data_4D87
# 
_entry.id   4D87 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4D87         
RCSB  RCSB070004   
WWPDB D_1000070004 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3nm8 . unspecified 
PDB 3npy . unspecified 
PDB 3nq5 . unspecified 
PDB 3nq0 . unspecified 
PDB 3nq1 . unspecified 
PDB 3ntm . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4D87 
_pdbx_database_status.recvd_initial_deposition_date   2012-01-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Adir, N.'      1 
'Goldfeder, M.' 2 
'Fishman, A.'   3 
# 
_citation.id                        primary 
_citation.title                     'Changes in tyrosinase specificity by ionic liquids and sodium dodecyl sulfate.' 
_citation.journal_abbrev            Appl.Microbiol.Biotechnol. 
_citation.journal_volume            97 
_citation.page_first                1953 
_citation.page_last                 1961 
_citation.year                      2013 
_citation.journal_id_ASTM           AMBIDG 
_citation.country                   GW 
_citation.journal_id_ISSN           0175-7598 
_citation.journal_id_CSD            0786 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22539021 
_citation.pdbx_database_id_DOI      10.1007/s00253-012-4050-z 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Goldfeder, M.'         1 
primary 'Egozy, M.'             2 
primary 'Shuster Ben-Yosef, V.' 3 
primary 'Adir, N.'              4 
primary 'Fishman, A.'           5 
# 
_cell.entry_id           4D87 
_cell.length_a           47.840 
_cell.length_b           79.140 
_cell.length_c           85.930 
_cell.angle_alpha        90.00 
_cell.angle_beta         103.56 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4D87 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Tyrosinase        35284.500 2 1.14.18.1 ? ? ? 
2 non-polymer syn 'COPPER (II) ION' 63.546    2 ?         ? ? ? 
3 non-polymer syn 'DODECYL SULFATE' 266.397   1 ?         ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSNKYRVRKNVLHLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAAGKFHTPPGSDRNAAHMSSAFLPWHREYLLRFERDL
QSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGNGNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAP
TLPTRDDVLNALKITQYDTPPWDMTSQNSFRNQLEGFINGPQLHNRVHRWVGGQMGVVPTAPNDPVFFLHHANVDRIWAV
WQIIHRNQNYQPMKNGPFGQNFRDPMYPWNTTPEDVMNHRKLGYVYDIELRKSKRSSHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSNKYRVRKNVLHLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAAGKFHTPPGSDRNAAHMSSAFLPWHREYLLRFERDL
QSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGNGNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAP
TLPTRDDVLNALKITQYDTPPWDMTSQNSFRNQLEGFINGPQLHNRVHRWVGGQMGVVPTAPNDPVFFLHHANVDRIWAV
WQIIHRNQNYQPMKNGPFGQNFRDPMYPWNTTPEDVMNHRKLGYVYDIELRKSKRSSHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ASN n 
1 4   LYS n 
1 5   TYR n 
1 6   ARG n 
1 7   VAL n 
1 8   ARG n 
1 9   LYS n 
1 10  ASN n 
1 11  VAL n 
1 12  LEU n 
1 13  HIS n 
1 14  LEU n 
1 15  THR n 
1 16  ASP n 
1 17  THR n 
1 18  GLU n 
1 19  LYS n 
1 20  ARG n 
1 21  ASP n 
1 22  PHE n 
1 23  VAL n 
1 24  ARG n 
1 25  THR n 
1 26  VAL n 
1 27  LEU n 
1 28  ILE n 
1 29  LEU n 
1 30  LYS n 
1 31  GLU n 
1 32  LYS n 
1 33  GLY n 
1 34  ILE n 
1 35  TYR n 
1 36  ASP n 
1 37  ARG n 
1 38  TYR n 
1 39  ILE n 
1 40  ALA n 
1 41  TRP n 
1 42  HIS n 
1 43  GLY n 
1 44  ALA n 
1 45  ALA n 
1 46  GLY n 
1 47  LYS n 
1 48  PHE n 
1 49  HIS n 
1 50  THR n 
1 51  PRO n 
1 52  PRO n 
1 53  GLY n 
1 54  SER n 
1 55  ASP n 
1 56  ARG n 
1 57  ASN n 
1 58  ALA n 
1 59  ALA n 
1 60  HIS n 
1 61  MET n 
1 62  SER n 
1 63  SER n 
1 64  ALA n 
1 65  PHE n 
1 66  LEU n 
1 67  PRO n 
1 68  TRP n 
1 69  HIS n 
1 70  ARG n 
1 71  GLU n 
1 72  TYR n 
1 73  LEU n 
1 74  LEU n 
1 75  ARG n 
1 76  PHE n 
1 77  GLU n 
1 78  ARG n 
1 79  ASP n 
1 80  LEU n 
1 81  GLN n 
1 82  SER n 
1 83  ILE n 
1 84  ASN n 
1 85  PRO n 
1 86  GLU n 
1 87  VAL n 
1 88  THR n 
1 89  LEU n 
1 90  PRO n 
1 91  TYR n 
1 92  TRP n 
1 93  GLU n 
1 94  TRP n 
1 95  GLU n 
1 96  THR n 
1 97  ASP n 
1 98  ALA n 
1 99  GLN n 
1 100 MET n 
1 101 GLN n 
1 102 ASP n 
1 103 PRO n 
1 104 SER n 
1 105 GLN n 
1 106 SER n 
1 107 GLN n 
1 108 ILE n 
1 109 TRP n 
1 110 SER n 
1 111 ALA n 
1 112 ASP n 
1 113 PHE n 
1 114 MET n 
1 115 GLY n 
1 116 GLY n 
1 117 ASN n 
1 118 GLY n 
1 119 ASN n 
1 120 PRO n 
1 121 ILE n 
1 122 LYS n 
1 123 ASP n 
1 124 PHE n 
1 125 ILE n 
1 126 VAL n 
1 127 ASP n 
1 128 THR n 
1 129 GLY n 
1 130 PRO n 
1 131 PHE n 
1 132 ALA n 
1 133 ALA n 
1 134 GLY n 
1 135 ARG n 
1 136 TRP n 
1 137 THR n 
1 138 THR n 
1 139 ILE n 
1 140 ASP n 
1 141 GLU n 
1 142 GLN n 
1 143 GLY n 
1 144 ASN n 
1 145 PRO n 
1 146 SER n 
1 147 GLY n 
1 148 GLY n 
1 149 LEU n 
1 150 LYS n 
1 151 ARG n 
1 152 ASN n 
1 153 PHE n 
1 154 GLY n 
1 155 ALA n 
1 156 THR n 
1 157 LYS n 
1 158 GLU n 
1 159 ALA n 
1 160 PRO n 
1 161 THR n 
1 162 LEU n 
1 163 PRO n 
1 164 THR n 
1 165 ARG n 
1 166 ASP n 
1 167 ASP n 
1 168 VAL n 
1 169 LEU n 
1 170 ASN n 
1 171 ALA n 
1 172 LEU n 
1 173 LYS n 
1 174 ILE n 
1 175 THR n 
1 176 GLN n 
1 177 TYR n 
1 178 ASP n 
1 179 THR n 
1 180 PRO n 
1 181 PRO n 
1 182 TRP n 
1 183 ASP n 
1 184 MET n 
1 185 THR n 
1 186 SER n 
1 187 GLN n 
1 188 ASN n 
1 189 SER n 
1 190 PHE n 
1 191 ARG n 
1 192 ASN n 
1 193 GLN n 
1 194 LEU n 
1 195 GLU n 
1 196 GLY n 
1 197 PHE n 
1 198 ILE n 
1 199 ASN n 
1 200 GLY n 
1 201 PRO n 
1 202 GLN n 
1 203 LEU n 
1 204 HIS n 
1 205 ASN n 
1 206 ARG n 
1 207 VAL n 
1 208 HIS n 
1 209 ARG n 
1 210 TRP n 
1 211 VAL n 
1 212 GLY n 
1 213 GLY n 
1 214 GLN n 
1 215 MET n 
1 216 GLY n 
1 217 VAL n 
1 218 VAL n 
1 219 PRO n 
1 220 THR n 
1 221 ALA n 
1 222 PRO n 
1 223 ASN n 
1 224 ASP n 
1 225 PRO n 
1 226 VAL n 
1 227 PHE n 
1 228 PHE n 
1 229 LEU n 
1 230 HIS n 
1 231 HIS n 
1 232 ALA n 
1 233 ASN n 
1 234 VAL n 
1 235 ASP n 
1 236 ARG n 
1 237 ILE n 
1 238 TRP n 
1 239 ALA n 
1 240 VAL n 
1 241 TRP n 
1 242 GLN n 
1 243 ILE n 
1 244 ILE n 
1 245 HIS n 
1 246 ARG n 
1 247 ASN n 
1 248 GLN n 
1 249 ASN n 
1 250 TYR n 
1 251 GLN n 
1 252 PRO n 
1 253 MET n 
1 254 LYS n 
1 255 ASN n 
1 256 GLY n 
1 257 PRO n 
1 258 PHE n 
1 259 GLY n 
1 260 GLN n 
1 261 ASN n 
1 262 PHE n 
1 263 ARG n 
1 264 ASP n 
1 265 PRO n 
1 266 MET n 
1 267 TYR n 
1 268 PRO n 
1 269 TRP n 
1 270 ASN n 
1 271 THR n 
1 272 THR n 
1 273 PRO n 
1 274 GLU n 
1 275 ASP n 
1 276 VAL n 
1 277 MET n 
1 278 ASN n 
1 279 HIS n 
1 280 ARG n 
1 281 LYS n 
1 282 LEU n 
1 283 GLY n 
1 284 TYR n 
1 285 VAL n 
1 286 TYR n 
1 287 ASP n 
1 288 ILE n 
1 289 GLU n 
1 290 LEU n 
1 291 ARG n 
1 292 LYS n 
1 293 SER n 
1 294 LYS n 
1 295 ARG n 
1 296 SER n 
1 297 SER n 
1 298 HIS n 
1 299 HIS n 
1 300 HIS n 
1 301 HIS n 
1 302 HIS n 
1 303 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus megaterium' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1404 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET9d 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    B2ZB02_BACME 
_struct_ref.pdbx_db_accession          B2ZB02 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSNKYRVRKNVLHLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAAGKFHTPPGSDRNAAHMSSAFLPWHREYLLRFERDL
QSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGNGNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAP
TLPTRDDVLNALKITQYDTPPWDMTSQNSFRNQLEGFINGPQLHNRVHRWVGGQMGVVPTAPNDPVFFLHHANVDRIWAV
WQIIHRNQNYQPMKNGPFGQNFRDPMYPWNTTPEDVMNHRKLGYVYDIELRKSKRSS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4D87 A 1 ? 297 ? B2ZB02 1 ? 297 ? 1 297 
2 1 4D87 B 1 ? 297 ? B2ZB02 1 ? 297 ? 1 297 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4D87 HIS A 298 ? UNP B2ZB02 ? ? 'EXPRESSION TAG' 298 1  
1 4D87 HIS A 299 ? UNP B2ZB02 ? ? 'EXPRESSION TAG' 299 2  
1 4D87 HIS A 300 ? UNP B2ZB02 ? ? 'EXPRESSION TAG' 300 3  
1 4D87 HIS A 301 ? UNP B2ZB02 ? ? 'EXPRESSION TAG' 301 4  
1 4D87 HIS A 302 ? UNP B2ZB02 ? ? 'EXPRESSION TAG' 302 5  
1 4D87 HIS A 303 ? UNP B2ZB02 ? ? 'EXPRESSION TAG' 303 6  
2 4D87 HIS B 298 ? UNP B2ZB02 ? ? 'EXPRESSION TAG' 298 7  
2 4D87 HIS B 299 ? UNP B2ZB02 ? ? 'EXPRESSION TAG' 299 8  
2 4D87 HIS B 300 ? UNP B2ZB02 ? ? 'EXPRESSION TAG' 300 9  
2 4D87 HIS B 301 ? UNP B2ZB02 ? ? 'EXPRESSION TAG' 301 10 
2 4D87 HIS B 302 ? UNP B2ZB02 ? ? 'EXPRESSION TAG' 302 11 
2 4D87 HIS B 303 ? UNP B2ZB02 ? ? 'EXPRESSION TAG' 303 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CU  non-polymer         . 'COPPER (II) ION' ? 'Cu 2'           63.546  
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SDS non-polymer         . 'DODECYL SULFATE' ? 'C12 H26 O4 S'   266.397 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4D87 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.24 
_exptl_crystal.density_percent_sol   45.11 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'PEG 8000, sodium cacodylate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2011-02-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9763 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9763 
# 
_reflns.entry_id                     4D87 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             83.53 
_reflns.d_resolution_high            3.5 
_reflns.number_obs                   6631 
_reflns.number_all                   16950 
_reflns.percent_possible_obs         82.97 
_reflns.pdbx_Rmerge_I_obs            0.097 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
3.5   3.69  73.4 0.162 ? 7.8 2.6 ? ? ? ? ? ? 1 1 
11.07 57.45 93.3 0.058 ? 9.7 2.5 ? ? ? ? ? ? 2 1 
# 
_refine.entry_id                                 4D87 
_refine.ls_number_reflns_obs                     5980 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             83.5 
_refine.ls_d_res_high                            3.50 
_refine.ls_percent_reflns_obs                    82.97 
_refine.ls_R_factor_obs                          0.26248 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.25925 
_refine.ls_R_factor_R_free                       0.29287 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.8 
_refine.ls_number_reflns_R_free                  650 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.771 
_refine.correlation_coeff_Fo_to_Fc_free          0.691 
_refine.B_iso_mean                               25.976 
_refine.aniso_B[1][1]                            0.77 
_refine.aniso_B[2][2]                            -0.63 
_refine.aniso_B[3][3]                            0.11 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.54 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.886 
_refine.pdbx_overall_ESU_R_Free                  1.001 
_refine.overall_SU_ML                            0.000 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             0.007 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4683 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         19 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4702 
_refine_hist.d_res_high                       3.50 
_refine_hist.d_res_low                        83.5 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.500 
_refine_ls_shell.d_res_low                        3.591 
_refine_ls_shell.number_reflns_R_work             411 
_refine_ls_shell.R_factor_R_work                  0.334 
_refine_ls_shell.percent_reflns_obs               77.74 
_refine_ls_shell.R_factor_R_free                  0.315 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             50 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4D87 
_struct.title                     'Crystal Structure of Tyrosinase from Bacillus megaterium in complex with SDS' 
_struct.pdbx_descriptor           'Tyrosinase (E.C.1.14.18.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4D87 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'type 3 copper protein, tyrosinase, oxidoreductase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 10  ? LEU A 14  ? ASN A 10  LEU A 14  5 ? 5  
HELX_P HELX_P2  2  ASP A 16  ? LYS A 32  ? ASP A 16  LYS A 32  1 ? 17 
HELX_P HELX_P3  3  TYR A 35  ? ALA A 45  ? TYR A 35  ALA A 45  1 ? 11 
HELX_P HELX_P4  4  ALA A 64  ? ASN A 84  ? ALA A 64  ASN A 84  1 ? 21 
HELX_P HELX_P5  5  GLU A 93  ? ALA A 98  ? GLU A 93  ALA A 98  1 ? 6  
HELX_P HELX_P6  6  ASN A 119 ? ASP A 123 ? ASN A 119 ASP A 123 5 ? 5  
HELX_P HELX_P7  7  THR A 164 ? ILE A 174 ? THR A 164 ILE A 174 1 ? 11 
HELX_P HELX_P8  8  SER A 189 ? GLY A 196 ? SER A 189 GLY A 196 1 ? 8  
HELX_P HELX_P9  9  GLN A 202 ? GLY A 212 ? GLN A 202 GLY A 212 1 ? 11 
HELX_P HELX_P10 10 GLY A 213 ? VAL A 217 ? GLY A 213 VAL A 217 5 ? 5  
HELX_P HELX_P11 11 THR A 220 ? ASP A 224 ? THR A 220 ASP A 224 5 ? 5  
HELX_P HELX_P12 12 PRO A 225 ? HIS A 245 ? PRO A 225 HIS A 245 1 ? 21 
HELX_P HELX_P13 13 THR A 272 ? MET A 277 ? THR A 272 MET A 277 5 ? 6  
HELX_P HELX_P14 14 HIS A 279 ? LEU A 282 ? HIS A 279 LEU A 282 5 ? 4  
HELX_P HELX_P15 15 THR B 17  ? GLU B 31  ? THR B 17  GLU B 31  1 ? 15 
HELX_P HELX_P16 16 TYR B 35  ? ALA B 45  ? TYR B 35  ALA B 45  1 ? 11 
HELX_P HELX_P17 17 ALA B 64  ? SER B 82  ? ALA B 64  SER B 82  1 ? 19 
HELX_P HELX_P18 18 GLU B 93  ? GLN B 99  ? GLU B 93  GLN B 99  1 ? 7  
HELX_P HELX_P19 19 ASP B 102 ? SER B 106 ? ASP B 102 SER B 106 5 ? 5  
HELX_P HELX_P20 20 ASN B 119 ? ASP B 123 ? ASN B 119 ASP B 123 5 ? 5  
HELX_P HELX_P21 21 THR B 164 ? LEU B 172 ? THR B 164 LEU B 172 1 ? 9  
HELX_P HELX_P22 22 SER B 189 ? GLY B 196 ? SER B 189 GLY B 196 1 ? 8  
HELX_P HELX_P23 23 GLN B 202 ? VAL B 211 ? GLN B 202 VAL B 211 1 ? 10 
HELX_P HELX_P24 24 GLY B 212 ? GLY B 216 ? GLY B 212 GLY B 216 5 ? 5  
HELX_P HELX_P25 25 THR B 220 ? PRO B 225 ? THR B 220 PRO B 225 5 ? 6  
HELX_P HELX_P26 26 VAL B 226 ? HIS B 245 ? VAL B 226 HIS B 245 1 ? 20 
HELX_P HELX_P27 27 THR B 272 ? MET B 277 ? THR B 272 MET B 277 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A HIS 69 NE2 ? ? ? 1_555 C CU . CU ? ? A HIS 69 A CU 401 1_555 ? ? ? ? ? ? ? 1.837 ? 
metalc2 metalc ? ? B HIS 60 NE2 ? ? ? 1_555 E CU . CU ? ? B HIS 60 B CU 401 1_555 ? ? ? ? ? ? ? 2.169 ? 
metalc3 metalc ? ? B HIS 42 NE2 ? ? ? 1_555 E CU . CU ? ? B HIS 42 B CU 401 1_555 ? ? ? ? ? ? ? 2.469 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  THR 50  A . ? THR 50  A PRO 51  A ? PRO 51  A 1 -0.22  
2  PRO 180 A . ? PRO 180 A PRO 181 A ? PRO 181 A 1 -12.63 
3  GLY 200 A . ? GLY 200 A PRO 201 A ? PRO 201 A 1 12.25  
4  GLN 251 A . ? GLN 251 A PRO 252 A ? PRO 252 A 1 6.25   
5  TYR 267 A . ? TYR 267 A PRO 268 A ? PRO 268 A 1 5.41   
6  THR 50  B . ? THR 50  B PRO 51  B ? PRO 51  B 1 1.14   
7  PRO 180 B . ? PRO 180 B PRO 181 B ? PRO 181 B 1 -2.27  
8  GLY 200 B . ? GLY 200 B PRO 201 B ? PRO 201 B 1 11.15  
9  GLN 251 B . ? GLN 251 B PRO 252 B ? PRO 252 B 1 8.35   
10 TYR 267 B . ? TYR 267 B PRO 268 B ? PRO 268 B 1 -0.14  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 6   ? ARG A 8   ? ARG A 6   ARG A 8   
A 2 TYR A 284 ? TYR A 286 ? TYR A 284 TYR A 286 
B 1 THR B 138 ? ILE B 139 ? THR B 138 ILE B 139 
B 2 PRO B 145 ? GLY B 147 ? PRO B 145 GLY B 147 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 8   ? N ARG A 8   O VAL A 285 ? O VAL A 285 
B 1 2 N THR B 138 ? N THR B 138 O SER B 146 ? O SER B 146 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CU A 401'  
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SDS A 402' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CU B 401'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 HIS A 42  ? HIS A 42  . ? 1_555 ? 
2 AC1 3 HIS A 60  ? HIS A 60  . ? 1_555 ? 
3 AC1 3 HIS A 69  ? HIS A 69  . ? 1_555 ? 
4 AC2 1 ARG A 209 ? ARG A 209 . ? 1_555 ? 
5 AC3 4 HIS B 42  ? HIS B 42  . ? 1_555 ? 
6 AC3 4 HIS B 60  ? HIS B 60  . ? 1_555 ? 
7 AC3 4 HIS B 69  ? HIS B 69  . ? 1_555 ? 
8 AC3 4 HIS B 231 ? HIS B 231 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4D87 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4D87 
_atom_sites.fract_transf_matrix[1][1]   0.020903 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005042 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012636 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011971 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CU 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 4   ? 9.790   -6.298  3.443   1.00 60.20  ? 4   LYS A N   1 
ATOM   2    C  CA  . LYS A 1 4   ? 10.204  -4.924  3.185   1.00 38.45  ? 4   LYS A CA  1 
ATOM   3    C  C   . LYS A 1 4   ? 9.247   -4.231  2.221   1.00 41.14  ? 4   LYS A C   1 
ATOM   4    O  O   . LYS A 1 4   ? 9.066   -4.673  1.086   1.00 63.47  ? 4   LYS A O   1 
ATOM   5    C  CB  . LYS A 1 4   ? 11.629  -4.889  2.627   1.00 56.27  ? 4   LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 4   ? 12.559  -5.926  3.236   1.00 50.17  ? 4   LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 4   ? 11.892  -7.289  3.313   1.00 62.84  ? 4   LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 4   ? 12.099  -8.078  2.031   1.00 81.43  ? 4   LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 4   ? 10.882  -8.846  1.648   1.00 83.29  ? 4   LYS A NZ  1 
ATOM   10   N  N   . TYR A 1 5   ? 8.638   -3.142  2.680   1.00 46.08  ? 5   TYR A N   1 
ATOM   11   C  CA  . TYR A 1 5   ? 7.699   -2.386  1.859   1.00 57.44  ? 5   TYR A CA  1 
ATOM   12   C  C   . TYR A 1 5   ? 8.133   -0.928  1.763   1.00 49.82  ? 5   TYR A C   1 
ATOM   13   O  O   . TYR A 1 5   ? 8.666   -0.495  0.741   1.00 55.08  ? 5   TYR A O   1 
ATOM   14   C  CB  . TYR A 1 5   ? 6.283   -2.494  2.429   1.00 65.15  ? 5   TYR A CB  1 
ATOM   15   C  CG  . TYR A 1 5   ? 5.843   -3.913  2.711   1.00 74.42  ? 5   TYR A CG  1 
ATOM   16   C  CD1 . TYR A 1 5   ? 5.940   -4.897  1.736   1.00 83.20  ? 5   TYR A CD1 1 
ATOM   17   C  CD2 . TYR A 1 5   ? 5.330   -4.268  3.951   1.00 81.89  ? 5   TYR A CD2 1 
ATOM   18   C  CE1 . TYR A 1 5   ? 5.539   -6.195  1.989   1.00 111.23 ? 5   TYR A CE1 1 
ATOM   19   C  CE2 . TYR A 1 5   ? 4.926   -5.563  4.214   1.00 93.10  ? 5   TYR A CE2 1 
ATOM   20   C  CZ  . TYR A 1 5   ? 5.033   -6.522  3.229   1.00 116.29 ? 5   TYR A CZ  1 
ATOM   21   O  OH  . TYR A 1 5   ? 4.632   -7.813  3.486   1.00 116.59 ? 5   TYR A OH  1 
ATOM   22   N  N   . ARG A 1 6   ? 7.903   -0.175  2.834   1.00 35.00  ? 6   ARG A N   1 
ATOM   23   C  CA  . ARG A 1 6   ? 8.249   1.210   2.866   1.00 33.91  ? 6   ARG A CA  1 
ATOM   24   C  C   . ARG A 1 6   ? 9.456   1.311   1.988   1.00 29.29  ? 6   ARG A C   1 
ATOM   25   O  O   . ARG A 1 6   ? 10.248  0.403   1.943   1.00 27.29  ? 6   ARG A O   1 
ATOM   26   C  CB  . ARG A 1 6   ? 8.514   1.712   4.282   1.00 37.40  ? 6   ARG A CB  1 
ATOM   27   C  CG  . ARG A 1 6   ? 7.271   2.315   4.939   1.00 43.61  ? 6   ARG A CG  1 
ATOM   28   C  CD  . ARG A 1 6   ? 7.532   2.863   6.329   1.00 29.18  ? 6   ARG A CD  1 
ATOM   29   N  NE  . ARG A 1 6   ? 7.336   1.839   7.336   1.00 29.79  ? 6   ARG A NE  1 
ATOM   30   C  CZ  . ARG A 1 6   ? 8.110   1.682   8.397   1.00 29.72  ? 6   ARG A CZ  1 
ATOM   31   N  NH1 . ARG A 1 6   ? 9.125   2.491   8.605   1.00 34.19  ? 6   ARG A NH1 1 
ATOM   32   N  NH2 . ARG A 1 6   ? 7.869   0.712   9.256   1.00 29.63  ? 6   ARG A NH2 1 
ATOM   33   N  N   . VAL A 1 7   ? 9.573   2.386   1.238   1.00 28.47  ? 7   VAL A N   1 
ATOM   34   C  CA  . VAL A 1 7   ? 10.614  2.470   0.244   1.00 28.83  ? 7   VAL A CA  1 
ATOM   35   C  C   . VAL A 1 7   ? 11.178  3.856   0.231   1.00 18.06  ? 7   VAL A C   1 
ATOM   36   O  O   . VAL A 1 7   ? 10.567  4.794   -0.236  1.00 15.91  ? 7   VAL A O   1 
ATOM   37   C  CB  . VAL A 1 7   ? 10.067  2.157   -1.131  1.00 34.35  ? 7   VAL A CB  1 
ATOM   38   C  CG1 . VAL A 1 7   ? 8.797   2.957   -1.353  1.00 58.70  ? 7   VAL A CG1 1 
ATOM   39   C  CG2 . VAL A 1 7   ? 11.115  2.426   -2.196  1.00 22.56  ? 7   VAL A CG2 1 
ATOM   40   N  N   . ARG A 1 8   ? 12.399  4.012   0.732   1.00 12.32  ? 8   ARG A N   1 
ATOM   41   C  CA  . ARG A 1 8   ? 13.010  5.318   0.935   1.00 10.70  ? 8   ARG A CA  1 
ATOM   42   C  C   . ARG A 1 8   ? 13.810  5.775   -0.265  1.00 12.67  ? 8   ARG A C   1 
ATOM   43   O  O   . ARG A 1 8   ? 14.872  5.263   -0.509  1.00 15.87  ? 8   ARG A O   1 
ATOM   44   C  CB  . ARG A 1 8   ? 13.936  5.249   2.136   1.00 11.56  ? 8   ARG A CB  1 
ATOM   45   C  CG  . ARG A 1 8   ? 13.603  6.170   3.297   1.00 18.48  ? 8   ARG A CG  1 
ATOM   46   C  CD  . ARG A 1 8   ? 13.256  5.334   4.512   1.00 26.68  ? 8   ARG A CD  1 
ATOM   47   N  NE  . ARG A 1 8   ? 13.976  5.678   5.731   1.00 24.59  ? 8   ARG A NE  1 
ATOM   48   C  CZ  . ARG A 1 8   ? 13.418  5.678   6.934   1.00 18.45  ? 8   ARG A CZ  1 
ATOM   49   N  NH1 . ARG A 1 8   ? 12.133  5.377   7.070   1.00 13.29  ? 8   ARG A NH1 1 
ATOM   50   N  NH2 . ARG A 1 8   ? 14.140  5.986   7.992   1.00 16.05  ? 8   ARG A NH2 1 
ATOM   51   N  N   . LYS A 1 9   ? 13.322  6.788   -0.969  1.00 15.62  ? 9   LYS A N   1 
ATOM   52   C  CA  . LYS A 1 9   ? 13.789  7.156   -2.300  1.00 12.09  ? 9   LYS A CA  1 
ATOM   53   C  C   . LYS A 1 9   ? 14.707  8.325   -2.371  1.00 12.88  ? 9   LYS A C   1 
ATOM   54   O  O   . LYS A 1 9   ? 14.470  9.321   -1.746  1.00 11.51  ? 9   LYS A O   1 
ATOM   55   C  CB  . LYS A 1 9   ? 12.595  7.532   -3.151  1.00 16.94  ? 9   LYS A CB  1 
ATOM   56   C  CG  . LYS A 1 9   ? 12.160  6.476   -4.138  1.00 23.64  ? 9   LYS A CG  1 
ATOM   57   C  CD  . LYS A 1 9   ? 10.785  6.796   -4.665  1.00 24.70  ? 9   LYS A CD  1 
ATOM   58   C  CE  . LYS A 1 9   ? 9.793   5.734   -4.269  1.00 24.74  ? 9   LYS A CE  1 
ATOM   59   N  NZ  . LYS A 1 9   ? 8.450   6.335   -4.092  1.00 41.26  ? 9   LYS A NZ  1 
ATOM   60   N  N   . ASN A 1 10  ? 15.744  8.227   -3.172  1.00 19.58  ? 10  ASN A N   1 
ATOM   61   C  CA  . ASN A 1 10  ? 16.653  9.340   -3.258  1.00 18.52  ? 10  ASN A CA  1 
ATOM   62   C  C   . ASN A 1 10  ? 15.860  10.549  -3.611  1.00 15.29  ? 10  ASN A C   1 
ATOM   63   O  O   . ASN A 1 10  ? 15.025  10.535  -4.484  1.00 17.12  ? 10  ASN A O   1 
ATOM   64   C  CB  . ASN A 1 10  ? 17.774  9.118   -4.265  1.00 14.22  ? 10  ASN A CB  1 
ATOM   65   C  CG  . ASN A 1 10  ? 18.409  10.404  -4.674  1.00 11.34  ? 10  ASN A CG  1 
ATOM   66   O  OD1 . ASN A 1 10  ? 17.897  11.449  -4.357  1.00 8.53   ? 10  ASN A OD1 1 
ATOM   67   N  ND2 . ASN A 1 10  ? 19.513  10.339  -5.374  1.00 14.30  ? 10  ASN A ND2 1 
ATOM   68   N  N   . VAL A 1 11  ? 16.114  11.609  -2.902  1.00 10.76  ? 11  VAL A N   1 
ATOM   69   C  CA  . VAL A 1 11  ? 15.477  12.872  -3.212  1.00 16.67  ? 11  VAL A CA  1 
ATOM   70   C  C   . VAL A 1 11  ? 15.358  13.110  -4.738  1.00 26.07  ? 11  VAL A C   1 
ATOM   71   O  O   . VAL A 1 11  ? 14.265  13.393  -5.238  1.00 27.02  ? 11  VAL A O   1 
ATOM   72   C  CB  . VAL A 1 11  ? 16.200  14.014  -2.498  1.00 18.27  ? 11  VAL A CB  1 
ATOM   73   C  CG1 . VAL A 1 11  ? 15.716  15.354  -2.985  1.00 15.60  ? 11  VAL A CG1 1 
ATOM   74   C  CG2 . VAL A 1 11  ? 15.981  13.880  -1.008  1.00 14.25  ? 11  VAL A CG2 1 
ATOM   75   N  N   . LEU A 1 12  ? 16.439  12.947  -5.494  1.00 28.91  ? 12  LEU A N   1 
ATOM   76   C  CA  . LEU A 1 12  ? 16.419  13.224  -6.935  1.00 23.78  ? 12  LEU A CA  1 
ATOM   77   C  C   . LEU A 1 12  ? 15.661  12.220  -7.797  1.00 21.93  ? 12  LEU A C   1 
ATOM   78   O  O   . LEU A 1 12  ? 15.804  12.212  -9.007  1.00 23.76  ? 12  LEU A O   1 
ATOM   79   C  CB  . LEU A 1 12  ? 17.838  13.342  -7.455  1.00 26.56  ? 12  LEU A CB  1 
ATOM   80   C  CG  . LEU A 1 12  ? 18.741  14.263  -6.650  1.00 35.72  ? 12  LEU A CG  1 
ATOM   81   C  CD1 . LEU A 1 12  ? 19.162  15.477  -7.461  1.00 27.57  ? 12  LEU A CD1 1 
ATOM   82   C  CD2 . LEU A 1 12  ? 18.052  14.686  -5.371  1.00 31.34  ? 12  LEU A CD2 1 
ATOM   83   N  N   . HIS A 1 13  ? 14.802  11.456  -7.141  1.00 21.18  ? 13  HIS A N   1 
ATOM   84   C  CA  . HIS A 1 13  ? 14.007  10.463  -7.788  1.00 23.68  ? 13  HIS A CA  1 
ATOM   85   C  C   . HIS A 1 13  ? 12.630  10.738  -7.402  1.00 18.06  ? 13  HIS A C   1 
ATOM   86   O  O   . HIS A 1 13  ? 11.722  9.945   -7.655  1.00 23.77  ? 13  HIS A O   1 
ATOM   87   C  CB  . HIS A 1 13  ? 14.343  9.100   -7.262  1.00 21.74  ? 13  HIS A CB  1 
ATOM   88   C  CG  . HIS A 1 13  ? 15.624  8.565   -7.774  1.00 23.48  ? 13  HIS A CG  1 
ATOM   89   N  ND1 . HIS A 1 13  ? 16.223  7.513   -7.231  1.00 22.98  ? 13  HIS A ND1 1 
ATOM   90   C  CD2 . HIS A 1 13  ? 16.427  8.985   -8.811  1.00 32.03  ? 13  HIS A CD2 1 
ATOM   91   C  CE1 . HIS A 1 13  ? 17.348  7.257   -7.889  1.00 38.44  ? 13  HIS A CE1 1 
ATOM   92   N  NE2 . HIS A 1 13  ? 17.476  8.163   -8.856  1.00 42.76  ? 13  HIS A NE2 1 
ATOM   93   N  N   . LEU A 1 14  ? 12.477  11.836  -6.695  1.00 14.85  ? 14  LEU A N   1 
ATOM   94   C  CA  . LEU A 1 14  ? 11.200  12.156  -6.116  1.00 25.53  ? 14  LEU A CA  1 
ATOM   95   C  C   . LEU A 1 14  ? 10.439  12.963  -7.128  1.00 23.87  ? 14  LEU A C   1 
ATOM   96   O  O   . LEU A 1 14  ? 10.843  14.046  -7.486  1.00 27.33  ? 14  LEU A O   1 
ATOM   97   C  CB  . LEU A 1 14  ? 11.355  12.925  -4.793  1.00 19.37  ? 14  LEU A CB  1 
ATOM   98   C  CG  . LEU A 1 14  ? 11.256  12.153  -3.483  1.00 13.12  ? 14  LEU A CG  1 
ATOM   99   C  CD1 . LEU A 1 14  ? 11.406  13.117  -2.336  1.00 11.64  ? 14  LEU A CD1 1 
ATOM   100  C  CD2 . LEU A 1 14  ? 9.984   11.355  -3.353  1.00 9.78   ? 14  LEU A CD2 1 
ATOM   101  N  N   . THR A 1 15  ? 9.365   12.377  -7.625  1.00 23.71  ? 15  THR A N   1 
ATOM   102  C  CA  . THR A 1 15  ? 8.469   13.078  -8.491  1.00 21.67  ? 15  THR A CA  1 
ATOM   103  C  C   . THR A 1 15  ? 8.163   14.227  -7.614  1.00 23.12  ? 15  THR A C   1 
ATOM   104  O  O   . THR A 1 15  ? 8.537   14.192  -6.463  1.00 25.36  ? 15  THR A O   1 
ATOM   105  C  CB  . THR A 1 15  ? 7.118   12.416  -8.466  1.00 25.20  ? 15  THR A CB  1 
ATOM   106  O  OG1 . THR A 1 15  ? 6.124   13.424  -8.374  1.00 23.55  ? 15  THR A OG1 1 
ATOM   107  C  CG2 . THR A 1 15  ? 7.034   11.530  -7.262  1.00 35.50  ? 15  THR A CG2 1 
ATOM   108  N  N   . ASP A 1 16  ? 7.501   15.249  -8.128  1.00 24.34  ? 16  ASP A N   1 
ATOM   109  C  CA  . ASP A 1 16  ? 7.277   16.422  -7.306  1.00 31.90  ? 16  ASP A CA  1 
ATOM   110  C  C   . ASP A 1 16  ? 6.045   16.177  -6.489  1.00 23.61  ? 16  ASP A C   1 
ATOM   111  O  O   . ASP A 1 16  ? 6.122   16.001  -5.278  1.00 19.98  ? 16  ASP A O   1 
ATOM   112  C  CB  . ASP A 1 16  ? 7.124   17.687  -8.119  1.00 40.02  ? 16  ASP A CB  1 
ATOM   113  C  CG  . ASP A 1 16  ? 7.477   17.486  -9.539  1.00 55.56  ? 16  ASP A CG  1 
ATOM   114  O  OD1 . ASP A 1 16  ? 8.311   16.611  -9.793  1.00 50.28  ? 16  ASP A OD1 1 
ATOM   115  O  OD2 . ASP A 1 16  ? 6.910   18.185  -10.402 1.00 71.41  ? 16  ASP A OD2 1 
ATOM   116  N  N   . THR A 1 17  ? 4.882   16.100  -7.098  1.00 16.00  ? 17  THR A N   1 
ATOM   117  C  CA  . THR A 1 17  ? 3.859   15.797  -6.118  1.00 21.56  ? 17  THR A CA  1 
ATOM   118  C  C   . THR A 1 17  ? 4.401   15.056  -4.904  1.00 20.88  ? 17  THR A C   1 
ATOM   119  O  O   . THR A 1 17  ? 3.887   15.224  -3.809  1.00 22.85  ? 17  THR A O   1 
ATOM   120  C  CB  . THR A 1 17  ? 2.750   14.961  -6.753  1.00 28.54  ? 17  THR A CB  1 
ATOM   121  O  OG1 . THR A 1 17  ? 2.358   13.944  -5.833  1.00 32.05  ? 17  THR A OG1 1 
ATOM   122  C  CG2 . THR A 1 17  ? 3.297   14.290  -8.025  1.00 22.45  ? 17  THR A CG2 1 
ATOM   123  N  N   . GLU A 1 18  ? 5.421   14.229  -5.091  1.00 20.40  ? 18  GLU A N   1 
ATOM   124  C  CA  . GLU A 1 18  ? 6.024   13.500  -3.975  1.00 21.46  ? 18  GLU A CA  1 
ATOM   125  C  C   . GLU A 1 18  ? 6.845   14.380  -3.070  1.00 17.36  ? 18  GLU A C   1 
ATOM   126  O  O   . GLU A 1 18  ? 6.976   14.129  -1.884  1.00 15.08  ? 18  GLU A O   1 
ATOM   127  C  CB  . GLU A 1 18  ? 6.897   12.363  -4.491  1.00 23.57  ? 18  GLU A CB  1 
ATOM   128  C  CG  . GLU A 1 18  ? 6.395   10.969  -4.181  1.00 31.02  ? 18  GLU A CG  1 
ATOM   129  C  CD  . GLU A 1 18  ? 7.031   9.897   -5.049  1.00 45.82  ? 18  GLU A CD  1 
ATOM   130  O  OE1 . GLU A 1 18  ? 7.730   10.230  -6.019  1.00 34.01  ? 18  GLU A OE1 1 
ATOM   131  O  OE2 . GLU A 1 18  ? 6.834   8.705   -4.766  1.00 51.48  ? 18  GLU A OE2 1 
ATOM   132  N  N   . LYS A 1 19  ? 7.352   15.473  -3.624  1.00 15.81  ? 19  LYS A N   1 
ATOM   133  C  CA  . LYS A 1 19  ? 8.102   16.443  -2.846  1.00 13.18  ? 19  LYS A CA  1 
ATOM   134  C  C   . LYS A 1 19  ? 7.108   17.328  -2.178  1.00 18.97  ? 19  LYS A C   1 
ATOM   135  O  O   . LYS A 1 19  ? 7.248   17.693  -1.030  1.00 21.01  ? 19  LYS A O   1 
ATOM   136  C  CB  . LYS A 1 19  ? 8.956   17.327  -3.728  1.00 12.20  ? 19  LYS A CB  1 
ATOM   137  C  CG  . LYS A 1 19  ? 10.147  16.649  -4.363  1.00 21.32  ? 19  LYS A CG  1 
ATOM   138  C  CD  . LYS A 1 19  ? 11.232  17.668  -4.645  1.00 19.43  ? 19  LYS A CD  1 
ATOM   139  C  CE  . LYS A 1 19  ? 11.810  17.536  -6.034  1.00 22.66  ? 19  LYS A CE  1 
ATOM   140  N  NZ  . LYS A 1 19  ? 13.286  17.392  -5.987  1.00 16.69  ? 19  LYS A NZ  1 
ATOM   141  N  N   . ARG A 1 20  ? 6.067   17.686  -2.922  1.00 22.61  ? 20  ARG A N   1 
ATOM   142  C  CA  . ARG A 1 20  ? 5.013   18.548  -2.401  1.00 25.16  ? 20  ARG A CA  1 
ATOM   143  C  C   . ARG A 1 20  ? 4.231   17.852  -1.292  1.00 23.96  ? 20  ARG A C   1 
ATOM   144  O  O   . ARG A 1 20  ? 3.645   18.505  -0.428  1.00 24.62  ? 20  ARG A O   1 
ATOM   145  C  CB  . ARG A 1 20  ? 4.066   18.976  -3.523  1.00 36.69  ? 20  ARG A CB  1 
ATOM   146  C  CG  . ARG A 1 20  ? 2.621   18.553  -3.311  1.00 54.77  ? 20  ARG A CG  1 
ATOM   147  C  CD  . ARG A 1 20  ? 1.660   19.495  -4.018  1.00 72.98  ? 20  ARG A CD  1 
ATOM   148  N  NE  . ARG A 1 20  ? 1.613   20.808  -3.380  1.00 101.60 ? 20  ARG A NE  1 
ATOM   149  C  CZ  . ARG A 1 20  ? 1.088   21.892  -3.940  1.00 110.40 ? 20  ARG A CZ  1 
ATOM   150  N  NH1 . ARG A 1 20  ? 0.561   21.825  -5.155  1.00 124.49 ? 20  ARG A NH1 1 
ATOM   151  N  NH2 . ARG A 1 20  ? 1.088   23.045  -3.285  1.00 105.29 ? 20  ARG A NH2 1 
ATOM   152  N  N   . ASP A 1 21  ? 4.228   16.523  -1.322  1.00 25.68  ? 21  ASP A N   1 
ATOM   153  C  CA  . ASP A 1 21  ? 3.522   15.736  -0.319  1.00 20.16  ? 21  ASP A CA  1 
ATOM   154  C  C   . ASP A 1 21  ? 4.370   15.556  0.936   1.00 15.38  ? 21  ASP A C   1 
ATOM   155  O  O   . ASP A 1 21  ? 3.845   15.472  2.046   1.00 19.51  ? 21  ASP A O   1 
ATOM   156  C  CB  . ASP A 1 21  ? 3.128   14.371  -0.888  1.00 22.66  ? 21  ASP A CB  1 
ATOM   157  C  CG  . ASP A 1 21  ? 2.290   14.485  -2.146  1.00 26.37  ? 21  ASP A CG  1 
ATOM   158  O  OD1 . ASP A 1 21  ? 1.047   14.531  -2.031  1.00 31.44  ? 21  ASP A OD1 1 
ATOM   159  O  OD2 . ASP A 1 21  ? 2.873   14.528  -3.249  1.00 18.20  ? 21  ASP A OD2 1 
ATOM   160  N  N   . PHE A 1 22  ? 5.685   15.498  0.751   1.00 17.00  ? 22  PHE A N   1 
ATOM   161  C  CA  . PHE A 1 22  ? 6.609   15.331  1.866   1.00 22.56  ? 22  PHE A CA  1 
ATOM   162  C  C   . PHE A 1 22  ? 6.769   16.630  2.648   1.00 15.71  ? 22  PHE A C   1 
ATOM   163  O  O   . PHE A 1 22  ? 6.867   16.620  3.875   1.00 12.91  ? 22  PHE A O   1 
ATOM   164  C  CB  . PHE A 1 22  ? 7.971   14.847  1.366   1.00 19.26  ? 22  PHE A CB  1 
ATOM   165  C  CG  . PHE A 1 22  ? 8.989   14.668  2.456   1.00 12.64  ? 22  PHE A CG  1 
ATOM   166  C  CD1 . PHE A 1 22  ? 9.318   13.403  2.914   1.00 10.65  ? 22  PHE A CD1 1 
ATOM   167  C  CD2 . PHE A 1 22  ? 9.616   15.765  3.023   1.00 12.17  ? 22  PHE A CD2 1 
ATOM   168  C  CE1 . PHE A 1 22  ? 10.254  13.235  3.917   1.00 14.42  ? 22  PHE A CE1 1 
ATOM   169  C  CE2 . PHE A 1 22  ? 10.553  15.604  4.026   1.00 7.21   ? 22  PHE A CE2 1 
ATOM   170  C  CZ  . PHE A 1 22  ? 10.873  14.337  4.474   1.00 7.56   ? 22  PHE A CZ  1 
ATOM   171  N  N   . VAL A 1 23  ? 6.793   17.748  1.929   1.00 9.90   ? 23  VAL A N   1 
ATOM   172  C  CA  . VAL A 1 23  ? 6.938   19.057  2.553   1.00 8.74   ? 23  VAL A CA  1 
ATOM   173  C  C   . VAL A 1 23  ? 5.642   19.477  3.236   1.00 10.60  ? 23  VAL A C   1 
ATOM   174  O  O   . VAL A 1 23  ? 5.657   20.223  4.215   1.00 7.87   ? 23  VAL A O   1 
ATOM   175  C  CB  . VAL A 1 23  ? 7.339   20.131  1.525   1.00 9.38   ? 23  VAL A CB  1 
ATOM   176  C  CG1 . VAL A 1 23  ? 7.306   21.512  2.162   1.00 14.02  ? 23  VAL A CG1 1 
ATOM   177  C  CG2 . VAL A 1 23  ? 8.718   19.832  0.956   1.00 8.75   ? 23  VAL A CG2 1 
ATOM   178  N  N   . ARG A 1 24  ? 4.520   18.993  2.712   1.00 17.45  ? 24  ARG A N   1 
ATOM   179  C  CA  . ARG A 1 24  ? 3.227   19.305  3.271   1.00 19.88  ? 24  ARG A CA  1 
ATOM   180  C  C   . ARG A 1 24  ? 3.023   18.579  4.560   1.00 15.10  ? 24  ARG A C   1 
ATOM   181  O  O   . ARG A 1 24  ? 2.195   18.983  5.342   1.00 14.16  ? 24  ARG A O   1 
ATOM   182  C  CB  . ARG A 1 24  ? 2.121   18.863  2.328   1.00 30.25  ? 24  ARG A CB  1 
ATOM   183  C  CG  . ARG A 1 24  ? 2.213   19.486  0.961   1.00 52.92  ? 24  ARG A CG  1 
ATOM   184  C  CD  . ARG A 1 24  ? 2.583   20.937  1.093   1.00 68.83  ? 24  ARG A CD  1 
ATOM   185  N  NE  . ARG A 1 24  ? 1.909   21.691  0.063   1.00 104.28 ? 24  ARG A NE  1 
ATOM   186  C  CZ  . ARG A 1 24  ? 0.721   21.372  -0.427  1.00 119.93 ? 24  ARG A CZ  1 
ATOM   187  N  NH1 . ARG A 1 24  ? 0.070   20.314  0.033   1.00 121.13 ? 24  ARG A NH1 1 
ATOM   188  N  NH2 . ARG A 1 24  ? 0.193   22.117  -1.385  1.00 126.78 ? 24  ARG A NH2 1 
ATOM   189  N  N   . THR A 1 25  ? 3.726   17.475  4.764   1.00 9.85   ? 25  THR A N   1 
ATOM   190  C  CA  . THR A 1 25  ? 3.533   16.724  5.976   1.00 7.88   ? 25  THR A CA  1 
ATOM   191  C  C   . THR A 1 25  ? 4.468   17.174  7.050   1.00 7.46   ? 25  THR A C   1 
ATOM   192  O  O   . THR A 1 25  ? 4.073   17.326  8.182   1.00 8.37   ? 25  THR A O   1 
ATOM   193  C  CB  . THR A 1 25  ? 3.721   15.248  5.753   1.00 10.43  ? 25  THR A CB  1 
ATOM   194  O  OG1 . THR A 1 25  ? 2.755   14.815  4.803   1.00 14.58  ? 25  THR A OG1 1 
ATOM   195  C  CG2 . THR A 1 25  ? 3.499   14.501  7.041   1.00 11.61  ? 25  THR A CG2 1 
ATOM   196  N  N   . VAL A 1 26  ? 5.709   17.436  6.694   1.00 6.65   ? 26  VAL A N   1 
ATOM   197  C  CA  . VAL A 1 26  ? 6.646   17.928  7.670   1.00 7.26   ? 26  VAL A CA  1 
ATOM   198  C  C   . VAL A 1 26  ? 6.020   19.102  8.379   1.00 8.86   ? 26  VAL A C   1 
ATOM   199  O  O   . VAL A 1 26  ? 6.162   19.236  9.563   1.00 11.05  ? 26  VAL A O   1 
ATOM   200  C  CB  . VAL A 1 26  ? 7.937   18.431  7.029   1.00 7.56   ? 26  VAL A CB  1 
ATOM   201  C  CG1 . VAL A 1 26  ? 8.563   19.462  7.928   1.00 9.48   ? 26  VAL A CG1 1 
ATOM   202  C  CG2 . VAL A 1 26  ? 8.912   17.310  6.767   1.00 3.58   ? 26  VAL A CG2 1 
ATOM   203  N  N   . LEU A 1 27  ? 5.283   19.941  7.678   1.00 8.82   ? 27  LEU A N   1 
ATOM   204  C  CA  . LEU A 1 27  ? 4.678   21.086  8.331   1.00 8.20   ? 27  LEU A CA  1 
ATOM   205  C  C   . LEU A 1 27  ? 3.697   20.581  9.330   1.00 10.17  ? 27  LEU A C   1 
ATOM   206  O  O   . LEU A 1 27  ? 3.780   20.880  10.508  1.00 10.02  ? 27  LEU A O   1 
ATOM   207  C  CB  . LEU A 1 27  ? 3.928   21.954  7.341   1.00 5.07   ? 27  LEU A CB  1 
ATOM   208  C  CG  . LEU A 1 27  ? 4.744   22.483  6.185   1.00 9.62   ? 27  LEU A CG  1 
ATOM   209  C  CD1 . LEU A 1 27  ? 3.903   23.409  5.340   1.00 9.72   ? 27  LEU A CD1 1 
ATOM   210  C  CD2 . LEU A 1 27  ? 5.964   23.191  6.709   1.00 11.32  ? 27  LEU A CD2 1 
ATOM   211  N  N   . ILE A 1 28  ? 2.750   19.802  8.866   1.00 9.00   ? 28  ILE A N   1 
ATOM   212  C  CA  . ILE A 1 28  ? 1.719   19.265  9.711   1.00 10.30  ? 28  ILE A CA  1 
ATOM   213  C  C   . ILE A 1 28  ? 2.265   18.695  11.009  1.00 10.61  ? 28  ILE A C   1 
ATOM   214  O  O   . ILE A 1 28  ? 1.740   18.908  12.083  1.00 12.37  ? 28  ILE A O   1 
ATOM   215  C  CB  . ILE A 1 28  ? 1.062   18.136  8.973   1.00 10.21  ? 28  ILE A CB  1 
ATOM   216  C  CG1 . ILE A 1 28  ? -0.168  18.628  8.253   1.00 6.40   ? 28  ILE A CG1 1 
ATOM   217  C  CG2 . ILE A 1 28  ? 0.738   17.019  9.933   1.00 21.06  ? 28  ILE A CG2 1 
ATOM   218  C  CD1 . ILE A 1 28  ? -1.125  17.500  7.984   1.00 25.22  ? 28  ILE A CD1 1 
ATOM   219  N  N   . LEU A 1 29  ? 3.321   17.930  10.891  1.00 8.42   ? 29  LEU A N   1 
ATOM   220  C  CA  . LEU A 1 29  ? 4.043   17.413  12.042  1.00 7.79   ? 29  LEU A CA  1 
ATOM   221  C  C   . LEU A 1 29  ? 4.551   18.546  12.884  1.00 9.85   ? 29  LEU A C   1 
ATOM   222  O  O   . LEU A 1 29  ? 4.559   18.465  14.107  1.00 8.44   ? 29  LEU A O   1 
ATOM   223  C  CB  . LEU A 1 29  ? 5.258   16.629  11.577  1.00 8.80   ? 29  LEU A CB  1 
ATOM   224  C  CG  . LEU A 1 29  ? 5.189   15.131  11.805  1.00 8.37   ? 29  LEU A CG  1 
ATOM   225  C  CD1 . LEU A 1 29  ? 3.802   14.673  11.476  1.00 12.16  ? 29  LEU A CD1 1 
ATOM   226  C  CD2 . LEU A 1 29  ? 6.189   14.412  10.951  1.00 7.52   ? 29  LEU A CD2 1 
ATOM   227  N  N   . LYS A 1 30  ? 4.988   19.621  12.252  1.00 11.41  ? 30  LYS A N   1 
ATOM   228  C  CA  . LYS A 1 30  ? 5.515   20.775  12.961  1.00 12.16  ? 30  LYS A CA  1 
ATOM   229  C  C   . LYS A 1 30  ? 4.381   21.542  13.603  1.00 19.00  ? 30  LYS A C   1 
ATOM   230  O  O   . LYS A 1 30  ? 4.440   21.931  14.762  1.00 18.39  ? 30  LYS A O   1 
ATOM   231  C  CB  . LYS A 1 30  ? 6.235   21.688  11.991  1.00 10.11  ? 30  LYS A CB  1 
ATOM   232  C  CG  . LYS A 1 30  ? 6.673   23.008  12.584  1.00 19.19  ? 30  LYS A CG  1 
ATOM   233  C  CD  . LYS A 1 30  ? 7.625   22.787  13.743  1.00 26.22  ? 30  LYS A CD  1 
ATOM   234  C  CE  . LYS A 1 30  ? 8.850   23.685  13.655  1.00 29.40  ? 30  LYS A CE  1 
ATOM   235  N  NZ  . LYS A 1 30  ? 9.910   23.294  14.632  1.00 28.51  ? 30  LYS A NZ  1 
ATOM   236  N  N   . GLU A 1 31  ? 3.340   21.767  12.826  1.00 17.91  ? 31  GLU A N   1 
ATOM   237  C  CA  . GLU A 1 31  ? 2.123   22.392  13.334  1.00 18.13  ? 31  GLU A CA  1 
ATOM   238  C  C   . GLU A 1 31  ? 1.548   21.625  14.523  1.00 17.94  ? 31  GLU A C   1 
ATOM   239  O  O   . GLU A 1 31  ? 1.193   22.223  15.535  1.00 21.86  ? 31  GLU A O   1 
ATOM   240  C  CB  . GLU A 1 31  ? 1.076   22.491  12.224  1.00 26.91  ? 31  GLU A CB  1 
ATOM   241  C  CG  . GLU A 1 31  ? 0.026   23.573  12.433  1.00 54.20  ? 31  GLU A CG  1 
ATOM   242  C  CD  . GLU A 1 31  ? -1.097  23.157  13.370  1.00 59.28  ? 31  GLU A CD  1 
ATOM   243  O  OE1 . GLU A 1 31  ? -1.492  21.967  13.338  1.00 47.70  ? 31  GLU A OE1 1 
ATOM   244  O  OE2 . GLU A 1 31  ? -1.586  24.026  14.132  1.00 46.98  ? 31  GLU A OE2 1 
ATOM   245  N  N   . LYS A 1 32  ? 1.455   20.307  14.438  1.00 14.26  ? 32  LYS A N   1 
ATOM   246  C  CA  . LYS A 1 32  ? 0.862   19.566  15.541  1.00 18.80  ? 32  LYS A CA  1 
ATOM   247  C  C   . LYS A 1 32  ? 1.834   19.391  16.679  1.00 14.62  ? 32  LYS A C   1 
ATOM   248  O  O   . LYS A 1 32  ? 1.603   18.605  17.574  1.00 12.67  ? 32  LYS A O   1 
ATOM   249  C  CB  . LYS A 1 32  ? 0.324   18.217  15.089  1.00 15.93  ? 32  LYS A CB  1 
ATOM   250  C  CG  . LYS A 1 32  ? -0.451  18.282  13.786  1.00 21.53  ? 32  LYS A CG  1 
ATOM   251  C  CD  . LYS A 1 32  ? 0.037   17.238  12.811  1.00 22.58  ? 32  LYS A CD  1 
ATOM   252  C  CE  . LYS A 1 32  ? -0.451  15.880  13.255  1.00 55.19  ? 32  LYS A CE  1 
ATOM   253  N  NZ  . LYS A 1 32  ? -1.317  16.064  14.443  1.00 66.41  ? 32  LYS A NZ  1 
ATOM   254  N  N   . GLY A 1 33  ? 2.870   20.216  16.638  1.00 10.98  ? 33  GLY A N   1 
ATOM   255  C  CA  . GLY A 1 33  ? 3.823   20.329  17.709  1.00 7.24   ? 33  GLY A CA  1 
ATOM   256  C  C   . GLY A 1 33  ? 4.399   18.988  17.966  1.00 10.22  ? 33  GLY A C   1 
ATOM   257  O  O   . GLY A 1 33  ? 4.777   18.688  19.072  1.00 8.04   ? 33  GLY A O   1 
ATOM   258  N  N   . ILE A 1 34  ? 4.445   18.183  16.915  1.00 16.27  ? 34  ILE A N   1 
ATOM   259  C  CA  . ILE A 1 34  ? 4.885   16.798  16.979  1.00 10.03  ? 34  ILE A CA  1 
ATOM   260  C  C   . ILE A 1 34  ? 6.298   16.737  16.517  1.00 6.08   ? 34  ILE A C   1 
ATOM   261  O  O   . ILE A 1 34  ? 6.999   15.803  16.763  1.00 5.64   ? 34  ILE A O   1 
ATOM   262  C  CB  . ILE A 1 34  ? 4.120   15.923  15.996  1.00 7.39   ? 34  ILE A CB  1 
ATOM   263  C  CG1 . ILE A 1 34  ? 2.844   15.390  16.592  1.00 5.61   ? 34  ILE A CG1 1 
ATOM   264  C  CG2 . ILE A 1 34  ? 4.958   14.744  15.625  1.00 8.93   ? 34  ILE A CG2 1 
ATOM   265  C  CD1 . ILE A 1 34  ? 2.098   14.522  15.621  1.00 7.04   ? 34  ILE A CD1 1 
ATOM   266  N  N   . TYR A 1 35  ? 6.700   17.755  15.806  1.00 6.79   ? 35  TYR A N   1 
ATOM   267  C  CA  . TYR A 1 35  ? 7.998   17.780  15.216  1.00 9.52   ? 35  TYR A CA  1 
ATOM   268  C  C   . TYR A 1 35  ? 8.995   18.280  16.209  1.00 9.15   ? 35  TYR A C   1 
ATOM   269  O  O   . TYR A 1 35  ? 10.135  17.894  16.210  1.00 7.70   ? 35  TYR A O   1 
ATOM   270  C  CB  . TYR A 1 35  ? 7.941   18.724  14.043  1.00 12.27  ? 35  TYR A CB  1 
ATOM   271  C  CG  . TYR A 1 35  ? 9.243   18.930  13.354  1.00 10.78  ? 35  TYR A CG  1 
ATOM   272  C  CD1 . TYR A 1 35  ? 9.464   18.418  12.104  1.00 7.87   ? 35  TYR A CD1 1 
ATOM   273  C  CD2 . TYR A 1 35  ? 10.233  19.664  13.937  1.00 13.04  ? 35  TYR A CD2 1 
ATOM   274  C  CE1 . TYR A 1 35  ? 10.652  18.621  11.465  1.00 11.68  ? 35  TYR A CE1 1 
ATOM   275  C  CE2 . TYR A 1 35  ? 11.419  19.874  13.299  1.00 9.67   ? 35  TYR A CE2 1 
ATOM   276  C  CZ  . TYR A 1 35  ? 11.609  19.345  12.070  1.00 10.19  ? 35  TYR A CZ  1 
ATOM   277  O  OH  . TYR A 1 35  ? 12.780  19.547  11.441  1.00 17.58  ? 35  TYR A OH  1 
ATOM   278  N  N   . ASP A 1 36  ? 8.539   19.172  17.083  1.00 9.60   ? 36  ASP A N   1 
ATOM   279  C  CA  . ASP A 1 36  ? 9.399   19.746  18.111  1.00 9.84   ? 36  ASP A CA  1 
ATOM   280  C  C   . ASP A 1 36  ? 9.943   18.652  19.024  1.00 11.90  ? 36  ASP A C   1 
ATOM   281  O  O   . ASP A 1 36  ? 11.062  18.749  19.526  1.00 17.09  ? 36  ASP A O   1 
ATOM   282  C  CB  . ASP A 1 36  ? 8.634   20.787  18.929  1.00 13.85  ? 36  ASP A CB  1 
ATOM   283  C  CG  . ASP A 1 36  ? 8.652   22.161  18.287  1.00 21.77  ? 36  ASP A CG  1 
ATOM   284  O  OD1 . ASP A 1 36  ? 9.384   23.042  18.785  1.00 21.72  ? 36  ASP A OD1 1 
ATOM   285  O  OD2 . ASP A 1 36  ? 7.933   22.359  17.285  1.00 28.87  ? 36  ASP A OD2 1 
ATOM   286  N  N   . ARG A 1 37  ? 9.216   17.579  19.227  1.00 9.35   ? 37  ARG A N   1 
ATOM   287  C  CA  . ARG A 1 37  ? 9.733   16.566  20.111  1.00 10.21  ? 37  ARG A CA  1 
ATOM   288  C  C   . ARG A 1 37  ? 10.844  15.878  19.517  1.00 8.96   ? 37  ARG A C   1 
ATOM   289  O  O   . ARG A 1 37  ? 11.427  15.121  20.122  1.00 7.73   ? 37  ARG A O   1 
ATOM   290  C  CB  . ARG A 1 37  ? 8.734   15.518  20.389  1.00 8.89   ? 37  ARG A CB  1 
ATOM   291  C  CG  . ARG A 1 37  ? 7.676   15.388  19.357  1.00 13.22  ? 37  ARG A CG  1 
ATOM   292  C  CD  . ARG A 1 37  ? 6.577   14.562  19.944  1.00 11.67  ? 37  ARG A CD  1 
ATOM   293  N  NE  . ARG A 1 37  ? 6.985   14.223  21.251  1.00 11.01  ? 37  ARG A NE  1 
ATOM   294  C  CZ  . ARG A 1 37  ? 6.446   13.272  21.916  1.00 11.08  ? 37  ARG A CZ  1 
ATOM   295  N  NH1 . ARG A 1 37  ? 5.487   12.621  21.393  1.00 10.24  ? 37  ARG A NH1 1 
ATOM   296  N  NH2 . ARG A 1 37  ? 6.892   13.003  23.081  1.00 19.33  ? 37  ARG A NH2 1 
ATOM   297  N  N   . TYR A 1 38  ? 11.125  16.132  18.287  1.00 6.57   ? 38  TYR A N   1 
ATOM   298  C  CA  . TYR A 1 38  ? 12.255  15.503  17.613  1.00 8.07   ? 38  TYR A CA  1 
ATOM   299  C  C   . TYR A 1 38  ? 13.542  16.305  17.782  1.00 9.71   ? 38  TYR A C   1 
ATOM   300  O  O   . TYR A 1 38  ? 14.641  15.757  17.697  1.00 8.37   ? 38  TYR A O   1 
ATOM   301  C  CB  . TYR A 1 38  ? 11.937  15.324  16.127  1.00 8.08   ? 38  TYR A CB  1 
ATOM   302  C  CG  . TYR A 1 38  ? 11.221  14.032  15.806  1.00 5.97   ? 38  TYR A CG  1 
ATOM   303  C  CD1 . TYR A 1 38  ? 11.805  12.804  16.084  1.00 7.74   ? 38  TYR A CD1 1 
ATOM   304  C  CD2 . TYR A 1 38  ? 9.960   14.041  15.224  1.00 4.33   ? 38  TYR A CD2 1 
ATOM   305  C  CE1 . TYR A 1 38  ? 11.154  11.620  15.792  1.00 9.52   ? 38  TYR A CE1 1 
ATOM   306  C  CE2 . TYR A 1 38  ? 9.301   12.863  14.928  1.00 7.31   ? 38  TYR A CE2 1 
ATOM   307  C  CZ  . TYR A 1 38  ? 9.903   11.656  15.214  1.00 13.56  ? 38  TYR A CZ  1 
ATOM   308  O  OH  . TYR A 1 38  ? 9.251   10.480  14.921  1.00 15.38  ? 38  TYR A OH  1 
ATOM   309  N  N   . ILE A 1 39  ? 13.397  17.604  18.021  1.00 6.68   ? 39  ILE A N   1 
ATOM   310  C  CA  . ILE A 1 39  ? 14.531  18.469  18.201  1.00 6.68   ? 39  ILE A CA  1 
ATOM   311  C  C   . ILE A 1 39  ? 14.959  18.165  19.606  1.00 8.68   ? 39  ILE A C   1 
ATOM   312  O  O   . ILE A 1 39  ? 16.105  17.912  19.878  1.00 12.34  ? 39  ILE A O   1 
ATOM   313  C  CB  . ILE A 1 39  ? 14.181  19.952  18.058  1.00 8.19   ? 39  ILE A CB  1 
ATOM   314  C  CG1 . ILE A 1 39  ? 13.561  20.242  16.705  1.00 9.15   ? 39  ILE A CG1 1 
ATOM   315  C  CG2 . ILE A 1 39  ? 15.426  20.800  18.191  1.00 6.35   ? 39  ILE A CG2 1 
ATOM   316  C  CD1 . ILE A 1 39  ? 13.133  21.678  16.540  1.00 5.67   ? 39  ILE A CD1 1 
ATOM   317  N  N   . ALA A 1 40  ? 13.995  18.141  20.495  1.00 7.86   ? 40  ALA A N   1 
ATOM   318  C  CA  . ALA A 1 40  ? 14.234  17.927  21.913  1.00 9.39   ? 40  ALA A CA  1 
ATOM   319  C  C   . ALA A 1 40  ? 14.915  16.596  22.190  1.00 13.36  ? 40  ALA A C   1 
ATOM   320  O  O   . ALA A 1 40  ? 16.031  16.565  22.672  1.00 17.22  ? 40  ALA A O   1 
ATOM   321  C  CB  . ALA A 1 40  ? 12.929  18.026  22.652  1.00 9.64   ? 40  ALA A CB  1 
ATOM   322  N  N   . TRP A 1 41  ? 14.314  15.501  21.782  1.00 10.64  ? 41  TRP A N   1 
ATOM   323  C  CA  . TRP A 1 41  ? 15.031  14.250  21.812  1.00 10.72  ? 41  TRP A CA  1 
ATOM   324  C  C   . TRP A 1 41  ? 16.479  14.389  21.434  1.00 10.34  ? 41  TRP A C   1 
ATOM   325  O  O   . TRP A 1 41  ? 17.343  13.995  22.206  1.00 8.71   ? 41  TRP A O   1 
ATOM   326  C  CB  . TRP A 1 41  ? 14.329  13.222  20.950  1.00 8.99   ? 41  TRP A CB  1 
ATOM   327  C  CG  . TRP A 1 41  ? 13.083  12.721  21.617  1.00 7.62   ? 41  TRP A CG  1 
ATOM   328  C  CD1 . TRP A 1 41  ? 12.712  12.911  22.926  1.00 9.59   ? 41  TRP A CD1 1 
ATOM   329  C  CD2 . TRP A 1 41  ? 12.008  11.910  21.047  1.00 8.66   ? 41  TRP A CD2 1 
ATOM   330  N  NE1 . TRP A 1 41  ? 11.528  12.299  23.189  1.00 9.32   ? 41  TRP A NE1 1 
ATOM   331  C  CE2 . TRP A 1 41  ? 11.059  11.689  22.112  1.00 7.49   ? 41  TRP A CE2 1 
ATOM   332  C  CE3 . TRP A 1 41  ? 11.757  11.365  19.818  1.00 13.39  ? 41  TRP A CE3 1 
ATOM   333  C  CZ2 . TRP A 1 41  ? 9.918   10.972  21.933  1.00 7.63   ? 41  TRP A CZ2 1 
ATOM   334  C  CZ3 . TRP A 1 41  ? 10.583  10.648  19.650  1.00 13.24  ? 41  TRP A CZ3 1 
ATOM   335  C  CH2 . TRP A 1 41  ? 9.686   10.465  20.683  1.00 7.52   ? 41  TRP A CH2 1 
ATOM   336  N  N   . HIS A 1 42  ? 16.805  14.949  20.271  1.00 10.14  ? 42  HIS A N   1 
ATOM   337  C  CA  . HIS A 1 42  ? 18.195  14.963  19.786  1.00 15.98  ? 42  HIS A CA  1 
ATOM   338  C  C   . HIS A 1 42  ? 19.069  15.874  20.535  1.00 15.88  ? 42  HIS A C   1 
ATOM   339  O  O   . HIS A 1 42  ? 20.296  15.844  20.382  1.00 13.97  ? 42  HIS A O   1 
ATOM   340  C  CB  . HIS A 1 42  ? 18.292  15.344  18.314  1.00 19.46  ? 42  HIS A CB  1 
ATOM   341  C  CG  . HIS A 1 42  ? 19.536  14.811  17.598  1.00 24.99  ? 42  HIS A CG  1 
ATOM   342  N  ND1 . HIS A 1 42  ? 20.544  15.600  17.221  1.00 25.53  ? 42  HIS A ND1 1 
ATOM   343  C  CD2 . HIS A 1 42  ? 19.857  13.531  17.144  1.00 24.93  ? 42  HIS A CD2 1 
ATOM   344  C  CE1 . HIS A 1 42  ? 21.478  14.864  16.579  1.00 38.22  ? 42  HIS A CE1 1 
ATOM   345  N  NE2 . HIS A 1 42  ? 21.057  13.604  16.535  1.00 37.58  ? 42  HIS A NE2 1 
ATOM   346  N  N   . GLY A 1 43  ? 18.496  16.742  21.336  1.00 16.88  ? 43  GLY A N   1 
ATOM   347  C  CA  . GLY A 1 43  ? 19.323  17.669  22.065  1.00 19.83  ? 43  GLY A CA  1 
ATOM   348  C  C   . GLY A 1 43  ? 19.520  17.124  23.444  1.00 17.25  ? 43  GLY A C   1 
ATOM   349  O  O   . GLY A 1 43  ? 20.374  17.563  24.189  1.00 14.33  ? 43  GLY A O   1 
ATOM   350  N  N   . ALA A 1 44  ? 18.705  16.137  23.764  1.00 15.07  ? 44  ALA A N   1 
ATOM   351  C  CA  . ALA A 1 44  ? 18.614  15.600  25.097  1.00 16.46  ? 44  ALA A CA  1 
