  0.0116  -0.0003 289  GLN B N   
4333 C CA  . GLN B 269 ? 0.2173 0.1782 0.2014 0.0164  0.0140  -0.0095 289  GLN B CA  
4334 C C   . GLN B 269 ? 0.2115 0.1762 0.2041 0.0203  0.0140  0.0002  289  GLN B C   
4335 O O   . GLN B 269 ? 0.2268 0.1514 0.1867 0.0212  0.0398  -0.0045 289  GLN B O   
4336 C CB  . GLN B 269 ? 0.2175 0.2040 0.2331 0.0101  0.0033  -0.0106 289  GLN B CB  
4337 C CG  . GLN B 269 ? 0.2452 0.2233 0.2336 0.0123  0.0045  -0.0259 289  GLN B CG  
4338 C CD  . GLN B 269 ? 0.2438 0.2635 0.2620 0.0126  0.0073  -0.0214 289  GLN B CD  
4339 O OE1 . GLN B 269 ? 0.2476 0.2993 0.2645 0.0070  0.0106  -0.0171 289  GLN B OE1 
4340 N NE2 . GLN B 269 ? 0.2502 0.2763 0.2696 0.0173  0.0003  -0.0158 289  GLN B NE2 
4341 N N   . THR B 270 ? 0.2268 0.1888 0.1988 0.0308  0.0245  -0.0041 290  THR B N   
4342 C CA  . THR B 270 ? 0.2186 0.1939 0.2026 0.0264  0.0168  -0.0019 290  THR B CA  
4343 C C   . THR B 270 ? 0.2193 0.2027 0.1974 0.0248  0.0232  -0.0014 290  THR B C   
4344 O O   . THR B 270 ? 0.2019 0.2011 0.2017 0.0366  0.0179  -0.0065 290  THR B O   
4345 C CB  . THR B 270 ? 0.2344 0.1929 0.1932 0.0339  0.0231  -0.0056 290  THR B CB  
4346 O OG1 . THR B 270 ? 0.2699 0.1838 0.1967 0.0484  0.0213  -0.0108 290  THR B OG1 
4347 C CG2 . THR B 270 ? 0.2363 0.1851 0.2081 0.0234  0.0213  -0.0183 290  THR B CG2 
4348 N N   . LYS B 271 ? 0.2127 0.2024 0.2089 0.0211  0.0275  -0.0073 291  LYS B N   
4349 C CA  . LYS B 271 ? 0.2141 0.1936 0.2188 0.0268  0.0239  0.0016  291  LYS B CA  
4350 C C   . LYS B 271 ? 0.2246 0.1841 0.2089 0.0199  0.0234  -0.0095 291  LYS B C   
4351 O O   . LYS B 271 ? 0.2233 0.1663 0.2035 0.0357  0.0238  0.0002  291  LYS B O   
4352 C CB  . LYS B 271 ? 0.2330 0.2143 0.2307 0.0300  0.0096  -0.0023 291  LYS B CB  
4353 C CG  . LYS B 271 ? 0.2504 0.2383 0.2320 0.0311  0.0172  -0.0040 291  LYS B CG  
4354 C CD  . LYS B 271 ? 0.2504 0.2818 0.2560 0.0300  -0.0044 -0.0084 291  LYS B CD  
4355 C CE  . LYS B 271 ? 0.2961 0.2827 0.2825 0.0209  -0.0093 0.0049  291  LYS B CE  
4356 N NZ  . LYS B 271 ? 0.3082 0.3472 0.2730 -0.0199 -0.0313 -0.0244 291  LYS B NZ  
4357 N N   . GLU B 272 ? 0.2232 0.1902 0.2094 0.0262  0.0286  -0.0094 292  GLU B N   
4358 C CA  . GLU B 272 ? 0.2460 0.1998 0.2074 0.0188  0.0206  -0.0044 292  GLU B CA  
4359 C C   . GLU B 272 ? 0.2198 0.1933 0.1998 0.0209  0.0105  0.0013  292  GLU B C   
4360 O O   . GLU B 272 ? 0.2275 0.1844 0.1913 0.0225  0.0270  0.0180  292  GLU B O   
4361 C CB  . GLU B 272 ? 0.2548 0.2447 0.2535 0.0203  -0.0042 0.0042  292  GLU B CB  
4362 C CG  . GLU B 272 ? 0.2962 0.2531 0.2825 0.0271  -0.0038 -0.0177 292  GLU B CG  
4363 C CD  . GLU B 272 ? 0.3075 0.2897 0.3418 0.0184  -0.0382 -0.0051 292  GLU B CD  
4364 O OE1 . GLU B 272 ? 0.3342 0.3034 0.3512 0.0090  -0.0559 -0.0144 292  GLU B OE1 
4365 O OE2 . GLU B 272 ? 0.3635 0.2911 0.3800 0.0254  -0.0365 -0.0098 292  GLU B OE2 
4366 N N   . ILE B 273 ? 0.2262 0.1751 0.1765 0.0274  0.0128  -0.0135 293  ILE B N   
4367 C CA  . ILE B 273 ? 0.2212 0.1564 0.1723 0.0251  -0.0001 -0.0112 293  ILE B CA  
4368 C C   . ILE B 273 ? 0.2229 0.1670 0.1808 0.0225  -0.0023 0.0050  293  ILE B C   
4369 O O   . ILE B 273 ? 0.2605 0.1753 0.1779 0.0308  -0.0040 0.0159  293  ILE B O   
4370 C CB  . ILE B 273 ? 0.2160 0.1431 0.1745 0.0229  -0.0070 -0.0197 293  ILE B CB  
4371 C CG1 . ILE B 273 ? 0.2088 0.1411 0.1751 0.0214  -0.0058 -0.0282 293  ILE B CG1 
4372 C CG2 . ILE B 273 ? 0.2421 0.1602 0.1717 0.0192  -0.0078 -0.0224 293  ILE B CG2 
4373 C CD1 . ILE B 273 ? 0.2127 0.1606 0.1876 0.0131  -0.0035 -0.0307 293  ILE B CD1 
4374 N N   . VAL B 274 ? 0.2031 0.1660 0.1720 0.0288  -0.0049 0.0063  294  VAL B N   
4375 C CA  . VAL B 274 ? 0.1995 0.1632 0.1754 0.0279  -0.0062 0.0000  294  VAL B CA  
4376 C C   . VAL B 274 ? 0.1971 0.1758 0.1747 0.0308  -0.0027 0.0029  294  VAL B C   
4377 O O   . VAL B 274 ? 0.1951 0.1668 0.1714 0.0365  -0.0046 -0.0103 294  VAL B O   
4378 C CB  . VAL B 274 ? 0.1993 0.1758 0.1697 0.0278  -0.0005 -0.0013 294  VAL B CB  
4379 C CG1 . VAL B 274 ? 0.2254 0.1856 0.1854 0.0282  0.0178  -0.0007 294  VAL B CG1 
4380 C CG2 . VAL B 274 ? 0.1991 0.1771 0.1857 0.0251  -0.0081 0.0018  294  VAL B CG2 
4381 N N   . GLN B 275 ? 0.1956 0.1751 0.1798 0.0292  0.0017  0.0055  295  GLN B N   
4382 C CA  . GLN B 275 ? 0.1898 0.1732 0.1782 0.0205  0.0005  0.0044  295  GLN B CA  
4383 C C   . GLN B 275 ? 0.1903 0.1595 0.1706 0.0230  0.0058  0.0012  295  GLN B C   
4384 O O   . GLN B 275 ? 0.2038 0.1626 0.1740 0.0301  0.0069  0.0047  295  GLN B O   
4385 C CB  . GLN B 275 ? 0.2116 0.1728 0.1882 0.0141  -0.0008 0.0030  295  GLN B CB  
4386 C CG  . GLN B 275 ? 0.2155 0.2019 0.2058 0.0161  -0.0124 -0.0024 295  GLN B CG  
4387 C CD  . GLN B 275 ? 0.2334 0.1984 0.2088 0.0210  -0.0114 -0.0054 295  GLN B CD  
4388 O OE1 . GLN B 275 ? 0.2383 0.1849 0.2254 0.0291  -0.0165 -0.0032 295  GLN B OE1 
4389 N NE2 . GLN B 275 ? 0.2270 0.2144 0.2091 0.0241  -0.0133 0.0079  295  GLN B NE2 
4390 N N   . LYS B 276 ? 0.1929 0.1481 0.1659 0.0165  0.0021  0.0055  296  LYS B N   
4391 C CA  . LYS B 276 ? 0.1916 0.1607 0.1555 0.0138  0.0089  0.0024  296  LYS B CA  
4392 C C   . LYS B 276 ? 0.2013 0.1501 0.1596 0.0141  0.0076  0.0016  296  LYS B C   
4393 O O   . LYS B 276 ? 0.2247 0.1622 0.1804 0.0217  0.0021  0.0213  296  LYS B O   
4394 C CB  . LYS B 276 ? 0.1895 0.1621 0.1716 0.0136  0.0065  0.0003  296  LYS B CB  
4395 C CG  . LYS B 276 ? 0.2029 0.1852 0.1751 0.0098  -0.0026 -0.0080 296  LYS B CG  
4396 C CD  . LYS B 276 ? 0.2192 0.2028 0.2233 -0.0061 -0.0015 -0.0158 296  LYS B CD  
4397 C CE  . LYS B 276 ? 0.2436 0.2246 0.2414 0.0021  -0.0065 -0.0026 296  LYS B CE  
4398 N NZ  . LYS B 276 ? 0.2602 0.2451 0.2915 -0.0164 -0.0212 -0.0253 296  LYS B NZ  
4399 N N   . LEU B 277 ? 0.1738 0.1473 0.1409 0.0052  0.0082  0.0035  297  LEU B N   
4400 C CA  . LEU B 277 ? 0.1562 0.1443 0.1376 0.0064  -0.0016 0.0067  297  LEU B CA  
4401 C C   . LEU B 277 ? 0.1583 0.1349 0.1334 0.0067  0.0005  0.0032  297  LEU B C   
4402 O O   . LEU B 277 ? 0.1620 0.1420 0.1192 0.0078  -0.0017 0.0003  297  LEU B O   
4403 C CB  . LEU B 277 ? 0.1404 0.1496 0.1280 0.0032  -0.0016 0.0065  297  LEU B CB  
4404 C CG  . LEU B 277 ? 0.1421 0.1479 0.1196 0.0040  -0.0030 0.0042  297  LEU B CG  
4405 C CD1 . LEU B 277 ? 0.1445 0.1440 0.1034 0.0091  -0.0043 0.0006  297  LEU B CD1 
4406 C CD2 . LEU B 277 ? 0.1464 0.1440 0.1452 0.0054  -0.0111 0.0040  297  LEU B CD2 
4407 N N   . GLN B 278 ? 0.1602 0.1451 0.1289 0.0051  -0.0028 0.0005  298  GLN B N   
4408 C CA  . GLN B 278 ? 0.1594 0.1449 0.1399 0.0071  -0.0028 -0.0063 298  GLN B CA  
4409 C C   . GLN B 278 ? 0.1445 0.1437 0.1360 0.0118  0.0024  -0.0045 298  GLN B C   
4410 O O   . GLN B 278 ? 0.1476 0.1562 0.1494 0.0137  -0.0017 -0.0121 298  GLN B O   
4411 C CB  . GLN B 278 ? 0.1782 0.1552 0.1577 0.0099  -0.0056 0.0100  298  GLN B CB  
4412 C CG  . GLN B 278 ? 0.1871 0.1757 0.1833 -0.0112 0.0054  0.0172  298  GLN B CG  
4413 C CD  . GLN B 278 ? 0.2164 0.1767 0.2201 -0.0152 0.0084  0.0168  298  GLN B CD  
4414 O OE1 . GLN B 278 ? 0.2329 0.2228 0.2618 -0.0313 -0.0165 0.0085  298  GLN B OE1 
4415 N NE2 . GLN B 278 ? 0.2235 0.1856 0.2183 -0.0154 -0.0047 0.0270  298  GLN B NE2 
4416 N N   . GLY B 279 ? 0.1488 0.1205 0.1139 0.0095  -0.0093 -0.0047 299  GLY B N   
4417 C CA  . GLY B 279 ? 0.1476 0.1227 0.1092 0.0083  -0.0009 -0.0035 299  GLY B CA  
4418 C C   . GLY B 279 ? 0.1407 0.1184 0.1060 0.0015  0.0012  0.0038  299  GLY B C   
4419 O O   . GLY B 279 ? 0.1606 0.1147 0.1057 0.0004  0.0126  0.0124  299  GLY B O   
4420 N N   . HIS B 280 ? 0.1278 0.1126 0.1056 0.0021  0.0021  0.0034  300  HIS B N   
4421 C CA  . HIS B 280 ? 0.1252 0.1144 0.0999 -0.0018 0.0008  0.0069  300  HIS B CA  
4422 C C   . HIS B 280 ? 0.1248 0.1116 0.1032 -0.0019 0.0003  0.0046  300  HIS B C   
4423 O O   . HIS B 280 ? 0.1306 0.1108 0.1245 -0.0083 -0.0021 -0.0016 300  HIS B O   
4424 C CB  . HIS B 280 ? 0.1128 0.1052 0.0974 -0.0011 -0.0037 0.0047  300  HIS B CB  
4425 C CG  . HIS B 280 ? 0.1088 0.1033 0.0922 0.0019  -0.0036 0.0042  300  HIS B CG  
4426 N ND1 . HIS B 280 ? 0.1044 0.1013 0.0896 0.0001  -0.0046 0.0061  300  HIS B ND1 
4427 C CD2 . HIS B 280 ? 0.1059 0.1018 0.0951 0.0030  -0.0048 0.0044  300  HIS B CD2 
4428 C CE1 . HIS B 280 ? 0.1048 0.1027 0.0867 0.0006  -0.0045 0.0074  300  HIS B CE1 
4429 N NE2 . HIS B 280 ? 0.1089 0.1015 0.0879 0.0031  -0.0047 0.0075  300  HIS B NE2 
4430 N N   . THR B 281 ? 0.1170 0.1188 0.1092 -0.0066 0.0015  0.0052  301  THR B N   
4431 C CA  . THR B 281 ? 0.1188 0.1242 0.1080 -0.0104 0.0010  0.0040  301  THR B CA  
4432 C C   . THR B 281 ? 0.1186 0.1183 0.1018 -0.0118 0.0039  0.0061  301  THR B C   
4433 O O   . THR B 281 ? 0.1185 0.1360 0.0972 -0.0153 -0.0072 0.0114  301  THR B O   
4434 C CB  . THR B 281 ? 0.1263 0.1336 0.1074 -0.0179 0.0021  0.0011  301  THR B CB  
4435 O OG1 . THR B 281 ? 0.1463 0.1339 0.1133 -0.0210 -0.0037 0.0036  301  THR B OG1 
4436 C CG2 . THR B 281 ? 0.1286 0.1401 0.1178 -0.0175 -0.0037 0.0077  301  THR B CG2 
4437 N N   . ASP B 282 ? 0.1151 0.1157 0.0979 -0.0103 -0.0004 0.0037  302  ASP B N   
4438 C CA  . ASP B 282 ? 0.1074 0.1082 0.0975 -0.0081 0.0008  -0.0025 302  ASP B CA  
4439 C C   . ASP B 282 ? 0.1046 0.0988 0.0942 -0.0061 -0.0020 -0.0024 302  ASP B C   
4440 O O   . ASP B 282 ? 0.1052 0.1026 0.0814 -0.0055 -0.0029 -0.0031 302  ASP B O   
4441 C CB  . ASP B 282 ? 0.1148 0.1103 0.1006 -0.0049 0.0006  -0.0040 302  ASP B CB  
4442 C CG  . ASP B 282 ? 0.1173 0.1133 0.0991 -0.0051 0.0007  -0.0015 302  ASP B CG  
4443 O OD1 . ASP B 282 ? 0.1284 0.1150 0.1062 -0.0057 0.0038  -0.0065 302  ASP B OD1 
4444 O OD2 . ASP B 282 ? 0.1309 0.1235 0.1058 0.0054  -0.0016 -0.0084 302  ASP B OD2 
4445 N N   . VAL B 283 ? 0.1094 0.1032 0.0914 -0.0070 -0.0010 -0.0055 303  VAL B N   
4446 C CA  . VAL B 283 ? 0.1073 0.1005 0.0990 -0.0031 0.0042  -0.0066 303  VAL B CA  
4447 C C   . VAL B 283 ? 0.1071 0.0937 0.0898 -0.0007 0.0003  -0.0052 303  VAL B C   
4448 O O   . VAL B 283 ? 0.1075 0.0956 0.0874 -0.0081 0.0068  -0.0119 303  VAL B O   
4449 C CB  . VAL B 283 ? 0.1178 0.1112 0.1033 -0.0011 -0.0012 -0.0051 303  VAL B CB  
4450 C CG1 . VAL B 283 ? 0.1231 0.1105 0.1064 -0.0099 0.0030  -0.0073 303  VAL B CG1 
4451 C CG2 . VAL B 283 ? 0.1197 0.1182 0.1035 -0.0059 0.0025  -0.0015 303  VAL B CG2 
4452 N N   . VAL B 284 ? 0.1076 0.0965 0.0868 0.0004  0.0002  -0.0023 304  VAL B N   
4453 C CA  . VAL B 284 ? 0.1080 0.1002 0.0913 -0.0007 -0.0031 -0.0019 304  VAL B CA  
4454 C C   . VAL B 284 ? 0.1171 0.0971 0.0919 0.0037  0.0000  -0.0022 304  VAL B C   
4455 O O   . VAL B 284 ? 0.1416 0.1023 0.1001 0.0154  0.0090  -0.0040 304  VAL B O   
4456 C CB  . VAL B 284 ? 0.1133 0.0989 0.0961 0.0031  -0.0014 -0.0032 304  VAL B CB  
4457 C CG1 . VAL B 284 ? 0.1102 0.1047 0.0971 0.0030  -0.0010 -0.0024 304  VAL B CG1 
4458 C CG2 . VAL B 284 ? 0.1168 0.0977 0.0979 -0.0021 -0.0099 -0.0005 304  VAL B CG2 
4459 N N   . ILE B 285 ? 0.1144 0.0936 0.0876 0.0002  -0.0022 0.0012  305  ILE B N   
4460 C CA  . ILE B 285 ? 0.1053 0.0960 0.0866 0.0014  0.0008  0.0006  305  ILE B CA  
4461 C C   . ILE B 285 ? 0.1036 0.0910 0.0935 -0.0007 -0.0017 -0.0011 305  ILE B C   