ATOM   352  C  C   . ALA A 1 44  ? 19.523  14.424  25.273  1.00 15.51  ? 44  ALA A C   1 
ATOM   353  O  O   . ALA A 1 44  ? 20.047  14.213  26.344  1.00 18.08  ? 44  ALA A O   1 
ATOM   354  C  CB  . ALA A 1 44  ? 17.194  15.179  25.362  1.00 17.24  ? 44  ALA A CB  1 
ATOM   355  N  N   . ALA A 1 45  ? 19.681  13.643  24.220  1.00 16.46  ? 45  ALA A N   1 
ATOM   356  C  CA  . ALA A 1 45  ? 20.633  12.540  24.197  1.00 18.75  ? 45  ALA A CA  1 
ATOM   357  C  C   . ALA A 1 45  ? 22.059  13.080  24.117  1.00 21.24  ? 45  ALA A C   1 
ATOM   358  O  O   . ALA A 1 45  ? 22.996  12.504  24.667  1.00 18.53  ? 45  ALA A O   1 
ATOM   359  C  CB  . ALA A 1 45  ? 20.343  11.613  23.021  1.00 9.83   ? 45  ALA A CB  1 
ATOM   360  N  N   . GLY A 1 46  ? 22.247  14.221  23.499  1.00 24.86  ? 46  GLY A N   1 
ATOM   361  C  CA  . GLY A 1 46  ? 23.588  14.746  23.407  1.00 28.07  ? 46  GLY A CA  1 
ATOM   362  C  C   . GLY A 1 46  ? 24.066  15.317  24.716  1.00 28.90  ? 46  GLY A C   1 
ATOM   363  O  O   . GLY A 1 46  ? 25.240  15.605  24.883  1.00 29.91  ? 46  GLY A O   1 
ATOM   364  N  N   . LYS A 1 47  ? 23.150  15.501  25.646  1.00 28.98  ? 47  LYS A N   1 
ATOM   365  C  CA  . LYS A 1 47  ? 23.502  16.074  26.931  1.00 32.69  ? 47  LYS A CA  1 
ATOM   366  C  C   . LYS A 1 47  ? 23.576  14.932  27.907  1.00 24.82  ? 47  LYS A C   1 
ATOM   367  O  O   . LYS A 1 47  ? 23.794  15.135  29.095  1.00 20.56  ? 47  LYS A O   1 
ATOM   368  C  CB  . LYS A 1 47  ? 22.442  17.067  27.389  1.00 32.87  ? 47  LYS A CB  1 
ATOM   369  C  CG  . LYS A 1 47  ? 22.898  18.508  27.518  1.00 41.26  ? 47  LYS A CG  1 
ATOM   370  C  CD  . LYS A 1 47  ? 21.723  19.423  27.823  1.00 64.29  ? 47  LYS A CD  1 
ATOM   371  C  CE  . LYS A 1 47  ? 21.593  19.725  29.305  1.00 35.30  ? 47  LYS A CE  1 
ATOM   372  N  NZ  . LYS A 1 47  ? 20.209  19.560  29.816  1.00 39.10  ? 47  LYS A NZ  1 
ATOM   373  N  N   . PHE A 1 48  ? 23.333  13.718  27.427  1.00 17.64  ? 48  PHE A N   1 
ATOM   374  C  CA  . PHE A 1 48  ? 23.377  12.551  28.289  1.00 15.34  ? 48  PHE A CA  1 
ATOM   375  C  C   . PHE A 1 48  ? 24.654  11.810  28.050  1.00 21.31  ? 48  PHE A C   1 
ATOM   376  O  O   . PHE A 1 48  ? 24.744  11.036  27.119  1.00 21.38  ? 48  PHE A O   1 
ATOM   377  C  CB  . PHE A 1 48  ? 22.233  11.629  27.974  1.00 11.64  ? 48  PHE A CB  1 
ATOM   378  C  CG  . PHE A 1 48  ? 22.274  10.325  28.703  1.00 11.07  ? 48  PHE A CG  1 
ATOM   379  C  CD1 . PHE A 1 48  ? 21.961  10.253  30.028  1.00 15.86  ? 48  PHE A CD1 1 
ATOM   380  C  CD2 . PHE A 1 48  ? 22.563  9.168   28.042  1.00 8.48   ? 48  PHE A CD2 1 
ATOM   381  C  CE1 . PHE A 1 48  ? 21.961  9.054   30.693  1.00 14.07  ? 48  PHE A CE1 1 
ATOM   382  C  CE2 . PHE A 1 48  ? 22.565  7.964   28.700  1.00 9.24   ? 48  PHE A CE2 1 
ATOM   383  C  CZ  . PHE A 1 48  ? 22.269  7.907   30.034  1.00 9.20   ? 48  PHE A CZ  1 
ATOM   384  N  N   . HIS A 1 49  ? 25.681  12.018  28.857  1.00 21.17  ? 49  HIS A N   1 
ATOM   385  C  CA  . HIS A 1 49  ? 26.932  11.349  28.615  1.00 12.35  ? 49  HIS A CA  1 
ATOM   386  C  C   . HIS A 1 49  ? 26.980  10.005  29.265  1.00 14.81  ? 49  HIS A C   1 
ATOM   387  O  O   . HIS A 1 49  ? 26.432  9.805   30.347  1.00 19.89  ? 49  HIS A O   1 
ATOM   388  C  CB  . HIS A 1 49  ? 28.072  12.228  29.069  1.00 14.96  ? 49  HIS A CB  1 
ATOM   389  C  CG  . HIS A 1 49  ? 28.173  13.529  28.312  1.00 29.14  ? 49  HIS A CG  1 
ATOM   390  N  ND1 . HIS A 1 49  ? 27.743  13.668  27.053  1.00 36.38  ? 49  HIS A ND1 1 
ATOM   391  C  CD2 . HIS A 1 49  ? 28.683  14.760  28.684  1.00 32.83  ? 49  HIS A CD2 1 
ATOM   392  C  CE1 . HIS A 1 49  ? 27.971  14.919  26.633  1.00 30.16  ? 49  HIS A CE1 1 
ATOM   393  N  NE2 . HIS A 1 49  ? 28.543  15.588  27.633  1.00 29.45  ? 49  HIS A NE2 1 
ATOM   394  N  N   . THR A 1 50  ? 27.633  9.052   28.607  1.00 19.03  ? 50  THR A N   1 
ATOM   395  C  CA  . THR A 1 50  ? 27.705  7.689   29.126  1.00 20.01  ? 50  THR A CA  1 
ATOM   396  C  C   . THR A 1 50  ? 29.070  7.048   28.892  1.00 17.55  ? 50  THR A C   1 
ATOM   397  O  O   . THR A 1 50  ? 29.428  6.723   27.760  1.00 13.82  ? 50  THR A O   1 
ATOM   398  C  CB  . THR A 1 50  ? 26.617  6.793   28.506  1.00 18.54  ? 50  THR A CB  1 
ATOM   399  O  OG1 . THR A 1 50  ? 27.008  6.410   27.181  1.00 19.90  ? 50  THR A OG1 1 
ATOM   400  C  CG2 . THR A 1 50  ? 25.289  7.531   28.445  1.00 17.27  ? 50  THR A CG2 1 
ATOM   401  N  N   . PRO A 1 51  ? 29.827  6.871   29.969  1.00 18.28  ? 51  PRO A N   1 
ATOM   402  C  CA  . PRO A 1 51  ? 29.374  7.275   31.304  1.00 24.30  ? 51  PRO A CA  1 
ATOM   403  C  C   . PRO A 1 51  ? 29.396  8.790   31.474  1.00 17.42  ? 51  PRO A C   1 
ATOM   404  O  O   . PRO A 1 51  ? 30.066  9.486   30.711  1.00 23.37  ? 51  PRO A O   1 
ATOM   405  C  CB  . PRO A 1 51  ? 30.406  6.627   32.229  1.00 34.20  ? 51  PRO A CB  1 
ATOM   406  C  CG  . PRO A 1 51  ? 31.641  6.536   31.400  1.00 24.94  ? 51  PRO A CG  1 
ATOM   407  C  CD  . PRO A 1 51  ? 31.172  6.271   29.997  1.00 12.69  ? 51  PRO A CD  1 
ATOM   408  N  N   . PRO A 1 52  ? 28.668  9.290   32.467  1.00 15.57  ? 52  PRO A N   1 
ATOM   409  C  CA  . PRO A 1 52  ? 28.608  10.731  32.730  1.00 25.74  ? 52  PRO A CA  1 
ATOM   410  C  C   . PRO A 1 52  ? 30.000  11.338  32.877  1.00 25.32  ? 52  PRO A C   1 
ATOM   411  O  O   . PRO A 1 52  ? 30.866  10.744  33.519  1.00 21.59  ? 52  PRO A O   1 
ATOM   412  C  CB  . PRO A 1 52  ? 27.857  10.809  34.060  1.00 32.51  ? 52  PRO A CB  1 
ATOM   413  C  CG  . PRO A 1 52  ? 28.165  9.517   34.735  1.00 37.81  ? 52  PRO A CG  1 
ATOM   414  C  CD  . PRO A 1 52  ? 28.258  8.494   33.638  1.00 25.20  ? 52  PRO A CD  1 
ATOM   415  N  N   . GLY A 1 53  ? 30.205  12.510  32.286  1.00 32.54  ? 53  GLY A N   1 
ATOM   416  C  CA  . GLY A 1 53  ? 31.487  13.186  32.356  1.00 40.84  ? 53  GLY A CA  1 
ATOM   417  C  C   . GLY A 1 53  ? 32.432  12.754  31.252  1.00 34.38  ? 53  GLY A C   1 
ATOM   418  O  O   . GLY A 1 53  ? 33.581  13.192  31.199  1.00 27.80  ? 53  GLY A O   1 
ATOM   419  N  N   . SER A 1 54  ? 31.925  11.990  30.276  1.00 38.57  ? 54  SER A N   1 
ATOM   420  C  CA  . SER A 1 54  ? 32.758  11.501  29.158  1.00 34.01  ? 54  SER A CA  1 
ATOM   421  C  C   . SER A 1 54  ? 32.252  11.639  27.725  1.00 33.26  ? 54  SER A C   1 
ATOM   422  O  O   . SER A 1 54  ? 31.246  11.056  27.365  1.00 29.75  ? 54  SER A O   1 
ATOM   423  C  CB  . SER A 1 54  ? 33.109  10.040  29.348  1.00 25.75  ? 54  SER A CB  1 
ATOM   424  O  OG  . SER A 1 54  ? 33.667  9.531   28.159  1.00 22.47  ? 54  SER A OG  1 
ATOM   425  N  N   . ASP A 1 55  ? 32.975  12.438  26.946  1.00 33.43  ? 55  ASP A N   1 
ATOM   426  C  CA  . ASP A 1 55  ? 32.632  12.742  25.562  1.00 26.65  ? 55  ASP A CA  1 
ATOM   427  C  C   . ASP A 1 55  ? 31.462  11.928  25.027  1.00 20.99  ? 55  ASP A C   1 
ATOM   428  O  O   . ASP A 1 55  ? 30.569  12.471  24.376  1.00 11.00  ? 55  ASP A O   1 
ATOM   429  C  CB  . ASP A 1 55  ? 33.853  12.553  24.658  1.00 40.01  ? 55  ASP A CB  1 
ATOM   430  C  CG  . ASP A 1 55  ? 34.739  13.782  24.611  1.00 52.05  ? 55  ASP A CG  1 
ATOM   431  O  OD1 . ASP A 1 55  ? 35.290  14.078  23.530  1.00 62.84  ? 55  ASP A OD1 1 
ATOM   432  O  OD2 . ASP A 1 55  ? 34.885  14.452  25.655  1.00 54.01  ? 55  ASP A OD2 1 
ATOM   433  N  N   . ARG A 1 56  ? 31.469  10.626  25.289  1.00 22.84  ? 56  ARG A N   1 
ATOM   434  C  CA  . ARG A 1 56  ? 30.452  9.752   24.708  1.00 14.51  ? 56  ARG A CA  1 
ATOM   435  C  C   . ARG A 1 56  ? 29.065  10.116  25.131  1.00 16.53  ? 56  ARG A C   1 
ATOM   436  O  O   . ARG A 1 56  ? 28.771  9.983   26.284  1.00 24.93  ? 56  ARG A O   1 
ATOM   437  C  CB  . ARG A 1 56  ? 30.628  8.342   25.227  1.00 9.74   ? 56  ARG A CB  1 
ATOM   438  C  CG  . ARG A 1 56  ? 31.863  7.576   24.816  1.00 12.99  ? 56  ARG A CG  1 
ATOM   439  C  CD  . ARG A 1 56  ? 31.532  6.099   24.873  1.00 13.26  ? 56  ARG A CD  1 
ATOM   440  N  NE  . ARG A 1 56  ? 32.603  5.262   25.380  1.00 10.04  ? 56  ARG A NE  1 
ATOM   441  C  CZ  . ARG A 1 56  ? 33.642  5.701   26.061  1.00 13.09  ? 56  ARG A CZ  1 
ATOM   442  N  NH1 . ARG A 1 56  ? 33.764  6.981   26.307  1.00 18.18  ? 56  ARG A NH1 1 
ATOM   443  N  NH2 . ARG A 1 56  ? 34.566  4.863   26.470  1.00 17.03  ? 56  ARG A NH2 1 
ATOM   444  N  N   . ASN A 1 57  ? 28.208  10.508  24.192  1.00 11.34  ? 57  ASN A N   1 
ATOM   445  C  CA  . ASN A 1 57  ? 26.806  10.744  24.500  1.00 11.12  ? 57  ASN A CA  1 
ATOM   446  C  C   . ASN A 1 57  ? 25.947  9.618   24.018  1.00 10.05  ? 57  ASN A C   1 
ATOM   447  O  O   . ASN A 1 57  ? 26.448  8.673   23.459  1.00 11.60  ? 57  ASN A O   1 
ATOM   448  C  CB  . ASN A 1 57  ? 26.275  12.071  23.949  1.00 16.17  ? 57  ASN A CB  1 
ATOM   449  C  CG  . ASN A 1 57  ? 26.841  12.432  22.599  1.00 16.06  ? 57  ASN A CG  1 
ATOM   450  O  OD1 . ASN A 1 57  ? 27.804  11.854  22.143  1.00 15.43  ? 57  ASN A OD1 1 
ATOM   451  N  ND2 . ASN A 1 57  ? 26.248  13.411  21.963  1.00 11.55  ? 57  ASN A ND2 1 
ATOM   452  N  N   . ALA A 1 58  ? 24.650  9.712   24.246  1.00 9.80   ? 58  ALA A N   1 
ATOM   453  C  CA  . ALA A 1 58  ? 23.707  8.679   23.780  1.00 10.58  ? 58  ALA A CA  1 
ATOM   454  C  C   . ALA A 1 58  ? 23.564  8.476   22.250  1.00 8.80   ? 58  ALA A C   1 
ATOM   455  O  O   . ALA A 1 58  ? 23.144  7.398   21.805  1.00 4.36   ? 58  ALA A O   1 
ATOM   456  C  CB  . ALA A 1 58  ? 22.340  8.963   24.378  1.00 11.35  ? 58  ALA A CB  1 
ATOM   457  N  N   . ALA A 1 59  ? 23.910  9.498   21.474  1.00 12.75  ? 59  ALA A N   1 
ATOM   458  C  CA  . ALA A 1 59  ? 23.781  9.429   20.023  1.00 7.13   ? 59  ALA A CA  1 
ATOM   459  C  C   . ALA A 1 59  ? 25.127  9.547   19.315  1.00 7.70   ? 59  ALA A C   1 
ATOM   460  O  O   . ALA A 1 59  ? 25.509  8.670   18.540  1.00 8.96   ? 59  ALA A O   1 
ATOM   461  C  CB  . ALA A 1 59  ? 22.824  10.503  19.526  1.00 9.76   ? 59  ALA A CB  1 
ATOM   462  N  N   . HIS A 1 60  ? 25.834  10.643  19.569  1.00 11.08  ? 60  HIS A N   1 
ATOM   463  C  CA  . HIS A 1 60  ? 27.094  10.904  18.900  1.00 11.95  ? 60  HIS A CA  1 
ATOM   464  C  C   . HIS A 1 60  ? 28.269  10.679  19.803  1.00 8.40   ? 60  HIS A C   1 
ATOM   465  O  O   . HIS A 1 60  ? 28.200  10.935  21.025  1.00 11.50  ? 60  HIS A O   1 
ATOM   466  C  CB  . HIS A 1 60  ? 27.121  12.326  18.352  1.00 18.47  ? 60  HIS A CB  1 
ATOM   467  C  CG  . HIS A 1 60  ? 25.766  12.842  17.930  1.00 19.85  ? 60  HIS A CG  1 
ATOM   468  N  ND1 . HIS A 1 60  ? 25.528  14.146  17.701  1.00 19.70  ? 60  HIS A ND1 1 
ATOM   469  C  CD2 . HIS A 1 60  ? 24.564  12.177  17.699  1.00 17.57  ? 60  HIS A CD2 1 
ATOM   470  C  CE1 . HIS A 1 60  ? 24.241  14.311  17.342  1.00 21.44  ? 60  HIS A CE1 1 
ATOM   471  N  NE2 . HIS A 1 60  ? 23.652  13.104  17.341  1.00 19.61  ? 60  HIS A NE2 1 
ATOM   472  N  N   . MET A 1 61  ? 29.365  10.202  19.223  1.00 7.16   ? 61  MET A N   1 
ATOM   473  C  CA  . MET A 1 61  ? 30.591  9.966   19.975  1.00 8.74   ? 61  MET A CA  1 
ATOM   474  C  C   . MET A 1 61  ? 30.744  8.529   20.463  1.00 12.38  ? 61  MET A C   1 
ATOM   475  O  O   . MET A 1 61  ? 31.755  8.179   21.071  1.00 11.36  ? 61  MET A O   1 
ATOM   476  C  CB  . MET A 1 61  ? 30.788  11.054  21.032  1.00 6.63   ? 61  MET A CB  1 
ATOM   477  C  CG  . MET A 1 61  ? 31.735  12.166  20.610  1.00 8.03   ? 61  MET A CG  1 
ATOM   478  S  SD  . MET A 1 61  ? 31.164  13.798  21.123  1.00 19.48  ? 61  MET A SD  1 
ATOM   479  C  CE  . MET A 1 61  ? 31.697  14.795  19.734  1.00 6.42   ? 61  MET A CE  1 
ATOM   480  N  N   . SER A 1 62  ? 29.740  7.700   20.197  1.00 9.81   ? 62  SER A N   1 
ATOM   481  C  CA  . SER A 1 62  ? 29.793  6.301   20.605  1.00 9.90   ? 62  SER A CA  1 
ATOM   482  C  C   . SER A 1 62  ? 29.208  5.333   19.583  1.00 9.53   ? 62  SER A C   1 
ATOM   483  O  O   . SER A 1 62  ? 28.656  5.751   18.566  1.00 9.58   ? 62  SER A O   1 
ATOM   484  C  CB  . SER A 1 62  ? 28.969  6.268   21.894  1.00 17.03  ? 62  SER A CB  1 
ATOM   485  O  OG  . SER A 1 62  ? 29.498  5.329   22.813  1.00 23.67  ? 62  SER A OG  1 
ATOM   486  N  N   . SER A 1 63  ? 29.332  4.038   19.857  1.00 9.84   ? 63  SER A N   1 
ATOM   487  C  CA  . SER A 1 63  ? 28.815  3.019   18.950  1.00 9.99   ? 63  SER A CA  1 
ATOM   488  C  C   . SER A 1 63  ? 27.330  3.153   18.682  1.00 8.43   ? 63  SER A C   1 
ATOM   489  O  O   . SER A 1 63  ? 26.805  2.577   17.735  1.00 6.71   ? 63  SER A O   1 
ATOM   490  C  CB  . SER A 1 63  ? 29.084  1.636   19.515  1.00 9.38   ? 63  SER A CB  1 
ATOM   491  O  OG  . SER A 1 63  ? 30.431  1.520   19.931  1.00 14.65  ? 63  SER A OG  1 
ATOM   492  N  N   . ALA A 1 64  ? 26.644  3.902   19.531  1.00 10.04  ? 64  ALA A N   1 
ATOM   493  C  CA  . ALA A 1 64  ? 25.186  3.934   19.492  1.00 11.65  ? 64  ALA A CA  1 
ATOM   494  C  C   . ALA A 1 64  ? 24.647  4.887   18.447  1.00 8.95   ? 64  ALA A C   1 
ATOM   495  O  O   . ALA A 1 64  ? 23.443  4.920   18.205  1.00 7.85   ? 64  ALA A O   1 
ATOM   496  C  CB  . ALA A 1 64  ? 24.619  4.299   20.872  1.00 13.73  ? 64  ALA A CB  1 
ATOM   497  N  N   . PHE A 1 65  ? 25.546  5.646   17.828  1.00 8.60   ? 65  PHE A N   1 
ATOM   498  C  CA  . PHE A 1 65  ? 25.193  6.737   16.913  1.00 8.73   ? 65  PHE A CA  1 
ATOM   499  C  C   . PHE A 1 65  ? 24.274  6.262   15.793  1.00 5.80   ? 65  PHE A C   1 
ATOM   500  O  O   . PHE A 1 65  ? 23.223  6.854   15.544  1.00 4.52   ? 65  PHE A O   1 
ATOM   501  C  CB  . PHE A 1 65  ? 26.493  7.393   16.381  1.00 10.03  ? 65  PHE A CB  1 
ATOM   502  C  CG  . PHE A 1 65  ? 26.311  8.315   15.198  1.00 7.71   ? 65  PHE A CG  1 
ATOM   503  C  CD1 . PHE A 1 65  ? 25.775  9.582   15.346  1.00 9.41   ? 65  PHE A CD1 1 
ATOM   504  C  CD2 . PHE A 1 65  ? 26.750  7.927   13.950  1.00 7.45   ? 65  PHE A CD2 1 
ATOM   505  C  CE1 . PHE A 1 65  ? 25.639  10.414  14.264  1.00 9.94   ? 65  PHE A CE1 1 
ATOM   506  C  CE2 . PHE A 1 65  ? 26.614  8.753   12.866  1.00 9.23   ? 65  PHE A CE2 1 
ATOM   507  C  CZ  . PHE A 1 65  ? 26.057  9.996   13.018  1.00 8.94   ? 65  PHE A CZ  1 
ATOM   508  N  N   . LEU A 1 66  ? 24.601  5.134   15.186  1.00 7.49   ? 66  LEU A N   1 
ATOM   509  C  CA  . LEU A 1 66  ? 23.863  4.654   14.038  1.00 4.34   ? 66  LEU A CA  1 
ATOM   510  C  C   . LEU A 1 66  ? 22.519  4.100   14.395  1.00 5.76   ? 66  LEU A C   1 
ATOM   511  O  O   . LEU A 1 66  ? 21.534  4.504   13.815  1.00 5.71   ? 66  LEU A O   1 
ATOM   512  C  CB  . LEU A 1 66  ? 24.646  3.610   13.264  1.00 6.43   ? 66  LEU A CB  1 
ATOM   513  C  CG  . LEU A 1 66  ? 25.974  3.924   12.587  1.00 8.01   ? 66  LEU A CG  1 
ATOM   514  C  CD1 . LEU A 1 66  ? 26.695  2.631   12.306  1.00 7.59   ? 66  LEU A CD1 1 
ATOM   515  C  CD2 . LEU A 1 66  ? 25.756  4.649   11.285  1.00 9.88   ? 66  LEU A CD2 1 
ATOM   516  N  N   . PRO A 1 67  ? 22.465  3.144   15.315  1.00 9.43   ? 67  PRO A N   1 
ATOM   517  C  CA  . PRO A 1 67  ? 21.180  2.570   15.755  1.00 10.07  ? 67  PRO A CA  1 
ATOM   518  C  C   . PRO A 1 67  ? 20.232  3.601   16.405  1.00 10.38  ? 67  PRO A C   1 
ATOM   519  O  O   . PRO A 1 67  ? 19.012  3.557   16.205  1.00 8.12   ? 67  PRO A O   1 
ATOM   520  C  CB  . PRO A 1 67  ? 21.603  1.479   16.748  1.00 5.89   ? 67  PRO A CB  1 
ATOM   521  C  CG  . PRO A 1 67  ? 22.960  1.872   17.203  1.00 6.66   ? 67  PRO A CG  1 
ATOM   522  C  CD  . PRO A 1 67  ? 23.604  2.537   16.028  1.00 7.22   ? 67  PRO A CD  1 
ATOM   523  N  N   . TRP A 1 68  ? 20.802  4.535   17.158  1.00 7.69   ? 68  TRP A N   1 
ATOM   524  C  CA  . TRP A 1 68  ? 20.039  5.638   17.714  1.00 6.48   ? 68  TRP A CA  1 
ATOM   525  C  C   . TRP A 1 68  ? 19.414  6.438   16.605  1.00 7.00   ? 68  TRP A C   1 
ATOM   526  O  O   . TRP A 1 68  ? 18.209  6.573   16.549  1.00 9.78   ? 68  TRP A O   1 
ATOM   527  C  CB  . TRP A 1 68  ? 20.943  6.542   18.545  1.00 9.51   ? 68  TRP A CB  1 
ATOM   528  C  CG  . TRP A 1 68  ? 20.206  7.508   19.428  1.00 9.46   ? 68  TRP A CG  1 
ATOM   529  C  CD1 . TRP A 1 68  ? 19.948  7.363   20.762  1.00 9.07   ? 68  TRP A CD1 1 
ATOM   530  C  CD2 . TRP A 1 68  ? 19.620  8.763   19.043  1.00 11.90  ? 68  TRP A CD2 1 
ATOM   531  N  NE1 . TRP A 1 68  ? 19.247  8.449   21.234  1.00 11.63  ? 68  TRP A NE1 1 
ATOM   532  C  CE2 . TRP A 1 68  ? 19.033  9.327   20.197  1.00 17.15  ? 68  TRP A CE2 1 
ATOM   533  C  CE3 . TRP A 1 68  ? 19.534  9.468   17.836  1.00 9.93   ? 68  TRP A CE3 1 
ATOM   534  C  CZ2 . TRP A 1 68  ? 18.373  10.561  20.182  1.00 14.41  ? 68  TRP A CZ2 1 
ATOM   535  C  CZ3 . TRP A 1 68  ? 18.879  10.696  17.824  1.00 10.75  ? 68  TRP A CZ3 1 
ATOM   536  C  CH2 . TRP A 1 68  ? 18.309  11.225  18.987  1.00 11.31  ? 68  TRP A CH2 1 
ATOM   537  N  N   . HIS A 1 69  ? 20.232  6.995   15.726  1.00 5.43   ? 69  HIS A N   1 
ATOM   538  C  CA  . HIS A 1 69  ? 19.683  7.776   14.619  1.00 7.59   ? 69  HIS A CA  1 
ATOM   539  C  C   . HIS A 1 69  ? 18.825  6.900   13.646  1.00 7.08   ? 69  HIS A C   1 
ATOM   540  O  O   . HIS A 1 69  ? 18.004  7.443   12.903  1.00 7.11   ? 69  HIS A O   1 
ATOM   541  C  CB  . HIS A 1 69  ? 20.764  8.634   13.895  1.00 5.64   ? 69  HIS A CB  1 
ATOM   542  C  CG  . HIS A 1 69  ? 21.265  9.842   14.669  1.00 7.44   ? 69  HIS A CG  1 
ATOM   543  N  ND1 . HIS A 1 69  ? 22.382  9.812   15.470  1.00 10.39  ? 69  HIS A ND1 1 
ATOM   544  C  CD2 . HIS A 1 69  ? 20.826  11.126  14.696  1.00 11.82  ? 69  HIS A CD2 1 
ATOM   545  C  CE1 . HIS A 1 69  ? 22.597  11.014  15.984  1.00 11.84  ? 69  HIS A CE1 1 
ATOM   546  N  NE2 . HIS A 1 69  ? 21.674  11.834  15.526  1.00 15.24  ? 69  HIS A NE2 1 
ATOM   547  N  N   . ARG A 1 70  ? 18.940  5.584   13.729  1.00 5.58   ? 70  ARG A N   1 
ATOM   548  C  CA  . ARG A 1 70  ? 18.096  4.702   12.943  1.00 7.45   ? 70  ARG A CA  1 
ATOM   549  C  C   . ARG A 1 70  ? 16.710  4.610   13.539  1.00 8.40   ? 70  ARG A C   1 
ATOM   550  O  O   . ARG A 1 70  ? 15.732  4.545   12.825  1.00 6.16   ? 70  ARG A O   1 
ATOM   551  C  CB  . ARG A 1 70  ? 18.706  3.315   12.891  1.00 11.06  ? 70  ARG A CB  1 
ATOM   552  C  CG  . ARG A 1 70  ? 19.404  2.981   11.588  1.00 11.60  ? 70  ARG A CG  1 
ATOM   553  C  CD  . ARG A 1 70  ? 18.462  2.242   10.663  1.00 8.70   ? 70  ARG A CD  1 
ATOM   554  N  NE  . ARG A 1 70  ? 19.147  1.191   9.942   1.00 14.77  ? 70  ARG A NE  1 
ATOM   555  C  CZ  . ARG A 1 70  ? 19.250  -0.047  10.387  1.00 22.44  ? 70  ARG A CZ  1 
ATOM   556  N  NH1 . ARG A 1 70  ? 18.711  -0.347  11.556  1.00 18.75  ? 70  ARG A NH1 1 
ATOM   557  N  NH2 . ARG A 1 70  ? 19.888  -0.973  9.674   1.00 22.18  ? 70  ARG A NH2 1 
ATOM   558  N  N   . GLU A 1 71  ? 16.661  4.584   14.864  1.00 10.20  ? 71  GLU A N   1 
ATOM   559  C  CA  . GLU A 1 71  ? 15.443  4.607   15.665  1.00 11.34  ? 71  GLU A CA  1 
ATOM   560  C  C   . GLU A 1 71  ? 14.771  5.958   15.564  1.00 9.38   ? 71  GLU A C   1 
ATOM   561  O  O   . GLU A 1 71  ? 13.580  6.040   15.266  1.00 10.67  ? 71  GLU A O   1 
ATOM   562  C  CB  . GLU A 1 71  ? 15.754  4.351   17.132  1.00 12.48  ? 71  GLU A CB  1 
ATOM   563  C  CG  . GLU A 1 71  ? 14.525  4.505   18.002  1.00 14.74  ? 71  GLU A CG  1 
ATOM   564  C  CD  . GLU A 1 71  ? 13.472  3.456   17.693  1.00 15.22  ? 71  GLU A CD  1 
ATOM   565  O  OE1 . GLU A 1 71  ? 13.805  2.482   16.999  1.00 14.81  ? 71  GLU A OE1 1 
ATOM   566  O  OE2 . GLU A 1 71  ? 12.320  3.590   18.150  1.00 21.57  ? 71  GLU A OE2 1 
ATOM   567  N  N   . TYR A 1 72  ? 15.540  7.009   15.838  1.00 13.91  ? 72  TYR A N   1 
ATOM   568  C  CA  . TYR A 1 72  ? 15.073  8.368   15.615  1.00 5.43   ? 72  TYR A CA  1 
ATOM   569  C  C   . TYR A 1 72  ? 14.256  8.407   14.323  1.00 8.38   ? 72  TYR A C   1 
ATOM   570  O  O   . TYR A 1 72  ? 13.044  8.619   14.326  1.00 9.05   ? 72  TYR A O   1 
ATOM   571  C  CB  . TYR A 1 72  ? 16.262  9.295   15.499  1.00 10.73  ? 72  TYR A CB  1 
ATOM   572  C  CG  . TYR A 1 72  ? 15.954  10.775  15.636  1.00 10.11  ? 72  TYR A CG  1 
ATOM   573  C  CD1 . TYR A 1 72  ? 15.444  11.284  16.816  1.00 9.25   ? 72  TYR A CD1 1 
ATOM   574  C  CD2 . TYR A 1 72  ? 16.204  11.660  14.592  1.00 4.74   ? 72  TYR A CD2 1 
ATOM   575  C  CE1 . TYR A 1 72  ? 15.208  12.636  16.967  1.00 7.70   ? 72  TYR A CE1 1 
ATOM   576  C  CE2 . TYR A 1 72  ? 15.961  13.002  14.725  1.00 5.38   ? 72  TYR A CE2 1 
ATOM   577  C  CZ  . TYR A 1 72  ? 15.471  13.493  15.909  1.00 5.35   ? 72  TYR A CZ  1 
ATOM   578  O  OH  . TYR A 1 72  ? 15.246  14.843  15.988  1.00 5.84   ? 72  TYR A OH  1 
ATOM   579  N  N   . LEU A 1 73  ? 14.913  8.107   13.216  1.00 8.23   ? 73  LEU A N   1 
ATOM   580  C  CA  . LEU A 1 73  ? 14.272  8.226   11.915  1.00 7.79   ? 73  LEU A CA  1 
ATOM   581  C  C   . LEU A 1 73  ? 13.003  7.414   11.819  1.00 8.56   ? 73  LEU A C   1 
ATOM   582  O  O   . LEU A 1 73  ? 11.947  7.934   11.468  1.00 8.36   ? 73  LEU A O   1 
ATOM   583  C  CB  . LEU A 1 73  ? 15.230  7.813   10.813  1.00 9.05   ? 73  LEU A CB  1 
ATOM   584  C  CG  . LEU A 1 73  ? 16.372  8.816   10.763  1.00 8.68   ? 73  LEU A CG  1 
ATOM   585  C  CD1 . LEU A 1 73  ? 17.358  8.471   9.672   1.00 8.08   ? 73  LEU A CD1 1 
ATOM   586  C  CD2 . LEU A 1 73  ? 15.816  10.216  10.580  1.00 8.39   ? 73  LEU A CD2 1 
ATOM   587  N  N   . LEU A 1 74  ? 13.123  6.126   12.117  1.00 10.88  ? 74  LEU A N   1 
ATOM   588  C  CA  . LEU A 1 74  ? 11.983  5.210   12.106  1.00 11.39  ? 74  LEU A CA  1 
ATOM   589  C  C   . LEU A 1 74  ? 10.731  5.837   12.727  1.00 9.93   ? 74  LEU A C   1 
ATOM   590  O  O   . LEU A 1 74  ? 9.671   5.883   12.095  1.00 8.68   ? 74  LEU A O   1 
ATOM   591  C  CB  . LEU A 1 74  ? 12.356  3.903   12.827  1.00 11.34  ? 74  LEU A CB  1 
ATOM   592  C  CG  . LEU A 1 74  ? 11.300  2.791   12.898  1.00 16.00  ? 74  LEU A CG  1 
ATOM   593  C  CD1 . LEU A 1 74  ? 10.563  2.664   11.572  1.00 15.55  ? 74  LEU A CD1 1 
ATOM   594  C  CD2 . LEU A 1 74  ? 11.902  1.449   13.319  1.00 11.83  ? 74  LEU A CD2 1 
ATOM   595  N  N   . ARG A 1 75  ? 10.872  6.295   13.972  1.00 9.56   ? 75  ARG A N   1 
ATOM   596  C  CA  . ARG A 1 75  ? 9.797   6.966   14.712  1.00 13.27  ? 75  ARG A CA  1 
ATOM   597  C  C   . ARG A 1 75  ? 9.259   8.154   13.937  1.00 11.57  ? 75  ARG A C   1 
ATOM   598  O  O   . ARG A 1 75  ? 8.056   8.424   13.963  1.00 10.95  ? 75  ARG A O   1 
ATOM   599  C  CB  . ARG A 1 75  ? 10.287  7.461   16.076  1.00 10.30  ? 75  ARG A CB  1 
ATOM   600  C  CG  . ARG A 1 75  ? 10.991  6.420   16.903  1.00 11.36  ? 75  ARG A CG  1 
ATOM   601  C  CD  . ARG A 1 75  ? 11.463  6.970   18.247  1.00 10.82  ? 75  ARG A CD  1 
ATOM   602  N  NE  . ARG A 1 75  ? 10.405  7.023   19.261  1.00 15.24  ? 75  ARG A NE  1 
ATOM   603  C  CZ  . ARG A 1 75  ? 10.241  6.137   20.246  1.00 17.55  ? 75  ARG A CZ  1 
ATOM   604  N  NH1 . ARG A 1 75  ? 9.250   6.285   21.112  1.00 12.46  ? 75  ARG A NH1 1 
ATOM   605  N  NH2 . ARG A 1 75  ? 11.065  5.103   20.374  1.00 20.10  ? 75  ARG A NH2 1 
ATOM   606  N  N   . PHE A 1 76  ? 10.159  8.861   13.257  1.00 8.17   ? 76  PHE A N   1 
ATOM   607  C  CA  . PHE A 1 76  ? 9.809   10.032  12.457  1.00 7.48   ? 76  PHE A CA  1 
ATOM   608  C  C   . PHE A 1 76  ? 9.087   9.649   11.154  1.00 7.67   ? 76  PHE A C   1 
ATOM   609  O  O   . PHE A 1 76  ? 8.022   10.185  10.853  1.00 7.00   ? 76  PHE A O   1 
ATOM   610  C  CB  . PHE A 1 76  ? 11.071  10.842  12.169  1.00 8.97   ? 76  PHE A CB  1 
ATOM   611  C  CG  . PHE A 1 76  ? 10.807  12.203  11.606  1.00 7.85   ? 76  PHE A CG  1 
ATOM   612  C  CD1 . PHE A 1 76  ? 10.380  13.236  12.421  1.00 6.62   ? 76  PHE A CD1 1 
ATOM   613  C  CD2 . PHE A 1 76  ? 10.997  12.454  10.257  1.00 10.93  ? 76  PHE A CD2 1 
ATOM   614  C  CE1 . PHE A 1 76  ? 10.132  14.494  11.895  1.00 7.25   ? 76  PHE A CE1 1 
ATOM   615  C  CE2 . PHE A 1 76  ? 10.754  13.708  9.723   1.00 8.21   ? 76  PHE A CE2 1 
ATOM   616  C  CZ  . PHE A 1 76  ? 10.324  14.727  10.541  1.00 7.58   ? 76  PHE A CZ  1 
ATOM   617  N  N   . GLU A 1 77  ? 9.655   8.733   10.376  1.00 7.33   ? 77  GLU A N   1 
ATOM   618  C  CA  . GLU A 1 77  ? 8.911   8.186   9.255   1.00 9.62   ? 77  GLU A CA  1 
ATOM   619  C  C   . GLU A 1 77  ? 7.526   7.826   9.776   1.00 16.72  ? 77  GLU A C   1 
ATOM   620  O  O   . GLU A 1 77  ? 6.536   8.284   9.235   1.00 15.43  ? 77  GLU A O   1 
ATOM   621  C  CB  . GLU A 1 77  ? 9.611   6.953   8.694   1.00 9.39   ? 77  GLU A CB  1 
ATOM   622  C  CG  . GLU A 1 77  ? 9.222   6.576   7.261   1.00 12.41  ? 77  GLU A CG  1 
ATOM   623  C  CD  . GLU A 1 77  ? 10.324  5.802   6.505   1.00 16.15  ? 77  GLU A CD  1 
ATOM   624  O  OE1 . GLU A 1 77  ? 10.527  4.595   6.762   1.00 13.29  ? 77  GLU A OE1 1 
ATOM   625  O  OE2 . GLU A 1 77  ? 10.980  6.399   5.624   1.00 19.54  ? 77  GLU A OE2 1 
ATOM   626  N  N   . ARG A 1 78  ? 7.474   7.029   10.847  1.00 19.11  ? 78  ARG A N   1 
ATOM   627  C  CA  . ARG A 1 78  ? 6.216   6.570   11.454  1.00 17.90  ? 78  ARG A CA  1 
ATOM   628  C  C   . ARG A 1 78  ? 5.199   7.639   11.715  1.00 16.71  ? 78  ARG A C   1 
ATOM   629  O  O   . ARG A 1 78  ? 4.018   7.441   11.474  1.00 22.96  ? 78  ARG A O   1 
ATOM   630  C  CB  . ARG A 1 78  ? 6.463   5.844   12.766  1.00 17.51  ? 78  ARG A CB  1 
ATOM   631  C  CG  . ARG A 1 78  ? 6.611   4.407   12.516  1.00 24.27  ? 78  ARG A CG  1 
ATOM   632  C  CD  . ARG A 1 78  ? 6.604   3.560   13.738  1.00 22.46  ? 78  ARG A CD  1 
ATOM   633  N  NE  . ARG A 1 78  ? 7.199   2.296   13.330  1.00 36.33  ? 78  ARG A NE  1 
ATOM   634  C  CZ  . ARG A 1 78  ? 8.003   1.554   14.078  1.00 49.20  ? 78  ARG A CZ  1 
ATOM   635  N  NH1 . ARG A 1 78  ? 8.301   1.929   15.320  1.00 55.02  ? 78  ARG A NH1 1 
ATOM   636  N  NH2 . ARG A 1 78  ? 8.502   0.430   13.577  1.00 36.68  ? 78  ARG A NH2 1 
ATOM   637  N  N   . ASP A 1 79  ? 5.646   8.751   12.265  1.00 12.14  ? 79  ASP A N   1 
ATOM   638  C  CA  . ASP A 1 79  ? 4.735   9.843   12.491  1.00 21.01  ? 79  ASP A CA  1 
ATOM   639  C  C   . ASP A 1 79  ? 4.340   10.372  11.141  1.00 15.71  ? 79  ASP A C   1 
ATOM   640  O  O   . ASP A 1 79  ? 3.168   10.688  10.906  1.00 18.08  ? 79  ASP A O   1 
ATOM   641  C  CB  . ASP A 1 79  ? 5.372   10.925  13.348  1.00 20.54  ? 79  ASP A CB  1 
ATOM   642  C  CG  . ASP A 1 79  ? 5.242   10.628  14.815  1.00 19.90  ? 79  ASP A CG  1 
ATOM   643  O  OD1 . ASP A 1 79  ? 5.720   11.433  15.640  1.00 15.54  ? 79  ASP A OD1 1 
ATOM   644  O  OD2 . ASP A 1 79  ? 4.639   9.578   15.133  1.00 30.44  ? 79  ASP A OD2 1 
ATOM   645  N  N   . LEU A 1 80  ? 5.312   10.471  10.240  1.00 9.79   ? 80  LEU A N   1 
ATOM   646  C  CA  . LEU A 1 80  ? 5.057   10.951  8.888   1.00 15.37  ? 80  LEU A CA  1 
ATOM   647  C  C   . LEU A 1 80  ? 4.120   10.005  8.146   1.00 19.58  ? 80  LEU A C   1 
ATOM   648  O  O   . LEU A 1 80  ? 3.424   10.408  7.214   1.00 22.17  ? 80  LEU A O   1 
ATOM   649  C  CB  . LEU A 1 80  ? 6.368   11.106  8.117   1.00 16.00  ? 80  LEU A CB  1 
ATOM   650  C  CG  . LEU A 1 80  ? 7.101   12.439  8.283   1.00 14.88  ? 80  LEU A CG  1 
ATOM   651  C  CD1 . LEU A 1 80  ? 8.093   12.652  7.151   1.00 12.95  ? 80  LEU A CD1 1 
ATOM   652  C  CD2 . LEU A 1 80  ? 6.110   13.591  8.358   1.00 5.64   ? 80  LEU A CD2 1 
ATOM   653  N  N   . GLN A 1 81  ? 4.107   8.744   8.566   1.00 19.34  ? 81  GLN A N   1 
ATOM   654  C  CA  . GLN A 1 81  ? 3.256   7.737   7.943   1.00 20.95  ? 81  GLN A CA  1 
ATOM   655  C  C   . GLN A 1 81  ? 1.822   7.838   8.454   1.00 22.39  ? 81  GLN A C   1 
ATOM   656  O  O   . GLN A 1 81  ? 0.897   8.100   7.685   1.00 25.02  ? 81  GLN A O   1 
ATOM   657  C  CB  . GLN A 1 81  ? 3.809   6.334   8.201   1.00 18.69  ? 81  GLN A CB  1 
ATOM   658  C  CG  . GLN A 1 81  ? 3.760   5.416   6.990   1.00 22.41  ? 81  GLN A CG  1 
ATOM   659  C  CD  . GLN A 1 81  ? 4.967   5.577   6.088   1.00 32.57  ? 81  GLN A CD  1 
ATOM   660  O  OE1 . GLN A 1 81  ? 5.574   6.646   6.028   1.00 27.90  ? 81  GLN A OE1 1 
ATOM   661  N  NE2 . GLN A 1 81  ? 5.322   4.512   5.379   1.00 41.21  ? 81  GLN A NE2 1 
ATOM   662  N  N   . SER A 1 82  ? 1.646   7.628   9.754   1.00 23.45  ? 82  SER A N   1 
ATOM   663  C  CA  . SER A 1 82  ? 0.326   7.696   10.369  1.00 29.12  ? 82  SER A CA  1 
ATOM   664  C  C   . SER A 1 82  ? -0.537  8.761   9.701   1.00 33.59  ? 82  SER A C   1 
ATOM   665  O  O   . SER A 1 82  ? -1.726  8.550   9.460   1.00 55.83  ? 82  SER A O   1 
ATOM   666  C  CB  . SER A 1 82  ? 0.447   7.981   11.867  1.00 34.37  ? 82  SER A CB  1 
ATOM   667  O  OG  . SER A 1 82  ? 1.043   6.890   12.547  1.00 18.39  ? 82  SER A OG  1 
ATOM   668  N  N   . ILE A 1 83  ? 0.069   9.906   9.403   1.00 21.06  ? 83  ILE A N   1 
ATOM   669  C  CA  . ILE A 1 83  ? -0.634  11.011  8.777   1.00 25.39  ? 83  ILE A CA  1 
ATOM   670  C  C   . ILE A 1 83  ? -0.968  10.786  7.287   1.00 21.28  ? 83  ILE A C   1 
ATOM   671  O  O   . ILE A 1 83  ? -2.137  10.749  6.900   1.00 29.61  ? 83  ILE A O   1 
ATOM   672  C  CB  . ILE A 1 83  ? 0.172   12.311  8.816   1.00 33.06  ? 83  ILE A CB  1 
ATOM   673  C  CG1 . ILE A 1 83  ? 0.489   12.681  10.266  1.00 36.72  ? 83  ILE A CG1 1 
ATOM   674  C  CG2 . ILE A 1 83  ? -0.583  13.438  8.127   1.00 30.37  ? 83  ILE A CG2 1 
ATOM   675  C  CD1 . ILE A 1 83  ? 0.666   14.166  10.493  1.00 30.55  ? 83  ILE A CD1 1 
ATOM   676  N  N   . ASN A 1 84  ? 0.070   10.642  6.470   1.00 17.72  ? 84  ASN A N   1 
ATOM   677  C  CA  . ASN A 1 84  ? -0.097  10.432  5.069   1.00 24.76  ? 84  ASN A CA  1 
ATOM   678  C  C   . ASN A 1 84  ? 0.616   9.116   4.772   1.00 23.92  ? 84  ASN A C   1 
ATOM   679  O  O   . ASN A 1 84  ? 1.839   9.074   4.672   1.00 20.63  ? 84  ASN A O   1 
ATOM   680  C  CB  . ASN A 1 84  ? 0.475   11.583  4.236   1.00 22.32  ? 84  ASN A CB  1 
ATOM   681  C  CG  . ASN A 1 84  ? 0.225   11.450  2.758   1.00 21.55  ? 84  ASN A CG  1 
ATOM   682  O  OD1 . ASN A 1 84  ? -0.037  12.432  2.085   1.00 18.59  ? 84  ASN A OD1 1 
ATOM   683  N  ND2 . ASN A 1 84  ? 0.335   10.240  2.238   1.00 28.72  ? 84  ASN A ND2 1 
ATOM   684  N  N   . PRO A 1 85  ? -0.149  8.027   4.662   1.00 22.14  ? 85  PRO A N   1 
ATOM   685  C  CA  . PRO A 1 85  ? 0.455   6.690   4.596   1.00 20.34  ? 85  PRO A CA  1 
ATOM   686  C  C   . PRO A 1 85  ? 1.403   6.549   3.406   1.00 27.15  ? 85  PRO A C   1 
ATOM   687  O  O   . PRO A 1 85  ? 2.274   5.675   3.375   1.00 35.90  ? 85  PRO A O   1 
ATOM   688  C  CB  . PRO A 1 85  ? -0.756  5.763   4.452   1.00 25.91  ? 85  PRO A CB  1 
ATOM   689  C  CG  . PRO A 1 85  ? -1.891  6.650   3.953   1.00 21.09  ? 85  PRO A CG  1 
ATOM   690  C  CD  . PRO A 1 85  ? -1.615  8.014   4.494   1.00 22.50  ? 85  PRO A CD  1 
ATOM   691  N  N   . GLU A 1 86  ? 1.274   7.455   2.456   1.00 28.49  ? 86  GLU A N   1 
ATOM   692  C  CA  . GLU A 1 86  ? 2.006   7.329   1.210   1.00 30.94  ? 86  GLU A CA  1 
ATOM   693  C  C   . GLU A 1 86  ? 3.325   8.037   1.267   1.00 34.53  ? 86  GLU A C   1 
ATOM   694  O  O   . GLU A 1 86  ? 4.028   8.076   0.279   1.00 47.63  ? 86  GLU A O   1 
ATOM   695  C  CB  . GLU A 1 86  ? 1.195   7.891   0.044   1.00 32.32  ? 86  GLU A CB  1 
ATOM   696  C  CG  . GLU A 1 86  ? 0.028   7.029   -0.393  1.00 39.81  ? 86  GLU A CG  1 
ATOM   697  C  CD  . GLU A 1 86  ? 0.477   5.784   -1.125  1.00 57.18  ? 86  GLU A CD  1 
ATOM   698  O  OE1 . GLU A 1 86  ? 1.688   5.645   -1.366  1.00 60.71  ? 86  GLU A OE1 1 
ATOM   699  O  OE2 . GLU A 1 86  ? -0.378  4.943   -1.456  1.00 47.87  ? 86  GLU A OE2 1 
ATOM   700  N  N   . VAL A 1 87  ? 3.653   8.623   2.412   1.00 34.71  ? 87  VAL A N   1 
ATOM   701  C  CA  . VAL A 1 87  ? 4.905   9.369   2.552   1.00 32.83  ? 87  VAL A CA  1 
ATOM   702  C  C   . VAL A 1 87  ? 5.991   8.596   3.294   1.00 25.02  ? 87  VAL A C   1 
ATOM   703  O  O   . VAL A 1 87  ? 5.764   8.064   4.384   1.00 18.07  ? 87  VAL A O   1 
ATOM   704  C  CB  . VAL A 1 87  ? 4.685   10.771  3.205   1.00 27.24  ? 87  VAL A CB  1 
ATOM   705  C  CG1 . VAL A 1 87  ? 6.012   11.392  3.592   1.00 27.84  ? 87  VAL A CG1 1 
ATOM   706  C  CG2 . VAL A 1 87  ? 3.933   11.685  2.253   1.00 22.46  ? 87  VAL A CG2 1 
ATOM   707  N  N   . THR A 1 88  ? 7.168   8.531   2.681   1.00 23.00  ? 88  THR A N   1 
ATOM   708  C  CA  . THR A 1 88  ? 8.309   7.891   3.307   1.00 19.65  ? 88  THR A CA  1 
ATOM   709  C  C   . THR A 1 88  ? 9.413   8.905   3.488   1.00 19.38  ? 88  THR A C   1 
ATOM   710  O  O   . THR A 1 88  ? 9.314   10.031  2.990   1.00 19.61  ? 88  THR A O   1 
ATOM   711  C  CB  . THR A 1 88  ? 8.857   6.726   2.481   1.00 18.46  ? 88  THR A CB  1 
ATOM   712  O  OG1 . THR A 1 88  ? 9.433   7.213   1.260   1.00 16.95  ? 88  THR A OG1 1 
ATOM   713  C  CG2 . THR A 1 88  ? 7.748   5.735   2.182   1.00 19.30  ? 88  THR A CG2 1 
ATOM   714  N  N   . LEU A 1 89  ? 10.456  8.528   4.190   1.00 16.91  ? 89  LEU A N   1 
ATOM   715  C  CA  . LEU A 1 89  ? 11.509  9.472   4.417   1.00 13.91  ? 89  LEU A CA  1 
ATOM   716  C  C   . LEU A 1 89  ? 12.617  9.236   3.427   1.00 14.40  ? 89  LEU A C   1 
ATOM   717  O  O   . LEU A 1 89  ? 13.242  8.188   3.418   1.00 16.23  ? 89  LEU A O   1 
ATOM   718  C  CB  . LEU A 1 89  ? 12.003  9.379   5.841   1.00 16.01  ? 89  LEU A CB  1 
ATOM   719  C  CG  . LEU A 1 89  ? 12.851  10.558  6.228   1.00 19.13  ? 89  LEU A CG  1 
ATOM   720  C  CD1 . LEU A 1 89  ? 13.676  10.136  7.413   1.00 18.64  ? 89  LEU A CD1 1 
ATOM   721  C  CD2 . LEU A 1 89  ? 13.726  10.872  5.029   1.00 15.35  ? 89  LEU A CD2 1 
ATOM   722  N  N   . PRO A 1 90  ? 12.821  10.226  2.576   1.00 12.87  ? 90  PRO A N   1 
ATOM   723  C  CA  . PRO A 1 90  ? 13.765  10.163  1.468   1.00 12.31  ? 90  PRO A CA  1 
ATOM   724  C  C   . PRO A 1 90  ? 15.166  10.421  1.983   1.00 15.50  ? 90  PRO A C   1 
ATOM   725  O  O   . PRO A 1 90  ? 15.336  10.951  3.104   1.00 15.38  ? 90  PRO A O   1 
ATOM   726  C  CB  . PRO A 1 90  ? 13.338  11.336  0.577   1.00 9.27   ? 90  PRO A CB  1 
ATOM   727  C  CG  . PRO A 1 90  ? 12.104  11.854  1.150   1.00 8.84   ? 90  PRO A CG  1 
ATOM   728  C  CD  . PRO A 1 90  ? 12.136  11.516  2.591   1.00 9.86   ? 90  PRO A CD  1 
ATOM   729  N  N   . TYR A 1 91  ? 16.157  10.060  1.170   1.00 8.83   ? 91  TYR A N   1 
ATOM   730  C  CA  . TYR A 1 91  ? 17.530  10.367  1.503   1.00 7.44   ? 91  TYR A CA  1 
ATOM   731  C  C   . TYR A 1 91  ? 18.136  11.403  0.574   1.00 6.23   ? 91  TYR A C   1 
ATOM   732  O  O   . TYR A 1 91  ? 17.671  11.625  -0.547  1.00 6.29   ? 91  TYR A O   1 
ATOM   733  C  CB  . TYR A 1 91  ? 18.399  9.116   1.527   1.00 7.75   ? 91  TYR A CB  1 
ATOM   734  C  CG  . TYR A 1 91  ? 18.489  8.310   0.239   1.00 16.00  ? 91  TYR A CG  1 
ATOM   735  C  CD1 . TYR A 1 91  ? 19.570  8.456   -0.628  1.00 10.38  ? 91  TYR A CD1 1 
ATOM   736  C  CD2 . TYR A 1 91  ? 17.515  7.365   -0.081  1.00 15.28  ? 91  TYR A CD2 1 
ATOM   737  C  CE1 . TYR A 1 91  ? 19.655  7.716   -1.777  1.00 5.78   ? 91  TYR A CE1 1 
ATOM   738  C  CE2 . TYR A 1 91  ? 17.598  6.615   -1.235  1.00 8.82   ? 91  TYR A CE2 1 
ATOM   739  C  CZ  . TYR A 1 91  ? 18.667  6.800   -2.075  1.00 6.37   ? 91  TYR A CZ  1 
ATOM   740  O  OH  . TYR A 1 91  ? 18.741  6.060   -3.223  1.00 11.10  ? 91  TYR A OH  1 
ATOM   741  N  N   . TRP A 1 92  ? 19.203  12.017  1.057   1.00 5.18   ? 92  TRP A N   1 
ATOM   742  C  CA  . TRP A 1 92  ? 19.934  13.056  0.384   1.00 7.29   ? 92  TRP A CA  1 
ATOM   743  C  C   . TRP A 1 92  ? 21.259  12.465  0.064   1.00 8.61   ? 92  TRP A C   1 
ATOM   744  O  O   . TRP A 1 92  ? 22.065  12.196  0.957   1.00 9.89   ? 92  TRP A O   1 
ATOM   745  C  CB  . TRP A 1 92  ? 20.091  14.219  1.339   1.00 5.86   ? 92  TRP A CB  1 
ATOM   746  C  CG  . TRP A 1 92  ? 21.054  15.298  0.949   1.00 8.32   ? 92  TRP A CG  1 
ATOM   747  C  CD1 . TRP A 1 92  ? 21.407  15.692  -0.312  1.00 12.40  ? 92  TRP A CD1 1 
ATOM   748  C  CD2 . TRP A 1 92  ? 21.794  16.194  1.835   1.00 11.18  ? 92  TRP A CD2 1 
ATOM   749  N  NE1 . TRP A 1 92  ? 22.308  16.712  -0.273  1.00 12.21  ? 92  TRP A NE1 1 
ATOM   750  C  CE2 . TRP A 1 92  ? 22.575  17.057  0.980   1.00 13.87  ? 92  TRP A CE2 1 
ATOM   751  C  CE3 . TRP A 1 92  ? 21.892  16.345  3.200   1.00 8.33   ? 92  TRP A CE3 1 
ATOM   752  C  CZ2 . TRP A 1 92  ? 23.401  18.024  1.484   1.00 17.63  ? 92  TRP A CZ2 1 
ATOM   753  C  CZ3 . TRP A 1 92  ? 22.738  17.319  3.698   1.00 8.76   ? 92  TRP A CZ3 1 
ATOM   754  C  CH2 . TRP A 1 92  ? 23.466  18.144  2.858   1.00 13.46  ? 92  TRP A CH2 1 
ATOM   755  N  N   . GLU A 1 93  ? 21.511  12.205  -1.203  1.00 5.97   ? 93  GLU A N   1 
ATOM   756  C  CA  . GLU A 1 93  ? 22.722  11.520  -1.571  1.00 5.31   ? 93  GLU A CA  1 
ATOM   757  C  C   . GLU A 1 93  ? 23.854  12.520  -1.746  1.00 8.94   ? 93  GLU A C   1 
ATOM   758  O  O   . GLU A 1 93  ? 24.269  12.796  -2.875  1.00 14.84  ? 93  GLU A O   1 
ATOM   759  C  CB  . GLU A 1 93  ? 22.476  10.747  -2.852  1.00 5.82   ? 93  GLU A CB  1 
ATOM   760  C  CG  . GLU A 1 93  ? 23.542  9.745   -3.159  1.00 8.37   ? 93  GLU A CG  1 
ATOM   761  C  CD  . GLU A 1 93  ? 23.163  8.860   -4.318  1.00 11.47  ? 93  GLU A CD  1 
ATOM   762  O  OE1 . GLU A 1 93  ? 23.207  9.323   -5.477  1.00 11.10  ? 93  GLU A OE1 1 
ATOM   763  O  OE2 . GLU A 1 93  ? 22.793  7.700   -4.067  1.00 12.41  ? 93  GLU A OE2 1 
ATOM   764  N  N   . TRP A 1 94  ? 24.348  13.082  -0.643  1.00 7.26   ? 94  TRP A N   1 
ATOM   765  C  CA  . TRP A 1 94  ? 25.342  14.152  -0.761  1.00 9.63   ? 94  TRP A CA  1 
ATOM   766  C  C   . TRP A 1 94  ? 26.636  13.769  -1.524  1.00 8.63   ? 94  TRP A C   1 
ATOM   767  O  O   . TRP A 1 94  ? 27.292  14.626  -2.102  1.00 8.66   ? 94  TRP A O   1 
ATOM   768  C  CB  . TRP A 1 94  ? 25.636  14.828  0.581   1.00 5.36   ? 94  TRP A CB  1 
ATOM   769  C  CG  . TRP A 1 94  ? 25.500  13.937  1.777   1.00 6.43   ? 94  TRP A CG  1 
ATOM   770  C  CD1 . TRP A 1 94  ? 24.470  13.926  2.668   1.00 8.12   ? 94  TRP A CD1 1 
ATOM   771  C  CD2 . TRP A 1 94  ? 26.424  12.944  2.235   1.00 9.24   ? 94  TRP A CD2 1 
ATOM   772  N  NE1 . TRP A 1 94  ? 24.687  12.993  3.642   1.00 6.03   ? 94  TRP A NE1 1 
ATOM   773  C  CE2 . TRP A 1 94  ? 25.889  12.366  3.398   1.00 5.54   ? 94  TRP A CE2 1 
ATOM   774  C  CE3 . TRP A 1 94  ? 27.661  12.467  1.765   1.00 12.54  ? 94  TRP A CE3 1 
ATOM   775  C  CZ2 . TRP A 1 94  ? 26.519  11.362  4.105   1.00 5.26   ? 94  TRP A CZ2 1 
ATOM   776  C  CZ3 . TRP A 1 94  ? 28.293  11.462  2.467   1.00 9.49   ? 94  TRP A CZ3 1 
ATOM   777  C  CH2 . TRP A 1 94  ? 27.723  10.921  3.623   1.00 7.00   ? 94  TRP A CH2 1 
ATOM   778  N  N   . GLU A 1 95  ? 26.996  12.497  -1.568  1.00 5.68   ? 95  GLU A N   1 
ATOM   779  C  CA  . GLU A 1 95  ? 28.214  12.148  -2.278  1.00 13.02  ? 95  GLU A CA  1 
ATOM   780  C  C   . GLU A 1 95  ? 28.093  12.354  -3.786  1.00 17.16  ? 95  GLU A C   1 
ATOM   781  O  O   . GLU A 1 95  ? 29.119  12.362  -4.492  1.00 21.00  ? 95  GLU A O   1 
ATOM   782  C  CB  . GLU A 1 95  ? 28.680  10.717  -1.961  1.00 15.99  ? 95  GLU A CB  1 
ATOM   783  C  CG  . GLU A 1 95  ? 27.744  9.617   -2.438  1.00 17.06  ? 95  GLU A CG  1 
ATOM   784  C  CD  . GLU A 1 95  ? 26.584  9.402   -1.495  1.00 11.98  ? 95  GLU A CD  1 
ATOM   785  O  OE1 . GLU A 1 95  ? 26.109  10.386  -0.894  1.00 9.56   ? 95  GLU A OE1 1 
ATOM   786  O  OE2 . GLU A 1 95  ? 26.143  8.244   -1.354  1.00 13.06  ? 95  GLU A OE2 1 
ATOM   787  N  N   . THR A 1 96  ? 26.863  12.490  -4.283  1.00 8.01   ? 96  THR A N   1 
ATOM   788  C  CA  . THR A 1 96  ? 26.681  12.683  -5.707  1.00 9.81   ? 96  THR A CA  1 
ATOM   789  C  C   . THR A 1 96  ? 26.544  14.167  -5.977  1.00 11.70  ? 96  THR A C   1 
ATOM   790  O  O   . THR A 1 96  ? 26.856  14.651  -7.066  1.00 13.11  ? 96  THR A O   1 
ATOM   791  C  CB  . THR A 1 96  ? 25.482  11.911  -6.245  1.00 11.53  ? 96  THR A CB  1 
ATOM   792  O  OG1 . THR A 1 96  ? 24.285  12.363  -5.600  1.00 12.62  ? 96  THR A OG1 1 
ATOM   793  C  CG2 . THR A 1 96  ? 25.691  10.419  -6.009  1.00 9.22   ? 96  THR A CG2 1 
ATOM   794  N  N   . ASP A 1 97  ? 26.085  14.901  -4.974  1.00 11.90  ? 97  ASP A N   1 
ATOM   795  C  CA  . ASP A 1 97  ? 26.034  16.351  -5.090  1.00 12.75  ? 97  ASP A CA  1 
ATOM   796  C  C   . ASP A 1 97  ? 27.431  16.891  -5.016  1.00 13.70  ? 97  ASP A C   1 
ATOM   797  O  O   . ASP A 1 97  ? 27.699  17.996  -5.474  1.00 18.56  ? 97  ASP A O   1 
ATOM   798  C  CB  . ASP A 1 97  ? 25.198  16.973  -3.981  1.00 13.11  ? 97  ASP A CB  1 
ATOM   799  C  CG  . ASP A 1 97  ? 23.746  17.044  -4.334  1.00 23.74  ? 97  ASP A CG  1 
ATOM   800  O  OD1 . ASP A 1 97  ? 23.033  17.834  -3.688  1.00 29.87  ? 97  ASP A OD1 1 
ATOM   801  O  OD2 . ASP A 1 97  ? 23.319  16.318  -5.257  1.00 25.36  ? 97  ASP A OD2 1 
ATOM   802  N  N   . ALA A 1 98  ? 28.330  16.111  -4.436  1.00 15.30  ? 98  ALA A N   1 
ATOM   803  C  CA  . ALA A 1 98  ? 29.665  16.619  -4.217  1.00 16.22  ? 98  ALA A CA  1 
ATOM   804  C  C   . ALA A 1 98  ? 30.364  16.762  -5.550  1.00 18.67  ? 98  ALA A C   1 
ATOM   805  O  O   . ALA A 1 98  ? 31.356  17.470  -5.643  1.00 23.03  ? 98  ALA A O   1 
ATOM   806  C  CB  . ALA A 1 98  ? 30.448  15.714  -3.287  1.00 14.60  ? 98  ALA A CB  1 
ATOM   807  N  N   . GLN A 1 99  ? 29.848  16.137  -6.587  1.00 19.10  ? 99  GLN A N   1 
ATOM   808  C  CA  . GLN A 1 99  ? 30.485  16.300  -7.875  1.00 28.14  ? 99  GLN A CA  1 
ATOM   809  C  C   . GLN A 1 99  ? 30.175  17.695  -8.410  1.00 27.57  ? 99  GLN A C   1 
ATOM   810  O  O   . GLN A 1 99  ? 31.052  18.438  -8.812  1.00 37.03  ? 99  GLN A O   1 
ATOM   811  C  CB  . GLN A 1 99  ? 30.053  15.208  -8.860  1.00 31.26  ? 99  GLN A CB  1 
ATOM   812  C  CG  . GLN A 1 99  ? 29.198  14.094  -8.272  1.00 42.28  ? 99  GLN A CG  1 
ATOM   813  C  CD  . GLN A 1 99  ? 29.629  12.693  -8.698  1.00 71.28  ? 99  GLN A CD  1 
ATOM   814  O  OE1 . GLN A 1 99  ? 28.906  11.987  -9.404  1.00 51.87  ? 99  GLN A OE1 1 
ATOM   815  N  NE2 . GLN A 1 99  ? 30.802  12.283  -8.253  1.00 75.89  ? 99  GLN A NE2 1 
ATOM   816  N  N   . MET A 1 100 ? 28.919  18.065  -8.390  1.00 17.58  ? 100 MET A N   1 
ATOM   817  C  CA  . MET A 1 100 ? 28.509  19.282  -9.092  1.00 15.87  ? 100 MET A CA  1 
ATOM   818  C  C   . MET A 1 100 ? 29.553  20.374  -8.930  1.00 23.08  ? 100 MET A C   1 
ATOM   819  O  O   . MET A 1 100 ? 30.197  20.485  -7.892  1.00 23.72  ? 100 MET A O   1 
ATOM   820  C  CB  . MET A 1 100 ? 27.174  19.820  -8.583  1.00 17.64  ? 100 MET A CB  1 
ATOM   821  C  CG  . MET A 1 100 ? 25.982  18.919  -8.813  1.00 18.34  ? 100 MET A CG  1 
ATOM   822  S  SD  . MET A 1 100 ? 24.468  19.513  -7.992  1.00 23.44  ? 100 MET A SD  1 
ATOM   823  C  CE  . MET A 1 100 ? 24.059  20.926  -9.018  1.00 39.87  ? 100 MET A CE  1 
ATOM   824  N  N   . GLN A 1 101 ? 29.712  21.169  -9.980  1.00 28.53  ? 101 GLN A N   1 
ATOM   825  C  CA  . GLN A 1 101 ? 30.523  22.372  -9.950  1.00 33.47  ? 101 GLN A CA  1 
ATOM   826  C  C   . GLN A 1 101 ? 30.176  23.186  -8.717  1.00 31.39  ? 101 GLN A C   1 
ATOM   827  O  O   . GLN A 1 101 ? 31.037  23.576  -7.926  1.00 31.05  ? 101 GLN A O   1 
ATOM   828  C  CB  . GLN A 1 101 ? 30.212  23.200  -11.191 1.00 47.68  ? 101 GLN A CB  1 
ATOM   829  C  CG  . GLN A 1 101 ? 31.058  24.431  -11.350 1.00 53.64  ? 101 GLN A CG  1 
ATOM   830  C  CD  . GLN A 1 101 ? 32.509  24.081  -11.575 1.00 64.68  ? 101 GLN A CD  1 
ATOM   831  O  OE1 . GLN A 1 101 ? 33.379  24.946  -11.526 1.00 91.43  ? 101 GLN A OE1 1 
ATOM   832  N  NE2 . GLN A 1 101 ? 32.780  22.802  -11.830 1.00 51.42  ? 101 GLN A NE2 1 
ATOM   833  N  N   . ASP A 1 102 ? 28.893  23.375  -8.480  1.00 34.10  ? 102 ASP A N   1 
ATOM   834  C  CA  . ASP A 1 102 ? 28.488  23.987  -7.236  1.00 28.43  ? 102 ASP A CA  1 
ATOM   835  C  C   . ASP A 1 102 ? 27.361  23.205  -6.622  1.00 25.97  ? 102 ASP A C   1 
ATOM   836  O  O   . ASP A 1 102 ? 26.222  23.407  -6.979  1.00 27.86  ? 102 ASP A O   1 
ATOM   837  C  CB  . ASP A 1 102 ? 28.046  25.413  -7.471  1.00 38.32  ? 102 ASP A CB  1 
ATOM   838  C  CG  . ASP A 1 102 ? 27.334  25.988  -6.296  1.00 43.67  ? 102 ASP A CG  1 
ATOM   839  O  OD1 . ASP A 1 102 ? 26.595  25.241  -5.643  1.00 53.21  ? 102 ASP A OD1 1 
ATOM   840  O  OD2 . ASP A 1 102 ? 27.503  27.183  -6.031  1.00 40.39  ? 102 ASP A OD2 1 
ATOM   841  N  N   . PRO A 1 103 ? 27.666  22.305  -5.705  1.00 22.42  ? 103 PRO A N   1 
ATOM   842  C  CA  . PRO A 1 103 ? 26.645  21.444  -5.141  1.00 23.52  ? 103 PRO A CA  1 
ATOM   843  C  C   . PRO A 1 103 ? 25.555  22.200  -4.414  1.00 29.96  ? 103 PRO A C   1 
ATOM   844  O  O   . PRO A 1 103 ? 24.763  21.591  -3.717  1.00 35.05  ? 103 PRO A O   1 
ATOM   845  C  CB  . PRO A 1 103 ? 27.420  20.578  -4.162  1.00 15.75  ? 103 PRO A CB  1 
ATOM   846  C  CG  . PRO A 1 103 ? 28.840  20.988  -4.255  1.00 14.31  ? 103 PRO A CG  1 
ATOM   847  C  CD  . PRO A 1 103 ? 28.989  21.719  -5.537  1.00 21.52  ? 103 PRO A CD  1 
ATOM   848  N  N   . SER A 1 104 ? 25.493  23.510  -4.564  1.00 26.47  ? 104 SER A N   1 
ATOM   849  C  CA  . SER A 1 104 ? 24.350  24.213  -3.981  1.00 24.56  ? 104 SER A CA  1 
ATOM   850  C  C   . SER A 1 104 ? 23.185  24.229  -4.963  1.00 25.06  ? 104 SER A C   1 
ATOM   851  O  O   . SER A 1 104 ? 22.006  24.242  -4.595  1.00 35.40  ? 104 SER A O   1 
ATOM   852  C  CB  . SER A 1 104 ? 24.700  25.618  -3.494  1.00 26.58  ? 104 SER A CB  1 
ATOM   853  O  OG  . SER A 1 104 ? 25.496  26.334  -4.410  1.00 40.06  ? 104 SER A OG  1 
ATOM   854  N  N   . GLN A 1 105 ? 23.546  24.241  -6.236  1.00 27.66  ? 105 GLN A N   1 
ATOM   855  C  CA  . GLN A 1 105 ? 22.570  24.093  -7.308  1.00 32.22  ? 105 GLN A CA  1 
ATOM   856  C  C   . GLN A 1 105 ? 21.784  22.776  -7.250  1.00 26.87  ? 105 GLN A C   1 
ATOM   857  O  O   . GLN A 1 105 ? 20.886  22.577  -8.060  1.00 33.02  ? 105 GLN A O   1 
ATOM   858  C  CB  . GLN A 1 105 ? 23.233  24.224  -8.696  1.00 40.94  ? 105 GLN A CB  1 
ATOM   859  C  CG  . GLN A 1 105 ? 24.283  25.332  -8.827  1.00 40.05  ? 105 GLN A CG  1 
ATOM   860  C  CD  . GLN A 1 105 ? 23.657  26.730  -8.889  1.00 28.69  ? 105 GLN A CD  1 
ATOM   861  O  OE1 . GLN A 1 105 ? 22.453  26.887  -8.753  1.00 28.31  ? 105 GLN A OE1 1 
ATOM   862  N  NE2 . GLN A 1 105 ? 24.487  27.742  -9.038  1.00 25.18  ? 105 GLN A NE2 1 
ATOM   863  N  N   . SER A 1 106 ? 22.113  21.868  -6.339  1.00 17.77  ? 106 SER A N   1 
ATOM   864  C  CA  . SER A 1 106 ? 21.330  20.647  -6.267  1.00 18.50  ? 106 SER A CA  1 
ATOM   865  C  C   . SER A 1 106 ? 19.853  20.998  -6.338  1.00 20.48  ? 106 SER A C   1 
ATOM   866  O  O   . SER A 1 106 ? 19.447  22.118  -6.024  1.00 18.44  ? 106 SER A O   1 
ATOM   867  C  CB  . SER A 1 106 ? 21.612  19.858  -4.992  1.00 20.49  ? 106 SER A CB  1 
ATOM   868  O  OG  . SER A 1 106 ? 20.882  18.648  -4.996  1.00 25.95  ? 106 SER A OG  1 
ATOM   869  N  N   . GLN A 1 107 ? 19.021  20.058  -6.731  1.00 20.57  ? 107 GLN A N   1 
ATOM   870  C  CA  . GLN A 1 107 ? 17.611  20.361  -6.804  1.00 19.46  ? 107 GLN A CA  1 
ATOM   871  C  C   . GLN A 1 107 ? 16.975  19.970  -5.504  1.00 14.46  ? 107 GLN A C   1 
ATOM   872  O  O   . GLN A 1 107 ? 15.780  19.904  -5.389  1.00 18.33  ? 107 GLN A O   1 
ATOM   873  C  CB  . GLN A 1 107 ? 16.941  19.675  -7.994  1.00 24.53  ? 107 GLN A CB  1 
ATOM   874  C  CG  . GLN A 1 107 ? 16.848  20.539  -9.264  1.00 26.22  ? 107 GLN A CG  1 
ATOM   875  C  CD  . GLN A 1 107 ? 16.059  21.819  -9.057  1.00 28.54  ? 107 GLN A CD  1 
ATOM   876  O  OE1 . GLN A 1 107 ? 15.362  21.965  -8.074  1.00 27.40  ? 107 GLN A OE1 1 
ATOM   877  N  NE2 . GLN A 1 107 ? 16.177  22.751  -9.983  1.00 20.35  ? 107 GLN A NE2 1 
ATOM   878  N  N   . ILE A 1 108 ? 17.795  19.792  -4.489  1.00 14.69  ? 108 ILE A N   1 
ATOM   879  C  CA  . ILE A 1 108 ? 17.250  19.621  -3.160  1.00 14.38  ? 108 ILE A CA  1 
ATOM   880  C  C   . ILE A 1 108 ? 17.105  20.933  -2.436  1.00 13.48  ? 108 ILE A C   1 
ATOM   881  O  O   . ILE A 1 108 ? 16.373  21.008  -1.481  1.00 14.43  ? 108 ILE A O   1 
ATOM   882  C  CB  . ILE A 1 108 ? 18.084  18.693  -2.279  1.00 19.91  ? 108 ILE A CB  1 
ATOM   883  C  CG1 . ILE A 1 108 ? 17.458  18.618  -0.899  1.00 16.07  ? 108 ILE A CG1 1 
ATOM   884  C  CG2 . ILE A 1 108 ? 19.502  19.199  -2.170  1.00 18.80  ? 108 ILE A CG2 1 
ATOM   885  C  CD1 . ILE A 1 108 ? 18.247  17.782  0.077   1.00 17.26  ? 108 ILE A CD1 1 
ATOM   886  N  N   . TRP A 1 109 ? 17.786  21.970  -2.895  1.00 14.26  ? 109 TRP A N   1 
ATOM   887  C  CA  . TRP A 1 109 ? 17.636  23.277  -2.269  1.00 13.49  ? 109 TRP A CA  1 
ATOM   888  C  C   . TRP A 1 109 ? 16.657  24.123  -3.053  1.00 16.72  ? 109 TRP A C   1 
ATOM   889  O  O   . TRP A 1 109 ? 16.636  25.343  -2.931  1.00 19.10  ? 109 TRP A O   1 
ATOM   890  C  CB  . TRP A 1 109 ? 18.980  23.991  -2.202  1.00 17.84  ? 109 TRP A CB  1 
ATOM   891  C  CG  . TRP A 1 109 ? 20.036  23.188  -1.566  1.00 14.42  ? 109 TRP A CG  1 
ATOM   892  C  CD1 . TRP A 1 109 ? 21.142  22.671  -2.164  1.00 17.86  ? 109 TRP A CD1 1 
ATOM   893  C  CD2 . TRP A 1 109 ? 20.093  22.787  -0.207  1.00 15.38  ? 109 TRP A CD2 1 
ATOM   894  N  NE1 . TRP A 1 109 ? 21.890  21.973  -1.259  1.00 17.79  ? 109 TRP A NE1 1 
ATOM   895  C  CE2 . TRP A 1 109 ? 21.263  22.029  -0.032  1.00 18.64  ? 109 TRP A CE2 1 
ATOM   896  C  CE3 . TRP A 1 109 ? 19.266  22.990  0.898   1.00 19.96  ? 109 TRP A CE3 1 
ATOM   897  C  CZ2 . TRP A 1 109 ? 21.638  21.470  1.177   1.00 18.03  ? 109 TRP A CZ2 1 
ATOM   898  C  CZ3 . TRP A 1 109 ? 19.637  22.437  2.111   1.00 21.84  ? 109 TRP A CZ3 1 
ATOM   899  C  CH2 . TRP A 1 109 ? 20.811  21.686  2.239   1.00 18.09  ? 109 TRP A CH2 1 
ATOM   900  N  N   . SER A 1 110 ? 15.866  23.452  -3.880  1.00 17.48  ? 110 SER A N   1 
ATOM   901  C  CA  . SER A 1 110 ? 14.889  24.119  -4.723  1.00 14.32  ? 110 SER A CA  1 
ATOM   902  C  C   . SER A 1 110 ? 13.780  24.713  -3.874  1.00 12.84  ? 110 SER A C   1 
ATOM   903  O  O   . SER A 1 110 ? 13.482  24.227  -2.786  1.00 12.57  ? 110 SER A O   1 
ATOM   904  C  CB  . SER A 1 110 ? 14.322  23.168  -5.786  1.00 14.92  ? 110 SER A CB  1 
ATOM   905  O  OG  . SER A 1 110 ? 13.537  22.137  -5.220  1.00 14.29  ? 110 SER A OG  1 
ATOM   906  N  N   . ALA A 1 111 ? 13.173  25.770  -4.394  1.00 12.82  ? 111 ALA A N   1 
ATOM   907  C  CA  . ALA A 1 111 ? 12.221  26.579  -3.644  1.00 11.02  ? 111 ALA A CA  1 
ATOM   908  C  C   . ALA A 1 111 ? 10.985  25.812  -3.201  1.00 10.69  ? 111 ALA A C   1 
ATOM   909  O  O   . ALA A 1 111 ? 10.418  26.088  -2.148  1.00 11.55  ? 111 ALA A O   1 
ATOM   910  C  CB  . ALA A 1 111 ? 11.822  27.782  -4.462  1.00 25.26  ? 111 ALA A CB  1 
ATOM   911  N  N   . ASP A 1 112 ? 10.561  24.858  -4.019  1.00 13.36  ? 112 ASP A N   1 
ATOM   912  C  CA  . ASP A 1 112 ? 9.418   24.004  -3.708  1.00 12.41  ? 112 ASP A CA  1 
ATOM   913  C  C   . ASP A 1 112 ? 9.775   22.830  -2.806  1.00 13.59  ? 112 ASP A C   1 
ATOM   914  O  O   . ASP A 1 112 ? 8.913   22.018  -2.500  1.00 13.38  ? 112 ASP A O   1 
ATOM   915  C  CB  . ASP A 1 112 ? 8.807   23.464  -5.001  1.00 16.78  ? 112 ASP A CB  1 
ATOM   916  C  CG  . ASP A 1 112 ? 9.781   22.555  -5.781  1.00 36.52  ? 112 ASP A CG  1 
ATOM   917  O  OD1 . ASP A 1 112 ? 9.586   22.343  -7.001  1.00 54.71  ? 112 ASP A OD1 1 
ATOM   918  O  OD2 . ASP A 1 112 ? 10.751  22.042  -5.177  1.00 25.16  ? 112 ASP A OD2 1 
ATOM   919  N  N   . PHE A 1 113 ? 11.045  22.736  -2.425  1.00 16.66  ? 113 PHE A N   1 
ATOM   920  C  CA  . PHE A 1 113 ? 11.526  21.625  -1.612  1.00 13.68  ? 113 PHE A CA  1 
ATOM   921  C  C   . PHE A 1 113 ? 11.995  21.871  -0.184  1.00 15.71  ? 113 PHE A C   1 
ATOM   922  O  O   . PHE A 1 113 ? 11.199  21.830  0.754   1.00 21.09  ? 113 PHE A O   1 
ATOM   923  C  CB  . PHE A 1 113 ? 12.679  20.906  -2.313  1.00 12.40  ? 113 PHE A CB  1 
ATOM   924  C  CG  . PHE A 1 113 ? 12.832  19.467  -1.910  1.00 16.71  ? 113 PHE A CG  1 
ATOM   925  C  CD1 . PHE A 1 113 ? 14.084  18.881  -1.845  1.00 17.01  ? 113 PHE A CD1 1 
ATOM   926  C  CD2 . PHE A 1 113 ? 11.721  18.701  -1.597  1.00 16.15  ? 113 PHE A CD2 1 
ATOM   927  C  CE1 . PHE A 1 113 ? 14.228  17.557  -1.474  1.00 18.14  ? 113 PHE A CE1 1 
ATOM   928  C  CE2 . PHE A 1 113 ? 11.857  17.377  -1.225  1.00 13.32  ? 113 PHE A CE2 1 
ATOM   929  C  CZ  . PHE A 1 113 ? 13.112  16.804  -1.163  1.00 14.77  ? 113 PHE A CZ  1 
ATOM   930  N  N   . MET A 1 114 ? 13.269  22.188  -0.007  1.00 11.80  ? 114 MET A N   1 
ATOM   931  C  CA  . MET A 1 114 ? 13.740  22.631  1.294   1.00 13.38  ? 114 MET A CA  1 
ATOM   932  C  C   . MET A 1 114 ? 13.988  24.116  1.361   1.00 12.74  ? 114 MET A C   1 
ATOM   933  O  O   . MET A 1 114 ? 13.945  24.724  2.410   1.00 12.58  ? 114 MET A O   1 
ATOM   934  C  CB  . MET A 1 114 ? 15.026  21.916  1.685   1.00 8.89   ? 114 MET A CB  1 
ATOM   935  C  CG  . MET A 1 114 ? 14.936  20.418  1.661   1.00 14.00  ? 114 MET A CG  1 
ATOM   936  S  SD  . MET A 1 114 ? 14.539  19.724  3.241   1.00 11.80  ? 114 MET A SD  1 
ATOM   937  C  CE  . MET A 1 114 ? 12.814  19.352  3.067   1.00 5.47   ? 114 MET A CE  1 
ATOM   938  N  N   . GLY A 1 115 ? 14.290  24.703  0.234   1.00 12.68  ? 115 GLY A N   1 
ATOM   939  C  CA  . GLY A 1 115 ? 14.714  26.086  0.230   1.00 12.46  ? 115 GLY A CA  1 
ATOM   940  C  C   . GLY A 1 115 ? 16.202  26.107  -0.056  1.00 16.20  ? 115 GLY A C   1 
ATOM   941  O  O   . GLY A 1 115 ? 16.835  25.052  -0.121  1.00 15.96  ? 115 GLY A O   1 
ATOM   942  N  N   . GLY A 1 116 ? 16.771  27.296  -0.220  1.00 22.20  ? 116 GLY A N   1 
ATOM   943  C  CA  . GLY A 1 116 ? 18.184  27.402  -0.527  1.00 27.55  ? 116 GLY A CA  1 
ATOM   944  C  C   . GLY A 1 116 ? 19.062  27.814  0.647   1.00 28.02  ? 116 GLY A C   1 
ATOM   945  O  O   . GLY A 1 116 ? 18.784  27.464  1.810   1.00 22.57  ? 116 GLY A O   1 
ATOM   946  N  N   . ASN A 1 117 ? 20.128  28.553  0.325   1.00 28.11  ? 117 ASN A N   1 
ATOM   947  C  CA  . ASN A 1 117 ? 21.152  28.930  1.286   1.00 25.70  ? 117 ASN A CA  1 
ATOM   948  C  C   . ASN A 1 117 ? 20.779  30.197  2.050   1.00 28.80  ? 117 ASN A C   1 
ATOM   949  O  O   . ASN A 1 117 ? 19.800  30.903  1.711   1.00 24.04  ? 117 ASN A O   1 
ATOM   950  C  CB  . ASN A 1 117 ? 22.482  29.166  0.567   1.00 25.19  ? 117 ASN A CB  1 
ATOM   951  C  CG  . ASN A 1 117 ? 23.668  29.124  1.512   1.00 23.10  ? 117 ASN A CG  1 
ATOM   952  O  OD1 . ASN A 1 117 ? 24.753  29.617  1.192   1.00 21.63  ? 117 ASN A OD1 1 
ATOM   953  N  ND2 . ASN A 1 117 ? 23.466  28.531  2.689   1.00 22.32  ? 117 ASN A ND2 1 
ATOM   954  N  N   . GLY A 1 118 ? 21.561  30.462  3.096   1.00 25.51  ? 118 GLY A N   1 
ATOM   955  C  CA  . GLY A 1 118 ? 21.360  31.629  3.919   1.00 21.58  ? 118 GLY A CA  1 
ATOM   956  C  C   . GLY A 1 118 ? 21.583  32.913  3.164   1.00 15.75  ? 118 GLY A C   1 
ATOM   957  O  O   . GLY A 1 118 ? 22.438  33.000  2.300   1.00 7.02   ? 118 GLY A O   1 
ATOM   958  N  N   . ASN A 1 119 ? 20.777  33.906  3.503   1.00 17.36  ? 119 ASN A N   1 
ATOM   959  C  CA  . ASN A 1 119 ? 20.904  35.245  2.984   1.00 9.16   ? 119 ASN A CA  1 
ATOM   960  C  C   . ASN A 1 119 ? 21.870  36.064  3.840   1.00 10.88  ? 119 ASN A C   1 
ATOM   961  O  O   . ASN A 1 119 ? 21.552  36.437  4.960   1.00 9.94   ? 119 ASN A O   1 
ATOM   962  C  CB  . ASN A 1 119 ? 19.523  35.884  2.965   1.00 8.20   ? 119 ASN A CB  1 
ATOM   963  C  CG  . ASN A 1 119 ? 19.560  37.310  2.539   1.00 9.83   ? 119 ASN A CG  1 
ATOM   964  O  OD1 . ASN A 1 119 ? 18.538  37.898  2.231   1.00 9.46   ? 119 ASN A OD1 1 
ATOM   965  N  ND2 . ASN A 1 119 ? 20.747  37.883  2.506   1.00 11.34  ? 119 ASN A ND2 1 
ATOM   966  N  N   . PRO A 1 120 ? 23.055  36.362  3.302   1.00 14.09  ? 120 PRO A N   1 
ATOM   967  C  CA  . PRO A 1 120 ? 24.106  37.086  4.017   1.00 15.08  ? 120 PRO A CA  1 
ATOM   968  C  C   . PRO A 1 120 ? 23.651  38.436  4.532   1.00 15.53  ? 120 PRO A C   1 
ATOM   969  O  O   . PRO A 1 120 ? 24.263  38.974  5.454   1.00 18.88  ? 120 PRO A O   1 
ATOM   970  C  CB  . PRO A 1 120 ? 25.164  37.285  2.945   1.00 10.48  ? 120 PRO A CB  1 
ATOM   971  C  CG  . PRO A 1 120 ? 24.402  37.271  1.688   1.00 7.98   ? 120 PRO A CG  1 
ATOM   972  C  CD  . PRO A 1 120 ? 23.394  36.197  1.885   1.00 11.38  ? 120 PRO A CD  1 
ATOM   973  N  N   . ILE A 1 121 ? 22.585  38.982  3.964   1.00 19.23  ? 121 ILE A N   1 
ATOM   974  C  CA  . ILE A 1 121 ? 22.112  40.280  4.419   1.00 19.43  ? 121 ILE A CA  1 
ATOM   975  C  C   . ILE A 1 121 ? 21.398  40.128  5.763   1.00 19.46  ? 121 ILE A C   1 
ATOM   976  O  O   . ILE A 1 121 ? 21.553  40.959  6.650   1.00 20.27  ? 121 ILE A O   1 
ATOM   977  C  CB  . ILE A 1 121 ? 21.167  40.952  3.405   1.00 27.70  ? 121 ILE A CB  1 
ATOM   978  C  CG1 . ILE A 1 121 ? 21.810  40.958  2.026   1.00 28.53  ? 121 ILE A CG1 1 
ATOM   979  C  CG2 . ILE A 1 121 ? 20.869  42.369  3.828   1.00 29.64  ? 121 ILE A CG2 1 
ATOM   980  C  CD1 . ILE A 1 121 ? 23.119  41.686  1.978   1.00 21.20  ? 121 ILE A CD1 1 
ATOM   981  N  N   . LYS A 1 122 ? 20.568  39.099  5.923   1.00 14.18  ? 122 LYS A N   1 
ATOM   982  C  CA  . LYS A 1 122 ? 19.783  38.898  7.139   1.00 12.89  ? 122 LYS A CA  1 
ATOM   983  C  C   . LYS A 1 122 ? 20.483  37.948  8.038   1.00 18.76  ? 122 LYS A C   1 
ATOM   984  O  O   . LYS A 1 122 ? 19.860  37.148  8.696   1.00 21.68  ? 122 LYS A O   1 
ATOM   985  C  CB  . LYS A 1 122 ? 18.430  38.267  6.869   1.00 8.04   ? 122 LYS A CB  1 
ATOM   986  C  CG  . LYS A 1 122 ? 17.617  38.858  5.753   1.00 12.08  ? 122 LYS A CG  1 
ATOM   987  C  CD  . LYS A 1 122 ? 17.097  37.774  4.835   1.00 13.21  ? 122 LYS A CD  1 
ATOM   988  C  CE  . LYS A 1 122 ? 15.616  37.538  5.034   1.00 18.06  ? 122 LYS A CE  1 
ATOM   989  N  NZ  . LYS A 1 122 ? 14.915  38.825  5.240   1.00 23.89  ? 122 LYS A NZ  1 
ATOM   990  N  N   . ASP A 1 123 ? 21.794  38.048  8.058   1.00 20.19  ? 123 ASP A N   1 
ATOM   991  C  CA  . ASP A 1 123 ? 22.586  37.171  8.876   1.00 30.84  ? 123 ASP A CA  1 
ATOM   992  C  C   . ASP A 1 123 ? 22.248  35.736  8.570   1.00 25.39  ? 123 ASP A C   1 
ATOM   993  O  O   . ASP A 1 123 ? 21.863  34.979  9.433   1.00 27.03  ? 123 ASP A O   1 
ATOM   994  C  CB  . ASP A 1 123 ? 22.393  37.512  10.331  1.00 65.86  ? 123 ASP A CB  1 
ATOM   995  C  CG  . ASP A 1 123 ? 23.313  38.607  10.763  1.00 67.61  ? 123 ASP A CG  1 
ATOM   996  O  OD1 . ASP A 1 123 ? 22.874  39.555  11.443  1.00 81.21  ? 123 ASP A OD1 1 
ATOM   997  O  OD2 . ASP A 1 123 ? 24.493  38.525  10.392  1.00 81.88  ? 123 ASP A OD2 1 
ATOM   998  N  N   . PHE A 1 124 ? 22.362  35.399  7.300   1.00 16.56  ? 124 PHE A N   1 
ATOM   999  C  CA  . PHE A 1 124 ? 22.232  34.042  6.844   1.00 18.28  ? 124 PHE A CA  1 
ATOM   1000 C  C   . PHE A 1 124 ? 20.943  33.316  7.198   1.00 17.13  ? 124 PHE A C   1 
ATOM   1001 O  O   . PHE A 1 124 ? 20.892  32.112  7.190   1.00 15.20  ? 124 PHE A O   1 
ATOM   1002 C  CB  . PHE A 1 124 ? 23.445  33.277  7.295   1.00 19.85  ? 124 PHE A CB  1 
ATOM   1003 C  CG  . PHE A 1 124 ? 24.711  33.788  6.701   1.00 19.16  ? 124 PHE A CG  1 
ATOM   1004 C  CD1 . PHE A 1 124 ? 25.296  34.925  7.185   1.00 20.15  ? 124 PHE A CD1 1 
ATOM   1005 C  CD2 . PHE A 1 124 ? 25.304  33.133  5.644   1.00 20.35  ? 124 PHE A CD2 1 
ATOM   1006 C  CE1 . PHE A 1 124 ? 26.465  35.405  6.632   1.00 28.43  ? 124 PHE A CE1 1 
ATOM   1007 C  CE2 . PHE A 1 124 ? 26.467  33.600  5.091   1.00 21.32  ? 124 PHE A CE2 1 
ATOM   1008 C  CZ  . PHE A 1 124 ? 27.050  34.739  5.586   1.00 26.44  ? 124 PHE A CZ  1 
ATOM   1009 N  N   . ILE A 1 125 ? 19.891  34.074  7.428   1.00 14.16  ? 125 ILE A N   1 
ATOM   1010 C  CA  . ILE A 1 125 ? 18.593  33.493  7.592   1.00 14.97  ? 125 ILE A CA  1 
ATOM   1011 C  C   . ILE A 1 125 ? 18.256  32.837  6.298   1.00 16.82  ? 125 ILE A C   1 
ATOM   1012 O  O   . ILE A 1 125 ? 18.796  33.197  5.283   1.00 13.54  ? 125 ILE A O   1 
ATOM   1013 C  CB  . ILE A 1 125 ? 17.531  34.555  7.750   1.00 15.15  ? 125 ILE A CB  1 
ATOM   1014 C  CG1 . ILE A 1 125 ? 17.394  34.974  9.196   1.00 23.45  ? 125 ILE A CG1 1 
ATOM   1015 C  CG2 . ILE A 1 125 ? 16.209  34.015  7.258   1.00 15.09  ? 125 ILE A CG2 1 
ATOM   1016 C  CD1 . ILE A 1 125 ? 15.956  35.184  9.590   1.00 31.63  ? 125 ILE A CD1 1 
ATOM   1017 N  N   . VAL A 1 126 ? 17.341  31.878  6.329   1.00 25.14  ? 126 VAL A N   1 
ATOM   1018 C  CA  . VAL A 1 126 ? 16.823  31.281  5.090   1.00 24.15  ? 126 VAL A CA  1 
ATOM   1019 C  C   . VAL A 1 126 ? 15.509  31.947  4.769   1.00 28.59  ? 126 VAL A C   1 
ATOM   1020 O  O   . VAL A 1 126 ? 14.574  31.877  5.564   1.00 34.21  ? 126 VAL A O   1 
ATOM   1021 C  CB  . VAL A 1 126 ? 16.558  29.750  5.187   1.00 17.35  ? 126 VAL A CB  1 
ATOM   1022 C  CG1 . VAL A 1 126 ? 16.250  29.198  3.810   1.00 13.82  ? 126 VAL A CG1 1 
ATOM   1023 C  CG2 . VAL A 1 126 ? 17.738  29.021  5.809   1.00 18.12  ? 126 VAL A CG2 1 
ATOM   1024 N  N   . ASP A 1 127 ? 15.388  32.586  3.617   1.00 37.29  ? 127 ASP A N   1 
ATOM   1025 C  CA  . ASP A 1 127 ? 14.146  33.274  3.289   1.00 30.13  ? 127 ASP A CA  1 
ATOM   1026 C  C   . ASP A 1 127 ? 13.410  32.674  2.123   1.00 23.91  ? 127 ASP A C   1 
ATOM   1027 O  O   . ASP A 1 127 ? 12.393  33.189  1.711   1.00 22.81  ? 127 ASP A O   1 
ATOM   1028 C  CB  . ASP A 1 127 ? 14.453  34.712  2.950   1.00 27.62  ? 127 ASP A CB  1 
ATOM   1029 C  CG  . ASP A 1 127 ? 15.618  34.839  2.027   1.00 28.91  ? 127 ASP A CG  1 
ATOM   1030 O  OD1 . ASP A 1 127 ? 16.538  34.017  2.125   1.00 33.24  ? 127 ASP A OD1 1 
ATOM   1031 O  OD2 . ASP A 1 127 ? 15.614  35.759  1.199   1.00 33.59  ? 127 ASP A OD2 1 
ATOM   1032 N  N   . THR A 1 128 ? 13.939  31.586  1.593   1.00 28.78  ? 128 THR A N   1 
ATOM   1033 C  CA  . THR A 1 128 ? 13.464  31.010  0.356   1.00 23.06  ? 128 THR A CA  1 
ATOM   1034 C  C   . THR A 1 128 ? 13.007  29.597  0.568   1.00 17.52  ? 128 THR A C   1 
ATOM   1035 O  O   . THR A 1 128 ? 13.782  28.765  0.978   1.00 18.68  ? 128 THR A O   1 
ATOM   1036 C  CB  . THR A 1 128 ? 14.594  30.977  -0.687  1.00 30.43  ? 128 THR A CB  1 
ATOM   1037 O  OG1 . THR A 1 128 ? 15.867  31.007  -0.037  1.00 26.42  ? 128 THR A OG1 1 
ATOM   1038 C  CG2 . THR A 1 128 ? 14.504  32.177  -1.574  1.00 28.52  ? 128 THR A CG2 1 
ATOM   1039 N  N   . GLY A 1 129 ? 11.753  29.306  0.278   1.00 12.82  ? 129 GLY A N   1 
ATOM   1040 C  CA  . GLY A 1 129 ? 11.307  27.924  0.351   1.00 21.17  ? 129 GLY A CA  1 
ATOM   1041 C  C   . GLY A 1 129 ? 10.418  27.587  1.527   1.00 16.26  ? 129 GLY A C   1 
ATOM   1042 O  O   . GLY A 1 129 ? 10.201  28.407  2.401   1.00 13.64  ? 129 GLY A O   1 
ATOM   1043 N  N   . PRO A 1 130 ? 9.845   26.406  1.570   1.00 10.93  ? 130 PRO A N   1 
ATOM   1044 C  CA  . PRO A 1 130 ? 8.800   26.171  2.555   1.00 11.69  ? 130 PRO A CA  1 
ATOM   1045 C  C   . PRO A 1 130 ? 9.215   26.386  4.006   1.00 17.75  ? 130 PRO A C   1 
ATOM   1046 O  O   . PRO A 1 130 ? 8.397   26.230  4.895   1.00 15.45  ? 130 PRO A O   1 
ATOM   1047 C  CB  . PRO A 1 130 ? 8.430   24.708  2.324   1.00 11.27  ? 130 PRO A CB  1 
ATOM   1048 C  CG  . PRO A 1 130 ? 8.984   24.352  1.005   1.00 7.99   ? 130 PRO A CG  1 
ATOM   1049 C  CD  . PRO A 1 130 ? 10.213  25.171  0.882   1.00 9.03   ? 130 PRO A CD  1 
ATOM   1050 N  N   . PHE A 1 131 ? 10.362  26.991  4.151   1.00 20.06  ? 131 PHE A N   1 
ATOM   1051 C  CA  . PHE A 1 131 ? 10.960  26.948  5.426   1.00 21.33  ? 131 PHE A CA  1 
ATOM   1052 C  C   . PHE A 1 131 ? 11.652  28.129  5.898   1.00 21.04  ? 131 PHE A C   1 
ATOM   1053 O  O   . PHE A 1 131 ? 12.384  28.027  6.798   1.00 22.16  ? 131 PHE A O   1 
ATOM   1054 C  CB  . PHE A 1 131 ? 11.964  25.838  5.421   1.00 22.04  ? 131 PHE A CB  1 
ATOM   1055 C  CG  . PHE A 1 131 ? 11.341  24.512  5.337   1.00 16.01  ? 131 PHE A CG  1 
ATOM   1056 C  CD1 . PHE A 1 131 ? 12.067  23.408  5.216   1.00 11.86  ? 131 PHE A CD1 1 
ATOM   1057 C  CD2 . PHE A 1 131 ? 10.003  24.418  5.409   1.00 19.81  ? 131 PHE A CD2 1 
ATOM   1058 C  CE1 . PHE A 1 131 ? 11.468  22.217  5.127   1.00 12.86  ? 131 PHE A CE1 1 
ATOM   1059 C  CE2 . PHE A 1 131 ? 9.396   23.215  5.356   1.00 24.57  ? 131 PHE A CE2 1 
ATOM   1060 C  CZ  . PHE A 1 131 ? 10.134  22.111  5.195   1.00 19.78  ? 131 PHE A CZ  1 
ATOM   1061 N  N   . ALA A 1 132 ? 11.499  29.265  5.257   1.00 20.49  ? 132 ALA A N   1 
ATOM   1062 C  CA  . ALA A 1 132 ? 12.324  30.379  5.673   1.00 31.51  ? 132 ALA A CA  1 
ATOM   1063 C  C   . ALA A 1 132 ? 11.617  31.212  6.682   1.00 31.23  ? 132 ALA A C   1 
ATOM   1064 O  O   . ALA A 1 132 ? 10.425  31.391  6.607   1.00 30.63  ? 132 ALA A O   1 
ATOM   1065 C  CB  . ALA A 1 132 ? 12.734  31.233  4.485   1.00 34.39  ? 132 ALA A CB  1 
ATOM   1066 N  N   . ALA A 1 133 ? 12.374  31.737  7.640   1.00 36.81  ? 133 ALA A N   1 
ATOM   1067 C  CA  . ALA A 1 133 ? 11.831  32.604  8.679   1.00 43.83  ? 133 ALA A CA  1 
ATOM   1068 C  C   . ALA A 1 133 ? 10.527  33.108  8.060   1.00 41.23  ? 133 ALA A C   1 
ATOM   1069 O  O   . ALA A 1 133 ? 10.534  33.650  6.954   1.00 30.38  ? 133 ALA A O   1 
ATOM   1070 C  CB  . ALA A 1 133 ? 12.843  33.619  9.131   1.00 56.54  ? 133 ALA A CB  1 
ATOM   1071 N  N   . GLY A 1 134 ? 9.421   32.933  8.774   1.00 51.74  ? 134 GLY A N   1 
ATOM   1072 C  CA  . GLY A 1 134 ? 8.137   33.369  8.281   1.00 47.87  ? 134 GLY A CA  1 
ATOM   1073 C  C   . GLY A 1 134 ? 7.067   32.275  8.170   1.00 32.84  ? 134 GLY A C   1 
ATOM   1074 O  O   . GLY A 1 134 ? 5.871   32.549  8.274   1.00 36.81  ? 134 GLY A O   1 
ATOM   1075 N  N   . ARG A 1 135 ? 7.512   31.041  7.958   1.00 22.47  ? 135 ARG A N   1 
ATOM   1076 C  CA  . ARG A 1 135 ? 6.614   29.931  7.851   1.00 14.83  ? 135 ARG A CA  1 
ATOM   1077 C  C   . ARG A 1 135 ? 7.258   28.804  8.578   1.00 18.24  ? 135 ARG A C   1 
ATOM   1078 O  O   . ARG A 1 135 ? 6.739   27.715  8.649   1.00 20.02  ? 135 ARG A O   1 
ATOM   1079 C  CB  . ARG A 1 135 ? 6.427   29.584  6.398   1.00 19.81  ? 135 ARG A CB  1 
ATOM   1080 C  CG  . ARG A 1 135 ? 6.942   30.677  5.494   1.00 28.22  ? 135 ARG A CG  1 
ATOM   1081 C  CD  . ARG A 1 135 ? 6.170   30.738  4.197   1.00 36.52  ? 135 ARG A CD  1 
ATOM   1082 N  NE  . ARG A 1 135 ? 6.996   30.347  3.069   1.00 40.29  ? 135 ARG A NE  1 
ATOM   1083 C  CZ  . ARG A 1 135 ? 8.064   31.014  2.665   1.00 46.96  ? 135 ARG A CZ  1 
ATOM   1084 N  NH1 . ARG A 1 135 ? 8.429   32.110  3.290   1.00 56.95  ? 135 ARG A NH1 1 
ATOM   1085 N  NH2 . ARG A 1 135 ? 8.758   30.594  1.626   1.00 44.66  ? 135 ARG A NH2 1 
ATOM   1086 N  N   . TRP A 1 136 ? 8.409   29.077  9.148   1.00 17.75  ? 136 TRP A N   1 
ATOM   1087 C  CA  . TRP A 1 136 ? 9.066   28.074  9.933   1.00 13.00  ? 136 TRP A CA  1 
ATOM   1088 C  C   . TRP A 1 136 ? 9.590   28.723  11.156  1.00 12.85  ? 136 TRP A C   1 
ATOM   1089 O  O   . TRP A 1 136 ? 10.131  29.823  11.096  1.00 11.80  ? 136 TRP A O   1 
ATOM   1090 C  CB  . TRP A 1 136 ? 10.216  27.468  9.149   1.00 15.74  ? 136 TRP A CB  1 
ATOM   1091 C  CG  . TRP A 1 136 ? 10.799  26.213  9.736   1.00 16.29  ? 136 TRP A CG  1 
ATOM   1092 C  CD1 . TRP A 1 136 ? 11.981  26.082  10.419  1.00 15.38  ? 136 TRP A CD1 1 
ATOM   1093 C  CD2 . TRP A 1 136 ? 10.236  24.868  9.712   1.00 20.37  ? 136 TRP A CD2 1 
ATOM   1094 N  NE1 . TRP A 1 136 ? 12.175  24.800  10.807  1.00 15.85  ? 136 TRP A NE1 1 
ATOM   1095 C  CE2 . TRP A 1 136 ? 11.163  24.033  10.423  1.00 17.97  ? 136 TRP A CE2 1 
ATOM   1096 C  CE3 . TRP A 1 136 ? 9.091   24.309  9.211   1.00 21.73  ? 136 TRP A CE3 1 
ATOM   1097 C  CZ2 . TRP A 1 136 ? 10.947  22.701  10.593  1.00 16.65  ? 136 TRP A CZ2 1 
ATOM   1098 C  CZ3 . TRP A 1 136 ? 8.886   22.959  9.388   1.00 21.77  ? 136 TRP A CZ3 1 
ATOM   1099 C  CH2 . TRP A 1 136 ? 9.793   22.175  10.063  1.00 16.72  ? 136 TRP A CH2 1 
ATOM   1100 N  N   . THR A 1 137 ? 9.419   28.050  12.283  1.00 23.13  ? 137 THR A N   1 
ATOM   1101 C  CA  . THR A 1 137 ? 9.788   28.528  13.606  1.00 25.49  ? 137 THR A CA  1 
ATOM   1102 C  C   . THR A 1 137 ? 10.934  27.723  14.163  1.00 19.73  ? 137 THR A C   1 
ATOM   1103 O  O   . THR A 1 137 ? 10.939  26.517  14.045  1.00 16.00  ? 137 THR A O   1 
ATOM   1104 C  CB  . THR A 1 137 ? 8.687   28.181  14.580  1.00 26.89  ? 137 THR A CB  1 
ATOM   1105 O  OG1 . THR A 1 137 ? 8.681   26.760  14.734  1.00 21.87  ? 137 THR A OG1 1 
ATOM   1106 C  CG2 . THR A 1 137 ? 7.360   28.628  14.048  1.00 27.05  ? 137 THR A CG2 1 
ATOM   1107 N  N   . THR A 1 138 ? 11.895  28.386  14.806  1.00 17.85  ? 138 THR A N   1 
ATOM   1108 C  CA  . THR A 1 138 ? 13.169  27.769  15.175  1.00 21.41  ? 138 THR A CA  1 
ATOM   1109 C  C   . THR A 1 138 ? 13.608  27.817  16.651  1.00 21.50  ? 138 THR A C   1 
ATOM   1110 O  O   . THR A 1 138 ? 14.157  28.811  17.088  1.00 27.23  ? 138 THR A O   1 
ATOM   1111 C  CB  . THR A 1 138 ? 14.322  28.452  14.423  1.00 21.53  ? 138 THR A CB  1 
ATOM   1112 O  OG1 . THR A 1 138 ? 14.546  29.748  14.987  1.00 19.02  ? 138 THR A OG1 1 
ATOM   1113 C  CG2 . THR A 1 138 ? 14.032  28.593  12.952  1.00 17.85  ? 138 THR A CG2 1 
ATOM   1114 N  N   . ILE A 1 139 ? 13.430  26.723  17.386  1.00 15.77  ? 139 ILE A N   1 
ATOM   1115 C  CA  . ILE A 1 139 ? 13.945  26.560  18.743  1.00 19.15  ? 139 ILE A CA  1 
ATOM   1116 C  C   . ILE A 1 139 ? 15.462  26.525  18.772  1.00 25.12  ? 139 ILE A C   1 
ATOM   1117 O  O   . ILE A 1 139 ? 16.062  26.188  17.771  1.00 35.60  ? 139 ILE A O   1 
ATOM   1118 C  CB  . ILE A 1 139 ? 13.771  25.110  19.192  1.00 17.71  ? 139 ILE A CB  1 
ATOM   1119 C  CG1 . ILE A 1 139 ? 12.399  24.919  19.798  1.00 23.92  ? 139 ILE A CG1 1 
ATOM   1120 C  CG2 . ILE A 1 139 ? 14.867  24.680  20.138  1.00 17.99  ? 139 ILE A CG2 1 
ATOM   1121 C  CD1 . ILE A 1 139 ? 11.326  25.565  18.964  1.00 30.32  ? 139 ILE A CD1 1 
ATOM   1122 N  N   . ASP A 1 140 ? 16.075  26.894  19.898  1.00 26.37  ? 140 ASP A N   1 
ATOM   1123 C  CA  . ASP A 1 140 ? 17.530  26.849  20.082  1.00 33.32  ? 140 ASP A CA  1 
ATOM   1124 C  C   . ASP A 1 140 ? 17.957  25.961  21.235  1.00 34.36  ? 140 ASP A C   1 
ATOM   1125 O  O   . ASP A 1 140 ? 17.175  25.136  21.659  1.00 39.08  ? 140 ASP A O   1 
ATOM   1126 C  CB  . ASP A 1 140 ? 17.794  28.217  20.681  1.00 43.27  ? 140 ASP A CB  1 
ATOM   1127 C  CG  . ASP A 1 140 ? 17.076  28.419  21.963  1.00 44.83  ? 140 ASP A CG  1 
ATOM   1128 O  OD1 . ASP A 1 140 ? 17.451  29.325  22.725  1.00 52.72  ? 140 ASP A OD1 1 
ATOM   1129 O  OD2 . ASP A 1 140 ? 16.120  27.668  22.200  1.00 43.86  ? 140 ASP A OD2 1 
ATOM   1130 N  N   . GLU A 1 141 ? 19.173  26.096  21.760  1.00 37.56  ? 141 GLU A N   1 
ATOM   1131 C  CA  . GLU A 1 141 ? 19.602  25.082  22.709  1.00 46.23  ? 141 GLU A CA  1 
ATOM   1132 C  C   . GLU A 1 141 ? 18.749  25.008  24.003  1.00 53.90  ? 141 GLU A C   1 
ATOM   1133 O  O   . GLU A 1 141 ? 18.463  23.914  24.514  1.00 39.72  ? 141 GLU A O   1 
ATOM   1134 C  CB  . GLU A 1 141 ? 21.070  25.316  23.033  1.00 43.56  ? 141 GLU A CB  1 
ATOM   1135 C  CG  . GLU A 1 141 ? 21.694  24.278  23.913  1.00 54.48  ? 141 GLU A CG  1 
ATOM   1136 C  CD  . GLU A 1 141 ? 23.055  24.719  24.369  1.00 77.50  ? 141 GLU A CD  1 
ATOM   1137 O  OE1 . GLU A 1 141 ? 23.921  24.960  23.493  1.00 80.88  ? 141 GLU A OE1 1 
ATOM   1138 O  OE2 . GLU A 1 141 ? 23.244  24.853  25.599  1.00 81.02  ? 141 GLU A OE2 1 
ATOM   1139 N  N   . GLN A 1 142 ? 18.363  26.130  24.571  1.00 61.62  ? 142 GLN A N   1 
ATOM   1140 C  CA  . GLN A 1 142 ? 17.626  26.010  25.804  1.00 60.77  ? 142 GLN A CA  1 
ATOM   1141 C  C   . GLN A 1 142 ? 16.263  25.397  25.520  1.00 46.87  ? 142 GLN A C   1 
ATOM   1142 O  O   . GLN A 1 142 ? 15.754  24.669  26.329  1.00 60.73  ? 142 GLN A O   1 
ATOM   1143 C  CB  . GLN A 1 142 ? 17.532  27.353  26.529  1.00 93.41  ? 142 GLN A CB  1 
ATOM   1144 C  CG  . GLN A 1 142 ? 16.898  27.308  27.908  1.00 106.16 ? 142 GLN A CG  1 
ATOM   1145 C  CD  . GLN A 1 142 ? 17.641  26.420  28.888  1.00 115.24 ? 142 GLN A CD  1 
ATOM   1146 O  OE1 . GLN A 1 142 ? 17.396  26.466  30.091  1.00 123.61 ? 142 GLN A OE1 1 
ATOM   1147 N  NE2 . GLN A 1 142 ? 18.543  25.602  28.377  1.00 122.89 ? 142 GLN A NE2 1 
ATOM   1148 N  N   . GLY A 1 143 ? 15.674  25.676  24.372  1.00 35.69  ? 143 GLY A N   1 
ATOM   1149 C  CA  . GLY A 1 143 ? 14.295  25.284  24.123  1.00 30.85  ? 143 GLY A CA  1 
ATOM   1150 C  C   . GLY A 1 143 ? 13.340  26.425  23.810  1.00 30.17  ? 143 GLY A C   1 
ATOM   1151 O  O   . GLY A 1 143 ? 12.130  26.219  23.671  1.00 28.17  ? 143 GLY A O   1 
ATOM   1152 N  N   . ASN A 1 144 ? 13.842  27.632  23.601  1.00 34.78  ? 144 ASN A N   1 
ATOM   1153 C  CA  . ASN A 1 144 ? 12.930  28.725  23.257  1.00 32.64  ? 144 ASN A CA  1 
ATOM   1154 C  C   . ASN A 1 144 ? 13.138  29.304  21.861  1.00 31.62  ? 144 ASN A C   1 
ATOM   1155 O  O   . ASN A 1 144 ? 14.257  29.423  21.397  1.00 32.31  ? 144 ASN A O   1 
ATOM   1156 C  CB  . ASN A 1 144 ? 12.964  29.836  24.312  1.00 29.92  ? 144 ASN A CB  1 
ATOM   1157 C  CG  . ASN A 1 144 ? 14.166  29.751  25.216  1.00 33.77  ? 144 ASN A CG  1 
ATOM   1158 O  OD1 . ASN A 1 144 ? 14.031  29.657  26.415  1.00 45.22  ? 144 ASN A OD1 1 
ATOM   1159 N  ND2 . ASN A 1 144 ? 15.345  29.795  24.644  1.00 29.50  ? 144 ASN A ND2 1 
ATOM   1160 N  N   . PRO A 1 145 ? 12.040  29.662  21.203  1.00 29.17  ? 145 PRO A N   1 
ATOM   1161 C  CA  . PRO A 1 145 ? 12.104  30.238  19.856  1.00 20.21  ? 145 PRO A CA  1 
ATOM   1162 C  C   . PRO A 1 145 ? 13.303  31.166  19.696  1.00 22.14  ? 145 PRO A C   1 
ATOM   1163 O  O   . PRO A 1 145 ? 13.586  31.966  20.587  1.00 19.32  ? 145 PRO A O   1 
ATOM   1164 C  CB  . PRO A 1 145 ? 10.804  31.037  19.760  1.00 19.87  ? 145 PRO A CB  1 
ATOM   1165 C  CG  . PRO A 1 145 ? 9.867   30.333  20.680  1.00 29.93  ? 145 PRO A CG  1 
ATOM   1166 C  CD  . PRO A 1 145 ? 10.711  29.830  21.817  1.00 35.58  ? 145 PRO A CD  1 
ATOM   1167 N  N   . SER A 1 146 ? 13.995  31.044  18.568  1.00 29.32  ? 146 SER A N   1 
ATOM   1168 C  CA  . SER A 1 146 ? 15.141  31.890  18.265  1.00 25.53  ? 146 SER A CA  1 
ATOM   1169 C  C   . SER A 1 146 ? 14.782  32.872  17.157  1.00 18.96  ? 146 SER A C   1 
ATOM   1170 O  O   . SER A 1 146 ? 15.002  34.076  17.286  1.00 16.66  ? 146 SER A O   1 
ATOM   1171 C  CB  . SER A 1 146 ? 16.343  31.040  17.849  1.00 23.46  ? 146 SER A CB  1 
ATOM   1172 O  OG  . SER A 1 146 ? 15.998  30.145  16.806  1.00 21.23  ? 146 SER A OG  1 
ATOM   1173 N  N   . GLY A 1 147 ? 14.232  32.357  16.062  1.00 20.07  ? 147 GLY A N   1 
ATOM   1174 C  CA  . GLY A 1 147 ? 13.800  33.202  14.957  1.00 22.39  ? 147 GLY A CA  1 
ATOM   1175 C  C   . GLY A 1 147 ? 14.389  32.478  13.786  1.00 23.01  ? 147 GLY A C   1 
ATOM   1176 O  O   . GLY A 1 147 ? 15.522  32.745  13.385  1.00 21.98  ? 147 GLY A O   1 
ATOM   1177 N  N   . GLY A 1 148 ? 13.622  31.546  13.196  1.00 23.85  ? 148 GLY A N   1 
ATOM   1178 C  CA  . GLY A 1 148 ? 13.752  31.054  11.837  1.00 25.29  ? 148 GLY A CA  1 
ATOM   1179 C  C   . GLY A 1 148 ? 14.763  29.961  11.615  1.00 27.88  ? 148 GLY A C   1 
ATOM   1180 O  O   . GLY A 1 148 ? 14.974  29.091  12.461  1.00 24.12  ? 148 GLY A O   1 
ATOM   1181 N  N   . LEU A 1 149 ? 15.383  30.004  10.440  1.00 27.58  ? 149 LEU A N   1 
ATOM   1182 C  CA  . LEU A 1 149 ? 16.288  28.982  9.990   1.00 26.22  ? 149 LEU A CA  1 
ATOM   1183 C  C   . LEU A 1 149 ? 17.498  29.707  9.506   1.00 17.57  ? 149 LEU A C   1 
ATOM   1184 O  O   . LEU A 1 149 ? 17.389  30.797  9.004   1.00 12.24  ? 149 LEU A O   1 
ATOM   1185 C  CB  . LEU A 1 149 ? 15.692  28.188  8.836   1.00 27.49  ? 149 LEU A CB  1 
ATOM   1186 C  CG  . LEU A 1 149 ? 15.655  26.663  8.851   1.00 21.16  ? 149 LEU A CG  1 
ATOM   1187 C  CD1 . LEU A 1 149 ? 15.414  26.228  7.432   1.00 25.04  ? 149 LEU A CD1 1 
ATOM   1188 C  CD2 . LEU A 1 149 ? 16.919  26.036  9.387   1.00 19.63  ? 149 LEU A CD2 1 
ATOM   1189 N  N   . LYS A 1 150 ? 18.656  29.100  9.687   1.00 19.10  ? 150 LYS A N   1 
ATOM   1190 C  CA  . LYS A 1 150 ? 19.881  29.616  9.096   1.00 16.56  ? 150 LYS A CA  1 
ATOM   1191 C  C   . LYS A 1 150 ? 20.633  28.532  8.304   1.00 17.07  ? 150 LYS A C   1 
ATOM   1192 O  O   . LYS A 1 150 ? 20.738  27.383  8.748   1.00 13.98  ? 150 LYS A O   1 
ATOM   1193 C  CB  . LYS A 1 150 ? 20.802  30.136  10.197  1.00 19.13  ? 150 LYS A CB  1 
ATOM   1194 C  CG  . LYS A 1 150 ? 20.247  31.286  11.029  1.00 18.69  ? 150 LYS A CG  1 
ATOM   1195 C  CD  . LYS A 1 150 ? 21.384  31.991  11.787  1.00 22.99  ? 150 LYS A CD  1 
ATOM   1196 C  CE  . LYS A 1 150 ? 21.013  33.413  12.217  1.00 34.03  ? 150 LYS A CE  1 
ATOM   1197 N  NZ  . LYS A 1 150 ? 22.150  34.210  12.781  1.00 24.12  ? 150 LYS A NZ  1 
ATOM   1198 N  N   . ARG A 1 151 ? 21.202  28.916  7.169   1.00 18.13  ? 151 ARG A N   1 
ATOM   1199 C  CA  . ARG A 1 151 ? 22.138  28.074  6.441   1.00 23.79  ? 151 ARG A CA  1 
ATOM   1200 C  C   . ARG A 1 151 ? 23.318  28.925  6.022   1.00 23.25  ? 151 ARG A C   1 
ATOM   1201 O  O   . ARG A 1 151 ? 23.157  30.117  5.884   1.00 21.50  ? 151 ARG A O   1 
ATOM   1202 C  CB  . ARG A 1 151 ? 21.478  27.485  5.208   1.00 22.71  ? 151 ARG A CB  1 
ATOM   1203 C  CG  . ARG A 1 151 ? 20.936  26.079  5.394   1.00 18.03  ? 151 ARG A CG  1 
ATOM   1204 C  CD  . ARG A 1 151 ? 19.849  25.786  4.385   1.00 15.40  ? 151 ARG A CD  1 
ATOM   1205 N  NE  . ARG A 1 151 ? 18.732  25.108  5.001   1.00 13.44  ? 151 ARG A NE  1 
ATOM   1206 C  CZ  . ARG A 1 151 ? 17.861  24.390  4.323   1.00 14.86  ? 151 ARG A CZ  1 
ATOM   1207 N  NH1 . ARG A 1 151 ? 18.000  24.277  3.020   1.00 16.91  ? 151 ARG A NH1 1 
ATOM   1208 N  NH2 . ARG A 1 151 ? 16.867  23.782  4.939   1.00 9.24   ? 151 ARG A NH2 1 
ATOM   1209 N  N   . ASN A 1 152 ? 24.492  28.319  5.850   1.00 15.06  ? 152 ASN A N   1 
ATOM   1210 C  CA  . ASN A 1 152 ? 25.636  28.932  5.196   1.00 11.51  ? 152 ASN A CA  1 
ATOM   1211 C  C   . ASN A 1 152 ? 26.493  27.850  4.587   1.00 14.44  ? 152 ASN A C   1 
ATOM   1212 O  O   . ASN A 1 152 ? 27.394  27.342  5.242   1.00 20.36  ? 152 ASN A O   1 
ATOM   1213 C  CB  . ASN A 1 152 ? 26.465  29.725  6.204   1.00 16.03  ? 152 ASN A CB  1 
ATOM   1214 C  CG  . ASN A 1 152 ? 27.386  30.729  5.541   1.00 15.10  ? 152 ASN A CG  1 
ATOM   1215 O  OD1 . ASN A 1 152 ? 27.825  31.697  6.167   1.00 12.49  ? 152 ASN A OD1 1 
ATOM   1216 N  ND2 . ASN A 1 152 ? 27.668  30.513  4.262   1.00 15.56  ? 152 ASN A ND2 1 
ATOM   1217 N  N   . PHE A 1 153 ? 26.216  27.495  3.337   1.00 20.75  ? 153 PHE A N   1 
ATOM   1218 C  CA  . PHE A 1 153 ? 26.899  26.368  2.690   1.00 23.24  ? 153 PHE A CA  1 
ATOM   1219 C  C   . PHE A 1 153 ? 28.424  26.541  2.584   1.00 20.98  ? 153 PHE A C   1 
ATOM   1220 O  O   . PHE A 1 153 ? 28.910  27.519  1.996   1.00 19.98  ? 153 PHE A O   1 
ATOM   1221 C  CB  . PHE A 1 153 ? 26.292  26.056  1.311   1.00 23.22  ? 153 PHE A CB  1 
ATOM   1222 C  CG  . PHE A 1 153 ? 24.852  25.638  1.354   1.00 20.59  ? 153 PHE A CG  1 
ATOM   1223 C  CD1 . PHE A 1 153 ? 24.326  25.034  2.479   1.00 20.72  ? 153 PHE A CD1 1 
ATOM   1224 C  CD2 . PHE A 1 153 ? 24.024  25.865  0.272   1.00 21.39  ? 153 PHE A CD2 1 
ATOM   1225 C  CE1 . PHE A 1 153 ? 23.002  24.657  2.519   1.00 23.17  ? 153 PHE A CE1 1 
ATOM   1226 C  CE2 . PHE A 1 153 ? 22.703  25.486  0.308   1.00 21.06  ? 153 PHE A CE2 1 
ATOM   1227 C  CZ  . PHE A 1 153 ? 22.193  24.883  1.429   1.00 19.42  ? 153 PHE A CZ  1 
ATOM   1228 N  N   . GLY A 1 154 ? 29.146  25.593  3.190   1.00 22.19  ? 154 GLY A N   1 
ATOM   1229 C  CA  . GLY A 1 154 ? 30.595  25.493  3.113   1.00 23.24  ? 154 GLY A CA  1 
ATOM   1230 C  C   . GLY A 1 154 ? 31.370  26.766  3.391   1.00 24.64  ? 154 GLY A C   1 
ATOM   1231 O  O   . GLY A 1 154 ? 32.335  27.066  2.675   1.00 22.63  ? 154 GLY A O   1 
ATOM   1232 N  N   . ALA A 1 155 ? 30.958  27.518  4.411   1.00 27.64  ? 155 ALA A N   1 
ATOM   1233 C  CA  . ALA A 1 155 ? 31.655  28.748  4.774   1.00 22.18  ? 155 ALA A CA  1 
ATOM   1234 C  C   . ALA A 1 155 ? 32.759  28.429  5.760   1.00 32.65  ? 155 ALA A C   1 
ATOM   1235 O  O   . ALA A 1 155 ? 33.627  29.265  6.051   1.00 39.11  ? 155 ALA A O   1 
ATOM   1236 C  CB  . ALA A 1 155 ? 30.693  29.739  5.388   1.00 14.65  ? 155 ALA A CB  1 
ATOM   1237 N  N   . THR A 1 156 ? 32.743  27.201  6.259   1.00 32.84  ? 156 THR A N   1 
ATOM   1238 C  CA  . THR A 1 156 ? 33.756  26.783  7.213   1.00 32.38  ? 156 THR A CA  1 
ATOM   1239 C  C   . THR A 1 156 ? 35.020  26.323  6.504   1.00 29.32  ? 156 THR A C   1 
ATOM   1240 O  O   . THR A 1 156 ? 34.972  25.469  5.619   1.00 26.55  ? 156 THR A O   1 
ATOM   1241 C  CB  . THR A 1 156 ? 33.259  25.666  8.152   1.00 43.08  ? 156 THR A CB  1 
ATOM   1242 O  OG1 . THR A 1 156 ? 33.116  26.194  9.477   1.00 73.81  ? 156 THR A OG1 1 
ATOM   1243 C  CG2 . THR A 1 156 ? 34.254  24.551  8.182   1.00 42.78  ? 156 THR A CG2 1 
ATOM   1244 N  N   . LYS A 1 157 ? 36.166  26.846  6.892   1.00 40.94  ? 157 LYS A N   1 
ATOM   1245 C  CA  . LYS A 1 157 ? 37.404  26.459  6.242   1.00 42.70  ? 157 LYS A CA  1 
ATOM   1246 C  C   . LYS A 1 157 ? 37.718  25.018  6.551   1.00 38.06  ? 157 LYS A C   1 
ATOM   1247 O  O   . LYS A 1 157 ? 38.553  24.411  5.901   1.00 23.95  ? 157 LYS A O   1 
ATOM   1248 C  CB  . LYS A 1 157 ? 38.545  27.347  6.711   1.00 32.72  ? 157 LYS A CB  1 
ATOM   1249 C  CG  . LYS A 1 157 ? 39.228  26.855  7.963   1.00 51.35  ? 157 LYS A CG  1 
ATOM   1250 C  CD  . LYS A 1 157 ? 40.390  27.759  8.322   1.00 73.97  ? 157 LYS A CD  1 
ATOM   1251 C  CE  . LYS A 1 157 ? 41.694  27.288  7.697   1.00 66.36  ? 157 LYS A CE  1 
ATOM   1252 N  NZ  . LYS A 1 157 ? 42.353  26.206  8.479   1.00 54.70  ? 157 LYS A NZ  1 
ATOM   1253 N  N   . GLU A 1 158 ? 36.935  24.492  7.480   1.00 39.09  ? 158 GLU A N   1 
ATOM   1254 C  CA  . GLU A 1 158 ? 37.080  23.165  8.036   1.00 41.77  ? 158 GLU A CA  1 
ATOM   1255 C  C   . GLU A 1 158 ? 36.379  22.153  7.175   1.00 25.58  ? 158 GLU A C   1 
ATOM   1256 O  O   . GLU A 1 158 ? 36.728  21.000  7.129   1.00 24.73  ? 158 GLU A O   1 
ATOM   1257 C  CB  . GLU A 1 158 ? 36.431  23.166  9.417   1.00 44.76  ? 158 GLU A CB  1 
ATOM   1258 C  CG  . GLU A 1 158 ? 37.142  22.340  10.465  1.00 74.40  ? 158 GLU A CG  1 
ATOM   1259 C  CD  . GLU A 1 158 ? 37.985  23.180  11.374  1.00 72.91  ? 158 GLU A CD  1 
ATOM   1260 O  OE1 . GLU A 1 158 ? 38.446  24.235  10.900  1.00 70.39  ? 158 GLU A OE1 1 
ATOM   1261 O  OE2 . GLU A 1 158 ? 38.178  22.790  12.545  1.00 70.65  ? 158 GLU A OE2 1 
ATOM   1262 N  N   . ALA A 1 159 ? 35.367  22.628  6.496   1.00 22.73  ? 159 ALA A N   1 
ATOM   1263 C  CA  . ALA A 1 159 ? 34.454  21.808  5.704   1.00 27.59  ? 159 ALA A CA  1 
ATOM   1264 C  C   . ALA A 1 159 ? 33.870  22.577  4.502   1.00 24.29  ? 159 ALA A C   1 
ATOM   1265 O  O   . ALA A 1 159 ? 32.655  22.794  4.401   1.00 20.18  ? 159 ALA A O   1 
ATOM   1266 C  CB  . ALA A 1 159 ? 33.334  21.255  6.595   1.00 31.30  ? 159 ALA A CB  1 
ATOM   1267 N  N   . PRO A 1 160 ? 34.744  22.974  3.574   1.00 20.00  ? 160 PRO A N   1 
ATOM   1268 C  CA  . PRO A 1 160 ? 34.373  23.797  2.428   1.00 18.46  ? 160 PRO A CA  1 
ATOM   1269 C  C   . PRO A 1 160 ? 33.567  22.993  1.430   1.00 17.39  ? 160 PRO A C   1 
ATOM   1270 O  O   . PRO A 1 160 ? 32.880  23.572  0.596   1.00 23.62  ? 160 PRO A O   1 
ATOM   1271 C  CB  . PRO A 1 160 ? 35.731  24.162  1.830   1.00 19.00  ? 160 PRO A CB  1 
ATOM   1272 C  CG  . PRO A 1 160 ? 36.592  22.994  2.158   1.00 16.88  ? 160 PRO A CG  1 
ATOM   1273 C  CD  . PRO A 1 160 ? 36.159  22.565  3.524   1.00 19.85  ? 160 PRO A CD  1 
ATOM   1274 N  N   . THR A 1 161 ? 33.631  21.674  1.550   1.00 16.69  ? 161 THR A N   1 
ATOM   1275 C  CA  . THR A 1 161 ? 33.114  20.781  0.536   1.00 13.45  ? 161 THR A CA  1 
ATOM   1276 C  C   . THR A 1 161 ? 32.525  19.513  1.170   1.00 12.83  ? 161 THR A C   1 
ATOM   1277 O  O   . THR A 1 161 ? 33.094  18.961  2.110   1.00 13.99  ? 161 THR A O   1 
ATOM   1278 C  CB  . THR A 1 161 ? 34.266  20.434  -0.438  1.00 11.78  ? 161 THR A CB  1 
ATOM   1279 O  OG1 . THR A 1 161 ? 33.839  19.435  -1.368  1.00 19.74  ? 161 THR A OG1 1 
ATOM   1280 C  CG2 . THR A 1 161 ? 35.494  19.953  0.332   1.00 14.34  ? 161 THR A CG2 1 
ATOM   1281 N  N   . LEU A 1 162 ? 31.388  19.066  0.647   1.00 11.47  ? 162 LEU A N   1 
ATOM   1282 C  CA  . LEU A 1 162 ? 30.724  17.875  1.162   1.00 13.79  ? 162 LEU A CA  1 
ATOM   1283 C  C   . LEU A 1 162 ? 31.571  16.627  0.933   1.00 11.93  ? 162 LEU A C   1 
ATOM   1284 O  O   . LEU A 1 162 ? 32.467  16.620  0.090   1.00 14.26  ? 162 LEU A O   1 
ATOM   1285 C  CB  . LEU A 1 162 ? 29.350  17.704  0.510   1.00 12.44  ? 162 LEU A CB  1 
ATOM   1286 C  CG  . LEU A 1 162 ? 28.161  18.297  1.268   1.00 6.49   ? 162 LEU A CG  1 
ATOM   1287 C  CD1 . LEU A 1 162 ? 26.881  18.153  0.460   1.00 8.37   ? 162 LEU A CD1 1 
ATOM   1288 C  CD2 . LEU A 1 162 ? 28.014  17.644  2.634   1.00 7.44   ? 162 LEU A CD2 1 
ATOM   1289 N  N   . PRO A 1 163 ? 31.280  15.574  1.690   1.00 12.75  ? 163 PRO A N   1 
ATOM   1290 C  CA  . PRO A 1 163 ? 32.018  14.313  1.571   1.00 21.77  ? 163 PRO A CA  1 
ATOM   1291 C  C   . PRO A 1 163 ? 32.222  13.912  0.114   1.00 23.69  ? 163 PRO A C   1 
ATOM   1292 O  O   . PRO A 1 163 ? 31.538  14.429  -0.769  1.00 23.24  ? 163 PRO A O   1 
ATOM   1293 C  CB  . PRO A 1 163 ? 31.100  13.308  2.269   1.00 16.36  ? 163 PRO A CB  1 
ATOM   1294 C  CG  . PRO A 1 163 ? 29.733  13.876  2.098   1.00 10.51  ? 163 PRO A CG  1 
ATOM   1295 C  CD  . PRO A 1 163 ? 29.899  15.368  2.159   1.00 11.93  ? 163 PRO A CD  1 
ATOM   1296 N  N   . THR A 1 164 ? 33.155  12.997  -0.128  1.00 19.55  ? 164 THR A N   1 
ATOM   1297 C  CA  . THR A 1 164 ? 33.442  12.535  -1.481  1.00 21.85  ? 164 THR A CA  1 
ATOM   1298 C  C   . THR A 1 164 ? 32.851  11.151  -1.728  1.00 19.25  ? 164 THR A C   1 
ATOM   1299 O  O   . THR A 1 164 ? 33.147  10.201  -1.003  1.00 21.38  ? 164 THR A O   1 
ATOM   1300 C  CB  . THR A 1 164 ? 34.957  12.493  -1.754  1.00 34.09  ? 164 THR A CB  1 
ATOM   1301 O  OG1 . THR A 1 164 ? 35.668  12.448  -0.511  1.00 28.98  ? 164 THR A OG1 1 
ATOM   1302 C  CG2 . THR A 1 164 ? 35.391  13.722  -2.538  1.00 37.17  ? 164 THR A CG2 1 
ATOM   1303 N  N   . ARG A 1 165 ? 32.016  11.044  -2.756  0.50 14.09  ? 165 ARG A N   1 
ATOM   1304 C  CA  . ARG A 1 165 ? 31.390  9.787   -3.099  0.50 17.88  ? 165 ARG A CA  1 
ATOM   1305 C  C   . ARG A 1 165 ? 32.422  8.687   -3.194  0.50 19.32  ? 165 ARG A C   1 
ATOM   1306 O  O   . ARG A 1 165 ? 32.072  7.522   -3.293  0.50 20.39  ? 165 ARG A O   1 
ATOM   1307 C  CB  . ARG A 1 165 ? 30.699  9.890   -4.446  0.50 16.68  ? 165 ARG A CB  1 
ATOM   1308 C  CG  . ARG A 1 165 ? 31.142  8.780   -5.374  0.50 23.70  ? 165 ARG A CG  1 
ATOM   1309 C  CD  . ARG A 1 165 ? 30.171  8.568   -6.511  0.50 27.02  ? 165 ARG A CD  1 
ATOM   1310 N  NE  . ARG A 1 165 ? 29.953  7.146   -6.750  0.50 34.73  ? 165 ARG A NE  1 
ATOM   1311 C  CZ  . ARG A 1 165 ? 30.899  6.262   -7.063  0.50 32.07  ? 165 ARG A CZ  1 
ATOM   1312 N  NH1 . ARG A 1 165 ? 32.164  6.640   -7.200  0.50 35.35  ? 165 ARG A NH1 1 
ATOM   1313 N  NH2 . ARG A 1 165 ? 30.567  4.987   -7.241  0.50 23.29  ? 165 ARG A NH2 1 
ATOM   1314 N  N   . ASP A 1 166 ? 33.690  9.066   -3.198  1.00 13.87  ? 166 ASP A N   1 
ATOM   1315 C  CA  . ASP A 1 166 ? 34.769  8.110   -3.267  1.00 22.17  ? 166 ASP A CA  1 
ATOM   1316 C  C   . ASP A 1 166 ? 35.254  7.878   -1.864  1.00 28.93  ? 166 ASP A C   1 
ATOM   1317 O  O   . ASP A 1 166 ? 35.949  6.936   -1.601  1.00 28.91  ? 166 ASP A O   1 
ATOM   1318 C  CB  . ASP A 1 166 ? 35.891  8.641   -4.153  1.00 42.15  ? 166 ASP A CB  1 
ATOM   1319 C  CG  . ASP A 1 166 ? 36.697  7.535   -4.838  1.00 53.48  ? 166 ASP A CG  1 
ATOM   1320 O  OD1 . ASP A 1 166 ? 37.816  7.812   -5.305  1.00 50.28  ? 166 ASP A OD1 1 
ATOM   1321 O  OD2 . ASP A 1 166 ? 36.225  6.389   -4.916  1.00 47.16  ? 166 ASP A OD2 1 
ATOM   1322 N  N   . ASP A 1 167 ? 34.866  8.749   -0.950  1.00 31.47  ? 167 ASP A N   1 
ATOM   1323 C  CA  . ASP A 1 167 ? 35.130  8.550   0.462   1.00 26.02  ? 167 ASP A CA  1 
ATOM   1324 C  C   . ASP A 1 167 ? 34.205  7.470   0.903   1.00 16.49  ? 167 ASP A C   1 
ATOM   1325 O  O   . ASP A 1 167 ? 34.599  6.420   1.346   1.00 19.52  ? 167 ASP A O   1 
ATOM   1326 C  CB  . ASP A 1 167 ? 34.737  9.793   1.228   1.00 28.61  ? 167 ASP A CB  1 
ATOM   1327 C  CG  . ASP A 1 167 ? 35.911  10.618  1.635   1.00 33.63  ? 167 ASP A CG  1 
ATOM   1328 O  OD1 . ASP A 1 167 ? 37.020  10.072  1.759   1.00 38.02  ? 167 ASP A OD1 1 
ATOM   1329 O  OD2 . ASP A 1 167 ? 35.711  11.821  1.844   1.00 28.73  ? 167 ASP A OD2 1 
ATOM   1330 N  N   . VAL A 1 168 ? 32.934  7.733   0.762   1.00 13.08  ? 168 VAL A N   1 
ATOM   1331 C  CA  . VAL A 1 168 ? 31.950  6.735   1.156   1.00 16.03  ? 168 VAL A CA  1 
ATOM   1332 C  C   . VAL A 1 168 ? 32.483  5.319   0.948   1.00 16.99  ? 168 VAL A C   1 
ATOM   1333 O  O   . VAL A 1 168 ? 32.659  4.583   1.919   1.00 16.26  ? 168 VAL A O   1 
ATOM   1334 C  CB  . VAL A 1 168 ? 30.622  6.908   0.413   1.00 12.63  ? 168 VAL A CB  1 
ATOM   1335 C  CG1 . VAL A 1 168 ? 29.617  5.925   0.950   1.00 15.38  ? 168 VAL A CG1 1 
ATOM   1336 C  CG2 . VAL A 1 168 ? 30.113  8.315   0.598   1.00 13.66  ? 168 VAL A CG2 1 
ATOM   1337 N  N   . LEU A 1 169 ? 32.756  4.936   -0.299  1.00 17.58  ? 169 LEU A N   1 
ATOM   1338 C  CA  . LEU A 1 169 ? 33.370  3.633   -0.560  1.00 20.51  ? 169 LEU A CA  1 
ATOM   1339 C  C   . LEU A 1 169 ? 34.436  3.263   0.493   1.00 21.15  ? 169 LEU A C   1 
ATOM   1340 O  O   . LEU A 1 169 ? 34.401  2.183   1.082   1.00 19.64  ? 169 LEU A O   1 
ATOM   1341 C  CB  . LEU A 1 169 ? 33.974  3.599   -1.966  1.00 28.22  ? 169 LEU A CB  1 
ATOM   1342 C  CG  . LEU A 1 169 ? 33.024  3.140   -3.066  1.00 27.16  ? 169 LEU A CG  1 
ATOM   1343 C  CD1 . LEU A 1 169 ? 31.668  3.745   -2.828  1.00 28.60  ? 169 LEU A CD1 1 
ATOM   1344 C  CD2 . LEU A 1 169 ? 33.578  3.539   -4.415  1.00 39.93  ? 169 LEU A CD2 1 
ATOM   1345 N  N   . ASN A 1 170 ? 35.381  4.162   0.737   1.00 18.69  ? 170 ASN A N   1 
ATOM   1346 C  CA  . ASN A 1 170 ? 36.456  3.841   1.655   1.00 15.55  ? 170 ASN A CA  1 
ATOM   1347 C  C   . ASN A 1 170 ? 35.935  3.394   3.012   1.00 14.62  ? 170 ASN A C   1 
ATOM   1348 O  O   . ASN A 1 170 ? 36.369  2.382   3.553   1.00 17.84  ? 170 ASN A O   1 
ATOM   1349 C  CB  . ASN A 1 170 ? 37.445  4.995   1.757   1.00 16.24  ? 170 ASN A CB  1 
ATOM   1350 C  CG  . ASN A 1 170 ? 38.277  5.144   0.498   1.00 27.89  ? 170 ASN A CG  1 
ATOM   1351 O  OD1 . ASN A 1 170 ? 38.767  4.156   -0.058  1.00 41.17  ? 170 ASN A OD1 1 
ATOM   1352 N  ND2 . ASN A 1 170 ? 38.434  6.377   0.034   1.00 33.59  ? 170 ASN A ND2 1 
ATOM   1353 N  N   . ALA A 1 171 ? 34.972  4.131   3.544   1.00 16.81  ? 171 ALA A N   1 
ATOM   1354 C  CA  . ALA A 1 171 ? 34.365  3.787   4.824   1.00 15.10  ? 171 ALA A CA  1 
ATOM   1355 C  C   . ALA A 1 171 ? 33.601  2.452   4.804   1.00 15.62  ? 171 ALA A C   1 
ATOM   1356 O  O   . ALA A 1 171 ? 33.457  1.801   5.836   1.00 15.50  ? 171 ALA A O   1 
ATOM   1357 C  CB  . ALA A 1 171 ? 33.450  4.917   5.279   1.00 14.76  ? 171 ALA A CB  1 
ATOM   1358 N  N   . LEU A 1 172 ? 33.115  2.044   3.634   1.00 16.49  ? 172 LEU A N   1 
ATOM   1359 C  CA  . LEU A 1 172 ? 32.409  0.769   3.513   1.00 13.19  ? 172 LEU A CA  1 
ATOM   1360 C  C   . LEU A 1 172 ? 33.378  -0.387  3.461   1.00 14.78  ? 172 LEU A C   1 
ATOM   1361 O  O   . LEU A 1 172 ? 32.955  -1.529  3.455   1.00 14.20  ? 172 LEU A O   1 
ATOM   1362 C  CB  . LEU A 1 172 ? 31.542  0.722   2.253   1.00 11.90  ? 172 LEU A CB  1 
ATOM   1363 C  CG  . LEU A 1 172 ? 30.206  1.457   2.247   1.00 6.93   ? 172 LEU A CG  1 
ATOM   1364 C  CD1 . LEU A 1 172 ? 29.727  1.582   0.845   1.00 6.44   ? 172 LEU A CD1 1 
ATOM   1365 C  CD2 . LEU A 1 172 ? 29.194  0.727   3.085   1.00 5.06   ? 172 LEU A CD2 1 
ATOM   1366 N  N   . LYS A 1 173 ? 34.673  -0.100  3.390   1.00 18.45  ? 173 LYS A N   1 
ATOM   1367 C  CA  . LYS A 1 173 ? 35.657  -1.173  3.302   1.00 20.53  ? 173 LYS A CA  1 
ATOM   1368 C  C   . LYS A 1 173 ? 35.990  -1.668  4.704   1.00 21.67  ? 173 LYS A C   1 
ATOM   1369 O  O   . LYS A 1 173 ? 36.310  -2.844  4.905   1.00 21.24  ? 173 LYS A O   1 
ATOM   1370 C  CB  . LYS A 1 173 ? 36.915  -0.720  2.540   1.00 22.59  ? 173 LYS A CB  1 
ATOM   1371 C  CG  . LYS A 1 173 ? 36.728  -0.523  1.025   1.00 20.02  ? 173 LYS A CG  1 
ATOM   1372 C  CD  . LYS A 1 173 ? 37.949  0.151   0.401   1.00 22.66  ? 173 LYS A CD  1 
ATOM   1373 C  CE  . LYS A 1 173 ? 37.674  0.588   -1.034  1.00 49.53  ? 173 LYS A CE  1 
ATOM   1374 N  NZ  . LYS A 1 173 ? 38.784  1.409   -1.617  1.00 60.76  ? 173 LYS A NZ  1 
ATOM   1375 N  N   . ILE A 1 174 ? 35.881  -0.758  5.671   1.00 19.71  ? 174 ILE A N   1 
ATOM   1376 C  CA  . ILE A 1 174 ? 36.184  -1.052  7.073   1.00 24.94  ? 174 ILE A CA  1 
ATOM   1377 C  C   . ILE A 1 174 ? 35.547  -2.370  7.503   1.00 24.24  ? 174 ILE A C   1 
ATOM   1378 O  O   . ILE A 1 174 ? 34.373  -2.603  7.256   1.00 22.57  ? 174 ILE A O   1 
ATOM   1379 C  CB  . ILE A 1 174 ? 35.686  0.084   8.020   1.00 20.80  ? 174 ILE A CB  1 
ATOM   1380 C  CG1 . ILE A 1 174 ? 36.127  1.469   7.507   1.00 19.75  ? 174 ILE A CG1 1 
ATOM   1381 C  CG2 . ILE A 1 174 ? 36.116  -0.180  9.464   1.00 23.93  ? 174 ILE A CG2 1 
ATOM   1382 C  CD1 . ILE A 1 174 ? 37.627  1.611   7.198   1.00 25.88  ? 174 ILE A CD1 1 
ATOM   1383 N  N   . THR A 1 175 ? 36.320  -3.236  8.139   1.00 29.27  ? 175 THR A N   1 
ATOM   1384 C  CA  . THR A 1 175 ? 35.809  -4.539  8.547   1.00 28.59  ? 175 THR A CA  1 
ATOM   1385 C  C   . THR A 1 175 ? 34.950  -4.491  9.832   1.00 37.28  ? 175 THR A C   1 
ATOM   1386 O  O   . THR A 1 175 ? 33.919  -5.157  9.924   1.00 33.62  ? 175 THR A O   1 
ATOM   1387 C  CB  . THR A 1 175 ? 36.972  -5.545  8.717   1.00 32.93  ? 175 THR A CB  1 
ATOM   1388 O  OG1 . THR A 1 175 ? 37.717  -5.628  7.496   1.00 47.10  ? 175 THR A OG1 1 
ATOM   1389 C  CG2 . THR A 1 175 ? 36.452  -6.932  9.078   1.00 27.24  ? 175 THR A CG2 1 
ATOM   1390 N  N   . GLN A 1 176 ? 35.382  -3.685  10.807  1.00 43.66  ? 176 GLN A N   1 
ATOM   1391 C  CA  . GLN A 1 176 ? 34.753  -3.609  12.137  1.00 29.13  ? 176 GLN A CA  1 
ATOM   1392 C  C   . GLN A 1 176 ? 33.750  -2.494  12.248  1.00 23.07  ? 176 GLN A C   1 
ATOM   1393 O  O   . GLN A 1 176 ? 34.051  -1.340  11.936  1.00 19.37  ? 176 GLN A O   1 
ATOM   1394 C  CB  . GLN A 1 176 ? 35.792  -3.386  13.245  1.00 31.66  ? 176 GLN A CB  1 
ATOM   1395 C  CG  . GLN A 1 176 ? 36.837  -4.481  13.375  1.00 35.54  ? 176 GLN A CG  1 
ATOM   1396 C  CD  . GLN A 1 176 ? 36.260  -5.788  13.895  1.00 44.56  ? 176 GLN A CD  1 
ATOM   1397 O  OE1 . GLN A 1 176 ? 35.947  -6.700  13.123  1.00 34.51  ? 176 GLN A OE1 1 
ATOM   1398 N  NE2 . GLN A 1 176 ? 36.132  -5.890  15.214  1.00 51.61  ? 176 GLN A NE2 1 
ATOM   1399 N  N   . TYR A 1 177 ? 32.565  -2.849  12.728  1.00 24.58  ? 177 TYR A N   1 
ATOM   1400 C  CA  . TYR A 1 177 ? 31.564  -1.860  13.044  1.00 21.04  ? 177 TYR A CA  1 
ATOM   1401 C  C   . TYR A 1 177 ? 32.134  -0.794  13.987  1.00 19.41  ? 177 TYR A C   1 
ATOM   1402 O  O   . TYR A 1 177 ? 31.955  0.402   13.766  1.00 17.13  ? 177 TYR A O   1 
ATOM   1403 C  CB  . TYR A 1 177 ? 30.350  -2.513  13.695  1.00 14.05  ? 177 TYR A CB  1 
ATOM   1404 C  CG  . TYR A 1 177 ? 29.379  -1.461  14.109  1.00 18.13  ? 177 TYR A CG  1 
ATOM   1405 C  CD1 . TYR A 1 177 ? 28.327  -1.088  13.275  1.00 19.94  ? 177 TYR A CD1 1 
ATOM   1406 C  CD2 . TYR A 1 177 ? 29.554  -0.783  15.307  1.00 18.44  ? 177 TYR A CD2 1 
ATOM   1407 C  CE1 . TYR A 1 177 ? 27.462  -0.092  13.644  1.00 16.14  ? 177 TYR A CE1 1 
ATOM   1408 C  CE2 . TYR A 1 177 ? 28.708  0.212   15.679  1.00 17.69  ? 177 TYR A CE2 1 
ATOM   1409 C  CZ  . TYR A 1 177 ? 27.662  0.554   14.846  1.00 16.06  ? 177 TYR A CZ  1 
ATOM   1410 O  OH  . TYR A 1 177 ? 26.803  1.552   15.218  1.00 11.84  ? 177 TYR A OH  1 
ATOM   1411 N  N   . ASP A 1 178 ? 32.783  -1.227  15.061  1.00 18.37  ? 178 ASP A N   1 
ATOM   1412 C  CA  . ASP A 1 178 ? 33.394  -0.282  15.980  1.00 17.47  ? 178 ASP A CA  1 
ATOM   1413 C  C   . ASP A 1 178 ? 34.489  -0.955  16.788  1.00 17.67  ? 178 ASP A C   1 