4462 O O   . ILE B 285 ? 0.1190 0.0935 0.0949 -0.0021 0.0012  -0.0023 305  ILE B O   
4463 C CB  . ILE B 285 ? 0.1088 0.0974 0.0913 0.0031  0.0032  0.0053  305  ILE B CB  
4464 C CG1 . ILE B 285 ? 0.1074 0.1018 0.0931 0.0086  0.0029  0.0035  305  ILE B CG1 
4465 C CG2 . ILE B 285 ? 0.1111 0.0963 0.0945 0.0073  0.0020  -0.0017 305  ILE B CG2 
4466 C CD1 . ILE B 285 ? 0.0987 0.0980 0.0922 -0.0068 0.0005  -0.0027 305  ILE B CD1 
4467 N N   . SER B 286 ? 0.1053 0.0885 0.0907 -0.0007 -0.0013 -0.0004 306  SER B N   
4468 C CA  . SER B 286 ? 0.1028 0.0910 0.0919 -0.0008 0.0006  -0.0083 306  SER B CA  
4469 C C   . SER B 286 ? 0.1091 0.0988 0.0919 0.0000  -0.0032 -0.0042 306  SER B C   
4470 O O   . SER B 286 ? 0.1240 0.1092 0.0924 -0.0012 -0.0043 -0.0004 306  SER B O   
4471 C CB  . SER B 286 ? 0.0996 0.0913 0.0882 0.0050  -0.0008 -0.0079 306  SER B CB  
4472 O OG  . SER B 286 ? 0.1030 0.0809 0.0940 0.0018  0.0003  -0.0149 306  SER B OG  
4473 N N   . THR B 287 ? 0.1097 0.1015 0.0919 0.0047  -0.0042 -0.0040 307  THR B N   
4474 C CA  . THR B 287 ? 0.1054 0.1064 0.1046 0.0054  -0.0004 -0.0039 307  THR B CA  
4475 C C   . THR B 287 ? 0.1101 0.1109 0.1080 0.0071  0.0066  -0.0031 307  THR B C   
4476 O O   . THR B 287 ? 0.1151 0.1155 0.1048 0.0099  0.0115  -0.0061 307  THR B O   
4477 C CB  . THR B 287 ? 0.1205 0.1067 0.1076 0.0081  -0.0062 -0.0041 307  THR B CB  
4478 O OG1 . THR B 287 ? 0.1366 0.1094 0.1118 0.0155  0.0053  -0.0163 307  THR B OG1 
4479 C CG2 . THR B 287 ? 0.1247 0.1119 0.1038 0.0007  -0.0039 -0.0092 307  THR B CG2 
4480 N N   . ALA B 288 ? 0.1085 0.1176 0.1067 0.0042  0.0091  -0.0025 308  ALA B N   
4481 C CA  . ALA B 288 ? 0.1112 0.1204 0.1028 0.0037  0.0090  -0.0001 308  ALA B CA  
4482 C C   . ALA B 288 ? 0.1129 0.1294 0.1090 0.0087  0.0083  0.0004  308  ALA B C   
4483 O O   . ALA B 288 ? 0.1230 0.1361 0.1053 0.0154  0.0150  -0.0026 308  ALA B O   
4484 C CB  . ALA B 288 ? 0.1251 0.1194 0.1123 0.0099  0.0051  0.0046  308  ALA B CB  
4485 N N   . CYS B 289 ? 0.1171 0.1365 0.1064 0.0106  0.0104  -0.0011 309  CYS B N   
4486 C CA  . CYS B 289 ? 0.1250 0.1372 0.1153 0.0139  0.0015  0.0010  309  CYS B CA  
4487 C C   . CYS B 289 ? 0.1283 0.1349 0.1202 0.0122  0.0055  0.0034  309  CYS B C   
4488 O O   . CYS B 289 ? 0.1524 0.1505 0.1009 0.0193  0.0018  -0.0014 309  CYS B O   
4489 C CB  . CYS B 289 ? 0.1407 0.1588 0.1210 0.0317  0.0069  -0.0030 309  CYS B CB  
4490 S SG  . CYS B 289 ? 0.1518 0.1621 0.1463 0.0313  -0.0041 -0.0108 309  CYS B SG  
4491 N N   . HIS B 290 ? 0.1280 0.1433 0.1287 0.0064  0.0025  0.0035  310  HIS B N   
4492 C CA  . HIS B 290 ? 0.1362 0.1396 0.1404 0.0055  0.0007  -0.0013 310  HIS B CA  
4493 C C   . HIS B 290 ? 0.1401 0.1455 0.1392 0.0052  0.0020  0.0034  310  HIS B C   
4494 O O   . HIS B 290 ? 0.1337 0.1500 0.1435 0.0089  0.0012  0.0024  310  HIS B O   
4495 C CB  . HIS B 290 ? 0.1374 0.1451 0.1424 0.0042  -0.0012 -0.0010 310  HIS B CB  
4496 C CG  . HIS B 290 ? 0.1360 0.1456 0.1478 -0.0001 -0.0007 0.0024  310  HIS B CG  
4497 N ND1 . HIS B 290 ? 0.1382 0.1491 0.1446 -0.0074 -0.0009 -0.0018 310  HIS B ND1 
4498 C CD2 . HIS B 290 ? 0.1444 0.1489 0.1410 -0.0037 -0.0021 -0.0020 310  HIS B CD2 
4499 C CE1 . HIS B 290 ? 0.1428 0.1478 0.1437 -0.0096 -0.0053 0.0004  310  HIS B CE1 
4500 N NE2 . HIS B 290 ? 0.1435 0.1565 0.1453 -0.0045 -0.0081 -0.0035 310  HIS B NE2 
4501 N N   . PRO B 291 ? 0.1385 0.1520 0.1345 0.0044  0.0036  0.0091  311  PRO B N   
4502 C CA  . PRO B 291 ? 0.1352 0.1597 0.1436 0.0075  0.0091  0.0019  311  PRO B CA  
4503 C C   . PRO B 291 ? 0.1453 0.1809 0.1560 0.0184  0.0006  0.0041  311  PRO B C   
4504 O O   . PRO B 291 ? 0.1553 0.2120 0.1608 0.0223  0.0172  0.0052  311  PRO B O   
4505 C CB  . PRO B 291 ? 0.1352 0.1616 0.1357 0.0093  0.0086  0.0067  311  PRO B CB  
4506 C CG  . PRO B 291 ? 0.1450 0.1577 0.1285 0.0026  0.0033  0.0069  311  PRO B CG  
4507 C CD  . PRO B 291 ? 0.1458 0.1481 0.1311 0.0002  -0.0019 0.0081  311  PRO B CD  
4508 N N   . THR B 292 ? 0.1690 0.1891 0.1536 0.0057  0.0081  -0.0063 312  THR B N   
4509 C CA  . THR B 292 ? 0.1700 0.2045 0.1869 0.0105  0.0077  -0.0039 312  THR B CA  
4510 C C   . THR B 292 ? 0.1825 0.2198 0.1998 0.0037  0.0019  0.0107  312  THR B C   
4511 O O   . THR B 292 ? 0.1974 0.2415 0.2290 0.0210  -0.0041 0.0194  312  THR B O   
4512 C CB  . THR B 292 ? 0.1664 0.2105 0.1992 0.0055  0.0122  -0.0082 312  THR B CB  
4513 O OG1 . THR B 292 ? 0.1628 0.2189 0.2103 0.0010  0.0226  -0.0090 312  THR B OG1 
4514 C CG2 . THR B 292 ? 0.1699 0.2188 0.1931 0.0013  0.0235  -0.0095 312  THR B CG2 
4515 N N   . GLU B 293 ? 0.1759 0.2260 0.2022 0.0058  -0.0034 0.0112  313  GLU B N   
4516 C CA  . GLU B 293 ? 0.1798 0.2050 0.1952 0.0086  -0.0005 -0.0011 313  GLU B CA  
4517 C C   . GLU B 293 ? 0.1668 0.1926 0.1675 0.0179  0.0015  0.0093  313  GLU B C   
4518 O O   . GLU B 293 ? 0.1582 0.1941 0.1856 0.0331  0.0017  0.0127  313  GLU B O   
4519 C CB  . GLU B 293 ? 0.1955 0.2138 0.2102 0.0166  0.0039  -0.0107 313  GLU B CB  
4520 C CG  . GLU B 293 ? 0.2308 0.2268 0.2575 -0.0018 -0.0142 -0.0151 313  GLU B CG  
4521 C CD  . GLU B 293 ? 0.2465 0.2492 0.2874 0.0053  -0.0298 0.0019  313  GLU B CD  
4522 O OE1 . GLU B 293 ? 0.2971 0.2630 0.3096 0.0186  -0.0409 0.0218  313  GLU B OE1 
4523 O OE2 . GLU B 293 ? 0.2733 0.2977 0.3411 -0.0275 -0.0462 0.0038  313  GLU B OE2 
4524 N N   . ASN B 294 ? 0.1693 0.1906 0.1627 0.0168  0.0013  0.0071  314  ASN B N   
4525 C CA  . ASN B 294 ? 0.1651 0.1894 0.1613 0.0185  0.0021  0.0162  314  ASN B CA  
4526 C C   . ASN B 294 ? 0.1570 0.1784 0.1582 0.0172  -0.0054 0.0146  314  ASN B C   
4527 O O   . ASN B 294 ? 0.1441 0.2079 0.1547 0.0173  -0.0132 0.0227  314  ASN B O   
4528 C CB  . ASN B 294 ? 0.1835 0.1825 0.1780 0.0192  0.0068  0.0174  314  ASN B CB  
4529 C CG  . ASN B 294 ? 0.1920 0.2046 0.1768 0.0215  0.0133  0.0193  314  ASN B CG  
4530 O OD1 . ASN B 294 ? 0.2073 0.1998 0.1758 0.0386  0.0230  0.0181  314  ASN B OD1 
4531 N ND2 . ASN B 294 ? 0.1947 0.2354 0.2014 0.0338  0.0158  0.0273  314  ASN B ND2 
4532 N N   . ILE B 295 ? 0.1416 0.1724 0.1304 0.0110  -0.0004 0.0128  315  ILE B N   
4533 C CA  . ILE B 295 ? 0.1373 0.1458 0.1210 -0.0016 -0.0034 0.0100  315  ILE B CA  
4534 C C   . ILE B 295 ? 0.1276 0.1469 0.1220 0.0024  0.0030  0.0087  315  ILE B C   
4535 O O   . ILE B 295 ? 0.1418 0.1487 0.1154 0.0062  0.0171  0.0036  315  ILE B O   
4536 C CB  . ILE B 295 ? 0.1364 0.1480 0.1261 -0.0020 -0.0036 0.0053  315  ILE B CB  
4537 C CG1 . ILE B 295 ? 0.1375 0.1483 0.1304 0.0040  -0.0055 0.0087  315  ILE B CG1 
4538 C CG2 . ILE B 295 ? 0.1349 0.1436 0.1104 -0.0060 -0.0086 0.0074  315  ILE B CG2 
4539 C CD1 . ILE B 295 ? 0.1391 0.1503 0.1517 -0.0057 -0.0106 0.0063  315  ILE B CD1 
4540 N N   . ILE B 296 ? 0.1228 0.1374 0.1169 0.0044  0.0033  0.0010  316  ILE B N   
4541 C CA  . ILE B 296 ? 0.1234 0.1264 0.1056 0.0094  0.0054  0.0007  316  ILE B CA  
4542 C C   . ILE B 296 ? 0.1136 0.1289 0.1081 0.0089  0.0065  0.0061  316  ILE B C   
4543 O O   . ILE B 296 ? 0.1354 0.1257 0.1061 0.0165  -0.0028 0.0038  316  ILE B O   
4544 C CB  . ILE B 296 ? 0.1221 0.1268 0.1157 0.0101  -0.0008 -0.0003 316  ILE B CB  
4545 C CG1 . ILE B 296 ? 0.1209 0.1300 0.1176 0.0158  -0.0072 0.0013  316  ILE B CG1 
4546 C CG2 . ILE B 296 ? 0.1222 0.1325 0.1102 0.0100  0.0010  -0.0066 316  ILE B CG2 
4547 C CD1 . ILE B 296 ? 0.1121 0.1321 0.1308 0.0132  -0.0222 -0.0055 316  ILE B CD1 
4548 N N   . ALA B 297 ? 0.1120 0.1270 0.0981 0.0127  0.0141  0.0032  317  ALA B N   
4549 C CA  . ALA B 297 ? 0.0985 0.1132 0.0978 0.0049  0.0057  0.0041  317  ALA B CA  
4550 C C   . ALA B 297 ? 0.1001 0.1104 0.0985 0.0024  0.0083  0.0017  317  ALA B C   
4551 O O   . ALA B 297 ? 0.0836 0.1184 0.1003 0.0002  0.0089  -0.0026 317  ALA B O   
4552 C CB  . ALA B 297 ? 0.0979 0.1103 0.0923 0.0072  0.0108  -0.0026 317  ALA B CB  
4553 N N   . SER B 298 ? 0.0982 0.1043 0.0943 0.0008  0.0053  -0.0003 318  SER B N   
4554 C CA  . SER B 298 ? 0.0974 0.0987 0.0922 0.0020  0.0033  0.0041  318  SER B CA  
4555 C C   . SER B 298 ? 0.0992 0.0940 0.0903 0.0014  0.0025  0.0032  318  SER B C   
4556 O O   . SER B 298 ? 0.1127 0.0983 0.0983 0.0059  0.0055  -0.0059 318  SER B O   
4557 C CB  . SER B 298 ? 0.1037 0.0998 0.0947 0.0011  0.0023  0.0057  318  SER B CB  
4558 O OG  . SER B 298 ? 0.1147 0.1157 0.0954 0.0033  0.0038  0.0113  318  SER B OG  
4559 N N   . ALA B 299 ? 0.0973 0.0904 0.0878 -0.0009 0.0051  0.0010  319  ALA B N   
4560 C CA  . ALA B 299 ? 0.0920 0.0910 0.0849 -0.0021 0.0013  0.0040  319  ALA B CA  
4561 C C   . ALA B 299 ? 0.0934 0.0902 0.0831 -0.0034 0.0035  0.0002  319  ALA B C   
4562 O O   . ALA B 299 ? 0.0918 0.0945 0.0824 -0.0080 0.0073  -0.0002 319  ALA B O   
4563 C CB  . ALA B 299 ? 0.1084 0.0877 0.0946 -0.0047 0.0041  0.0024  319  ALA B CB  
4564 N N   . ALA B 300 ? 0.0965 0.0925 0.0745 -0.0026 0.0025  0.0025  320  ALA B N   
4565 C CA  . ALA B 300 ? 0.0978 0.0931 0.0844 -0.0027 0.0006  0.0018  320  ALA B CA  
4566 C C   . ALA B 300 ? 0.1000 0.0944 0.0774 -0.0005 0.0006  0.0032  320  ALA B C   
4567 O O   . ALA B 300 ? 0.1052 0.0957 0.0752 0.0050  -0.0020 0.0014  320  ALA B O   
4568 C CB  . ALA B 300 ? 0.0901 0.0953 0.0797 0.0001  -0.0011 0.0017  320  ALA B CB  
4569 N N   . LEU B 301 ? 0.1008 0.0998 0.0868 -0.0027 0.0004  0.0036  321  LEU B N   
4570 C CA  . LEU B 301 ? 0.1022 0.0995 0.0922 -0.0028 -0.0035 0.0045  321  LEU B CA  
4571 C C   . LEU B 301 ? 0.1065 0.1108 0.0887 -0.0011 -0.0055 0.0027  321  LEU B C   
4572 O O   . LEU B 301 ? 0.0980 0.1168 0.0939 -0.0078 -0.0108 0.0057  321  LEU B O   
4573 C CB  . LEU B 301 ? 0.1092 0.1006 0.0984 -0.0043 -0.0052 0.0003  321  LEU B CB  
4574 C CG  . LEU B 301 ? 0.1090 0.1004 0.0990 -0.0015 -0.0057 -0.0001 321  LEU B CG  
4575 C CD1 . LEU B 301 ? 0.1074 0.1025 0.0972 -0.0032 -0.0089 0.0003  321  LEU B CD1 
4576 C CD2 . LEU B 301 ? 0.1128 0.1008 0.0985 0.0000  -0.0124 0.0042  321  LEU B CD2 
4577 N N   . GLU B 302 ? 0.1053 0.1176 0.0983 -0.0018 -0.0050 0.0000  322  GLU B N   
4578 C CA  . GLU B 302 ? 0.1164 0.1250 0.1052 0.0014  0.0015  -0.0004 322  GLU B CA  
4579 C C   . GLU B 302 ? 0.1293 0.1157 0.1092 -0.0001 0.0014  0.0010  322  GLU B C   
4580 O O   . GLU B 302 ? 0.1257 0.1254 0.0997 -0.0023 0.0079  0.0033  322  GLU B O   
4581 C CB  . GLU B 302 ? 0.1241 0.1388 0.1172 -0.0017 -0.0098 0.0091  322  GLU B CB  
4582 C CG  . GLU B 302 ? 0.1437 0.1548 0.1408 0.0078  0.0037  0.0040  322  GLU B CG  
4583 C CD  . GLU B 302 ? 0.1590 0.1602 0.1670 -0.0009 -0.0056 -0.0002 322  GLU B CD  
4584 O OE1 . GLU B 302 ? 0.1688 0.1786 0.1899 -0.0085 0.0043  0.0143  322  GLU B OE1 
4585 O OE2 . GLU B 302 ? 0.1888 0.1884 0.1867 0.0098  0.0081  -0.0168 322  GLU B OE2 
4586 N N   . ASN B 303 ? 0.1313 0.1152 0.1081 -0.0020 0.0007  0.0006  323  ASN B N   
4587 C CA  . ASN B 303 ? 0.1288 0.1242 0.1137 -0.0073 -0.0004 0.0074  323  ASN B CA  
4588 C C   . ASN B 303 ? 0.1274 0.1259 0.1116 -0.0075 0.0005  0.0102  323  ASN B C   
4589 O O   . ASN B 303 ? 0.1498 0.1324 0.1122 -0.0122 -0.0078 0.0124  323  ASN B O   
4590 C CB  . ASN B 303 ? 0.1419 0.1275 0.1284 -0.0090 -0.0020 -0.0031 323  ASN B CB  
4591 C CG  . ASN B 303 ? 0.1484 0.1467 0.1436 -0.0135 -0.0112 0.0016  323  ASN B CG  
4592 O OD1 . ASN B 303 ? 0.2137 0.1554 0.1837 -0.0244 -0.0166 -0.0103 323  ASN B OD1 
4593 N ND2 . ASN B 303 ? 0.1444 0.1607 0.1623 -0.0070 -0.0093 0.0005  323  ASN B ND2 
4594 N N   . ASP B 304 ? 0.1156 0.1275 0.1101 -0.0064 -0.0084 0.0094  324  ASP B N   
4595 C CA  . ASP B 304 ? 0.1170 0.1177 0.0938 -0.0084 -0.0067 0.0062  324  ASP B CA  
4596 C C   . ASP B 304 ? 0.1116 0.1187 0.1045 -0.0099 -0.0095 0.0037  324  ASP B C   
4597 O O   . ASP B 304 ? 0.1197 0.1245 0.0877 -0.0182 0.0000  0.0167  324  ASP B O   
4598 C CB  . ASP B 304 ? 0.1137 0.1277 0.0958 -0.0048 -0.0075 0.0059  324  ASP B CB  
4599 C CG  . ASP B 304 ? 0.1100 0.1281 0.1088 -0.0033 -0.0052 0.0061  324  ASP B CG  
4600 O OD1 . ASP B 304 ? 0.1072 0.1291 0.1133 -0.0019 -0.0134 0.0062  324  ASP B OD1 
4601 O OD2 . ASP B 304 ? 0.1175 0.1292 0.1145 0.0037  -0.0101 0.0118  324  ASP B OD2 
4602 N N   . LYS B 305 ? 0.1110 0.1146 0.1053 -0.0111 -0.0085 0.0026  325  LYS B N   
4603 C CA  . LYS B 305 ? 0.1197 0.1153 0.1139 -0.0136 -0.0126 -0.0002 325  LYS B CA  
4604 C C   . LYS B 305 ? 0.1136 0.1083 0.1118 -0.0117 -0.0052 -0.0024 325  LYS B C   
4605 O O   . LYS B 305 ? 0.1045 0.1198 0.1154 -0.0299 -0.0131 -0.0028 325  LYS B O   
4606 C CB  . LYS B 305 ? 0.1332 0.1256 0.1287 -0.0053 -0.0091 -0.0040 325  LYS B CB  
4607 C CG  . LYS B 305 ? 0.1366 0.1406 0.1405 -0.0045 -0.0174 0.0040  325  LYS B CG  
4608 C CD  . LYS B 305 ? 0.1492 0.1483 0.1434 -0.0001 -0.0076 0.0032  325  LYS B CD  
4609 C CE  . LYS B 305 ? 0.1751 0.1665 0.1489 -0.0008 -0.0046 0.0103  325  LYS B CE  
4610 N NZ  . LYS B 305 ? 0.1678 0.1761 0.1601 0.0045  0.0063  0.0089  325  LYS B NZ  
4611 N N   . THR B 306 ? 0.1142 0.1061 0.1086 -0.0119 -0.0024 -0.0038 326  THR B N   
4612 C CA  . THR B 306 ? 0.1029 0.1087 0.1006 -0.0001 0.0059  0.0044  326  THR B CA  
4613 C C   . THR B 306 ? 0.1013 0.1057 0.0932 -0.0042 0.0006  -0.0008 326  THR B C   
4614 O O   . THR B 306 ? 0.0883 0.0999 0.0893 -0.0088 0.0119  -0.0018 326  THR B O   
4615 C CB  . THR B 306 ? 0.1093 0.1166 0.1004 -0.0021 -0.0041 0.0026  326  THR B CB  
4616 O OG1 . THR B 306 ? 0.1150 0.1134 0.1139 0.0048  -0.0024 0.0126  326  THR B OG1 
4617 C CG2 . THR B 306 ? 0.1112 0.1151 0.1043 -0.0035 0.0009  0.0115  326  THR B CG2 
4618 N N   . ILE B 307 ? 0.0985 0.0998 0.0870 -0.0033 0.0031  -0.0014 327  ILE B N   
4619 C CA  . ILE B 307 ? 0.0962 0.0945 0.0883 0.0013  0.0007  -0.0019 327  ILE B CA  
4620 C C   . ILE B 307 ? 0.1013 0.0933 0.0871 0.0028  -0.0003 -0.0019 327  ILE B C   
4621 O O   . ILE B 307 ? 0.1129 0.0979 0.0847 -0.0017 -0.0040 0.0039  327  ILE B O   
4622 C CB  . ILE B 307 ? 0.0976 0.0953 0.0962 -0.0005 0.0003  -0.0012 327  ILE B CB  
4623 C CG1 . ILE B 307 ? 0.1052 0.0934 0.0995 0.0047  0.0003  0.0004  327  ILE B CG1 
4624 C CG2 . ILE B 307 ? 0.1004 0.0974 0.0961 0.0050  0.0024  0.0006  327  ILE B CG2 
4625 C CD1 . ILE B 307 ? 0.1173 0.0922 0.1105 0.0086  0.0030  0.0009  327  ILE B CD1 
4626 N N   . LYS B 308 ? 0.0988 0.0989 0.0809 0.0077  -0.0047 -0.0017 328  LYS B N   
4627 C CA  . LYS B 308 ? 0.1004 0.0953 0.0844 0.0084  -0.0052 -0.0031 328  LYS B CA  
4628 C C   . LYS B 308 ? 0.1015 0.1059 0.0931 0.0113  -0.0024 -0.0014 328  LYS B C   
4629 O O   . LYS B 308 ? 0.1153 0.1152 0.0920 0.0213  -0.0128 0.0044  328  LYS B O   
4630 C CB  . LYS B 308 ? 0.0946 0.0983 0.0809 0.0060  -0.0053 0.0022  328  LYS B CB  
4631 C CG  . LYS B 308 ? 0.0939 0.0916 0.0782 0.0004  -0.0060 -0.0017 328  LYS B CG  
4632 C CD  . LYS B 308 ? 0.0957 0.0928 0.0835 0.0009  -0.0060 0.0036  328  LYS B CD  
4633 C CE  . LYS B 308 ? 0.0999 0.0978 0.0902 -0.0007 -0.0009 0.0001  328  LYS B CE  
4634 N NZ  . LYS B 308 ? 0.1121 0.1042 0.0916 0.0012  -0.0048 0.0000  328  LYS B NZ  
4635 N N   . LEU B 309 ? 0.1054 0.1092 0.0960 0.0129  -0.0068 0.0001  329  LEU B N   
4636 C CA  . LEU B 309 ? 0.1094 0.1171 0.1044 0.0081  -0.0007 -0.0010 329  LEU B CA  
4637 C C   . LEU B 309 ? 0.1214 0.1219 0.1100 0.0101  -0.0071 0.0043  329  LEU B C   
4638 O O   . LEU B 309 ? 0.1179 0.1277 0.1081 0.0101  -0.0061 0.0027  329  LEU B O   
4639 C CB  . LEU B 309 ? 0.1137 0.1159 0.1158 0.0074  -0.0031 -0.0004 329  LEU B CB  
4640 C CG  . LEU B 309 ? 0.1276 0.1174 0.1227 0.0090  -0.0015 0.0028  329  LEU B CG  
4641 C CD1 . LEU B 309 ? 0.1248 0.1188 0.1343 0.0066  0.0028  -0.0042 329  LEU B CD1 
4642 C CD2 . LEU B 309 ? 0.1371 0.1240 0.1235 0.0129  -0.0035 0.0098  329  LEU B CD2 
4643 N N   . TRP B 310 ? 0.1182 0.1257 0.1153 0.0071  -0.0053 -0.0001 330  TRP B N   
4644 C CA  . TRP B 310 ? 0.1300 0.1242 0.1307 0.0076  -0.0025 0.0032  330  TRP B CA  
4645 C C   . TRP B 310 ? 0.1325 0.1351 0.1326 0.0071  0.0015  0.0082  330  TRP B C   
4646 O O   . TRP B 310 ? 0.1401 0.1475 0.1381 0.0099  -0.0035 0.0183  330  TRP B O   
4647 C CB  . TRP B 310 ? 0.1239 0.1340 0.1275 0.0077  -0.0070 -0.0002 330  TRP B CB  
4648 C CG  . TRP B 310 ? 0.1230 0.1223 0.1175 0.0002  -0.0065 0.0028  330  TRP B CG  
4649 C CD1 . TRP B 310 ? 0.1236 0.1287 0.1196 0.0070  -0.0030 0.0045  330  TRP B CD1 
4650 C CD2 . TRP B 310 ? 0.1202 0.1198 0.1100 0.0039  -0.0070 0.0011  330  TRP B CD2 
4651 N NE1 . TRP B 310 ? 0.1209 0.1229 0.1096 0.0065  -0.0121 0.0076  330  TRP B NE1 
4652 C CE2 . TRP B 310 ? 0.1210 0.1185 0.1070 0.0033  -0.0089 0.0023  330  TRP B CE2 
4653 C CE3 . TRP B 310 ? 0.1146 0.1277 0.1003 0.0067  -0.0178 0.0004  330  TRP B CE3 
4654 C CZ2 . TRP B 310 ? 0.1190 0.1224 0.1085 0.0032  -0.0092 0.0037  330  TRP B CZ2 
4655 C CZ3 . TRP B 310 ? 0.1273 0.1157 0.1047 0.0021  -0.0158 0.0035  330  TRP B CZ3 
4656 C CH2 . TRP B 310 ? 0.1213 0.1213 0.1048 -0.0014 -0.0080 -0.0007 330  TRP B CH2 
4657 N N   . LYS B 311 ? 0.1421 0.1540 0.1240 0.0056  -0.0059 0.0086  331  LYS B N   
4658 C CA  . LYS B 311 ? 0.1468 0.1593 0.1389 0.0032  0.0010  0.0140  331  LYS B CA  
4659 C C   . LYS B 311 ? 0.1564 0.1612 0.1420 0.0076  -0.0063 0.0153  331  LYS B C   
4660 O O   . LYS B 311 ? 0.1583 0.1592 0.1564 0.0144  0.0040  0.0194  331  LYS B O   
4661 C CB  . LYS B 311 ? 0.1581 0.1660 0.1398 0.0045  0.0000  0.0071  331  LYS B CB  
4662 C CG  . LYS B 311 ? 0.1707 0.1651 0.1677 0.0042  0.0038  0.0060  331  LYS B CG  
4663 C CD  . LYS B 311 ? 0.1833 0.1804 0.1552 0.0006  -0.0039 0.0038  331  LYS B CD  
4664 C CE  . LYS B 311 ? 0.1824 0.1899 0.1829 0.0083  0.0060  0.0115  331  LYS B CE  
4665 N NZ  . LYS B 311 ? 0.1886 0.1999 0.1835 -0.0078 -0.0119 0.0031  331  LYS B NZ  
4666 N N   . SER B 312 ? 0.1588 0.1697 0.1445 0.0081  -0.0051 0.0184  332  SER B N   
4667 C CA  . SER B 312 ? 0.1831 0.1806 0.1689 0.0206  -0.0179 0.0048  332  SER B CA  
4668 C C   . SER B 312 ? 0.1879 0.1935 0.1912 0.0097  -0.0072 0.0100  332  SER B C   
4669 O O   . SER B 312 ? 0.1965 0.1834 0.1932 0.0186  -0.0149 0.0090  332  SER B O   
4670 C CB  . SER B 312 ? 0.1910 0.1755 0.1668 0.0222  -0.0213 0.0072  332  SER B CB  
4671 O OG  . SER B 312 ? 0.2125 0.1927 0.1702 0.0383  -0.0168 0.0004  332  SER B OG  
4672 N N   . ASP B 313 ? 0.2034 0.2012 0.2103 0.0164  -0.0119 0.0220  333  ASP B N   
4673 C CA  . ASP B 313 ? 0.2070 0.2386 0.2306 0.0190  0.0042  0.0239  333  ASP B CA  
4674 C C   . ASP B 313 ? 0.2324 0.2758 0.2355 0.0222  0.0065  0.0088  333  ASP B C   
4675 O O   . ASP B 313 ? 0.2366 0.3186 0.2627 0.0124  0.0106  0.0178  333  ASP B O   
4676 C CB  . ASP B 313 ? 0.2099 0.2308 0.2341 0.0169  0.0047  0.0272  333  ASP B CB  
4677 C CG  . ASP B 313 ? 0.2166 0.2228 0.2420 0.0220  0.0091  0.0127  333  ASP B CG  
4678 O OD1 . ASP B 313 ? 0.2166 0.2177 0.2591 0.0194  -0.0138 0.0124  333  ASP B OD1 
4679 O OD2 . ASP B 313 ? 0.2306 0.2499 0.2352 0.0167  0.0285  0.0270  333  ASP B OD2 
4680 N N   . CYS B 314 ? 0.2491 0.2849 0.2428 0.0254  -0.0006 -0.0038 334  CYS B N   
4681 C CA  . CYS B 314 ? 0.2468 0.2880 0.2451 0.0331  -0.0031 -0.0128 334  CYS B CA  
4682 C C   . CYS B 314 ? 0.2489 0.2961 0.2329 0.0524  -0.0014 -0.0147 334  CYS B C   
4683 O O   . CYS B 314 ? 0.2259 0.2706 0.2469 0.0727  -0.0145 -0.0389 334  CYS B O   
4684 C CB  . CYS B 314 ? 0.2748 0.2894 0.2840 0.0423  -0.0009 -0.0095 334  CYS B CB  
4685 S SG  . CYS B 314 ? 0.3036 0.2822 0.3063 0.0533  0.0261  0.0174  334  CYS B SG  
4686 O OXT . CYS B 314 ? 0.2572 0.2814 0.1969 0.0567  -0.0098 -0.0183 334  CYS B OXT 
4687 N N   . GLY C 2   ? 0.2038 0.2709 0.2368 -0.0243 0.0220  0.0077  586  GLY C N   
4688 C CA  . GLY C 2   ? 0.1913 0.2448 0.2228 -0.0209 0.0186  0.0206  586  GLY C CA  
4689 C C   . GLY C 2   ? 0.1648 0.2102 0.2075 -0.0124 0.0042  0.0037  586  GLY C C   
4690 O O   . GLY C 2   ? 0.1869 0.2266 0.2253 -0.0210 0.0036  -0.0173 586  GLY C O   
4691 N N   . THR C 3   ? 0.1560 0.1830 0.1753 -0.0015 0.0203  0.0046  587  THR C N   
4692 C CA  . THR C 3   ? 0.1446 0.1575 0.1570 0.0049  0.0084  0.0056  587  THR C CA  
4693 C C   . THR C 3   ? 0.1344 0.1575 0.1415 -0.0020 0.0141  0.0085  587  THR C C   
4694 O O   . THR C 3   ? 0.1220 0.1461 0.1360 0.0040  0.0069  0.0176  587  THR C O   
4695 C CB  . THR C 3   ? 0.1464 0.1621 0.1557 -0.0035 0.0127  0.0023  587  THR C CB  
4696 O OG1 . THR C 3   ? 0.1271 0.1441 0.1665 -0.0056 0.0060  -0.0094 587  THR C OG1 
4697 C CG2 . THR C 3   ? 0.1572 0.1684 0.1798 0.0033  0.0061  0.0045  587  THR C CG2 
4698 N N   . CYS C 4   ? 0.1282 0.1486 0.1448 0.0005  0.0155  0.0082  588  CYS C N   
4699 C CA  . CYS C 4   ? 0.1353 0.1400 0.1405 0.0022  0.0137  0.0017  588  CYS C CA  
4700 C C   . CYS C 4   ? 0.1354 0.1383 0.1372 0.0011  0.0131  0.0039  588  CYS C C   
4701 O O   . CYS C 4   ? 0.1303 0.1427 0.1347 0.0032  0.0223  0.0069  588  CYS C O   
4702 C CB  . CYS C 4   ? 0.1495 0.1617 0.1437 0.0053  0.0084  0.0063  588  CYS C CB  
4703 S SG  . CYS C 4   ? 0.2015 0.1847 0.1337 0.0083  0.0061  -0.0076 588  CYS C SG  
4704 N N   . VAL C 5   ? 0.1262 0.1356 0.1348 -0.0038 0.0097  -0.0013 589  VAL C N   
4705 C CA  . VAL C 5   ? 0.1207 0.1345 0.1365 -0.0076 0.0028  -0.0013 589  VAL C CA  
4706 C C   . VAL C 5   ? 0.1285 0.1264 0.1233 -0.0087 0.0010  -0.0017 589  VAL C C   
4707 O O   . VAL C 5   ? 0.1299 0.1278 0.1237 -0.0163 0.0046  -0.0061 589  VAL C O   
4708 C CB  . VAL C 5   ? 0.1275 0.1391 0.1380 -0.0100 -0.0036 -0.0065 589  VAL C CB  
4709 C CG1 . VAL C 5   ? 0.1391 0.1482 0.1447 -0.0082 0.0068  -0.0057 589  VAL C CG1 
4710 C CG2 . VAL C 5   ? 0.1252 0.1500 0.1416 -0.0008 -0.0096 -0.0021 589  VAL C CG2 
4711 N N   . ALA C 6   ? 0.1092 0.1295 0.1154 -0.0081 -0.0003 0.0015  590  ALA C N   
4712 C CA  . ALA C 6   ? 0.1142 0.1183 0.1094 -0.0042 -0.0008 0.0024  590  ALA C CA  
4713 C C   . ALA C 6   ? 0.1086 0.1162 0.1094 -0.0042 -0.0020 0.0034  590  ALA C C   
4714 O O   . ALA C 6   ? 0.1024 0.1234 0.0978 -0.0013 -0.0059 0.0089  590  ALA C O   
4715 C CB  . ALA C 6   ? 0.1185 0.1323 0.1016 -0.0081 -0.0029 0.0031  590  ALA C CB  
4716 N N   . ALA C 7   ? 0.1112 0.1098 0.1094 -0.0085 0.0006  0.0029  591  ALA C N   
4717 C CA  . ALA C 7   ? 0.1195 0.1147 0.1146 -0.0024 0.0026  -0.0041 591  ALA C CA  
4718 C C   . ALA C 7   ? 0.1175 0.1120 0.1128 -0.0052 0.0029  -0.0016 591  ALA C C   
4719 O O   . ALA C 7   ? 0.1148 0.1117 0.1245 -0.0054 0.0076  0.0000  591  ALA C O   
4720 C CB  . ALA C 7   ? 0.1399 0.1233 0.1134 -0.0054 -0.0067 -0.0003 591  ALA C CB  
4721 N N   . ARG C 8   ? 0.1160 0.1100 0.1138 0.0003  0.0018  -0.0031 592  ARG C N   