ATOM   1414 O  O   . ASP A 1 178 ? 34.577  -2.181  16.873  1.00 17.63  ? 178 ASP A O   1 
ATOM   1415 C  CB  . ASP A 1 178 ? 32.347  0.356   16.897  1.00 15.02  ? 178 ASP A CB  1 
ATOM   1416 C  CG  . ASP A 1 178 ? 32.667  1.808   17.237  1.00 16.22  ? 178 ASP A CG  1 
ATOM   1417 O  OD1 . ASP A 1 178 ? 33.807  2.258   16.991  1.00 12.98  ? 178 ASP A OD1 1 
ATOM   1418 O  OD2 . ASP A 1 178 ? 31.770  2.497   17.769  1.00 18.08  ? 178 ASP A OD2 1 
ATOM   1419 N  N   . THR A 1 179 ? 35.236  -0.136  17.511  1.00 16.44  ? 179 THR A N   1 
ATOM   1420 C  CA  . THR A 1 179 ? 36.254  -0.683  18.352  1.00 14.80  ? 179 THR A CA  1 
ATOM   1421 C  C   . THR A 1 179 ? 36.672  0.173   19.531  1.00 17.28  ? 179 THR A C   1 
ATOM   1422 O  O   . THR A 1 179 ? 36.647  1.380   19.469  1.00 16.01  ? 179 THR A O   1 
ATOM   1423 C  CB  . THR A 1 179 ? 37.439  -1.017  17.490  1.00 14.33  ? 179 THR A CB  1 
ATOM   1424 O  OG1 . THR A 1 179 ? 37.731  0.104   16.658  1.00 13.03  ? 179 THR A OG1 1 
ATOM   1425 C  CG2 . THR A 1 179 ? 37.057  -2.162  16.628  1.00 18.12  ? 179 THR A CG2 1 
ATOM   1426 N  N   . PRO A 1 180 ? 37.047  -0.491  20.614  1.00 16.42  ? 180 PRO A N   1 
ATOM   1427 C  CA  . PRO A 1 180 ? 37.594  0.150   21.801  1.00 18.00  ? 180 PRO A CA  1 
ATOM   1428 C  C   . PRO A 1 180 ? 38.297  1.435   21.478  1.00 17.80  ? 180 PRO A C   1 
ATOM   1429 O  O   . PRO A 1 180 ? 38.973  1.452   20.481  1.00 13.26  ? 180 PRO A O   1 
ATOM   1430 C  CB  . PRO A 1 180 ? 38.632  -0.869  22.243  1.00 20.04  ? 180 PRO A CB  1 
ATOM   1431 C  CG  . PRO A 1 180 ? 38.046  -2.178  21.856  1.00 18.97  ? 180 PRO A CG  1 
ATOM   1432 C  CD  . PRO A 1 180 ? 37.050  -1.950  20.758  1.00 15.01  ? 180 PRO A CD  1 
ATOM   1433 N  N   . PRO A 1 181 ? 38.220  2.456   22.316  1.00 18.04  ? 181 PRO A N   1 
ATOM   1434 C  CA  . PRO A 1 181 ? 37.291  2.578   23.452  1.00 19.04  ? 181 PRO A CA  1 
ATOM   1435 C  C   . PRO A 1 181 ? 35.862  3.018   23.072  1.00 19.62  ? 181 PRO A C   1 
ATOM   1436 O  O   . PRO A 1 181 ? 35.122  3.529   23.929  1.00 19.57  ? 181 PRO A O   1 
ATOM   1437 C  CB  . PRO A 1 181 ? 37.972  3.615   24.341  1.00 21.71  ? 181 PRO A CB  1 
ATOM   1438 C  CG  . PRO A 1 181 ? 38.793  4.459   23.385  1.00 22.48  ? 181 PRO A CG  1 
ATOM   1439 C  CD  . PRO A 1 181 ? 39.241  3.517   22.291  1.00 15.14  ? 181 PRO A CD  1 
ATOM   1440 N  N   . TRP A 1 182 ? 35.459  2.837   21.824  1.00 18.75  ? 182 TRP A N   1 
ATOM   1441 C  CA  . TRP A 1 182 ? 34.115  3.176   21.423  1.00 12.18  ? 182 TRP A CA  1 
ATOM   1442 C  C   . TRP A 1 182 ? 33.842  4.607   21.562  1.00 10.76  ? 182 TRP A C   1 
ATOM   1443 O  O   . TRP A 1 182 ? 32.809  4.970   22.121  1.00 12.63  ? 182 TRP A O   1 
ATOM   1444 C  CB  . TRP A 1 182 ? 33.124  2.448   22.275  1.00 11.52  ? 182 TRP A CB  1 
ATOM   1445 C  CG  . TRP A 1 182 ? 33.733  1.243   22.893  1.00 13.71  ? 182 TRP A CG  1 
ATOM   1446 C  CD1 . TRP A 1 182 ? 34.455  1.177   24.061  1.00 17.44  ? 182 TRP A CD1 1 
ATOM   1447 C  CD2 . TRP A 1 182 ? 33.722  -0.117  22.374  1.00 14.48  ? 182 TRP A CD2 1 
ATOM   1448 N  NE1 . TRP A 1 182 ? 34.871  -0.098  24.298  1.00 21.30  ? 182 TRP A NE1 1 
ATOM   1449 C  CE2 . TRP A 1 182 ? 34.462  -0.919  23.319  1.00 19.06  ? 182 TRP A CE2 1 
ATOM   1450 C  CE3 . TRP A 1 182 ? 33.193  -0.719  21.264  1.00 18.52  ? 182 TRP A CE3 1 
ATOM   1451 C  CZ2 . TRP A 1 182 ? 34.649  -2.268  23.142  1.00 19.05  ? 182 TRP A CZ2 1 
ATOM   1452 C  CZ3 . TRP A 1 182 ? 33.381  -2.082  21.093  1.00 25.53  ? 182 TRP A CZ3 1 
ATOM   1453 C  CH2 . TRP A 1 182 ? 34.098  -2.836  22.006  1.00 23.22  ? 182 TRP A CH2 1 
ATOM   1454 N  N   . ASP A 1 183 ? 34.720  5.443   21.033  1.00 9.58   ? 183 ASP A N   1 
ATOM   1455 C  CA  . ASP A 1 183 ? 34.529  6.881   21.114  1.00 12.05  ? 183 ASP A CA  1 
ATOM   1456 C  C   . ASP A 1 183 ? 35.223  7.566   19.953  1.00 8.14   ? 183 ASP A C   1 
ATOM   1457 O  O   . ASP A 1 183 ? 35.563  6.918   18.974  1.00 10.03  ? 183 ASP A O   1 
ATOM   1458 C  CB  . ASP A 1 183 ? 35.106  7.411   22.414  1.00 19.43  ? 183 ASP A CB  1 
ATOM   1459 C  CG  . ASP A 1 183 ? 36.472  6.823   22.740  1.00 18.71  ? 183 ASP A CG  1 
ATOM   1460 O  OD1 . ASP A 1 183 ? 36.973  7.067   23.862  1.00 23.28  ? 183 ASP A OD1 1 
ATOM   1461 O  OD2 . ASP A 1 183 ? 37.008  6.114   21.884  1.00 11.55  ? 183 ASP A OD2 1 
ATOM   1462 N  N   . MET A 1 184 ? 35.427  8.868   20.044  1.00 5.04   ? 184 MET A N   1 
ATOM   1463 C  CA  . MET A 1 184 ? 35.998  9.634   18.961  1.00 7.46   ? 184 MET A CA  1 
ATOM   1464 C  C   . MET A 1 184 ? 37.257  9.064   18.411  1.00 9.38   ? 184 MET A C   1 
ATOM   1465 O  O   . MET A 1 184 ? 37.539  9.224   17.237  1.00 6.30   ? 184 MET A O   1 
ATOM   1466 C  CB  . MET A 1 184 ? 36.337  11.025  19.435  1.00 15.80  ? 184 MET A CB  1 
ATOM   1467 C  CG  . MET A 1 184 ? 35.651  11.452  20.695  1.00 20.93  ? 184 MET A CG  1 
ATOM   1468 S  SD  . MET A 1 184 ? 35.776  13.221  20.665  1.00 28.93  ? 184 MET A SD  1 
ATOM   1469 C  CE  . MET A 1 184 ? 36.519  13.424  19.064  1.00 27.08  ? 184 MET A CE  1 
ATOM   1470 N  N   . THR A 1 185 ? 38.050  8.447   19.275  1.00 16.84  ? 185 THR A N   1 
ATOM   1471 C  CA  . THR A 1 185 ? 39.394  8.014   18.906  1.00 17.46  ? 185 THR A CA  1 
ATOM   1472 C  C   . THR A 1 185 ? 39.458  6.578   18.365  1.00 16.13  ? 185 THR A C   1 
ATOM   1473 O  O   . THR A 1 185 ? 40.526  6.122   17.953  1.00 15.88  ? 185 THR A O   1 
ATOM   1474 C  CB  . THR A 1 185 ? 40.381  8.144   20.097  1.00 10.40  ? 185 THR A CB  1 
ATOM   1475 O  OG1 . THR A 1 185 ? 40.050  7.188   21.104  1.00 8.03   ? 185 THR A OG1 1 
ATOM   1476 C  CG2 . THR A 1 185 ? 40.321  9.516   20.709  1.00 10.04  ? 185 THR A CG2 1 
ATOM   1477 N  N   . SER A 1 186 ? 38.322  5.877   18.374  1.00 14.13  ? 186 SER A N   1 
ATOM   1478 C  CA  . SER A 1 186 ? 38.235  4.514   17.854  1.00 12.57  ? 186 SER A CA  1 
ATOM   1479 C  C   . SER A 1 186 ? 39.008  4.424   16.558  1.00 19.50  ? 186 SER A C   1 
ATOM   1480 O  O   . SER A 1 186 ? 38.808  5.261   15.683  1.00 19.84  ? 186 SER A O   1 
ATOM   1481 C  CB  . SER A 1 186 ? 36.779  4.151   17.561  1.00 9.80   ? 186 SER A CB  1 
ATOM   1482 O  OG  . SER A 1 186 ? 36.025  4.054   18.752  1.00 15.19  ? 186 SER A OG  1 
ATOM   1483 N  N   . GLN A 1 187 ? 39.855  3.425   16.375  1.00 21.74  ? 187 GLN A N   1 
ATOM   1484 C  CA  . GLN A 1 187 ? 40.509  3.296   15.087  1.00 17.89  ? 187 GLN A CA  1 
ATOM   1485 C  C   . GLN A 1 187 ? 39.924  2.140   14.296  1.00 17.12  ? 187 GLN A C   1 
ATOM   1486 O  O   . GLN A 1 187 ? 39.397  1.199   14.867  1.00 17.95  ? 187 GLN A O   1 
ATOM   1487 C  CB  . GLN A 1 187 ? 42.023  3.181   15.240  1.00 19.85  ? 187 GLN A CB  1 
ATOM   1488 C  CG  . GLN A 1 187 ? 42.705  4.512   15.526  1.00 30.24  ? 187 GLN A CG  1 
ATOM   1489 C  CD  . GLN A 1 187 ? 43.760  4.884   14.503  1.00 45.44  ? 187 GLN A CD  1 
ATOM   1490 O  OE1 . GLN A 1 187 ? 43.549  5.738   13.644  1.00 44.07  ? 187 GLN A OE1 1 
ATOM   1491 N  NE2 . GLN A 1 187 ? 44.907  4.252   14.602  1.00 24.07  ? 187 GLN A NE2 1 
ATOM   1492 N  N   . ASN A 1 188 ? 39.992  2.244   12.973  1.00 18.76  ? 188 ASN A N   1 
ATOM   1493 C  CA  . ASN A 1 188 ? 39.499  1.216   12.050  1.00 28.36  ? 188 ASN A CA  1 
ATOM   1494 C  C   . ASN A 1 188 ? 38.086  0.759   12.336  1.00 24.46  ? 188 ASN A C   1 
ATOM   1495 O  O   . ASN A 1 188 ? 37.763  -0.433  12.250  1.00 17.67  ? 188 ASN A O   1 
ATOM   1496 C  CB  . ASN A 1 188 ? 40.439  0.021   12.045  1.00 31.25  ? 188 ASN A CB  1 
ATOM   1497 C  CG  . ASN A 1 188 ? 41.636  0.246   11.165  1.00 40.97  ? 188 ASN A CG  1 
ATOM   1498 O  OD1 . ASN A 1 188 ? 42.446  1.140   11.413  1.00 28.44  ? 188 ASN A OD1 1 
ATOM   1499 N  ND2 . ASN A 1 188 ? 41.755  -0.561  10.117  1.00 78.20  ? 188 ASN A ND2 1 
ATOM   1500 N  N   . SER A 1 189 ? 37.256  1.734   12.678  1.00 21.66  ? 189 SER A N   1 
ATOM   1501 C  CA  . SER A 1 189 ? 35.873  1.488   13.003  1.00 17.89  ? 189 SER A CA  1 
ATOM   1502 C  C   . SER A 1 189 ? 35.011  2.097   11.925  1.00 14.05  ? 189 SER A C   1 
ATOM   1503 O  O   . SER A 1 189 ? 35.150  3.269   11.580  1.00 10.57  ? 189 SER A O   1 
ATOM   1504 C  CB  . SER A 1 189 ? 35.541  2.085   14.370  1.00 15.39  ? 189 SER A CB  1 
ATOM   1505 O  OG  . SER A 1 189 ? 34.173  1.941   14.684  1.00 14.45  ? 189 SER A OG  1 
ATOM   1506 N  N   . PHE A 1 190 ? 34.128  1.278   11.379  1.00 15.20  ? 190 PHE A N   1 
ATOM   1507 C  CA  . PHE A 1 190 ? 33.143  1.770   10.451  1.00 11.99  ? 190 PHE A CA  1 
ATOM   1508 C  C   . PHE A 1 190 ? 32.364  2.907   11.097  1.00 8.97   ? 190 PHE A C   1 
ATOM   1509 O  O   . PHE A 1 190 ? 32.145  3.934   10.481  1.00 9.41   ? 190 PHE A O   1 
ATOM   1510 C  CB  . PHE A 1 190 ? 32.178  0.656   10.077  1.00 13.55  ? 190 PHE A CB  1 
ATOM   1511 C  CG  . PHE A 1 190 ? 31.017  1.132   9.310   1.00 10.84  ? 190 PHE A CG  1 
ATOM   1512 C  CD1 . PHE A 1 190 ? 31.189  1.620   8.038   1.00 12.01  ? 190 PHE A CD1 1 
ATOM   1513 C  CD2 . PHE A 1 190 ? 29.758  1.131   9.866   1.00 11.15  ? 190 PHE A CD2 1 
ATOM   1514 C  CE1 . PHE A 1 190 ? 30.125  2.086   7.325   1.00 11.31  ? 190 PHE A CE1 1 
ATOM   1515 C  CE2 . PHE A 1 190 ? 28.688  1.591   9.165   1.00 12.78  ? 190 PHE A CE2 1 
ATOM   1516 C  CZ  . PHE A 1 190 ? 28.866  2.072   7.892   1.00 11.08  ? 190 PHE A CZ  1 
ATOM   1517 N  N   . ARG A 1 191 ? 31.949  2.718   12.345  1.00 10.05  ? 191 ARG A N   1 
ATOM   1518 C  CA  . ARG A 1 191 ? 31.045  3.662   12.994  1.00 9.53   ? 191 ARG A CA  1 
ATOM   1519 C  C   . ARG A 1 191 ? 31.696  5.006   13.207  1.00 6.69   ? 191 ARG A C   1 
ATOM   1520 O  O   . ARG A 1 191 ? 31.032  6.029   13.158  1.00 5.37   ? 191 ARG A O   1 
ATOM   1521 C  CB  . ARG A 1 191 ? 30.542  3.116   14.331  1.00 13.14  ? 191 ARG A CB  1 
ATOM   1522 C  CG  . ARG A 1 191 ? 29.551  4.028   15.053  1.00 11.82  ? 191 ARG A CG  1 
ATOM   1523 C  CD  . ARG A 1 191 ? 30.240  5.183   15.768  1.00 11.15  ? 191 ARG A CD  1 
ATOM   1524 N  NE  . ARG A 1 191 ? 31.421  4.718   16.492  1.00 10.78  ? 191 ARG A NE  1 
ATOM   1525 C  CZ  . ARG A 1 191 ? 32.350  5.517   17.003  1.00 11.16  ? 191 ARG A CZ  1 
ATOM   1526 N  NH1 . ARG A 1 191 ? 32.245  6.831   16.870  1.00 12.52  ? 191 ARG A NH1 1 
ATOM   1527 N  NH2 . ARG A 1 191 ? 33.391  5.000   17.634  1.00 11.90  ? 191 ARG A NH2 1 
ATOM   1528 N  N   . ASN A 1 192 ? 32.992  5.008   13.471  1.00 8.92   ? 192 ASN A N   1 
ATOM   1529 C  CA  . ASN A 1 192 ? 33.656  6.264   13.757  1.00 9.41   ? 192 ASN A CA  1 
ATOM   1530 C  C   . ASN A 1 192 ? 33.971  6.982   12.469  1.00 13.19  ? 192 ASN A C   1 
ATOM   1531 O  O   . ASN A 1 192 ? 33.835  8.202   12.364  1.00 14.50  ? 192 ASN A O   1 
ATOM   1532 C  CB  . ASN A 1 192 ? 34.925  6.062   14.566  1.00 9.92   ? 192 ASN A CB  1 
ATOM   1533 C  CG  . ASN A 1 192 ? 35.378  7.342   15.215  1.00 14.81  ? 192 ASN A CG  1 
ATOM   1534 O  OD1 . ASN A 1 192 ? 34.549  8.168   15.593  1.00 16.69  ? 192 ASN A OD1 1 
ATOM   1535 N  ND2 . ASN A 1 192 ? 36.687  7.532   15.334  1.00 16.53  ? 192 ASN A ND2 1 
ATOM   1536 N  N   . GLN A 1 193 ? 34.381  6.251   11.450  1.00 17.15  ? 193 GLN A N   1 
ATOM   1537 C  CA  . GLN A 1 193 ? 34.608  6.891   10.168  1.00 11.70  ? 193 GLN A CA  1 
ATOM   1538 C  C   . GLN A 1 193 ? 33.303  7.477   9.648   1.00 13.24  ? 193 GLN A C   1 
ATOM   1539 O  O   . GLN A 1 193 ? 33.206  8.680   9.469   1.00 16.45  ? 193 GLN A O   1 
ATOM   1540 C  CB  . GLN A 1 193 ? 35.215  5.923   9.180   1.00 13.54  ? 193 GLN A CB  1 
ATOM   1541 C  CG  . GLN A 1 193 ? 36.706  6.096   9.045   1.00 23.03  ? 193 GLN A CG  1 
ATOM   1542 C  CD  . GLN A 1 193 ? 37.252  5.492   7.771   1.00 34.00  ? 193 GLN A CD  1 
ATOM   1543 O  OE1 . GLN A 1 193 ? 37.142  6.083   6.710   1.00 37.96  ? 193 GLN A OE1 1 
ATOM   1544 N  NE2 . GLN A 1 193 ? 37.856  4.318   7.873   1.00 28.29  ? 193 GLN A NE2 1 
ATOM   1545 N  N   . LEU A 1 194 ? 32.281  6.653   9.450   1.00 10.84  ? 194 LEU A N   1 
ATOM   1546 C  CA  . LEU A 1 194 ? 31.023  7.214   8.972   1.00 8.65   ? 194 LEU A CA  1 
ATOM   1547 C  C   . LEU A 1 194 ? 30.574  8.440   9.771   1.00 10.45  ? 194 LEU A C   1 
ATOM   1548 O  O   . LEU A 1 194 ? 29.879  9.302   9.248   1.00 10.45  ? 194 LEU A O   1 
ATOM   1549 C  CB  . LEU A 1 194 ? 29.929  6.154   9.070   1.00 11.87  ? 194 LEU A CB  1 
ATOM   1550 C  CG  . LEU A 1 194 ? 28.777  6.135   8.057   1.00 13.22  ? 194 LEU A CG  1 
ATOM   1551 C  CD1 . LEU A 1 194 ? 27.502  5.543   8.669   1.00 9.96   ? 194 LEU A CD1 1 
ATOM   1552 C  CD2 . LEU A 1 194 ? 28.509  7.518   7.523   1.00 12.69  ? 194 LEU A CD2 1 
ATOM   1553 N  N   . GLU A 1 195 ? 30.931  8.509   11.048  1.00 10.44  ? 195 GLU A N   1 
ATOM   1554 C  CA  . GLU A 1 195 ? 30.471  9.618   11.870  1.00 11.85  ? 195 GLU A CA  1 
ATOM   1555 C  C   . GLU A 1 195 ? 31.273  10.844  11.535  1.00 12.88  ? 195 GLU A C   1 
ATOM   1556 O  O   . GLU A 1 195 ? 30.736  11.938  11.456  1.00 11.63  ? 195 GLU A O   1 
ATOM   1557 C  CB  . GLU A 1 195 ? 30.589  9.299   13.347  1.00 11.86  ? 195 GLU A CB  1 
ATOM   1558 C  CG  . GLU A 1 195 ? 30.115  10.416  14.208  1.00 11.14  ? 195 GLU A CG  1 
ATOM   1559 C  CD  . GLU A 1 195 ? 29.767  9.916   15.568  1.00 13.28  ? 195 GLU A CD  1 
ATOM   1560 O  OE1 . GLU A 1 195 ? 29.055  10.641  16.292  1.00 18.37  ? 195 GLU A OE1 1 
ATOM   1561 O  OE2 . GLU A 1 195 ? 30.198  8.790   15.899  1.00 7.65   ? 195 GLU A OE2 1 
ATOM   1562 N  N   . GLY A 1 196 ? 32.572  10.649  11.351  1.00 17.73  ? 196 GLY A N   1 
ATOM   1563 C  CA  . GLY A 1 196 ? 33.396  11.643  10.688  1.00 23.39  ? 196 GLY A CA  1 
ATOM   1564 C  C   . GLY A 1 196 ? 34.624  12.096  11.449  1.00 22.30  ? 196 GLY A C   1 
ATOM   1565 O  O   . GLY A 1 196 ? 35.188  13.138  11.153  1.00 21.19  ? 196 GLY A O   1 
ATOM   1566 N  N   . PHE A 1 197 ? 35.059  11.302  12.415  1.00 18.15  ? 197 PHE A N   1 
ATOM   1567 C  CA  . PHE A 1 197 ? 36.040  11.766  13.382  1.00 27.07  ? 197 PHE A CA  1 
ATOM   1568 C  C   . PHE A 1 197 ? 37.483  11.511  12.938  1.00 33.37  ? 197 PHE A C   1 
ATOM   1569 O  O   . PHE A 1 197 ? 38.407  12.272  13.241  1.00 35.33  ? 197 PHE A O   1 
ATOM   1570 C  CB  . PHE A 1 197 ? 35.729  11.134  14.744  1.00 23.30  ? 197 PHE A CB  1 
ATOM   1571 C  CG  . PHE A 1 197 ? 34.574  11.789  15.460  1.00 16.78  ? 197 PHE A CG  1 
ATOM   1572 C  CD1 . PHE A 1 197 ? 34.544  13.164  15.608  1.00 16.64  ? 197 PHE A CD1 1 
ATOM   1573 C  CD2 . PHE A 1 197 ? 33.518  11.041  15.964  1.00 12.02  ? 197 PHE A CD2 1 
ATOM   1574 C  CE1 . PHE A 1 197 ? 33.504  13.776  16.247  1.00 17.25  ? 197 PHE A CE1 1 
ATOM   1575 C  CE2 . PHE A 1 197 ? 32.469  11.648  16.608  1.00 11.93  ? 197 PHE A CE2 1 
ATOM   1576 C  CZ  . PHE A 1 197 ? 32.457  13.017  16.750  1.00 14.49  ? 197 PHE A CZ  1 
ATOM   1577 N  N   . ILE A 1 198 ? 37.654  10.412  12.224  1.00 37.45  ? 198 ILE A N   1 
ATOM   1578 C  CA  . ILE A 1 198 ? 38.910  10.053  11.586  1.00 45.31  ? 198 ILE A CA  1 
ATOM   1579 C  C   . ILE A 1 198 ? 39.305  11.312  10.788  1.00 42.31  ? 198 ILE A C   1 
ATOM   1580 O  O   . ILE A 1 198 ? 38.639  11.651  9.806   1.00 47.40  ? 198 ILE A O   1 
ATOM   1581 C  CB  . ILE A 1 198 ? 38.677  8.777   10.689  1.00 45.69  ? 198 ILE A CB  1 
ATOM   1582 C  CG1 . ILE A 1 198 ? 37.930  7.693   11.469  1.00 24.87  ? 198 ILE A CG1 1 
ATOM   1583 C  CG2 . ILE A 1 198 ? 39.970  8.218   10.160  1.00 60.97  ? 198 ILE A CG2 1 
ATOM   1584 C  CD1 . ILE A 1 198 ? 38.741  7.031   12.542  1.00 25.27  ? 198 ILE A CD1 1 
ATOM   1585 N  N   . ASN A 1 199 ? 40.364  12.012  11.217  1.00 33.58  ? 199 ASN A N   1 
ATOM   1586 C  CA  . ASN A 1 199 ? 40.794  13.255  10.558  1.00 37.68  ? 199 ASN A CA  1 
ATOM   1587 C  C   . ASN A 1 199 ? 39.709  14.293  10.400  1.00 31.18  ? 199 ASN A C   1 
ATOM   1588 O  O   . ASN A 1 199 ? 39.738  15.084  9.463   1.00 22.81  ? 199 ASN A O   1 
ATOM   1589 C  CB  . ASN A 1 199 ? 41.250  12.919  9.139   1.00 70.45  ? 199 ASN A CB  1 
ATOM   1590 C  CG  . ASN A 1 199 ? 42.343  11.895  9.099   1.00 73.75  ? 199 ASN A CG  1 
ATOM   1591 O  OD1 . ASN A 1 199 ? 42.109  10.707  9.308   1.00 77.93  ? 199 ASN A OD1 1 
ATOM   1592 N  ND2 . ASN A 1 199 ? 43.551  12.344  8.805   1.00 76.87  ? 199 ASN A ND2 1 
ATOM   1593 N  N   . GLY A 1 200 ? 38.735  14.252  11.299  1.00 37.70  ? 200 GLY A N   1 
ATOM   1594 C  CA  . GLY A 1 200 ? 37.542  15.063  11.197  1.00 32.90  ? 200 GLY A CA  1 
ATOM   1595 C  C   . GLY A 1 200 ? 37.755  16.513  10.851  1.00 22.86  ? 200 GLY A C   1 
ATOM   1596 O  O   . GLY A 1 200 ? 38.800  17.078  11.147  1.00 17.25  ? 200 GLY A O   1 
ATOM   1597 N  N   . PRO A 1 201 ? 36.752  17.123  10.216  1.00 20.54  ? 201 PRO A N   1 
ATOM   1598 C  CA  . PRO A 1 201 ? 35.430  16.512  10.110  1.00 20.15  ? 201 PRO A CA  1 
ATOM   1599 C  C   . PRO A 1 201 ? 35.270  15.726  8.801   1.00 19.61  ? 201 PRO A C   1 
ATOM   1600 O  O   . PRO A 1 201 ? 35.615  16.217  7.719   1.00 15.40  ? 201 PRO A O   1 
ATOM   1601 C  CB  . PRO A 1 201 ? 34.502  17.725  10.136  1.00 16.42  ? 201 PRO A CB  1 
ATOM   1602 C  CG  . PRO A 1 201 ? 35.275  18.792  9.473   1.00 18.27  ? 201 PRO A CG  1 
ATOM   1603 C  CD  . PRO A 1 201 ? 36.736  18.526  9.776   1.00 19.64  ? 201 PRO A CD  1 
ATOM   1604 N  N   . GLN A 1 202 ? 34.730  14.520  8.877   1.00 21.29  ? 202 GLN A N   1 
ATOM   1605 C  CA  . GLN A 1 202 ? 34.496  13.780  7.664   1.00 18.27  ? 202 GLN A CA  1 
ATOM   1606 C  C   . GLN A 1 202 ? 33.076  13.290  7.544   1.00 14.14  ? 202 GLN A C   1 
ATOM   1607 O  O   . GLN A 1 202 ? 32.349  13.189  8.499   1.00 12.47  ? 202 GLN A O   1 
ATOM   1608 C  CB  . GLN A 1 202 ? 35.463  12.612  7.550   1.00 22.75  ? 202 GLN A CB  1 
ATOM   1609 C  CG  . GLN A 1 202 ? 36.925  13.009  7.550   1.00 26.01  ? 202 GLN A CG  1 
ATOM   1610 C  CD  . GLN A 1 202 ? 37.406  13.505  6.211   1.00 23.66  ? 202 GLN A CD  1 
ATOM   1611 O  OE1 . GLN A 1 202 ? 38.402  14.204  6.122   1.00 30.79  ? 202 GLN A OE1 1 
ATOM   1612 N  NE2 . GLN A 1 202 ? 36.704  13.141  5.166   1.00 20.88  ? 202 GLN A NE2 1 
ATOM   1613 N  N   . LEU A 1 203 ? 32.686  12.995  6.330   1.00 13.70  ? 203 LEU A N   1 
ATOM   1614 C  CA  . LEU A 1 203 ? 31.407  12.361  6.087   1.00 14.01  ? 203 LEU A CA  1 
ATOM   1615 C  C   . LEU A 1 203 ? 30.315  13.041  6.922   1.00 9.28   ? 203 LEU A C   1 
ATOM   1616 O  O   . LEU A 1 203 ? 30.038  14.202  6.740   1.00 9.84   ? 203 LEU A O   1 
ATOM   1617 C  CB  . LEU A 1 203 ? 31.507  10.882  6.420   1.00 12.61  ? 203 LEU A CB  1 
ATOM   1618 C  CG  . LEU A 1 203 ? 32.306  10.135  5.390   1.00 6.76   ? 203 LEU A CG  1 
ATOM   1619 C  CD1 . LEU A 1 203 ? 32.636  8.770   5.904   1.00 7.19   ? 203 LEU A CD1 1 
ATOM   1620 C  CD2 . LEU A 1 203 ? 31.537  10.035  4.092   1.00 5.04   ? 203 LEU A CD2 1 
ATOM   1621 N  N   . HIS A 1 204 ? 29.719  12.310  7.856   1.00 7.34   ? 204 HIS A N   1 
ATOM   1622 C  CA  . HIS A 1 204 ? 28.552  12.785  8.585   1.00 10.35  ? 204 HIS A CA  1 
ATOM   1623 C  C   . HIS A 1 204 ? 28.785  14.109  9.311   1.00 13.05  ? 204 HIS A C   1 
ATOM   1624 O  O   . HIS A 1 204 ? 27.960  15.023  9.243   1.00 13.71  ? 204 HIS A O   1 
ATOM   1625 C  CB  . HIS A 1 204 ? 27.997  11.696  9.517   1.00 11.83  ? 204 HIS A CB  1 
ATOM   1626 C  CG  . HIS A 1 204 ? 27.145  12.230  10.618  1.00 12.59  ? 204 HIS A CG  1 
ATOM   1627 N  ND1 . HIS A 1 204 ? 27.611  12.407  11.905  1.00 14.55  ? 204 HIS A ND1 1 
ATOM   1628 C  CD2 . HIS A 1 204 ? 25.838  12.574  10.637  1.00 8.52   ? 204 HIS A CD2 1 
ATOM   1629 C  CE1 . HIS A 1 204 ? 26.635  12.877  12.657  1.00 10.94  ? 204 HIS A CE1 1 
ATOM   1630 N  NE2 . HIS A 1 204 ? 25.549  12.985  11.913  1.00 9.95   ? 204 HIS A NE2 1 
ATOM   1631 N  N   . ASN A 1 205 ? 29.898  14.197  10.028  1.00 13.97  ? 205 ASN A N   1 
ATOM   1632 C  CA  . ASN A 1 205 ? 30.284  15.443  10.649  1.00 14.40  ? 205 ASN A CA  1 
ATOM   1633 C  C   . ASN A 1 205 ? 30.583  16.479  9.593   1.00 11.06  ? 205 ASN A C   1 
ATOM   1634 O  O   . ASN A 1 205 ? 30.184  17.628  9.719   1.00 12.27  ? 205 ASN A O   1 
ATOM   1635 C  CB  . ASN A 1 205 ? 31.487  15.221  11.558  1.00 16.87  ? 205 ASN A CB  1 
ATOM   1636 C  CG  . ASN A 1 205 ? 31.174  14.299  12.714  1.00 20.26  ? 205 ASN A CG  1 
ATOM   1637 O  OD1 . ASN A 1 205 ? 32.076  13.686  13.278  1.00 25.22  ? 205 ASN A OD1 1 
ATOM   1638 N  ND2 . ASN A 1 205 ? 29.895  14.177  13.063  1.00 20.46  ? 205 ASN A ND2 1 
ATOM   1639 N  N   . ARG A 1 206 ? 31.187  16.119  8.484   1.00 9.85   ? 206 ARG A N   1 
ATOM   1640 C  CA  . ARG A 1 206 ? 31.429  17.129  7.465   1.00 10.59  ? 206 ARG A CA  1 
ATOM   1641 C  C   . ARG A 1 206 ? 30.182  17.565  6.772   1.00 11.32  ? 206 ARG A C   1 
ATOM   1642 O  O   . ARG A 1 206 ? 30.059  18.715  6.436   1.00 17.66  ? 206 ARG A O   1 
ATOM   1643 C  CB  . ARG A 1 206 ? 32.416  16.658  6.424   1.00 17.94  ? 206 ARG A CB  1 
ATOM   1644 C  CG  . ARG A 1 206 ? 32.910  17.782  5.548   1.00 20.10  ? 206 ARG A CG  1 
ATOM   1645 C  CD  . ARG A 1 206 ? 33.752  17.253  4.413   1.00 19.53  ? 206 ARG A CD  1 
ATOM   1646 N  NE  . ARG A 1 206 ? 35.154  17.466  4.666   1.00 20.13  ? 206 ARG A NE  1 
ATOM   1647 C  CZ  . ARG A 1 206 ? 35.921  18.201  3.893   1.00 17.15  ? 206 ARG A CZ  1 
ATOM   1648 N  NH1 . ARG A 1 206 ? 35.408  18.779  2.835   1.00 17.21  ? 206 ARG A NH1 1 
ATOM   1649 N  NH2 . ARG A 1 206 ? 37.193  18.362  4.184   1.00 17.89  ? 206 ARG A NH2 1 
ATOM   1650 N  N   . VAL A 1 207 ? 29.251  16.659  6.531   1.00 11.35  ? 207 VAL A N   1 
ATOM   1651 C  CA  . VAL A 1 207 ? 27.919  17.128  6.107   1.00 9.91   ? 207 VAL A CA  1 
ATOM   1652 C  C   . VAL A 1 207 ? 27.398  18.286  7.003   1.00 13.50  ? 207 VAL A C   1 
ATOM   1653 O  O   . VAL A 1 207 ? 27.137  19.381  6.494   1.00 16.06  ? 207 VAL A O   1 
ATOM   1654 C  CB  . VAL A 1 207 ? 26.859  15.964  5.976   1.00 6.53   ? 207 VAL A CB  1 
ATOM   1655 C  CG1 . VAL A 1 207 ? 25.599  16.455  5.306   1.00 4.79   ? 207 VAL A CG1 1 
ATOM   1656 C  CG2 . VAL A 1 207 ? 27.414  14.800  5.181   1.00 11.36  ? 207 VAL A CG2 1 
ATOM   1657 N  N   . HIS A 1 208 ? 27.294  18.064  8.321   1.00 13.74  ? 208 HIS A N   1 
ATOM   1658 C  CA  . HIS A 1 208 ? 26.741  19.066  9.252   1.00 14.05  ? 208 HIS A CA  1 
ATOM   1659 C  C   . HIS A 1 208 ? 27.350  20.461  9.270   1.00 13.35  ? 208 HIS A C   1 
ATOM   1660 O  O   . HIS A 1 208 ? 26.649  21.467  9.319   1.00 13.83  ? 208 HIS A O   1 
ATOM   1661 C  CB  . HIS A 1 208 ? 26.741  18.547  10.688  1.00 11.48  ? 208 HIS A CB  1 
ATOM   1662 C  CG  . HIS A 1 208 ? 25.673  17.539  10.970  1.00 12.15  ? 208 HIS A CG  1 
ATOM   1663 N  ND1 . HIS A 1 208 ? 24.339  17.869  11.055  1.00 14.35  ? 208 HIS A ND1 1 
ATOM   1664 C  CD2 . HIS A 1 208 ? 25.750  16.208  11.211  1.00 13.54  ? 208 HIS A CD2 1 
ATOM   1665 C  CE1 . HIS A 1 208 ? 23.635  16.784  11.332  1.00 18.57  ? 208 HIS A CE1 1 
ATOM   1666 N  NE2 . HIS A 1 208 ? 24.469  15.761  11.431  1.00 17.98  ? 208 HIS A NE2 1 
ATOM   1667 N  N   . ARG A 1 209 ? 28.677  20.511  9.229   1.00 13.82  ? 209 ARG A N   1 
ATOM   1668 C  CA  . ARG A 1 209 ? 29.397  21.778  9.219   1.00 24.14  ? 209 ARG A CA  1 
ATOM   1669 C  C   . ARG A 1 209 ? 29.324  22.425  7.841   1.00 29.71  ? 209 ARG A C   1 
ATOM   1670 O  O   . ARG A 1 209 ? 29.475  23.639  7.704   1.00 39.34  ? 209 ARG A O   1 
ATOM   1671 C  CB  . ARG A 1 209 ? 30.856  21.570  9.627   1.00 25.05  ? 209 ARG A CB  1 
ATOM   1672 C  CG  . ARG A 1 209 ? 31.033  20.914  10.987  1.00 42.62  ? 209 ARG A CG  1 
ATOM   1673 C  CD  . ARG A 1 209 ? 31.994  21.703  11.860  1.00 44.82  ? 209 ARG A CD  1 
ATOM   1674 N  NE  . ARG A 1 209 ? 33.036  22.357  11.074  1.00 59.78  ? 209 ARG A NE  1 
ATOM   1675 C  CZ  . ARG A 1 209 ? 33.976  23.145  11.588  1.00 91.10  ? 209 ARG A CZ  1 
ATOM   1676 N  NH1 . ARG A 1 209 ? 34.007  23.379  12.893  1.00 90.32  ? 209 ARG A NH1 1 
ATOM   1677 N  NH2 . ARG A 1 209 ? 34.885  23.698  10.797  1.00 116.86 ? 209 ARG A NH2 1 
ATOM   1678 N  N   . TRP A 1 210 ? 29.091  21.604  6.821   1.00 25.27  ? 210 TRP A N   1 
ATOM   1679 C  CA  . TRP A 1 210 ? 28.985  22.091  5.460   1.00 20.45  ? 210 TRP A CA  1 
ATOM   1680 C  C   . TRP A 1 210 ? 27.785  22.976  5.302   1.00 22.38  ? 210 TRP A C   1 
ATOM   1681 O  O   . TRP A 1 210 ? 27.878  24.086  4.735   1.00 25.65  ? 210 TRP A O   1 
ATOM   1682 C  CB  . TRP A 1 210 ? 28.911  20.926  4.480   1.00 18.72  ? 210 TRP A CB  1 
ATOM   1683 C  CG  . TRP A 1 210 ? 28.937  21.353  3.032   1.00 18.91  ? 210 TRP A CG  1 
ATOM   1684 C  CD1 . TRP A 1 210 ? 30.041  21.422  2.186   1.00 18.06  ? 210 TRP A CD1 1 
ATOM   1685 C  CD2 . TRP A 1 210 ? 27.800  21.787  2.207   1.00 16.30  ? 210 TRP A CD2 1 
ATOM   1686 N  NE1 . TRP A 1 210 ? 29.675  21.854  0.937   1.00 15.82  ? 210 TRP A NE1 1 
ATOM   1687 C  CE2 . TRP A 1 210 ? 28.346  22.090  0.882   1.00 13.94  ? 210 TRP A CE2 1 
ATOM   1688 C  CE3 . TRP A 1 210 ? 26.440  21.946  2.425   1.00 21.49  ? 210 TRP A CE3 1 
ATOM   1689 C  CZ2 . TRP A 1 210 ? 27.547  22.532  -0.157  1.00 17.03  ? 210 TRP A CZ2 1 
ATOM   1690 C  CZ3 . TRP A 1 210 ? 25.644  22.393  1.368   1.00 16.56  ? 210 TRP A CZ3 1 
ATOM   1691 C  CH2 . TRP A 1 210 ? 26.187  22.677  0.109   1.00 14.90  ? 210 TRP A CH2 1 
ATOM   1692 N  N   . VAL A 1 211 ? 26.642  22.509  5.795   1.00 16.20  ? 211 VAL A N   1 
ATOM   1693 C  CA  . VAL A 1 211 ? 25.394  23.287  5.717   1.00 16.26  ? 211 VAL A CA  1 
ATOM   1694 C  C   . VAL A 1 211 ? 25.355  24.503  6.619   1.00 21.28  ? 211 VAL A C   1 
ATOM   1695 O  O   . VAL A 1 211 ? 24.669  25.490  6.326   1.00 15.68  ? 211 VAL A O   1 
ATOM   1696 C  CB  . VAL A 1 211 ? 24.156  22.469  6.120   1.00 10.75  ? 211 VAL A CB  1 
ATOM   1697 C  CG1 . VAL A 1 211 ? 22.888  23.270  5.820   1.00 13.56  ? 211 VAL A CG1 1 
ATOM   1698 C  CG2 . VAL A 1 211 ? 24.145  21.156  5.405   1.00 13.80  ? 211 VAL A CG2 1 
ATOM   1699 N  N   . GLY A 1 212 ? 26.057  24.420  7.741   1.00 21.85  ? 212 GLY A N   1 
ATOM   1700 C  CA  . GLY A 1 212 ? 26.098  25.537  8.666   1.00 20.32  ? 212 GLY A CA  1 
ATOM   1701 C  C   . GLY A 1 212 ? 24.753  25.856  9.307   1.00 18.93  ? 212 GLY A C   1 
ATOM   1702 O  O   . GLY A 1 212 ? 23.834  25.032  9.297   1.00 18.79  ? 212 GLY A O   1 
ATOM   1703 N  N   . GLY A 1 213 ? 24.641  27.052  9.877   1.00 12.34  ? 213 GLY A N   1 
ATOM   1704 C  CA  . GLY A 1 213 ? 23.449  27.425  10.605  1.00 9.67   ? 213 GLY A CA  1 
ATOM   1705 C  C   . GLY A 1 213 ? 23.211  26.399  11.679  1.00 10.17  ? 213 GLY A C   1 
ATOM   1706 O  O   . GLY A 1 213 ? 24.159  25.847  12.225  1.00 10.28  ? 213 GLY A O   1 
ATOM   1707 N  N   . GLN A 1 214 ? 21.946  26.124  11.965  1.00 9.02   ? 214 GLN A N   1 
ATOM   1708 C  CA  . GLN A 1 214 ? 21.603  25.192  13.026  1.00 8.41   ? 214 GLN A CA  1 
ATOM   1709 C  C   . GLN A 1 214 ? 22.255  23.840  12.799  1.00 10.03  ? 214 GLN A C   1 
ATOM   1710 O  O   . GLN A 1 214 ? 22.622  23.144  13.754  1.00 10.22  ? 214 GLN A O   1 
ATOM   1711 C  CB  . GLN A 1 214 ? 20.091  25.041  13.140  1.00 8.91   ? 214 GLN A CB  1 
ATOM   1712 C  CG  . GLN A 1 214 ? 19.410  26.151  13.916  1.00 11.32  ? 214 GLN A CG  1 
ATOM   1713 C  CD  . GLN A 1 214 ? 18.996  27.310  13.042  1.00 10.51  ? 214 GLN A CD  1 
ATOM   1714 O  OE1 . GLN A 1 214 ? 19.430  27.418  11.892  1.00 9.23   ? 214 GLN A OE1 1 
ATOM   1715 N  NE2 . GLN A 1 214 ? 18.138  28.183  13.579  1.00 9.84   ? 214 GLN A NE2 1 
ATOM   1716 N  N   . MET A 1 215 ? 22.437  23.479  11.544  1.00 9.30   ? 215 MET A N   1 
ATOM   1717 C  CA  . MET A 1 215 ? 22.912  22.155  11.237  1.00 10.07  ? 215 MET A CA  1 
ATOM   1718 C  C   . MET A 1 215 ? 24.369  22.013  11.566  1.00 11.80  ? 215 MET A C   1 
ATOM   1719 O  O   . MET A 1 215 ? 24.943  20.960  11.422  1.00 11.51  ? 215 MET A O   1 
ATOM   1720 C  CB  . MET A 1 215 ? 22.657  21.849  9.788   1.00 8.19   ? 215 MET A CB  1 
ATOM   1721 C  CG  . MET A 1 215 ? 21.601  20.810  9.556   1.00 10.82  ? 215 MET A CG  1 
ATOM   1722 S  SD  . MET A 1 215 ? 22.082  19.733  8.202   1.00 51.35  ? 215 MET A SD  1 
ATOM   1723 C  CE  . MET A 1 215 ? 21.525  18.178  8.818   1.00 18.68  ? 215 MET A CE  1 
ATOM   1724 N  N   . GLY A 1 216 ? 24.964  23.087  12.041  1.00 14.13  ? 216 GLY A N   1 
ATOM   1725 C  CA  . GLY A 1 216 ? 26.384  23.085  12.343  1.00 12.59  ? 216 GLY A CA  1 
ATOM   1726 C  C   . GLY A 1 216 ? 26.666  22.680  13.759  1.00 9.31   ? 216 GLY A C   1 
ATOM   1727 O  O   . GLY A 1 216 ? 27.804  22.368  14.107  1.00 11.44  ? 216 GLY A O   1 
ATOM   1728 N  N   . VAL A 1 217 ? 25.631  22.815  14.572  1.00 14.16  ? 217 VAL A N   1 
ATOM   1729 C  CA  . VAL A 1 217 ? 25.713  22.632  16.001  1.00 18.45  ? 217 VAL A CA  1 
ATOM   1730 C  C   . VAL A 1 217 ? 24.918  21.397  16.352  1.00 16.69  ? 217 VAL A C   1 
ATOM   1731 O  O   . VAL A 1 217 ? 23.848  21.148  15.822  1.00 15.03  ? 217 VAL A O   1 
ATOM   1732 C  CB  . VAL A 1 217 ? 25.168  23.844  16.731  1.00 17.46  ? 217 VAL A CB  1 
ATOM   1733 C  CG1 . VAL A 1 217 ? 26.034  25.035  16.477  1.00 9.28   ? 217 VAL A CG1 1 
ATOM   1734 C  CG2 . VAL A 1 217 ? 23.802  24.136  16.260  1.00 20.61  ? 217 VAL A CG2 1 
ATOM   1735 N  N   . VAL A 1 218 ? 25.479  20.604  17.234  1.00 15.78  ? 218 VAL A N   1 
ATOM   1736 C  CA  . VAL A 1 218 ? 24.973  19.288  17.497  1.00 27.29  ? 218 VAL A CA  1 
ATOM   1737 C  C   . VAL A 1 218 ? 23.558  19.290  17.993  1.00 27.35  ? 218 VAL A C   1 
ATOM   1738 O  O   . VAL A 1 218 ? 22.767  18.465  17.587  1.00 31.13  ? 218 VAL A O   1 
ATOM   1739 C  CB  . VAL A 1 218 ? 25.832  18.626  18.550  1.00 63.06  ? 218 VAL A CB  1 
ATOM   1740 C  CG1 . VAL A 1 218 ? 25.023  17.620  19.379  1.00 54.63  ? 218 VAL A CG1 1 
ATOM   1741 C  CG2 . VAL A 1 218 ? 27.113  18.039  17.917  1.00 49.56  ? 218 VAL A CG2 1 
ATOM   1742 N  N   . PRO A 1 219 ? 23.247  20.214  18.882  1.00 31.28  ? 219 PRO A N   1 
ATOM   1743 C  CA  . PRO A 1 219 ? 21.966  20.242  19.586  1.00 34.40  ? 219 PRO A CA  1 
ATOM   1744 C  C   . PRO A 1 219 ? 20.846  20.879  18.805  1.00 27.86  ? 219 PRO A C   1 
ATOM   1745 O  O   . PRO A 1 219 ? 19.739  20.396  18.912  1.00 29.49  ? 219 PRO A O   1 
ATOM   1746 C  CB  . PRO A 1 219 ? 22.274  21.099  20.793  1.00 35.95  ? 219 PRO A CB  1 
ATOM   1747 C  CG  . PRO A 1 219 ? 23.254  22.062  20.277  1.00 44.94  ? 219 PRO A CG  1 
ATOM   1748 C  CD  . PRO A 1 219 ? 24.132  21.294  19.324  1.00 33.12  ? 219 PRO A CD  1 
ATOM   1749 N  N   . THR A 1 220 ? 21.122  21.935  18.050  1.00 21.14  ? 220 THR A N   1 
ATOM   1750 C  CA  . THR A 1 220 ? 20.128  22.571  17.179  1.00 17.84  ? 220 THR A CA  1 
ATOM   1751 C  C   . THR A 1 220 ? 20.013  21.992  15.762  1.00 14.04  ? 220 THR A C   1 
ATOM   1752 O  O   . THR A 1 220 ? 19.166  22.425  14.968  1.00 8.96   ? 220 THR A O   1 
ATOM   1753 C  CB  . THR A 1 220 ? 20.421  24.070  17.063  1.00 15.80  ? 220 THR A CB  1 
ATOM   1754 O  OG1 . THR A 1 220 ? 21.807  24.241  16.739  1.00 18.62  ? 220 THR A OG1 1 
ATOM   1755 C  CG2 . THR A 1 220 ? 20.113  24.763  18.377  1.00 22.15  ? 220 THR A CG2 1 
ATOM   1756 N  N   . ALA A 1 221 ? 20.873  21.027  15.450  1.00 14.75  ? 221 ALA A N   1 
ATOM   1757 C  CA  . ALA A 1 221 ? 20.799  20.332  14.177  1.00 11.74  ? 221 ALA A CA  1 
ATOM   1758 C  C   . ALA A 1 221 ? 19.381  20.102  13.664  1.00 10.81  ? 221 ALA A C   1 
ATOM   1759 O  O   . ALA A 1 221 ? 18.978  20.714  12.689  1.00 8.95   ? 221 ALA A O   1 
ATOM   1760 C  CB  . ALA A 1 221 ? 21.491  18.966  14.261  1.00 13.38  ? 221 ALA A CB  1 
ATOM   1761 N  N   . PRO A 1 222 ? 18.598  19.248  14.345  1.00 13.71  ? 222 PRO A N   1 
ATOM   1762 C  CA  . PRO A 1 222 ? 17.304  18.877  13.758  1.00 10.33  ? 222 PRO A CA  1 
ATOM   1763 C  C   . PRO A 1 222 ? 16.289  19.999  13.522  1.00 8.28   ? 222 PRO A C   1 
ATOM   1764 O  O   . PRO A 1 222 ? 15.172  19.685  13.150  1.00 4.56   ? 222 PRO A O   1 
ATOM   1765 C  CB  . PRO A 1 222 ? 16.750  17.868  14.767  1.00 10.16  ? 222 PRO A CB  1 
ATOM   1766 C  CG  . PRO A 1 222 ? 17.964  17.304  15.434  1.00 11.19  ? 222 PRO A CG  1 
ATOM   1767 C  CD  . PRO A 1 222 ? 18.874  18.475  15.572  1.00 12.79  ? 222 PRO A CD  1 
ATOM   1768 N  N   . ASN A 1 223 ? 16.643  21.263  13.712  1.00 9.61   ? 223 ASN A N   1 
ATOM   1769 C  CA  . ASN A 1 223 ? 15.707  22.340  13.381  1.00 12.59  ? 223 ASN A CA  1 
ATOM   1770 C  C   . ASN A 1 223 ? 15.444  22.314  11.891  1.00 11.39  ? 223 ASN A C   1 
ATOM   1771 O  O   . ASN A 1 223 ? 14.399  22.731  11.403  1.00 12.30  ? 223 ASN A O   1 
ATOM   1772 C  CB  . ASN A 1 223 ? 16.288  23.712  13.747  1.00 11.07  ? 223 ASN A CB  1 
ATOM   1773 C  CG  . ASN A 1 223 ? 15.683  24.295  15.002  1.00 9.51   ? 223 ASN A CG  1 
ATOM   1774 O  OD1 . ASN A 1 223 ? 14.539  24.758  15.010  1.00 7.69   ? 223 ASN A OD1 1 
ATOM   1775 N  ND2 . ASN A 1 223 ? 16.467  24.302  16.069  1.00 13.02  ? 223 ASN A ND2 1 
ATOM   1776 N  N   . ASP A 1 224 ? 16.442  21.822  11.175  1.00 15.46  ? 224 ASP A N   1 
ATOM   1777 C  CA  . ASP A 1 224 ? 16.521  21.932  9.725   1.00 15.02  ? 224 ASP A CA  1 
ATOM   1778 C  C   . ASP A 1 224 ? 16.089  20.618  9.065   1.00 14.79  ? 224 ASP A C   1 
ATOM   1779 O  O   . ASP A 1 224 ? 16.804  19.612  9.138   1.00 12.17  ? 224 ASP A O   1 
ATOM   1780 C  CB  . ASP A 1 224 ? 17.961  22.261  9.341   1.00 14.89  ? 224 ASP A CB  1 
ATOM   1781 C  CG  . ASP A 1 224 ? 18.122  22.468  7.880   1.00 15.87  ? 224 ASP A CG  1 
ATOM   1782 O  OD1 . ASP A 1 224 ? 17.373  21.841  7.091   1.00 8.95   ? 224 ASP A OD1 1 
ATOM   1783 O  OD2 . ASP A 1 224 ? 19.006  23.266  7.523   1.00 24.20  ? 224 ASP A OD2 1 
ATOM   1784 N  N   . PRO A 1 225 ? 14.916  20.620  8.411   1.00 13.43  ? 225 PRO A N   1 
ATOM   1785 C  CA  . PRO A 1 225 ? 14.346  19.343  7.969   1.00 11.52  ? 225 PRO A CA  1 
ATOM   1786 C  C   . PRO A 1 225 ? 15.390  18.441  7.300   1.00 11.45  ? 225 PRO A C   1 
ATOM   1787 O  O   . PRO A 1 225 ? 15.316  17.212  7.414   1.00 9.46   ? 225 PRO A O   1 
ATOM   1788 C  CB  . PRO A 1 225 ? 13.261  19.778  6.977   1.00 11.86  ? 225 PRO A CB  1 
ATOM   1789 C  CG  . PRO A 1 225 ? 12.833  21.127  7.466   1.00 10.59  ? 225 PRO A CG  1 
ATOM   1790 C  CD  . PRO A 1 225 ? 14.103  21.773  7.975   1.00 9.83   ? 225 PRO A CD  1 
ATOM   1791 N  N   . VAL A 1 226 ? 16.371  19.052  6.639   1.00 17.50  ? 226 VAL A N   1 
ATOM   1792 C  CA  . VAL A 1 226 ? 17.376  18.301  5.881   1.00 17.62  ? 226 VAL A CA  1 
ATOM   1793 C  C   . VAL A 1 226 ? 18.150  17.302  6.760   1.00 13.18  ? 226 VAL A C   1 
ATOM   1794 O  O   . VAL A 1 226 ? 18.584  16.257  6.273   1.00 8.32   ? 226 VAL A O   1 
ATOM   1795 C  CB  . VAL A 1 226 ? 18.333  19.246  5.093   1.00 13.24  ? 226 VAL A CB  1 
ATOM   1796 C  CG1 . VAL A 1 226 ? 19.463  19.761  5.981   1.00 12.75  ? 226 VAL A CG1 1 
ATOM   1797 C  CG2 . VAL A 1 226 ? 18.878  18.542  3.871   1.00 6.01   ? 226 VAL A CG2 1 
ATOM   1798 N  N   . PHE A 1 227 ? 18.303  17.631  8.046   1.00 12.80  ? 227 PHE A N   1 
ATOM   1799 C  CA  . PHE A 1 227 ? 18.815  16.711  9.064   1.00 10.21  ? 227 PHE A CA  1 
ATOM   1800 C  C   . PHE A 1 227 ? 18.401  15.270  8.790   1.00 13.75  ? 227 PHE A C   1 
ATOM   1801 O  O   . PHE A 1 227 ? 19.235  14.356  8.837   1.00 13.41  ? 227 PHE A O   1 
ATOM   1802 C  CB  . PHE A 1 227 ? 18.251  17.118  10.424  1.00 8.94   ? 227 PHE A CB  1 
ATOM   1803 C  CG  . PHE A 1 227 ? 18.705  16.263  11.573  1.00 8.91   ? 227 PHE A CG  1 
ATOM   1804 C  CD1 . PHE A 1 227 ? 17.910  15.247  12.053  1.00 4.85   ? 227 PHE A CD1 1 
ATOM   1805 C  CD2 . PHE A 1 227 ? 19.907  16.520  12.201  1.00 9.67   ? 227 PHE A CD2 1 
ATOM   1806 C  CE1 . PHE A 1 227 ? 18.317  14.502  13.114  1.00 7.97   ? 227 PHE A CE1 1 
ATOM   1807 C  CE2 . PHE A 1 227 ? 20.322  15.769  13.267  1.00 9.57   ? 227 PHE A CE2 1 
ATOM   1808 C  CZ  . PHE A 1 227 ? 19.528  14.765  13.723  1.00 10.16  ? 227 PHE A CZ  1 
ATOM   1809 N  N   . PHE A 1 228 ? 17.114  15.080  8.487   1.00 13.43  ? 228 PHE A N   1 
ATOM   1810 C  CA  . PHE A 1 228 ? 16.534  13.752  8.356   1.00 10.02  ? 228 PHE A CA  1 
ATOM   1811 C  C   . PHE A 1 228 ? 16.871  13.103  7.023   1.00 12.46  ? 228 PHE A C   1 
ATOM   1812 O  O   . PHE A 1 228 ? 17.195  11.926  6.975   1.00 12.60  ? 228 PHE A O   1 
ATOM   1813 C  CB  . PHE A 1 228 ? 15.027  13.808  8.575   1.00 7.80   ? 228 PHE A CB  1 
ATOM   1814 C  CG  . PHE A 1 228 ? 14.628  14.305  9.951   1.00 11.28  ? 228 PHE A CG  1 
ATOM   1815 C  CD1 . PHE A 1 228 ? 14.430  13.417  11.009  1.00 10.17  ? 228 PHE A CD1 1 
ATOM   1816 C  CD2 . PHE A 1 228 ? 14.424  15.660  10.174  1.00 8.59   ? 228 PHE A CD2 1 
ATOM   1817 C  CE1 . PHE A 1 228 ? 14.063  13.882  12.254  1.00 6.61   ? 228 PHE A CE1 1 
ATOM   1818 C  CE2 . PHE A 1 228 ? 14.062  16.120  11.402  1.00 6.41   ? 228 PHE A CE2 1 
ATOM   1819 C  CZ  . PHE A 1 228 ? 13.883  15.233  12.448  1.00 5.57   ? 228 PHE A CZ  1 
ATOM   1820 N  N   . LEU A 1 229 ? 16.762  13.841  5.930   1.00 11.13  ? 229 LEU A N   1 
ATOM   1821 C  CA  . LEU A 1 229 ? 17.285  13.311  4.686   1.00 8.11   ? 229 LEU A CA  1 
ATOM   1822 C  C   . LEU A 1 229 ? 18.729  12.960  4.940   1.00 7.73   ? 229 LEU A C   1 
ATOM   1823 O  O   . LEU A 1 229 ? 19.161  11.857  4.635   1.00 8.59   ? 229 LEU A O   1 
ATOM   1824 C  CB  . LEU A 1 229 ? 17.226  14.346  3.571   1.00 7.68   ? 229 LEU A CB  1 
ATOM   1825 C  CG  . LEU A 1 229 ? 15.893  14.478  2.852   1.00 6.82   ? 229 LEU A CG  1 
ATOM   1826 C  CD1 . LEU A 1 229 ? 14.774  14.198  3.819   1.00 12.14  ? 229 LEU A CD1 1 
ATOM   1827 C  CD2 . LEU A 1 229 ? 15.826  15.875  2.320   1.00 7.73   ? 229 LEU A CD2 1 
ATOM   1828 N  N   . HIS A 1 230 ? 19.475  13.908  5.507   1.00 9.07   ? 230 HIS A N   1 
ATOM   1829 C  CA  . HIS A 1 230 ? 20.890  13.678  5.737   1.00 7.47   ? 230 HIS A CA  1 
ATOM   1830 C  C   . HIS A 1 230 ? 21.003  12.345  6.388   1.00 7.40   ? 230 HIS A C   1 
ATOM   1831 O  O   . HIS A 1 230 ? 21.599  11.422  5.839   1.00 8.45   ? 230 HIS A O   1 
ATOM   1832 C  CB  . HIS A 1 230 ? 21.516  14.654  6.712   1.00 8.02   ? 230 HIS A CB  1 
ATOM   1833 C  CG  . HIS A 1 230 ? 22.920  14.252  7.062   1.00 7.81   ? 230 HIS A CG  1 
ATOM   1834 N  ND1 . HIS A 1 230 ? 23.425  14.321  8.356   1.00 8.29   ? 230 HIS A ND1 1 
ATOM   1835 C  CD2 . HIS A 1 230 ? 23.876  13.723  6.303   1.00 8.55   ? 230 HIS A CD2 1 
ATOM   1836 C  CE1 . HIS A 1 230 ? 24.665  13.872  8.338   1.00 9.82   ? 230 HIS A CE1 1 
ATOM   1837 N  NE2 . HIS A 1 230 ? 24.978  13.500  7.119   1.00 11.38  ? 230 HIS A NE2 1 
ATOM   1838 N  N   . HIS A 1 231 ? 20.425  12.252  7.574   1.00 6.89   ? 231 HIS A N   1 
ATOM   1839 C  CA  . HIS A 1 231 ? 20.466  11.019  8.308   1.00 6.30   ? 231 HIS A CA  1 
ATOM   1840 C  C   . HIS A 1 231 ? 19.835  9.848   7.573   1.00 13.35  ? 231 HIS A C   1 
ATOM   1841 O  O   . HIS A 1 231 ? 20.218  8.702   7.808   1.00 16.85  ? 231 HIS A O   1 
ATOM   1842 C  CB  . HIS A 1 231 ? 19.812  11.230  9.644   1.00 6.29   ? 231 HIS A CB  1 
ATOM   1843 C  CG  . HIS A 1 231 ? 20.759  11.746  10.669  1.00 7.38   ? 231 HIS A CG  1 
ATOM   1844 N  ND1 . HIS A 1 231 ? 21.662  10.930  11.312  1.00 7.53   ? 231 HIS A ND1 1 
ATOM   1845 C  CD2 . HIS A 1 231 ? 20.974  12.997  11.150  1.00 8.05   ? 231 HIS A CD2 1 
ATOM   1846 C  CE1 . HIS A 1 231 ? 22.388  11.649  12.147  1.00 9.14   ? 231 HIS A CE1 1 
ATOM   1847 N  NE2 . HIS A 1 231 ? 21.993  12.910  12.063  1.00 7.09   ? 231 HIS A NE2 1 
ATOM   1848 N  N   . ALA A 1 232 ? 18.867  10.120  6.695   1.00 14.58  ? 232 ALA A N   1 
ATOM   1849 C  CA  . ALA A 1 232 ? 18.308  9.066   5.845   1.00 10.48  ? 232 ALA A CA  1 
ATOM   1850 C  C   . ALA A 1 232 ? 19.487  8.416   5.133   1.00 9.16   ? 232 ALA A C   1 
ATOM   1851 O  O   . ALA A 1 232 ? 19.698  7.207   5.227   1.00 8.66   ? 232 ALA A O   1 
ATOM   1852 C  CB  . ALA A 1 232 ? 17.339  9.643   4.817   1.00 7.49   ? 232 ALA A CB  1 
ATOM   1853 N  N   . ASN A 1 233 ? 20.264  9.246   4.441   1.00 9.04   ? 233 ASN A N   1 
ATOM   1854 C  CA  . ASN A 1 233 ? 21.388  8.780   3.660   1.00 9.18   ? 233 ASN A CA  1 
ATOM   1855 C  C   . ASN A 1 233 ? 22.389  8.025   4.514   1.00 7.87   ? 233 ASN A C   1 
ATOM   1856 O  O   . ASN A 1 233 ? 22.931  7.002   4.088   1.00 8.03   ? 233 ASN A O   1 
ATOM   1857 C  CB  . ASN A 1 233 ? 22.045  9.944   2.929   1.00 7.87   ? 233 ASN A CB  1 
ATOM   1858 C  CG  . ASN A 1 233 ? 22.982  9.471   1.856   1.00 6.17   ? 233 ASN A CG  1 
ATOM   1859 O  OD1 . ASN A 1 233 ? 22.691  8.504   1.145   1.00 6.40   ? 233 ASN A OD1 1 
ATOM   1860 N  ND2 . ASN A 1 233 ? 24.134  10.112  1.761   1.00 5.36   ? 233 ASN A ND2 1 
ATOM   1861 N  N   . VAL A 1 234 ? 22.618  8.541   5.719   1.00 6.06   ? 234 VAL A N   1 
ATOM   1862 C  CA  . VAL A 1 234 ? 23.595  7.989   6.638   1.00 5.88   ? 234 VAL A CA  1 
ATOM   1863 C  C   . VAL A 1 234 ? 23.191  6.592   7.084   1.00 9.79   ? 234 VAL A C   1 
ATOM   1864 O  O   . VAL A 1 234 ? 24.040  5.746   7.361   1.00 12.51  ? 234 VAL A O   1 
ATOM   1865 C  CB  . VAL A 1 234 ? 23.698  8.868   7.879   1.00 7.19   ? 234 VAL A CB  1 
ATOM   1866 C  CG1 . VAL A 1 234 ? 24.544  8.190   8.929   1.00 17.60  ? 234 VAL A CG1 1 
ATOM   1867 C  CG2 . VAL A 1 234 ? 24.260  10.223  7.498   1.00 6.80   ? 234 VAL A CG2 1 
ATOM   1868 N  N   . ASP A 1 235 ? 21.883  6.355   7.126   1.00 9.29   ? 235 ASP A N   1 
ATOM   1869 C  CA  . ASP A 1 235 ? 21.320  5.080   7.547   1.00 9.29   ? 235 ASP A CA  1 
ATOM   1870 C  C   . ASP A 1 235 ? 21.411  4.077   6.397   1.00 9.77   ? 235 ASP A C   1 
ATOM   1871 O  O   . ASP A 1 235 ? 21.515  2.859   6.615   1.00 7.05   ? 235 ASP A O   1 
ATOM   1872 C  CB  . ASP A 1 235 ? 19.864  5.291   7.933   1.00 8.63   ? 235 ASP A CB  1 
ATOM   1873 C  CG  . ASP A 1 235 ? 19.230  4.049   8.500   1.00 11.65  ? 235 ASP A CG  1 
ATOM   1874 O  OD1 . ASP A 1 235 ? 18.124  3.678   8.027   1.00 8.83   ? 235 ASP A OD1 1 
ATOM   1875 O  OD2 . ASP A 1 235 ? 19.835  3.464   9.434   1.00 12.62  ? 235 ASP A OD2 1 
ATOM   1876 N  N   . ARG A 1 236 ? 21.353  4.626   5.177   1.00 8.69   ? 236 ARG A N   1 
ATOM   1877 C  CA  . ARG A 1 236 ? 21.363  3.867   3.927   1.00 7.07   ? 236 ARG A CA  1 
ATOM   1878 C  C   . ARG A 1 236 ? 22.741  3.266   3.734   1.00 7.38   ? 236 ARG A C   1 
ATOM   1879 O  O   . ARG A 1 236 ? 22.906  2.105   3.357   1.00 6.85   ? 236 ARG A O   1 
ATOM   1880 C  CB  . ARG A 1 236 ? 21.024  4.800   2.763   1.00 4.83   ? 236 ARG A CB  1 
ATOM   1881 C  CG  . ARG A 1 236 ? 21.250  4.224   1.386   1.00 5.68   ? 236 ARG A CG  1 
ATOM   1882 C  CD  . ARG A 1 236 ? 20.813  5.186   0.285   1.00 6.32   ? 236 ARG A CD  1 
ATOM   1883 N  NE  . ARG A 1 236 ? 21.822  6.192   -0.042  1.00 6.98   ? 236 ARG A NE  1 
ATOM   1884 C  CZ  . ARG A 1 236 ? 22.847  5.977   -0.859  1.00 9.31   ? 236 ARG A CZ  1 
ATOM   1885 N  NH1 . ARG A 1 236 ? 23.009  4.790   -1.416  1.00 7.87   ? 236 ARG A NH1 1 
ATOM   1886 N  NH2 . ARG A 1 236 ? 23.716  6.943   -1.117  1.00 7.34   ? 236 ARG A NH2 1 
ATOM   1887 N  N   . ILE A 1 237 ? 23.731  4.090   4.023   1.00 6.74   ? 237 ILE A N   1 
ATOM   1888 C  CA  . ILE A 1 237 ? 25.118  3.698   3.994   1.00 5.41   ? 237 ILE A CA  1 
ATOM   1889 C  C   . ILE A 1 237 ? 25.419  2.584   4.977   1.00 6.23   ? 237 ILE A C   1 
ATOM   1890 O  O   . ILE A 1 237 ? 26.132  1.638   4.655   1.00 6.93   ? 237 ILE A O   1 
ATOM   1891 C  CB  . ILE A 1 237 ? 25.983  4.881   4.387   1.00 4.57   ? 237 ILE A CB  1 
ATOM   1892 C  CG1 . ILE A 1 237 ? 25.758  6.040   3.410   1.00 5.69   ? 237 ILE A CG1 1 
ATOM   1893 C  CG2 . ILE A 1 237 ? 27.428  4.458   4.463   1.00 8.39   ? 237 ILE A CG2 1 
ATOM   1894 C  CD1 . ILE A 1 237 ? 26.198  5.759   1.994   1.00 4.25   ? 237 ILE A CD1 1 
ATOM   1895 N  N   . TRP A 1 238 ? 24.890  2.700   6.187   1.00 6.92   ? 238 TRP A N   1 
ATOM   1896 C  CA  . TRP A 1 238 ? 25.083  1.657   7.176   1.00 9.55   ? 238 TRP A CA  1 
ATOM   1897 C  C   . TRP A 1 238 ? 24.483  0.413   6.610   1.00 9.19   ? 238 TRP A C   1 
ATOM   1898 O  O   . TRP A 1 238 ? 25.058  -0.674  6.660   1.00 8.76   ? 238 TRP A O   1 
ATOM   1899 C  CB  . TRP A 1 238 ? 24.292  1.976   8.425   1.00 9.95   ? 238 TRP A CB  1 
ATOM   1900 C  CG  . TRP A 1 238 ? 24.483  0.962   9.489   1.00 12.69  ? 238 TRP A CG  1 
ATOM   1901 C  CD1 . TRP A 1 238 ? 25.454  -0.012  9.546   1.00 15.74  ? 238 TRP A CD1 1 
ATOM   1902 C  CD2 . TRP A 1 238 ? 23.703  0.814   10.671  1.00 13.43  ? 238 TRP A CD2 1 
ATOM   1903 N  NE1 . TRP A 1 238 ? 25.315  -0.749  10.693  1.00 16.99  ? 238 TRP A NE1 1 
ATOM   1904 C  CE2 . TRP A 1 238 ? 24.241  -0.258  11.412  1.00 13.54  ? 238 TRP A CE2 1 
ATOM   1905 C  CE3 . TRP A 1 238 ? 22.588  1.491   11.191  1.00 14.61  ? 238 TRP A CE3 1 
ATOM   1906 C  CZ2 . TRP A 1 238 ? 23.716  -0.678  12.628  1.00 10.28  ? 238 TRP A CZ2 1 
ATOM   1907 C  CZ3 . TRP A 1 238 ? 22.064  1.082   12.394  1.00 14.18  ? 238 TRP A CZ3 1 
ATOM   1908 C  CH2 . TRP A 1 238 ? 22.624  0.006   13.103  1.00 9.72   ? 238 TRP A CH2 1 
ATOM   1909 N  N   . ALA A 1 239 ? 23.269  0.606   6.119   1.00 8.45   ? 239 ALA A N   1 
ATOM   1910 C  CA  . ALA A 1 239 ? 22.447  -0.459  5.626   1.00 5.99   ? 239 ALA A CA  1 
ATOM   1911 C  C   . ALA A 1 239 ? 23.217  -1.188  4.575   1.00 5.41   ? 239 ALA A C   1 
ATOM   1912 O  O   . ALA A 1 239 ? 23.204  -2.408  4.533   1.00 10.78  ? 239 ALA A O   1 
ATOM   1913 C  CB  . ALA A 1 239 ? 21.180  0.110   5.043   1.00 5.44   ? 239 ALA A CB  1 
ATOM   1914 N  N   . VAL A 1 240 ? 23.899  -0.438  3.723   1.00 6.55   ? 240 VAL A N   1 
ATOM   1915 C  CA  . VAL A 1 240 ? 24.730  -1.063  2.706   1.00 10.24  ? 240 VAL A CA  1 
ATOM   1916 C  C   . VAL A 1 240 ? 25.842  -1.823  3.401   1.00 7.66   ? 240 VAL A C   1 
ATOM   1917 O  O   . VAL A 1 240 ? 26.126  -2.966  3.062   1.00 6.68   ? 240 VAL A O   1 
ATOM   1918 C  CB  . VAL A 1 240 ? 25.366  -0.033  1.745   1.00 8.84   ? 240 VAL A CB  1 
ATOM   1919 C  CG1 . VAL A 1 240 ? 26.385  -0.707  0.873   1.00 7.69   ? 240 VAL A CG1 1 
ATOM   1920 C  CG2 . VAL A 1 240 ? 24.307  0.659   0.909   1.00 5.01   ? 240 VAL A CG2 1 
ATOM   1921 N  N   . TRP A 1 241 ? 26.443  -1.185  4.400   1.00 7.80   ? 241 TRP A N   1 
ATOM   1922 C  CA  . TRP A 1 241 ? 27.548  -1.782  5.131   1.00 8.73   ? 241 TRP A CA  1 
ATOM   1923 C  C   . TRP A 1 241 ? 27.151  -3.103  5.725   1.00 10.32  ? 241 TRP A C   1 
ATOM   1924 O  O   . TRP A 1 241 ? 27.978  -3.983  5.893   1.00 11.95  ? 241 TRP A O   1 
ATOM   1925 C  CB  . TRP A 1 241 ? 27.989  -0.887  6.281   1.00 10.76  ? 241 TRP A CB  1 
ATOM   1926 C  CG  . TRP A 1 241 ? 29.243  -1.364  6.964   1.00 13.60  ? 241 TRP A CG  1 
ATOM   1927 C  CD1 . TRP A 1 241 ? 30.524  -1.013  6.651   1.00 16.19  ? 241 TRP A CD1 1 
ATOM   1928 C  CD2 . TRP A 1 241 ? 29.338  -2.259  8.075   1.00 16.16  ? 241 TRP A CD2 1 
ATOM   1929 N  NE1 . TRP A 1 241 ? 31.411  -1.631  7.495   1.00 13.21  ? 241 TRP A NE1 1 
ATOM   1930 C  CE2 . TRP A 1 241 ? 30.707  -2.413  8.384   1.00 18.29  ? 241 TRP A CE2 1 
ATOM   1931 C  CE3 . TRP A 1 241 ? 28.399  -2.963  8.848   1.00 22.50  ? 241 TRP A CE3 1 
ATOM   1932 C  CZ2 . TRP A 1 241 ? 31.168  -3.223  9.422   1.00 26.58  ? 241 TRP A CZ2 1 
ATOM   1933 C  CZ3 . TRP A 1 241 ? 28.857  -3.780  9.883   1.00 23.40  ? 241 TRP A CZ3 1 
ATOM   1934 C  CH2 . TRP A 1 241 ? 30.230  -3.901  10.156  1.00 24.43  ? 241 TRP A CH2 1 
ATOM   1935 N  N   . GLN A 1 242 ? 25.888  -3.223  6.100   1.00 12.48  ? 242 GLN A N   1 
ATOM   1936 C  CA  . GLN A 1 242 ? 25.432  -4.403  6.803   1.00 10.72  ? 242 GLN A CA  1 
ATOM   1937 C  C   . GLN A 1 242 ? 25.290  -5.570  5.845   1.00 8.83   ? 242 GLN A C   1 
ATOM   1938 O  O   . GLN A 1 242 ? 25.446  -6.727  6.226   1.00 10.30  ? 242 GLN A O   1 
ATOM   1939 C  CB  . GLN A 1 242 ? 24.109  -4.104  7.497   1.00 12.87  ? 242 GLN A CB  1 
ATOM   1940 C  CG  . GLN A 1 242 ? 24.198  -3.030  8.567   1.00 13.96  ? 242 GLN A CG  1 
ATOM   1941 C  CD  . GLN A 1 242 ? 22.924  -2.897  9.389   1.00 18.26  ? 242 GLN A CD  1 
ATOM   1942 O  OE1 . GLN A 1 242 ? 21.922  -2.345  8.923   1.00 15.52  ? 242 GLN A OE1 1 
ATOM   1943 N  NE2 . GLN A 1 242 ? 22.954  -3.418  10.618  1.00 17.92  ? 242 GLN A NE2 1 