4722 C CA  . ARG C 8   ? 0.1189 0.1119 0.1078 -0.0011 0.0025  0.0089  592  ARG C CA  
4723 C C   . ARG C 8   ? 0.1142 0.1152 0.1038 -0.0022 0.0031  0.0067  592  ARG C C   
4724 O O   . ARG C 8   ? 0.1163 0.1133 0.1106 -0.0047 0.0116  0.0052  592  ARG C O   
4725 C CB  . ARG C 8   ? 0.1186 0.1190 0.1106 0.0001  0.0009  0.0105  592  ARG C CB  
4726 C CG  . ARG C 8   ? 0.1255 0.1156 0.1119 0.0011  0.0027  0.0144  592  ARG C CG  
4727 C CD  . ARG C 8   ? 0.1266 0.1068 0.1027 0.0021  0.0047  0.0065  592  ARG C CD  
4728 N NE  . ARG C 8   ? 0.1298 0.1051 0.0935 0.0014  0.0011  0.0050  592  ARG C NE  
4729 C CZ  . ARG C 8   ? 0.1218 0.1016 0.0977 0.0040  -0.0007 0.0022  592  ARG C CZ  
4730 N NH1 . ARG C 8   ? 0.1312 0.0990 0.0961 -0.0016 -0.0016 0.0031  592  ARG C NH1 
4731 N NH2 . ARG C 8   ? 0.1339 0.0949 0.0901 0.0115  -0.0079 0.0042  592  ARG C NH2 
4732 N N   . THR C 9   ? 0.1217 0.1080 0.1022 -0.0004 0.0015  0.0062  593  THR C N   
4733 C CA  . THR C 9   ? 0.1306 0.1152 0.1058 -0.0046 0.0007  0.0102  593  THR C CA  
4734 C C   . THR C 9   ? 0.1294 0.1236 0.1187 -0.0066 0.0013  0.0097  593  THR C C   
4735 O O   . THR C 9   ? 0.1386 0.1364 0.1173 -0.0107 0.0002  0.0115  593  THR C O   
4736 C CB  . THR C 9   ? 0.1420 0.1218 0.1141 -0.0058 -0.0004 0.0026  593  THR C CB  
4737 O OG1 . THR C 9   ? 0.1443 0.1386 0.1452 -0.0010 -0.0121 0.0037  593  THR C OG1 
4738 C CG2 . THR C 9   ? 0.1402 0.1236 0.1279 -0.0028 -0.0041 0.0005  593  THR C CG2 
4739 N N   . ARG C 10  ? 0.1327 0.1363 0.1233 -0.0059 -0.0032 0.0040  594  ARG C N   
4740 C CA  . ARG C 10  ? 0.1402 0.1424 0.1484 -0.0112 -0.0014 -0.0017 594  ARG C CA  
4741 C C   . ARG C 10  ? 0.1524 0.1507 0.1463 -0.0051 0.0016  -0.0047 594  ARG C C   
4742 O O   . ARG C 10  ? 0.1640 0.1447 0.1271 -0.0061 -0.0057 0.0039  594  ARG C O   
4743 C CB  . ARG C 10  ? 0.1398 0.1468 0.1522 -0.0071 -0.0036 -0.0030 594  ARG C CB  
4744 C CG  . ARG C 10  ? 0.1536 0.1528 0.1577 -0.0026 -0.0005 -0.0036 594  ARG C CG  
4745 C CD  . ARG C 10  ? 0.1498 0.1573 0.1535 -0.0025 0.0009  -0.0027 594  ARG C CD  
4746 N NE  . ARG C 10  ? 0.1437 0.1524 0.1541 -0.0065 -0.0060 -0.0021 594  ARG C NE  
4747 C CZ  . ARG C 10  ? 0.1478 0.1528 0.1473 -0.0104 -0.0026 -0.0104 594  ARG C CZ  
4748 N NH1 . ARG C 10  ? 0.1496 0.1410 0.1502 -0.0253 0.0095  -0.0101 594  ARG C NH1 
4749 N NH2 . ARG C 10  ? 0.1523 0.1481 0.1591 -0.0261 -0.0113 0.0007  594  ARG C NH2 
4750 N N   . PRO C 11  ? 0.1687 0.1537 0.1622 -0.0098 -0.0058 -0.0029 595  PRO C N   
4751 C CA  . PRO C 11  ? 0.1633 0.1611 0.1645 -0.0090 -0.0100 -0.0090 595  PRO C CA  
4752 C C   . PRO C 11  ? 0.1767 0.1870 0.1735 -0.0085 -0.0228 -0.0080 595  PRO C C   
4753 O O   . PRO C 11  ? 0.2036 0.1735 0.1950 0.0103  -0.0066 -0.0173 595  PRO C O   
4754 C CB  . PRO C 11  ? 0.1649 0.1628 0.1711 -0.0105 -0.0144 -0.0066 595  PRO C CB  
4755 C CG  . PRO C 11  ? 0.1637 0.1592 0.1777 -0.0155 -0.0079 -0.0078 595  PRO C CG  
4756 C CD  . PRO C 11  ? 0.1694 0.1573 0.1766 -0.0161 0.0003  -0.0082 595  PRO C CD  
4757 N N   . VAL C 12  ? 0.1918 0.1943 0.1965 0.0046  -0.0209 -0.0190 596  VAL C N   
4758 C CA  . VAL C 12  ? 0.2239 0.2234 0.1965 0.0045  -0.0236 -0.0088 596  VAL C CA  
4759 C C   . VAL C 12  ? 0.2322 0.2288 0.2335 -0.0043 -0.0271 -0.0085 596  VAL C C   
4760 O O   . VAL C 12  ? 0.2296 0.2244 0.2496 -0.0102 -0.0506 -0.0049 596  VAL C O   
4761 C CB  . VAL C 12  ? 0.2356 0.2351 0.2200 0.0072  -0.0148 -0.0216 596  VAL C CB  
4762 C CG1 . VAL C 12  ? 0.2307 0.2709 0.2263 0.0011  -0.0256 -0.0229 596  VAL C CG1 
4763 C CG2 . VAL C 12  ? 0.2528 0.2376 0.2338 0.0056  -0.0251 -0.0175 596  VAL C CG2 
4764 N N   . LEU C 13  ? 0.2513 0.2674 0.2547 0.0169  -0.0319 -0.0032 597  LEU C N   
4765 C CA  . LEU C 13  ? 0.2655 0.2954 0.3024 -0.0047 -0.0315 -0.0078 597  LEU C CA  
4766 C C   . LEU C 13  ? 0.3031 0.3078 0.2960 0.0128  -0.0241 -0.0122 597  LEU C C   
4767 O O   . LEU C 13  ? 0.3522 0.3259 0.3463 0.0260  -0.0533 -0.0044 597  LEU C O   
4768 C CB  . LEU C 13  ? 0.2864 0.3006 0.3053 0.0063  -0.0219 -0.0059 597  LEU C CB  
4769 C CG  . LEU C 13  ? 0.2961 0.2979 0.2984 0.0029  0.0051  -0.0050 597  LEU C CG  
4770 C CD1 . LEU C 13  ? 0.2913 0.3279 0.3338 0.0135  0.0063  0.0012  597  LEU C CD1 
4771 C CD2 . LEU C 13  ? 0.3034 0.3056 0.3096 0.0075  0.0109  0.0046  597  LEU C CD2 
4772 N N   . SER C 14  ? 0.3124 0.3068 0.3355 0.0076  -0.0340 -0.0040 598  SER C N   
4773 C CA  . SER C 14  ? 0.3171 0.3152 0.3327 -0.0032 -0.0198 -0.0021 598  SER C CA  
4774 C C   . SER C 14  ? 0.2995 0.3217 0.3438 -0.0003 -0.0226 0.0067  598  SER C C   
4775 O O   . SER C 14  ? 0.3531 0.3376 0.3628 0.0012  -0.0210 0.0213  598  SER C O   
4776 C CB  . SER C 14  ? 0.3187 0.3343 0.3358 0.0137  -0.0079 0.0162  598  SER C CB  
4777 O OG  . SER C 14  ? 0.3183 0.3884 0.3521 0.0033  -0.0199 0.0088  598  SER C OG  
4778 N N   . TYR C 15  ? 0.2786 0.2760 0.3410 -0.0242 -0.0111 0.0034  599  TYR C N   
4779 C CA  . TYR C 15  ? 0.2469 0.2620 0.3002 -0.0179 -0.0372 -0.0002 599  TYR C CA  
4780 C C   . TYR C 15  ? 0.1565 0.1912 0.3737 -0.0948 0.0380  0.0382  599  TYR C C   
4781 O O   . TYR C 15  ? 0.2001 0.2341 0.3127 -0.0432 -0.0049 0.0402  599  TYR C O   
4782 C CB  . TYR C 15  ? 0.2724 0.2653 0.3108 -0.0146 -0.0255 0.0120  599  TYR C CB  
4783 C CG  . TYR C 15  ? 0.2667 0.2724 0.2974 -0.0006 -0.0212 0.0019  599  TYR C CG  
4784 C CD1 . TYR C 15  ? 0.2689 0.2722 0.2875 0.0006  -0.0188 0.0020  599  TYR C CD1 
4785 C CD2 . TYR C 15  ? 0.2746 0.2662 0.2969 -0.0067 -0.0325 0.0009  599  TYR C CD2 
4786 C CE1 . TYR C 15  ? 0.2743 0.2701 0.2684 -0.0018 -0.0139 -0.0002 599  TYR C CE1 
4787 C CE2 . TYR C 15  ? 0.2697 0.2735 0.2681 0.0029  -0.0219 0.0021  599  TYR C CE2 
4788 C CZ  . TYR C 15  ? 0.2771 0.2706 0.2496 0.0007  -0.0133 0.0012  599  TYR C CZ  
4789 O OH  . TYR C 15  ? 0.2727 0.2803 0.2201 0.0095  -0.0112 -0.0093 599  TYR C OH  
4790 O OXT . TYR C 15  ? 0.1628 0.1374 0.3953 -0.0833 -0.1111 -0.0638 599  TYR C OXT 
4791 N N   . GLY D 2   ? 0.1966 0.2605 0.2124 -0.0430 -0.0131 -0.0071 586  GLY D N   
4792 C CA  . GLY D 2   ? 0.1772 0.2259 0.2119 -0.0216 -0.0085 -0.0070 586  GLY D CA  
4793 C C   . GLY D 2   ? 0.1759 0.2050 0.2010 -0.0175 0.0002  0.0012  586  GLY D C   
4794 O O   . GLY D 2   ? 0.1968 0.2214 0.2273 -0.0228 -0.0115 0.0320  586  GLY D O   
4795 N N   . THR D 3   ? 0.1492 0.1889 0.1882 -0.0068 -0.0107 -0.0002 587  THR D N   
4796 C CA  . THR D 3   ? 0.1487 0.1617 0.1716 0.0001  -0.0054 -0.0001 587  THR D CA  
4797 C C   . THR D 3   ? 0.1423 0.1509 0.1465 -0.0066 -0.0067 -0.0007 587  THR D C   
4798 O O   . THR D 3   ? 0.1301 0.1352 0.1362 0.0004  0.0033  -0.0138 587  THR D O   
4799 C CB  . THR D 3   ? 0.1461 0.1572 0.1786 0.0025  -0.0159 -0.0051 587  THR D CB  
4800 O OG1 . THR D 3   ? 0.1273 0.1471 0.1886 0.0016  -0.0129 -0.0028 587  THR D OG1 
4801 C CG2 . THR D 3   ? 0.1600 0.1632 0.1979 -0.0034 -0.0130 -0.0054 587  THR D CG2 
4802 N N   . CYS D 4   ? 0.1481 0.1432 0.1535 0.0013  -0.0153 -0.0020 588  CYS D N   
4803 C CA  . CYS D 4   ? 0.1411 0.1454 0.1490 -0.0033 -0.0166 0.0042  588  CYS D CA  
4804 C C   . CYS D 4   ? 0.1472 0.1434 0.1426 -0.0038 -0.0155 0.0002  588  CYS D C   
4805 O O   . CYS D 4   ? 0.1517 0.1463 0.1501 -0.0048 -0.0231 -0.0024 588  CYS D O   
4806 C CB  . CYS D 4   ? 0.1622 0.1550 0.1487 -0.0081 -0.0174 0.0065  588  CYS D CB  
4807 S SG  . CYS D 4   ? 0.1800 0.1756 0.1596 -0.0185 -0.0444 0.0289  588  CYS D SG  
4808 N N   . VAL D 5   ? 0.1380 0.1429 0.1403 -0.0059 -0.0146 0.0063  589  VAL D N   
4809 C CA  . VAL D 5   ? 0.1385 0.1360 0.1363 -0.0083 -0.0103 0.0000  589  VAL D CA  
4810 C C   . VAL D 5   ? 0.1316 0.1275 0.1347 -0.0055 -0.0055 -0.0006 589  VAL D C   
4811 O O   . VAL D 5   ? 0.1446 0.1213 0.1397 -0.0049 -0.0060 0.0027  589  VAL D O   
4812 C CB  . VAL D 5   ? 0.1389 0.1467 0.1415 -0.0048 -0.0092 0.0059  589  VAL D CB  
4813 C CG1 . VAL D 5   ? 0.1467 0.1612 0.1492 -0.0054 -0.0178 0.0038  589  VAL D CG1 
4814 C CG2 . VAL D 5   ? 0.1455 0.1571 0.1507 0.0003  -0.0125 -0.0042 589  VAL D CG2 
4815 N N   . ALA D 6   ? 0.1223 0.1267 0.1209 -0.0071 -0.0014 -0.0029 590  ALA D N   
4816 C CA  . ALA D 6   ? 0.1242 0.1125 0.1169 -0.0054 -0.0006 -0.0040 590  ALA D CA  
4817 C C   . ALA D 6   ? 0.1192 0.1162 0.1091 -0.0075 0.0007  -0.0029 590  ALA D C   
4818 O O   . ALA D 6   ? 0.1272 0.1193 0.1200 -0.0067 0.0064  -0.0097 590  ALA D O   
4819 C CB  . ALA D 6   ? 0.1193 0.1188 0.1175 -0.0048 -0.0043 -0.0080 590  ALA D CB  
4820 N N   . ALA D 7   ? 0.1174 0.1109 0.1110 -0.0098 -0.0139 -0.0025 591  ALA D N   
4821 C CA  . ALA D 7   ? 0.1157 0.1158 0.1084 -0.0065 -0.0082 -0.0008 591  ALA D CA  
4822 C C   . ALA D 7   ? 0.1180 0.1175 0.1052 -0.0041 -0.0084 -0.0009 591  ALA D C   
4823 O O   . ALA D 7   ? 0.1247 0.1177 0.1138 -0.0057 -0.0117 -0.0120 591  ALA D O   
4824 C CB  . ALA D 7   ? 0.1237 0.1319 0.1047 -0.0035 -0.0057 0.0025  591  ALA D CB  
4825 N N   . ARG D 8   ? 0.1195 0.1155 0.1073 0.0031  -0.0004 -0.0014 592  ARG D N   
4826 C CA  . ARG D 8   ? 0.1262 0.1166 0.1072 0.0053  0.0024  -0.0026 592  ARG D CA  
4827 C C   . ARG D 8   ? 0.1280 0.1216 0.1092 0.0000  -0.0014 -0.0026 592  ARG D C   
4828 O O   . ARG D 8   ? 0.1464 0.1258 0.1053 0.0078  -0.0049 -0.0084 592  ARG D O   
4829 C CB  . ARG D 8   ? 0.1294 0.1217 0.1203 0.0000  0.0012  -0.0077 592  ARG D CB  
4830 C CG  . ARG D 8   ? 0.1306 0.1228 0.1248 0.0010  0.0012  -0.0027 592  ARG D CG  
4831 C CD  . ARG D 8   ? 0.1299 0.1115 0.1194 0.0047  -0.0008 0.0008  592  ARG D CD  
4832 N NE  . ARG D 8   ? 0.1392 0.1136 0.1080 0.0040  -0.0078 0.0084  592  ARG D NE  
4833 C CZ  . ARG D 8   ? 0.1310 0.0999 0.1027 0.0088  0.0011  0.0055  592  ARG D CZ  
4834 N NH1 . ARG D 8   ? 0.1387 0.1036 0.0839 0.0053  0.0031  0.0219  592  ARG D NH1 
4835 N NH2 . ARG D 8   ? 0.1306 0.0950 0.0969 0.0081  -0.0034 0.0109  592  ARG D NH2 
4836 N N   . THR D 9   ? 0.1314 0.1235 0.1123 0.0042  -0.0006 -0.0001 593  THR D N   
4837 C CA  . THR D 9   ? 0.1413 0.1256 0.1205 -0.0010 -0.0064 -0.0029 593  THR D CA  
4838 C C   . THR D 9   ? 0.1376 0.1402 0.1323 -0.0016 -0.0006 -0.0016 593  THR D C   
4839 O O   . THR D 9   ? 0.1378 0.1565 0.1300 -0.0059 0.0049  -0.0064 593  THR D O   
4840 C CB  . THR D 9   ? 0.1471 0.1324 0.1202 -0.0016 -0.0025 0.0007  593  THR D CB  
4841 O OG1 . THR D 9   ? 0.1467 0.1365 0.1409 0.0035  -0.0039 0.0174  593  THR D OG1 
4842 C CG2 . THR D 9   ? 0.1495 0.1328 0.1256 -0.0031 -0.0081 0.0010  593  THR D CG2 
4843 N N   . ARG D 10  ? 0.1396 0.1426 0.1430 -0.0011 0.0097  -0.0029 594  ARG D N   
4844 C CA  . ARG D 10  ? 0.1497 0.1480 0.1619 -0.0092 0.0042  0.0039  594  ARG D CA  
4845 C C   . ARG D 10  ? 0.1592 0.1531 0.1587 -0.0063 0.0053  0.0057  594  ARG D C   
4846 O O   . ARG D 10  ? 0.1734 0.1233 0.1440 -0.0020 0.0053  0.0087  594  ARG D O   
4847 C CB  . ARG D 10  ? 0.1551 0.1518 0.1688 -0.0072 0.0101  0.0036  594  ARG D CB  
4848 C CG  . ARG D 10  ? 0.1624 0.1592 0.1561 -0.0095 0.0075  0.0071  594  ARG D CG  
4849 C CD  . ARG D 10  ? 0.1629 0.1678 0.1742 -0.0052 0.0032  0.0029  594  ARG D CD  
4850 N NE  . ARG D 10  ? 0.1714 0.1689 0.1727 -0.0106 0.0002  0.0057  594  ARG D NE  