ATOM   1944 N  N   . ILE A 1 243 ? 25.011  -5.251  4.590   1.00 12.17  ? 243 ILE A N   1 
ATOM   1945 C  CA  . ILE A 1 243 ? 24.822  -6.268  3.569   1.00 15.32  ? 243 ILE A CA  1 
ATOM   1946 C  C   . ILE A 1 243 ? 26.145  -6.769  3.055   1.00 14.11  ? 243 ILE A C   1 
ATOM   1947 O  O   . ILE A 1 243 ? 26.343  -7.948  2.809   1.00 15.40  ? 243 ILE A O   1 
ATOM   1948 C  CB  . ILE A 1 243 ? 24.088  -5.700  2.384   1.00 42.67  ? 243 ILE A CB  1 
ATOM   1949 C  CG1 . ILE A 1 243 ? 22.651  -5.465  2.781   1.00 43.56  ? 243 ILE A CG1 1 
ATOM   1950 C  CG2 . ILE A 1 243 ? 24.136  -6.689  1.253   1.00 41.33  ? 243 ILE A CG2 1 
ATOM   1951 C  CD1 . ILE A 1 243 ? 22.019  -6.723  3.296   1.00 38.47  ? 243 ILE A CD1 1 
ATOM   1952 N  N   . ILE A 1 244 ? 27.049  -5.833  2.870   1.00 13.68  ? 244 ILE A N   1 
ATOM   1953 C  CA  . ILE A 1 244 ? 28.399  -6.141  2.496   1.00 12.57  ? 244 ILE A CA  1 
ATOM   1954 C  C   . ILE A 1 244 ? 29.185  -7.043  3.430   1.00 9.21   ? 244 ILE A C   1 
ATOM   1955 O  O   . ILE A 1 244 ? 29.584  -8.145  3.065   1.00 6.29   ? 244 ILE A O   1 
ATOM   1956 C  CB  . ILE A 1 244 ? 29.168  -4.837  2.457   1.00 13.93  ? 244 ILE A CB  1 
ATOM   1957 C  CG1 . ILE A 1 244 ? 28.714  -4.037  1.237   1.00 11.81  ? 244 ILE A CG1 1 
ATOM   1958 C  CG2 . ILE A 1 244 ? 30.650  -5.093  2.455   1.00 15.34  ? 244 ILE A CG2 1 
ATOM   1959 C  CD1 . ILE A 1 244 ? 29.404  -2.732  1.066   1.00 11.08  ? 244 ILE A CD1 1 
ATOM   1960 N  N   . HIS A 1 245 ? 29.377  -6.549  4.645   1.00 13.13  ? 245 HIS A N   1 
ATOM   1961 C  CA  . HIS A 1 245 ? 29.967  -7.267  5.759   1.00 17.57  ? 245 HIS A CA  1 
ATOM   1962 C  C   . HIS A 1 245 ? 28.862  -7.884  6.489   1.00 21.32  ? 245 HIS A C   1 
ATOM   1963 O  O   . HIS A 1 245 ? 28.491  -7.476  7.602   1.00 27.45  ? 245 HIS A O   1 
ATOM   1964 C  CB  . HIS A 1 245 ? 30.694  -6.298  6.628   1.00 16.94  ? 245 HIS A CB  1 
ATOM   1965 C  CG  . HIS A 1 245 ? 31.566  -5.413  5.839   1.00 13.70  ? 245 HIS A CG  1 
ATOM   1966 N  ND1 . HIS A 1 245 ? 32.744  -5.861  5.298   1.00 17.52  ? 245 HIS A ND1 1 
ATOM   1967 C  CD2 . HIS A 1 245 ? 31.386  -4.155  5.386   1.00 14.51  ? 245 HIS A CD2 1 
ATOM   1968 C  CE1 . HIS A 1 245 ? 33.288  -4.893  4.587   1.00 23.34  ? 245 HIS A CE1 1 
ATOM   1969 N  NE2 . HIS A 1 245 ? 32.484  -3.847  4.625   1.00 20.65  ? 245 HIS A NE2 1 
ATOM   1970 N  N   . ARG A 1 246 ? 28.204  -8.868  5.898   1.00 20.17  ? 246 ARG A N   1 
ATOM   1971 C  CA  . ARG A 1 246 ? 27.081  -9.423  6.639   1.00 23.67  ? 246 ARG A CA  1 
ATOM   1972 C  C   . ARG A 1 246 ? 27.557  -10.196 7.860   1.00 30.97  ? 246 ARG A C   1 
ATOM   1973 O  O   . ARG A 1 246 ? 26.976  -10.053 8.942   1.00 30.59  ? 246 ARG A O   1 
ATOM   1974 C  CB  . ARG A 1 246 ? 26.151  -10.270 5.785   1.00 35.18  ? 246 ARG A CB  1 
ATOM   1975 C  CG  . ARG A 1 246 ? 24.906  -10.688 6.532   1.00 42.26  ? 246 ARG A CG  1 
ATOM   1976 C  CD  . ARG A 1 246 ? 23.806  -9.702  6.263   1.00 51.82  ? 246 ARG A CD  1 
ATOM   1977 N  NE  . ARG A 1 246 ? 23.852  -9.336  4.862   1.00 61.54  ? 246 ARG A NE  1 
ATOM   1978 C  CZ  . ARG A 1 246 ? 24.053  -10.208 3.877   1.00 66.94  ? 246 ARG A CZ  1 
ATOM   1979 N  NH1 . ARG A 1 246 ? 24.220  -11.492 4.158   1.00 69.85  ? 246 ARG A NH1 1 
ATOM   1980 N  NH2 . ARG A 1 246 ? 24.089  -9.801  2.609   1.00 70.20  ? 246 ARG A NH2 1 
ATOM   1981 N  N   . ASN A 1 247 ? 28.584  -11.008 7.738   1.00 31.80  ? 247 ASN A N   1 
ATOM   1982 C  CA  . ASN A 1 247 ? 28.995  -11.743 8.912   1.00 35.50  ? 247 ASN A CA  1 
ATOM   1983 C  C   . ASN A 1 247 ? 29.030  -10.818 10.121  1.00 33.61  ? 247 ASN A C   1 
ATOM   1984 O  O   . ASN A 1 247 ? 28.239  -10.971 11.018  1.00 31.30  ? 247 ASN A O   1 
ATOM   1985 C  CB  . ASN A 1 247 ? 30.332  -12.429 8.682   1.00 53.44  ? 247 ASN A CB  1 
ATOM   1986 C  CG  . ASN A 1 247 ? 30.181  -13.816 8.092   1.00 63.72  ? 247 ASN A CG  1 
ATOM   1987 O  OD1 . ASN A 1 247 ? 29.581  -13.992 7.036   1.00 52.67  ? 247 ASN A OD1 1 
ATOM   1988 N  ND2 . ASN A 1 247 ? 30.734  -14.809 8.773   1.00 60.15  ? 247 ASN A ND2 1 
ATOM   1989 N  N   . GLN A 1 248 ? 29.932  -9.845  10.115  1.00 37.52  ? 248 GLN A N   1 
ATOM   1990 C  CA  . GLN A 1 248 ? 30.098  -8.891  11.217  1.00 35.10  ? 248 GLN A CA  1 
ATOM   1991 C  C   . GLN A 1 248 ? 28.845  -8.321  11.853  1.00 30.70  ? 248 GLN A C   1 
ATOM   1992 O  O   . GLN A 1 248 ? 27.842  -8.147  11.200  1.00 30.62  ? 248 GLN A O   1 
ATOM   1993 C  CB  . GLN A 1 248 ? 30.782  -7.616  10.729  1.00 33.06  ? 248 GLN A CB  1 
ATOM   1994 C  CG  . GLN A 1 248 ? 32.167  -7.824  10.175  1.00 34.33  ? 248 GLN A CG  1 
ATOM   1995 C  CD  . GLN A 1 248 ? 33.010  -8.673  11.084  1.00 46.01  ? 248 GLN A CD  1 
ATOM   1996 O  OE1 . GLN A 1 248 ? 32.970  -8.521  12.304  1.00 36.66  ? 248 GLN A OE1 1 
ATOM   1997 N  NE2 . GLN A 1 248 ? 33.789  -9.573  10.500  1.00 44.05  ? 248 GLN A NE2 1 
ATOM   1998 N  N   . ASN A 1 249 ? 28.930  -8.009  13.137  1.00 25.28  ? 249 ASN A N   1 
ATOM   1999 C  CA  . ASN A 1 249 ? 27.780  -7.553  13.888  1.00 27.14  ? 249 ASN A CA  1 
ATOM   2000 C  C   . ASN A 1 249 ? 28.074  -6.342  14.744  1.00 27.81  ? 249 ASN A C   1 
ATOM   2001 O  O   . ASN A 1 249 ? 29.214  -5.911  14.833  1.00 26.42  ? 249 ASN A O   1 
ATOM   2002 C  CB  . ASN A 1 249 ? 27.440  -8.742  14.780  1.00 36.03  ? 249 ASN A CB  1 
ATOM   2003 C  CG  . ASN A 1 249 ? 25.961  -8.844  15.094  1.00 55.27  ? 249 ASN A CG  1 
ATOM   2004 O  OD1 . ASN A 1 249 ? 25.168  -8.010  14.679  1.00 51.93  ? 249 ASN A OD1 1 
ATOM   2005 N  ND2 . ASN A 1 249 ? 25.585  -9.874  15.832  1.00 59.68  ? 249 ASN A ND2 1 
ATOM   2006 N  N   . TYR A 1 250 ? 27.048  -5.796  15.377  1.00 25.58  ? 250 TYR A N   1 
ATOM   2007 C  CA  . TYR A 1 250 ? 27.203  -4.605  16.197  1.00 23.12  ? 250 TYR A CA  1 
ATOM   2008 C  C   . TYR A 1 250 ? 28.244  -4.835  17.292  1.00 25.28  ? 250 TYR A C   1 
ATOM   2009 O  O   . TYR A 1 250 ? 28.431  -5.960  17.763  1.00 28.80  ? 250 TYR A O   1 
ATOM   2010 C  CB  . TYR A 1 250 ? 25.845  -4.220  16.787  1.00 22.63  ? 250 TYR A CB  1 
ATOM   2011 C  CG  . TYR A 1 250 ? 25.856  -2.977  17.634  1.00 24.58  ? 250 TYR A CG  1 
ATOM   2012 C  CD1 . TYR A 1 250 ? 25.684  -1.717  17.069  1.00 24.62  ? 250 TYR A CD1 1 
ATOM   2013 C  CD2 . TYR A 1 250 ? 26.025  -3.066  19.010  1.00 25.77  ? 250 TYR A CD2 1 
ATOM   2014 C  CE1 . TYR A 1 250 ? 25.690  -0.579  17.858  1.00 20.38  ? 250 TYR A CE1 1 
ATOM   2015 C  CE2 . TYR A 1 250 ? 26.034  -1.941  19.802  1.00 22.74  ? 250 TYR A CE2 1 
ATOM   2016 C  CZ  . TYR A 1 250 ? 25.866  -0.706  19.222  1.00 19.85  ? 250 TYR A CZ  1 
ATOM   2017 O  OH  . TYR A 1 250 ? 25.883  0.401   20.025  1.00 21.00  ? 250 TYR A OH  1 
ATOM   2018 N  N   . GLN A 1 251 ? 28.934  -3.770  17.681  1.00 25.35  ? 251 GLN A N   1 
ATOM   2019 C  CA  . GLN A 1 251 ? 29.871  -3.838  18.789  1.00 23.19  ? 251 GLN A CA  1 
ATOM   2020 C  C   . GLN A 1 251 ? 29.814  -2.508  19.506  1.00 21.44  ? 251 GLN A C   1 
ATOM   2021 O  O   . GLN A 1 251 ? 29.647  -1.464  18.866  1.00 22.74  ? 251 GLN A O   1 
ATOM   2022 C  CB  . GLN A 1 251 ? 31.287  -4.134  18.303  1.00 22.66  ? 251 GLN A CB  1 
ATOM   2023 C  CG  . GLN A 1 251 ? 31.462  -5.518  17.694  1.00 22.42  ? 251 GLN A CG  1 
ATOM   2024 C  CD  . GLN A 1 251 ? 32.920  -5.843  17.411  1.00 32.16  ? 251 GLN A CD  1 
ATOM   2025 O  OE1 . GLN A 1 251 ? 33.763  -5.790  18.307  1.00 29.21  ? 251 GLN A OE1 1 
ATOM   2026 N  NE2 . GLN A 1 251 ? 33.221  -6.195  16.165  1.00 36.88  ? 251 GLN A NE2 1 
ATOM   2027 N  N   . PRO A 1 252 ? 29.967  -2.532  20.840  1.00 19.54  ? 252 PRO A N   1 
ATOM   2028 C  CA  . PRO A 1 252 ? 30.310  -3.708  21.641  1.00 21.23  ? 252 PRO A CA  1 
ATOM   2029 C  C   . PRO A 1 252 ? 29.095  -4.549  22.006  1.00 16.71  ? 252 PRO A C   1 
ATOM   2030 O  O   . PRO A 1 252 ? 27.977  -4.052  22.019  1.00 19.45  ? 252 PRO A O   1 
ATOM   2031 C  CB  . PRO A 1 252 ? 30.884  -3.078  22.907  1.00 24.97  ? 252 PRO A CB  1 
ATOM   2032 C  CG  . PRO A 1 252 ? 30.084  -1.870  23.091  1.00 19.90  ? 252 PRO A CG  1 
ATOM   2033 C  CD  . PRO A 1 252 ? 29.805  -1.342  21.694  1.00 19.82  ? 252 PRO A CD  1 
ATOM   2034 N  N   . MET A 1 253 ? 29.294  -5.812  22.335  1.00 11.81  ? 253 MET A N   1 
ATOM   2035 C  CA  . MET A 1 253 ? 28.166  -6.654  22.706  1.00 19.60  ? 253 MET A CA  1 
ATOM   2036 C  C   . MET A 1 253 ? 27.877  -6.563  24.196  1.00 23.63  ? 253 MET A C   1 
ATOM   2037 O  O   . MET A 1 253 ? 26.748  -6.702  24.655  1.00 22.97  ? 253 MET A O   1 
ATOM   2038 C  CB  . MET A 1 253 ? 28.436  -8.108  22.335  1.00 20.81  ? 253 MET A CB  1 
ATOM   2039 C  CG  . MET A 1 253 ? 28.484  -8.385  20.855  1.00 28.64  ? 253 MET A CG  1 
ATOM   2040 S  SD  . MET A 1 253 ? 26.873  -8.823  20.259  1.00 20.78  ? 253 MET A SD  1 
ATOM   2041 C  CE  . MET A 1 253 ? 25.898  -7.587  21.065  1.00 28.69  ? 253 MET A CE  1 
ATOM   2042 N  N   . LYS A 1 254 ? 28.946  -6.428  24.961  1.00 25.06  ? 254 LYS A N   1 
ATOM   2043 C  CA  . LYS A 1 254 ? 28.883  -6.351  26.406  1.00 29.18  ? 254 LYS A CA  1 
ATOM   2044 C  C   . LYS A 1 254 ? 30.130  -5.630  26.877  1.00 43.88  ? 254 LYS A C   1 
ATOM   2045 O  O   . LYS A 1 254 ? 30.876  -5.091  26.080  1.00 49.86  ? 254 LYS A O   1 
ATOM   2046 C  CB  . LYS A 1 254 ? 28.787  -7.740  27.032  1.00 34.42  ? 254 LYS A CB  1 
ATOM   2047 C  CG  . LYS A 1 254 ? 30.073  -8.542  27.048  1.00 41.20  ? 254 LYS A CG  1 
ATOM   2048 C  CD  . LYS A 1 254 ? 30.605  -8.748  28.461  1.00 47.32  ? 254 LYS A CD  1 
ATOM   2049 C  CE  . LYS A 1 254 ? 30.290  -10.132 29.011  1.00 61.67  ? 254 LYS A CE  1 
ATOM   2050 N  NZ  . LYS A 1 254 ? 30.243  -10.187 30.503  1.00 57.61  ? 254 LYS A NZ  1 
ATOM   2051 N  N   . ASN A 1 255 ? 30.382  -5.585  28.168  1.00 50.19  ? 255 ASN A N   1 
ATOM   2052 C  CA  . ASN A 1 255 ? 31.562  -4.844  28.544  1.00 52.25  ? 255 ASN A CA  1 
ATOM   2053 C  C   . ASN A 1 255 ? 31.451  -3.440  27.980  1.00 44.90  ? 255 ASN A C   1 
ATOM   2054 O  O   . ASN A 1 255 ? 32.369  -2.626  28.115  1.00 45.20  ? 255 ASN A O   1 
ATOM   2055 C  CB  . ASN A 1 255 ? 32.742  -5.537  27.888  1.00 69.79  ? 255 ASN A CB  1 
ATOM   2056 C  CG  . ASN A 1 255 ? 33.195  -6.787  28.624  1.00 68.70  ? 255 ASN A CG  1 
ATOM   2057 O  OD1 . ASN A 1 255 ? 34.058  -7.529  28.148  1.00 54.02  ? 255 ASN A OD1 1 
ATOM   2058 N  ND2 . ASN A 1 255 ? 32.619  -7.020  29.796  1.00 69.70  ? 255 ASN A ND2 1 
ATOM   2059 N  N   . GLY A 1 256 ? 30.320  -3.130  27.338  1.00 36.81  ? 256 GLY A N   1 
ATOM   2060 C  CA  . GLY A 1 256 ? 30.050  -1.811  26.802  1.00 29.36  ? 256 GLY A CA  1 
ATOM   2061 C  C   . GLY A 1 256 ? 29.556  -0.809  27.817  1.00 24.19  ? 256 GLY A C   1 
ATOM   2062 O  O   . GLY A 1 256 ? 28.925  -1.181  28.782  1.00 23.80  ? 256 GLY A O   1 
ATOM   2063 N  N   . PRO A 1 257 ? 29.836  0.474   27.576  1.00 14.41  ? 257 PRO A N   1 
ATOM   2064 C  CA  . PRO A 1 257 ? 29.417  1.566   28.458  1.00 19.83  ? 257 PRO A CA  1 
ATOM   2065 C  C   . PRO A 1 257 ? 27.916  1.727   28.549  1.00 23.33  ? 257 PRO A C   1 
ATOM   2066 O  O   . PRO A 1 257 ? 27.238  1.964   27.572  1.00 19.98  ? 257 PRO A O   1 
ATOM   2067 C  CB  . PRO A 1 257 ? 30.022  2.766   27.783  1.00 17.76  ? 257 PRO A CB  1 
ATOM   2068 C  CG  . PRO A 1 257 ? 31.291  2.244   27.232  1.00 14.92  ? 257 PRO A CG  1 
ATOM   2069 C  CD  . PRO A 1 257 ? 31.065  0.819   26.852  1.00 9.86   ? 257 PRO A CD  1 
ATOM   2070 N  N   . PHE A 1 258 ? 27.334  1.465   29.702  1.00 28.04  ? 258 PHE A N   1 
ATOM   2071 C  CA  . PHE A 1 258 ? 25.892  1.286   29.703  1.00 27.01  ? 258 PHE A CA  1 
ATOM   2072 C  C   . PHE A 1 258 ? 25.277  2.302   28.791  1.00 27.87  ? 258 PHE A C   1 
ATOM   2073 O  O   . PHE A 1 258 ? 25.418  3.499   29.007  1.00 22.26  ? 258 PHE A O   1 
ATOM   2074 C  CB  . PHE A 1 258 ? 25.229  1.345   31.089  1.00 30.26  ? 258 PHE A CB  1 
ATOM   2075 C  CG  . PHE A 1 258 ? 23.729  1.198   31.038  1.00 29.35  ? 258 PHE A CG  1 
ATOM   2076 C  CD1 . PHE A 1 258 ? 23.125  -0.008  31.301  1.00 25.55  ? 258 PHE A CD1 1 
ATOM   2077 C  CD2 . PHE A 1 258 ? 22.928  2.261   30.670  1.00 25.14  ? 258 PHE A CD2 1 
ATOM   2078 C  CE1 . PHE A 1 258 ? 21.751  -0.142  31.230  1.00 28.50  ? 258 PHE A CE1 1 
ATOM   2079 C  CE2 . PHE A 1 258 ? 21.559  2.129   30.591  1.00 22.87  ? 258 PHE A CE2 1 
ATOM   2080 C  CZ  . PHE A 1 258 ? 20.970  0.927   30.879  1.00 25.73  ? 258 PHE A CZ  1 
ATOM   2081 N  N   . GLY A 1 259 ? 24.555  1.781   27.807  1.00 31.30  ? 259 GLY A N   1 
ATOM   2082 C  CA  . GLY A 1 259 ? 23.887  2.536   26.768  1.00 30.62  ? 259 GLY A CA  1 
ATOM   2083 C  C   . GLY A 1 259 ? 24.618  2.429   25.446  1.00 28.72  ? 259 GLY A C   1 
ATOM   2084 O  O   . GLY A 1 259 ? 24.267  3.110   24.489  1.00 35.53  ? 259 GLY A O   1 
ATOM   2085 N  N   . GLN A 1 260 ? 25.643  1.585   25.384  1.00 23.34  ? 260 GLN A N   1 
ATOM   2086 C  CA  . GLN A 1 260 ? 26.438  1.467   24.159  1.00 22.99  ? 260 GLN A CA  1 
ATOM   2087 C  C   . GLN A 1 260 ? 26.555  0.011   23.736  1.00 18.94  ? 260 GLN A C   1 
ATOM   2088 O  O   . GLN A 1 260 ? 27.071  -0.309  22.667  1.00 18.61  ? 260 GLN A O   1 
ATOM   2089 C  CB  . GLN A 1 260 ? 27.840  2.076   24.333  1.00 20.36  ? 260 GLN A CB  1 
ATOM   2090 C  CG  . GLN A 1 260 ? 27.884  3.590   24.638  1.00 17.54  ? 260 GLN A CG  1 
ATOM   2091 C  CD  . GLN A 1 260 ? 27.321  4.456   23.506  1.00 18.59  ? 260 GLN A CD  1 
ATOM   2092 O  OE1 . GLN A 1 260 ? 26.992  5.624   23.707  1.00 20.36  ? 260 GLN A OE1 1 
ATOM   2093 N  NE2 . GLN A 1 260 ? 27.218  3.885   22.313  1.00 19.02  ? 260 GLN A NE2 1 
ATOM   2094 N  N   . ASN A 1 261 ? 26.064  -0.871  24.590  1.00 17.86  ? 261 ASN A N   1 
ATOM   2095 C  CA  . ASN A 1 261 ? 26.105  -2.293  24.313  1.00 19.44  ? 261 ASN A CA  1 
ATOM   2096 C  C   . ASN A 1 261 ? 24.896  -2.775  23.527  1.00 19.90  ? 261 ASN A C   1 
ATOM   2097 O  O   . ASN A 1 261 ? 23.847  -2.155  23.544  1.00 26.97  ? 261 ASN A O   1 
ATOM   2098 C  CB  . ASN A 1 261 ? 26.244  -3.066  25.616  1.00 26.06  ? 261 ASN A CB  1 
ATOM   2099 C  CG  . ASN A 1 261 ? 27.566  -2.792  26.305  1.00 26.75  ? 261 ASN A CG  1 
ATOM   2100 O  OD1 . ASN A 1 261 ? 27.610  -2.277  27.419  1.00 26.90  ? 261 ASN A OD1 1 
ATOM   2101 N  ND2 . ASN A 1 261 ? 28.655  -3.122  25.631  1.00 27.22  ? 261 ASN A ND2 1 
ATOM   2102 N  N   . PHE A 1 262 ? 25.064  -3.899  22.847  1.00 16.07  ? 262 PHE A N   1 
ATOM   2103 C  CA  . PHE A 1 262 ? 24.083  -4.418  21.899  1.00 16.09  ? 262 PHE A CA  1 
ATOM   2104 C  C   . PHE A 1 262 ? 22.618  -4.450  22.380  1.00 18.11  ? 262 PHE A C   1 
ATOM   2105 O  O   . PHE A 1 262 ? 21.683  -4.295  21.581  1.00 16.32  ? 262 PHE A O   1 
ATOM   2106 C  CB  . PHE A 1 262 ? 24.519  -5.806  21.454  1.00 20.38  ? 262 PHE A CB  1 
ATOM   2107 C  CG  . PHE A 1 262 ? 23.576  -6.451  20.494  1.00 24.04  ? 262 PHE A CG  1 
ATOM   2108 C  CD1 . PHE A 1 262 ? 23.349  -5.882  19.257  1.00 23.52  ? 262 PHE A CD1 1 
ATOM   2109 C  CD2 . PHE A 1 262 ? 22.933  -7.638  20.815  1.00 24.39  ? 262 PHE A CD2 1 
ATOM   2110 C  CE1 . PHE A 1 262 ? 22.498  -6.472  18.358  1.00 24.35  ? 262 PHE A CE1 1 
ATOM   2111 C  CE2 . PHE A 1 262 ? 22.075  -8.243  19.915  1.00 22.50  ? 262 PHE A CE2 1 
ATOM   2112 C  CZ  . PHE A 1 262 ? 21.861  -7.657  18.680  1.00 26.74  ? 262 PHE A CZ  1 
ATOM   2113 N  N   . ARG A 1 263 ? 22.433  -4.640  23.686  1.00 23.89  ? 263 ARG A N   1 
ATOM   2114 C  CA  . ARG A 1 263 ? 21.100  -4.827  24.290  1.00 24.73  ? 263 ARG A CA  1 
ATOM   2115 C  C   . ARG A 1 263 ? 20.730  -3.800  25.376  1.00 28.30  ? 263 ARG A C   1 
ATOM   2116 O  O   . ARG A 1 263 ? 19.785  -4.017  26.136  1.00 33.05  ? 263 ARG A O   1 
ATOM   2117 C  CB  . ARG A 1 263 ? 20.950  -6.241  24.869  1.00 17.55  ? 263 ARG A CB  1 
ATOM   2118 C  CG  . ARG A 1 263 ? 21.130  -7.348  23.880  1.00 15.34  ? 263 ARG A CG  1 
ATOM   2119 C  CD  . ARG A 1 263 ? 21.251  -8.688  24.566  1.00 18.76  ? 263 ARG A CD  1 
ATOM   2120 N  NE  . ARG A 1 263 ? 21.748  -9.684  23.625  1.00 33.98  ? 263 ARG A NE  1 
ATOM   2121 C  CZ  . ARG A 1 263 ? 20.979  -10.355 22.782  1.00 43.73  ? 263 ARG A CZ  1 
ATOM   2122 N  NH1 . ARG A 1 263 ? 19.668  -10.157 22.766  1.00 42.40  ? 263 ARG A NH1 1 
ATOM   2123 N  NH2 . ARG A 1 263 ? 21.524  -11.231 21.958  1.00 54.15  ? 263 ARG A NH2 1 
ATOM   2124 N  N   . ASP A 1 264 ? 21.474  -2.697  25.449  1.00 27.77  ? 264 ASP A N   1 
ATOM   2125 C  CA  . ASP A 1 264 ? 21.139  -1.602  26.357  1.00 25.38  ? 264 ASP A CA  1 
ATOM   2126 C  C   . ASP A 1 264 ? 20.047  -0.767  25.696  1.00 21.34  ? 264 ASP A C   1 
ATOM   2127 O  O   . ASP A 1 264 ? 19.978  -0.679  24.475  1.00 24.00  ? 264 ASP A O   1 
ATOM   2128 C  CB  . ASP A 1 264 ? 22.366  -0.721  26.626  1.00 26.69  ? 264 ASP A CB  1 
ATOM   2129 C  CG  . ASP A 1 264 ? 23.527  -1.497  27.241  1.00 33.67  ? 264 ASP A CG  1 
ATOM   2130 O  OD1 . ASP A 1 264 ? 23.287  -2.592  27.800  1.00 34.47  ? 264 ASP A OD1 1 
ATOM   2131 O  OD2 . ASP A 1 264 ? 24.676  -0.999  27.195  1.00 33.02  ? 264 ASP A OD2 1 
ATOM   2132 N  N   . PRO A 1 265 ? 19.185  -0.144  26.496  1.00 18.74  ? 265 PRO A N   1 
ATOM   2133 C  CA  . PRO A 1 265 ? 18.243  0.831   25.959  1.00 15.45  ? 265 PRO A CA  1 
ATOM   2134 C  C   . PRO A 1 265 ? 19.034  2.090   25.666  1.00 17.58  ? 265 PRO A C   1 
ATOM   2135 O  O   . PRO A 1 265 ? 19.986  2.388   26.392  1.00 19.38  ? 265 PRO A O   1 
ATOM   2136 C  CB  . PRO A 1 265 ? 17.294  1.089   27.128  1.00 24.78  ? 265 PRO A CB  1 
ATOM   2137 C  CG  . PRO A 1 265 ? 17.687  0.113   28.203  1.00 34.38  ? 265 PRO A CG  1 
ATOM   2138 C  CD  . PRO A 1 265 ? 19.094  -0.248  27.951  1.00 26.28  ? 265 PRO A CD  1 
ATOM   2139 N  N   . MET A 1 266 ? 18.610  2.828   24.660  1.00 16.36  ? 266 MET A N   1 
ATOM   2140 C  CA  . MET A 1 266 ? 19.300  4.019   24.238  1.00 11.68  ? 266 MET A CA  1 
ATOM   2141 C  C   . MET A 1 266 ? 18.511  5.245   24.618  1.00 16.93  ? 266 MET A C   1 
ATOM   2142 O  O   . MET A 1 266 ? 17.514  5.550   23.998  1.00 13.29  ? 266 MET A O   1 
ATOM   2143 C  CB  . MET A 1 266 ? 19.440  4.000   22.731  1.00 10.38  ? 266 MET A CB  1 
ATOM   2144 C  CG  . MET A 1 266 ? 20.461  3.032   22.190  1.00 9.94   ? 266 MET A CG  1 
ATOM   2145 S  SD  . MET A 1 266 ? 20.335  3.004   20.413  1.00 12.14  ? 266 MET A SD  1 
ATOM   2146 C  CE  . MET A 1 266 ? 18.566  2.965   20.237  1.00 11.42  ? 266 MET A CE  1 
ATOM   2147 N  N   . TYR A 1 267 ? 18.958  5.955   25.637  1.00 14.44  ? 267 TYR A N   1 
ATOM   2148 C  CA  . TYR A 1 267 ? 18.312  7.192   26.022  1.00 7.06   ? 267 TYR A CA  1 
ATOM   2149 C  C   . TYR A 1 267 ? 18.072  7.987   24.752  1.00 10.22  ? 267 TYR A C   1 
ATOM   2150 O  O   . TYR A 1 267 ? 18.948  8.056   23.894  1.00 13.09  ? 267 TYR A O   1 
ATOM   2151 C  CB  . TYR A 1 267 ? 19.258  7.952   26.937  1.00 6.93   ? 267 TYR A CB  1 
ATOM   2152 C  CG  . TYR A 1 267 ? 18.678  9.200   27.562  1.00 11.91  ? 267 TYR A CG  1 
ATOM   2153 C  CD1 . TYR A 1 267 ? 17.992  9.137   28.771  1.00 10.77  ? 267 TYR A CD1 1 
ATOM   2154 C  CD2 . TYR A 1 267 ? 18.859  10.452  26.975  1.00 11.09  ? 267 TYR A CD2 1 
ATOM   2155 C  CE1 . TYR A 1 267 ? 17.472  10.264  29.351  1.00 7.28   ? 267 TYR A CE1 1 
ATOM   2156 C  CE2 . TYR A 1 267 ? 18.341  11.584  27.555  1.00 5.23   ? 267 TYR A CE2 1 
ATOM   2157 C  CZ  . TYR A 1 267 ? 17.644  11.474  28.743  1.00 6.38   ? 267 TYR A CZ  1 
ATOM   2158 O  OH  . TYR A 1 267 ? 17.106  12.572  29.358  1.00 15.08  ? 267 TYR A OH  1 
ATOM   2159 N  N   . PRO A 1 268 ? 16.893  8.609   24.619  1.00 12.58  ? 268 PRO A N   1 
ATOM   2160 C  CA  . PRO A 1 268 ? 15.837  8.694   25.632  1.00 11.06  ? 268 PRO A CA  1 
ATOM   2161 C  C   . PRO A 1 268 ? 14.840  7.544   25.605  1.00 13.56  ? 268 PRO A C   1 
ATOM   2162 O  O   . PRO A 1 268 ? 13.867  7.617   26.355  1.00 18.05  ? 268 PRO A O   1 
ATOM   2163 C  CB  . PRO A 1 268 ? 15.113  9.987   25.242  1.00 11.69  ? 268 PRO A CB  1 
ATOM   2164 C  CG  . PRO A 1 268 ? 15.191  10.004  23.714  1.00 10.72  ? 268 PRO A CG  1 
ATOM   2165 C  CD  . PRO A 1 268 ? 16.515  9.302   23.365  1.00 13.99  ? 268 PRO A CD  1 
ATOM   2166 N  N   . TRP A 1 269 ? 15.072  6.517   24.787  1.00 11.00  ? 269 TRP A N   1 
ATOM   2167 C  CA  . TRP A 1 269 ? 14.079  5.452   24.613  1.00 15.32  ? 269 TRP A CA  1 
ATOM   2168 C  C   . TRP A 1 269 ? 14.447  4.155   25.373  1.00 20.61  ? 269 TRP A C   1 
ATOM   2169 O  O   . TRP A 1 269 ? 15.500  4.076   26.031  1.00 16.35  ? 269 TRP A O   1 
ATOM   2170 C  CB  . TRP A 1 269 ? 13.818  5.160   23.119  1.00 14.57  ? 269 TRP A CB  1 
ATOM   2171 C  CG  . TRP A 1 269 ? 13.726  6.400   22.275  1.00 14.24  ? 269 TRP A CG  1 
ATOM   2172 C  CD1 . TRP A 1 269 ? 12.780  7.389   22.362  1.00 14.37  ? 269 TRP A CD1 1 
ATOM   2173 C  CD2 . TRP A 1 269 ? 14.601  6.780   21.203  1.00 11.55  ? 269 TRP A CD2 1 
ATOM   2174 N  NE1 . TRP A 1 269 ? 13.026  8.360   21.425  1.00 8.86   ? 269 TRP A NE1 1 
ATOM   2175 C  CE2 . TRP A 1 269 ? 14.139  8.014   20.702  1.00 8.44   ? 269 TRP A CE2 1 
ATOM   2176 C  CE3 . TRP A 1 269 ? 15.744  6.205   20.630  1.00 11.52  ? 269 TRP A CE3 1 
ATOM   2177 C  CZ2 . TRP A 1 269 ? 14.772  8.683   19.650  1.00 9.52   ? 269 TRP A CZ2 1 
ATOM   2178 C  CZ3 . TRP A 1 269 ? 16.375  6.869   19.581  1.00 10.50  ? 269 TRP A CZ3 1 
ATOM   2179 C  CH2 . TRP A 1 269 ? 15.885  8.096   19.101  1.00 10.36  ? 269 TRP A CH2 1 
ATOM   2180 N  N   . ASN A 1 270 ? 13.570  3.148   25.282  1.00 26.49  ? 270 ASN A N   1 
ATOM   2181 C  CA  . ASN A 1 270 ? 13.861  1.811   25.813  1.00 25.63  ? 270 ASN A CA  1 
ATOM   2182 C  C   . ASN A 1 270 ? 14.487  0.880   24.757  1.00 23.28  ? 270 ASN A C   1 
ATOM   2183 O  O   . ASN A 1 270 ? 15.100  -0.147  25.092  1.00 23.48  ? 270 ASN A O   1 
ATOM   2184 C  CB  . ASN A 1 270 ? 12.612  1.168   26.417  1.00 28.39  ? 270 ASN A CB  1 
ATOM   2185 C  CG  . ASN A 1 270 ? 12.304  1.693   27.797  1.00 49.35  ? 270 ASN A CG  1 
ATOM   2186 O  OD1 . ASN A 1 270 ? 11.238  1.423   28.353  1.00 49.74  ? 270 ASN A OD1 1 
ATOM   2187 N  ND2 . ASN A 1 270 ? 13.241  2.451   28.366  1.00 46.77  ? 270 ASN A ND2 1 
ATOM   2188 N  N   . THR A 1 271 ? 14.350  1.279   23.490  1.00 23.14  ? 271 THR A N   1 
ATOM   2189 C  CA  . THR A 1 271 ? 14.832  0.539   22.322  1.00 18.78  ? 271 THR A CA  1 
ATOM   2190 C  C   . THR A 1 271 ? 16.340  0.282   22.302  1.00 19.37  ? 271 THR A C   1 
ATOM   2191 O  O   . THR A 1 271 ? 17.127  1.163   22.658  1.00 17.46  ? 271 THR A O   1 
ATOM   2192 C  CB  . THR A 1 271 ? 14.502  1.324   21.054  1.00 18.29  ? 271 THR A CB  1 
ATOM   2193 O  OG1 . THR A 1 271 ? 13.173  1.864   21.152  1.00 18.21  ? 271 THR A OG1 1 
ATOM   2194 C  CG2 . THR A 1 271 ? 14.641  0.421   19.836  1.00 15.97  ? 271 THR A CG2 1 
ATOM   2195 N  N   . THR A 1 272 ? 16.736  -0.919  21.873  1.00 19.41  ? 272 THR A N   1 
ATOM   2196 C  CA  . THR A 1 272 ? 18.141  -1.335  21.908  1.00 14.26  ? 272 THR A CA  1 
ATOM   2197 C  C   . THR A 1 272 ? 18.739  -1.429  20.505  1.00 14.47  ? 272 THR A C   1 
ATOM   2198 O  O   . THR A 1 272 ? 18.013  -1.624  19.525  1.00 16.51  ? 272 THR A O   1 
ATOM   2199 C  CB  . THR A 1 272 ? 18.296  -2.709  22.608  1.00 11.39  ? 272 THR A CB  1 
ATOM   2200 O  OG1 . THR A 1 272 ? 17.776  -3.750  21.770  1.00 8.19   ? 272 THR A OG1 1 
ATOM   2201 C  CG2 . THR A 1 272 ? 17.549  -2.716  23.927  1.00 16.51  ? 272 THR A CG2 1 
ATOM   2202 N  N   . PRO A 1 273 ? 20.071  -1.296  20.399  1.00 12.95  ? 273 PRO A N   1 
ATOM   2203 C  CA  . PRO A 1 273 ? 20.703  -1.484  19.091  1.00 14.11  ? 273 PRO A CA  1 
ATOM   2204 C  C   . PRO A 1 273 ? 20.141  -2.736  18.445  1.00 15.58  ? 273 PRO A C   1 
ATOM   2205 O  O   . PRO A 1 273 ? 19.887  -2.757  17.251  1.00 15.98  ? 273 PRO A O   1 
ATOM   2206 C  CB  . PRO A 1 273 ? 22.178  -1.710  19.437  1.00 14.17  ? 273 PRO A CB  1 
ATOM   2207 C  CG  . PRO A 1 273 ? 22.374  -1.021  20.726  1.00 14.70  ? 273 PRO A CG  1 
ATOM   2208 C  CD  . PRO A 1 273 ? 21.059  -1.076  21.467  1.00 13.09  ? 273 PRO A CD  1 
ATOM   2209 N  N   . GLU A 1 274 ? 19.931  -3.775  19.241  1.00 14.52  ? 274 GLU A N   1 
ATOM   2210 C  CA  . GLU A 1 274 ? 19.430  -5.010  18.683  1.00 11.46  ? 274 GLU A CA  1 
ATOM   2211 C  C   . GLU A 1 274 ? 18.119  -4.771  17.977  1.00 11.91  ? 274 GLU A C   1 
ATOM   2212 O  O   . GLU A 1 274 ? 17.870  -5.341  16.931  1.00 16.43  ? 274 GLU A O   1 
ATOM   2213 C  CB  . GLU A 1 274 ? 19.220  -6.054  19.754  1.00 19.96  ? 274 GLU A CB  1 
ATOM   2214 C  CG  . GLU A 1 274 ? 18.845  -7.406  19.188  1.00 21.19  ? 274 GLU A CG  1 
ATOM   2215 C  CD  . GLU A 1 274 ? 18.555  -8.393  20.286  1.00 27.90  ? 274 GLU A CD  1 
ATOM   2216 O  OE1 . GLU A 1 274 ? 18.574  -9.616  20.036  1.00 19.63  ? 274 GLU A OE1 1 
ATOM   2217 O  OE2 . GLU A 1 274 ? 18.307  -7.932  21.419  1.00 33.30  ? 274 GLU A OE2 1 
ATOM   2218 N  N   . ASP A 1 275 ? 17.279  -3.920  18.542  1.00 12.31  ? 275 ASP A N   1 
ATOM   2219 C  CA  . ASP A 1 275 ? 15.917  -3.791  18.051  1.00 12.37  ? 275 ASP A CA  1 
ATOM   2220 C  C   . ASP A 1 275 ? 15.812  -3.291  16.646  1.00 13.64  ? 275 ASP A C   1 
ATOM   2221 O  O   . ASP A 1 275 ? 14.769  -3.437  16.009  1.00 11.43  ? 275 ASP A O   1 
ATOM   2222 C  CB  . ASP A 1 275 ? 15.131  -2.881  18.954  1.00 13.67  ? 275 ASP A CB  1 
ATOM   2223 C  CG  . ASP A 1 275 ? 14.974  -3.460  20.292  1.00 19.75  ? 275 ASP A CG  1 
ATOM   2224 O  OD1 . ASP A 1 275 ? 14.950  -4.704  20.351  1.00 22.73  ? 275 ASP A OD1 1 
ATOM   2225 O  OD2 . ASP A 1 275 ? 14.907  -2.690  21.268  1.00 25.68  ? 275 ASP A OD2 1 
ATOM   2226 N  N   . VAL A 1 276 ? 16.892  -2.702  16.162  1.00 11.33  ? 276 VAL A N   1 
ATOM   2227 C  CA  . VAL A 1 276 ? 16.871  -2.085  14.860  1.00 12.56  ? 276 VAL A CA  1 
ATOM   2228 C  C   . VAL A 1 276 ? 18.080  -2.474  14.034  1.00 15.63  ? 276 VAL A C   1 
ATOM   2229 O  O   . VAL A 1 276 ? 18.574  -1.669  13.260  1.00 14.97  ? 276 VAL A O   1 
ATOM   2230 C  CB  . VAL A 1 276 ? 16.933  -0.567  15.018  1.00 10.70  ? 276 VAL A CB  1 
ATOM   2231 C  CG1 . VAL A 1 276 ? 15.730  -0.071  15.766  1.00 12.68  ? 276 VAL A CG1 1 
ATOM   2232 C  CG2 . VAL A 1 276 ? 18.175  -0.185  15.763  1.00 9.08   ? 276 VAL A CG2 1 
ATOM   2233 N  N   . MET A 1 277 ? 18.612  -3.668  14.156  1.00 13.61  ? 277 MET A N   1 
ATOM   2234 C  CA  . MET A 1 277 ? 19.807  -3.916  13.385  1.00 15.95  ? 277 MET A CA  1 
ATOM   2235 C  C   . MET A 1 277 ? 19.439  -4.443  12.035  1.00 22.05  ? 277 MET A C   1 
ATOM   2236 O  O   . MET A 1 277 ? 20.239  -4.448  11.103  1.00 19.53  ? 277 MET A O   1 
ATOM   2237 C  CB  . MET A 1 277 ? 20.758  -4.828  14.118  1.00 18.81  ? 277 MET A CB  1 
ATOM   2238 C  CG  . MET A 1 277 ? 21.153  -4.234  15.452  1.00 41.12  ? 277 MET A CG  1 
ATOM   2239 S  SD  . MET A 1 277 ? 22.718  -3.405  15.301  1.00 27.70  ? 277 MET A SD  1 
ATOM   2240 C  CE  . MET A 1 277 ? 23.401  -4.502  14.073  1.00 26.43  ? 277 MET A CE  1 
ATOM   2241 N  N   . ASN A 1 278 ? 18.192  -4.856  11.921  1.00 24.31  ? 278 ASN A N   1 
ATOM   2242 C  CA  . ASN A 1 278 ? 17.660  -5.227  10.634  1.00 29.85  ? 278 ASN A CA  1 
ATOM   2243 C  C   . ASN A 1 278 ? 16.562  -4.258  10.234  1.00 25.36  ? 278 ASN A C   1 
ATOM   2244 O  O   . ASN A 1 278 ? 15.488  -4.248  10.833  1.00 17.93  ? 278 ASN A O   1 
ATOM   2245 C  CB  . ASN A 1 278 ? 17.124  -6.641  10.694  1.00 28.88  ? 278 ASN A CB  1 
ATOM   2246 C  CG  . ASN A 1 278 ? 16.545  -7.073  9.393   1.00 34.83  ? 278 ASN A CG  1 
ATOM   2247 O  OD1 . ASN A 1 278 ? 17.102  -6.788  8.334   1.00 33.81  ? 278 ASN A OD1 1 
ATOM   2248 N  ND2 . ASN A 1 278 ? 15.403  -7.741  9.448   1.00 36.47  ? 278 ASN A ND2 1 
ATOM   2249 N  N   . HIS A 1 279 ? 16.851  -3.439  9.227   1.00 25.59  ? 279 HIS A N   1 
ATOM   2250 C  CA  . HIS A 1 279 ? 15.967  -2.345  8.859   1.00 21.33  ? 279 HIS A CA  1 
ATOM   2251 C  C   . HIS A 1 279 ? 14.749  -2.891  8.144   1.00 21.19  ? 279 HIS A C   1 
ATOM   2252 O  O   . HIS A 1 279 ? 13.663  -2.328  8.221   1.00 26.30  ? 279 HIS A O   1 
ATOM   2253 C  CB  . HIS A 1 279 ? 16.691  -1.356  7.961   1.00 21.34  ? 279 HIS A CB  1 
ATOM   2254 C  CG  . HIS A 1 279 ? 17.098  -1.933  6.646   1.00 21.55  ? 279 HIS A CG  1 
ATOM   2255 N  ND1 . HIS A 1 279 ? 16.208  -2.118  5.612   1.00 24.34  ? 279 HIS A ND1 1 
ATOM   2256 C  CD2 . HIS A 1 279 ? 18.296  -2.376  6.198   1.00 23.87  ? 279 HIS A CD2 1 
ATOM   2257 C  CE1 . HIS A 1 279 ? 16.841  -2.645  4.579   1.00 25.88  ? 279 HIS A CE1 1 
ATOM   2258 N  NE2 . HIS A 1 279 ? 18.107  -2.812  4.909   1.00 28.88  ? 279 HIS A NE2 1 
ATOM   2259 N  N   . ARG A 1 280 ? 14.895  -3.961  7.404   1.00 19.57  ? 280 ARG A N   1 
ATOM   2260 C  CA  . ARG A 1 280 ? 13.708  -4.521  6.819   1.00 26.98  ? 280 ARG A CA  1 
ATOM   2261 C  C   . ARG A 1 280 ? 12.733  -4.697  7.942   1.00 23.16  ? 280 ARG A C   1 
ATOM   2262 O  O   . ARG A 1 280 ? 11.676  -4.100  7.962   1.00 23.36  ? 280 ARG A O   1 
ATOM   2263 C  CB  . ARG A 1 280 ? 13.991  -5.873  6.191   1.00 48.92  ? 280 ARG A CB  1 
ATOM   2264 C  CG  . ARG A 1 280 ? 14.714  -5.803  4.862   1.00 63.05  ? 280 ARG A CG  1 
ATOM   2265 C  CD  . ARG A 1 280 ? 16.145  -6.273  5.022   1.00 67.37  ? 280 ARG A CD  1 
ATOM   2266 N  NE  . ARG A 1 280 ? 16.710  -6.626  3.740   1.00 88.82  ? 280 ARG A NE  1 
ATOM   2267 C  CZ  . ARG A 1 280 ? 15.966  -6.878  2.683   1.00 85.60  ? 280 ARG A CZ  1 
ATOM   2268 N  NH1 . ARG A 1 280 ? 14.651  -6.804  2.793   1.00 76.00  ? 280 ARG A NH1 1 
ATOM   2269 N  NH2 . ARG A 1 280 ? 16.528  -7.196  1.528   1.00 96.57  ? 280 ARG A NH2 1 
ATOM   2270 N  N   . LYS A 1 281 ? 13.108  -5.523  8.899   1.00 22.92  ? 281 LYS A N   1 
ATOM   2271 C  CA  . LYS A 1 281 ? 12.194  -5.895  9.983   1.00 24.70  ? 281 LYS A CA  1 
ATOM   2272 C  C   . LYS A 1 281 ? 11.507  -4.681  10.592  1.00 25.44  ? 281 LYS A C   1 
ATOM   2273 O  O   . LYS A 1 281 ? 10.532  -4.815  11.332  1.00 29.00  ? 281 LYS A O   1 
ATOM   2274 C  CB  . LYS A 1 281 ? 12.980  -6.598  11.091  1.00 31.00  ? 281 LYS A CB  1 
ATOM   2275 C  CG  . LYS A 1 281 ? 12.475  -7.978  11.469  1.00 55.09  ? 281 LYS A CG  1 
ATOM   2276 C  CD  . LYS A 1 281 ? 12.805  -8.992  10.394  1.00 58.52  ? 281 LYS A CD  1 
ATOM   2277 C  CE  . LYS A 1 281 ? 12.441  -10.403 10.835  1.00 61.71  ? 281 LYS A CE  1 
ATOM   2278 N  NZ  . LYS A 1 281 ? 13.308  -10.886 11.944  1.00 56.13  ? 281 LYS A NZ  1 
ATOM   2279 N  N   . LEU A 1 282 ? 12.062  -3.504  10.314  1.00 24.17  ? 282 LEU A N   1 
ATOM   2280 C  CA  . LEU A 1 282 ? 11.497  -2.237  10.744  1.00 16.34  ? 282 LEU A CA  1 
ATOM   2281 C  C   . LEU A 1 282 ? 10.538  -1.776  9.677   1.00 15.52  ? 282 LEU A C   1 
ATOM   2282 O  O   . LEU A 1 282 ? 9.901   -0.750  9.815   1.00 15.77  ? 282 LEU A O   1 
ATOM   2283 C  CB  . LEU A 1 282 ? 12.595  -1.197  10.901  1.00 11.71  ? 282 LEU A CB  1 
ATOM   2284 C  CG  . LEU A 1 282 ? 13.714  -1.628  11.832  1.00 14.10  ? 282 LEU A CG  1 
ATOM   2285 C  CD1 . LEU A 1 282 ? 14.823  -0.642  11.665  1.00 16.93  ? 282 LEU A CD1 1 
ATOM   2286 C  CD2 . LEU A 1 282 ? 13.223  -1.689  13.269  1.00 18.14  ? 282 LEU A CD2 1 
ATOM   2287 N  N   . GLY A 1 283 ? 10.459  -2.537  8.597   1.00 18.36  ? 283 GLY A N   1 
ATOM   2288 C  CA  . GLY A 1 283 ? 9.441   -2.318  7.594   1.00 23.57  ? 283 GLY A CA  1 
ATOM   2289 C  C   . GLY A 1 283 ? 9.717   -1.236  6.563   1.00 27.87  ? 283 GLY A C   1 
ATOM   2290 O  O   . GLY A 1 283 ? 8.777   -0.702  5.966   1.00 28.75  ? 283 GLY A O   1 
ATOM   2291 N  N   . TYR A 1 284 ? 10.987  -0.901  6.343   1.00 23.51  ? 284 TYR A N   1 
ATOM   2292 C  CA  . TYR A 1 284 ? 11.355  -0.003  5.245   1.00 21.42  ? 284 TYR A CA  1 
ATOM   2293 C  C   . TYR A 1 284 ? 12.574  -0.544  4.535   1.00 21.00  ? 284 TYR A C   1 
ATOM   2294 O  O   . TYR A 1 284 ? 13.349  -1.300  5.104   1.00 22.51  ? 284 TYR A O   1 
ATOM   2295 C  CB  . TYR A 1 284 ? 11.642  1.418   5.739   1.00 20.39  ? 284 TYR A CB  1 
ATOM   2296 C  CG  . TYR A 1 284 ? 12.939  1.567   6.511   1.00 20.26  ? 284 TYR A CG  1 
ATOM   2297 C  CD1 . TYR A 1 284 ? 14.153  1.792   5.858   1.00 18.47  ? 284 TYR A CD1 1 
ATOM   2298 C  CD2 . TYR A 1 284 ? 12.946  1.494   7.898   1.00 18.92  ? 284 TYR A CD2 1 
ATOM   2299 C  CE1 . TYR A 1 284 ? 15.316  1.941   6.567   1.00 11.49  ? 284 TYR A CE1 1 
ATOM   2300 C  CE2 . TYR A 1 284 ? 14.103  1.625   8.604   1.00 16.89  ? 284 TYR A CE2 1 
ATOM   2301 C  CZ  . TYR A 1 284 ? 15.279  1.853   7.933   1.00 12.17  ? 284 TYR A CZ  1 
ATOM   2302 O  OH  . TYR A 1 284 ? 16.433  1.988   8.639   1.00 11.46  ? 284 TYR A OH  1 
ATOM   2303 N  N   . VAL A 1 285 ? 12.746  -0.143  3.288   1.00 20.93  ? 285 VAL A N   1 
ATOM   2304 C  CA  . VAL A 1 285 ? 13.960  -0.449  2.575   1.00 17.79  ? 285 VAL A CA  1 
ATOM   2305 C  C   . VAL A 1 285 ? 14.262  0.691   1.631   1.00 15.18  ? 285 VAL A C   1 
ATOM   2306 O  O   . VAL A 1 285 ? 13.358  1.409   1.211   1.00 14.75  ? 285 VAL A O   1 
ATOM   2307 C  CB  . VAL A 1 285 ? 13.787  -1.687  1.717   1.00 18.39  ? 285 VAL A CB  1 
ATOM   2308 C  CG1 . VAL A 1 285 ? 12.847  -1.356  0.568   1.00 19.87  ? 285 VAL A CG1 1 
ATOM   2309 C  CG2 . VAL A 1 285 ? 15.156  -2.120  1.200   1.00 17.13  ? 285 VAL A CG2 1 
ATOM   2310 N  N   . TYR A 1 286 ? 15.517  0.715   1.213   1.00 13.60  ? 286 TYR A N   1 
ATOM   2311 C  CA  . TYR A 1 286 ? 16.085  1.684   0.310   1.00 14.90  ? 286 TYR A CA  1 
ATOM   2312 C  C   . TYR A 1 286 ? 16.006  1.202   -1.120  1.00 13.95  ? 286 TYR A C   1 
ATOM   2313 O  O   . TYR A 1 286 ? 16.511  0.149   -1.457  1.00 19.16  ? 286 TYR A O   1 
ATOM   2314 C  CB  . TYR A 1 286 ? 17.535  1.878   0.703   1.00 9.60   ? 286 TYR A CB  1 
ATOM   2315 C  CG  . TYR A 1 286 ? 17.668  2.870   1.788   1.00 4.98   ? 286 TYR A CG  1 
ATOM   2316 C  CD1 . TYR A 1 286 ? 17.372  2.547   3.083   1.00 7.37   ? 286 TYR A CD1 1 
ATOM   2317 C  CD2 . TYR A 1 286 ? 18.027  4.148   1.507   1.00 6.42   ? 286 TYR A CD2 1 
ATOM   2318 C  CE1 . TYR A 1 286 ? 17.451  3.487   4.075   1.00 17.18  ? 286 TYR A CE1 1 
ATOM   2319 C  CE2 . TYR A 1 286 ? 18.117  5.081   2.484   1.00 8.61   ? 286 TYR A CE2 1 
ATOM   2320 C  CZ  . TYR A 1 286 ? 17.831  4.744   3.758   1.00 15.26  ? 286 TYR A CZ  1 
ATOM   2321 O  OH  . TYR A 1 286 ? 17.946  5.709   4.701   1.00 15.98  ? 286 TYR A OH  1 
ATOM   2322 N  N   . ASP A 1 287 ? 15.455  2.065   -1.954  1.00 14.55  ? 287 ASP A N   1 
ATOM   2323 C  CA  . ASP A 1 287 ? 15.318  1.803   -3.356  1.00 23.92  ? 287 ASP A CA  1 
ATOM   2324 C  C   . ASP A 1 287 ? 16.649  1.407   -3.940  1.00 31.15  ? 287 ASP A C   1 
ATOM   2325 O  O   . ASP A 1 287 ? 17.188  2.092   -4.796  1.00 45.60  ? 287 ASP A O   1 
ATOM   2326 C  CB  . ASP A 1 287 ? 14.866  3.051   -4.055  1.00 19.51  ? 287 ASP A CB  1 
ATOM   2327 C  CG  . ASP A 1 287 ? 15.978  3.951   -4.311  1.00 14.86  ? 287 ASP A CG  1 
ATOM   2328 O  OD1 . ASP A 1 287 ? 16.978  3.838   -3.594  1.00 9.65   ? 287 ASP A OD1 1 
ATOM   2329 O  OD2 . ASP A 1 287 ? 15.864  4.765   -5.225  1.00 14.38  ? 287 ASP A OD2 1 
ATOM   2330 N  N   . ILE A 1 288 ? 17.123  0.233   -3.506  1.00 16.42  ? 288 ILE A N   1 
ATOM   2331 C  CA  . ILE A 1 288 ? 18.184  -0.483  -4.157  1.00 14.33  ? 288 ILE A CA  1 
ATOM   2332 C  C   . ILE A 1 288 ? 18.021  -1.721  -3.363  1.00 21.74  ? 288 ILE A C   1 
ATOM   2333 O  O   . ILE A 1 288 ? 18.087  -1.664  -2.155  1.00 21.97  ? 288 ILE A O   1 
ATOM   2334 C  CB  . ILE A 1 288 ? 19.559  0.116   -3.931  1.00 15.63  ? 288 ILE A CB  1 
ATOM   2335 C  CG1 . ILE A 1 288 ? 19.466  1.405   -3.126  1.00 7.99   ? 288 ILE A CG1 1 
ATOM   2336 C  CG2 . ILE A 1 288 ? 20.194  0.433   -5.260  1.00 27.14  ? 288 ILE A CG2 1 
ATOM   2337 C  CD1 . ILE A 1 288 ? 20.774  2.129   -2.946  1.00 2.00   ? 288 ILE A CD1 1 
ATOM   2338 N  N   . GLU A 1 289 ? 17.728  -2.832  -4.024  1.00 31.53  ? 289 GLU A N   1 
ATOM   2339 C  CA  . GLU A 1 289 ? 17.132  -3.956  -3.330  1.00 26.70  ? 289 GLU A CA  1 
ATOM   2340 C  C   . GLU A 1 289 ? 17.096  -5.159  -4.224  1.00 18.77  ? 289 GLU A C   1 
ATOM   2341 O  O   . GLU A 1 289 ? 16.028  -5.536  -4.673  1.00 15.59  ? 289 GLU A O   1 
ATOM   2342 C  CB  . GLU A 1 289 ? 15.691  -3.605  -3.007  1.00 38.24  ? 289 GLU A CB  1 
ATOM   2343 C  CG  . GLU A 1 289 ? 15.321  -2.197  -3.446  1.00 43.56  ? 289 GLU A CG  1 
ATOM   2344 C  CD  . GLU A 1 289 ? 14.091  -2.151  -4.300  1.00 43.64  ? 289 GLU A CD  1 
ATOM   2345 O  OE1 . GLU A 1 289 ? 13.157  -2.907  -4.003  1.00 47.77  ? 289 GLU A OE1 1 
ATOM   2346 O  OE2 . GLU A 1 289 ? 14.057  -1.354  -5.258  1.00 43.52  ? 289 GLU A OE2 1 
ATOM   2347 N  N   . LYS B 1 4   ? -5.107  -4.233  42.103  1.00 55.28  ? 4   LYS B N   1 
ATOM   2348 C  CA  . LYS B 1 4   ? -4.198  -3.193  42.533  1.00 45.79  ? 4   LYS B CA  1 
ATOM   2349 C  C   . LYS B 1 4   ? -3.216  -3.733  43.550  1.00 52.81  ? 4   LYS B C   1 
ATOM   2350 O  O   . LYS B 1 4   ? -3.410  -3.613  44.745  1.00 53.39  ? 4   LYS B O   1 
ATOM   2351 C  CB  . LYS B 1 4   ? -4.986  -2.042  43.110  1.00 51.21  ? 4   LYS B CB  1 
ATOM   2352 C  CG  . LYS B 1 4   ? -6.394  -1.969  42.561  1.00 47.51  ? 4   LYS B CG  1 
ATOM   2353 C  CD  . LYS B 1 4   ? -7.122  -3.297  42.691  1.00 68.22  ? 4   LYS B CD  1 
ATOM   2354 C  CE  . LYS B 1 4   ? -8.630  -3.109  42.709  1.00 80.85  ? 4   LYS B CE  1 
ATOM   2355 N  NZ  . LYS B 1 4   ? -9.087  -2.198  41.627  1.00 58.44  ? 4   LYS B NZ  1 
ATOM   2356 N  N   . TYR B 1 5   ? -2.146  -4.345  43.053  1.00 52.38  ? 5   TYR B N   1 
ATOM   2357 C  CA  . TYR B 1 5   ? -1.131  -4.940  43.915  1.00 68.32  ? 5   TYR B CA  1 
ATOM   2358 C  C   . TYR B 1 5   ? 0.047   -3.980  44.034  1.00 46.80  ? 5   TYR B C   1 
ATOM   2359 O  O   . TYR B 1 5   ? -0.089  -2.780  43.793  1.00 66.11  ? 5   TYR B O   1 
ATOM   2360 C  CB  . TYR B 1 5   ? -0.590  -6.229  43.294  1.00 72.67  ? 5   TYR B CB  1 
ATOM   2361 C  CG  . TYR B 1 5   ? -1.407  -7.459  43.623  1.00 69.68  ? 5   TYR B CG  1 
ATOM   2362 C  CD1 . TYR B 1 5   ? -0.952  -8.392  44.545  1.00 76.93  ? 5   TYR B CD1 1 
ATOM   2363 C  CD2 . TYR B 1 5   ? -2.632  -7.686  43.011  1.00 72.41  ? 5   TYR B CD2 1 
ATOM   2364 C  CE1 . TYR B 1 5   ? -1.695  -9.517  44.849  1.00 106.39 ? 5   TYR B CE1 1 
ATOM   2365 C  CE2 . TYR B 1 5   ? -3.382  -8.808  43.308  1.00 102.14 ? 5   TYR B CE2 1 
ATOM   2366 C  CZ  . TYR B 1 5   ? -2.909  -9.720  44.227  1.00 116.31 ? 5   TYR B CZ  1 
ATOM   2367 O  OH  . TYR B 1 5   ? -3.653  -10.838 44.527  1.00 85.66  ? 5   TYR B OH  1 
ATOM   2368 N  N   . ARG B 1 6   ? 1.207   -4.512  44.407  1.00 26.68  ? 6   ARG B N   1 
ATOM   2369 C  CA  . ARG B 1 6   ? 2.373   -3.688  44.699  1.00 25.88  ? 6   ARG B CA  1 
ATOM   2370 C  C   . ARG B 1 6   ? 2.118   -2.483  45.597  1.00 31.97  ? 6   ARG B C   1 
ATOM   2371 O  O   . ARG B 1 6   ? 2.128   -1.341  45.138  1.00 46.17  ? 6   ARG B O   1 
ATOM   2372 C  CB  . ARG B 1 6   ? 3.019   -3.193  43.403  1.00 32.92  ? 6   ARG B CB  1 
ATOM   2373 C  CG  . ARG B 1 6   ? 3.941   -1.999  43.586  1.00 27.50  ? 6   ARG B CG  1 
ATOM   2374 C  CD  . ARG B 1 6   ? 4.137   -1.248  42.280  1.00 20.58  ? 6   ARG B CD  1 
ATOM   2375 N  NE  . ARG B 1 6   ? 3.096   -1.562  41.306  1.00 25.80  ? 6   ARG B NE  1 
ATOM   2376 C  CZ  . ARG B 1 6   ? 3.313   -2.192  40.157  1.00 35.34  ? 6   ARG B CZ  1 
ATOM   2377 N  NH1 . ARG B 1 6   ? 4.539   -2.579  39.832  1.00 46.27  ? 6   ARG B NH1 1 
ATOM   2378 N  NH2 . ARG B 1 6   ? 2.304   -2.436  39.331  1.00 27.93  ? 6   ARG B NH2 1 
ATOM   2379 N  N   . VAL B 1 7   ? 1.887   -2.747  46.878  1.00 26.39  ? 7   VAL B N   1 
ATOM   2380 C  CA  . VAL B 1 7   ? 1.573   -1.691  47.834  1.00 25.21  ? 7   VAL B CA  1 
ATOM   2381 C  C   . VAL B 1 7   ? 2.711   -0.741  48.193  1.00 33.74  ? 7   VAL B C   1 
ATOM   2382 O  O   . VAL B 1 7   ? 3.757   -1.164  48.685  1.00 39.07  ? 7   VAL B O   1 
ATOM   2383 C  CB  . VAL B 1 7   ? 1.012   -2.310  49.128  1.00 27.75  ? 7   VAL B CB  1 
ATOM   2384 C  CG1 . VAL B 1 7   ? 1.950   -3.388  49.650  1.00 31.28  ? 7   VAL B CG1 1 
ATOM   2385 C  CG2 . VAL B 1 7   ? 0.790   -1.233  50.179  1.00 26.28  ? 7   VAL B CG2 1 
ATOM   2386 N  N   . ARG B 1 8   ? 2.494   0.547   47.945  1.00 38.10  ? 8   ARG B N   1 
ATOM   2387 C  CA  . ARG B 1 8   ? 3.467   1.580   48.295  1.00 35.13  ? 8   ARG B CA  1 
ATOM   2388 C  C   . ARG B 1 8   ? 3.201   2.071   49.711  1.00 31.50  ? 8   ARG B C   1 
ATOM   2389 O  O   . ARG B 1 8   ? 2.093   2.563   50.002  1.00 29.49  ? 8   ARG B O   1 
ATOM   2390 C  CB  . ARG B 1 8   ? 3.405   2.754   47.327  1.00 27.45  ? 8   ARG B CB  1 
ATOM   2391 C  CG  . ARG B 1 8   ? 4.210   2.501   46.092  1.00 26.01  ? 8   ARG B CG  1 
ATOM   2392 C  CD  . ARG B 1 8   ? 3.404   2.780   44.874  1.00 41.08  ? 8   ARG B CD  1 
ATOM   2393 N  NE  . ARG B 1 8   ? 3.376   4.198   44.518  1.00 39.52  ? 8   ARG B NE  1 
ATOM   2394 C  CZ  . ARG B 1 8   ? 3.671   4.658   43.304  1.00 27.28  ? 8   ARG B CZ  1 
ATOM   2395 N  NH1 . ARG B 1 8   ? 4.022   3.820   42.337  1.00 14.63  ? 8   ARG B NH1 1 
ATOM   2396 N  NH2 . ARG B 1 8   ? 3.596   5.953   43.051  1.00 26.03  ? 8   ARG B NH2 1 
ATOM   2397 N  N   . LYS B 1 9   ? 4.243   2.004   50.546  1.00 27.43  ? 9   LYS B N   1 
ATOM   2398 C  CA  . LYS B 1 9   ? 4.166   2.152   51.999  1.00 29.39  ? 9   LYS B CA  1 
ATOM   2399 C  C   . LYS B 1 9   ? 4.771   3.422   52.587  1.00 23.98  ? 9   LYS B C   1 
ATOM   2400 O  O   . LYS B 1 9   ? 5.908   3.716   52.329  1.00 17.30  ? 9   LYS B O   1 
ATOM   2401 C  CB  . LYS B 1 9   ? 4.919   0.989   52.643  1.00 29.85  ? 9   LYS B CB  1 
ATOM   2402 C  CG  . LYS B 1 9   ? 4.086   -0.123  53.245  1.00 36.26  ? 9   LYS B CG  1 
ATOM   2403 C  CD  . LYS B 1 9   ? 4.872   -1.425  53.236  1.00 45.92  ? 9   LYS B CD  1 
ATOM   2404 C  CE  . LYS B 1 9   ? 4.572   -2.275  54.457  1.00 59.43  ? 9   LYS B CE  1 
ATOM   2405 N  NZ  . LYS B 1 9   ? 5.638   -3.268  54.771  1.00 35.83  ? 9   LYS B NZ  1 
ATOM   2406 N  N   . ASN B 1 10  ? 4.021   4.136   53.426  1.00 28.30  ? 10  ASN B N   1 
ATOM   2407 C  CA  . ASN B 1 10  ? 4.592   5.202   54.243  1.00 25.91  ? 10  ASN B CA  1 
ATOM   2408 C  C   . ASN B 1 10  ? 5.963   4.768   54.716  1.00 19.92  ? 10  ASN B C   1 
ATOM   2409 O  O   . ASN B 1 10  ? 6.128   3.637   55.145  1.00 28.09  ? 10  ASN B O   1 
ATOM   2410 C  CB  . ASN B 1 10  ? 3.692   5.476   55.461  1.00 27.47  ? 10  ASN B CB  1 
ATOM   2411 C  CG  . ASN B 1 10  ? 4.050   6.771   56.194  1.00 27.97  ? 10  ASN B CG  1 
ATOM   2412 O  OD1 . ASN B 1 10  ? 5.231   7.149   56.315  1.00 24.03  ? 10  ASN B OD1 1 
ATOM   2413 N  ND2 . ASN B 1 10  ? 3.013   7.465   56.685  1.00 27.34  ? 10  ASN B ND2 1 
ATOM   2414 N  N   . VAL B 1 11  ? 6.912   5.680   54.668  1.00 15.30  ? 11  VAL B N   1 
ATOM   2415 C  CA  . VAL B 1 11  ? 8.284   5.396   55.003  1.00 17.87  ? 11  VAL B CA  1 
ATOM   2416 C  C   . VAL B 1 11  ? 8.482   5.044   56.464  1.00 18.04  ? 11  VAL B C   1 
ATOM   2417 O  O   . VAL B 1 11  ? 9.490   4.485   56.832  1.00 17.05  ? 11  VAL B O   1 
ATOM   2418 C  CB  . VAL B 1 11  ? 9.170   6.596   54.666  1.00 27.06  ? 11  VAL B CB  1 
ATOM   2419 C  CG1 . VAL B 1 11  ? 10.482  6.501   55.408  1.00 31.48  ? 11  VAL B CG1 1 
ATOM   2420 C  CG2 . VAL B 1 11  ? 9.423   6.669   53.177  1.00 21.96  ? 11  VAL B CG2 1 
ATOM   2421 N  N   . LEU B 1 12  ? 7.523   5.372   57.303  1.00 16.26  ? 12  LEU B N   1 
ATOM   2422 C  CA  . LEU B 1 12  ? 7.662   5.133   58.726  1.00 19.26  ? 12  LEU B CA  1 
ATOM   2423 C  C   . LEU B 1 12  ? 7.148   3.775   59.081  1.00 17.03  ? 12  LEU B C   1 
ATOM   2424 O  O   . LEU B 1 12  ? 7.467   3.227   60.116  1.00 16.05  ? 12  LEU B O   1 
ATOM   2425 C  CB  . LEU B 1 12  ? 6.876   6.174   59.497  1.00 30.47  ? 12  LEU B CB  1 
ATOM   2426 C  CG  . LEU B 1 12  ? 7.135   7.575   58.962  1.00 31.19  ? 12  LEU B CG  1 
ATOM   2427 C  CD1 . LEU B 1 12  ? 5.869   8.416   58.876  1.00 34.34  ? 12  LEU B CD1 1 
ATOM   2428 C  CD2 . LEU B 1 12  ? 8.242   8.258   59.739  1.00 25.26  ? 12  LEU B CD2 1 
ATOM   2429 N  N   . HIS B 1 13  ? 6.371   3.214   58.173  1.00 19.54  ? 13  HIS B N   1 
ATOM   2430 C  CA  . HIS B 1 13  ? 5.788   1.912   58.354  1.00 21.10  ? 13  HIS B CA  1 
ATOM   2431 C  C   . HIS B 1 13  ? 6.707   0.812   57.939  1.00 17.60  ? 13  HIS B C   1 
ATOM   2432 O  O   . HIS B 1 13  ? 6.466   -0.359  58.224  1.00 22.18  ? 13  HIS B O   1 
ATOM   2433 C  CB  . HIS B 1 13  ? 4.500   1.842   57.571  1.00 22.01  ? 13  HIS B CB  1 
ATOM   2434 C  CG  . HIS B 1 13  ? 3.371   2.572   58.226  1.00 31.39  ? 13  HIS B CG  1 
ATOM   2435 N  ND1 . HIS B 1 13  ? 2.523   3.337   57.546  1.00 43.91  ? 13  HIS B ND1 1 
ATOM   2436 C  CD2 . HIS B 1 13  ? 2.979   2.637   59.557  1.00 36.47  ? 13  HIS B CD2 1 
ATOM   2437 C  CE1 . HIS B 1 13  ? 1.626   3.869   58.389  1.00 52.01  ? 13  HIS B CE1 1 
ATOM   2438 N  NE2 . HIS B 1 13  ? 1.913   3.440   59.620  1.00 51.28  ? 13  HIS B NE2 1 
ATOM   2439 N  N   . LEU B 1 14  ? 7.777   1.136   57.255  1.00 17.40  ? 14  LEU B N   1 
ATOM   2440 C  CA  . LEU B 1 14  ? 8.646   0.101   56.751  1.00 22.97  ? 14  LEU B CA  1 
ATOM   2441 C  C   . LEU B 1 14  ? 9.483   -0.526  57.846  1.00 27.63  ? 14  LEU B C   1 
ATOM   2442 O  O   . LEU B 1 14  ? 9.737   0.097   58.847  1.00 34.13  ? 14  LEU B O   1 
ATOM   2443 C  CB  . LEU B 1 14  ? 9.571   0.709   55.722  1.00 26.52  ? 14  LEU B CB  1 
ATOM   2444 C  CG  . LEU B 1 14  ? 8.905   1.321   54.528  1.00 17.07  ? 14  LEU B CG  1 
ATOM   2445 C  CD1 . LEU B 1 14  ? 9.882   2.340   54.013  1.00 17.86  ? 14  LEU B CD1 1 
ATOM   2446 C  CD2 . LEU B 1 14  ? 8.709   0.222   53.524  1.00 22.63  ? 14  LEU B CD2 1 
ATOM   2447 N  N   . THR B 1 15  ? 9.938   -1.752  57.634  1.00 23.81  ? 15  THR B N   1 
ATOM   2448 C  CA  . THR B 1 15  ? 10.813  -2.402  58.583  1.00 25.94  ? 15  THR B CA  1 
ATOM   2449 C  C   . THR B 1 15  ? 12.192  -1.825  58.472  1.00 26.77  ? 15  THR B C   1 
ATOM   2450 O  O   . THR B 1 15  ? 12.363  -0.778  57.900  1.00 29.54  ? 15  THR B O   1 
ATOM   2451 C  CB  . THR B 1 15  ? 10.930  -3.886  58.284  1.00 33.35  ? 15  THR B CB  1 
ATOM   2452 O  OG1 . THR B 1 15  ? 12.221  -4.150  57.732  1.00 26.50  ? 15  THR B OG1 1 
ATOM   2453 C  CG2 . THR B 1 15  ? 9.868   -4.293  57.293  1.00 32.27  ? 15  THR B CG2 1 
ATOM   2454 N  N   . ASP B 1 16  ? 13.178  -2.510  59.027  1.00 26.60  ? 16  ASP B N   1 
ATOM   2455 C  CA  . ASP B 1 16  ? 14.562  -2.100  58.918  1.00 28.64  ? 16  ASP B CA  1 
ATOM   2456 C  C   . ASP B 1 16  ? 15.221  -2.974  57.883  1.00 24.48  ? 16  ASP B C   1 
ATOM   2457 O  O   . ASP B 1 16  ? 16.341  -2.716  57.482  1.00 26.07  ? 16  ASP B O   1 
ATOM   2458 C  CB  . ASP B 1 16  ? 15.303  -2.275  60.235  1.00 40.02  ? 16  ASP B CB  1 
ATOM   2459 C  CG  . ASP B 1 16  ? 14.892  -1.268  61.289  1.00 44.69  ? 16  ASP B CG  1 
ATOM   2460 O  OD1 . ASP B 1 16  ? 14.890  -0.059  61.002  1.00 50.10  ? 16  ASP B OD1 1 
ATOM   2461 O  OD2 . ASP B 1 16  ? 14.590  -1.690  62.424  1.00 57.77  ? 16  ASP B OD2 1 
ATOM   2462 N  N   . THR B 1 17  ? 14.526  -4.022  57.456  1.00 19.37  ? 17  THR B N   1 
ATOM   2463 C  CA  . THR B 1 17  ? 14.992  -4.775  56.325  1.00 20.59  ? 17  THR B CA  1 
ATOM   2464 C  C   . THR B 1 17  ? 14.412  -4.155  55.071  1.00 26.36  ? 17  THR B C   1 
ATOM   2465 O  O   . THR B 1 17  ? 15.119  -4.016  54.080  1.00 31.62  ? 17  THR B O   1 
ATOM   2466 C  CB  . THR B 1 17  ? 14.628  -6.248  56.496  1.00 23.56  ? 17  THR B CB  1 
ATOM   2467 O  OG1 . THR B 1 17  ? 14.330  -6.808  55.221  1.00 22.23  ? 17  THR B OG1 1 
ATOM   2468 C  CG2 . THR B 1 17  ? 13.378  -6.346  57.378  1.00 29.20  ? 17  THR B CG2 1 
ATOM   2469 N  N   . GLU B 1 18  ? 13.139  -3.780  55.081  1.00 25.79  ? 18  GLU B N   1 
ATOM   2470 C  CA  . GLU B 1 18  ? 12.579  -3.115  53.910  1.00 29.01  ? 18  GLU B CA  1 
ATOM   2471 C  C   . GLU B 1 18  ? 13.466  -1.968  53.434  1.00 24.10  ? 18  GLU B C   1 
ATOM   2472 O  O   . GLU B 1 18  ? 13.973  -1.968  52.312  1.00 27.25  ? 18  GLU B O   1 
ATOM   2473 C  CB  . GLU B 1 18  ? 11.212  -2.513  54.231  1.00 26.23  ? 18  GLU B CB  1 
ATOM   2474 C  CG  . GLU B 1 18  ? 10.056  -3.167  53.491  1.00 26.99  ? 18  GLU B CG  1 
ATOM   2475 C  CD  . GLU B 1 18  ? 9.061   -3.823  54.428  1.00 37.82  ? 18  GLU B CD  1 
ATOM   2476 O  OE1 . GLU B 1 18  ? 9.249   -3.727  55.659  1.00 40.57  ? 18  GLU B OE1 1 
ATOM   2477 O  OE2 . GLU B 1 18  ? 8.090   -4.434  53.933  1.00 45.39  ? 18  GLU B OE2 1 
ATOM   2478 N  N   . LYS B 1 19  ? 13.645  -0.998  54.322  1.00 17.04  ? 19  LYS B N   1 
ATOM   2479 C  CA  . LYS B 1 19  ? 14.624  0.081   54.215  1.00 21.98  ? 19  LYS B CA  1 
ATOM   2480 C  C   . LYS B 1 19  ? 16.033  -0.350  53.852  1.00 22.33  ? 19  LYS B C   1 
ATOM   2481 O  O   . LYS B 1 19  ? 16.758  0.392   53.223  1.00 19.96  ? 19  LYS B O   1 
ATOM   2482 C  CB  . LYS B 1 19  ? 14.685  0.890   55.506  1.00 30.05  ? 19  LYS B CB  1 
ATOM   2483 C  CG  . LYS B 1 19  ? 13.366  0.993   56.244  1.00 34.46  ? 19  LYS B CG  1 
ATOM   2484 C  CD  . LYS B 1 19  ? 13.322  2.191   57.178  1.00 37.05  ? 19  LYS B CD  1 
ATOM   2485 C  CE  . LYS B 1 19  ? 14.586  2.312   58.000  1.00 28.28  ? 19  LYS B CE  1 
ATOM   2486 N  NZ  . LYS B 1 19  ? 14.271  2.402   59.446  1.00 48.44  ? 19  LYS B NZ  1 
ATOM   2487 N  N   . ARG B 1 20  ? 16.440  -1.534  54.265  1.00 25.74  ? 20  ARG B N   1 
ATOM   2488 C  CA  . ARG B 1 20  ? 17.781  -1.997  53.952  1.00 31.56  ? 20  ARG B CA  1 
ATOM   2489 C  C   . ARG B 1 20  ? 17.786  -2.328  52.505  1.00 26.50  ? 20  ARG B C   1 
ATOM   2490 O  O   . ARG B 1 20  ? 18.780  -2.160  51.827  1.00 24.21  ? 20  ARG B O   1 
ATOM   2491 C  CB  . ARG B 1 20  ? 18.106  -3.260  54.738  1.00 36.69  ? 20  ARG B CB  1 
ATOM   2492 C  CG  . ARG B 1 20  ? 19.429  -3.922  54.395  1.00 71.42  ? 20  ARG B CG  1 
ATOM   2493 C  CD  . ARG B 1 20  ? 19.829  -4.948  55.456  1.00 99.09  ? 20  ARG B CD  1 
ATOM   2494 N  NE  . ARG B 1 20  ? 20.309  -4.339  56.706  1.00 124.39 ? 20  ARG B NE  1 
ATOM   2495 C  CZ  . ARG B 1 20  ? 20.080  -4.828  57.924  1.00 115.94 ? 20  ARG B CZ  1 
ATOM   2496 N  NH1 . ARG B 1 20  ? 19.371  -5.935  58.074  1.00 105.08 ? 20  ARG B NH1 1 
ATOM   2497 N  NH2 . ARG B 1 20  ? 20.558  -4.210  58.993  1.00 134.59 ? 20  ARG B NH2 1 
ATOM   2498 N  N   . ASP B 1 21  ? 16.652  -2.813  52.040  1.00 22.41  ? 21  ASP B N   1 
ATOM   2499 C  CA  . ASP B 1 21  ? 16.523  -3.261  50.678  1.00 22.54  ? 21  ASP B CA  1 
ATOM   2500 C  C   . ASP B 1 21  ? 16.436  -2.065  49.776  1.00 20.53  ? 21  ASP B C   1 
ATOM   2501 O  O   . ASP B 1 21  ? 17.337  -1.803  49.007  1.00 20.02  ? 21  ASP B O   1 
ATOM   2502 C  CB  . ASP B 1 21  ? 15.280  -4.118  50.545  1.00 28.49  ? 21  ASP B CB  1 
ATOM   2503 C  CG  . ASP B 1 21  ? 15.458  -5.482  51.153  1.00 28.30  ? 21  ASP B CG  1 
ATOM   2504 O  OD1 . ASP B 1 21  ? 16.562  -5.772  51.634  1.00 33.46  ? 21  ASP B OD1 1 
ATOM   2505 O  OD2 . ASP B 1 21  ? 14.499  -6.268  51.140  1.00 25.45  ? 21  ASP B OD2 1 
ATOM   2506 N  N   . PHE B 1 22  ? 15.326  -1.360  49.794  1.00 17.65  ? 22  PHE B N   1 
ATOM   2507 C  CA  . PHE B 1 22  ? 15.258  -0.184  48.961  1.00 19.26  ? 22  PHE B CA  1 
ATOM   2508 C  C   . PHE B 1 22  ? 16.455  0.664   48.632  1.00 16.73  ? 22  PHE B C   1 
ATOM   2509 O  O   . PHE B 1 22  ? 16.631  1.146   47.532  1.00 16.42  ? 22  PHE B O   1 
ATOM   2510 C  CB  . PHE B 1 22  ? 14.525  0.912   49.702  1.00 19.80  ? 22  PHE B CB  1 
ATOM   2511 C  CG  . PHE B 1 22  ? 14.110  2.076   48.854  1.00 17.07  ? 22  PHE B CG  1 
ATOM   2512 C  CD1 . PHE B 1 22  ? 13.282  1.907   47.785  1.00 18.01  ? 22  PHE B CD1 1 
ATOM   2513 C  CD2 . PHE B 1 22  ? 14.500  3.349   49.182  1.00 15.94  ? 22  PHE B CD2 1 
ATOM   2514 C  CE1 . PHE B 1 22  ? 12.871  2.986   47.036  1.00 14.75  ? 22  PHE B CE1 1 
ATOM   2515 C  CE2 . PHE B 1 22  ? 14.099  4.426   48.439  1.00 16.46  ? 22  PHE B CE2 1 
ATOM   2516 C  CZ  . PHE B 1 22  ? 13.277  4.247   47.369  1.00 11.80  ? 22  PHE B CZ  1 
ATOM   2517 N  N   . VAL B 1 23  ? 17.223  0.916   49.672  1.00 16.83  ? 23  VAL B N   1 
ATOM   2518 C  CA  . VAL B 1 23  ? 18.340  1.825   49.596  1.00 15.17  ? 23  VAL B CA  1 
ATOM   2519 C  C   . VAL B 1 23  ? 19.442  1.073   48.951  1.00 11.72  ? 23  VAL B C   1 
ATOM   2520 O  O   . VAL B 1 23  ? 20.490  1.624   48.719  1.00 8.77   ? 23  VAL B O   1 
ATOM   2521 C  CB  . VAL B 1 23  ? 18.868  2.217   50.964  1.00 15.22  ? 23  VAL B CB  1 
ATOM   2522 C  CG1 . VAL B 1 23  ? 20.374  2.338   50.899  1.00 11.99  ? 23  VAL B CG1 1 
ATOM   2523 C  CG2 . VAL B 1 23  ? 18.237  3.513   51.403  1.00 15.03  ? 23  VAL B CG2 1 
ATOM   2524 N  N   . ARG B 1 24  ? 19.220  -0.197  48.695  1.00 16.56  ? 24  ARG B N   1 
ATOM   2525 C  CA  . ARG B 1 24  ? 20.285  -1.039  48.208  1.00 19.39  ? 24  ARG B CA  1 
ATOM   2526 C  C   . ARG B 1 24  ? 19.986  -1.278  46.762  1.00 15.90  ? 24  ARG B C   1 
ATOM   2527 O  O   . ARG B 1 24  ? 20.883  -1.378  45.951  1.00 11.56  ? 24  ARG B O   1 
ATOM   2528 C  CB  . ARG B 1 24  ? 20.337  -2.340  49.017  1.00 30.25  ? 24  ARG B CB  1 
ATOM   2529 C  CG  . ARG B 1 24  ? 20.839  -3.567  48.277  1.00 41.03  ? 24  ARG B CG  1 
ATOM   2530 C  CD  . ARG B 1 24  ? 20.377  -4.855  48.950  1.00 50.36  ? 24  ARG B CD  1 
ATOM   2531 N  NE  . ARG B 1 24  ? 21.336  -5.254  49.962  1.00 73.50  ? 24  ARG B NE  1 
ATOM   2532 C  CZ  . ARG B 1 24  ? 22.213  -4.408  50.482  1.00 102.70 ? 24  ARG B CZ  1 
ATOM   2533 N  NH1 . ARG B 1 24  ? 22.210  -3.150  50.076  1.00 114.92 ? 24  ARG B NH1 1 
ATOM   2534 N  NH2 . ARG B 1 24  ? 23.079  -4.803  51.401  1.00 114.83 ? 24  ARG B NH2 1 
ATOM   2535 N  N   . THR B 1 25  ? 18.702  -1.343  46.448  1.00 13.00  ? 25  THR B N   1 
ATOM   2536 C  CA  . THR B 1 25  ? 18.251  -1.447  45.071  1.00 10.80  ? 25  THR B CA  1 
ATOM   2537 C  C   . THR B 1 25  ? 18.501  -0.183  44.280  1.00 12.43  ? 25  THR B C   1 
ATOM   2538 O  O   . THR B 1 25  ? 18.727  -0.211  43.067  1.00 12.78  ? 25  THR B O   1 
ATOM   2539 C  CB  . THR B 1 25  ? 16.749  -1.707  45.018  1.00 13.40  ? 25  THR B CB  1 
ATOM   2540 O  OG1 . THR B 1 25  ? 16.417  -2.824  45.860  1.00 15.85  ? 25  THR B OG1 1 
ATOM   2541 C  CG2 . THR B 1 25  ? 16.325  -1.971  43.576  1.00 20.91  ? 25  THR B CG2 1 
ATOM   2542 N  N   . VAL B 1 26  ? 18.430  0.935   44.981  1.00 10.70  ? 26  VAL B N   1 
ATOM   2543 C  CA  . VAL B 1 26  ? 18.621  2.220   44.362  1.00 8.01   ? 26  VAL B CA  1 
ATOM   2544 C  C   . VAL B 1 26  ? 20.066  2.336   43.974  1.00 11.67  ? 26  VAL B C   1 
ATOM   2545 O  O   . VAL B 1 26  ? 20.383  2.795   42.876  1.00 17.55  ? 26  VAL B O   1 
ATOM   2546 C  CB  . VAL B 1 26  ? 18.289  3.341   45.343  1.00 8.33   ? 26  VAL B CB  1 
ATOM   2547 C  CG1 . VAL B 1 26  ? 19.020  4.615   44.970  1.00 12.46  ? 26  VAL B CG1 1 
ATOM   2548 C  CG2 . VAL B 1 26  ? 16.787  3.547   45.389  1.00 11.41  ? 26  VAL B CG2 1 
ATOM   2549 N  N   . LEU B 1 27  ? 20.942  1.898   44.875  1.00 12.65  ? 27  LEU B N   1 
ATOM   2550 C  CA  . LEU B 1 27  ? 22.377  1.925   44.614  1.00 15.08  ? 27  LEU B CA  1 
ATOM   2551 C  C   . LEU B 1 27  ? 22.727  1.048   43.422  1.00 12.26  ? 27  LEU B C   1 
ATOM   2552 O  O   . LEU B 1 27  ? 23.614  1.372   42.635  1.00 13.14  ? 27  LEU B O   1 
ATOM   2553 C  CB  . LEU B 1 27  ? 23.157  1.496   45.846  1.00 13.02  ? 27  LEU B CB  1 
ATOM   2554 C  CG  . LEU B 1 27  ? 23.167  2.532   46.971  1.00 13.31  ? 27  LEU B CG  1 
ATOM   2555 C  CD1 . LEU B 1 27  ? 23.902  1.975   48.170  1.00 14.61  ? 27  LEU B CD1 1 
ATOM   2556 C  CD2 . LEU B 1 27  ? 23.817  3.809   46.488  1.00 6.60   ? 27  LEU B CD2 1 
ATOM   2557 N  N   . ILE B 1 28  ? 21.994  -0.044  43.256  1.00 14.22  ? 28  ILE B N   1 
ATOM   2558 C  CA  . ILE B 1 28  ? 22.222  -0.990  42.157  1.00 19.17  ? 28  ILE B CA  1 
ATOM   2559 C  C   . ILE B 1 28  ? 21.639  -0.521  40.843  1.00 16.80  ? 28  ILE B C   1 
ATOM   2560 O  O   . ILE B 1 28  ? 22.037  -0.969  39.790  1.00 21.50  ? 28  ILE B O   1 
ATOM   2561 C  CB  . ILE B 1 28  ? 21.601  -2.351  42.444  1.00 18.90  ? 28  ILE B CB  1 
ATOM   2562 C  CG1 . ILE B 1 28  ? 22.497  -3.469  41.958  1.00 23.49  ? 28  ILE B CG1 1 
ATOM   2563 C  CG2 . ILE B 1 28  ? 20.289  -2.472  41.715  1.00 18.46  ? 28  ILE B CG2 1 
ATOM   2564 C  CD1 . ILE B 1 28  ? 21.773  -4.789  41.853  1.00 27.77  ? 28  ILE B CD1 1 
ATOM   2565 N  N   . LEU B 1 29  ? 20.677  0.375   40.918  1.00 13.81  ? 29  LEU B N   1 
ATOM   2566 C  CA  . LEU B 1 29  ? 20.270  1.145   39.767  1.00 22.87  ? 29  LEU B CA  1 
ATOM   2567 C  C   . LEU B 1 29  ? 21.429  2.083   39.510  1.00 20.43  ? 29  LEU B C   1 
ATOM   2568 O  O   . LEU B 1 29  ? 22.053  2.060   38.476  1.00 15.00  ? 29  LEU B O   1 
ATOM   2569 C  CB  . LEU B 1 29  ? 19.058  1.991   40.123  1.00 24.42  ? 29  LEU B CB  1 
ATOM   2570 C  CG  . LEU B 1 29  ? 17.722  1.975   39.401  1.00 22.42  ? 29  LEU B CG  1 
ATOM   2571 C  CD1 . LEU B 1 29  ? 17.862  1.576   37.950  1.00 29.30  ? 29  LEU B CD1 1 
ATOM   2572 C  CD2 . LEU B 1 29  ? 16.739  1.078   40.116  1.00 24.83  ? 29  LEU B CD2 1 
ATOM   2573 N  N   . LYS B 1 30  ? 21.650  2.961   40.469  1.00 20.20  ? 30  LYS B N   1 
ATOM   2574 C  CA  . LYS B 1 30  ? 22.484  4.108   40.281  1.00 17.78  ? 30  LYS B CA  1 
ATOM   2575 C  C   . LYS B 1 30  ? 23.694  3.741   39.530  1.00 15.53  ? 30  LYS B C   1 
ATOM   2576 O  O   . LYS B 1 30  ? 24.335  4.590   38.937  1.00 18.84  ? 30  LYS B O   1 
ATOM   2577 C  CB  . LYS B 1 30  ? 22.925  4.675   41.613  1.00 22.51  ? 30  LYS B CB  1 
ATOM   2578 C  CG  . LYS B 1 30  ? 24.254  5.407   41.541  1.00 26.50  ? 30  LYS B CG  1 
ATOM   2579 C  CD  . LYS B 1 30  ? 24.093  6.862   41.930  1.00 34.65  ? 30  LYS B CD  1 
ATOM   2580 C  CE  . LYS B 1 30  ? 24.062  7.754   40.706  1.00 41.17  ? 30  LYS B CE  1 
ATOM   2581 N  NZ  . LYS B 1 30  ? 22.974  8.768   40.753  1.00 39.03  ? 30  LYS B NZ  1 
ATOM   2582 N  N   . GLU B 1 31  ? 24.047  2.478   39.580  1.00 20.17  ? 31  GLU B N   1 
ATOM   2583 C  CA  . GLU B 1 31  ? 25.350  2.119   39.079  1.00 25.02  ? 31  GLU B CA  1 
ATOM   2584 C  C   . GLU B 1 31  ? 25.367  1.097   37.980  1.00 23.64  ? 31  GLU B C   1 
ATOM   2585 O  O   . GLU B 1 31  ? 26.425  0.631   37.601  1.00 23.36  ? 31  GLU B O   1 
ATOM   2586 C  CB  . GLU B 1 31  ? 26.240  1.662   40.208  1.00 29.62  ? 31  GLU B CB  1 
ATOM   2587 C  CG  . GLU B 1 31  ? 27.360  0.808   39.710  1.00 37.84  ? 31  GLU B CG  1 
ATOM   2588 C  CD  . GLU B 1 31  ? 26.957  -0.628  39.641  1.00 70.61  ? 31  GLU B CD  1 
ATOM   2589 O  OE1 . GLU B 1 31  ? 26.358  -1.119  40.614  1.00 84.98  ? 31  GLU B OE1 1 
ATOM   2590 O  OE2 . GLU B 1 31  ? 27.242  -1.263  38.615  1.00 85.20  ? 31  GLU B OE2 1 
ATOM   2591 N  N   . LYS B 1 32  ? 24.203  0.770   37.440  1.00 19.74  ? 32  LYS B N   1 
ATOM   2592 C  CA  . LYS B 1 32  ? 24.153  0.002   36.226  1.00 14.54  ? 32  LYS B CA  1 
ATOM   2593 C  C   . LYS B 1 32  ? 23.972  1.019   35.150  1.00 18.30  ? 32  LYS B C   1 
ATOM   2594 O  O   . LYS B 1 32  ? 23.821  0.689   34.001  1.00 21.21  ? 32  LYS B O   1 
ATOM   2595 C  CB  . LYS B 1 32  ? 22.972  -0.940  36.208  1.00 14.32  ? 32  LYS B CB  1 
ATOM   2596 C  CG  . LYS B 1 32  ? 22.923  -1.917  37.366  1.00 18.28  ? 32  LYS B CG  1 
ATOM   2597 C  CD  . LYS B 1 32  ? 21.969  -3.066  37.089  1.00 24.63  ? 32  LYS B CD  1 
ATOM   2598 C  CE  . LYS B 1 32  ? 22.674  -4.394  37.236  1.00 24.95  ? 32  LYS B CE  1 
ATOM   2599 N  NZ  . LYS B 1 32  ? 24.046  -4.186  37.761  1.00 28.91  ? 32  LYS B NZ  1 
ATOM   2600 N  N   . GLY B 1 33  ? 23.983  2.282   35.531  1.00 24.40  ? 33  GLY B N   1 
ATOM   2601 C  CA  . GLY B 1 33  ? 23.855  3.360   34.576  1.00 16.24  ? 33  GLY B CA  1 
ATOM   2602 C  C   . GLY B 1 33  ? 22.453  3.894   34.515  1.00 16.87  ? 33  GLY B C   1 
ATOM   2603 O  O   . GLY B 1 33  ? 22.214  4.924   33.948  1.00 17.66  ? 33  GLY B O   1 
ATOM   2604 N  N   . ILE B 1 34  ? 21.521  3.175   35.109  1.00 22.20  ? 34  ILE B N   1 
ATOM   2605 C  CA  . ILE B 1 34  ? 20.109  3.459   34.956  1.00 25.14  ? 34  ILE B CA  1 
ATOM   2606 C  C   . ILE B 1 34  ? 19.633  4.746   35.602  1.00 22.07  ? 34  ILE B C   1 
ATOM   2607 O  O   . ILE B 1 34  ? 18.943  5.534   34.979  1.00 15.69  ? 34  ILE B O   1 
ATOM   2608 C  CB  . ILE B 1 34  ? 19.266  2.339   35.568  1.00 25.76  ? 34  ILE B CB  1 
ATOM   2609 C  CG1 . ILE B 1 34  ? 19.141  1.160   34.614  1.00 14.32  ? 34  ILE B CG1 1 
ATOM   2610 C  CG2 . ILE B 1 34  ? 17.896  2.871   35.942  1.00 21.95  ? 34  ILE B CG2 1 
ATOM   2611 C  CD1 . ILE B 1 34  ? 18.781  -0.114  35.323  1.00 13.97  ? 34  ILE B CD1 1 
ATOM   2612 N  N   . TYR B 1 35  ? 19.984  4.951   36.857  1.00 19.80  ? 35  TYR B N   1 
ATOM   2613 C  CA  . TYR B 1 35  ? 19.500  6.112   37.560  1.00 17.92  ? 35  TYR B CA  1 
ATOM   2614 C  C   . TYR B 1 35  ? 19.706  7.320   36.723  1.00 13.08  ? 35  TYR B C   1 
ATOM   2615 O  O   . TYR B 1 35  ? 18.761  7.947   36.357  1.00 15.46  ? 35  TYR B O   1 
ATOM   2616 C  CB  . TYR B 1 35  ? 20.211  6.301   38.882  1.00 26.05  ? 35  TYR B CB  1 
ATOM   2617 C  CG  . TYR B 1 35  ? 19.363  7.008   39.895  1.00 33.53  ? 35  TYR B CG  1 
ATOM   2618 C  CD1 . TYR B 1 35  ? 18.967  6.385   41.058  1.00 26.21  ? 35  TYR B CD1 1 
ATOM   2619 C  CD2 . TYR B 1 35  ? 18.952  8.298   39.685  1.00 30.87  ? 35  TYR B CD2 1 
ATOM   2620 C  CE1 . TYR B 1 35  ? 18.194  7.043   41.983  1.00 17.03  ? 35  TYR B CE1 1 
ATOM   2621 C  CE2 . TYR B 1 35  ? 18.174  8.950   40.607  1.00 23.46  ? 35  TYR B CE2 1 
ATOM   2622 C  CZ  . TYR B 1 35  ? 17.805  8.307   41.743  1.00 17.90  ? 35  TYR B CZ  1 
ATOM   2623 O  OH  . TYR B 1 35  ? 17.027  8.940   42.639  1.00 26.42  ? 35  TYR B OH  1 
ATOM   2624 N  N   . ASP B 1 36  ? 20.950  7.656   36.445  1.00 11.95  ? 36  ASP B N   1 
ATOM   2625 C  CA  . ASP B 1 36  ? 21.269  8.914   35.741  1.00 13.17  ? 36  ASP B CA  1 
ATOM   2626 C  C   . ASP B 1 36  ? 20.234  9.223   34.709  1.00 9.86   ? 36  ASP B C   1 
ATOM   2627 O  O   . ASP B 1 36  ? 19.999  10.380  34.473  1.00 7.19   ? 36  ASP B O   1 
ATOM   2628 C  CB  . ASP B 1 36  ? 22.741  8.944   35.333  1.00 24.91  ? 36  ASP B CB  1 
ATOM   2629 C  CG  . ASP B 1 36  ? 23.709  8.695   36.471  1.00 30.89  ? 36  ASP B CG  1 
ATOM   2630 O  OD1 . ASP B 1 36  ? 24.259  9.665   37.005  1.00 33.20  ? 36  ASP B OD1 1 
ATOM   2631 O  OD2 . ASP B 1 36  ? 23.972  7.529   36.799  1.00 26.49  ? 36  ASP B OD2 1 
ATOM   2632 N  N   . ARG B 1 37  ? 19.637  8.236   34.068  1.00 12.82  ? 37  ARG B N   1 
ATOM   2633 C  CA  . ARG B 1 37  ? 18.612  8.503   33.056  1.00 13.27  ? 37  ARG B CA  1 
ATOM   2634 C  C   . ARG B 1 37  ? 17.212  8.806   33.490  1.00 7.68   ? 37  ARG B C   1 
ATOM   2635 O  O   . ARG B 1 37  ? 16.303  8.836   32.704  1.00 7.23   ? 37  ARG B O   1 
ATOM   2636 C  CB  . ARG B 1 37  ? 18.595  7.237   32.189  1.00 15.83  ? 37  ARG B CB  1 
ATOM   2637 C  CG  . ARG B 1 37  ? 17.353  6.373   32.318  1.00 16.54  ? 37  ARG B CG  1 
ATOM   2638 C  CD  . ARG B 1 37  ? 17.709  4.900   32.315  1.00 23.47  ? 37  ARG B CD  1 
ATOM   2639 N  NE  . ARG B 1 37  ? 17.133  4.204   31.176  1.00 35.20  ? 37  ARG B NE  1 
ATOM   2640 C  CZ  . ARG B 1 37  ? 17.262  4.595   29.919  1.00 30.64  ? 37  ARG B CZ  1 
ATOM   2641 N  NH1 . ARG B 1 37  ? 17.944  5.681   29.644  1.00 16.13  ? 37  ARG B NH1 1 
ATOM   2642 N  NH2 . ARG B 1 37  ? 16.709  3.903   28.947  1.00 31.22  ? 37  ARG B NH2 1 
ATOM   2643 N  N   . TYR B 1 38  ? 17.065  9.025   34.770  1.00 7.39   ? 38  TYR B N   1 
ATOM   2644 C  CA  . TYR B 1 38  ? 15.896  9.634   35.361  1.00 7.50   ? 38  TYR B CA  1 
ATOM   2645 C  C   . TYR B 1 38  ? 16.256  11.012  35.833  1.00 6.99   ? 38  TYR B C   1 
ATOM   2646 O  O   . TYR B 1 38  ? 15.404  11.839  36.073  1.00 9.35   ? 38  TYR B O   1 
ATOM   2647 C  CB  . TYR B 1 38  ? 15.470  8.834   36.584  1.00 10.56  ? 38  TYR B CB  1 
ATOM   2648 C  CG  . TYR B 1 38  ? 14.653  7.606   36.301  1.00 6.31   ? 38  TYR B CG  1 
ATOM   2649 C  CD1 . TYR B 1 38  ? 13.364  7.706   35.854  1.00 4.72   ? 38  TYR B CD1 1 
ATOM   2650 C  CD2 . TYR B 1 38  ? 15.171  6.362   36.492  1.00 9.34   ? 38  TYR B CD2 1 
ATOM   2651 C  CE1 . TYR B 1 38  ? 12.613  6.597   35.596  1.00 7.25   ? 38  TYR B CE1 1 
ATOM   2652 C  CE2 . TYR B 1 38  ? 14.428  5.246   36.227  1.00 14.32  ? 38  TYR B CE2 1 
ATOM   2653 C  CZ  . TYR B 1 38  ? 13.143  5.376   35.785  1.00 13.29  ? 38  TYR B CZ  1 
ATOM   2654 O  OH  . TYR B 1 38  ? 12.380  4.265   35.536  1.00 18.25  ? 38  TYR B OH  1 
ATOM   2655 N  N   . ILE B 1 39  ? 17.538  11.239  36.003  1.00 6.68   ? 39  ILE B N   1 
ATOM   2656 C  CA  . ILE B 1 39  ? 18.046  12.544  36.321  1.00 9.06   ? 39  ILE B CA  1 
ATOM   2657 C  C   . ILE B 1 39  ? 18.005  13.376  35.071  1.00 10.13  ? 39  ILE B C   1 
ATOM   2658 O  O   . ILE B 1 39  ? 17.827  14.572  35.125  1.00 10.60  ? 39  ILE B O   1 
ATOM   2659 C  CB  . ILE B 1 39  ? 19.501  12.447  36.726  1.00 8.70   ? 39  ILE B CB  1 
ATOM   2660 C  CG1 . ILE B 1 39  ? 19.603  11.930  38.139  1.00 12.21  ? 39  ILE B CG1 1 
ATOM   2661 C  CG2 . ILE B 1 39  ? 20.157  13.790  36.599  1.00 4.89   ? 39  ILE B CG2 1 
ATOM   2662 C  CD1 . ILE B 1 39  ? 20.983  12.074  38.705  1.00 18.27  ? 39  ILE B CD1 1 
ATOM   2663 N  N   . ALA B 1 40  ? 18.193  12.708  33.947  1.00 5.71   ? 40  ALA B N   1 
ATOM   2664 C  CA  . ALA B 1 40  ? 18.206  13.303  32.622  1.00 2.00   ? 40  ALA B CA  1 
ATOM   2665 C  C   . ALA B 1 40  ? 16.831  13.478  31.957  1.00 4.92   ? 40  ALA B C   1 
ATOM   2666 O  O   . ALA B 1 40  ? 16.615  14.457  31.280  1.00 6.87   ? 40  ALA B O   1 
ATOM   2667 C  CB  . ALA B 1 40  ? 19.138  12.504  31.734  1.00 7.81   ? 40  ALA B CB  1 
ATOM   2668 N  N   . TRP B 1 41  ? 15.920  12.520  32.124  1.00 5.06   ? 41  TRP B N   1 
ATOM   2669 C  CA  . TRP B 1 41  ? 14.496  12.669  31.734  1.00 7.97   ? 41  TRP B CA  1 
ATOM   2670 C  C   . TRP B 1 41  ? 13.814  13.864  32.431  1.00 9.91   ? 41  TRP B C   1 
ATOM   2671 O  O   . TRP B 1 41  ? 13.131  14.672  31.779  1.00 9.26   ? 41  TRP B O   1 
ATOM   2672 C  CB  . TRP B 1 41  ? 13.695  11.388  32.063  1.00 7.93   ? 41  TRP B CB  1 
ATOM   2673 C  CG  . TRP B 1 41  ? 13.660  10.287  31.008  1.00 6.97   ? 41  TRP B CG  1 
ATOM   2674 C  CD1 . TRP B 1 41  ? 13.911  10.421  29.679  1.00 7.75   ? 41  TRP B CD1 1 
ATOM   2675 C  CD2 . TRP B 1 41  ? 13.361  8.887   31.217  1.00 11.23  ? 41  TRP B CD2 1 
ATOM   2676 N  NE1 . TRP B 1 41  ? 13.781  9.209   29.039  1.00 11.14  ? 41  TRP B NE1 1 
ATOM   2677 C  CE2 . TRP B 1 41  ? 13.449  8.250   29.959  1.00 16.53  ? 41  TRP B CE2 1 
ATOM   2678 C  CE3 . TRP B 1 41  ? 13.034  8.117   32.340  1.00 12.28  ? 41  TRP B CE3 1 
ATOM   2679 C  CZ2 . TRP B 1 41  ? 13.219  6.871   29.789  1.00 20.29  ? 41  TRP B CZ2 1 
ATOM   2680 C  CZ3 . TRP B 1 41  ? 12.803  6.751   32.170  1.00 14.22  ? 41  TRP B CZ3 1 
ATOM   2681 C  CH2 . TRP B 1 41  ? 12.900  6.143   30.902  1.00 16.22  ? 41  TRP B CH2 1 
ATOM   2682 N  N   . HIS B 1 42  ? 14.002  13.999  33.742  1.00 9.06   ? 42  HIS B N   1 
ATOM   2683 C  CA  . HIS B 1 42  ? 13.422  15.083  34.537  1.00 9.82   ? 42  HIS B CA  1 
ATOM   2684 C  C   . HIS B 1 42  ? 13.984  16.389  34.184  1.00 11.13  ? 42  HIS B C   1 
ATOM   2685 O  O   . HIS B 1 42  ? 13.320  17.415  34.324  1.00 14.45  ? 42  HIS B O   1 
ATOM   2686 C  CB  . HIS B 1 42  ? 13.682  14.889  36.025  1.00 10.70  ? 42  HIS B CB  1 
ATOM   2687 C  CG  . HIS B 1 42  ? 12.904  15.838  36.920  1.00 16.36  ? 42  HIS B CG  1 
ATOM   2688 N  ND1 . HIS B 1 42  ? 13.492  16.598  37.839  1.00 19.09  ? 42  HIS B ND1 1 
ATOM   2689 C  CD2 . HIS B 1 42  ? 11.546  16.093  37.021  1.00 15.70  ? 42  HIS B CD2 1 
ATOM   2690 C  CE1 . HIS B 1 42  ? 12.569  17.317  38.485  1.00 17.09  ? 42  HIS B CE1 1 
ATOM   2691 N  NE2 . HIS B 1 42  ? 11.380  17.006  37.986  1.00 19.18  ? 42  HIS B NE2 1 
ATOM   2692 N  N   . GLY B 1 43  ? 15.238  16.385  33.782  1.00 11.77  ? 43  GLY B N   1 
ATOM   2693 C  CA  . GLY B 1 43  ? 15.884  17.581  33.275  1.00 14.19  ? 43  GLY B CA  1 
ATOM   2694 C  C   . GLY B 1 43  ? 15.466  17.944  31.860  1.00 9.83   ? 43  GLY B C   1 
ATOM   2695 O  O   . GLY B 1 43  ? 15.175  19.101  31.586  1.00 12.83  ? 43  GLY B O   1 
ATOM   2696 N  N   . ALA B 1 44  ? 15.442  16.975  30.953  1.00 8.74   ? 44  ALA B N   1 
ATOM   2697 C  CA  . ALA B 1 44  ? 15.009  17.267  29.603  1.00 11.20  ? 44  ALA B CA  1 
ATOM   2698 C  C   . ALA B 1 44  ? 13.621  17.911  29.630  1.00 16.92  ? 44  ALA B C   1 
ATOM   2699 O  O   . ALA B 1 44  ? 13.377  18.921  28.966  1.00 22.97  ? 44  ALA B O   1 
ATOM   2700 C  CB  . ALA B 1 44  ? 15.007  15.997  28.746  1.00 5.73   ? 44  ALA B CB  1 
ATOM   2701 N  N   . ALA B 1 45  ? 12.694  17.273  30.315  1.00 16.19  ? 45  ALA B N   1 
ATOM   2702 C  CA  . ALA B 1 45  ? 11.310  17.664  30.243  1.00 16.25  ? 45  ALA B CA  1 
ATOM   2703 C  C   . ALA B 1 45  ? 11.085  18.871  31.088  1.00 20.06  ? 45  ALA B C   1 
ATOM   2704 O  O   . ALA B 1 45  ? 10.105  18.956  31.778  1.00 23.28  ? 45  ALA B O   1 
ATOM   2705 C  CB  . ALA B 1 45  ? 10.438  16.543  30.724  1.00 13.44  ? 45  ALA B CB  1 
ATOM   2706 N  N   . GLY B 1 46  ? 12.001  19.814  31.043  1.00 21.55  ? 46  GLY B N   1 
ATOM   2707 C  CA  . GLY B 1 46  ? 11.835  21.004  31.830  1.00 30.79  ? 46  GLY B CA  1 
ATOM   2708 C  C   . GLY B 1 46  ? 12.629  22.098  31.194  1.00 31.25  ? 46  GLY B C   1 
ATOM   2709 O  O   . GLY B 1 46  ? 12.786  23.183  31.745  1.00 41.10  ? 46  GLY B O   1 
ATOM   2710 N  N   . LYS B 1 47  ? 13.166  21.774  30.031  1.00 28.96  ? 47  LYS B N   1 
ATOM   2711 C  CA  . LYS B 1 47  ? 13.656  22.754  29.106  1.00 29.27  ? 47  LYS B CA  1 
ATOM   2712 C  C   . LYS B 1 47  ? 12.648  22.564  28.032  1.00 26.24  ? 47  LYS B C   1 
ATOM   2713 O  O   . LYS B 1 47  ? 12.714  23.215  27.014  1.00 29.39  ? 47  LYS B O   1 
ATOM   2714 C  CB  . LYS B 1 47  ? 15.041  22.412  28.551  1.00 39.37  ? 47  LYS B CB  1 
ATOM   2715 C  CG  . LYS B 1 47  ? 16.192  22.549  29.535  1.00 60.74  ? 47  LYS B CG  1 
ATOM   2716 C  CD  . LYS B 1 47  ? 17.491  22.979  28.886  1.00 47.56  ? 47  LYS B CD  1 
ATOM   2717 C  CE  . LYS B 1 47  ? 18.107  24.153  29.631  1.00 59.87  ? 47  LYS B CE  1 
ATOM   2718 N  NZ  . LYS B 1 47  ? 19.592  24.185  29.547  1.00 72.73  ? 47  LYS B NZ  1 
ATOM   2719 N  N   . PHE B 1 48  ? 11.667  21.705  28.219  1.00 24.76  ? 48  PHE B N   1 
ATOM   2720 C  CA  . PHE B 1 48  ? 10.760  21.486  27.104  1.00 22.80  ? 48  PHE B CA  1 
ATOM   2721 C  C   . PHE B 1 48  ? 9.444   22.198  27.167  1.00 18.64  ? 48  PHE B C   1 
ATOM   2722 O  O   . PHE B 1 48  ? 8.434   21.559  27.356  1.00 17.66  ? 48  PHE B O   1 
ATOM   2723 C  CB  . PHE B 1 48  ? 10.448  20.023  26.900  1.00 18.61  ? 48  PHE B CB  1 
ATOM   2724 C  CG  . PHE B 1 48  ? 9.527   19.785  25.754  1.00 20.93  ? 48  PHE B CG  1 
ATOM   2725 C  CD1 . PHE B 1 48  ? 10.020  19.637  24.469  1.00 28.60  ? 48  PHE B CD1 1 
ATOM   2726 C  CD2 . PHE B 1 48  ? 8.180   19.762  25.942  1.00 17.50  ? 48  PHE B CD2 1 
ATOM   2727 C  CE1 . PHE B 1 48  ? 9.183   19.432  23.401  1.00 17.95  ? 48  PHE B CE1 1 
ATOM   2728 C  CE2 . PHE B 1 48  ? 7.333   19.554  24.874  1.00 22.09  ? 48  PHE B CE2 1 
ATOM   2729 C  CZ  . PHE B 1 48  ? 7.832   19.392  23.603  1.00 14.66  ? 48  PHE B CZ  1 
ATOM   2730 N  N   . HIS B 1 49  ? 9.459   23.498  26.918  1.00 19.39  ? 49  HIS B N   1 
ATOM   2731 C  CA  . HIS B 1 49  ? 8.291   24.355  27.073  1.00 15.98  ? 49  HIS B CA  1 
ATOM   2732 C  C   . HIS B 1 49  ? 7.164   24.074  26.078  1.00 17.90  ? 49  HIS B C   1 
ATOM   2733 O  O   . HIS B 1 49  ? 7.413   23.766  24.912  1.00 23.04  ? 49  HIS B O   1 
ATOM   2734 C  CB  . HIS B 1 49  ? 8.742   25.813  27.007  1.00 22.76  ? 49  HIS B CB  1 
ATOM   2735 C  CG  . HIS B 1 49  ? 9.799   26.149  28.014  1.00 28.03  ? 49  HIS B CG  1 
ATOM   2736 N  ND1 . HIS B 1 49  ? 9.536   26.206  29.368  1.00 34.69  ? 49  HIS B ND1 1 
ATOM   2737 C  CD2 . HIS B 1 49  ? 11.123  26.419  27.880  1.00 29.13  ? 49  HIS B CD2 1 
ATOM   2738 C  CE1 . HIS B 1 49  ? 10.645  26.498  30.023  1.00 36.35  ? 49  HIS B CE1 1 
ATOM   2739 N  NE2 . HIS B 1 49  ? 11.624  26.630  29.143  1.00 38.66  ? 49  HIS B NE2 1 
ATOM   2740 N  N   . THR B 1 50  ? 5.932   24.015  26.587  1.00 21.04  ? 50  THR B N   1 
ATOM   2741 C  CA  . THR B 1 50  ? 4.780   23.627  25.768  1.00 24.70  ? 50  THR B CA  1 
ATOM   2742 C  C   . THR B 1 50  ? 3.620   24.609  25.762  1.00 24.83  ? 50  THR B C   1 
ATOM   2743 O  O   . THR B 1 50  ? 2.783   24.566  26.629  1.00 26.60  ? 50  THR B O   1 
ATOM   2744 C  CB  . THR B 1 50  ? 4.181   22.274  26.205  1.00 22.39  ? 50  THR B CB  1 
ATOM   2745 O  OG1 . THR B 1 50  ? 3.358   22.461  27.347  1.00 27.05  ? 50  THR B OG1 1 
ATOM   2746 C  CG2 . THR B 1 50  ? 5.237   21.302  26.578  1.00 18.63  ? 50  THR B CG2 1 
ATOM   2747 N  N   . PRO B 1 51  ? 3.587   25.485  24.763  1.00 26.69  ? 51  PRO B N   1 
ATOM   2748 C  CA  . PRO B 1 51  ? 4.603   25.489  23.705  1.00 26.83  ? 51  PRO B CA  1 
ATOM   2749 C  C   . PRO B 1 51  ? 5.939   26.038  24.193  1.00 23.22  ? 51  PRO B C   1 
ATOM   2750 O  O   . PRO B 1 51  ? 6.143   26.187  25.398  1.00 33.84  ? 51  PRO B O   1 
ATOM   2751 C  CB  . PRO B 1 51  ? 4.003   26.424  22.654  1.00 30.63  ? 51  PRO B CB  1 
ATOM   2752 C  CG  . PRO B 1 51  ? 3.137   27.352  23.436  1.00 32.32  ? 51  PRO B CG  1 
ATOM   2753 C  CD  . PRO B 1 51  ? 2.570   26.532  24.560  1.00 32.38  ? 51  PRO B CD  1 
ATOM   2754 N  N   . PRO B 1 52  ? 6.836   26.334  23.258  1.00 17.14  ? 52  PRO B N   1 
ATOM   2755 C  CA  . PRO B 1 52  ? 8.160   26.865  23.599  1.00 26.69  ? 52  PRO B CA  1 
ATOM   2756 C  C   . PRO B 1 52  ? 8.119   28.366  23.865  1.00 35.28  ? 52  PRO B C   1 
ATOM   2757 O  O   . PRO B 1 52  ? 7.455   29.105  23.137  1.00 38.62  ? 52  PRO B O   1 
ATOM   2758 C  CB  . PRO B 1 52  ? 8.981   26.577  22.341  1.00 35.30  ? 52  PRO B CB  1 
ATOM   2759 C  CG  . PRO B 1 52  ? 7.980   26.574  21.238  1.00 37.47  ? 52  PRO B CG  1 
ATOM   2760 C  CD  . PRO B 1 52  ? 6.723   26.000  21.827  1.00 29.15  ? 52  PRO B CD  1 
ATOM   2761 N  N   . GLY B 1 53  ? 8.825   28.805  24.901  1.00 38.19  ? 53  GLY B N   1 
ATOM   2762 C  CA  . GLY B 1 53  ? 8.869   30.180  25.248  1.00 48.11  ? 53  GLY B CA  1 
ATOM   2763 C  C   . GLY B 1 53  ? 7.740   30.480  26.191  1.00 49.95  ? 53  GLY B C   1 
ATOM   2764 O  O   . GLY B 1 53  ? 7.710   31.500  26.834  1.00 58.44  ? 53  GLY B O   1 
ATOM   2765 N  N   . SER B 1 54  ? 6.797   29.581  26.299  1.00 36.66  ? 54  SER B N   1 
ATOM   2766 C  CA  . SER B 1 54  ? 5.843   29.713  27.337  1.00 39.41  ? 54  SER B CA  1 
ATOM   2767 C  C   . SER B 1 54  ? 6.603   29.500  28.562  1.00 47.77  ? 54  SER B C   1 
ATOM   2768 O  O   . SER B 1 54  ? 7.746   29.172  28.562  1.00 54.91  ? 54  SER B O   1 
ATOM   2769 C  CB  . SER B 1 54  ? 5.122   28.432  27.533  1.00 36.72  ? 54  SER B CB  1 
ATOM   2770 O  OG  . SER B 1 54  ? 5.322   27.990  28.860  1.00 42.64  ? 54  SER B OG  1 
ATOM   2771 N  N   . ASP B 1 55  ? 5.833   29.578  29.628  1.00 43.28  ? 55  ASP B N   1 
ATOM   2772 C  CA  . ASP B 1 55  ? 6.350   29.358  30.967  1.00 44.12  ? 55  ASP B CA  1 
ATOM   2773 C  C   . ASP B 1 55  ? 6.193   27.891  31.380  1.00 48.62  ? 55  ASP B C   1 
ATOM   2774 O  O   . ASP B 1 55  ? 6.931   27.412  32.244  1.00 57.44  ? 55  ASP B O   1 
ATOM   2775 C  CB  . ASP B 1 55  ? 5.686   30.308  31.976  1.00 48.67  ? 55  ASP B CB  1 
ATOM   2776 C  CG  . ASP B 1 55  ? 6.698   31.156  32.729  1.00 77.60  ? 55  ASP B CG  1 
ATOM   2777 O  OD1 . ASP B 1 55  ? 6.287   32.101  33.434  1.00 60.50  ? 55  ASP B OD1 1 
ATOM   2778 O  OD2 . ASP B 1 55  ? 7.911   30.887  32.601  1.00 94.23  ? 55  ASP B OD2 1 
ATOM   2779 N  N   . ARG B 1 56  ? 5.247   27.183  30.752  1.00 40.91  ? 56  ARG B N   1 
ATOM   2780 C  CA  . ARG B 1 56  ? 4.990   25.764  31.049  1.00 32.17  ? 56  ARG B CA  1 
ATOM   2781 C  C   . ARG B 1 56  ? 6.050   24.919  30.402  1.00 32.51  ? 56  ARG B C   1 
ATOM   2782 O  O   . ARG B 1 56  ? 6.566   25.273  29.345  1.00 39.75  ? 56  ARG B O   1 
ATOM   2783 C  CB  . ARG B 1 56  ? 3.650   25.309  30.474  1.00 25.77  ? 56  ARG B CB  1 
ATOM   2784 C  CG  . ARG B 1 56  ? 2.543   26.303  30.632  1.00 40.49  ? 56  ARG B CG  1 
ATOM   2785 C  CD  . ARG B 1 56  ? 1.301   25.931  29.853  1.00 30.13  ? 56  ARG B CD  1 
ATOM   2786 N  NE  . ARG B 1 56  ? 0.392   27.069  29.813  1.00 26.37  ? 56  ARG B NE  1 
ATOM   2787 C  CZ  . ARG B 1 56  ? 0.423   27.996  28.866  1.00 25.29  ? 56  ARG B CZ  1 
ATOM   2788 N  NH1 . ARG B 1 56  ? 1.298   27.897  27.869  1.00 28.78  ? 56  ARG B NH1 1 
ATOM   2789 N  NH2 . ARG B 1 56  ? -0.429  29.009  28.905  1.00 22.79  ? 56  ARG B NH2 1 
ATOM   2790 N  N   . ASN B 1 57  ? 6.357   23.806  31.086  1.00 23.37  ? 57  ASN B N   1 
ATOM   2791 C  CA  . ASN B 1 57  ? 7.125   22.688  30.559  1.00 22.27  ? 57  ASN B CA  1 
ATOM   2792 C  C   . ASN B 1 57  ? 6.318   21.443  30.624  1.00 16.12  ? 57  ASN B C   1 
ATOM   2793 O  O   . ASN B 1 57  ? 5.426   21.329  31.407  1.00 16.97  ? 57  ASN B O   1 
ATOM   2794 C  CB  . ASN B 1 57  ? 8.463   22.415  31.270  1.00 24.63  ? 57  ASN B CB  1 
ATOM   2795 C  CG  . ASN B 1 57  ? 8.530   22.940  32.682  1.00 26.49  ? 57  ASN B CG  1 
ATOM   2796 O  OD1 . ASN B 1 57  ? 9.345   23.793  32.982  1.00 32.55  ? 57  ASN B OD1 1 
ATOM   2797 N  ND2 . ASN B 1 57  ? 7.725   22.390  33.567  1.00 23.89  ? 57  ASN B ND2 1 
ATOM   2798 N  N   . ALA B 1 58  ? 6.655   20.482  29.802  1.00 21.77  ? 58  ALA B N   1 
ATOM   2799 C  CA  . ALA B 1 58  ? 5.918   19.253  29.787  1.00 16.58  ? 58  ALA B CA  1 
ATOM   2800 C  C   . ALA B 1 58  ? 5.663   18.679  31.122  1.00 16.86  ? 58  ALA B C   1 
ATOM   2801 O  O   . ALA B 1 58  ? 5.100   17.609  31.233  1.00 21.19  ? 58  ALA B O   1 
ATOM   2802 C  CB  . ALA B 1 58  ? 6.360   18.391  28.637  1.00 18.27  ? 58  ALA B CB  1 
ATOM   2803 N  N   . ALA B 1 59  ? 6.241   19.113  32.126  1.00 20.50  ? 59  ALA B N   1 
ATOM   2804 C  CA  . ALA B 1 59  ? 6.019   18.606  33.461  1.00 20.44  ? 59  ALA B CA  1 
ATOM   2805 C  C   . ALA B 1 59  ? 5.531   19.623  34.409  1.00 24.13  ? 59  ALA B C   1 
ATOM   2806 O  O   . ALA B 1 59  ? 4.402   19.581  34.854  1.00 25.08  ? 59  ALA B O   1 
ATOM   2807 C  CB  . ALA B 1 59  ? 7.455   18.303  33.776  1.00 22.09  ? 59  ALA B CB  1 
ATOM   2808 N  N   . HIS B 1 60  ? 6.391   20.575  34.713  1.00 25.53  ? 60  HIS B N   1 
ATOM   2809 C  CA  . HIS B 1 60  ? 6.051   21.461  35.823  1.00 26.24  ? 60  HIS B CA  1 
ATOM   2810 C  C   . HIS B 1 60  ? 5.200   22.571  35.255  1.00 28.90  ? 60  HIS B C   1 
ATOM   2811 O  O   . HIS B 1 60  ? 5.079   22.679  34.045  1.00 35.81  ? 60  HIS B O   1 
ATOM   2812 C  CB  . HIS B 1 60  ? 7.317   22.056  36.440  1.00 22.39  ? 60  HIS B CB  1 
ATOM   2813 C  CG  . HIS B 1 60  ? 8.311   21.027  36.875  1.00 27.11  ? 60  HIS B CG  1 
ATOM   2814 N  ND1 . HIS B 1 60  ? 9.441   20.722  36.140  1.00 26.18  ? 60  HIS B ND1 1 
ATOM   2815 C  CD2 . HIS B 1 60  ? 8.329   20.206  37.957  1.00 30.55  ? 60  HIS B CD2 1 
ATOM   2816 C  CE1 . HIS B 1 60  ? 10.119  19.772  36.762  1.00 29.93  ? 60  HIS B CE1 1 
ATOM   2817 N  NE2 . HIS B 1 60  ? 9.465   19.435  37.861  1.00 33.44  ? 60  HIS B NE2 1 
ATOM   2818 N  N   . MET B 1 61  ? 4.686   23.440  36.095  1.00 30.86  ? 61  MET B N   1 
ATOM   2819 C  CA  . MET B 1 61  ? 3.986   24.608  35.626  1.00 28.99  ? 61  MET B CA  1 
ATOM   2820 C  C   . MET B 1 61  ? 3.129   24.305  34.426  1.00 31.70  ? 61  MET B C   1 
ATOM   2821 O  O   . MET B 1 61  ? 3.282   24.903  33.379  1.00 38.05  ? 61  MET B O   1 
ATOM   2822 C  CB  . MET B 1 61  ? 4.987   25.681  35.292  1.00 25.73  ? 61  MET B CB  1 
ATOM   2823 C  CG  . MET B 1 61  ? 6.394   25.276  35.650  1.00 30.68  ? 61  MET B CG  1 
ATOM   2824 S  SD  . MET B 1 61  ? 7.312   26.591  36.447  1.00 25.78  ? 61  MET B SD  1 
ATOM   2825 C  CE  . MET B 1 61  ? 7.989   25.757  37.869  1.00 14.07  ? 61  MET B CE  1 
ATOM   2826 N  N   . SER B 1 62  ? 2.207   23.357  34.567  1.00 25.82  ? 62  SER B N   1 
ATOM   2827 C  CA  . SER B 1 62  ? 1.119   23.158  33.584  1.00 20.05  ? 62  SER B CA  1 
ATOM   2828 C  C   . SER B 1 62  ? 0.193   22.093  34.153  1.00 19.59  ? 62  SER B C   1 
ATOM   2829 O  O   . SER B 1 62  ? 0.239   21.774  35.311  1.00 24.30  ? 62  SER B O   1 
ATOM   2830 C  CB  . SER B 1 62  ? 1.649   23.209  32.162  1.00 26.99  ? 62  SER B CB  1 
ATOM   2831 O  OG  . SER B 1 62  ? 1.309   22.061  31.415  1.00 26.85  ? 62  SER B OG  1 
ATOM   2832 N  N   . SER B 1 63  ? -0.697  21.597  33.286  1.00 17.56  ? 63  SER B N   1 
ATOM   2833 C  CA  . SER B 1 63  ? -1.565  20.502  33.689  1.00 19.96  ? 63  SER B CA  1 
ATOM   2834 C  C   . SER B 1 63  ? -1.111  19.036  33.382  1.00 21.12  ? 63  SER B C   1 
ATOM   2835 O  O   . SER B 1 63  ? -1.898  18.122  33.432  1.00 23.24  ? 63  SER B O   1 
ATOM   2836 C  CB  . SER B 1 63  ? -2.943  20.744  33.181  1.00 24.55  ? 63  SER B CB  1 
ATOM   2837 O  OG  . SER B 1 63  ? -3.510  21.845  33.866  1.00 30.56  ? 63  SER B OG  1 
ATOM   2838 N  N   . ALA B 1 64  ? 0.148   18.851  33.065  1.00 21.66  ? 64  ALA B N   1 
ATOM   2839 C  CA  . ALA B 1 64  ? 0.790   17.552  32.923  1.00 14.98  ? 64  ALA B CA  1 
ATOM   2840 C  C   . ALA B 1 64  ? 1.574   17.170  34.168  1.00 14.42  ? 64  ALA B C   1 
ATOM   2841 O  O   . ALA B 1 64  ? 1.770   15.994  34.434  1.00 13.27  ? 64  ALA B O   1 
ATOM   2842 C  CB  . ALA B 1 64  ? 1.716   17.553  31.700  1.00 18.45  ? 64  ALA B CB  1 
ATOM   2843 N  N   . PHE B 1 65  ? 1.981   18.166  34.933  1.00 17.61  ? 65  PHE B N   1 
ATOM   2844 C  CA  . PHE B 1 65  ? 2.737   17.975  36.151  1.00 21.13  ? 65  PHE B CA  1 
ATOM   2845 C  C   . PHE B 1 65  ? 2.504   16.722  36.959  1.00 19.66  ? 65  PHE B C   1 
ATOM   2846 O  O   . PHE B 1 65  ? 3.441   16.075  37.382  1.00 12.92  ? 65  PHE B O   1 
ATOM   2847 C  CB  . PHE B 1 65  ? 2.376   19.084  37.129  1.00 23.16  ? 65  PHE B CB  1 
ATOM   2848 C  CG  . PHE B 1 65  ? 2.946   18.907  38.510  1.00 23.87  ? 65  PHE B CG  1 
ATOM   2849 C  CD1 . PHE B 1 65  ? 4.295   18.880  38.727  1.00 21.10  ? 65  PHE B CD1 1 
ATOM   2850 C  CD2 . PHE B 1 65  ? 2.111   18.798  39.595  1.00 22.78  ? 65  PHE B CD2 1 
ATOM   2851 C  CE1 . PHE B 1 65  ? 4.790   18.732  39.993  1.00 19.00  ? 65  PHE B CE1 1 
ATOM   2852 C  CE2 . PHE B 1 65  ? 2.604   18.647  40.861  1.00 17.44  ? 65  PHE B CE2 1 
ATOM   2853 C  CZ  . PHE B 1 65  ? 3.949   18.613  41.057  1.00 14.98  ? 65  PHE B CZ  1 
ATOM   2854 N  N   . LEU B 1 66  ? 1.264   16.332  37.163  1.00 21.96  ? 66  LEU B N   1 
ATOM   2855 C  CA  . LEU B 1 66  ? 1.046   15.168  38.000  1.00 20.62  ? 66  LEU B CA  1 
ATOM   2856 C  C   . LEU B 1 66  ? 1.096   13.820  37.317  1.00 16.00  ? 66  LEU B C   1 
ATOM   2857 O  O   . LEU B 1 66  ? 1.601   12.882  37.887  1.00 13.67  ? 66  LEU B O   1 
ATOM   2858 C  CB  . LEU B 1 66  ? -0.237  15.312  38.803  1.00 23.14  ? 66  LEU B CB  1 
ATOM   2859 C  CG  . LEU B 1 66  ? -0.620  16.751  39.087  1.00 24.23  ? 66  LEU B CG  1 
ATOM   2860 C  CD1 . LEU B 1 66  ? -1.864  17.126  38.298  1.00 26.59  ? 66  LEU B CD1 1 
ATOM   2861 C  CD2 . LEU B 1 66  ? -0.791  16.984  40.574  1.00 29.63  ? 66  LEU B CD2 1 
ATOM   2862 N  N   . PRO B 1 67  ? 0.555   13.678  36.124  1.00 13.45  ? 67  PRO B N   1 
ATOM   2863 C  CA  . PRO B 1 67  ? 0.587   12.361  35.510  1.00 11.56  ? 67  PRO B CA  1 
ATOM   2864 C  C   . PRO B 1 67  ? 1.969   12.131  34.971  1.00 13.73  ? 67  PRO B C   1 
ATOM   2865 O  O   . PRO B 1 67  ? 2.423   11.019  34.788  1.00 17.19  ? 67  PRO B O   1 
ATOM   2866 C  CB  . PRO B 1 67  ? -0.427  12.469  34.389  1.00 12.13  ? 67  PRO B CB  1 
ATOM   2867 C  CG  . PRO B 1 67  ? -0.687  13.902  34.226  1.00 17.39  ? 67  PRO B CG  1 
ATOM   2868 C  CD  . PRO B 1 67  ? -0.497  14.510  35.552  1.00 14.75  ? 67  PRO B CD  1 
ATOM   2869 N  N   . TRP B 1 68  ? 2.666   13.219  34.726  1.00 18.59  ? 68  TRP B N   1 
ATOM   2870 C  CA  . TRP B 1 68  ? 4.045   13.088  34.262  1.00 11.14  ? 68  TRP B CA  1 
ATOM   2871 C  C   . TRP B 1 68  ? 4.845   12.415  35.342  1.00 9.37   ? 68  TRP B C   1 
ATOM   2872 O  O   . TRP B 1 68  ? 5.411   11.351  35.139  1.00 8.85   ? 68  TRP B O   1 
ATOM   2873 C  CB  . TRP B 1 68  ? 4.654   14.456  33.913  1.00 8.42   ? 68  TRP B CB  1 
ATOM   2874 C  CG  . TRP B 1 68  ? 5.988   14.341  33.224  1.00 8.39   ? 68  TRP B CG  1 
ATOM   2875 C  CD1 . TRP B 1 68  ? 6.213   14.393  31.887  1.00 10.10  ? 68  TRP B CD1 1 
ATOM   2876 C  CD2 . TRP B 1 68  ? 7.270   14.109  33.837  1.00 12.87  ? 68  TRP B CD2 1 
ATOM   2877 N  NE1 . TRP B 1 68  ? 7.546   14.225  31.624  1.00 11.71  ? 68  TRP B NE1 1 
ATOM   2878 C  CE2 . TRP B 1 68  ? 8.220   14.049  32.804  1.00 10.60  ? 68  TRP B CE2 1 
ATOM   2879 C  CE3 . TRP B 1 68  ? 7.707   13.953  35.160  1.00 17.25  ? 68  TRP B CE3 1 
ATOM   2880 C  CZ2 . TRP B 1 68  ? 9.577   13.848  33.044  1.00 9.22   ? 68  TRP B CZ2 1 
ATOM   2881 C  CZ3 . TRP B 1 68  ? 9.052   13.757  35.396  1.00 10.23  ? 68  TRP B CZ3 1 
ATOM   2882 C  CH2 . TRP B 1 68  ? 9.969   13.705  34.345  1.00 9.61   ? 68  TRP B CH2 1 
ATOM   2883 N  N   . HIS B 1 69  ? 4.877   13.053  36.502  1.00 8.32   ? 69  HIS B N   1 
ATOM   2884 C  CA  . HIS B 1 69  ? 5.584   12.523  37.644  1.00 7.03   ? 69  HIS B CA  1 
ATOM   2885 C  C   . HIS B 1 69  ? 4.952   11.219  38.128  1.00 9.05   ? 69  HIS B C   1 
ATOM   2886 O  O   . HIS B 1 69  ? 5.582   10.458  38.860  1.00 8.19   ? 69  HIS B O   1 
ATOM   2887 C  CB  . HIS B 1 69  ? 5.641   13.569  38.743  1.00 6.24   ? 69  HIS B CB  1 
ATOM   2888 C  CG  . HIS B 1 69  ? 6.560   14.710  38.436  1.00 8.46   ? 69  HIS B CG  1 
ATOM   2889 N  ND1 . HIS B 1 69  ? 6.148   15.853  37.799  1.00 9.14   ? 69  HIS B ND1 1 
ATOM   2890 C  CD2 . HIS B 1 69  ? 7.888   14.866  38.672  1.00 9.16   ? 69  HIS B CD2 1 
ATOM   2891 C  CE1 . HIS B 1 69  ? 7.174   16.677  37.660  1.00 11.82  ? 69  HIS B CE1 1 
ATOM   2892 N  NE2 . HIS B 1 69  ? 8.239   16.105  38.186  1.00 11.36  ? 69  HIS B NE2 1 
ATOM   2893 N  N   . ARG B 1 70  ? 3.759   10.905  37.641  1.00 10.99  ? 70  ARG B N   1 
ATOM   2894 C  CA  . ARG B 1 70  ? 3.143   9.621   37.922  1.00 8.76   ? 70  ARG B CA  1 
ATOM   2895 C  C   . ARG B 1 70  ? 3.823   8.513   37.148  1.00 8.15   ? 70  ARG B C   1 
ATOM   2896 O  O   . ARG B 1 70  ? 4.382   7.600   37.722  1.00 6.38   ? 70  ARG B O   1 
ATOM   2897 C  CB  . ARG B 1 70  ? 1.660   9.674   37.608  1.00 8.03   ? 70  ARG B CB  1 
ATOM   2898 C  CG  . ARG B 1 70  ? 0.747   9.806   38.815  1.00 10.90  ? 70  ARG B CG  1 
ATOM   2899 C  CD  . ARG B 1 70  ? -0.097  8.556   38.964  1.00 20.16  ? 70  ARG B CD  1 
ATOM   2900 N  NE  . ARG B 1 70  ? -1.356  8.747   39.679  1.00 24.33  ? 70  ARG B NE  1 
ATOM   2901 C  CZ  . ARG B 1 70  ? -2.534  8.888   39.087  1.00 22.32  ? 70  ARG B CZ  1 
ATOM   2902 N  NH1 . ARG B 1 70  ? -2.601  8.889   37.771  1.00 16.97  ? 70  ARG B NH1 1 
ATOM   2903 N  NH2 . ARG B 1 70  ? -3.636  9.028   39.803  1.00 22.74  ? 70  ARG B NH2 1 
ATOM   2904 N  N   . GLU B 1 71  ? 3.889   8.623   35.828  1.00 9.01   ? 71  GLU B N   1 
ATOM   2905 C  CA  . GLU B 1 71  ? 4.583   7.595   35.040  1.00 7.76   ? 71  GLU B CA  1 
ATOM   2906 C  C   . GLU B 1 71  ? 6.099   7.785   34.964  1.00 10.66  ? 71  GLU B C   1 
ATOM   2907 O  O   . GLU B 1 71  ? 6.813   7.015   34.355  1.00 12.73  ? 71  GLU B O   1 
ATOM   2908 C  CB  . GLU B 1 71  ? 4.063   7.482   33.622  1.00 8.53   ? 71  GLU B CB  1 
ATOM   2909 C  CG  . GLU B 1 71  ? 4.764   6.373   32.877  1.00 16.66  ? 71  GLU B CG  1 
ATOM   2910 C  CD  . GLU B 1 71  ? 4.271   6.157   31.462  1.00 18.39  ? 71  GLU B CD  1 
ATOM   2911 O  OE1 . GLU B 1 71  ? 3.386   6.913   31.033  1.00 17.75  ? 71  GLU B OE1 1 
ATOM   2912 O  OE2 . GLU B 1 71  ? 4.788   5.243   30.780  1.00 11.46  ? 71  GLU B OE2 1 
ATOM   2913 N  N   . TYR B 1 72  ? 6.589   8.723   35.762  1.00 10.53  ? 72  TYR B N   1 
ATOM   2914 C  CA  . TYR B 1 72  ? 8.007   8.892   36.037  1.00 7.70   ? 72  TYR B CA  1 
ATOM   2915 C  C   . TYR B 1 72  ? 8.307   8.019   37.216  1.00 6.48   ? 72  TYR B C   1 
ATOM   2916 O  O   . TYR B 1 72  ? 9.272   7.305   37.234  1.00 5.68   ? 72  TYR B O   1 
ATOM   2917 C  CB  . TYR B 1 72  ? 8.307   10.317  36.436  1.00 8.81   ? 72  TYR B CB  1 
ATOM   2918 C  CG  . TYR B 1 72  ? 9.756   10.695  36.534  1.00 7.30   ? 72  TYR B CG  1 
ATOM   2919 C  CD1 . TYR B 1 72  ? 10.422  11.185  35.454  1.00 5.46   ? 72  TYR B CD1 1 
ATOM   2920 C  CD2 . TYR B 1 72  ? 10.429  10.617  37.720  1.00 13.56  ? 72  TYR B CD2 1 
ATOM   2921 C  CE1 . TYR B 1 72  ? 11.732  11.551  35.548  1.00 5.62   ? 72  TYR B CE1 1 
ATOM   2922 C  CE2 . TYR B 1 72  ? 11.736  10.988  37.818  1.00 13.26  ? 72  TYR B CE2 1 
ATOM   2923 C  CZ  . TYR B 1 72  ? 12.371  11.454  36.726  1.00 7.23   ? 72  TYR B CZ  1 
ATOM   2924 O  OH  . TYR B 1 72  ? 13.673  11.831  36.817  1.00 11.89  ? 72  TYR B OH  1 
ATOM   2925 N  N   . LEU B 1 73  ? 7.485   8.128   38.242  1.00 9.24   ? 73  LEU B N   1 
ATOM   2926 C  CA  . LEU B 1 73  ? 7.536   7.207   39.382  1.00 10.38  ? 73  LEU B CA  1 
ATOM   2927 C  C   . LEU B 1 73  ? 7.257   5.772   38.963  1.00 10.11  ? 73  LEU B C   1 
ATOM   2928 O  O   . LEU B 1 73  ? 8.059   4.874   39.230  1.00 7.82   ? 73  LEU B O   1 
ATOM   2929 C  CB  . LEU B 1 73  ? 6.540   7.632   40.472  1.00 11.84  ? 73  LEU B CB  1 
ATOM   2930 C  CG  . LEU B 1 73  ? 6.714   9.020   41.104  1.00 13.41  ? 73  LEU B CG  1 
ATOM   2931 C  CD1 . LEU B 1 73  ? 5.738   9.259   42.233  1.00 7.26   ? 73  LEU B CD1 1 
ATOM   2932 C  CD2 . LEU B 1 73  ? 8.142   9.248   41.589  1.00 13.36  ? 73  LEU B CD2 1 
ATOM   2933 N  N   . LEU B 1 74  ? 6.106   5.567   38.325  1.00 8.61   ? 74  LEU B N   1 
ATOM   2934 C  CA  . LEU B 1 74  ? 5.784   4.286   37.706  1.00 7.52   ? 74  LEU B CA  1 
ATOM   2935 C  C   . LEU B 1 74  ? 6.956   3.527   37.060  1.00 10.89  ? 74  LEU B C   1 
ATOM   2936 O  O   . LEU B 1 74  ? 7.305   2.414   37.469  1.00 11.50  ? 74  LEU B O   1 
ATOM   2937 C  CB  . LEU B 1 74  ? 4.744   4.484   36.601  1.00 6.00   ? 74  LEU B CB  1 
ATOM   2938 C  CG  . LEU B 1 74  ? 4.266   3.175   35.963  1.00 13.32  ? 74  LEU B CG  1 
ATOM   2939 C  CD1 . LEU B 1 74  ? 3.900   2.196   37.070  1.00 15.81  ? 74  LEU B CD1 1 
ATOM   2940 C  CD2 . LEU B 1 74  ? 3.099   3.375   34.991  1.00 16.00  ? 74  LEU B CD2 1 
ATOM   2941 N  N   . ARG B 1 75  ? 7.557   4.108   36.054  1.00 9.59   ? 75  ARG B N   1 
ATOM   2942 C  CA  . ARG B 1 75  ? 8.645   3.461   35.373  1.00 13.29  ? 75  ARG B CA  1 
ATOM   2943 C  C   . ARG B 1 75  ? 9.994   3.597   36.045  1.00 25.53  ? 75  ARG B C   1 
ATOM   2944 O  O   . ARG B 1 75  ? 11.011  3.255   35.453  1.00 27.67  ? 75  ARG B O   1 
ATOM   2945 C  CB  . ARG B 1 75  ? 8.734   4.095   34.024  1.00 13.99  ? 75  ARG B CB  1 
ATOM   2946 C  CG  . ARG B 1 75  ? 7.809   5.281   33.946  1.00 13.15  ? 75  ARG B CG  1 
ATOM   2947 C  CD  . ARG B 1 75  ? 8.371   6.249   32.964  1.00 16.06  ? 75  ARG B CD  1 
ATOM   2948 N  NE  . ARG B 1 75  ? 8.780   5.530   31.781  1.00 15.51  ? 75  ARG B NE  1 
ATOM   2949 C  CZ  . ARG B 1 75  ? 7.933   5.077   30.884  1.00 18.12  ? 75  ARG B CZ  1 
ATOM   2950 N  NH1 . ARG B 1 75  ? 8.397   4.430   29.836  1.00 22.84  ? 75  ARG B NH1 1 
ATOM   2951 N  NH2 . ARG B 1 75  ? 6.633   5.277   31.042  1.00 18.69  ? 75  ARG B NH2 1 
ATOM   2952 N  N   . PHE B 1 76  ? 9.977   4.076   37.285  1.00 23.54  ? 76  PHE B N   1 
ATOM   2953 C  CA  . PHE B 1 76  ? 11.152  4.088   38.139  1.00 18.59  ? 76  PHE B CA  1 
ATOM   2954 C  C   . PHE B 1 76  ? 11.028  2.917   39.107  1.00 21.58  ? 76  PHE B C   1 
ATOM   2955 O  O   . PHE B 1 76  ? 12.028  2.378   39.582  1.00 22.27  ? 76  PHE B O   1 
ATOM   2956 C  CB  . PHE B 1 76  ? 11.248  5.405   38.908  1.00 14.80  ? 76  PHE B CB  1 
ATOM   2957 C  CG  . PHE B 1 76  ? 12.413  5.472   39.854  1.00 11.44  ? 76  PHE B CG  1 
ATOM   2958 C  CD1 . PHE B 1 76  ? 13.392  4.493   39.838  1.00 11.31  ? 76  PHE B CD1 1 
ATOM   2959 C  CD2 . PHE B 1 76  ? 12.528  6.513   40.760  1.00 18.37  ? 76  PHE B CD2 1 
ATOM   2960 C  CE1 . PHE B 1 76  ? 14.465  4.551   40.706  1.00 11.78  ? 76  PHE B CE1 1 
ATOM   2961 C  CE2 . PHE B 1 76  ? 13.598  6.577   41.632  1.00 16.24  ? 76  PHE B CE2 1 
ATOM   2962 C  CZ  . PHE B 1 76  ? 14.569  5.595   41.605  1.00 8.97   ? 76  PHE B CZ  1 
ATOM   2963 N  N   . GLU B 1 77  ? 9.789   2.518   39.378  1.00 20.49  ? 77  GLU B N   1 
ATOM   2964 C  CA  . GLU B 1 77  ? 9.518   1.376   40.242  1.00 28.56  ? 77  GLU B CA  1 
ATOM   2965 C  C   . GLU B 1 77  ? 9.977   0.035   39.682  1.00 32.62  ? 77  GLU B C   1 
ATOM   2966 O  O   . GLU B 1 77  ? 10.900  -0.584  40.211  1.00 32.19  ? 77  GLU B O   1 
ATOM   2967 C  CB  . GLU B 1 77  ? 8.018   1.254   40.516  1.00 28.55  ? 77  GLU B CB  1 
ATOM   2968 C  CG  . GLU B 1 77  ? 7.681   0.592   41.841  1.00 25.72  ? 77  GLU B CG  1 
ATOM   2969 C  CD  . GLU B 1 77  ? 6.366   1.079   42.419  1.00 30.76  ? 77  GLU B CD  1 
ATOM   2970 O  OE1 . GLU B 1 77  ? 5.780   2.024   41.850  1.00 30.72  ? 77  GLU B OE1 1 
ATOM   2971 O  OE2 . GLU B 1 77  ? 5.920   0.517   43.441  1.00 41.63  ? 77  GLU B OE2 1 
ATOM   2972 N  N   . ARG B 1 78  ? 9.332   -0.411  38.607  1.00 20.93  ? 78  ARG B N   1 
ATOM   2973 C  CA  . ARG B 1 78  ? 9.764   -1.613  37.905  1.00 23.53  ? 78  ARG B CA  1 
ATOM   2974 C  C   . ARG B 1 78  ? 11.261  -1.882  37.897  1.00 26.80  ? 78  ARG B C   1 
ATOM   2975 O  O   . ARG B 1 78  ? 11.723  -2.889  38.434  1.00 31.30  ? 78  ARG B O   1 
ATOM   2976 C  CB  . ARG B 1 78  ? 9.397   -1.532  36.423  1.00 27.17  ? 78  ARG B CB  1 
ATOM   2977 C  CG  . ARG B 1 78  ? 8.018   -2.080  36.094  1.00 27.30  ? 78  ARG B CG  1 
ATOM   2978 C  CD  . ARG B 1 78  ? 7.231   -1.112  35.226  1.00 22.65  ? 78  ARG B CD  1 
ATOM   2979 N  NE  . ARG B 1 78  ? 5.790   -1.253  35.417  1.00 21.33  ? 78  ARG B NE  1 
ATOM   2980 C  CZ  . ARG B 1 78  ? 4.875   -0.610  34.699  1.00 35.56  ? 78  ARG B CZ  1 
ATOM   2981 N  NH1 . ARG B 1 78  ? 5.249   0.223   33.737  1.00 32.89  ? 78  ARG B NH1 1 
ATOM   2982 N  NH2 . ARG B 1 78  ? 3.586   -0.799  34.942  1.00 50.54  ? 78  ARG B NH2 1 
ATOM   2983 N  N   . ASP B 1 79  ? 12.018  -0.971  37.294  1.00 22.85  ? 79  ASP B N   1 
ATOM   2984 C  CA  . ASP B 1 79  ? 13.452  -1.039  37.345  1.00 25.54  ? 79  ASP B CA  1 
ATOM   2985 C  C   . ASP B 1 79  ? 13.903  -1.087  38.790  1.00 26.35  ? 79  ASP B C   1 
ATOM   2986 O  O   . ASP B 1 79  ? 15.076  -1.275  39.039  1.00 33.53  ? 79  ASP B O   1 
ATOM   2987 C  CB  . ASP B 1 79  ? 14.006  0.178   36.631  1.00 31.12  ? 79  ASP B CB  1 
ATOM   2988 C  CG  . ASP B 1 79  ? 13.681  0.174   35.160  1.00 35.26  ? 79  ASP B CG  1 
ATOM   2989 O  OD1 . ASP B 1 79  ? 12.506  0.388   34.810  1.00 36.97  ? 79  ASP B OD1 1 
ATOM   2990 O  OD2 . ASP B 1 79  ? 14.597  -0.051  34.349  1.00 29.60  ? 79  ASP B OD2 1 
ATOM   2991 N  N   . LEU B 1 80  ? 12.997  -0.948  39.753  1.00 23.49  ? 80  LEU B N   1 
ATOM   2992 C  CA  . LEU B 1 80  ? 13.311  -1.467  41.073  1.00 24.55  ? 80  LEU B CA  1 
ATOM   2993 C  C   . LEU B 1 80  ? 12.848  -2.896  41.172  1.00 19.35  ? 80  LEU B C   1 
ATOM   2994 O  O   . LEU B 1 80  ? 13.544  -3.758  41.681  1.00 16.34  ? 80  LEU B O   1 
ATOM   2995 C  CB  . LEU B 1 80  ? 12.571  -0.683  42.149  1.00 24.34  ? 80  LEU B CB  1 
ATOM   2996 C  CG  . LEU B 1 80  ? 12.702  0.820   42.318  1.00 15.86  ? 80  LEU B CG  1 
ATOM   2997 C  CD1 . LEU B 1 80  ? 11.331  1.344   42.675  1.00 15.68  ? 80  LEU B CD1 1 
ATOM   2998 C  CD2 . LEU B 1 80  ? 13.687  1.131   43.420  1.00 15.50  ? 80  LEU B CD2 1 
ATOM   2999 N  N   . GLN B 1 81  ? 11.644  -3.132  40.695  1.00 16.14  ? 81  GLN B N   1 
ATOM   3000 C  CA  . GLN B 1 81  ? 11.076  -4.456  40.723  1.00 23.13  ? 81  GLN B CA  1 
ATOM   3001 C  C   . GLN B 1 81  ? 11.823  -5.428  39.844  1.00 23.21  ? 81  GLN B C   1 
ATOM   3002 O  O   . GLN B 1 81  ? 11.676  -6.629  39.974  1.00 19.25  ? 81  GLN B O   1 
ATOM   3003 C  CB  . GLN B 1 81  ? 9.670   -4.425  40.152  1.00 25.32  ? 81  GLN B CB  1 
ATOM   3004 C  CG  . GLN B 1 81  ? 8.670   -5.241  40.929  1.00 23.29  ? 81  GLN B CG  1 
ATOM   3005 C  CD  . GLN B 1 81  ? 8.079   -4.431  42.033  1.00 24.56  ? 81  GLN B CD  1 