4851 C CZ  . ARG D 10  ? 0.1704 0.1693 0.1656 -0.0068 -0.0153 0.0020  594  ARG D CZ  
4852 N NH1 . ARG D 10  ? 0.1732 0.1731 0.1652 -0.0151 -0.0354 0.0106  594  ARG D NH1 
4853 N NH2 . ARG D 10  ? 0.1909 0.1581 0.1762 -0.0076 -0.0214 -0.0063 594  ARG D NH2 
4854 N N   . PRO D 11  ? 0.1702 0.1604 0.1725 -0.0123 0.0034  0.0022  595  PRO D N   
4855 C CA  . PRO D 11  ? 0.1863 0.1722 0.1806 -0.0065 0.0093  0.0115  595  PRO D CA  
4856 C C   . PRO D 11  ? 0.1994 0.1955 0.1859 -0.0034 0.0165  0.0113  595  PRO D C   
4857 O O   . PRO D 11  ? 0.1990 0.2167 0.1965 0.0062  0.0328  0.0310  595  PRO D O   
4858 C CB  . PRO D 11  ? 0.1881 0.1729 0.1891 -0.0054 0.0060  0.0085  595  PRO D CB  
4859 C CG  . PRO D 11  ? 0.1834 0.1720 0.1949 -0.0123 -0.0009 0.0057  595  PRO D CG  
4860 C CD  . PRO D 11  ? 0.1742 0.1698 0.1826 -0.0101 -0.0058 0.0048  595  PRO D CD  
4861 N N   . VAL D 12  ? 0.2137 0.2046 0.2092 0.0082  0.0097  0.0218  596  VAL D N   
4862 C CA  . VAL D 12  ? 0.2390 0.2367 0.2164 0.0023  0.0206  0.0196  596  VAL D CA  
4863 C C   . VAL D 12  ? 0.2478 0.2395 0.2452 -0.0061 0.0140  0.0139  596  VAL D C   
4864 O O   . VAL D 12  ? 0.2583 0.2388 0.2338 -0.0259 0.0096  0.0272  596  VAL D O   
4865 C CB  . VAL D 12  ? 0.2539 0.2429 0.2511 0.0159  0.0098  0.0267  596  VAL D CB  
4866 C CG1 . VAL D 12  ? 0.2523 0.2716 0.2765 0.0126  0.0062  0.0231  596  VAL D CG1 
4867 C CG2 . VAL D 12  ? 0.2746 0.2470 0.2449 0.0109  0.0115  0.0169  596  VAL D CG2 
4868 N N   . LEU D 13  ? 0.2714 0.2683 0.2516 0.0062  0.0267  0.0140  597  LEU D N   
4869 C CA  . LEU D 13  ? 0.2801 0.3010 0.2973 -0.0074 0.0298  0.0121  597  LEU D CA  
4870 C C   . LEU D 13  ? 0.3277 0.3216 0.3013 0.0026  0.0418  0.0194  597  LEU D C   
4871 O O   . LEU D 13  ? 0.3745 0.3299 0.3308 0.0186  0.0709  0.0202  597  LEU D O   
4872 C CB  . LEU D 13  ? 0.2993 0.3108 0.3161 0.0043  0.0195  0.0108  597  LEU D CB  
4873 C CG  . LEU D 13  ? 0.2969 0.3194 0.3188 -0.0023 0.0219  0.0131  597  LEU D CG  
4874 C CD1 . LEU D 13  ? 0.3181 0.3296 0.3723 0.0121  0.0118  0.0214  597  LEU D CD1 
4875 C CD2 . LEU D 13  ? 0.3131 0.3408 0.3283 -0.0065 0.0059  0.0003  597  LEU D CD2 
4876 N N   . SER D 14  ? 0.3340 0.3249 0.3282 0.0050  0.0419  0.0127  598  SER D N   
4877 C CA  . SER D 14  ? 0.3366 0.3323 0.3238 -0.0049 0.0370  0.0086  598  SER D CA  
4878 C C   . SER D 14  ? 0.3189 0.3396 0.3530 0.0017  0.0389  -0.0081 598  SER D C   
4879 O O   . SER D 14  ? 0.3697 0.3659 0.3860 0.0052  0.0194  -0.0398 598  SER D O   
4880 C CB  . SER D 14  ? 0.3453 0.3572 0.3576 0.0107  0.0290  0.0013  598  SER D CB  
4881 O OG  . SER D 14  ? 0.3875 0.3947 0.3754 0.0104  0.0452  -0.0075 598  SER D OG  
4882 N N   . TYR D 15  ? 0.2980 0.2947 0.3357 -0.0101 0.0255  0.0084  599  TYR D N   
4883 C CA  . TYR D 15  ? 0.2814 0.2737 0.3061 0.0061  0.0251  0.0076  599  TYR D CA  
4884 C C   . TYR D 15  ? 0.2532 0.2769 0.3152 -0.0099 0.0216  0.0095  599  TYR D C   
4885 O O   . TYR D 15  ? 0.2149 0.2757 0.3198 -0.0113 0.0158  0.0098  599  TYR D O   
4886 C CB  . TYR D 15  ? 0.2675 0.2712 0.3091 0.0081  0.0273  0.0048  599  TYR D CB  
4887 C CG  . TYR D 15  ? 0.2708 0.2664 0.2897 0.0034  0.0253  0.0097  599  TYR D CG  
4888 C CD1 . TYR D 15  ? 0.2632 0.2710 0.2814 0.0032  0.0279  0.0065  599  TYR D CD1 
4889 C CD2 . TYR D 15  ? 0.2669 0.2556 0.2852 0.0039  0.0188  0.0104  599  TYR D CD2 
4890 C CE1 . TYR D 15  ? 0.2550 0.2724 0.2565 0.0042  0.0229  0.0152  599  TYR D CE1 
4891 C CE2 . TYR D 15  ? 0.2563 0.2587 0.2645 0.0075  0.0159  0.0118  599  TYR D CE2 
4892 C CZ  . TYR D 15  ? 0.2602 0.2554 0.2442 0.0144  0.0206  0.0148  599  TYR D CZ  
4893 O OH  . TYR D 15  ? 0.2399 0.2540 0.2361 0.0112  0.0261  0.0269  599  TYR D OH  
4894 O OXT . TYR D 15  ? 0.2575 0.2566 0.3609 -0.0080 0.0225  0.0254  599  TYR D OXT 
4895 C C1  . GOL E .   ? 0.3134 0.2690 0.2750 -0.0037 0.0146  -0.0059 1335 GOL A C1  
4896 O O1  . GOL E .   ? 0.3800 0.2737 0.3411 0.0181  0.0344  -0.0057 1335 GOL A O1  
4897 C C2  . GOL E .   ? 0.2724 0.2604 0.2763 -0.0117 0.0028  0.0058  1335 GOL A C2  
4898 O O2  . GOL E .   ? 0.2687 0.2895 0.2818 -0.0258 0.0027  -0.0115 1335 GOL A O2  
4899 C C3  . GOL E .   ? 0.2555 0.2544 0.2323 -0.0109 -0.0153 0.0023  1335 GOL A C3  
4900 O O3  . GOL E .   ? 0.2683 0.2427 0.2055 0.0059  -0.0173 0.0151  1335 GOL A O3  
4901 C C1  . GOL F .   ? 0.2616 0.2963 0.2680 -0.0067 -0.0012 0.0032  1335 GOL B C1  
4902 O O1  . GOL F .   ? 0.3318 0.3264 0.3196 0.0192  0.0031  -0.0320 1335 GOL B O1  
4903 C C2  . GOL F .   ? 0.2559 0.2610 0.2415 -0.0149 0.0188  0.0046  1335 GOL B C2  
4904 O O2  . GOL F .   ? 0.2362 0.2083 0.1948 0.0018  0.0041  -0.0206 1335 GOL B O2  
4905 C C3  . GOL F .   ? 0.2746 0.2565 0.2631 -0.0143 0.0051  0.0058  1335 GOL B C3  
4906 O O3  . GOL F .   ? 0.2953 0.2627 0.2487 -0.0462 0.0031  0.0221  1335 GOL B O3  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   21  ?   ?   ?   A . n 
A 1 2   GLY 2   22  ?   ?   ?   A . n 
A 1 3   ALA 3   23  ?   ?   ?   A . n 
A 1 4   THR 4   24  ?   ?   ?   A . n 
A 1 5   GLN 5   25  ?   ?   ?   A . n 
A 1 6   SER 6   26  ?   ?   ?   A . n 
A 1 7   LYS 7   27  ?   ?   ?   A . n 
A 1 8   PRO 8   28  ?   ?   ?   A . n 
A 1 9   THR 9   29  ?   ?   ?   A . n 
A 1 10  PRO 10  30  ?   ?   ?   A . n 
A 1 11  VAL 11  31  31  VAL VAL A . n 
A 1 12  LYS 12  32  32  LYS LYS A . n 
A 1 13  PRO 13  33  33  PRO PRO A . n 
A 1 14  ASN 14  34  34  ASN ASN A . n 
A 1 15  TYR 15  35  35  TYR TYR A . n 
A 1 16  ALA 16  36  36  ALA ALA A . n 
A 1 17  LEU 17  37  37  LEU LEU A . n 
A 1 18  LYS 18  38  38  LYS LYS A . n 
A 1 19  PHE 19  39  39  PHE PHE A . n 
A 1 20  THR 20  40  40  THR THR A . n 
A 1 21  LEU 21  41  41  LEU LEU A . n 
A 1 22  ALA 22  42  42  ALA ALA A . n 
A 1 23  GLY 23  43  43  GLY GLY A . n 
A 1 24  HIS 24  44  44  HIS HIS A . n 
A 1 25  THR 25  45  45  THR THR A . n 
A 1 26  LYS 26  46  46  LYS LYS A . n 
A 1 27  ALA 27  47  47  ALA ALA A . n 
A 1 28  VAL 28  48  48  VAL VAL A . n 
A 1 29  SER 29  49  49  SER SER A . n 
A 1 30  SER 30  50  50  SER SER A . n 
A 1 31  VAL 31  51  51  VAL VAL A . n 
A 1 32  LYS 32  52  52  LYS LYS A . n 
A 1 33  PHE 33  53  53  PHE PHE A . n 
A 1 34  SER 34  54  54  SER SER A . n 
A 1 35  PRO 35  55  55  PRO PRO A . n 
A 1 36  ASN 36  56  56  ASN ASN A . n 
A 1 37  GLY 37  57  57  GLY GLY A . n 
A 1 38  GLU 38  58  58  GLU GLU A . n 
A 1 39  TRP 39  59  59  TRP TRP A . n 
A 1 40  LEU 40  60  60  LEU LEU A . n 
A 1 41  ALA 41  61  61  ALA ALA A . n 
A 1 42  SER 42  62  62  SER SER A . n 
A 1 43  SER 43  63  63  SER SER A . n 
A 1 44  SER 44  64  64  SER SER A . n 
A 1 45  ALA 45  65  65  ALA ALA A . n 
A 1 46  ASP 46  66  66  ASP ASP A . n 
A 1 47  LYS 47  67  67  LYS LYS A . n 
A 1 48  LEU 48  68  68  LEU LEU A . n 
A 1 49  ILE 49  69  69  ILE ILE A . n 
A 1 50  LYS 50  70  70  LYS LYS A . n 
A 1 51  ILE 51  71  71  ILE ILE A . n 
A 1 52  TRP 52  72  72  TRP TRP A . n 
A 1 53  GLY 53  73  73  GLY GLY A . n 
A 1 54  ALA 54  74  74  ALA ALA A . n 
A 1 55  TYR 55  75  75  TYR TYR A . n 
A 1 56  ASP 56  76  76  ASP ASP A . n 
A 1 57  GLY 57  77  77  GLY GLY A . n 
A 1 58  LYS 58  78  78  LYS LYS A . n 
A 1 59  PHE 59  79  79  PHE PHE A . n 
A 1 60  GLU 60  80  80  GLU GLU A . n 
A 1 61  LYS 61  81  81  LYS LYS A . n 
A 1 62  THR 62  82  82  THR THR A . n 
A 1 63  ILE 63  83  83  ILE ILE A . n 
A 1 64  SER 64  84  84  SER SER A . n 
A 1 65  GLY 65  85  85  GLY GLY A . n 
A 1 66  HIS 66  86  86  HIS HIS A . n 
A 1 67  LYS 67  87  87  LYS LYS A . n 
A 1 68  LEU 68  88  88  LEU LEU A . n 
A 1 69  GLY 69  89  89  GLY GLY A . n 
A 1 70  ILE 70  90  90  ILE ILE A . n 
A 1 71  SER 71  91  91  SER SER A . n 
A 1 72  ASP 72  92  92  ASP ASP A . n 
A 1 73  VAL 73  93  93  VAL VAL A . n 
A 1 74  ALA 74  94  94  ALA ALA A . n 
A 1 75  TRP 75  95  95  TRP TRP A . n 
A 1 76  SER 76  96  96  SER SER A . n 
A 1 77  SER 77  97  97  SER SER A . n 
A 1 78  ASP 78  98  98  ASP ASP A . n 
A 1 79  SER 79  99  99  SER SER A . n 
A 1 80  ASN 80  100 100 ASN ASN A . n 
A 1 81  LEU 81  101 101 LEU LEU A . n 
A 1 82  LEU 82  102 102 LEU LEU A . n 
A 1 83  VAL 83  103 103 VAL VAL A . n 
A 1 84  SER 84  104 104 SER SER A . n 
A 1 85  ALA 85  105 105 ALA ALA A . n 
A 1 86  SER 86  106 106 SER SER A . n 
A 1 87  ASP 87  107 107 ASP ASP A . n 
A 1 88  ASP 88  108 108 ASP ASP A . n 
A 1 89  LYS 89  109 109 LYS LYS A . n 
A 1 90  THR 90  110 110 THR THR A . n 
A 1 91  LEU 91  111 111 LEU LEU A . n 
A 1 92  LYS 92  112 112 LYS LYS A . n 
A 1 93  ILE 93  113 113 ILE ILE A . n 
A 1 94  TRP 94  114 114 TRP TRP A . n 
A 1 95  ASP 95  115 115 ASP ASP A . n 
A 1 96  VAL 96  116 116 VAL VAL A . n 
A 1 97  SER 97  117 117 SER SER A . n 
A 1 98  SER 98  118 118 SER SER A . n 
A 1 99  GLY 99  119 119 GLY GLY A . n 
A 1 100 LYS 100 120 120 LYS LYS A . n 
A 1 101 CYS 101 121 121 CYS CYS A . n 
A 1 102 LEU 102 122 122 LEU LEU A . n 
A 1 103 LYS 103 123 123 LYS LYS A . n 
A 1 104 THR 104 124 124 THR THR A . n 
A 1 105 LEU 105 125 125 LEU LEU A . n 
A 1 106 LYS 106 126 126 LYS LYS A . n 
A 1 107 GLY 107 127 127 GLY GLY A . n 
A 1 108 HIS 108 128 128 HIS HIS A . n 
A 1 109 SER 109 129 129 SER SER A . n 
A 1 110 ASN 110 130 130 ASN ASN A . n 
A 1 111 TYR 111 131 131 TYR TYR A . n 
A 1 112 VAL 112 132 132 VAL VAL A . n 
A 1 113 PHE 113 133 133 PHE PHE A . n 
A 1 114 CYS 114 134 134 CYS CYS A . n 
A 1 115 CYS 115 135 135 CYS CYS A . n 
A 1 116 ASN 116 136 136 ASN ASN A . n 
A 1 117 PHE 117 137 137 PHE PHE A . n 
A 1 118 ASN 118 138 138 ASN ASN A . n 
A 1 119 PRO 119 139 139 PRO PRO A . n 
A 1 120 GLN 120 140 140 GLN GLN A . n 
A 1 121 SER 121 141 141 SER SER A . n 
A 1 122 ASN 122 142 142 ASN ASN A . n 
A 1 123 LEU 123 143 143 LEU LEU A . n 
A 1 124 ILE 124 144 144 ILE ILE A . n 
A 1 125 VAL 125 145 145 VAL VAL A . n 
A 1 126 SER 126 146 146 SER SER A . n 
A 1 127 GLY 127 147 147 GLY GLY A . n 
A 1 128 SER 128 148 148 SER SER A . n 
A 1 129 PHE 129 149 149 PHE PHE A . n 
A 1 130 ASP 130 150 150 ASP ASP A . n 
A 1 131 GLU 131 151 151 GLU GLU A . n 
A 1 132 SER 132 152 152 SER SER A . n 
A 1 133 VAL 133 153 153 VAL VAL A . n 
A 1 134 ARG 134 154 154 ARG ARG A . n 
A 1 135 ILE 135 155 155 ILE ILE A . n 
A 1 136 TRP 136 156 156 TRP TRP A . n 
A 1 137 ASP 137 157 157 ASP ASP A . n 
A 1 138 VAL 138 158 158 VAL VAL A . n 
A 1 139 LYS 139 159 159 LYS LYS A . n 
A 1 140 THR 140 160 160 THR THR A . n 
A 1 141 GLY 141 161 161 GLY GLY A . n 
A 1 142 LYS 142 162 162 LYS LYS A . n 
A 1 143 CYS 143 163 163 CYS CYS A . n 
A 1 144 LEU 144 164 164 LEU LEU A . n 
A 1 145 LYS 145 165 165 LYS LYS A . n 
A 1 146 THR 146 166 166 THR THR A . n 
A 1 147 LEU 147 167 167 LEU LEU A . n 
A 1 148 PRO 148 168 168 PRO PRO A . n 
A 1 149 ALA 149 169 169 ALA ALA A . n 
A 1 150 HIS 150 170 170 HIS HIS A . n 
A 1 151 SER 151 171 171 SER SER A . n 
A 1 152 ASP 152 172 172 ASP ASP A . n 
A 1 153 PRO 153 173 173 PRO PRO A . n 
A 1 154 VAL 154 174 174 VAL VAL A . n 
A 1 155 SER 155 175 175 SER SER A . n 
A 1 156 ALA 156 176 176 ALA ALA A . n 
A 1 157 VAL 157 177 177 VAL VAL A . n 
A 1 158 HIS 158 178 178 HIS HIS A . n 
A 1 159 PHE 159 179 179 PHE PHE A . n 
A 1 160 ASN 160 180 180 ASN ASN A . n 
A 1 161 ARG 161 181 181 ARG ARG A . n 
A 1 162 ASP 162 182 182 ASP ASP A . n 
A 1 163 GLY 163 183 183 GLY GLY A . n 
A 1 164 SER 164 184 184 SER SER A . n 
A 1 165 LEU 165 185 185 LEU LEU A . n 
A 1 166 ILE 166 186 186 ILE ILE A . n 
A 1 167 VAL 167 187 187 VAL VAL A . n 
A 1 168 SER 168 188 188 SER SER A . n 
A 1 169 SER 169 189 189 SER SER A . n 
A 1 170 SER 170 190 190 SER SER A . n 
A 1 171 TYR 171 191 191 TYR TYR A . n 
A 1 172 ASP 172 192 192 ASP ASP A . n 
A 1 173 GLY 173 193 193 GLY GLY A . n 
A 1 174 LEU 174 194 194 LEU LEU A . n 
A 1 175 CYS 175 195 195 CYS CYS A . n 
A 1 176 ARG 176 196 196 ARG ARG A . n 
A 1 177 ILE 177 197 197 ILE ILE A . n 
A 1 178 TRP 178 198 198 TRP TRP A . n 
A 1 179 ASP 179 199 199 ASP ASP A . n 
A 1 180 THR 180 200 200 THR THR A . n 
A 1 181 ALA 181 201 201 ALA ALA A . n 
A 1 182 SER 182 202 202 SER SER A . n 
A 1 183 GLY 183 203 203 GLY GLY A . n 
A 1 184 GLN 184 204 204 GLN GLN A . n 
A 1 185 CYS 185 205 205 CYS CYS A . n 
A 1 186 LEU 186 206 206 LEU LEU A . n 
A 1 187 LYS 187 207 207 LYS LYS A . n 
A 1 188 THR 188 208 208 THR THR A . n 
A 1 189 LEU 189 209 209 LEU LEU A . n 
A 1 190 ILE 190 210 210 ILE ILE A . n 
A 1 191 ASP 191 211 211 ASP ASP A . n 
A 1 192 ASP 192 212 212 ASP ASP A . n 
A 1 193 ASP 193 213 ?   ?   ?   A . n 
A 1 194 ASN 194 214 214 ASN ASN A . n 
A 1 195 PRO 195 215 215 PRO PRO A . n 
A 1 196 PRO 196 216 216 PRO PRO A . n 
A 1 197 VAL 197 217 217 VAL VAL A . n 
A 1 198 SER 198 218 218 SER SER A . n 
A 1 199 PHE 199 219 219 PHE PHE A . n 
A 1 200 VAL 200 220 220 VAL VAL A . n 
A 1 201 LYS 201 221 221 LYS LYS A . n 
A 1 202 PHE 202 222 222 PHE PHE A . n 
A 1 203 SER 203 223 223 SER SER A . n 
A 1 204 PRO 204 224 224 PRO PRO A . n 
A 1 205 ASN 205 225 225 ASN ASN A . n 
A 1 206 GLY 206 226 226 GLY GLY A . n 
A 1 207 LYS 207 227 227 LYS LYS A . n 
A 1 208 TYR 208 228 228 TYR TYR A . n 
A 1 209 ILE 209 229 229 ILE ILE A . n 
A 1 210 LEU 210 230 230 LEU LEU A . n 
A 1 211 ALA 211 231 231 ALA ALA A . n 
A 1 212 ALA 212 232 232 ALA ALA A . n 
A 1 213 THR 213 233 233 THR THR A . n 
A 1 214 LEU 214 234 234 LEU LEU A . n 
A 1 215 ASP 215 235 235 ASP ASP A . n 
A 1 216 ASN 216 236 236 ASN ASN A . n 
A 1 217 THR 217 237 237 THR THR A . n 
A 1 218 LEU 218 238 238 LEU LEU A . n 
A 1 219 LYS 219 239 239 LYS LYS A . n 
A 1 220 LEU 220 240 240 LEU LEU A . n 
A 1 221 TRP 221 241 241 TRP TRP A . n 
A 1 222 ASP 222 242 242 ASP ASP A . n 
A 1 223 TYR 223 243 243 TYR TYR A . n 
A 1 224 SER 224 244 244 SER SER A . n 
A 1 225 LYS 225 245 245 LYS LYS A . n 
A 1 226 GLY 226 246 246 GLY GLY A . n 
A 1 227 LYS 227 247 247 LYS LYS A . n 
A 1 228 CYS 228 248 248 CYS CYS A . n 
A 1 229 LEU 229 249 249 LEU LEU A . n 
A 1 230 LYS 230 250 250 LYS LYS A . n 
A 1 231 THR 231 251 251 THR THR A . n 
A 1 232 TYR 232 252 252 TYR TYR A . n 
A 1 233 THR 233 253 253 THR THR A . n 
A 1 234 GLY 234 254 254 GLY GLY A . n 
A 1 235 HIS 235 255 255 HIS HIS A . n 
A 1 236 LYS 236 256 256 LYS LYS A . n 
A 1 237 ASN 237 257 257 ASN ASN A . n 
A 1 238 GLU 238 258 258 GLU GLU A . n 
A 1 239 LYS 239 259 259 LYS LYS A . n 
A 1 240 TYR 240 260 260 TYR TYR A . n 
A 1 241 CYS 241 261 261 CYS CYS A . n 
A 1 242 ILE 242 262 262 ILE ILE A . n 
A 1 243 PHE 243 263 263 PHE PHE A . n 
A 1 244 ALA 244 264 264 ALA ALA A . n 
A 1 245 ASN 245 265 265 ASN ASN A . n 
A 1 246 PHE 246 266 266 PHE PHE A . n 
A 1 247 SER 247 267 267 SER SER A . n 
A 1 248 VAL 248 268 268 VAL VAL A . n 
A 1 249 THR 249 269 269 THR THR A . n 
A 1 250 GLY 250 270 270 GLY GLY A . n 
A 1 251 GLY 251 271 271 GLY GLY A . n 
A 1 252 LYS 252 272 272 LYS LYS A . n 
A 1 253 TRP 253 273 273 TRP TRP A . n 
A 1 254 ILE 254 274 274 ILE ILE A . n 
A 1 255 VAL 255 275 275 VAL VAL A . n 
A 1 256 SER 256 276 276 SER SER A . n 
A 1 257 GLY 257 277 277 GLY GLY A . n 
A 1 258 SER 258 278 278 SER SER A . n 
A 1 259 GLU 259 279 279 GLU GLU A . n 
A 1 260 ASP 260 280 280 ASP ASP A . n 
A 1 261 ASN 261 281 281 ASN ASN A . n 
A 1 262 LEU 262 282 282 LEU LEU A . n 
A 1 263 VAL 263 283 283 VAL VAL A . n 
A 1 264 TYR 264 284 284 TYR TYR A . n 
A 1 265 ILE 265 285 285 ILE ILE A . n 
A 1 266 TRP 266 286 286 TRP TRP A . n 
A 1 267 ASN 267 287 287 ASN ASN A . n 
A 1 268 LEU 268 288 288 LEU LEU A . n 
A 1 269 GLN 269 289 289 GLN GLN A . n 
A 1 270 THR 270 290 290 THR THR A . n 
A 1 271 LYS 271 291 291 LYS LYS A . n 
A 1 272 GLU 272 292 292 GLU GLU A . n 
A 1 273 ILE 273 293 293 ILE ILE A . n 
A 1 274 VAL 274 294 294 VAL VAL A . n 
A 1 275 GLN 275 295 295 GLN GLN A . n 
A 1 276 LYS 276 296 296 LYS LYS A . n 
A 1 277 LEU 277 297 297 LEU LEU A . n 
A 1 278 GLN 278 298 298 GLN GLN A . n 
A 1 279 GLY 279 299 299 GLY GLY A . n 
A 1 280 HIS 280 300 300 HIS HIS A . n 
A 1 281 THR 281 301 301 THR THR A . n 
A 1 282 ASP 282 302 302 ASP ASP A . n 
A 1 283 VAL 283 303 303 VAL VAL A . n 
A 1 284 VAL 284 304 304 VAL VAL A . n 
A 1 285 ILE 285 305 305 ILE ILE A . n 
A 1 286 SER 286 306 306 SER SER A . n 
A 1 287 THR 287 307 307 THR THR A . n 
A 1 288 ALA 288 308 308 ALA ALA A . n 
A 1 289 CYS 289 309 309 CYS CYS A . n 
A 1 290 HIS 290 310 310 HIS HIS A . n 
A 1 291 PRO 291 311 311 PRO PRO A . n 
A 1 292 THR 292 312 312 THR THR A . n 
A 1 293 GLU 293 313 313 GLU GLU A . n 
A 1 294 ASN 294 314 314 ASN ASN A . n 
A 1 295 ILE 295 315 315 ILE ILE A . n 
A 1 296 ILE 296 316 316 ILE ILE A . n 
A 1 297 ALA 297 317 317 ALA ALA A . n 
A 1 298 SER 298 318 318 SER SER A . n 
A 1 299 ALA 299 319 319 ALA ALA A . n 
A 1 300 ALA 300 320 320 ALA ALA A . n 
A 1 301 LEU 301 321 321 LEU LEU A . n 
A 1 302 GLU 302 322 322 GLU GLU A . n 
A 1 303 ASN 303 323 323 ASN ASN A . n 
A 1 304 ASP 304 324 324 ASP ASP A . n 
A 1 305 LYS 305 325 325 LYS LYS A . n 
A 1 306 THR 306 326 326 THR THR A . n 
A 1 307 ILE 307 327 327 ILE ILE A . n 
A 1 308 LYS 308 328 328 LYS LYS A . n 
A 1 309 LEU 309 329 329 LEU LEU A . n 
A 1 310 TRP 310 330 330 TRP TRP A . n 
A 1 311 LYS 311 331 331 LYS LYS A . n 
A 1 312 SER 312 332 332 SER SER A . n 
A 1 313 ASP 313 333 333 ASP ASP A . n 
A 1 314 CYS 314 334 334 CYS CYS A . n 
A 1 315 GLY 315 335 ?   ?   ?   A . n 
A 1 316 ALA 316 336 ?   ?   ?   A . n 
B 1 1   MET 1   21  ?   ?   ?   B . n 
B 1 2   GLY 2   22  ?   ?   ?   B . n 
B 1 3   ALA 3   23  ?   ?   ?   B . n 
B 1 4   THR 4   24  ?   ?   ?   B . n 
B 1 5   GLN 5   25  ?   ?   ?   B . n 
B 1 6   SER 6   26  ?   ?   ?   B . n 
B 1 7   LYS 7   27  ?   ?   ?   B . n 
B 1 8   PRO 8   28  ?   ?   ?   B . n 
B 1 9   THR 9   29  ?   ?   ?   B . n 
B 1 10  PRO 10  30  ?   ?   ?   B . n 
B 1 11  VAL 11  31  ?   ?   ?   B . n 
B 1 12  LYS 12  32  32  LYS LYS B . n 
B 1 13  PRO 13  33  33  PRO PRO B . n 
B 1 14  ASN 14  34  34  ASN ASN B . n 
B 1 15  TYR 15  35  35  TYR TYR B . n 
B 1 16  ALA 16  36  36  ALA ALA B . n 
B 1 17  LEU 17  37  37  LEU LEU B . n 
B 1 18  LYS 18  38  38  LYS LYS B . n 
B 1 19  PHE 19  39  39  PHE PHE B . n 
B 1 20  THR 20  40  40  THR THR B . n 
B 1 21  LEU 21  41  41  LEU LEU B . n 
B 1 22  ALA 22  42  42  ALA ALA B . n 
B 1 23  GLY 23  43  43  GLY GLY B . n 
B 1 24  HIS 24  44  44  HIS HIS B . n 
B 1 25  THR 25  45  45  THR THR B . n 
B 1 26  LYS 26  46  46  LYS LYS B . n 
B 1 27  ALA 27  47  47  ALA ALA B . n 
B 1 28  VAL 28  48  48  VAL VAL B . n 
B 1 29  SER 29  49  49  SER SER B . n 
B 1 30  SER 30  50  50  SER SER B . n 
B 1 31  VAL 31  51  51  VAL VAL B . n 
B 1 32  LYS 32  52  52  LYS LYS B . n 
B 1 33  PHE 33  53  53  PHE PHE B . n 
B 1 34  SER 34  54  54  SER SER B . n 
B 1 35  PRO 35  55  55  PRO PRO B . n 
B 1 36  ASN 36  56  56  ASN ASN B . n 
B 1 37  GLY 37  57  57  GLY GLY B . n 
B 1 38  GLU 38  58  58  GLU GLU B . n 
B 1 39  TRP 39  59  59  TRP TRP B . n 
B 1 40  LEU 40  60  60  LEU LEU B . n 
B 1 41  ALA 41  61  61  ALA ALA B . n 
B 1 42  SER 42  62  62  SER SER B . n 
B 1 43  SER 43  63  63  SER SER B . n 
B 1 44  SER 44  64  64  SER SER B . n 
B 1 45  ALA 45  65  65  ALA ALA B . n 
B 1 46  ASP 46  66  66  ASP ASP B . n 
B 1 47  LYS 47  67  67  LYS LYS B . n 
B 1 48  LEU 48  68  68  LEU LEU B . n 
B 1 49  ILE 49  69  69  ILE ILE B . n 
B 1 50  LYS 50  70  70  LYS LYS B . n 
B 1 51  ILE 51  71  71  ILE ILE B . n 
B 1 52  TRP 52  72  72  TRP TRP B . n 
B 1 53  GLY 53  73  73  GLY GLY B . n 
B 1 54  ALA 54  74  74  ALA ALA B . n 
B 1 55  TYR 55  75  75  TYR TYR B . n 
B 1 56  ASP 56  76  76  ASP ASP B . n 
B 1 57  GLY 57  77  77  GLY GLY B . n 
B 1 58  LYS 58  78  78  LYS LYS B . n 
B 1 59  PHE 59  79  79  PHE PHE B . n 
B 1 60  GLU 60  80  80  GLU GLU B . n 
B 1 61  LYS 61  81  81  LYS LYS B . n 
B 1 62  THR 62  82  82  THR THR B . n 
B 1 63  ILE 63  83  83  ILE ILE B . n 
B 1 64  SER 64  84  84  SER SER B . n 
B 1 65  GLY 65  85  85  GLY GLY B . n 
B 1 66  HIS 66  86  86  HIS HIS B . n 
B 1 67  LYS 67  87  87  LYS LYS B . n 
B 1 68  LEU 68  88  88  LEU LEU B . n 
B 1 69  GLY 69  89  89  GLY GLY B . n 
B 1 70  ILE 70  90  90  ILE ILE B . n 
B 1 71  SER 71  91  91  SER SER B . n 
B 1 72  ASP 72  92  92  ASP ASP B . n 
B 1 73  VAL 73  93  93  VAL VAL B . n 
B 1 74  ALA 74  94  94  ALA ALA B . n 
B 1 75  TRP 75  95  95  TRP TRP B . n 
B 1 76  SER 76  96  96  SER SER B . n 
B 1 77  SER 77  97  97  SER SER B . n 
B 1 78  ASP 78  98  98  ASP ASP B . n 
B 1 79  SER 79  99  99  SER SER B . n 
B 1 80  ASN 80  100 100 ASN ASN B . n 
B 1 81  LEU 81  101 101 LEU LEU B . n 
B 1 82  LEU 82  102 102 LEU LEU B . n 
B 1 83  VAL 83  103 103 VAL VAL B . n 
B 1 84  SER 84  104 104 SER SER B . n 
B 1 85  ALA 85  105 105 ALA ALA B . n 
B 1 86  SER 86  106 106 SER SER B . n 
B 1 87  ASP 87  107 107 ASP ASP B . n 
B 1 88  ASP 88  108 108 ASP ASP B . n 
B 1 89  LYS 89  109 109 LYS LYS B . n 
B 1 90  THR 90  110 110 THR THR B . n 
B 1 91  LEU 91  111 111 LEU LEU B . n 
B 1 92  LYS 92  112 112 LYS LYS B . n 
B 1 93  ILE 93  113 113 ILE ILE B . n 
B 1 94  TRP 94  114 114 TRP TRP B . n 
B 1 95  ASP 95  115 115 ASP ASP B . n 
B 1 96  VAL 96  116 116 VAL VAL B . n 
B 1 97  SER 97  117 117 SER SER B . n 
B 1 98  SER 98  118 118 SER SER B . n 
B 1 99  GLY 99  119 119 GLY GLY B . n 
B 1 100 LYS 100 120 120 LYS LYS B . n 
B 1 101 CYS 101 121 121 CYS CYS B . n 
B 1 102 LEU 102 122 122 LEU LEU B . n 
B 1 103 LYS 103 123 123 LYS LYS B . n 
B 1 104 THR 104 124 124 THR THR B . n 
B 1 105 LEU 105 125 125 LEU LEU B . n 
B 1 106 LYS 106 126 126 LYS LYS B . n 
B 1 107 GLY 107 127 127 GLY GLY B . n 
B 1 108 HIS 108 128 128 HIS HIS B . n 
B 1 109 SER 109 129 129 SER SER B . n 
B 1 110 ASN 110 130 130 ASN ASN B . n 
B 1 111 TYR 111 131 131 TYR TYR B . n 
B 1 112 VAL 112 132 132 VAL VAL B . n 
B 1 113 PHE 113 133 133 PHE PHE B . n 
B 1 114 CYS 114 134 134 CYS CYS B . n 
B 1 115 CYS 115 135 135 CYS CYS B . n 
B 1 116 ASN 116 136 136 ASN ASN B . n 
B 1 117 PHE 117 137 137 PHE PHE B . n 
B 1 118 ASN 118 138 138 ASN ASN B . n 
B 1 119 PRO 119 139 139 PRO PRO B . n 
B 1 120 GLN 120 140 140 GLN GLN B . n 
B 1 121 SER 121 141 141 SER SER B . n 
B 1 122 ASN 122 142 142 ASN ASN B . n 
B 1 123 LEU 123 143 143 LEU LEU B . n 
B 1 124 ILE 124 144 144 ILE ILE B . n 
B 1 125 VAL 125 145 145 VAL VAL B . n 
B 1 126 SER 126 146 146 SER SER B . n 
B 1 127 GLY 127 147 147 GLY GLY B . n 
B 1 128 SER 128 148 148 SER SER B . n 
B 1 129 PHE 129 149 149 PHE PHE B . n 
B 1 130 ASP 130 150 150 ASP ASP B . n 
B 1 131 GLU 131 151 151 GLU GLU B . n 
B 1 132 SER 132 152 152 SER SER B . n 