ATOM   3006 O  OE1 . GLN B 1 81  ? 7.997   -3.225  41.921  1.00 28.31  ? 81  GLN B OE1 1 
ATOM   3007 N  NE2 . GLN B 1 81  ? 7.679   -5.078  43.109  1.00 22.78  ? 81  GLN B NE2 1 
ATOM   3008 N  N   . SER B 1 82  ? 12.628  -4.946  38.936  1.00 23.72  ? 82  SER B N   1 
ATOM   3009 C  CA  . SER B 1 82  ? 13.368  -5.875  38.142  1.00 24.65  ? 82  SER B CA  1 
ATOM   3010 C  C   . SER B 1 82  ? 14.654  -6.195  38.838  1.00 30.22  ? 82  SER B C   1 
ATOM   3011 O  O   . SER B 1 82  ? 15.301  -7.158  38.512  1.00 33.45  ? 82  SER B O   1 
ATOM   3012 C  CB  . SER B 1 82  ? 13.589  -5.296  36.765  1.00 35.45  ? 82  SER B CB  1 
ATOM   3013 O  OG  . SER B 1 82  ? 12.334  -4.925  36.209  1.00 50.10  ? 82  SER B OG  1 
ATOM   3014 N  N   . ILE B 1 83  ? 15.001  -5.392  39.835  1.00 32.84  ? 83  ILE B N   1 
ATOM   3015 C  CA  . ILE B 1 83  ? 16.208  -5.607  40.634  1.00 30.24  ? 83  ILE B CA  1 
ATOM   3016 C  C   . ILE B 1 83  ? 15.868  -6.261  41.961  1.00 30.61  ? 83  ILE B C   1 
ATOM   3017 O  O   . ILE B 1 83  ? 16.691  -6.927  42.554  1.00 35.09  ? 83  ILE B O   1 
ATOM   3018 C  CB  . ILE B 1 83  ? 16.959  -4.300  40.925  1.00 21.18  ? 83  ILE B CB  1 
ATOM   3019 C  CG1 . ILE B 1 83  ? 17.393  -3.630  39.632  1.00 20.97  ? 83  ILE B CG1 1 
ATOM   3020 C  CG2 . ILE B 1 83  ? 18.187  -4.583  41.756  1.00 20.29  ? 83  ILE B CG2 1 
ATOM   3021 C  CD1 . ILE B 1 83  ? 18.370  -4.449  38.829  1.00 18.10  ? 83  ILE B CD1 1 
ATOM   3022 N  N   . ASN B 1 84  ? 14.640  -6.041  42.420  1.00 28.13  ? 84  ASN B N   1 
ATOM   3023 C  CA  . ASN B 1 84  ? 14.173  -6.588  43.688  1.00 29.34  ? 84  ASN B CA  1 
ATOM   3024 C  C   . ASN B 1 84  ? 12.650  -6.665  43.733  1.00 32.42  ? 84  ASN B C   1 
ATOM   3025 O  O   . ASN B 1 84  ? 11.992  -5.833  44.357  1.00 31.89  ? 84  ASN B O   1 
ATOM   3026 C  CB  . ASN B 1 84  ? 14.693  -5.752  44.859  1.00 31.73  ? 84  ASN B CB  1 
ATOM   3027 C  CG  . ASN B 1 84  ? 14.673  -6.511  46.171  1.00 35.70  ? 84  ASN B CG  1 
ATOM   3028 O  OD1 . ASN B 1 84  ? 15.685  -6.596  46.867  1.00 41.31  ? 84  ASN B OD1 1 
ATOM   3029 N  ND2 . ASN B 1 84  ? 13.517  -7.067  46.516  1.00 38.79  ? 84  ASN B ND2 1 
ATOM   3030 N  N   . PRO B 1 85  ? 12.101  -7.670  43.060  1.00 29.44  ? 85  PRO B N   1 
ATOM   3031 C  CA  . PRO B 1 85  ? 10.648  -7.851  42.965  1.00 29.35  ? 85  PRO B CA  1 
ATOM   3032 C  C   . PRO B 1 85  ? 9.875   -7.272  44.149  1.00 34.11  ? 85  PRO B C   1 
ATOM   3033 O  O   . PRO B 1 85  ? 8.870   -6.592  43.942  1.00 42.58  ? 85  PRO B O   1 
ATOM   3034 C  CB  . PRO B 1 85  ? 10.491  -9.373  42.933  1.00 30.67  ? 85  PRO B CB  1 
ATOM   3035 C  CG  . PRO B 1 85  ? 11.680  -9.883  43.673  1.00 31.23  ? 85  PRO B CG  1 
ATOM   3036 C  CD  . PRO B 1 85  ? 12.800  -8.934  43.352  1.00 29.98  ? 85  PRO B CD  1 
ATOM   3037 N  N   . GLU B 1 86  ? 10.330  -7.545  45.367  1.00 32.49  ? 86  GLU B N   1 
ATOM   3038 C  CA  . GLU B 1 86  ? 9.600   -7.126  46.558  1.00 37.82  ? 86  GLU B CA  1 
ATOM   3039 C  C   . GLU B 1 86  ? 10.077  -5.827  47.182  1.00 37.36  ? 86  GLU B C   1 
ATOM   3040 O  O   . GLU B 1 86  ? 9.889   -5.590  48.365  1.00 37.56  ? 86  GLU B O   1 
ATOM   3041 C  CB  . GLU B 1 86  ? 9.559   -8.244  47.590  1.00 42.68  ? 86  GLU B CB  1 
ATOM   3042 C  CG  . GLU B 1 86  ? 9.252   -9.595  46.981  1.00 46.18  ? 86  GLU B CG  1 
ATOM   3043 C  CD  . GLU B 1 86  ? 7.952   -10.193 47.466  1.00 55.90  ? 86  GLU B CD  1 
ATOM   3044 O  OE1 . GLU B 1 86  ? 7.020   -9.435  47.778  1.00 58.92  ? 86  GLU B OE1 1 
ATOM   3045 O  OE2 . GLU B 1 86  ? 7.864   -11.432 47.532  1.00 40.36  ? 86  GLU B OE2 1 
ATOM   3046 N  N   . VAL B 1 87  ? 10.670  -4.976  46.366  1.00 30.50  ? 87  VAL B N   1 
ATOM   3047 C  CA  . VAL B 1 87  ? 10.864  -3.577  46.716  1.00 28.07  ? 87  VAL B CA  1 
ATOM   3048 C  C   . VAL B 1 87  ? 9.854   -2.700  45.997  1.00 20.07  ? 87  VAL B C   1 
ATOM   3049 O  O   . VAL B 1 87  ? 9.726   -2.759  44.785  1.00 21.56  ? 87  VAL B O   1 
ATOM   3050 C  CB  . VAL B 1 87  ? 12.296  -3.093  46.389  1.00 24.63  ? 87  VAL B CB  1 
ATOM   3051 C  CG1 . VAL B 1 87  ? 12.393  -1.583  46.555  1.00 22.13  ? 87  VAL B CG1 1 
ATOM   3052 C  CG2 . VAL B 1 87  ? 13.311  -3.812  47.272  1.00 21.74  ? 87  VAL B CG2 1 
ATOM   3053 N  N   . THR B 1 88  ? 9.114   -1.903  46.750  1.00 15.09  ? 88  THR B N   1 
ATOM   3054 C  CA  . THR B 1 88  ? 8.232   -0.924  46.134  1.00 18.78  ? 88  THR B CA  1 
ATOM   3055 C  C   . THR B 1 88  ? 8.658   0.491   46.535  1.00 18.28  ? 88  THR B C   1 
ATOM   3056 O  O   . THR B 1 88  ? 9.512   0.665   47.415  1.00 14.53  ? 88  THR B O   1 
ATOM   3057 C  CB  . THR B 1 88  ? 6.721   -1.184  46.445  1.00 28.12  ? 88  THR B CB  1 
ATOM   3058 O  OG1 . THR B 1 88  ? 6.428   -0.911  47.819  1.00 39.06  ? 88  THR B OG1 1 
ATOM   3059 C  CG2 . THR B 1 88  ? 6.349   -2.622  46.144  1.00 22.34  ? 88  THR B CG2 1 
ATOM   3060 N  N   . LEU B 1 89  ? 8.068   1.491   45.889  1.00 21.44  ? 89  LEU B N   1 
ATOM   3061 C  CA  . LEU B 1 89  ? 8.404   2.883   46.161  1.00 21.81  ? 89  LEU B CA  1 
ATOM   3062 C  C   . LEU B 1 89  ? 7.583   3.442   47.319  1.00 23.59  ? 89  LEU B C   1 
ATOM   3063 O  O   . LEU B 1 89  ? 6.363   3.575   47.222  1.00 27.34  ? 89  LEU B O   1 
ATOM   3064 C  CB  . LEU B 1 89  ? 8.196   3.739   44.910  1.00 18.47  ? 89  LEU B CB  1 
ATOM   3065 C  CG  . LEU B 1 89  ? 9.421   4.499   44.397  1.00 11.62  ? 89  LEU B CG  1 
ATOM   3066 C  CD1 . LEU B 1 89  ? 9.077   5.956   44.130  1.00 11.42  ? 89  LEU B CD1 1 
ATOM   3067 C  CD2 . LEU B 1 89  ? 10.574  4.387   45.382  1.00 19.97  ? 89  LEU B CD2 1 
ATOM   3068 N  N   . PRO B 1 90  ? 8.263   3.776   48.412  1.00 19.75  ? 90  PRO B N   1 
ATOM   3069 C  CA  . PRO B 1 90  ? 7.599   4.352   49.586  1.00 19.73  ? 90  PRO B CA  1 
ATOM   3070 C  C   . PRO B 1 90  ? 7.439   5.863   49.451  1.00 18.03  ? 90  PRO B C   1 
ATOM   3071 O  O   . PRO B 1 90  ? 8.187   6.496   48.705  1.00 15.60  ? 90  PRO B O   1 
ATOM   3072 C  CB  . PRO B 1 90  ? 8.567   4.025   50.724  1.00 16.59  ? 90  PRO B CB  1 
ATOM   3073 C  CG  . PRO B 1 90  ? 9.262   2.786   50.275  1.00 15.50  ? 90  PRO B CG  1 
ATOM   3074 C  CD  . PRO B 1 90  ? 9.396   2.910   48.783  1.00 16.82  ? 90  PRO B CD  1 
ATOM   3075 N  N   . TYR B 1 91  ? 6.472   6.429   50.165  1.00 13.93  ? 91  TYR B N   1 
ATOM   3076 C  CA  . TYR B 1 91  ? 6.219   7.864   50.108  1.00 10.83  ? 91  TYR B CA  1 
ATOM   3077 C  C   . TYR B 1 91  ? 6.650   8.558   51.396  1.00 13.56  ? 91  TYR B C   1 
ATOM   3078 O  O   . TYR B 1 91  ? 6.776   7.922   52.443  1.00 16.58  ? 91  TYR B O   1 
ATOM   3079 C  CB  . TYR B 1 91  ? 4.738   8.136   49.835  1.00 11.66  ? 91  TYR B CB  1 
ATOM   3080 C  CG  . TYR B 1 91  ? 3.799   7.408   50.771  1.00 16.95  ? 91  TYR B CG  1 
ATOM   3081 C  CD1 . TYR B 1 91  ? 2.793   8.088   51.444  1.00 18.00  ? 91  TYR B CD1 1 
ATOM   3082 C  CD2 . TYR B 1 91  ? 3.919   6.041   50.980  1.00 24.03  ? 91  TYR B CD2 1 
ATOM   3083 C  CE1 . TYR B 1 91  ? 1.933   7.427   52.300  1.00 22.80  ? 91  TYR B CE1 1 
ATOM   3084 C  CE2 . TYR B 1 91  ? 3.063   5.371   51.834  1.00 22.38  ? 91  TYR B CE2 1 
ATOM   3085 C  CZ  . TYR B 1 91  ? 2.073   6.068   52.492  1.00 22.57  ? 91  TYR B CZ  1 
ATOM   3086 O  OH  . TYR B 1 91  ? 1.219   5.406   53.343  1.00 24.05  ? 91  TYR B OH  1 
ATOM   3087 N  N   . TRP B 1 92  ? 6.875   9.865   51.311  1.00 17.47  ? 92  TRP B N   1 
ATOM   3088 C  CA  . TRP B 1 92  ? 7.281   10.639  52.455  1.00 21.90  ? 92  TRP B CA  1 
ATOM   3089 C  C   . TRP B 1 92  ? 6.179   11.544  52.864  1.00 24.24  ? 92  TRP B C   1 
ATOM   3090 O  O   . TRP B 1 92  ? 6.003   12.613  52.257  1.00 16.50  ? 92  TRP B O   1 
ATOM   3091 C  CB  . TRP B 1 92  ? 8.465   11.486  52.076  1.00 19.05  ? 92  TRP B CB  1 
ATOM   3092 C  CG  . TRP B 1 92  ? 8.914   12.466  53.123  1.00 21.20  ? 92  TRP B CG  1 
ATOM   3093 C  CD1 . TRP B 1 92  ? 8.627   12.461  54.468  1.00 22.14  ? 92  TRP B CD1 1 
ATOM   3094 C  CD2 . TRP B 1 92  ? 9.772   13.630  52.928  1.00 19.28  ? 92  TRP B CD2 1 
ATOM   3095 N  NE1 . TRP B 1 92  ? 9.225   13.513  55.095  1.00 22.54  ? 92  TRP B NE1 1 
ATOM   3096 C  CE2 . TRP B 1 92  ? 9.918   14.251  54.225  1.00 19.44  ? 92  TRP B CE2 1 
ATOM   3097 C  CE3 . TRP B 1 92  ? 10.390  14.205  51.838  1.00 19.11  ? 92  TRP B CE3 1 
ATOM   3098 C  CZ2 . TRP B 1 92  ? 10.666  15.383  54.407  1.00 21.79  ? 92  TRP B CZ2 1 
ATOM   3099 C  CZ3 . TRP B 1 92  ? 11.145  15.348  52.032  1.00 19.41  ? 92  TRP B CZ3 1 
ATOM   3100 C  CH2 . TRP B 1 92  ? 11.280  15.920  53.286  1.00 24.60  ? 92  TRP B CH2 1 
ATOM   3101 N  N   . GLU B 1 93  ? 5.416   11.160  53.886  1.00 21.29  ? 93  GLU B N   1 
ATOM   3102 C  CA  . GLU B 1 93  ? 4.248   11.937  54.260  1.00 16.67  ? 93  GLU B CA  1 
ATOM   3103 C  C   . GLU B 1 93  ? 4.631   13.224  54.972  1.00 19.80  ? 93  GLU B C   1 
ATOM   3104 O  O   . GLU B 1 93  ? 4.440   13.341  56.179  1.00 24.03  ? 93  GLU B O   1 
ATOM   3105 C  CB  . GLU B 1 93  ? 3.364   11.094  55.166  1.00 15.78  ? 93  GLU B CB  1 
ATOM   3106 C  CG  . GLU B 1 93  ? 2.110   11.786  55.598  1.00 19.40  ? 93  GLU B CG  1 
ATOM   3107 C  CD  . GLU B 1 93  ? 1.151   10.835  56.239  1.00 20.75  ? 93  GLU B CD  1 
ATOM   3108 O  OE1 . GLU B 1 93  ? 1.179   10.700  57.475  1.00 23.50  ? 93  GLU B OE1 1 
ATOM   3109 O  OE2 . GLU B 1 93  ? 0.380   10.196  55.504  1.00 20.20  ? 93  GLU B OE2 1 
ATOM   3110 N  N   . TRP B 1 94  ? 5.176   14.187  54.238  1.00 16.97  ? 94  TRP B N   1 
ATOM   3111 C  CA  . TRP B 1 94  ? 5.812   15.322  54.901  1.00 17.07  ? 94  TRP B CA  1 
ATOM   3112 C  C   . TRP B 1 94  ? 4.883   16.155  55.805  1.00 21.02  ? 94  TRP B C   1 
ATOM   3113 O  O   . TRP B 1 94  ? 5.358   16.861  56.689  1.00 23.97  ? 94  TRP B O   1 
ATOM   3114 C  CB  . TRP B 1 94  ? 6.596   16.206  53.917  1.00 17.55  ? 94  TRP B CB  1 
ATOM   3115 C  CG  . TRP B 1 94  ? 6.120   16.141  52.495  1.00 20.26  ? 94  TRP B CG  1 
ATOM   3116 C  CD1 . TRP B 1 94  ? 6.749   15.524  51.452  1.00 22.58  ? 94  TRP B CD1 1 
ATOM   3117 C  CD2 . TRP B 1 94  ? 4.924   16.726  51.951  1.00 15.99  ? 94  TRP B CD2 1 
ATOM   3118 N  NE1 . TRP B 1 94  ? 6.019   15.682  50.303  1.00 21.62  ? 94  TRP B NE1 1 
ATOM   3119 C  CE2 . TRP B 1 94  ? 4.895   16.413  50.581  1.00 11.80  ? 94  TRP B CE2 1 
ATOM   3120 C  CE3 . TRP B 1 94  ? 3.876   17.475  52.490  1.00 19.00  ? 94  TRP B CE3 1 
ATOM   3121 C  CZ2 . TRP B 1 94  ? 3.871   16.819  49.746  1.00 10.17  ? 94  TRP B CZ2 1 
ATOM   3122 C  CZ3 . TRP B 1 94  ? 2.863   17.877  51.665  1.00 15.60  ? 94  TRP B CZ3 1 
ATOM   3123 C  CH2 . TRP B 1 94  ? 2.864   17.551  50.306  1.00 13.38  ? 94  TRP B CH2 1 
ATOM   3124 N  N   . GLU B 1 95  ? 3.571   16.066  55.610  1.00 19.78  ? 95  GLU B N   1 
ATOM   3125 C  CA  . GLU B 1 95  ? 2.657   16.831  56.453  1.00 23.89  ? 95  GLU B CA  1 
ATOM   3126 C  C   . GLU B 1 95  ? 2.765   16.450  57.941  1.00 26.31  ? 95  GLU B C   1 
ATOM   3127 O  O   . GLU B 1 95  ? 2.707   17.320  58.816  1.00 29.69  ? 95  GLU B O   1 
ATOM   3128 C  CB  . GLU B 1 95  ? 1.213   16.733  55.944  1.00 26.44  ? 95  GLU B CB  1 
ATOM   3129 C  CG  . GLU B 1 95  ? 0.705   15.331  55.651  1.00 24.58  ? 95  GLU B CG  1 
ATOM   3130 C  CD  . GLU B 1 95  ? 1.079   14.833  54.269  1.00 19.70  ? 95  GLU B CD  1 
ATOM   3131 O  OE1 . GLU B 1 95  ? 2.258   14.964  53.877  1.00 15.28  ? 95  GLU B OE1 1 
ATOM   3132 O  OE2 . GLU B 1 95  ? 0.185   14.303  53.573  1.00 16.24  ? 95  GLU B OE2 1 
ATOM   3133 N  N   . THR B 1 96  ? 2.942   15.158  58.220  1.00 26.61  ? 96  THR B N   1 
ATOM   3134 C  CA  . THR B 1 96  ? 3.047   14.649  59.600  1.00 24.93  ? 96  THR B CA  1 
ATOM   3135 C  C   . THR B 1 96  ? 4.413   14.950  60.242  1.00 26.66  ? 96  THR B C   1 
ATOM   3136 O  O   . THR B 1 96  ? 4.524   15.140  61.463  1.00 24.18  ? 96  THR B O   1 
ATOM   3137 C  CB  . THR B 1 96  ? 2.757   13.121  59.677  1.00 22.00  ? 96  THR B CB  1 
ATOM   3138 O  OG1 . THR B 1 96  ? 3.719   12.389  58.902  1.00 26.24  ? 96  THR B OG1 1 
ATOM   3139 C  CG2 . THR B 1 96  ? 1.346   12.815  59.172  1.00 21.64  ? 96  THR B CG2 1 
ATOM   3140 N  N   . ASP B 1 97  ? 5.443   14.998  59.398  1.00 29.01  ? 97  ASP B N   1 
ATOM   3141 C  CA  . ASP B 1 97  ? 6.803   15.327  59.812  1.00 28.93  ? 97  ASP B CA  1 
ATOM   3142 C  C   . ASP B 1 97  ? 6.873   16.793  60.149  1.00 29.22  ? 97  ASP B C   1 
ATOM   3143 O  O   . ASP B 1 97  ? 7.732   17.232  60.913  1.00 30.61  ? 97  ASP B O   1 
ATOM   3144 C  CB  . ASP B 1 97  ? 7.775   15.058  58.671  1.00 27.61  ? 97  ASP B CB  1 
ATOM   3145 C  CG  . ASP B 1 97  ? 8.307   13.654  58.690  1.00 28.22  ? 97  ASP B CG  1 
ATOM   3146 O  OD1 . ASP B 1 97  ? 9.336   13.389  58.026  1.00 28.10  ? 97  ASP B OD1 1 
ATOM   3147 O  OD2 . ASP B 1 97  ? 7.694   12.819  59.388  1.00 32.57  ? 97  ASP B OD2 1 
ATOM   3148 N  N   . ALA B 1 98  ? 5.964   17.545  59.540  1.00 27.74  ? 98  ALA B N   1 
ATOM   3149 C  CA  . ALA B 1 98  ? 5.849   18.977  59.751  1.00 36.85  ? 98  ALA B CA  1 
ATOM   3150 C  C   . ALA B 1 98  ? 5.486   19.268  61.202  1.00 40.16  ? 98  ALA B C   1 
ATOM   3151 O  O   . ALA B 1 98  ? 5.920   20.275  61.769  1.00 38.94  ? 98  ALA B O   1 
ATOM   3152 C  CB  . ALA B 1 98  ? 4.793   19.542  58.814  1.00 39.92  ? 98  ALA B CB  1 
ATOM   3153 N  N   . GLN B 1 99  ? 4.698   18.372  61.792  1.00 39.23  ? 99  GLN B N   1 
ATOM   3154 C  CA  . GLN B 1 99  ? 4.237   18.546  63.158  1.00 41.32  ? 99  GLN B CA  1 
ATOM   3155 C  C   . GLN B 1 99  ? 5.366   18.378  64.172  1.00 43.31  ? 99  GLN B C   1 
ATOM   3156 O  O   . GLN B 1 99  ? 5.273   18.912  65.272  1.00 48.22  ? 99  GLN B O   1 
ATOM   3157 C  CB  . GLN B 1 99  ? 3.062   17.613  63.460  1.00 40.31  ? 99  GLN B CB  1 
ATOM   3158 C  CG  . GLN B 1 99  ? 1.866   17.862  62.550  1.00 42.99  ? 99  GLN B CG  1 
ATOM   3159 C  CD  . GLN B 1 99  ? 0.723   16.875  62.764  1.00 64.11  ? 99  GLN B CD  1 
ATOM   3160 O  OE1 . GLN B 1 99  ? 0.906   15.660  62.679  1.00 65.21  ? 99  GLN B OE1 1 
ATOM   3161 N  NE2 . GLN B 1 99  ? -0.470  17.401  63.031  1.00 76.35  ? 99  GLN B NE2 1 
ATOM   3162 N  N   . MET B 1 100 ? 6.437   17.701  63.796  1.00 43.23  ? 100 MET B N   1 
ATOM   3163 C  CA  . MET B 1 100 ? 7.530   17.472  64.728  1.00 35.76  ? 100 MET B CA  1 
ATOM   3164 C  C   . MET B 1 100 ? 8.031   18.764  65.348  1.00 32.03  ? 100 MET B C   1 
ATOM   3165 O  O   . MET B 1 100 ? 7.792   19.828  64.818  1.00 35.48  ? 100 MET B O   1 
ATOM   3166 C  CB  . MET B 1 100 ? 8.680   16.784  64.010  1.00 27.33  ? 100 MET B CB  1 
ATOM   3167 C  CG  . MET B 1 100 ? 8.281   15.611  63.154  1.00 26.53  ? 100 MET B CG  1 
ATOM   3168 S  SD  . MET B 1 100 ? 9.473   14.319  63.414  1.00 25.58  ? 100 MET B SD  1 
ATOM   3169 C  CE  . MET B 1 100 ? 10.829  15.286  64.032  1.00 25.77  ? 100 MET B CE  1 
ATOM   3170 N  N   . GLN B 1 101 ? 8.726   18.665  66.471  1.00 31.27  ? 101 GLN B N   1 
ATOM   3171 C  CA  . GLN B 1 101 ? 9.420   19.805  67.055  1.00 47.54  ? 101 GLN B CA  1 
ATOM   3172 C  C   . GLN B 1 101 ? 10.567  20.178  66.103  1.00 34.61  ? 101 GLN B C   1 
ATOM   3173 O  O   . GLN B 1 101 ? 10.747  21.340  65.721  1.00 36.79  ? 101 GLN B O   1 
ATOM   3174 C  CB  . GLN B 1 101 ? 9.925   19.462  68.468  1.00 51.07  ? 101 GLN B CB  1 
ATOM   3175 C  CG  . GLN B 1 101 ? 10.579  20.623  69.240  1.00 70.48  ? 101 GLN B CG  1 
ATOM   3176 C  CD  . GLN B 1 101 ? 9.726   21.905  69.280  1.00 80.47  ? 101 GLN B CD  1 
ATOM   3177 O  OE1 . GLN B 1 101 ? 10.260  23.019  69.347  1.00 78.70  ? 101 GLN B OE1 1 
ATOM   3178 N  NE2 . GLN B 1 101 ? 8.405   21.749  69.252  1.00 66.10  ? 101 GLN B NE2 1 
ATOM   3179 N  N   . ASP B 1 102 ? 11.249  19.161  65.618  1.00 33.50  ? 102 ASP B N   1 
ATOM   3180 C  CA  . ASP B 1 102 ? 12.309  19.346  64.649  1.00 39.07  ? 102 ASP B CA  1 
ATOM   3181 C  C   . ASP B 1 102 ? 12.311  18.180  63.681  1.00 33.11  ? 102 ASP B C   1 
ATOM   3182 O  O   . ASP B 1 102 ? 12.880  17.151  63.999  1.00 28.81  ? 102 ASP B O   1 
ATOM   3183 C  CB  . ASP B 1 102 ? 13.652  19.402  65.377  1.00 39.99  ? 102 ASP B CB  1 
ATOM   3184 C  CG  . ASP B 1 102 ? 14.772  19.942  64.508  1.00 44.39  ? 102 ASP B CG  1 
ATOM   3185 O  OD1 . ASP B 1 102 ? 15.353  19.156  63.734  1.00 49.19  ? 102 ASP B OD1 1 
ATOM   3186 O  OD2 . ASP B 1 102 ? 15.068  21.149  64.606  1.00 43.65  ? 102 ASP B OD2 1 
ATOM   3187 N  N   . PRO B 1 103 ? 11.691  18.328  62.515  1.00 27.56  ? 103 PRO B N   1 
ATOM   3188 C  CA  . PRO B 1 103 ? 11.542  17.207  61.594  1.00 30.05  ? 103 PRO B CA  1 
ATOM   3189 C  C   . PRO B 1 103 ? 12.871  16.665  61.117  1.00 35.42  ? 103 PRO B C   1 
ATOM   3190 O  O   . PRO B 1 103 ? 12.988  15.518  60.681  1.00 30.96  ? 103 PRO B O   1 
ATOM   3191 C  CB  . PRO B 1 103 ? 10.804  17.812  60.412  1.00 27.93  ? 103 PRO B CB  1 
ATOM   3192 C  CG  . PRO B 1 103 ? 10.344  19.135  60.870  1.00 37.28  ? 103 PRO B CG  1 
ATOM   3193 C  CD  . PRO B 1 103 ? 11.375  19.579  61.838  1.00 33.93  ? 103 PRO B CD  1 
ATOM   3194 N  N   . SER B 1 104 ? 13.898  17.484  61.199  1.00 35.50  ? 104 SER B N   1 
ATOM   3195 C  CA  . SER B 1 104 ? 15.206  16.960  60.796  1.00 32.47  ? 104 SER B CA  1 
ATOM   3196 C  C   . SER B 1 104 ? 15.471  15.667  61.556  1.00 29.18  ? 104 SER B C   1 
ATOM   3197 O  O   . SER B 1 104 ? 16.374  14.892  61.225  1.00 21.31  ? 104 SER B O   1 
ATOM   3198 C  CB  . SER B 1 104 ? 16.299  17.983  61.105  1.00 32.45  ? 104 SER B CB  1 
ATOM   3199 O  OG  . SER B 1 104 ? 16.756  17.886  62.439  1.00 32.44  ? 104 SER B OG  1 
ATOM   3200 N  N   . GLN B 1 105 ? 14.620  15.368  62.516  1.00 34.86  ? 105 GLN B N   1 
ATOM   3201 C  CA  . GLN B 1 105 ? 14.778  14.131  63.247  1.00 32.73  ? 105 GLN B CA  1 
ATOM   3202 C  C   . GLN B 1 105 ? 13.678  13.168  62.896  1.00 25.95  ? 105 GLN B C   1 
ATOM   3203 O  O   . GLN B 1 105 ? 13.085  12.543  63.765  1.00 24.27  ? 105 GLN B O   1 
ATOM   3204 C  CB  . GLN B 1 105 ? 14.831  14.384  64.750  1.00 32.92  ? 105 GLN B CB  1 
ATOM   3205 C  CG  . GLN B 1 105 ? 15.566  15.656  65.115  1.00 31.08  ? 105 GLN B CG  1 
ATOM   3206 C  CD  . GLN B 1 105 ? 16.890  15.389  65.777  1.00 37.36  ? 105 GLN B CD  1 
ATOM   3207 O  OE1 . GLN B 1 105 ? 16.944  14.968  66.923  1.00 34.60  ? 105 GLN B OE1 1 
ATOM   3208 N  NE2 . GLN B 1 105 ? 17.970  15.635  65.060  1.00 33.24  ? 105 GLN B NE2 1 
ATOM   3209 N  N   . SER B 1 106 ? 13.416  13.054  61.606  1.00 20.53  ? 106 SER B N   1 
ATOM   3210 C  CA  . SER B 1 106 ? 12.481  12.063  61.114  1.00 26.00  ? 106 SER B CA  1 
ATOM   3211 C  C   . SER B 1 106 ? 13.262  10.794  60.811  1.00 31.10  ? 106 SER B C   1 
ATOM   3212 O  O   . SER B 1 106 ? 14.416  10.842  60.418  1.00 26.66  ? 106 SER B O   1 
ATOM   3213 C  CB  . SER B 1 106 ? 11.760  12.574  59.871  1.00 24.59  ? 106 SER B CB  1 
ATOM   3214 O  OG  . SER B 1 106 ? 10.438  12.091  59.796  1.00 16.78  ? 106 SER B OG  1 
ATOM   3215 N  N   . GLN B 1 107 ? 12.630  9.655   61.022  1.00 34.45  ? 107 GLN B N   1 
ATOM   3216 C  CA  . GLN B 1 107 ? 13.275  8.373   60.818  1.00 43.15  ? 107 GLN B CA  1 
ATOM   3217 C  C   . GLN B 1 107 ? 13.763  8.284   59.402  1.00 37.68  ? 107 GLN B C   1 
ATOM   3218 O  O   . GLN B 1 107 ? 14.424  7.325   59.023  1.00 38.95  ? 107 GLN B O   1 
ATOM   3219 C  CB  . GLN B 1 107 ? 12.250  7.261   60.996  1.00 66.15  ? 107 GLN B CB  1 
ATOM   3220 C  CG  . GLN B 1 107 ? 12.244  6.515   62.317  1.00 64.08  ? 107 GLN B CG  1 
ATOM   3221 C  CD  . GLN B 1 107 ? 11.251  5.378   62.269  1.00 88.67  ? 107 GLN B CD  1 
ATOM   3222 O  OE1 . GLN B 1 107 ? 11.393  4.457   61.475  1.00 68.99  ? 107 GLN B OE1 1 
ATOM   3223 N  NE2 . GLN B 1 107 ? 10.226  5.452   63.095  1.00 87.56  ? 107 GLN B NE2 1 
ATOM   3224 N  N   . ILE B 1 108 ? 13.392  9.270   58.606  1.00 32.87  ? 108 ILE B N   1 
ATOM   3225 C  CA  . ILE B 1 108 ? 13.684  9.255   57.190  1.00 25.78  ? 108 ILE B CA  1 
ATOM   3226 C  C   . ILE B 1 108 ? 15.019  9.880   56.950  1.00 28.75  ? 108 ILE B C   1 
ATOM   3227 O  O   . ILE B 1 108 ? 15.639  9.659   55.932  1.00 32.40  ? 108 ILE B O   1 
ATOM   3228 C  CB  . ILE B 1 108 ? 12.727  10.140  56.432  1.00 28.58  ? 108 ILE B CB  1 
ATOM   3229 C  CG1 . ILE B 1 108 ? 12.377  9.513   55.098  1.00 28.32  ? 108 ILE B CG1 1 
ATOM   3230 C  CG2 . ILE B 1 108 ? 13.387  11.486  56.239  1.00 22.47  ? 108 ILE B CG2 1 
ATOM   3231 C  CD1 . ILE B 1 108 ? 12.330  10.497  53.956  1.00 28.01  ? 108 ILE B CD1 1 
ATOM   3232 N  N   . TRP B 1 109 ? 15.456  10.700  57.883  1.00 29.73  ? 109 TRP B N   1 
ATOM   3233 C  CA  . TRP B 1 109 ? 16.751  11.293  57.753  1.00 38.24  ? 109 TRP B CA  1 
ATOM   3234 C  C   . TRP B 1 109 ? 17.734  10.534  58.580  1.00 44.61  ? 109 TRP B C   1 
ATOM   3235 O  O   . TRP B 1 109 ? 18.881  10.969  58.781  1.00 47.75  ? 109 TRP B O   1 
ATOM   3236 C  CB  . TRP B 1 109 ? 16.678  12.765  58.087  1.00 32.20  ? 109 TRP B CB  1 
ATOM   3237 C  CG  . TRP B 1 109 ? 15.644  13.418  57.213  1.00 31.46  ? 109 TRP B CG  1 
ATOM   3238 C  CD1 . TRP B 1 109 ? 14.373  13.823  57.556  1.00 31.63  ? 109 TRP B CD1 1 
ATOM   3239 C  CD2 . TRP B 1 109 ? 15.743  13.695  55.784  1.00 31.28  ? 109 TRP B CD2 1 
ATOM   3240 N  NE1 . TRP B 1 109 ? 13.716  14.327  56.482  1.00 26.49  ? 109 TRP B NE1 1 
ATOM   3241 C  CE2 . TRP B 1 109 ? 14.482  14.281  55.395  1.00 22.10  ? 109 TRP B CE2 1 
ATOM   3242 C  CE3 . TRP B 1 109 ? 16.717  13.509  54.822  1.00 33.71  ? 109 TRP B CE3 1 
ATOM   3243 C  CZ2 . TRP B 1 109 ? 14.232  14.671  54.117  1.00 21.53  ? 109 TRP B CZ2 1 
ATOM   3244 C  CZ3 . TRP B 1 109 ? 16.451  13.908  53.535  1.00 24.86  ? 109 TRP B CZ3 1 
ATOM   3245 C  CH2 . TRP B 1 109 ? 15.242  14.479  53.194  1.00 23.90  ? 109 TRP B CH2 1 
ATOM   3246 N  N   . SER B 1 110 ? 17.300  9.369   59.043  1.00 38.91  ? 110 SER B N   1 
ATOM   3247 C  CA  . SER B 1 110 ? 18.140  8.457   59.772  1.00 31.19  ? 110 SER B CA  1 
ATOM   3248 C  C   . SER B 1 110 ? 19.212  8.097   58.831  1.00 37.01  ? 110 SER B C   1 
ATOM   3249 O  O   . SER B 1 110 ? 19.119  8.403   57.661  1.00 34.08  ? 110 SER B O   1 
ATOM   3250 C  CB  . SER B 1 110 ? 17.460  7.124   59.858  1.00 40.78  ? 110 SER B CB  1 
ATOM   3251 O  OG  . SER B 1 110 ? 17.219  6.655   58.562  1.00 39.13  ? 110 SER B OG  1 
ATOM   3252 N  N   . ALA B 1 111 ? 20.239  7.435   59.334  1.00 46.86  ? 111 ALA B N   1 
ATOM   3253 C  CA  . ALA B 1 111 ? 21.507  7.261   58.637  1.00 46.28  ? 111 ALA B CA  1 
ATOM   3254 C  C   . ALA B 1 111 ? 21.642  5.831   58.201  1.00 34.08  ? 111 ALA B C   1 
ATOM   3255 O  O   . ALA B 1 111 ? 22.655  5.201   58.420  1.00 38.62  ? 111 ALA B O   1 
ATOM   3256 C  CB  . ALA B 1 111 ? 22.667  7.649   59.546  1.00 38.34  ? 111 ALA B CB  1 
ATOM   3257 N  N   . ASP B 1 112 ? 20.596  5.319   57.592  1.00 28.88  ? 112 ASP B N   1 
ATOM   3258 C  CA  . ASP B 1 112 ? 20.580  3.951   57.153  1.00 32.82  ? 112 ASP B CA  1 
ATOM   3259 C  C   . ASP B 1 112 ? 19.673  3.928   55.970  1.00 32.90  ? 112 ASP B C   1 
ATOM   3260 O  O   . ASP B 1 112 ? 19.476  2.901   55.339  1.00 29.53  ? 112 ASP B O   1 
ATOM   3261 C  CB  . ASP B 1 112 ? 20.019  3.057   58.239  1.00 50.34  ? 112 ASP B CB  1 
ATOM   3262 C  CG  . ASP B 1 112 ? 18.901  3.698   58.988  1.00 46.84  ? 112 ASP B CG  1 
ATOM   3263 O  OD1 . ASP B 1 112 ? 18.242  3.013   59.784  1.00 60.86  ? 112 ASP B OD1 1 
ATOM   3264 O  OD2 . ASP B 1 112 ? 18.682  4.897   58.785  1.00 39.18  ? 112 ASP B OD2 1 
ATOM   3265 N  N   . PHE B 1 113 ? 19.132  5.108   55.700  1.00 42.36  ? 113 PHE B N   1 
ATOM   3266 C  CA  . PHE B 1 113 ? 18.260  5.409   54.591  1.00 40.09  ? 113 PHE B CA  1 
ATOM   3267 C  C   . PHE B 1 113 ? 18.764  6.402   53.563  1.00 37.86  ? 113 PHE B C   1 
ATOM   3268 O  O   . PHE B 1 113 ? 19.488  6.046   52.646  1.00 37.24  ? 113 PHE B O   1 
ATOM   3269 C  CB  . PHE B 1 113 ? 16.985  6.000   55.145  1.00 35.01  ? 113 PHE B CB  1 
ATOM   3270 C  CG  . PHE B 1 113 ? 15.770  5.717   54.337  1.00 37.44  ? 113 PHE B CG  1 
ATOM   3271 C  CD1 . PHE B 1 113 ? 15.347  6.600   53.377  1.00 51.59  ? 113 PHE B CD1 1 
ATOM   3272 C  CD2 . PHE B 1 113 ? 15.018  4.605   54.574  1.00 39.85  ? 113 PHE B CD2 1 
ATOM   3273 C  CE1 . PHE B 1 113 ? 14.209  6.352   52.646  1.00 50.05  ? 113 PHE B CE1 1 
ATOM   3274 C  CE2 . PHE B 1 113 ? 13.880  4.350   53.847  1.00 40.13  ? 113 PHE B CE2 1 
ATOM   3275 C  CZ  . PHE B 1 113 ? 13.470  5.226   52.887  1.00 39.40  ? 113 PHE B CZ  1 
ATOM   3276 N  N   . MET B 1 114 ? 18.444  7.665   53.741  1.00 39.86  ? 114 MET B N   1 
ATOM   3277 C  CA  . MET B 1 114 ? 19.015  8.693   52.888  1.00 32.53  ? 114 MET B CA  1 
ATOM   3278 C  C   . MET B 1 114 ? 20.136  9.399   53.597  1.00 29.88  ? 114 MET B C   1 
ATOM   3279 O  O   . MET B 1 114 ? 21.045  9.905   52.972  1.00 29.94  ? 114 MET B O   1 
ATOM   3280 C  CB  . MET B 1 114 ? 17.976  9.717   52.468  1.00 29.51  ? 114 MET B CB  1 
ATOM   3281 C  CG  . MET B 1 114 ? 16.575  9.170   52.446  1.00 35.23  ? 114 MET B CG  1 
ATOM   3282 S  SD  . MET B 1 114 ? 16.224  8.760   50.759  1.00 26.29  ? 114 MET B SD  1 
ATOM   3283 C  CE  . MET B 1 114 ? 14.723  7.822   50.955  1.00 42.51  ? 114 MET B CE  1 
ATOM   3284 N  N   . GLY B 1 115 ? 20.066  9.456   54.910  1.00 30.94  ? 115 GLY B N   1 
ATOM   3285 C  CA  . GLY B 1 115 ? 21.118  10.112  55.638  1.00 31.78  ? 115 GLY B CA  1 
ATOM   3286 C  C   . GLY B 1 115 ? 20.561  11.335  56.293  1.00 34.73  ? 115 GLY B C   1 
ATOM   3287 O  O   . GLY B 1 115 ? 19.378  11.368  56.574  1.00 30.94  ? 115 GLY B O   1 
ATOM   3288 N  N   . GLY B 1 116 ? 21.387  12.345  56.528  1.00 38.12  ? 116 GLY B N   1 
ATOM   3289 C  CA  . GLY B 1 116 ? 20.883  13.492  57.282  1.00 35.30  ? 116 GLY B CA  1 
ATOM   3290 C  C   . GLY B 1 116 ? 20.957  14.830  56.572  1.00 26.17  ? 116 GLY B C   1 
ATOM   3291 O  O   . GLY B 1 116 ? 21.026  14.862  55.355  1.00 25.09  ? 116 GLY B O   1 
ATOM   3292 N  N   . ASN B 1 117 ? 20.912  15.931  57.325  1.00 28.41  ? 117 ASN B N   1 
ATOM   3293 C  CA  . ASN B 1 117 ? 21.047  17.269  56.737  1.00 26.79  ? 117 ASN B CA  1 
ATOM   3294 C  C   . ASN B 1 117 ? 22.507  17.565  56.325  1.00 24.69  ? 117 ASN B C   1 
ATOM   3295 O  O   . ASN B 1 117 ? 23.447  16.866  56.740  1.00 24.96  ? 117 ASN B O   1 
ATOM   3296 C  CB  . ASN B 1 117 ? 20.509  18.366  57.680  1.00 19.55  ? 117 ASN B CB  1 
ATOM   3297 C  CG  . ASN B 1 117 ? 20.434  19.742  57.001  1.00 19.76  ? 117 ASN B CG  1 
ATOM   3298 O  OD1 . ASN B 1 117 ? 20.633  20.779  57.629  1.00 24.59  ? 117 ASN B OD1 1 
ATOM   3299 N  ND2 . ASN B 1 117 ? 20.146  19.744  55.709  1.00 24.17  ? 117 ASN B ND2 1 
ATOM   3300 N  N   . GLY B 1 118 ? 22.686  18.559  55.462  1.00 26.54  ? 118 GLY B N   1 
ATOM   3301 C  CA  . GLY B 1 118 ? 24.014  18.908  55.002  1.00 33.64  ? 118 GLY B CA  1 
ATOM   3302 C  C   . GLY B 1 118 ? 24.872  19.443  56.132  1.00 36.89  ? 118 GLY B C   1 
ATOM   3303 O  O   . GLY B 1 118 ? 24.355  19.947  57.136  1.00 30.71  ? 118 GLY B O   1 
ATOM   3304 N  N   . ASN B 1 119 ? 26.187  19.329  55.968  1.00 37.98  ? 119 ASN B N   1 
ATOM   3305 C  CA  . ASN B 1 119 ? 27.132  19.803  56.967  1.00 31.99  ? 119 ASN B CA  1 
ATOM   3306 C  C   . ASN B 1 119 ? 27.597  21.204  56.592  1.00 38.04  ? 119 ASN B C   1 
ATOM   3307 O  O   . ASN B 1 119 ? 28.230  21.384  55.552  1.00 46.90  ? 119 ASN B O   1 
ATOM   3308 C  CB  . ASN B 1 119 ? 28.312  18.831  57.057  1.00 28.47  ? 119 ASN B CB  1 
ATOM   3309 C  CG  . ASN B 1 119 ? 29.254  19.154  58.194  1.00 26.72  ? 119 ASN B CG  1 
ATOM   3310 O  OD1 . ASN B 1 119 ? 30.020  18.300  58.629  1.00 22.61  ? 119 ASN B OD1 1 
ATOM   3311 N  ND2 . ASN B 1 119 ? 29.207  20.392  58.680  1.00 28.17  ? 119 ASN B ND2 1 
ATOM   3312 N  N   . PRO B 1 120 ? 27.296  22.140  57.471  1.00 32.12  ? 120 PRO B N   1 
ATOM   3313 C  CA  . PRO B 1 120 ? 27.659  23.541  57.324  1.00 41.34  ? 120 PRO B CA  1 
ATOM   3314 C  C   . PRO B 1 120 ? 29.083  23.712  56.857  1.00 44.21  ? 120 PRO B C   1 
ATOM   3315 O  O   . PRO B 1 120 ? 29.317  24.372  55.864  1.00 43.10  ? 120 PRO B O   1 
ATOM   3316 C  CB  . PRO B 1 120 ? 27.529  24.060  58.748  1.00 41.01  ? 120 PRO B CB  1 
ATOM   3317 C  CG  . PRO B 1 120 ? 26.459  23.223  59.340  1.00 28.54  ? 120 PRO B CG  1 
ATOM   3318 C  CD  . PRO B 1 120 ? 26.663  21.864  58.764  1.00 24.07  ? 120 PRO B CD  1 
ATOM   3319 N  N   . ILE B 1 121 ? 30.005  23.117  57.598  1.00 35.12  ? 121 ILE B N   1 
ATOM   3320 C  CA  . ILE B 1 121 ? 31.457  23.137  57.374  1.00 36.22  ? 121 ILE B CA  1 
ATOM   3321 C  C   . ILE B 1 121 ? 31.913  22.688  55.965  1.00 46.54  ? 121 ILE B C   1 
ATOM   3322 O  O   . ILE B 1 121 ? 32.905  23.209  55.430  1.00 43.34  ? 121 ILE B O   1 
ATOM   3323 C  CB  . ILE B 1 121 ? 32.169  22.223  58.393  1.00 27.75  ? 121 ILE B CB  1 
ATOM   3324 C  CG1 . ILE B 1 121 ? 31.697  22.557  59.800  1.00 28.53  ? 121 ILE B CG1 1 
ATOM   3325 C  CG2 . ILE B 1 121 ? 33.682  22.345  58.262  1.00 44.19  ? 121 ILE B CG2 1 
ATOM   3326 C  CD1 . ILE B 1 121 ? 31.569  24.019  60.052  1.00 36.18  ? 121 ILE B CD1 1 
ATOM   3327 N  N   . LYS B 1 122 ? 31.226  21.697  55.391  1.00 40.06  ? 122 LYS B N   1 
ATOM   3328 C  CA  . LYS B 1 122 ? 31.565  21.202  54.063  1.00 41.40  ? 122 LYS B CA  1 
ATOM   3329 C  C   . LYS B 1 122 ? 30.676  21.772  52.981  1.00 51.68  ? 122 LYS B C   1 
ATOM   3330 O  O   . LYS B 1 122 ? 30.500  21.137  51.936  1.00 62.28  ? 122 LYS B O   1 
ATOM   3331 C  CB  . LYS B 1 122 ? 31.441  19.685  54.007  1.00 35.56  ? 122 LYS B CB  1 
ATOM   3332 C  CG  . LYS B 1 122 ? 32.192  18.912  55.045  1.00 37.38  ? 122 LYS B CG  1 
ATOM   3333 C  CD  . LYS B 1 122 ? 31.355  17.725  55.516  1.00 34.24  ? 122 LYS B CD  1 
ATOM   3334 C  CE  . LYS B 1 122 ? 31.788  16.400  54.899  1.00 32.95  ? 122 LYS B CE  1 
ATOM   3335 N  NZ  . LYS B 1 122 ? 33.041  15.942  55.538  1.00 47.79  ? 122 LYS B NZ  1 
ATOM   3336 N  N   . ASP B 1 123 ? 30.094  22.945  53.225  1.00 50.48  ? 123 ASP B N   1 
ATOM   3337 C  CA  . ASP B 1 123 ? 29.255  23.603  52.214  1.00 52.24  ? 123 ASP B CA  1 
ATOM   3338 C  C   . ASP B 1 123 ? 27.980  22.790  51.980  1.00 39.95  ? 123 ASP B C   1 
ATOM   3339 O  O   . ASP B 1 123 ? 27.531  22.612  50.842  1.00 36.61  ? 123 ASP B O   1 
ATOM   3340 C  CB  . ASP B 1 123 ? 30.028  23.812  50.899  1.00 65.86  ? 123 ASP B CB  1 
ATOM   3341 C  CG  . ASP B 1 123 ? 31.309  24.630  51.093  1.00 77.03  ? 123 ASP B CG  1 
ATOM   3342 O  OD1 . ASP B 1 123 ? 31.984  24.918  50.079  1.00 84.74  ? 123 ASP B OD1 1 
ATOM   3343 O  OD2 . ASP B 1 123 ? 31.636  24.985  52.257  1.00 70.71  ? 123 ASP B OD2 1 
ATOM   3344 N  N   . PHE B 1 124 ? 27.428  22.311  53.097  1.00 38.88  ? 124 PHE B N   1 
ATOM   3345 C  CA  . PHE B 1 124 ? 26.180  21.539  53.198  1.00 32.32  ? 124 PHE B CA  1 
ATOM   3346 C  C   . PHE B 1 124 ? 26.145  20.226  52.387  1.00 33.58  ? 124 PHE B C   1 
ATOM   3347 O  O   . PHE B 1 124 ? 25.076  19.724  52.003  1.00 24.76  ? 124 PHE B O   1 
ATOM   3348 C  CB  . PHE B 1 124 ? 24.963  22.443  52.956  1.00 27.47  ? 124 PHE B CB  1 
ATOM   3349 C  CG  . PHE B 1 124 ? 24.916  23.642  53.869  1.00 29.75  ? 124 PHE B CG  1 
ATOM   3350 C  CD1 . PHE B 1 124 ? 25.590  24.805  53.535  1.00 36.70  ? 124 PHE B CD1 1 
ATOM   3351 C  CD2 . PHE B 1 124 ? 24.218  23.596  55.069  1.00 37.74  ? 124 PHE B CD2 1 
ATOM   3352 C  CE1 . PHE B 1 124 ? 25.576  25.890  54.369  1.00 43.48  ? 124 PHE B CE1 1 
ATOM   3353 C  CE2 . PHE B 1 124 ? 24.197  24.684  55.919  1.00 40.06  ? 124 PHE B CE2 1 
ATOM   3354 C  CZ  . PHE B 1 124 ? 24.877  25.834  55.563  1.00 39.93  ? 124 PHE B CZ  1 
ATOM   3355 N  N   . ILE B 1 125 ? 27.338  19.692  52.141  1.00 38.33  ? 125 ILE B N   1 
ATOM   3356 C  CA  . ILE B 1 125 ? 27.522  18.356  51.599  1.00 32.69  ? 125 ILE B CA  1 
ATOM   3357 C  C   . ILE B 1 125 ? 27.184  17.281  52.618  1.00 35.69  ? 125 ILE B C   1 
ATOM   3358 O  O   . ILE B 1 125 ? 27.839  17.156  53.659  1.00 33.08  ? 125 ILE B O   1 
ATOM   3359 C  CB  . ILE B 1 125 ? 28.990  18.118  51.196  1.00 28.74  ? 125 ILE B CB  1 
ATOM   3360 C  CG1 . ILE B 1 125 ? 29.226  18.614  49.779  1.00 32.64  ? 125 ILE B CG1 1 
ATOM   3361 C  CG2 . ILE B 1 125 ? 29.333  16.634  51.306  1.00 24.84  ? 125 ILE B CG2 1 
ATOM   3362 C  CD1 . ILE B 1 125 ? 28.420  17.859  48.762  1.00 30.14  ? 125 ILE B CD1 1 
ATOM   3363 N  N   . VAL B 1 126 ? 26.167  16.493  52.278  1.00 31.66  ? 126 VAL B N   1 
ATOM   3364 C  CA  . VAL B 1 126 ? 25.674  15.374  53.077  1.00 17.87  ? 126 VAL B CA  1 
ATOM   3365 C  C   . VAL B 1 126 ? 26.688  14.270  53.304  1.00 19.40  ? 126 VAL B C   1 
ATOM   3366 O  O   . VAL B 1 126 ? 27.016  13.535  52.386  1.00 22.87  ? 126 VAL B O   1 
ATOM   3367 C  CB  . VAL B 1 126 ? 24.517  14.721  52.343  1.00 18.11  ? 126 VAL B CB  1 
ATOM   3368 C  CG1 . VAL B 1 126 ? 24.042  13.491  53.090  1.00 26.69  ? 126 VAL B CG1 1 
ATOM   3369 C  CG2 . VAL B 1 126 ? 23.409  15.748  52.128  1.00 24.16  ? 126 VAL B CG2 1 
ATOM   3370 N  N   . ASP B 1 127 ? 27.142  14.135  54.545  1.00 26.52  ? 127 ASP B N   1 
ATOM   3371 C  CA  . ASP B 1 127 ? 28.244  13.242  54.906  1.00 29.52  ? 127 ASP B CA  1 
ATOM   3372 C  C   . ASP B 1 127 ? 27.809  12.007  55.716  1.00 24.09  ? 127 ASP B C   1 
ATOM   3373 O  O   . ASP B 1 127 ? 28.646  11.264  56.225  1.00 25.01  ? 127 ASP B O   1 
ATOM   3374 C  CB  . ASP B 1 127 ? 29.289  14.038  55.698  1.00 39.91  ? 127 ASP B CB  1 
ATOM   3375 C  CG  . ASP B 1 127 ? 28.737  14.595  57.011  1.00 50.71  ? 127 ASP B CG  1 
ATOM   3376 O  OD1 . ASP B 1 127 ? 27.785  15.409  56.997  1.00 41.36  ? 127 ASP B OD1 1 
ATOM   3377 O  OD2 . ASP B 1 127 ? 29.278  14.216  58.066  1.00 52.12  ? 127 ASP B OD2 1 
ATOM   3378 N  N   . THR B 1 128 ? 26.499  11.794  55.816  1.00 25.76  ? 128 THR B N   1 
ATOM   3379 C  CA  . THR B 1 128 ? 25.914  10.691  56.578  1.00 24.41  ? 128 THR B CA  1 
ATOM   3380 C  C   . THR B 1 128 ? 24.852  9.974   55.781  1.00 28.56  ? 128 THR B C   1 
ATOM   3381 O  O   . THR B 1 128 ? 24.006  10.602  55.141  1.00 30.64  ? 128 THR B O   1 
ATOM   3382 C  CB  . THR B 1 128 ? 25.147  11.190  57.805  1.00 23.35  ? 128 THR B CB  1 
ATOM   3383 O  OG1 . THR B 1 128 ? 24.056  12.009  57.363  1.00 24.10  ? 128 THR B OG1 1 
ATOM   3384 C  CG2 . THR B 1 128 ? 26.046  11.975  58.716  1.00 33.75  ? 128 THR B CG2 1 
ATOM   3385 N  N   . GLY B 1 129 ? 24.865  8.654   55.866  1.00 26.47  ? 129 GLY B N   1 
ATOM   3386 C  CA  . GLY B 1 129 ? 23.832  7.861   55.245  1.00 27.60  ? 129 GLY B CA  1 
ATOM   3387 C  C   . GLY B 1 129 ? 24.333  7.472   53.885  1.00 25.99  ? 129 GLY B C   1 
ATOM   3388 O  O   . GLY B 1 129 ? 25.327  8.019   53.420  1.00 24.57  ? 129 GLY B O   1 
ATOM   3389 N  N   . PRO B 1 130 ? 23.611  6.565   53.219  1.00 32.22  ? 130 PRO B N   1 
ATOM   3390 C  CA  . PRO B 1 130 ? 24.026  5.799   52.035  1.00 29.79  ? 130 PRO B CA  1 
ATOM   3391 C  C   . PRO B 1 130 ? 24.321  6.655   50.830  1.00 29.08  ? 130 PRO B C   1 
ATOM   3392 O  O   . PRO B 1 130 ? 24.942  6.153   49.903  1.00 28.71  ? 130 PRO B O   1 
ATOM   3393 C  CB  . PRO B 1 130 ? 22.801  4.932   51.724  1.00 29.24  ? 130 PRO B CB  1 
ATOM   3394 C  CG  . PRO B 1 130 ? 21.935  5.001   52.960  1.00 35.16  ? 130 PRO B CG  1 
ATOM   3395 C  CD  . PRO B 1 130 ? 22.188  6.366   53.528  1.00 31.83  ? 130 PRO B CD  1 
ATOM   3396 N  N   . PHE B 1 131 ? 23.895  7.911   50.830  1.00 32.57  ? 131 PHE B N   1 
ATOM   3397 C  CA  . PHE B 1 131 ? 24.104  8.753   49.661  1.00 35.04  ? 131 PHE B CA  1 
ATOM   3398 C  C   . PHE B 1 131 ? 25.088  9.883   49.943  1.00 38.13  ? 131 PHE B C   1 
ATOM   3399 O  O   . PHE B 1 131 ? 25.142  10.871  49.204  1.00 44.32  ? 131 PHE B O   1 
ATOM   3400 C  CB  . PHE B 1 131 ? 22.766  9.269   49.147  1.00 27.54  ? 131 PHE B CB  1 
ATOM   3401 C  CG  . PHE B 1 131 ? 21.724  8.192   49.032  1.00 34.13  ? 131 PHE B CG  1 
ATOM   3402 C  CD1 . PHE B 1 131 ? 20.833  7.957   50.074  1.00 38.12  ? 131 PHE B CD1 1 
ATOM   3403 C  CD2 . PHE B 1 131 ? 21.640  7.402   47.898  1.00 38.62  ? 131 PHE B CD2 1 
ATOM   3404 C  CE1 . PHE B 1 131 ? 19.866  6.964   49.983  1.00 35.67  ? 131 PHE B CE1 1 
ATOM   3405 C  CE2 . PHE B 1 131 ? 20.669  6.402   47.795  1.00 33.83  ? 131 PHE B CE2 1 
ATOM   3406 C  CZ  . PHE B 1 131 ? 19.782  6.184   48.841  1.00 26.49  ? 131 PHE B CZ  1 
ATOM   3407 N  N   . ALA B 1 132 ? 25.872  9.723   51.010  1.00 24.90  ? 132 ALA B N   1 
ATOM   3408 C  CA  . ALA B 1 132 ? 26.890  10.708  51.355  1.00 31.03  ? 132 ALA B CA  1 
ATOM   3409 C  C   . ALA B 1 132 ? 27.870  10.896  50.193  1.00 38.31  ? 132 ALA B C   1 
ATOM   3410 O  O   . ALA B 1 132 ? 28.135  9.958   49.431  1.00 43.21  ? 132 ALA B O   1 
ATOM   3411 C  CB  . ALA B 1 132 ? 27.641  10.286  52.618  1.00 37.84  ? 132 ALA B CB  1 
ATOM   3412 N  N   . ALA B 1 133 ? 28.411  12.106  50.071  1.00 36.21  ? 133 ALA B N   1 
ATOM   3413 C  CA  . ALA B 1 133 ? 29.463  12.378  49.104  1.00 37.60  ? 133 ALA B CA  1 
ATOM   3414 C  C   . ALA B 1 133 ? 30.605  11.387  49.316  1.00 41.00  ? 133 ALA B C   1 
ATOM   3415 O  O   . ALA B 1 133 ? 31.190  11.321  50.392  1.00 42.14  ? 133 ALA B O   1 
ATOM   3416 C  CB  . ALA B 1 133 ? 29.955  13.821  49.237  1.00 26.76  ? 133 ALA B CB  1 
ATOM   3417 N  N   . GLY B 1 134 ? 30.915  10.620  48.277  1.00 33.53  ? 134 GLY B N   1 
ATOM   3418 C  CA  . GLY B 1 134 ? 31.909  9.568   48.367  1.00 37.42  ? 134 GLY B CA  1 
ATOM   3419 C  C   . GLY B 1 134 ? 31.334  8.183   48.121  1.00 43.11  ? 134 GLY B C   1 
ATOM   3420 O  O   . GLY B 1 134 ? 32.056  7.256   47.742  1.00 50.52  ? 134 GLY B O   1 
ATOM   3421 N  N   . ARG B 1 135 ? 30.031  8.046   48.350  1.00 45.97  ? 135 ARG B N   1 
ATOM   3422 C  CA  . ARG B 1 135 ? 29.326  6.775   48.172  1.00 52.72  ? 135 ARG B CA  1 
ATOM   3423 C  C   . ARG B 1 135 ? 28.214  6.966   47.150  1.00 53.73  ? 135 ARG B C   1 
ATOM   3424 O  O   . ARG B 1 135 ? 27.610  5.999   46.662  1.00 49.51  ? 135 ARG B O   1 
ATOM   3425 C  CB  . ARG B 1 135 ? 28.735  6.296   49.496  1.00 42.78  ? 135 ARG B CB  1 
ATOM   3426 C  CG  . ARG B 1 135 ? 29.752  5.712   50.443  1.00 38.34  ? 135 ARG B CG  1 
ATOM   3427 C  CD  . ARG B 1 135 ? 29.063  5.033   51.614  1.00 43.41  ? 135 ARG B CD  1 
ATOM   3428 N  NE  . ARG B 1 135 ? 28.463  5.985   52.544  1.00 52.94  ? 135 ARG B NE  1 
ATOM   3429 C  CZ  . ARG B 1 135 ? 29.126  6.601   53.519  1.00 55.25  ? 135 ARG B CZ  1 
ATOM   3430 N  NH1 . ARG B 1 135 ? 30.424  6.378   53.692  1.00 44.59  ? 135 ARG B NH1 1 
ATOM   3431 N  NH2 . ARG B 1 135 ? 28.493  7.448   54.322  1.00 45.84  ? 135 ARG B NH2 1 
ATOM   3432 N  N   . TRP B 1 136 ? 28.003  8.213   46.754  1.00 47.74  ? 136 TRP B N   1 
ATOM   3433 C  CA  . TRP B 1 136 ? 27.020  8.573   45.752  1.00 44.73  ? 136 TRP B CA  1 
ATOM   3434 C  C   . TRP B 1 136 ? 27.586  9.603   44.793  1.00 50.43  ? 136 TRP B C   1 
ATOM   3435 O  O   . TRP B 1 136 ? 28.621  10.235  45.069  1.00 47.86  ? 136 TRP B O   1 
ATOM   3436 C  CB  . TRP B 1 136 ? 25.781  9.090   46.449  1.00 37.44  ? 136 TRP B CB  1 
ATOM   3437 C  CG  . TRP B 1 136 ? 24.589  9.383   45.592  1.00 34.89  ? 136 TRP B CG  1 
ATOM   3438 C  CD1 . TRP B 1 136 ? 24.159  10.609  45.159  1.00 34.18  ? 136 TRP B CD1 1 
ATOM   3439 C  CD2 . TRP B 1 136 ? 23.598  8.438   45.082  1.00 36.63  ? 136 TRP B CD2 1 
ATOM   3440 N  NE1 . TRP B 1 136 ? 23.014  10.494  44.435  1.00 32.58  ? 136 TRP B NE1 1 
ATOM   3441 C  CE2 . TRP B 1 136 ? 22.635  9.221   44.347  1.00 33.58  ? 136 TRP B CE2 1 
ATOM   3442 C  CE3 . TRP B 1 136 ? 23.431  7.072   45.157  1.00 41.07  ? 136 TRP B CE3 1 
ATOM   3443 C  CZ2 . TRP B 1 136 ? 21.562  8.651   43.721  1.00 36.28  ? 136 TRP B CZ2 1 
ATOM   3444 C  CZ3 . TRP B 1 136 ? 22.344  6.506   44.521  1.00 39.96  ? 136 TRP B CZ3 1 
ATOM   3445 C  CH2 . TRP B 1 136 ? 21.435  7.278   43.817  1.00 41.42  ? 136 TRP B CH2 1 
ATOM   3446 N  N   . THR B 1 137 ? 26.933  9.790   43.653  1.00 51.79  ? 137 THR B N   1 
ATOM   3447 C  CA  . THR B 1 137 ? 27.510  10.557  42.562  1.00 43.20  ? 137 THR B CA  1 
ATOM   3448 C  C   . THR B 1 137 ? 26.485  11.405  41.814  1.00 44.05  ? 137 THR B C   1 
ATOM   3449 O  O   . THR B 1 137 ? 25.625  10.876  41.123  1.00 47.58  ? 137 THR B O   1 
ATOM   3450 C  CB  . THR B 1 137 ? 28.118  9.587   41.561  1.00 47.14  ? 137 THR B CB  1 
ATOM   3451 O  OG1 . THR B 1 137 ? 27.114  8.656   41.161  1.00 46.74  ? 137 THR B OG1 1 
ATOM   3452 C  CG2 . THR B 1 137 ? 29.217  8.816   42.210  1.00 59.28  ? 137 THR B CG2 1 
ATOM   3453 N  N   . THR B 1 138 ? 26.585  12.721  41.934  1.00 33.58  ? 138 THR B N   1 
ATOM   3454 C  CA  . THR B 1 138 ? 25.586  13.583  41.346  1.00 28.43  ? 138 THR B CA  1 
ATOM   3455 C  C   . THR B 1 138 ? 26.032  14.314  40.098  1.00 33.55  ? 138 THR B C   1 
ATOM   3456 O  O   . THR B 1 138 ? 27.210  14.502  39.853  1.00 37.20  ? 138 THR B O   1 
ATOM   3457 C  CB  . THR B 1 138 ? 25.079  14.622  42.336  1.00 25.25  ? 138 THR B CB  1 
ATOM   3458 O  OG1 . THR B 1 138 ? 25.793  14.494  43.562  1.00 27.50  ? 138 THR B OG1 1 
ATOM   3459 C  CG2 . THR B 1 138 ? 23.597  14.426  42.572  1.00 21.49  ? 138 THR B CG2 1 
ATOM   3460 N  N   . ILE B 1 139 ? 25.036  14.734  39.333  1.00 33.81  ? 139 ILE B N   1 
ATOM   3461 C  CA  . ILE B 1 139 ? 25.195  15.350  38.025  1.00 20.13  ? 139 ILE B CA  1 
ATOM   3462 C  C   . ILE B 1 139 ? 24.597  16.769  38.006  1.00 31.14  ? 139 ILE B C   1 
ATOM   3463 O  O   . ILE B 1 139 ? 23.460  16.976  38.443  1.00 35.65  ? 139 ILE B O   1 
ATOM   3464 C  CB  . ILE B 1 139 ? 24.513  14.480  36.984  1.00 12.13  ? 139 ILE B CB  1 
ATOM   3465 C  CG1 . ILE B 1 139 ? 25.539  13.642  36.237  1.00 24.00  ? 139 ILE B CG1 1 
ATOM   3466 C  CG2 . ILE B 1 139 ? 23.772  15.316  35.983  1.00 21.84  ? 139 ILE B CG2 1 
ATOM   3467 C  CD1 . ILE B 1 139 ? 25.972  12.469  37.033  1.00 28.38  ? 139 ILE B CD1 1 
ATOM   3468 N  N   . ASP B 1 140 ? 25.378  17.741  37.518  1.00 33.98  ? 140 ASP B N   1 
ATOM   3469 C  CA  . ASP B 1 140 ? 24.931  19.139  37.362  1.00 32.29  ? 140 ASP B CA  1 
ATOM   3470 C  C   . ASP B 1 140 ? 24.023  19.361  36.144  1.00 32.37  ? 140 ASP B C   1 
ATOM   3471 O  O   . ASP B 1 140 ? 23.727  18.432  35.392  1.00 37.76  ? 140 ASP B O   1 
ATOM   3472 C  CB  . ASP B 1 140 ? 26.128  20.097  37.301  1.00 33.70  ? 140 ASP B CB  1 
ATOM   3473 C  CG  . ASP B 1 140 ? 27.037  19.831  36.104  1.00 41.42  ? 140 ASP B CG  1 
ATOM   3474 O  OD1 . ASP B 1 140 ? 28.169  20.367  36.068  1.00 50.38  ? 140 ASP B OD1 1 
ATOM   3475 O  OD2 . ASP B 1 140 ? 26.617  19.093  35.187  1.00 43.01  ? 140 ASP B OD2 1 
ATOM   3476 N  N   . GLU B 1 141 ? 23.592  20.598  35.934  1.00 34.53  ? 141 GLU B N   1 
ATOM   3477 C  CA  . GLU B 1 141 ? 22.625  20.869  34.873  1.00 38.44  ? 141 GLU B CA  1 
ATOM   3478 C  C   . GLU B 1 141 ? 23.148  20.521  33.483  1.00 32.75  ? 141 GLU B C   1 
ATOM   3479 O  O   . GLU B 1 141 ? 22.385  20.216  32.566  1.00 31.47  ? 141 GLU B O   1 
ATOM   3480 C  CB  . GLU B 1 141 ? 22.187  22.333  34.903  1.00 54.89  ? 141 GLU B CB  1 
ATOM   3481 C  CG  . GLU B 1 141 ? 21.208  22.714  33.800  1.00 50.23  ? 141 GLU B CG  1 
ATOM   3482 C  CD  . GLU B 1 141 ? 20.972  24.206  33.739  1.00 64.23  ? 141 GLU B CD  1 
ATOM   3483 O  OE1 . GLU B 1 141 ? 20.702  24.811  34.800  1.00 86.52  ? 141 GLU B OE1 1 
ATOM   3484 O  OE2 . GLU B 1 141 ? 21.073  24.774  32.632  1.00 65.44  ? 141 GLU B OE2 1 
ATOM   3485 N  N   . GLN B 1 142 ? 24.458  20.567  33.332  1.00 36.90  ? 142 GLN B N   1 
ATOM   3486 C  CA  . GLN B 1 142 ? 25.059  20.403  32.027  1.00 42.24  ? 142 GLN B CA  1 
ATOM   3487 C  C   . GLN B 1 142 ? 25.131  18.941  31.643  1.00 32.44  ? 142 GLN B C   1 
ATOM   3488 O  O   . GLN B 1 142 ? 25.461  18.602  30.514  1.00 35.96  ? 142 GLN B O   1 
ATOM   3489 C  CB  . GLN B 1 142 ? 26.441  21.049  32.023  1.00 93.41  ? 142 GLN B CB  1 
ATOM   3490 C  CG  . GLN B 1 142 ? 26.423  22.467  32.591  1.00 106.16 ? 142 GLN B CG  1 
ATOM   3491 C  CD  . GLN B 1 142 ? 27.809  23.023  32.865  1.00 115.24 ? 142 GLN B CD  1 
ATOM   3492 O  OE1 . GLN B 1 142 ? 27.972  24.208  33.163  1.00 133.20 ? 142 GLN B OE1 1 
ATOM   3493 N  NE2 . GLN B 1 142 ? 28.814  22.170  32.772  1.00 122.89 ? 142 GLN B NE2 1 
ATOM   3494 N  N   . GLY B 1 143 ? 24.805  18.063  32.581  1.00 35.67  ? 143 GLY B N   1 
ATOM   3495 C  CA  . GLY B 1 143 ? 24.972  16.637  32.336  1.00 35.95  ? 143 GLY B CA  1 
ATOM   3496 C  C   . GLY B 1 143 ? 26.378  16.146  32.629  1.00 42.68  ? 143 GLY B C   1 
ATOM   3497 O  O   . GLY B 1 143 ? 26.721  14.966  32.407  1.00 42.33  ? 143 GLY B O   1 
ATOM   3498 N  N   . ASN B 1 144 ? 27.158  17.010  33.247  1.00 39.74  ? 144 ASN B N   1 
ATOM   3499 C  CA  . ASN B 1 144 ? 28.471  16.637  33.704  1.00 47.04  ? 144 ASN B CA  1 
ATOM   3500 C  C   . ASN B 1 144 ? 28.417  16.430  35.207  1.00 51.35  ? 144 ASN B C   1 
ATOM   3501 O  O   . ASN B 1 144 ? 27.801  17.225  35.905  1.00 51.93  ? 144 ASN B O   1 
ATOM   3502 C  CB  . ASN B 1 144 ? 29.462  17.748  33.384  1.00 59.58  ? 144 ASN B CB  1 
ATOM   3503 C  CG  . ASN B 1 144 ? 29.671  17.938  31.908  1.00 69.46  ? 144 ASN B CG  1 
ATOM   3504 O  OD1 . ASN B 1 144 ? 28.921  17.429  31.093  1.00 60.54  ? 144 ASN B OD1 1 
ATOM   3505 N  ND2 . ASN B 1 144 ? 30.689  18.688  31.560  1.00 100.55 ? 144 ASN B ND2 1 
ATOM   3506 N  N   . PRO B 1 145 ? 29.197  15.468  35.691  1.00 49.25  ? 145 PRO B N   1 
ATOM   3507 C  CA  . PRO B 1 145 ? 29.528  15.269  37.102  1.00 50.20  ? 145 PRO B CA  1 
ATOM   3508 C  C   . PRO B 1 145 ? 29.556  16.510  37.993  1.00 50.68  ? 145 PRO B C   1 
ATOM   3509 O  O   . PRO B 1 145 ? 29.995  17.556  37.553  1.00 42.14  ? 145 PRO B O   1 
ATOM   3510 C  CB  . PRO B 1 145 ? 30.937  14.707  37.013  1.00 47.01  ? 145 PRO B CB  1 
ATOM   3511 C  CG  . PRO B 1 145 ? 30.935  13.911  35.759  1.00 42.87  ? 145 PRO B CG  1 
ATOM   3512 C  CD  . PRO B 1 145 ? 29.896  14.492  34.843  1.00 42.68  ? 145 PRO B CD  1 
ATOM   3513 N  N   . SER B 1 146 ? 29.131  16.357  39.251  1.00 49.30  ? 146 SER B N   1 
ATOM   3514 C  CA  . SER B 1 146 ? 28.925  17.459  40.191  1.00 36.53  ? 146 SER B CA  1 
ATOM   3515 C  C   . SER B 1 146 ? 29.774  17.338  41.426  1.00 32.40  ? 146 SER B C   1 
ATOM   3516 O  O   . SER B 1 146 ? 30.488  18.252  41.784  1.00 32.84  ? 146 SER B O   1 
ATOM   3517 C  CB  . SER B 1 146 ? 27.472  17.497  40.636  1.00 36.78  ? 146 SER B CB  1 
ATOM   3518 O  OG  . SER B 1 146 ? 26.971  16.183  40.795  1.00 29.68  ? 146 SER B OG  1 
ATOM   3519 N  N   . GLY B 1 147 ? 29.690  16.187  42.085  1.00 37.19  ? 147 GLY B N   1 
ATOM   3520 C  CA  . GLY B 1 147 ? 30.461  15.945  43.290  1.00 40.77  ? 147 GLY B CA  1 
ATOM   3521 C  C   . GLY B 1 147 ? 29.243  15.644  44.142  1.00 30.27  ? 147 GLY B C   1 
ATOM   3522 O  O   . GLY B 1 147 ? 28.122  15.581  43.638  1.00 36.48  ? 147 GLY B O   1 
ATOM   3523 N  N   . GLY B 1 148 ? 29.465  15.456  45.439  1.00 21.59  ? 148 GLY B N   1 
ATOM   3524 C  CA  . GLY B 1 148 ? 28.386  15.148  46.358  1.00 20.57  ? 148 GLY B CA  1 
ATOM   3525 C  C   . GLY B 1 148 ? 27.068  15.854  46.609  1.00 17.56  ? 148 GLY B C   1 
ATOM   3526 O  O   . GLY B 1 148 ? 26.952  17.065  46.417  1.00 18.99  ? 148 GLY B O   1 
ATOM   3527 N  N   . LEU B 1 149 ? 26.070  15.090  47.041  1.00 16.76  ? 149 LEU B N   1 
ATOM   3528 C  CA  . LEU B 1 149 ? 24.794  15.636  47.421  1.00 13.08  ? 149 LEU B CA  1 
ATOM   3529 C  C   . LEU B 1 149 ? 24.955  16.828  48.316  1.00 15.10  ? 149 LEU B C   1 
ATOM   3530 O  O   . LEU B 1 149 ? 25.971  17.021  48.955  1.00 12.53  ? 149 LEU B O   1 
ATOM   3531 C  CB  . LEU B 1 149 ? 23.939  14.595  48.114  1.00 10.09  ? 149 LEU B CB  1 
ATOM   3532 C  CG  . LEU B 1 149 ? 22.588  14.413  47.422  1.00 13.41  ? 149 LEU B CG  1 
ATOM   3533 C  CD1 . LEU B 1 149 ? 21.713  13.495  48.231  1.00 21.82  ? 149 LEU B CD1 1 
ATOM   3534 C  CD2 . LEU B 1 149 ? 21.887  15.740  47.168  1.00 17.31  ? 149 LEU B CD2 1 
ATOM   3535 N  N   . LYS B 1 150 ? 23.909  17.629  48.350  1.00 22.68  ? 150 LYS B N   1 