B 1 133 VAL 133 153 153 VAL VAL B . n 
B 1 134 ARG 134 154 154 ARG ARG B . n 
B 1 135 ILE 135 155 155 ILE ILE B . n 
B 1 136 TRP 136 156 156 TRP TRP B . n 
B 1 137 ASP 137 157 157 ASP ASP B . n 
B 1 138 VAL 138 158 158 VAL VAL B . n 
B 1 139 LYS 139 159 159 LYS LYS B . n 
B 1 140 THR 140 160 160 THR THR B . n 
B 1 141 GLY 141 161 161 GLY GLY B . n 
B 1 142 LYS 142 162 162 LYS LYS B . n 
B 1 143 CYS 143 163 163 CYS CYS B . n 
B 1 144 LEU 144 164 164 LEU LEU B . n 
B 1 145 LYS 145 165 165 LYS LYS B . n 
B 1 146 THR 146 166 166 THR THR B . n 
B 1 147 LEU 147 167 167 LEU LEU B . n 
B 1 148 PRO 148 168 168 PRO PRO B . n 
B 1 149 ALA 149 169 169 ALA ALA B . n 
B 1 150 HIS 150 170 170 HIS HIS B . n 
B 1 151 SER 151 171 171 SER SER B . n 
B 1 152 ASP 152 172 172 ASP ASP B . n 
B 1 153 PRO 153 173 173 PRO PRO B . n 
B 1 154 VAL 154 174 174 VAL VAL B . n 
B 1 155 SER 155 175 175 SER SER B . n 
B 1 156 ALA 156 176 176 ALA ALA B . n 
B 1 157 VAL 157 177 177 VAL VAL B . n 
B 1 158 HIS 158 178 178 HIS HIS B . n 
B 1 159 PHE 159 179 179 PHE PHE B . n 
B 1 160 ASN 160 180 180 ASN ASN B . n 
B 1 161 ARG 161 181 181 ARG ARG B . n 
B 1 162 ASP 162 182 182 ASP ASP B . n 
B 1 163 GLY 163 183 183 GLY GLY B . n 
B 1 164 SER 164 184 184 SER SER B . n 
B 1 165 LEU 165 185 185 LEU LEU B . n 
B 1 166 ILE 166 186 186 ILE ILE B . n 
B 1 167 VAL 167 187 187 VAL VAL B . n 
B 1 168 SER 168 188 188 SER SER B . n 
B 1 169 SER 169 189 189 SER SER B . n 
B 1 170 SER 170 190 190 SER SER B . n 
B 1 171 TYR 171 191 191 TYR TYR B . n 
B 1 172 ASP 172 192 192 ASP ASP B . n 
B 1 173 GLY 173 193 193 GLY GLY B . n 
B 1 174 LEU 174 194 194 LEU LEU B . n 
B 1 175 CYS 175 195 195 CYS CYS B . n 
B 1 176 ARG 176 196 196 ARG ARG B . n 
B 1 177 ILE 177 197 197 ILE ILE B . n 
B 1 178 TRP 178 198 198 TRP TRP B . n 
B 1 179 ASP 179 199 199 ASP ASP B . n 
B 1 180 THR 180 200 200 THR THR B . n 
B 1 181 ALA 181 201 201 ALA ALA B . n 
B 1 182 SER 182 202 202 SER SER B . n 
B 1 183 GLY 183 203 203 GLY GLY B . n 
B 1 184 GLN 184 204 204 GLN GLN B . n 
B 1 185 CYS 185 205 205 CYS CYS B . n 
B 1 186 LEU 186 206 206 LEU LEU B . n 
B 1 187 LYS 187 207 207 LYS LYS B . n 
B 1 188 THR 188 208 208 THR THR B . n 
B 1 189 LEU 189 209 209 LEU LEU B . n 
B 1 190 ILE 190 210 210 ILE ILE B . n 
B 1 191 ASP 191 211 211 ASP ASP B . n 
B 1 192 ASP 192 212 ?   ?   ?   B . n 
B 1 193 ASP 193 213 ?   ?   ?   B . n 
B 1 194 ASN 194 214 214 ASN ASN B . n 
B 1 195 PRO 195 215 215 PRO PRO B . n 
B 1 196 PRO 196 216 216 PRO PRO B . n 
B 1 197 VAL 197 217 217 VAL VAL B . n 
B 1 198 SER 198 218 218 SER SER B . n 
B 1 199 PHE 199 219 219 PHE PHE B . n 
B 1 200 VAL 200 220 220 VAL VAL B . n 
B 1 201 LYS 201 221 221 LYS LYS B . n 
B 1 202 PHE 202 222 222 PHE PHE B . n 
B 1 203 SER 203 223 223 SER SER B . n 
B 1 204 PRO 204 224 224 PRO PRO B . n 
B 1 205 ASN 205 225 225 ASN ASN B . n 
B 1 206 GLY 206 226 226 GLY GLY B . n 
B 1 207 LYS 207 227 227 LYS LYS B . n 
B 1 208 TYR 208 228 228 TYR TYR B . n 
B 1 209 ILE 209 229 229 ILE ILE B . n 
B 1 210 LEU 210 230 230 LEU LEU B . n 
B 1 211 ALA 211 231 231 ALA ALA B . n 
B 1 212 ALA 212 232 232 ALA ALA B . n 
B 1 213 THR 213 233 233 THR THR B . n 
B 1 214 LEU 214 234 234 LEU LEU B . n 
B 1 215 ASP 215 235 235 ASP ASP B . n 
B 1 216 ASN 216 236 236 ASN ASN B . n 
B 1 217 THR 217 237 237 THR THR B . n 
B 1 218 LEU 218 238 238 LEU LEU B . n 
B 1 219 LYS 219 239 239 LYS LYS B . n 
B 1 220 LEU 220 240 240 LEU LEU B . n 
B 1 221 TRP 221 241 241 TRP TRP B . n 
B 1 222 ASP 222 242 242 ASP ASP B . n 
B 1 223 TYR 223 243 243 TYR TYR B . n 
B 1 224 SER 224 244 244 SER SER B . n 
B 1 225 LYS 225 245 245 LYS LYS B . n 
B 1 226 GLY 226 246 246 GLY GLY B . n 
B 1 227 LYS 227 247 247 LYS LYS B . n 
B 1 228 CYS 228 248 248 CYS CYS B . n 
B 1 229 LEU 229 249 249 LEU LEU B . n 
B 1 230 LYS 230 250 250 LYS LYS B . n 
B 1 231 THR 231 251 251 THR THR B . n 
B 1 232 TYR 232 252 252 TYR TYR B . n 
B 1 233 THR 233 253 253 THR THR B . n 
B 1 234 GLY 234 254 254 GLY GLY B . n 
B 1 235 HIS 235 255 255 HIS HIS B . n 
B 1 236 LYS 236 256 256 LYS LYS B . n 
B 1 237 ASN 237 257 257 ASN ASN B . n 
B 1 238 GLU 238 258 258 GLU GLU B . n 
B 1 239 LYS 239 259 259 LYS LYS B . n 
B 1 240 TYR 240 260 260 TYR TYR B . n 
B 1 241 CYS 241 261 261 CYS CYS B . n 
B 1 242 ILE 242 262 262 ILE ILE B . n 
B 1 243 PHE 243 263 263 PHE PHE B . n 
B 1 244 ALA 244 264 264 ALA ALA B . n 
B 1 245 ASN 245 265 265 ASN ASN B . n 
B 1 246 PHE 246 266 266 PHE PHE B . n 
B 1 247 SER 247 267 267 SER SER B . n 
B 1 248 VAL 248 268 268 VAL VAL B . n 
B 1 249 THR 249 269 269 THR THR B . n 
B 1 250 GLY 250 270 270 GLY GLY B . n 
B 1 251 GLY 251 271 271 GLY GLY B . n 
B 1 252 LYS 252 272 272 LYS LYS B . n 
B 1 253 TRP 253 273 273 TRP TRP B . n 
B 1 254 ILE 254 274 274 ILE ILE B . n 
B 1 255 VAL 255 275 275 VAL VAL B . n 
B 1 256 SER 256 276 276 SER SER B . n 
B 1 257 GLY 257 277 277 GLY GLY B . n 
B 1 258 SER 258 278 278 SER SER B . n 
B 1 259 GLU 259 279 279 GLU GLU B . n 
B 1 260 ASP 260 280 280 ASP ASP B . n 
B 1 261 ASN 261 281 281 ASN ASN B . n 
B 1 262 LEU 262 282 282 LEU LEU B . n 
B 1 263 VAL 263 283 283 VAL VAL B . n 
B 1 264 TYR 264 284 284 TYR TYR B . n 
B 1 265 ILE 265 285 285 ILE ILE B . n 
B 1 266 TRP 266 286 286 TRP TRP B . n 
B 1 267 ASN 267 287 287 ASN ASN B . n 
B 1 268 LEU 268 288 288 LEU LEU B . n 
B 1 269 GLN 269 289 289 GLN GLN B . n 
B 1 270 THR 270 290 290 THR THR B . n 
B 1 271 LYS 271 291 291 LYS LYS B . n 
B 1 272 GLU 272 292 292 GLU GLU B . n 
B 1 273 ILE 273 293 293 ILE ILE B . n 
B 1 274 VAL 274 294 294 VAL VAL B . n 
B 1 275 GLN 275 295 295 GLN GLN B . n 
B 1 276 LYS 276 296 296 LYS LYS B . n 
B 1 277 LEU 277 297 297 LEU LEU B . n 
B 1 278 GLN 278 298 298 GLN GLN B . n 
B 1 279 GLY 279 299 299 GLY GLY B . n 
B 1 280 HIS 280 300 300 HIS HIS B . n 
B 1 281 THR 281 301 301 THR THR B . n 
B 1 282 ASP 282 302 302 ASP ASP B . n 
B 1 283 VAL 283 303 303 VAL VAL B . n 
B 1 284 VAL 284 304 304 VAL VAL B . n 
B 1 285 ILE 285 305 305 ILE ILE B . n 
B 1 286 SER 286 306 306 SER SER B . n 
B 1 287 THR 287 307 307 THR THR B . n 
B 1 288 ALA 288 308 308 ALA ALA B . n 
B 1 289 CYS 289 309 309 CYS CYS B . n 
B 1 290 HIS 290 310 310 HIS HIS B . n 
B 1 291 PRO 291 311 311 PRO PRO B . n 
B 1 292 THR 292 312 312 THR THR B . n 
B 1 293 GLU 293 313 313 GLU GLU B . n 
B 1 294 ASN 294 314 314 ASN ASN B . n 
B 1 295 ILE 295 315 315 ILE ILE B . n 
B 1 296 ILE 296 316 316 ILE ILE B . n 
B 1 297 ALA 297 317 317 ALA ALA B . n 
B 1 298 SER 298 318 318 SER SER B . n 
B 1 299 ALA 299 319 319 ALA ALA B . n 
B 1 300 ALA 300 320 320 ALA ALA B . n 
B 1 301 LEU 301 321 321 LEU LEU B . n 
B 1 302 GLU 302 322 322 GLU GLU B . n 
B 1 303 ASN 303 323 323 ASN ASN B . n 
B 1 304 ASP 304 324 324 ASP ASP B . n 
B 1 305 LYS 305 325 325 LYS LYS B . n 
B 1 306 THR 306 326 326 THR THR B . n 
B 1 307 ILE 307 327 327 ILE ILE B . n 
B 1 308 LYS 308 328 328 LYS LYS B . n 
B 1 309 LEU 309 329 329 LEU LEU B . n 
B 1 310 TRP 310 330 330 TRP TRP B . n 
B 1 311 LYS 311 331 331 LYS LYS B . n 
B 1 312 SER 312 332 332 SER SER B . n 
B 1 313 ASP 313 333 333 ASP ASP B . n 
B 1 314 CYS 314 334 334 CYS CYS B . n 
B 1 315 GLY 315 335 ?   ?   ?   B . n 
B 1 316 ALA 316 336 ?   ?   ?   B . n 
C 2 1   ASP 1   585 ?   ?   ?   C . n 
C 2 2   GLY 2   586 586 GLY GLY C . n 
C 2 3   THR 3   587 587 THR THR C . n 
C 2 4   CYS 4   588 588 CYS CYS C . n 
C 2 5   VAL 5   589 589 VAL VAL C . n 
C 2 6   ALA 6   590 590 ALA ALA C . n 
C 2 7   ALA 7   591 591 ALA ALA C . n 
C 2 8   ARG 8   592 592 ARG ARG C . n 
C 2 9   THR 9   593 593 THR THR C . n 
C 2 10  ARG 10  594 594 ARG ARG C . n 
C 2 11  PRO 11  595 595 PRO PRO C . n 
C 2 12  VAL 12  596 596 VAL VAL C . n 
C 2 13  LEU 13  597 597 LEU LEU C . n 
C 2 14  SER 14  598 598 SER SER C . n 
C 2 15  TYR 15  599 599 TYR TYR C . n 
D 2 1   ASP 1   585 ?   ?   ?   D . n 
D 2 2   GLY 2   586 586 GLY GLY D . n 
D 2 3   THR 3   587 587 THR THR D . n 
D 2 4   CYS 4   588 588 CYS CYS D . n 
D 2 5   VAL 5   589 589 VAL VAL D . n 
D 2 6   ALA 6   590 590 ALA ALA D . n 
D 2 7   ALA 7   591 591 ALA ALA D . n 
D 2 8   ARG 8   592 592 ARG ARG D . n 
D 2 9   THR 9   593 593 THR THR D . n 
D 2 10  ARG 10  594 594 ARG ARG D . n 
D 2 11  PRO 11  595 595 PRO PRO D . n 
D 2 12  VAL 12  596 596 VAL VAL D . n 
D 2 13  LEU 13  597 597 LEU LEU D . n 
D 2 14  SER 14  598 598 SER SER D . n 
D 2 15  TYR 15  599 599 TYR TYR D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 GOL 1   1335 1335 GOL GOL A . 
F 3 GOL 1   1335 1335 GOL GOL B . 
G 3 GOL 1   1000 1000 GOL GOL D . 
H 4 HOH 1   2001 2001 HOH HOH A . 
H 4 HOH 2   2002 2002 HOH HOH A . 
H 4 HOH 3   2003 2003 HOH HOH A . 
H 4 HOH 4   2004 2004 HOH HOH A . 
H 4 HOH 5   2005 2005 HOH HOH A . 
H 4 HOH 6   2006 2006 HOH HOH A . 
H 4 HOH 7   2007 2007 HOH HOH A . 
H 4 HOH 8   2008 2008 HOH HOH A . 
H 4 HOH 9   2009 2009 HOH HOH A . 
H 4 HOH 10  2010 2010 HOH HOH A . 
H 4 HOH 11  2011 2011 HOH HOH A . 
H 4 HOH 12  2012 2012 HOH HOH A . 
H 4 HOH 13  2013 2013 HOH HOH A . 
H 4 HOH 14  2014 2014 HOH HOH A . 
H 4 HOH 15  2015 2015 HOH HOH A . 
H 4 HOH 16  2016 2016 HOH HOH A . 
H 4 HOH 17  2017 2017 HOH HOH A . 
H 4 HOH 18  2018 2018 HOH HOH A . 
H 4 HOH 19  2019 2019 HOH HOH A . 
H 4 HOH 20  2020 2020 HOH HOH A . 
H 4 HOH 21  2021 2021 HOH HOH A . 
H 4 HOH 22  2022 2022 HOH HOH A . 
H 4 HOH 23  2023 2023 HOH HOH A . 
H 4 HOH 24  2024 2024 HOH HOH A . 
H 4 HOH 25  2025 2025 HOH HOH A . 
H 4 HOH 26  2026 2026 HOH HOH A . 
H 4 HOH 27  2027 2027 HOH HOH A . 
H 4 HOH 28  2028 2028 HOH HOH A . 
H 4 HOH 29  2029 2029 HOH HOH A . 
H 4 HOH 30  2030 2030 HOH HOH A . 
H 4 HOH 31  2031 2031 HOH HOH A . 
H 4 HOH 32  2032 2032 HOH HOH A . 
H 4 HOH 33  2033 2033 HOH HOH A . 
H 4 HOH 34  2034 2034 HOH HOH A . 
H 4 HOH 35  2035 2035 HOH HOH A . 
H 4 HOH 36  2036 2036 HOH HOH A . 
H 4 HOH 37  2038 2038 HOH HOH A . 
H 4 HOH 38  2039 2039 HOH HOH A . 
H 4 HOH 39  2040 2040 HOH HOH A . 
H 4 HOH 40  2041 2041 HOH HOH A . 
H 4 HOH 41  2042 2042 HOH HOH A . 
H 4 HOH 42  2043 2043 HOH HOH A . 
H 4 HOH 43  2044 2044 HOH HOH A . 
H 4 HOH 44  2045 2045 HOH HOH A . 
H 4 HOH 45  2046 2046 HOH HOH A . 
H 4 HOH 46  2047 2047 HOH HOH A . 
H 4 HOH 47  2048 2048 HOH HOH A . 
H 4 HOH 48  2049 2049 HOH HOH A . 
H 4 HOH 49  2050 2050 HOH HOH A . 
H 4 HOH 50  2051 2051 HOH HOH A . 
H 4 HOH 51  2052 2052 HOH HOH A . 
H 4 HOH 52  2053 2053 HOH HOH A . 
H 4 HOH 53  2054 2054 HOH HOH A . 
H 4 HOH 54  2055 2055 HOH HOH A . 
H 4 HOH 55  2056 2056 HOH HOH A . 
H 4 HOH 56  2057 2057 HOH HOH A . 
H 4 HOH 57  2058 2058 HOH HOH A . 
H 4 HOH 58  2059 2059 HOH HOH A . 
H 4 HOH 59  2060 2060 HOH HOH A . 
H 4 HOH 60  2061 2061 HOH HOH A . 
H 4 HOH 61  2062 2062 HOH HOH A . 
H 4 HOH 62  2063 2063 HOH HOH A . 
H 4 HOH 63  2064 2064 HOH HOH A . 
H 4 HOH 64  2065 2065 HOH HOH A . 
H 4 HOH 65  2066 2066 HOH HOH A . 
H 4 HOH 66  2067 2067 HOH HOH A . 
H 4 HOH 67  2068 2068 HOH HOH A . 
H 4 HOH 68  2069 2069 HOH HOH A . 
H 4 HOH 69  2070 2070 HOH HOH A . 
H 4 HOH 70  2071 2071 HOH HOH A . 
H 4 HOH 71  2072 2072 HOH HOH A . 
H 4 HOH 72  2073 2073 HOH HOH A . 
H 4 HOH 73  2074 2074 HOH HOH A . 
H 4 HOH 74  2075 2075 HOH HOH A . 
H 4 HOH 75  2076 2076 HOH HOH A . 
H 4 HOH 76  2077 2077 HOH HOH A . 
H 4 HOH 77  2078 2078 HOH HOH A . 
H 4 HOH 78  2079 2079 HOH HOH A . 
H 4 HOH 79  2080 2080 HOH HOH A . 
H 4 HOH 80  2081 2081 HOH HOH A . 
H 4 HOH 81  2082 2082 HOH HOH A . 
H 4 HOH 82  2083 2083 HOH HOH A . 
H 4 HOH 83  2084 2084 HOH HOH A . 
H 4 HOH 84  2085 2085 HOH HOH A . 
H 4 HOH 85  2086 2086 HOH HOH A . 
H 4 HOH 86  2087 2087 HOH HOH A . 
H 4 HOH 87  2088 2088 HOH HOH A . 
H 4 HOH 88  2089 2089 HOH HOH A . 
H 4 HOH 89  2090 2090 HOH HOH A . 
H 4 HOH 90  2091 2091 HOH HOH A . 
H 4 HOH 91  2092 2092 HOH HOH A . 
H 4 HOH 92  2093 2093 HOH HOH A . 
H 4 HOH 93  2094 2094 HOH HOH A . 
H 4 HOH 94  2095 2095 HOH HOH A . 
H 4 HOH 95  2096 2096 HOH HOH A . 
H 4 HOH 96  2097 2097 HOH HOH A . 
H 4 HOH 97  2098 2098 HOH HOH A . 
H 4 HOH 98  2099 2099 HOH HOH A . 
H 4 HOH 99  2100 2100 HOH HOH A . 
H 4 HOH 100 2101 2101 HOH HOH A . 
H 4 HOH 101 2102 2102 HOH HOH A . 
H 4 HOH 102 2103 2103 HOH HOH A . 
H 4 HOH 103 2104 2104 HOH HOH A . 
H 4 HOH 104 2105 2105 HOH HOH A . 
H 4 HOH 105 2106 2106 HOH HOH A . 
H 4 HOH 106 2107 2107 HOH HOH A . 
H 4 HOH 107 2108 2108 HOH HOH A . 
H 4 HOH 108 2109 2109 HOH HOH A . 
H 4 HOH 109 2110 2110 HOH HOH A . 
H 4 HOH 110 2111 2111 HOH HOH A . 
H 4 HOH 111 2112 2112 HOH HOH A . 
H 4 HOH 112 2113 2113 HOH HOH A . 
H 4 HOH 113 2114 2114 HOH HOH A . 
H 4 HOH 114 2115 2115 HOH HOH A . 
H 4 HOH 115 2116 2116 HOH HOH A . 
H 4 HOH 116 2117 2117 HOH HOH A . 
H 4 HOH 117 2118 2118 HOH HOH A . 
H 4 HOH 118 2119 2119 HOH HOH A . 
H 4 HOH 119 2120 2120 HOH HOH A . 
H 4 HOH 120 2121 2121 HOH HOH A . 
H 4 HOH 121 2122 2122 HOH HOH A . 
H 4 HOH 122 2123 2123 HOH HOH A . 
H 4 HOH 123 2124 2124 HOH HOH A . 
H 4 HOH 124 2125 2125 HOH HOH A . 
H 4 HOH 125 2126 2126 HOH HOH A . 
H 4 HOH 126 2127 2127 HOH HOH A . 
H 4 HOH 127 2128 2128 HOH HOH A . 
H 4 HOH 128 2129 2129 HOH HOH A . 
H 4 HOH 129 2130 2130 HOH HOH A . 
H 4 HOH 130 2131 2131 HOH HOH A . 
H 4 HOH 131 2132 2132 HOH HOH A . 
H 4 HOH 132 2133 2133 HOH HOH A . 
H 4 HOH 133 2134 2134 HOH HOH A . 
H 4 HOH 134 2135 2135 HOH HOH A . 
H 4 HOH 135 2136 2136 HOH HOH A . 
H 4 HOH 136 2137 2137 HOH HOH A . 
H 4 HOH 137 2138 2138 HOH HOH A . 
H 4 HOH 138 2139 2139 HOH HOH A . 
H 4 HOH 139 2140 2140 HOH HOH A . 
H 4 HOH 140 2141 2141 HOH HOH A . 
H 4 HOH 141 2142 2142 HOH HOH A . 
H 4 HOH 142 2143 2143 HOH HOH A . 
H 4 HOH 143 2144 2144 HOH HOH A . 
H 4 HOH 144 2145 2145 HOH HOH A . 
H 4 HOH 145 2146 2146 HOH HOH A . 
H 4 HOH 146 2147 2147 HOH HOH A . 
H 4 HOH 147 2148 2148 HOH HOH A . 
H 4 HOH 148 2149 2149 HOH HOH A . 
H 4 HOH 149 2150 2150 HOH HOH A . 
H 4 HOH 150 2151 2151 HOH HOH A . 
H 4 HOH 151 2152 2152 HOH HOH A . 
H 4 HOH 152 2153 2153 HOH HOH A . 
H 4 HOH 153 2154 2154 HOH HOH A . 
H 4 HOH 154 2155 2155 HOH HOH A . 
H 4 HOH 155 2156 2156 HOH HOH A . 
H 4 HOH 156 2157 2157 HOH HOH A . 
H 4 HOH 157 2158 2158 HOH HOH A . 
H 4 HOH 158 2159 2159 HOH HOH A . 
H 4 HOH 159 2160 2160 HOH HOH A . 
H 4 HOH 160 2161 2161 HOH HOH A . 
H 4 HOH 161 2162 2162 HOH HOH A . 
H 4 HOH 162 2163 2163 HOH HOH A . 
H 4 HOH 163 2164 2164 HOH HOH A . 
H 4 HOH 164 2165 2165 HOH HOH A . 
I 4 HOH 1   2001 2001 HOH HOH B . 
I 4 HOH 2   2002 2002 HOH HOH B . 
I 4 HOH 3   2003 2003 HOH HOH B . 
I 4 HOH 4   2004 2004 HOH HOH B . 
I 4 HOH 5   2005 2005 HOH HOH B . 
I 4 HOH 6   2006 2006 HOH HOH B . 
I 4 HOH 7   2007 2007 HOH HOH B . 
I 4 HOH 8   2008 2008 HOH HOH B . 
I 4 HOH 9   2009 2009 HOH HOH B . 
I 4 HOH 10  2010 2010 HOH HOH B . 
I 4 HOH 11  2011 2011 HOH HOH B . 
I 4 HOH 12  2012 2012 HOH HOH B . 
I 4 HOH 13  2013 2013 HOH HOH B . 
I 4 HOH 14  2014 2014 HOH HOH B . 
I 4 HOH 15  2015 2015 HOH HOH B . 
I 4 HOH 16  2016 2016 HOH HOH B . 
I 4 HOH 17  2017 2017 HOH HOH B . 
I 4 HOH 18  2018 2018 HOH HOH B . 
I 4 HOH 19  2019 2019 HOH HOH B . 
I 4 HOH 20  2020 2020 HOH HOH B . 
I 4 HOH 21  2021 2021 HOH HOH B . 
I 4 HOH 22  2022 2022 HOH HOH B . 
I 4 HOH 23  2023 2023 HOH HOH B . 
I 4 HOH 24  2024 2024 HOH HOH B . 
I 4 HOH 25  2025 2025 HOH HOH B . 
I 4 HOH 26  2026 2026 HOH HOH B . 
I 4 HOH 27  2027 2027 HOH HOH B . 
I 4 HOH 28  2028 2028 HOH HOH B . 
I 4 HOH 29  2029 2029 HOH HOH B . 
I 4 HOH 30  2030 2030 HOH HOH B . 
I 4 HOH 31  2031 2031 HOH HOH B . 
I 4 HOH 32  2032 2032 HOH HOH B . 
I 4 HOH 33  2033 2033 HOH HOH B . 
I 4 HOH 34  2034 2034 HOH HOH B . 
I 4 HOH 35  2035 2035 HOH HOH B . 
I 4 HOH 36  2036 2036 HOH HOH B . 
I 4 HOH 37  2037 2037 HOH HOH B . 
I 4 HOH 38  2038 2038 HOH HOH B . 
I 4 HOH 39  2039 2039 HOH HOH B . 
I 4 HOH 40  2040 2040 HOH HOH B . 
I 4 HOH 41  2041 2041 HOH HOH B . 
I 4 HOH 42  2042 2042 HOH HOH B . 
I 4 HOH 43  2043 2043 HOH HOH B . 
I 4 HOH 44  2044 2044 HOH HOH B . 
I 4 HOH 45  2045 2045 HOH HOH B . 
I 4 HOH 46  2046 2046 HOH HOH B . 
I 4 HOH 47  2047 2047 HOH HOH B . 
I 4 HOH 48  2048 2048 HOH HOH B . 
I 4 HOH 49  2049 2049 HOH HOH B . 
I 4 HOH 50  2050 2050 HOH HOH B . 
I 4 HOH 51  2051 2051 HOH HOH B . 
I 4 HOH 52  2052 2052 HOH HOH B . 
I 4 HOH 53  2053 2053 HOH HOH B . 
I 4 HOH 54  2054 2054 HOH HOH B . 
I 4 HOH 55  2055 2055 HOH HOH B . 
I 4 HOH 56  2056 2056 HOH HOH B . 
I 4 HOH 57  2057 2057 HOH HOH B . 
I 4 HOH 58  2058 2058 HOH HOH B . 
I 4 HOH 59  2059 2059 HOH HOH B . 
I 4 HOH 60  2060 2060 HOH HOH B . 
I 4 HOH 61  2061 2061 HOH HOH B . 
I 4 HOH 62  2062 2062 HOH HOH B . 
I 4 HOH 63  2063 2063 HOH HOH B . 
I 4 HOH 64  2064 2064 HOH HOH B . 
I 4 HOH 65  2065 2065 HOH HOH B . 
I 4 HOH 66  2066 2066 HOH HOH B . 
I 4 HOH 67  2067 2067 HOH HOH B . 
I 4 HOH 68  2068 2068 HOH HOH B . 
I 4 HOH 69  2069 2069 HOH HOH B . 
I 4 HOH 70  2070 2070 HOH HOH B . 
I 4 HOH 71  2071 2071 HOH HOH B . 
I 4 HOH 72  2072 2072 HOH HOH B . 
I 4 HOH 73  2073 2073 HOH HOH B . 
I 4 HOH 74  2074 2074 HOH HOH B . 
I 4 HOH 75  2075 2075 HOH HOH B . 
I 4 HOH 76  2076 2076 HOH HOH B . 
I 4 HOH 77  2077 2077 HOH HOH B . 
I 4 HOH 78  2078 2078 HOH HOH B . 
I 4 HOH 79  2079 2079 HOH HOH B . 
I 4 HOH 80  2080 2080 HOH HOH B . 
I 4 HOH 81  2081 2081 HOH HOH B . 
I 4 HOH 82  2082 2082 HOH HOH B . 
I 4 HOH 83  2083 2083 HOH HOH B . 
I 4 HOH 84  2084 2084 HOH HOH B . 
I 4 HOH 85  2085 2085 HOH HOH B . 
I 4 HOH 86  2086 2086 HOH HOH B . 
I 4 HOH 87  2087 2087 HOH HOH B . 
I 4 HOH 88  2088 2088 HOH HOH B . 
I 4 HOH 89  2089 2089 HOH HOH B . 
I 4 HOH 90  2090 2090 HOH HOH B . 
I 4 HOH 91  2091 2091 HOH HOH B . 
I 4 HOH 92  2092 2092 HOH HOH B . 
I 4 HOH 93  2093 2093 HOH HOH B . 
I 4 HOH 94  2094 2094 HOH HOH B . 
I 4 HOH 95  2095 2095 HOH HOH B . 
I 4 HOH 96  2096 2096 HOH HOH B . 
I 4 HOH 97  2097 2097 HOH HOH B . 
I 4 HOH 98  2098 2098 HOH HOH B . 
I 4 HOH 99  2099 2099 HOH HOH B . 
I 4 HOH 100 2100 2100 HOH HOH B . 
I 4 HOH 101 2101 2101 HOH HOH B . 
I 4 HOH 102 2102 2102 HOH HOH B . 
I 4 HOH 103 2103 2103 HOH HOH B . 
I 4 HOH 104 2104 2104 HOH HOH B . 
I 4 HOH 105 2105 2105 HOH HOH B . 
I 4 HOH 106 2106 2106 HOH HOH B . 
I 4 HOH 107 2107 2107 HOH HOH B . 
I 4 HOH 108 2108 2108 HOH HOH B . 
I 4 HOH 109 2109 2109 HOH HOH B . 
I 4 HOH 110 2110 2110 HOH HOH B . 
I 4 HOH 111 2111 2111 HOH HOH B . 
I 4 HOH 112 2112 2112 HOH HOH B . 
I 4 HOH 113 2113 2113 HOH HOH B . 
I 4 HOH 114 2114 2114 HOH HOH B . 
I 4 HOH 115 2115 2115 HOH HOH B . 
I 4 HOH 116 2116 2116 HOH HOH B . 
I 4 HOH 117 2117 2117 HOH HOH B . 
I 4 HOH 118 2118 2118 HOH HOH B . 
I 4 HOH 119 2119 2119 HOH HOH B . 
I 4 HOH 120 2120 2120 HOH HOH B . 
I 4 HOH 121 2121 2121 HOH HOH B . 
I 4 HOH 122 2122 2122 HOH HOH B . 
I 4 HOH 123 2123 2123 HOH HOH B . 
I 4 HOH 124 2124 2124 HOH HOH B . 
I 4 HOH 125 2125 2125 HOH HOH B . 
I 4 HOH 126 2126 2126 HOH HOH B . 
I 4 HOH 127 2127 2127 HOH HOH B . 
I 4 HOH 128 2128 2128 HOH HOH B . 
I 4 HOH 129 2129 2129 HOH HOH B . 
I 4 HOH 130 2130 2130 HOH HOH B . 
I 4 HOH 131 2131 2131 HOH HOH B . 
I 4 HOH 132 2132 2132 HOH HOH B . 
I 4 HOH 133 2133 2133 HOH HOH B . 
I 4 HOH 134 2134 2134 HOH HOH B . 
I 4 HOH 135 2135 2135 HOH HOH B . 
I 4 HOH 136 2136 2136 HOH HOH B . 
I 4 HOH 137 2137 2137 HOH HOH B . 
I 4 HOH 138 2138 2138 HOH HOH B . 
I 4 HOH 139 2139 2139 HOH HOH B . 
I 4 HOH 140 2140 2140 HOH HOH B . 
I 4 HOH 141 2141 2141 HOH HOH B . 
I 4 HOH 142 2142 2142 HOH HOH B . 
I 4 HOH 143 2143 2143 HOH HOH B . 
I 4 HOH 144 2144 2144 HOH HOH B . 
I 4 HOH 145 2145 2145 HOH HOH B . 
J 4 HOH 1   2001 2001 HOH HOH C . 
J 4 HOH 2   2002 2002 HOH HOH C . 
J 4 HOH 3   2003 2003 HOH HOH C . 
J 4 HOH 4   2004 2004 HOH HOH C . 
J 4 HOH 5   2005 2005 HOH HOH C . 
J 4 HOH 6   2006 2006 HOH HOH C . 
J 4 HOH 7   2007 2007 HOH HOH C . 
K 4 HOH 1   2001 2001 HOH HOH D . 
K 4 HOH 2   2002 2002 HOH HOH D . 
K 4 HOH 3   2003 2003 HOH HOH D . 
K 4 HOH 4   2004 2004 HOH HOH D . 
K 4 HOH 5   2005 2005 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,E,G,H,K 
2 1 B,C,F,I,J   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1670  ? 
1 MORE         -8.8  ? 
1 'SSA (A^2)'  12260 ? 
2 'ABSA (A^2)' 1850  ? 
2 MORE         -8.0  ? 
2 'SSA (A^2)'  12180 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2014-05-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.8.0069 ? 1 
XDS    'data reduction' .        ? 2 
XSCALE 'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 151 ? ? 81.41   7.28   
2 1 LEU A 234 ? ? -79.79  36.44  
3 1 ASN A 257 ? ? -157.80 89.91  
4 1 ASP A 324 ? ? -121.93 -67.39 
5 1 LEU B 234 ? ? -81.30  37.69  
6 1 ASP B 324 ? ? -122.77 -66.21 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 21  ? A MET 1   
2  1 Y 1 A GLY 22  ? A GLY 2   
3  1 Y 1 A ALA 23  ? A ALA 3   
4  1 Y 1 A THR 24  ? A THR 4   
5  1 Y 1 A GLN 25  ? A GLN 5   
6  1 Y 1 A SER 26  ? A SER 6   
7  1 Y 1 A LYS 27  ? A LYS 7   
8  1 Y 1 A PRO 28  ? A PRO 8   
9  1 Y 1 A THR 29  ? A THR 9   
10 1 Y 1 A PRO 30  ? A PRO 10  
11 1 Y 1 A ASP 213 ? A ASP 193 
12 1 Y 1 A GLY 335 ? A GLY 315 
13 1 Y 1 A ALA 336 ? A ALA 316 
14 1 Y 1 B MET 21  ? B MET 1   
15 1 Y 1 B GLY 22  ? B GLY 2   
16 1 Y 1 B ALA 23  ? B ALA 3   
17 1 Y 1 B THR 24  ? B THR 4   
18 1 Y 1 B GLN 25  ? B GLN 5   
19 1 Y 1 B SER 26  ? B SER 6   
20 1 Y 1 B LYS 27  ? B LYS 7   
21 1 Y 1 B PRO 28  ? B PRO 8   
22 1 Y 1 B THR 29  ? B THR 9   
23 1 Y 1 B PRO 30  ? B PRO 10  
24 1 Y 1 B VAL 31  ? B VAL 11  
25 1 Y 1 B ASP 212 ? B ASP 192 
26 1 Y 1 B ASP 213 ? B ASP 193 
27 1 Y 1 B GLY 335 ? B GLY 315 
28 1 Y 1 B ALA 336 ? B ALA 316 
29 1 Y 1 C ASP 585 ? C ASP 1   
30 1 Y 1 D ASP 585 ? D ASP 1   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 GLYCEROL GOL 
4 water    HOH 
# 
loop_
_pdbx_reflns_twin.domain_id 
_pdbx_reflns_twin.crystal_id 
_pdbx_reflns_twin.diffrn_id 
_pdbx_reflns_twin.type 
_pdbx_reflns_twin.operator 
_pdbx_reflns_twin.fraction 
1 1 1 ? 'H, K, L' 0.793 
2 1 1 ? -h,-k,l   0.207 
#