ATOM   3536 C  CA  . LYS B 1 150 ? 23.819  18.743  49.273  1.00 24.38  ? 150 LYS B CA  1 
ATOM   3537 C  C   . LYS B 1 150 ? 22.387  18.895  49.744  1.00 24.40  ? 150 LYS B C   1 
ATOM   3538 O  O   . LYS B 1 150 ? 21.436  18.801  48.954  1.00 16.60  ? 150 LYS B O   1 
ATOM   3539 C  CB  . LYS B 1 150 ? 24.255  20.050  48.616  1.00 21.63  ? 150 LYS B CB  1 
ATOM   3540 C  CG  . LYS B 1 150 ? 25.738  20.180  48.393  1.00 26.94  ? 150 LYS B CG  1 
ATOM   3541 C  CD  . LYS B 1 150 ? 26.076  21.560  47.872  1.00 24.83  ? 150 LYS B CD  1 
ATOM   3542 C  CE  . LYS B 1 150 ? 27.570  21.739  47.740  1.00 35.73  ? 150 LYS B CE  1 
ATOM   3543 N  NZ  . LYS B 1 150 ? 27.930  23.082  47.228  1.00 56.32  ? 150 LYS B NZ  1 
ATOM   3544 N  N   . ARG B 1 151 ? 22.250  19.132  51.043  1.00 25.32  ? 151 ARG B N   1 
ATOM   3545 C  CA  . ARG B 1 151 ? 20.970  19.489  51.633  1.00 23.18  ? 151 ARG B CA  1 
ATOM   3546 C  C   . ARG B 1 151 ? 21.137  20.643  52.627  1.00 20.03  ? 151 ARG B C   1 
ATOM   3547 O  O   . ARG B 1 151 ? 22.230  20.899  53.124  1.00 25.19  ? 151 ARG B O   1 
ATOM   3548 C  CB  . ARG B 1 151 ? 20.347  18.275  52.309  1.00 22.81  ? 151 ARG B CB  1 
ATOM   3549 C  CG  . ARG B 1 151 ? 20.138  17.083  51.376  1.00 20.46  ? 151 ARG B CG  1 
ATOM   3550 C  CD  . ARG B 1 151 ? 19.975  15.793  52.177  1.00 24.19  ? 151 ARG B CD  1 
ATOM   3551 N  NE  . ARG B 1 151 ? 19.629  14.626  51.366  1.00 22.73  ? 151 ARG B NE  1 
ATOM   3552 C  CZ  . ARG B 1 151 ? 19.672  13.365  51.806  1.00 24.56  ? 151 ARG B CZ  1 
ATOM   3553 N  NH1 . ARG B 1 151 ? 20.058  13.089  53.051  1.00 31.74  ? 151 ARG B NH1 1 
ATOM   3554 N  NH2 . ARG B 1 151 ? 19.331  12.364  51.002  1.00 27.66  ? 151 ARG B NH2 1 
ATOM   3555 N  N   . ASN B 1 152 ? 20.006  21.245  52.942  1.00 18.11  ? 152 ASN B N   1 
ATOM   3556 C  CA  . ASN B 1 152 ? 19.900  22.298  53.920  1.00 27.12  ? 152 ASN B CA  1 
ATOM   3557 C  C   . ASN B 1 152 ? 18.391  22.389  54.046  1.00 31.32  ? 152 ASN B C   1 
ATOM   3558 O  O   . ASN B 1 152 ? 17.721  23.087  53.272  1.00 26.92  ? 152 ASN B O   1 
ATOM   3559 C  CB  . ASN B 1 152 ? 20.559  23.597  53.436  1.00 27.46  ? 152 ASN B CB  1 
ATOM   3560 C  CG  . ASN B 1 152 ? 21.338  24.299  54.535  1.00 24.09  ? 152 ASN B CG  1 
ATOM   3561 O  OD1 . ASN B 1 152 ? 22.212  25.118  54.263  1.00 28.15  ? 152 ASN B OD1 1 
ATOM   3562 N  ND2 . ASN B 1 152 ? 21.022  23.974  55.790  1.00 21.26  ? 152 ASN B ND2 1 
ATOM   3563 N  N   . PHE B 1 153 ? 17.861  21.643  55.012  1.00 25.82  ? 153 PHE B N   1 
ATOM   3564 C  CA  . PHE B 1 153 ? 16.492  21.798  55.444  1.00 16.76  ? 153 PHE B CA  1 
ATOM   3565 C  C   . PHE B 1 153 ? 16.364  23.192  56.004  1.00 22.02  ? 153 PHE B C   1 
ATOM   3566 O  O   . PHE B 1 153 ? 17.247  23.699  56.701  1.00 25.05  ? 153 PHE B O   1 
ATOM   3567 C  CB  . PHE B 1 153 ? 16.127  20.803  56.535  1.00 17.03  ? 153 PHE B CB  1 
ATOM   3568 C  CG  . PHE B 1 153 ? 16.203  19.374  56.113  1.00 15.57  ? 153 PHE B CG  1 
ATOM   3569 C  CD1 . PHE B 1 153 ? 17.180  18.947  55.249  1.00 18.88  ? 153 PHE B CD1 1 
ATOM   3570 C  CD2 . PHE B 1 153 ? 15.303  18.460  56.603  1.00 18.68  ? 153 PHE B CD2 1 
ATOM   3571 C  CE1 . PHE B 1 153 ? 17.257  17.627  54.875  1.00 27.42  ? 153 PHE B CE1 1 
ATOM   3572 C  CE2 . PHE B 1 153 ? 15.369  17.141  56.241  1.00 21.62  ? 153 PHE B CE2 1 
ATOM   3573 C  CZ  . PHE B 1 153 ? 16.348  16.722  55.371  1.00 26.77  ? 153 PHE B CZ  1 
ATOM   3574 N  N   . GLY B 1 154 ? 15.258  23.803  55.625  1.00 25.12  ? 154 GLY B N   1 
ATOM   3575 C  CA  . GLY B 1 154 ? 14.696  25.024  56.180  1.00 29.92  ? 154 GLY B CA  1 
ATOM   3576 C  C   . GLY B 1 154 ? 15.606  26.232  56.302  1.00 30.17  ? 154 GLY B C   1 
ATOM   3577 O  O   . GLY B 1 154 ? 15.466  27.007  57.225  1.00 19.64  ? 154 GLY B O   1 
ATOM   3578 N  N   . ALA B 1 155 ? 16.535  26.401  55.376  1.00 33.59  ? 155 ALA B N   1 
ATOM   3579 C  CA  . ALA B 1 155 ? 17.479  27.500  55.457  1.00 26.26  ? 155 ALA B CA  1 
ATOM   3580 C  C   . ALA B 1 155 ? 17.111  28.556  54.467  1.00 30.78  ? 155 ALA B C   1 
ATOM   3581 O  O   . ALA B 1 155 ? 17.840  29.507  54.253  1.00 30.54  ? 155 ALA B O   1 
ATOM   3582 C  CB  . ALA B 1 155 ? 18.884  27.017  55.189  1.00 21.73  ? 155 ALA B CB  1 
ATOM   3583 N  N   . THR B 1 156 ? 15.967  28.348  53.850  1.00 33.55  ? 156 THR B N   1 
ATOM   3584 C  CA  . THR B 1 156 ? 15.314  29.315  52.973  1.00 40.12  ? 156 THR B CA  1 
ATOM   3585 C  C   . THR B 1 156 ? 14.219  30.134  53.701  1.00 47.96  ? 156 THR B C   1 
ATOM   3586 O  O   . THR B 1 156 ? 13.335  29.571  54.374  1.00 45.66  ? 156 THR B O   1 
ATOM   3587 C  CB  . THR B 1 156 ? 14.748  28.624  51.692  1.00 43.17  ? 156 THR B CB  1 
ATOM   3588 O  OG1 . THR B 1 156 ? 15.549  28.990  50.561  1.00 62.49  ? 156 THR B OG1 1 
ATOM   3589 C  CG2 . THR B 1 156 ? 13.315  29.027  51.451  1.00 45.97  ? 156 THR B CG2 1 
ATOM   3590 N  N   . LYS B 1 157 ? 14.313  31.466  53.568  1.00 52.95  ? 157 LYS B N   1 
ATOM   3591 C  CA  . LYS B 1 157 ? 13.327  32.435  54.083  1.00 48.49  ? 157 LYS B CA  1 
ATOM   3592 C  C   . LYS B 1 157 ? 11.938  32.178  53.514  1.00 44.94  ? 157 LYS B C   1 
ATOM   3593 O  O   . LYS B 1 157 ? 10.927  32.368  54.191  1.00 48.68  ? 157 LYS B O   1 
ATOM   3594 C  CB  . LYS B 1 157 ? 13.755  33.874  53.740  1.00 43.71  ? 157 LYS B CB  1 
ATOM   3595 C  CG  . LYS B 1 157 ? 12.701  34.926  54.088  1.00 50.87  ? 157 LYS B CG  1 
ATOM   3596 C  CD  . LYS B 1 157 ? 13.260  36.340  54.110  1.00 68.96  ? 157 LYS B CD  1 
ATOM   3597 C  CE  . LYS B 1 157 ? 12.158  37.368  54.310  1.00 54.26  ? 157 LYS B CE  1 
ATOM   3598 N  NZ  . LYS B 1 157 ? 11.280  37.542  53.119  1.00 82.99  ? 157 LYS B NZ  1 
ATOM   3599 N  N   . GLU B 1 158 ? 11.921  31.719  52.276  1.00 39.77  ? 158 GLU B N   1 
ATOM   3600 C  CA  . GLU B 1 158 ? 10.721  31.500  51.506  1.00 45.65  ? 158 GLU B CA  1 
ATOM   3601 C  C   . GLU B 1 158 ? 10.146  30.102  51.692  1.00 48.49  ? 158 GLU B C   1 
ATOM   3602 O  O   . GLU B 1 158 ? 9.103   29.774  51.150  1.00 53.19  ? 158 GLU B O   1 
ATOM   3603 C  CB  . GLU B 1 158 ? 11.058  31.733  50.038  1.00 45.65  ? 158 GLU B CB  1 
ATOM   3604 C  CG  . GLU B 1 158 ? 10.051  31.197  49.058  1.00 56.85  ? 158 GLU B CG  1 
ATOM   3605 C  CD  . GLU B 1 158 ? 9.867   32.124  47.892  1.00 63.27  ? 158 GLU B CD  1 
ATOM   3606 O  OE1 . GLU B 1 158 ? 10.462  33.212  47.931  1.00 70.39  ? 158 GLU B OE1 1 
ATOM   3607 O  OE2 . GLU B 1 158 ? 9.135   31.783  46.946  1.00 70.63  ? 158 GLU B OE2 1 
ATOM   3608 N  N   . ALA B 1 159 ? 10.836  29.274  52.458  1.00 42.76  ? 159 ALA B N   1 
ATOM   3609 C  CA  . ALA B 1 159 ? 10.326  27.979  52.897  1.00 39.30  ? 159 ALA B CA  1 
ATOM   3610 C  C   . ALA B 1 159 ? 11.108  27.447  54.109  1.00 35.18  ? 159 ALA B C   1 
ATOM   3611 O  O   . ALA B 1 159 ? 11.964  26.569  53.985  1.00 36.98  ? 159 ALA B O   1 
ATOM   3612 C  CB  . ALA B 1 159 ? 10.331  26.979  51.741  1.00 35.99  ? 159 ALA B CB  1 
ATOM   3613 N  N   . PRO B 1 160 ? 10.821  28.008  55.292  1.00 32.49  ? 160 PRO B N   1 
ATOM   3614 C  CA  . PRO B 1 160 ? 11.413  27.600  56.576  1.00 34.29  ? 160 PRO B CA  1 
ATOM   3615 C  C   . PRO B 1 160 ? 10.769  26.363  57.230  1.00 25.31  ? 160 PRO B C   1 
ATOM   3616 O  O   . PRO B 1 160 ? 11.321  25.808  58.185  1.00 22.97  ? 160 PRO B O   1 
ATOM   3617 C  CB  . PRO B 1 160 ? 11.181  28.832  57.457  1.00 32.67  ? 160 PRO B CB  1 
ATOM   3618 C  CG  . PRO B 1 160 ? 9.949   29.479  56.884  1.00 24.20  ? 160 PRO B CG  1 
ATOM   3619 C  CD  . PRO B 1 160 ? 10.088  29.284  55.403  1.00 32.70  ? 160 PRO B CD  1 
ATOM   3620 N  N   . THR B 1 161 ? 9.628   25.934  56.719  1.00 19.27  ? 161 THR B N   1 
ATOM   3621 C  CA  . THR B 1 161 ? 8.931   24.818  57.308  1.00 18.00  ? 161 THR B CA  1 
ATOM   3622 C  C   . THR B 1 161 ? 8.268   24.010  56.229  1.00 22.65  ? 161 THR B C   1 
ATOM   3623 O  O   . THR B 1 161 ? 7.859   24.557  55.205  1.00 24.82  ? 161 THR B O   1 
ATOM   3624 C  CB  . THR B 1 161 ? 7.831   25.308  58.244  1.00 26.26  ? 161 THR B CB  1 
ATOM   3625 O  OG1 . THR B 1 161 ? 6.992   24.202  58.588  1.00 33.40  ? 161 THR B OG1 1 
ATOM   3626 C  CG2 . THR B 1 161 ? 6.990   26.359  57.550  1.00 28.44  ? 161 THR B CG2 1 
ATOM   3627 N  N   . LEU B 1 162 ? 8.035   22.741  56.512  1.00 24.13  ? 162 LEU B N   1 
ATOM   3628 C  CA  . LEU B 1 162 ? 7.373   21.835  55.600  1.00 25.00  ? 162 LEU B CA  1 
ATOM   3629 C  C   . LEU B 1 162 ? 5.900   22.099  55.585  1.00 22.85  ? 162 LEU B C   1 
ATOM   3630 O  O   . LEU B 1 162 ? 5.361   22.537  56.568  1.00 22.77  ? 162 LEU B O   1 
ATOM   3631 C  CB  . LEU B 1 162 ? 7.568   20.415  56.091  1.00 21.45  ? 162 LEU B CB  1 
ATOM   3632 C  CG  . LEU B 1 162 ? 8.805   19.689  55.616  1.00 17.00  ? 162 LEU B CG  1 
ATOM   3633 C  CD1 . LEU B 1 162 ? 9.289   18.907  56.807  1.00 25.47  ? 162 LEU B CD1 1 
ATOM   3634 C  CD2 . LEU B 1 162 ? 8.502   18.753  54.466  1.00 16.39  ? 162 LEU B CD2 1 
ATOM   3635 N  N   . PRO B 1 163 ? 5.227   21.804  54.487  1.00 27.34  ? 163 PRO B N   1 
ATOM   3636 C  CA  . PRO B 1 163 ? 3.769   21.983  54.500  1.00 33.98  ? 163 PRO B CA  1 
ATOM   3637 C  C   . PRO B 1 163 ? 3.080   21.142  55.602  1.00 38.26  ? 163 PRO B C   1 
ATOM   3638 O  O   . PRO B 1 163 ? 3.679   20.163  56.082  1.00 26.53  ? 163 PRO B O   1 
ATOM   3639 C  CB  . PRO B 1 163 ? 3.342   21.541  53.090  1.00 30.66  ? 163 PRO B CB  1 
ATOM   3640 C  CG  . PRO B 1 163 ? 4.551   20.830  52.488  1.00 25.19  ? 163 PRO B CG  1 
ATOM   3641 C  CD  . PRO B 1 163 ? 5.738   21.449  53.149  1.00 28.06  ? 163 PRO B CD  1 
ATOM   3642 N  N   . THR B 1 164 ? 1.862   21.541  56.004  1.00 39.52  ? 164 THR B N   1 
ATOM   3643 C  CA  . THR B 1 164 ? 1.110   20.866  57.086  1.00 33.99  ? 164 THR B CA  1 
ATOM   3644 C  C   . THR B 1 164 ? -0.102  20.072  56.601  1.00 26.67  ? 164 THR B C   1 
ATOM   3645 O  O   . THR B 1 164 ? -0.485  20.151  55.431  1.00 32.04  ? 164 THR B O   1 
ATOM   3646 C  CB  . THR B 1 164 ? 0.634   21.855  58.212  1.00 44.64  ? 164 THR B CB  1 
ATOM   3647 O  OG1 . THR B 1 164 ? -0.470  22.656  57.748  1.00 41.68  ? 164 THR B OG1 1 
ATOM   3648 C  CG2 . THR B 1 164 ? 1.790   22.740  58.687  1.00 50.22  ? 164 THR B CG2 1 
ATOM   3649 N  N   . ARG B 1 165 ? -0.707  19.324  57.515  0.50 23.32  ? 165 ARG B N   1 
ATOM   3650 C  CA  . ARG B 1 165 ? -1.839  18.491  57.161  0.50 28.44  ? 165 ARG B CA  1 
ATOM   3651 C  C   . ARG B 1 165 ? -2.972  19.374  56.719  0.50 28.08  ? 165 ARG B C   1 
ATOM   3652 O  O   . ARG B 1 165 ? -3.726  19.040  55.804  0.50 26.37  ? 165 ARG B O   1 
ATOM   3653 C  CB  . ARG B 1 165 ? -2.292  17.695  58.356  0.50 28.24  ? 165 ARG B CB  1 
ATOM   3654 C  CG  . ARG B 1 165 ? -3.277  16.645  58.020  0.50 27.89  ? 165 ARG B CG  1 
ATOM   3655 C  CD  . ARG B 1 165 ? -3.537  15.863  59.267  0.50 40.00  ? 165 ARG B CD  1 
ATOM   3656 N  NE  . ARG B 1 165 ? -4.498  14.792  59.060  0.50 47.44  ? 165 ARG B NE  1 
ATOM   3657 C  CZ  . ARG B 1 165 ? -5.814  14.960  59.085  0.50 34.29  ? 165 ARG B CZ  1 
ATOM   3658 N  NH1 . ARG B 1 165 ? -6.330  16.164  59.296  0.50 30.18  ? 165 ARG B NH1 1 
ATOM   3659 N  NH2 . ARG B 1 165 ? -6.611  13.924  58.893  0.50 24.87  ? 165 ARG B NH2 1 
ATOM   3660 N  N   . ASP B 1 166 ? -3.098  20.509  57.388  1.00 27.36  ? 166 ASP B N   1 
ATOM   3661 C  CA  . ASP B 1 166 ? -4.073  21.479  56.958  1.00 32.30  ? 166 ASP B CA  1 
ATOM   3662 C  C   . ASP B 1 166 ? -3.834  21.830  55.511  1.00 32.27  ? 166 ASP B C   1 
ATOM   3663 O  O   . ASP B 1 166 ? -4.710  21.622  54.684  1.00 29.70  ? 166 ASP B O   1 
ATOM   3664 C  CB  . ASP B 1 166 ? -4.062  22.691  57.862  1.00 33.27  ? 166 ASP B CB  1 
ATOM   3665 C  CG  . ASP B 1 166 ? -4.718  22.393  59.186  1.00 39.36  ? 166 ASP B CG  1 
ATOM   3666 O  OD1 . ASP B 1 166 ? -4.507  23.147  60.160  1.00 55.51  ? 166 ASP B OD1 1 
ATOM   3667 O  OD2 . ASP B 1 166 ? -5.449  21.376  59.252  1.00 31.93  ? 166 ASP B OD2 1 
ATOM   3668 N  N   . ASP B 1 167 ? -2.627  22.298  55.196  1.00 37.83  ? 167 ASP B N   1 
ATOM   3669 C  CA  . ASP B 1 167 ? -2.303  22.718  53.834  1.00 32.15  ? 167 ASP B CA  1 
ATOM   3670 C  C   . ASP B 1 167 ? -2.927  21.755  52.854  1.00 29.13  ? 167 ASP B C   1 
ATOM   3671 O  O   . ASP B 1 167 ? -3.580  22.170  51.892  1.00 29.94  ? 167 ASP B O   1 
ATOM   3672 C  CB  . ASP B 1 167 ? -0.788  22.782  53.609  1.00 30.93  ? 167 ASP B CB  1 
ATOM   3673 C  CG  . ASP B 1 167 ? -0.157  24.025  54.200  1.00 41.72  ? 167 ASP B CG  1 
ATOM   3674 O  OD1 . ASP B 1 167 ? -0.801  25.100  54.190  1.00 66.99  ? 167 ASP B OD1 1 
ATOM   3675 O  OD2 . ASP B 1 167 ? 0.993   23.926  54.676  1.00 38.95  ? 167 ASP B OD2 1 
ATOM   3676 N  N   . VAL B 1 168 ? -2.739  20.469  53.146  1.00 27.79  ? 168 VAL B N   1 
ATOM   3677 C  CA  . VAL B 1 168 ? -3.107  19.361  52.274  1.00 27.62  ? 168 VAL B CA  1 
ATOM   3678 C  C   . VAL B 1 168 ? -4.611  19.102  52.211  1.00 33.50  ? 168 VAL B C   1 
ATOM   3679 O  O   . VAL B 1 168 ? -5.168  18.831  51.136  1.00 29.78  ? 168 VAL B O   1 
ATOM   3680 C  CB  . VAL B 1 168 ? -2.435  18.089  52.787  1.00 27.94  ? 168 VAL B CB  1 
ATOM   3681 C  CG1 . VAL B 1 168 ? -2.980  16.867  52.064  1.00 34.17  ? 168 VAL B CG1 1 
ATOM   3682 C  CG2 . VAL B 1 168 ? -0.920  18.208  52.676  1.00 19.67  ? 168 VAL B CG2 1 
ATOM   3683 N  N   . LEU B 1 169 ? -5.250  19.179  53.377  1.00 38.27  ? 169 LEU B N   1 
ATOM   3684 C  CA  . LEU B 1 169 ? -6.696  19.018  53.498  1.00 42.28  ? 169 LEU B CA  1 
ATOM   3685 C  C   . LEU B 1 169 ? -7.427  20.082  52.695  1.00 40.77  ? 169 LEU B C   1 
ATOM   3686 O  O   . LEU B 1 169 ? -8.491  19.825  52.120  1.00 39.50  ? 169 LEU B O   1 
ATOM   3687 C  CB  . LEU B 1 169 ? -7.105  19.120  54.965  1.00 41.51  ? 169 LEU B CB  1 
ATOM   3688 C  CG  . LEU B 1 169 ? -7.358  17.781  55.661  1.00 34.08  ? 169 LEU B CG  1 
ATOM   3689 C  CD1 . LEU B 1 169 ? -6.400  16.717  55.160  1.00 29.42  ? 169 LEU B CD1 1 
ATOM   3690 C  CD2 . LEU B 1 169 ? -7.259  17.942  57.163  1.00 35.72  ? 169 LEU B CD2 1 
ATOM   3691 N  N   . ASN B 1 170 ? -6.839  21.279  52.684  1.00 37.86  ? 170 ASN B N   1 
ATOM   3692 C  CA  . ASN B 1 170 ? -7.339  22.418  51.922  1.00 38.21  ? 170 ASN B CA  1 
ATOM   3693 C  C   . ASN B 1 170 ? -7.240  22.168  50.435  1.00 41.90  ? 170 ASN B C   1 
ATOM   3694 O  O   . ASN B 1 170 ? -8.139  22.528  49.678  1.00 55.56  ? 170 ASN B O   1 
ATOM   3695 C  CB  . ASN B 1 170 ? -6.561  23.697  52.264  1.00 47.23  ? 170 ASN B CB  1 
ATOM   3696 C  CG  . ASN B 1 170 ? -7.150  24.440  53.446  1.00 59.35  ? 170 ASN B CG  1 
ATOM   3697 O  OD1 . ASN B 1 170 ? -8.374  24.573  53.565  1.00 55.69  ? 170 ASN B OD1 1 
ATOM   3698 N  ND2 . ASN B 1 170 ? -6.279  24.935  54.330  1.00 55.76  ? 170 ASN B ND2 1 
ATOM   3699 N  N   . ALA B 1 171 ? -6.142  21.558  50.015  1.00 38.68  ? 171 ALA B N   1 
ATOM   3700 C  CA  . ALA B 1 171 ? -5.903  21.346  48.598  1.00 39.42  ? 171 ALA B CA  1 
ATOM   3701 C  C   . ALA B 1 171 ? -6.853  20.284  48.029  1.00 39.05  ? 171 ALA B C   1 
ATOM   3702 O  O   . ALA B 1 171 ? -7.358  20.415  46.913  1.00 42.73  ? 171 ALA B O   1 
ATOM   3703 C  CB  . ALA B 1 171 ? -4.450  20.955  48.374  1.00 35.86  ? 171 ALA B CB  1 
ATOM   3704 N  N   . LEU B 1 172 ? -7.109  19.246  48.815  1.00 37.29  ? 172 LEU B N   1 
ATOM   3705 C  CA  . LEU B 1 172 ? -8.046  18.189  48.441  1.00 42.75  ? 172 LEU B CA  1 
ATOM   3706 C  C   . LEU B 1 172 ? -9.491  18.670  48.311  1.00 43.30  ? 172 LEU B C   1 
ATOM   3707 O  O   . LEU B 1 172 ? -10.351 17.936  47.816  1.00 38.15  ? 172 LEU B O   1 
ATOM   3708 C  CB  . LEU B 1 172 ? -7.987  17.091  49.499  1.00 53.90  ? 172 LEU B CB  1 
ATOM   3709 C  CG  . LEU B 1 172 ? -6.665  16.335  49.558  1.00 45.95  ? 172 LEU B CG  1 
ATOM   3710 C  CD1 . LEU B 1 172 ? -6.523  15.559  50.869  1.00 46.93  ? 172 LEU B CD1 1 
ATOM   3711 C  CD2 . LEU B 1 172 ? -6.569  15.434  48.327  1.00 36.12  ? 172 LEU B CD2 1 
ATOM   3712 N  N   . LYS B 1 173 ? -9.727  19.891  48.773  1.00 45.97  ? 173 LYS B N   1 
ATOM   3713 C  CA  . LYS B 1 173 ? -11.040 20.509  48.775  1.00 46.70  ? 173 LYS B CA  1 
ATOM   3714 C  C   . LYS B 1 173 ? -11.377 20.962  47.386  1.00 46.14  ? 173 LYS B C   1 
ATOM   3715 O  O   . LYS B 1 173 ? -12.532 20.952  46.973  1.00 57.27  ? 173 LYS B O   1 
ATOM   3716 C  CB  . LYS B 1 173 ? -11.041 21.737  49.687  1.00 37.24  ? 173 LYS B CB  1 
ATOM   3717 C  CG  . LYS B 1 173 ? -10.989 21.413  51.169  1.00 36.02  ? 173 LYS B CG  1 
ATOM   3718 C  CD  . LYS B 1 173 ? -12.046 22.160  51.958  1.00 37.28  ? 173 LYS B CD  1 
ATOM   3719 C  CE  . LYS B 1 173 ? -11.877 21.915  53.446  1.00 55.24  ? 173 LYS B CE  1 
ATOM   3720 N  NZ  . LYS B 1 173 ? -12.496 22.980  54.280  1.00 50.82  ? 173 LYS B NZ  1 
ATOM   3721 N  N   . ILE B 1 174 ? -10.340 21.359  46.652  1.00 35.84  ? 174 ILE B N   1 
ATOM   3722 C  CA  . ILE B 1 174 ? -10.487 22.022  45.363  1.00 44.02  ? 174 ILE B CA  1 
ATOM   3723 C  C   . ILE B 1 174 ? -11.211 21.232  44.294  1.00 49.14  ? 174 ILE B C   1 
ATOM   3724 O  O   . ILE B 1 174 ? -10.789 20.152  43.936  1.00 46.76  ? 174 ILE B O   1 
ATOM   3725 C  CB  . ILE B 1 174 ? -9.149  22.458  44.808  1.00 40.89  ? 174 ILE B CB  1 
ATOM   3726 C  CG1 . ILE B 1 174 ? -8.326  23.087  45.909  1.00 45.25  ? 174 ILE B CG1 1 
ATOM   3727 C  CG2 . ILE B 1 174 ? -9.364  23.513  43.753  1.00 41.96  ? 174 ILE B CG2 1 
ATOM   3728 C  CD1 . ILE B 1 174 ? -8.573  24.570  46.058  1.00 43.45  ? 174 ILE B CD1 1 
ATOM   3729 N  N   . THR B 1 175 ? -12.291 21.814  43.773  1.00 55.33  ? 175 THR B N   1 
ATOM   3730 C  CA  . THR B 1 175 ? -13.202 21.110  42.877  1.00 49.55  ? 175 THR B CA  1 
ATOM   3731 C  C   . THR B 1 175 ? -12.626 20.830  41.475  1.00 47.54  ? 175 THR B C   1 
ATOM   3732 O  O   . THR B 1 175 ? -12.859 19.765  40.901  1.00 50.40  ? 175 THR B O   1 
ATOM   3733 C  CB  . THR B 1 175 ? -14.532 21.888  42.774  1.00 52.62  ? 175 THR B CB  1 
ATOM   3734 O  OG1 . THR B 1 175 ? -15.045 22.129  44.094  1.00 49.85  ? 175 THR B OG1 1 
ATOM   3735 C  CG2 . THR B 1 175 ? -15.556 21.109  41.945  1.00 59.91  ? 175 THR B CG2 1 
ATOM   3736 N  N   . GLN B 1 176 ? -11.868 21.781  40.934  1.00 41.07  ? 176 GLN B N   1 
ATOM   3737 C  CA  . GLN B 1 176 ? -11.275 21.636  39.599  1.00 47.47  ? 176 GLN B CA  1 
ATOM   3738 C  C   . GLN B 1 176 ? -9.874  20.989  39.589  1.00 44.86  ? 176 GLN B C   1 
ATOM   3739 O  O   . GLN B 1 176 ? -9.008  21.363  40.393  1.00 38.24  ? 176 GLN B O   1 
ATOM   3740 C  CB  . GLN B 1 176 ? -11.213 23.001  38.912  1.00 46.23  ? 176 GLN B CB  1 
ATOM   3741 C  CG  . GLN B 1 176 ? -12.568 23.620  38.669  1.00 36.69  ? 176 GLN B CG  1 
ATOM   3742 C  CD  . GLN B 1 176 ? -13.414 22.766  37.752  1.00 53.38  ? 176 GLN B CD  1 
ATOM   3743 O  OE1 . GLN B 1 176 ? -14.309 22.051  38.202  1.00 64.35  ? 176 GLN B OE1 1 
ATOM   3744 N  NE2 . GLN B 1 176 ? -13.131 22.829  36.456  1.00 56.77  ? 176 GLN B NE2 1 
ATOM   3745 N  N   . TYR B 1 177 ? -9.651  20.034  38.677  1.00 45.02  ? 177 TYR B N   1 
ATOM   3746 C  CA  . TYR B 1 177 ? -8.307  19.491  38.467  1.00 37.89  ? 177 TYR B CA  1 
ATOM   3747 C  C   . TYR B 1 177 ? -7.349  20.634  38.100  1.00 35.93  ? 177 TYR B C   1 
ATOM   3748 O  O   . TYR B 1 177 ? -6.366  20.883  38.823  1.00 35.24  ? 177 TYR B O   1 
ATOM   3749 C  CB  . TYR B 1 177 ? -8.261  18.403  37.372  1.00 37.93  ? 177 TYR B CB  1 
ATOM   3750 C  CG  . TYR B 1 177 ? -6.836  18.014  37.076  1.00 33.43  ? 177 TYR B CG  1 
ATOM   3751 C  CD1 . TYR B 1 177 ? -6.207  17.014  37.811  1.00 35.48  ? 177 TYR B CD1 1 
ATOM   3752 C  CD2 . TYR B 1 177 ? -6.092  18.705  36.118  1.00 31.47  ? 177 TYR B CD2 1 
ATOM   3753 C  CE1 . TYR B 1 177 ? -4.882  16.695  37.577  1.00 37.01  ? 177 TYR B CE1 1 
ATOM   3754 C  CE2 . TYR B 1 177 ? -4.771  18.395  35.880  1.00 30.06  ? 177 TYR B CE2 1 
ATOM   3755 C  CZ  . TYR B 1 177 ? -4.171  17.388  36.612  1.00 28.52  ? 177 TYR B CZ  1 
ATOM   3756 O  OH  . TYR B 1 177 ? -2.852  17.067  36.384  1.00 20.37  ? 177 TYR B OH  1 
ATOM   3757 N  N   . ASP B 1 178 ? -7.639  21.310  36.977  1.00 34.95  ? 178 ASP B N   1 
ATOM   3758 C  CA  . ASP B 1 178 ? -6.893  22.498  36.528  1.00 33.85  ? 178 ASP B CA  1 
ATOM   3759 C  C   . ASP B 1 178 ? -7.825  23.505  35.816  1.00 28.23  ? 178 ASP B C   1 
ATOM   3760 O  O   . ASP B 1 178 ? -8.876  23.141  35.280  1.00 26.73  ? 178 ASP B O   1 
ATOM   3761 C  CB  . ASP B 1 178 ? -5.716  22.089  35.615  1.00 34.77  ? 178 ASP B CB  1 
ATOM   3762 C  CG  . ASP B 1 178 ? -4.591  23.126  35.580  1.00 25.90  ? 178 ASP B CG  1 
ATOM   3763 O  OD1 . ASP B 1 178 ? -4.837  24.296  35.936  1.00 22.54  ? 178 ASP B OD1 1 
ATOM   3764 O  OD2 . ASP B 1 178 ? -3.461  22.767  35.191  1.00 23.92  ? 178 ASP B OD2 1 
ATOM   3765 N  N   . THR B 1 179 ? -7.417  24.776  35.808  1.00 25.84  ? 179 THR B N   1 
ATOM   3766 C  CA  . THR B 1 179 ? -8.190  25.873  35.205  1.00 29.34  ? 179 THR B CA  1 
ATOM   3767 C  C   . THR B 1 179 ? -7.386  26.807  34.297  1.00 28.16  ? 179 THR B C   1 
ATOM   3768 O  O   . THR B 1 179 ? -6.314  27.253  34.667  1.00 23.85  ? 179 THR B O   1 
ATOM   3769 C  CB  . THR B 1 179 ? -8.790  26.790  36.269  1.00 24.69  ? 179 THR B CB  1 
ATOM   3770 O  OG1 . THR B 1 179 ? -7.745  27.571  36.848  1.00 20.16  ? 179 THR B OG1 1 
ATOM   3771 C  CG2 . THR B 1 179 ? -9.452  25.997  37.328  1.00 24.73  ? 179 THR B CG2 1 
ATOM   3772 N  N   . PRO B 1 180 ? -7.934  27.124  33.127  1.00 26.34  ? 180 PRO B N   1 
ATOM   3773 C  CA  . PRO B 1 180 ? -7.237  27.955  32.167  1.00 24.14  ? 180 PRO B CA  1 
ATOM   3774 C  C   . PRO B 1 180 ? -6.528  29.006  32.936  1.00 22.78  ? 180 PRO B C   1 
ATOM   3775 O  O   . PRO B 1 180 ? -7.034  29.325  33.977  1.00 25.71  ? 180 PRO B O   1 
ATOM   3776 C  CB  . PRO B 1 180 ? -8.380  28.583  31.388  1.00 25.53  ? 180 PRO B CB  1 
ATOM   3777 C  CG  . PRO B 1 180 ? -9.422  27.546  31.413  1.00 16.37  ? 180 PRO B CG  1 
ATOM   3778 C  CD  . PRO B 1 180 ? -9.370  27.103  32.831  1.00 27.20  ? 180 PRO B CD  1 
ATOM   3779 N  N   . PRO B 1 181 ? -5.410  29.528  32.458  1.00 22.84  ? 181 PRO B N   1 
ATOM   3780 C  CA  . PRO B 1 181 ? -4.807  29.071  31.204  1.00 27.56  ? 181 PRO B CA  1 
ATOM   3781 C  C   . PRO B 1 181 ? -3.996  27.787  31.356  1.00 29.26  ? 181 PRO B C   1 
ATOM   3782 O  O   . PRO B 1 181 ? -3.334  27.390  30.397  1.00 25.23  ? 181 PRO B O   1 
ATOM   3783 C  CB  . PRO B 1 181 ? -3.884  30.230  30.823  1.00 31.36  ? 181 PRO B CB  1 
ATOM   3784 C  CG  . PRO B 1 181 ? -3.520  30.856  32.126  1.00 27.55  ? 181 PRO B CG  1 
ATOM   3785 C  CD  . PRO B 1 181 ? -4.737  30.723  32.996  1.00 29.04  ? 181 PRO B CD  1 
ATOM   3786 N  N   . TRP B 1 182 ? -4.038  27.144  32.521  1.00 34.46  ? 182 TRP B N   1 
ATOM   3787 C  CA  . TRP B 1 182 ? -3.280  25.886  32.716  1.00 28.69  ? 182 TRP B CA  1 
ATOM   3788 C  C   . TRP B 1 182 ? -1.852  26.042  33.220  1.00 31.48  ? 182 TRP B C   1 
ATOM   3789 O  O   . TRP B 1 182 ? -1.027  25.157  32.989  1.00 28.49  ? 182 TRP B O   1 
ATOM   3790 C  CB  . TRP B 1 182 ? -3.456  25.033  31.429  1.00 25.08  ? 182 TRP B CB  1 
ATOM   3791 C  CG  . TRP B 1 182 ? -4.862  25.117  30.828  1.00 32.99  ? 182 TRP B CG  1 
ATOM   3792 C  CD1 . TRP B 1 182 ? -5.272  25.876  29.753  1.00 31.79  ? 182 TRP B CD1 1 
ATOM   3793 C  CD2 . TRP B 1 182 ? -6.017  24.388  31.259  1.00 33.17  ? 182 TRP B CD2 1 
ATOM   3794 N  NE1 . TRP B 1 182 ? -6.610  25.666  29.506  1.00 26.89  ? 182 TRP B NE1 1 
ATOM   3795 C  CE2 . TRP B 1 182 ? -7.090  24.756  30.419  1.00 31.86  ? 182 TRP B CE2 1 
ATOM   3796 C  CE3 . TRP B 1 182 ? -6.251  23.460  32.282  1.00 31.09  ? 182 TRP B CE3 1 
ATOM   3797 C  CZ2 . TRP B 1 182 ? -8.368  24.233  30.576  1.00 40.16  ? 182 TRP B CZ2 1 
ATOM   3798 C  CZ3 . TRP B 1 182 ? -7.513  22.944  32.435  1.00 28.45  ? 182 TRP B CZ3 1 
ATOM   3799 C  CH2 . TRP B 1 182 ? -8.557  23.327  31.590  1.00 38.76  ? 182 TRP B CH2 1 
ATOM   3800 N  N   . ASP B 1 183 ? -1.452  27.197  33.694  1.00 33.30  ? 183 ASP B N   1 
ATOM   3801 C  CA  . ASP B 1 183 ? -0.100  27.395  34.256  1.00 29.46  ? 183 ASP B CA  1 
ATOM   3802 C  C   . ASP B 1 183 ? 0.058   27.903  35.656  1.00 28.74  ? 183 ASP B C   1 
ATOM   3803 O  O   . ASP B 1 183 ? -0.825  27.676  36.495  1.00 27.61  ? 183 ASP B O   1 
ATOM   3804 C  CB  . ASP B 1 183 ? 0.417   28.487  33.240  1.00 37.84  ? 183 ASP B CB  1 
ATOM   3805 C  CG  . ASP B 1 183 ? -0.319  29.852  33.337  1.00 41.77  ? 183 ASP B CG  1 
ATOM   3806 O  OD1 . ASP B 1 183 ? 0.032   30.762  32.548  1.00 30.50  ? 183 ASP B OD1 1 
ATOM   3807 O  OD2 . ASP B 1 183 ? -1.225  30.006  34.170  1.00 49.99  ? 183 ASP B OD2 1 
ATOM   3808 N  N   . MET B 1 184 ? 1.181   28.561  35.940  1.00 22.64  ? 184 MET B N   1 
ATOM   3809 C  CA  . MET B 1 184 ? 1.451   29.022  37.287  1.00 19.73  ? 184 MET B CA  1 
ATOM   3810 C  C   . MET B 1 184 ? 0.311   29.856  37.853  1.00 28.06  ? 184 MET B C   1 
ATOM   3811 O  O   . MET B 1 184 ? 0.098   29.831  39.065  1.00 35.39  ? 184 MET B O   1 
ATOM   3812 C  CB  . MET B 1 184 ? 2.753   29.809  37.344  1.00 23.26  ? 184 MET B CB  1 
ATOM   3813 C  CG  . MET B 1 184 ? 4.006   29.000  37.090  1.00 24.18  ? 184 MET B CG  1 
ATOM   3814 S  SD  . MET B 1 184 ? 5.462   30.055  37.276  1.00 49.80  ? 184 MET B SD  1 
ATOM   3815 C  CE  . MET B 1 184 ? 5.125   30.794  38.860  1.00 27.08  ? 184 MET B CE  1 
ATOM   3816 N  N   . THR B 1 185 ? -0.421  30.582  37.001  1.00 29.63  ? 185 THR B N   1 
ATOM   3817 C  CA  . THR B 1 185 ? -1.508  31.456  37.489  1.00 36.82  ? 185 THR B CA  1 
ATOM   3818 C  C   . THR B 1 185 ? -2.915  30.845  37.585  1.00 35.56  ? 185 THR B C   1 
ATOM   3819 O  O   . THR B 1 185 ? -3.858  31.539  37.970  1.00 36.94  ? 185 THR B O   1 
ATOM   3820 C  CB  . THR B 1 185 ? -1.630  32.792  36.683  1.00 34.89  ? 185 THR B CB  1 
ATOM   3821 O  OG1 . THR B 1 185 ? -2.098  32.532  35.351  1.00 47.69  ? 185 THR B OG1 1 
ATOM   3822 C  CG2 . THR B 1 185 ? -0.316  33.541  36.641  1.00 28.19  ? 185 THR B CG2 1 
ATOM   3823 N  N   . SER B 1 186 ? -3.062  29.569  37.234  1.00 33.53  ? 186 SER B N   1 
ATOM   3824 C  CA  . SER B 1 186 ? -4.363  28.901  37.322  1.00 33.30  ? 186 SER B CA  1 
ATOM   3825 C  C   . SER B 1 186 ? -4.987  29.009  38.722  1.00 33.26  ? 186 SER B C   1 
ATOM   3826 O  O   . SER B 1 186 ? -4.406  28.530  39.695  1.00 31.06  ? 186 SER B O   1 
ATOM   3827 C  CB  . SER B 1 186 ? -4.229  27.428  36.938  1.00 29.93  ? 186 SER B CB  1 
ATOM   3828 O  OG  . SER B 1 186 ? -3.842  27.288  35.582  1.00 23.07  ? 186 SER B OG  1 
ATOM   3829 N  N   . GLN B 1 187 ? -6.167  29.624  38.822  1.00 34.58  ? 187 GLN B N   1 
ATOM   3830 C  CA  . GLN B 1 187 ? -6.849  29.770  40.117  1.00 39.84  ? 187 GLN B CA  1 
ATOM   3831 C  C   . GLN B 1 187 ? -7.775  28.583  40.364  1.00 37.12  ? 187 GLN B C   1 
ATOM   3832 O  O   . GLN B 1 187 ? -8.116  27.860  39.430  1.00 35.27  ? 187 GLN B O   1 
ATOM   3833 C  CB  . GLN B 1 187 ? -7.641  31.084  40.198  1.00 51.89  ? 187 GLN B CB  1 
ATOM   3834 C  CG  . GLN B 1 187 ? -6.795  32.347  40.054  1.00 49.12  ? 187 GLN B CG  1 
ATOM   3835 C  CD  . GLN B 1 187 ? -5.709  32.448  41.108  1.00 64.05  ? 187 GLN B CD  1 
ATOM   3836 O  OE1 . GLN B 1 187 ? -4.639  31.853  40.973  1.00 68.22  ? 187 GLN B OE1 1 
ATOM   3837 N  NE2 . GLN B 1 187 ? -5.978  33.200  42.166  1.00 76.90  ? 187 GLN B NE2 1 
ATOM   3838 N  N   . ASN B 1 188 ? -8.175  28.370  41.615  1.00 34.84  ? 188 ASN B N   1 
ATOM   3839 C  CA  . ASN B 1 188 ? -9.049  27.244  41.928  1.00 34.60  ? 188 ASN B CA  1 
ATOM   3840 C  C   . ASN B 1 188 ? -8.667  26.017  41.102  1.00 30.09  ? 188 ASN B C   1 
ATOM   3841 O  O   . ASN B 1 188 ? -9.517  25.402  40.459  1.00 28.01  ? 188 ASN B O   1 
ATOM   3842 C  CB  . ASN B 1 188 ? -10.511 27.614  41.660  1.00 36.39  ? 188 ASN B CB  1 
ATOM   3843 C  CG  . ASN B 1 188 ? -11.089 28.527  42.723  1.00 67.73  ? 188 ASN B CG  1 
ATOM   3844 O  OD1 . ASN B 1 188 ? -10.637 29.659  42.901  1.00 75.83  ? 188 ASN B OD1 1 
ATOM   3845 N  ND2 . ASN B 1 188 ? -12.105 28.040  43.433  1.00 91.94  ? 188 ASN B ND2 1 
ATOM   3846 N  N   . SER B 1 189 ? -7.377  25.691  41.108  1.00 36.97  ? 189 SER B N   1 
ATOM   3847 C  CA  . SER B 1 189 ? -6.851  24.576  40.325  1.00 35.91  ? 189 SER B CA  1 
ATOM   3848 C  C   . SER B 1 189 ? -6.080  23.598  41.187  1.00 33.86  ? 189 SER B C   1 
ATOM   3849 O  O   . SER B 1 189 ? -4.954  23.888  41.586  1.00 28.24  ? 189 SER B O   1 
ATOM   3850 C  CB  . SER B 1 189 ? -5.926  25.076  39.228  1.00 31.25  ? 189 SER B CB  1 
ATOM   3851 O  OG  . SER B 1 189 ? -5.068  24.024  38.826  1.00 31.67  ? 189 SER B OG  1 
ATOM   3852 N  N   . PHE B 1 190 ? -6.678  22.433  41.437  1.00 34.44  ? 190 PHE B N   1 
ATOM   3853 C  CA  . PHE B 1 190 ? -6.092  21.448  42.338  1.00 31.34  ? 190 PHE B CA  1 
ATOM   3854 C  C   . PHE B 1 190 ? -4.635  21.272  42.022  1.00 29.94  ? 190 PHE B C   1 
ATOM   3855 O  O   . PHE B 1 190 ? -3.802  21.256  42.932  1.00 29.99  ? 190 PHE B O   1 
ATOM   3856 C  CB  . PHE B 1 190 ? -6.770  20.077  42.227  1.00 33.42  ? 190 PHE B CB  1 
ATOM   3857 C  CG  . PHE B 1 190 ? -6.025  18.986  42.950  1.00 30.65  ? 190 PHE B CG  1 
ATOM   3858 C  CD1 . PHE B 1 190 ? -5.813  19.065  44.318  1.00 27.63  ? 190 PHE B CD1 1 
ATOM   3859 C  CD2 . PHE B 1 190 ? -5.517  17.897  42.252  1.00 35.97  ? 190 PHE B CD2 1 
ATOM   3860 C  CE1 . PHE B 1 190 ? -5.119  18.077  44.980  1.00 32.30  ? 190 PHE B CE1 1 
ATOM   3861 C  CE2 . PHE B 1 190 ? -4.819  16.902  42.903  1.00 37.71  ? 190 PHE B CE2 1 
ATOM   3862 C  CZ  . PHE B 1 190 ? -4.619  16.990  44.272  1.00 41.09  ? 190 PHE B CZ  1 
ATOM   3863 N  N   . ARG B 1 191 ? -4.341  21.104  40.733  1.00 27.04  ? 191 ARG B N   1 
ATOM   3864 C  CA  . ARG B 1 191 ? -2.980  20.839  40.279  1.00 30.13  ? 191 ARG B CA  1 
ATOM   3865 C  C   . ARG B 1 191 ? -2.009  21.958  40.719  1.00 30.49  ? 191 ARG B C   1 
ATOM   3866 O  O   . ARG B 1 191 ? -0.980  21.686  41.350  1.00 29.29  ? 191 ARG B O   1 
ATOM   3867 C  CB  . ARG B 1 191 ? -2.981  20.633  38.766  1.00 30.93  ? 191 ARG B CB  1 
ATOM   3868 C  CG  . ARG B 1 191 ? -1.640  20.281  38.157  1.00 33.79  ? 191 ARG B CG  1 
ATOM   3869 C  CD  . ARG B 1 191 ? -0.745  21.518  37.925  1.00 28.89  ? 191 ARG B CD  1 
ATOM   3870 N  NE  . ARG B 1 191 ? -1.451  22.640  37.298  1.00 27.71  ? 191 ARG B NE  1 
ATOM   3871 C  CZ  . ARG B 1 191 ? -0.958  23.874  37.247  1.00 24.14  ? 191 ARG B CZ  1 
ATOM   3872 N  NH1 . ARG B 1 191 ? 0.227   24.127  37.787  1.00 24.04  ? 191 ARG B NH1 1 
ATOM   3873 N  NH2 . ARG B 1 191 ? -1.642  24.860  36.676  1.00 21.11  ? 191 ARG B NH2 1 
ATOM   3874 N  N   . ASN B 1 192 ? -2.363  23.208  40.406  1.00 31.31  ? 192 ASN B N   1 
ATOM   3875 C  CA  . ASN B 1 192 ? -1.512  24.365  40.683  1.00 28.31  ? 192 ASN B CA  1 
ATOM   3876 C  C   . ASN B 1 192 ? -1.243  24.392  42.151  1.00 25.81  ? 192 ASN B C   1 
ATOM   3877 O  O   . ASN B 1 192 ? -0.119  24.549  42.609  1.00 27.83  ? 192 ASN B O   1 
ATOM   3878 C  CB  . ASN B 1 192 ? -2.214  25.675  40.283  1.00 29.89  ? 192 ASN B CB  1 
ATOM   3879 C  CG  . ASN B 1 192 ? -1.235  26.738  39.831  1.00 25.27  ? 192 ASN B CG  1 
ATOM   3880 O  OD1 . ASN B 1 192 ? -0.332  26.449  39.064  1.00 22.57  ? 192 ASN B OD1 1 
ATOM   3881 N  ND2 . ASN B 1 192 ? -1.394  27.962  40.319  1.00 28.45  ? 192 ASN B ND2 1 
ATOM   3882 N  N   . GLN B 1 193 ? -2.285  24.213  42.922  1.00 29.46  ? 193 GLN B N   1 
ATOM   3883 C  CA  . GLN B 1 193 ? -2.120  24.328  44.349  1.00 34.24  ? 193 GLN B CA  1 
ATOM   3884 C  C   . GLN B 1 193 ? -1.300  23.191  44.909  1.00 28.59  ? 193 GLN B C   1 
ATOM   3885 O  O   . GLN B 1 193 ? -0.401  23.404  45.711  1.00 28.00  ? 193 GLN B O   1 
ATOM   3886 C  CB  . GLN B 1 193 ? -3.468  24.384  45.014  1.00 49.74  ? 193 GLN B CB  1 
ATOM   3887 C  CG  . GLN B 1 193 ? -3.588  25.547  45.944  1.00 48.95  ? 193 GLN B CG  1 
ATOM   3888 C  CD  . GLN B 1 193 ? -3.811  25.075  47.338  1.00 63.99  ? 193 GLN B CD  1 
ATOM   3889 O  OE1 . GLN B 1 193 ? -3.094  25.455  48.256  1.00 58.85  ? 193 GLN B OE1 1 
ATOM   3890 N  NE2 . GLN B 1 193 ? -4.801  24.214  47.506  1.00 81.44  ? 193 GLN B NE2 1 
ATOM   3891 N  N   . LEU B 1 194 ? -1.584  21.968  44.490  1.00 22.82  ? 194 LEU B N   1 
ATOM   3892 C  CA  . LEU B 1 194 ? -0.781  20.838  44.925  1.00 17.29  ? 194 LEU B CA  1 
ATOM   3893 C  C   . LEU B 1 194 ? 0.687   20.976  44.532  1.00 23.80  ? 194 LEU B C   1 
ATOM   3894 O  O   . LEU B 1 194 ? 1.571   20.608  45.286  1.00 23.60  ? 194 LEU B O   1 
ATOM   3895 C  CB  . LEU B 1 194 ? -1.337  19.543  44.377  1.00 21.03  ? 194 LEU B CB  1 
ATOM   3896 C  CG  . LEU B 1 194 ? -0.842  18.389  45.231  1.00 21.19  ? 194 LEU B CG  1 
ATOM   3897 C  CD1 . LEU B 1 194 ? -1.250  17.040  44.670  1.00 21.02  ? 194 LEU B CD1 1 
ATOM   3898 C  CD2 . LEU B 1 194 ? 0.659   18.501  45.413  1.00 16.56  ? 194 LEU B CD2 1 
ATOM   3899 N  N   . GLU B 1 195 ? 0.943   21.482  43.333  1.00 24.54  ? 195 GLU B N   1 
ATOM   3900 C  CA  . GLU B 1 195 ? 2.298   21.878  42.918  1.00 16.42  ? 195 GLU B CA  1 
ATOM   3901 C  C   . GLU B 1 195 ? 2.831   22.902  43.919  1.00 17.26  ? 195 GLU B C   1 
ATOM   3902 O  O   . GLU B 1 195 ? 3.850   22.713  44.570  1.00 18.51  ? 195 GLU B O   1 
ATOM   3903 C  CB  . GLU B 1 195 ? 2.293   22.430  41.484  1.00 20.83  ? 195 GLU B CB  1 
ATOM   3904 C  CG  . GLU B 1 195 ? 3.670   22.434  40.821  1.00 29.43  ? 195 GLU B CG  1 
ATOM   3905 C  CD  . GLU B 1 195 ? 3.650   22.409  39.291  1.00 26.08  ? 195 GLU B CD  1 
ATOM   3906 O  OE1 . GLU B 1 195 ? 4.734   22.152  38.714  1.00 22.78  ? 195 GLU B OE1 1 
ATOM   3907 O  OE2 . GLU B 1 195 ? 2.584   22.642  38.674  1.00 24.68  ? 195 GLU B OE2 1 
ATOM   3908 N  N   . GLY B 1 196 ? 2.085   23.983  44.056  1.00 21.82  ? 196 GLY B N   1 
ATOM   3909 C  CA  . GLY B 1 196 ? 2.249   24.875  45.182  1.00 23.92  ? 196 GLY B CA  1 
ATOM   3910 C  C   . GLY B 1 196 ? 2.538   26.273  44.733  1.00 27.65  ? 196 GLY B C   1 
ATOM   3911 O  O   . GLY B 1 196 ? 3.402   26.935  45.288  1.00 33.88  ? 196 GLY B O   1 
ATOM   3912 N  N   . PHE B 1 197 ? 1.855   26.708  43.698  1.00 31.03  ? 197 PHE B N   1 
ATOM   3913 C  CA  . PHE B 1 197 ? 2.178   27.984  43.118  1.00 35.67  ? 197 PHE B CA  1 
ATOM   3914 C  C   . PHE B 1 197 ? 1.205   29.030  43.579  1.00 48.55  ? 197 PHE B C   1 
ATOM   3915 O  O   . PHE B 1 197 ? 1.399   30.211  43.326  1.00 51.79  ? 197 PHE B O   1 
ATOM   3916 C  CB  . PHE B 1 197 ? 2.184   27.895  41.608  1.00 29.46  ? 197 PHE B CB  1 
ATOM   3917 C  CG  . PHE B 1 197 ? 3.458   27.359  41.056  1.00 32.97  ? 197 PHE B CG  1 
ATOM   3918 C  CD1 . PHE B 1 197 ? 4.611   28.079  41.145  1.00 29.63  ? 197 PHE B CD1 1 
ATOM   3919 C  CD2 . PHE B 1 197 ? 3.494   26.128  40.475  1.00 34.35  ? 197 PHE B CD2 1 
ATOM   3920 C  CE1 . PHE B 1 197 ? 5.780   27.590  40.652  1.00 26.87  ? 197 PHE B CE1 1 
ATOM   3921 C  CE2 . PHE B 1 197 ? 4.656   25.624  39.978  1.00 29.39  ? 197 PHE B CE2 1 
ATOM   3922 C  CZ  . PHE B 1 197 ? 5.805   26.358  40.070  1.00 27.32  ? 197 PHE B CZ  1 
ATOM   3923 N  N   . ILE B 1 198 ? 0.163   28.589  44.268  1.00 49.92  ? 198 ILE B N   1 
ATOM   3924 C  CA  . ILE B 1 198 ? -0.766  29.500  44.884  1.00 45.52  ? 198 ILE B CA  1 
ATOM   3925 C  C   . ILE B 1 198 ? -0.125  29.893  46.181  1.00 51.78  ? 198 ILE B C   1 
ATOM   3926 O  O   . ILE B 1 198 ? 0.042   29.072  47.068  1.00 57.52  ? 198 ILE B O   1 
ATOM   3927 C  CB  . ILE B 1 198 ? -2.071  28.813  45.227  1.00 54.30  ? 198 ILE B CB  1 
ATOM   3928 C  CG1 . ILE B 1 198 ? -2.889  28.555  43.968  1.00 44.14  ? 198 ILE B CG1 1 
ATOM   3929 C  CG2 . ILE B 1 198 ? -2.835  29.666  46.221  1.00 55.77  ? 198 ILE B CG2 1 
ATOM   3930 C  CD1 . ILE B 1 198 ? -2.252  29.096  42.713  1.00 47.40  ? 198 ILE B CD1 1 
ATOM   3931 N  N   . ASN B 1 199 ? 0.244   31.152  46.297  1.00 56.35  ? 199 ASN B N   1 
ATOM   3932 C  CA  . ASN B 1 199 ? 1.060   31.588  47.412  1.00 58.03  ? 199 ASN B CA  1 
ATOM   3933 C  C   . ASN B 1 199 ? 2.316   30.752  47.440  1.00 47.27  ? 199 ASN B C   1 
ATOM   3934 O  O   . ASN B 1 199 ? 2.506   29.960  48.338  1.00 50.62  ? 199 ASN B O   1 
ATOM   3935 C  CB  . ASN B 1 199 ? 0.323   31.394  48.737  1.00 70.45  ? 199 ASN B CB  1 
ATOM   3936 C  CG  . ASN B 1 199 ? -0.898  32.279  48.868  1.00 73.75  ? 199 ASN B CG  1 
ATOM   3937 O  OD1 . ASN B 1 199 ? -1.931  32.059  48.230  1.00 77.93  ? 199 ASN B OD1 1 
ATOM   3938 N  ND2 . ASN B 1 199 ? -0.787  33.289  49.705  1.00 76.87  ? 199 ASN B ND2 1 
ATOM   3939 N  N   . GLY B 1 200 ? 3.172   30.906  46.450  1.00 46.97  ? 200 GLY B N   1 
ATOM   3940 C  CA  . GLY B 1 200 ? 4.410   30.157  46.433  1.00 44.40  ? 200 GLY B CA  1 
ATOM   3941 C  C   . GLY B 1 200 ? 5.105   30.414  47.736  1.00 43.11  ? 200 GLY B C   1 
ATOM   3942 O  O   . GLY B 1 200 ? 5.043   31.524  48.230  1.00 44.56  ? 200 GLY B O   1 
ATOM   3943 N  N   . PRO B 1 201 ? 5.747   29.405  48.306  1.00 40.64  ? 201 PRO B N   1 
ATOM   3944 C  CA  . PRO B 1 201 ? 6.016   28.141  47.645  1.00 33.20  ? 201 PRO B CA  1 
ATOM   3945 C  C   . PRO B 1 201 ? 5.443   27.016  48.458  1.00 33.64  ? 201 PRO B C   1 
ATOM   3946 O  O   . PRO B 1 201 ? 6.120   26.442  49.282  1.00 36.69  ? 201 PRO B O   1 
ATOM   3947 C  CB  . PRO B 1 201 ? 7.518   28.064  47.739  1.00 38.16  ? 201 PRO B CB  1 
ATOM   3948 C  CG  . PRO B 1 201 ? 7.791   28.623  49.080  1.00 46.99  ? 201 PRO B CG  1 
ATOM   3949 C  CD  . PRO B 1 201 ? 6.762   29.689  49.325  1.00 53.10  ? 201 PRO B CD  1 
ATOM   3950 N  N   . GLN B 1 202 ? 4.196   26.687  48.210  1.00 36.01  ? 202 GLN B N   1 
ATOM   3951 C  CA  . GLN B 1 202 ? 3.447   25.820  49.116  1.00 24.51  ? 202 GLN B CA  1 
ATOM   3952 C  C   . GLN B 1 202 ? 3.625   24.390  48.691  1.00 26.46  ? 202 GLN B C   1 
ATOM   3953 O  O   . GLN B 1 202 ? 4.136   24.109  47.583  1.00 34.48  ? 202 GLN B O   1 
ATOM   3954 C  CB  . GLN B 1 202 ? 1.962   26.147  49.051  1.00 27.27  ? 202 GLN B CB  1 
ATOM   3955 C  CG  . GLN B 1 202 ? 1.652   27.565  49.466  1.00 43.08  ? 202 GLN B CG  1 
ATOM   3956 C  CD  . GLN B 1 202 ? 2.154   27.859  50.847  1.00 47.80  ? 202 GLN B CD  1 
ATOM   3957 O  OE1 . GLN B 1 202 ? 2.399   29.019  51.202  1.00 50.06  ? 202 GLN B OE1 1 
ATOM   3958 N  NE2 . GLN B 1 202 ? 2.320   26.806  51.647  1.00 33.51  ? 202 GLN B NE2 1 
ATOM   3959 N  N   . LEU B 1 203 ? 3.244   23.482  49.583  1.00 29.05  ? 203 LEU B N   1 
ATOM   3960 C  CA  . LEU B 1 203 ? 3.205   22.059  49.247  1.00 25.52  ? 203 LEU B CA  1 
ATOM   3961 C  C   . LEU B 1 203 ? 4.456   21.505  48.513  1.00 17.75  ? 203 LEU B C   1 
ATOM   3962 O  O   . LEU B 1 203 ? 5.570   21.547  49.021  1.00 14.67  ? 203 LEU B O   1 
ATOM   3963 C  CB  . LEU B 1 203 ? 1.961   21.779  48.424  1.00 15.20  ? 203 LEU B CB  1 
ATOM   3964 C  CG  . LEU B 1 203 ? 0.745   22.107  49.227  1.00 14.00  ? 203 LEU B CG  1 
ATOM   3965 C  CD1 . LEU B 1 203 ? -0.475  22.031  48.326  1.00 20.26  ? 203 LEU B CD1 1 
ATOM   3966 C  CD2 . LEU B 1 203 ? 0.640   21.126  50.397  1.00 22.29  ? 203 LEU B CD2 1 
ATOM   3967 N  N   . HIS B 1 204 ? 4.238   20.918  47.362  1.00 14.59  ? 204 HIS B N   1 
ATOM   3968 C  CA  . HIS B 1 204 ? 5.345   20.390  46.651  1.00 16.15  ? 204 HIS B CA  1 
ATOM   3969 C  C   . HIS B 1 204 ? 6.404   21.433  46.580  1.00 21.79  ? 204 HIS B C   1 
ATOM   3970 O  O   . HIS B 1 204 ? 7.441   21.340  47.240  1.00 25.41  ? 204 HIS B O   1 
ATOM   3971 C  CB  . HIS B 1 204 ? 4.905   19.951  45.250  1.00 19.95  ? 204 HIS B CB  1 
ATOM   3972 C  CG  . HIS B 1 204 ? 6.012   19.862  44.223  1.00 15.50  ? 204 HIS B CG  1 
ATOM   3973 N  ND1 . HIS B 1 204 ? 5.762   19.831  42.917  1.00 19.51  ? 204 HIS B ND1 1 
ATOM   3974 C  CD2 . HIS B 1 204 ? 7.374   19.801  44.353  1.00 10.36  ? 204 HIS B CD2 1 
ATOM   3975 C  CE1 . HIS B 1 204 ? 6.899   19.775  42.245  1.00 12.64  ? 204 HIS B CE1 1 
ATOM   3976 N  NE2 . HIS B 1 204 ? 7.888   19.752  43.118  1.00 12.97  ? 204 HIS B NE2 1 
ATOM   3977 N  N   . ASN B 1 205 ? 6.178   22.476  45.826  1.00 17.18  ? 205 ASN B N   1 
ATOM   3978 C  CA  . ASN B 1 205 ? 7.237   23.455  45.670  1.00 17.27  ? 205 ASN B CA  1 
ATOM   3979 C  C   . ASN B 1 205 ? 8.023   23.659  46.945  1.00 24.11  ? 205 ASN B C   1 
ATOM   3980 O  O   . ASN B 1 205 ? 9.256   23.640  46.930  1.00 17.69  ? 205 ASN B O   1 
ATOM   3981 C  CB  . ASN B 1 205 ? 6.658   24.773  45.197  1.00 17.77  ? 205 ASN B CB  1 
ATOM   3982 C  CG  . ASN B 1 205 ? 6.745   24.923  43.726  1.00 23.96  ? 205 ASN B CG  1 
ATOM   3983 O  OD1 . ASN B 1 205 ? 6.335   25.940  43.166  1.00 27.82  ? 205 ASN B OD1 1 
ATOM   3984 N  ND2 . ASN B 1 205 ? 7.287   23.907  43.066  1.00 27.74  ? 205 ASN B ND2 1 
ATOM   3985 N  N   . ARG B 1 206 ? 7.304   23.759  48.056  1.00 27.24  ? 206 ARG B N   1 
ATOM   3986 C  CA  . ARG B 1 206 ? 7.853   24.152  49.349  1.00 22.98  ? 206 ARG B CA  1 
ATOM   3987 C  C   . ARG B 1 206 ? 8.977   23.278  49.822  1.00 20.85  ? 206 ARG B C   1 
ATOM   3988 O  O   . ARG B 1 206 ? 10.015  23.776  50.203  1.00 21.25  ? 206 ARG B O   1 
ATOM   3989 C  CB  . ARG B 1 206 ? 6.765   24.211  50.412  1.00 23.59  ? 206 ARG B CB  1 
ATOM   3990 C  CG  . ARG B 1 206 ? 7.279   24.721  51.750  1.00 34.89  ? 206 ARG B CG  1 
ATOM   3991 C  CD  . ARG B 1 206 ? 6.212   25.411  52.587  1.00 33.57  ? 206 ARG B CD  1 
ATOM   3992 N  NE  . ARG B 1 206 ? 6.617   26.755  52.963  1.00 33.87  ? 206 ARG B NE  1 
ATOM   3993 C  CZ  . ARG B 1 206 ? 5.991   27.483  53.868  1.00 27.27  ? 206 ARG B CZ  1 
ATOM   3994 N  NH1 . ARG B 1 206 ? 4.950   26.981  54.492  1.00 32.54  ? 206 ARG B NH1 1 
ATOM   3995 N  NH2 . ARG B 1 206 ? 6.403   28.702  54.157  1.00 19.84  ? 206 ARG B NH2 1 
ATOM   3996 N  N   . VAL B 1 207 ? 8.776   21.972  49.801  1.00 23.42  ? 207 VAL B N   1 
ATOM   3997 C  CA  . VAL B 1 207 ? 9.866   21.066  50.100  1.00 21.43  ? 207 VAL B CA  1 
ATOM   3998 C  C   . VAL B 1 207 ? 11.184  21.178  49.397  1.00 17.26  ? 207 VAL B C   1 
ATOM   3999 O  O   . VAL B 1 207 ? 12.246  21.419  49.982  1.00 16.67  ? 207 VAL B O   1 
ATOM   4000 C  CB  . VAL B 1 207 ? 9.593   19.668  49.580  1.00 15.91  ? 207 VAL B CB  1 
ATOM   4001 C  CG1 . VAL B 1 207 ? 10.763  18.787  49.904  1.00 13.97  ? 207 VAL B CG1 1 
ATOM   4002 C  CG2 . VAL B 1 207 ? 8.335   19.113  50.181  1.00 21.00  ? 207 VAL B CG2 1 
ATOM   4003 N  N   . HIS B 1 208 ? 11.105  21.016  48.096  1.00 19.78  ? 208 HIS B N   1 
ATOM   4004 C  CA  . HIS B 1 208 ? 12.312  21.181  47.313  1.00 24.32  ? 208 HIS B CA  1 
ATOM   4005 C  C   . HIS B 1 208 ? 12.459  22.673  47.321  1.00 19.74  ? 208 HIS B C   1 
ATOM   4006 O  O   . HIS B 1 208 ? 12.983  23.272  46.358  1.00 14.17  ? 208 HIS B O   1 
ATOM   4007 C  CB  . HIS B 1 208 ? 11.797  21.357  45.890  1.00 20.41  ? 208 HIS B CB  1 
ATOM   4008 C  CG  . HIS B 1 208 ? 11.775  20.078  45.087  1.00 18.43  ? 208 HIS B CG  1 
ATOM   4009 N  ND1 . HIS B 1 208 ? 12.140  18.892  45.607  1.00 16.75  ? 208 HIS B ND1 1 
ATOM   4010 C  CD2 . HIS B 1 208 ? 11.413  19.833  43.764  1.00 19.02  ? 208 HIS B CD2 1 
ATOM   4011 C  CE1 . HIS B 1 208 ? 12.020  17.935  44.667  1.00 17.73  ? 208 HIS B CE1 1 
ATOM   4012 N  NE2 . HIS B 1 208 ? 11.574  18.513  43.540  1.00 15.98  ? 208 HIS B NE2 1 
ATOM   4013 N  N   . ARG B 1 209 ? 12.211  23.291  48.453  1.00 21.45  ? 209 ARG B N   1 
ATOM   4014 C  CA  . ARG B 1 209 ? 12.609  24.660  48.755  1.00 31.31  ? 209 ARG B CA  1 
ATOM   4015 C  C   . ARG B 1 209 ? 13.005  24.502  50.218  1.00 23.98  ? 209 ARG B C   1 
ATOM   4016 O  O   . ARG B 1 209 ? 13.874  25.217  50.718  1.00 15.73  ? 209 ARG B O   1 
ATOM   4017 C  CB  . ARG B 1 209 ? 11.545  25.748  48.611  1.00 43.01  ? 209 ARG B CB  1 
ATOM   4018 C  CG  . ARG B 1 209 ? 11.200  26.093  47.171  1.00 43.04  ? 209 ARG B CG  1 
ATOM   4019 C  CD  . ARG B 1 209 ? 11.196  27.597  46.949  1.00 45.14  ? 209 ARG B CD  1 
ATOM   4020 N  NE  . ARG B 1 209 ? 12.439  28.219  47.396  1.00 62.45  ? 209 ARG B NE  1 
ATOM   4021 C  CZ  . ARG B 1 209 ? 12.927  29.352  46.902  1.00 62.96  ? 209 ARG B CZ  1 
ATOM   4022 N  NH1 . ARG B 1 209 ? 12.277  29.993  45.941  1.00 58.62  ? 209 ARG B NH1 1 
ATOM   4023 N  NH2 . ARG B 1 209 ? 14.066  29.845  47.369  1.00 41.73  ? 209 ARG B NH2 1 
ATOM   4024 N  N   . TRP B 1 210 ? 12.362  23.559  50.899  1.00 27.61  ? 210 TRP B N   1 
ATOM   4025 C  CA  . TRP B 1 210 ? 12.657  23.288  52.283  1.00 33.02  ? 210 TRP B CA  1 
ATOM   4026 C  C   . TRP B 1 210 ? 13.876  22.401  52.337  1.00 36.21  ? 210 TRP B C   1 
ATOM   4027 O  O   . TRP B 1 210 ? 14.765  22.652  53.154  1.00 40.63  ? 210 TRP B O   1 
ATOM   4028 C  CB  . TRP B 1 210 ? 11.487  22.650  53.030  1.00 28.43  ? 210 TRP B CB  1 
ATOM   4029 C  CG  . TRP B 1 210 ? 11.792  22.361  54.487  1.00 25.14  ? 210 TRP B CG  1 
ATOM   4030 C  CD1 . TRP B 1 210 ? 11.592  23.198  55.550  1.00 27.84  ? 210 TRP B CD1 1 
ATOM   4031 C  CD2 . TRP B 1 210 ? 12.351  21.154  55.028  1.00 26.73  ? 210 TRP B CD2 1 
ATOM   4032 N  NE1 . TRP B 1 210 ? 11.982  22.584  56.720  1.00 24.36  ? 210 TRP B NE1 1 
ATOM   4033 C  CE2 . TRP B 1 210 ? 12.453  21.327  56.427  1.00 22.11  ? 210 TRP B CE2 1 
ATOM   4034 C  CE3 . TRP B 1 210 ? 12.771  19.931  54.472  1.00 27.27  ? 210 TRP B CE3 1 
ATOM   4035 C  CZ2 . TRP B 1 210 ? 12.957  20.338  57.270  1.00 25.17  ? 210 TRP B CZ2 1 
ATOM   4036 C  CZ3 . TRP B 1 210 ? 13.276  18.944  55.320  1.00 20.57  ? 210 TRP B CZ3 1 
ATOM   4037 C  CH2 . TRP B 1 210 ? 13.362  19.155  56.696  1.00 20.58  ? 210 TRP B CH2 1 
ATOM   4038 N  N   . VAL B 1 211 ? 13.962  21.402  51.454  1.00 25.66  ? 211 VAL B N   1 
ATOM   4039 C  CA  . VAL B 1 211 ? 15.104  20.491  51.551  1.00 23.13  ? 211 VAL B CA  1 
ATOM   4040 C  C   . VAL B 1 211 ? 16.431  21.102  51.094  1.00 20.28  ? 211 VAL B C   1 
ATOM   4041 O  O   . VAL B 1 211 ? 17.491  20.777  51.625  1.00 20.87  ? 211 VAL B O   1 
ATOM   4042 C  CB  . VAL B 1 211 ? 14.880  19.135  50.870  1.00 22.99  ? 211 VAL B CB  1 
ATOM   4043 C  CG1 . VAL B 1 211 ? 16.167  18.324  50.918  1.00 20.51  ? 211 VAL B CG1 1 
ATOM   4044 C  CG2 . VAL B 1 211 ? 13.732  18.391  51.578  1.00 16.78  ? 211 VAL B CG2 1 
ATOM   4045 N  N   . GLY B 1 212 ? 16.382  22.029  50.155  1.00 18.83  ? 212 GLY B N   1 
ATOM   4046 C  CA  . GLY B 1 212 ? 17.611  22.693  49.760  1.00 21.87  ? 212 GLY B CA  1 
ATOM   4047 C  C   . GLY B 1 212 ? 18.470  21.891  48.790  1.00 19.54  ? 212 GLY B C   1 
ATOM   4048 O  O   . GLY B 1 212 ? 18.009  20.910  48.193  1.00 21.69  ? 212 GLY B O   1 
ATOM   4049 N  N   . GLY B 1 213 ? 19.723  22.310  48.621  1.00 16.99  ? 213 GLY B N   1 
ATOM   4050 C  CA  . GLY B 1 213 ? 20.609  21.681  47.655  1.00 26.26  ? 213 GLY B CA  1 
ATOM   4051 C  C   . GLY B 1 213 ? 19.928  21.341  46.334  1.00 24.03  ? 213 GLY B C   1 
ATOM   4052 O  O   . GLY B 1 213 ? 19.014  22.048  45.894  1.00 19.13  ? 213 GLY B O   1 
ATOM   4053 N  N   . GLN B 1 214 ? 20.329  20.226  45.743  1.00 19.39  ? 214 GLN B N   1 
ATOM   4054 C  CA  . GLN B 1 214 ? 19.765  19.809  44.483  1.00 18.84  ? 214 GLN B CA  1 
ATOM   4055 C  C   . GLN B 1 214 ? 18.305  19.484  44.534  1.00 20.62  ? 214 GLN B C   1 
ATOM   4056 O  O   . GLN B 1 214 ? 17.806  18.874  43.600  1.00 23.90  ? 214 GLN B O   1 
ATOM   4057 C  CB  . GLN B 1 214 ? 20.454  18.559  43.987  1.00 20.13  ? 214 GLN B CB  1 
ATOM   4058 C  CG  . GLN B 1 214 ? 21.791  18.790  43.436  1.00 18.70  ? 214 GLN B CG  1 
ATOM   4059 C  CD  . GLN B 1 214 ? 22.793  18.281  44.344  1.00 15.32  ? 214 GLN B CD  1 
ATOM   4060 O  OE1 . GLN B 1 214 ? 22.737  18.566  45.516  1.00 12.10  ? 214 GLN B OE1 1 
ATOM   4061 N  NE2 . GLN B 1 214 ? 23.711  17.495  43.841  1.00 15.62  ? 214 GLN B NE2 1 
ATOM   4062 N  N   . MET B 1 215 ? 17.613  19.829  45.601  1.00 16.55  ? 215 MET B N   1 
ATOM   4063 C  CA  . MET B 1 215 ? 16.212  19.478  45.649  1.00 16.38  ? 215 MET B CA  1 
ATOM   4064 C  C   . MET B 1 215 ? 15.415  20.746  45.628  1.00 23.39  ? 215 MET B C   1 
ATOM   4065 O  O   . MET B 1 215 ? 14.254  20.787  46.014  1.00 22.37  ? 215 MET B O   1 
ATOM   4066 C  CB  . MET B 1 215 ? 15.891  18.660  46.884  1.00 13.93  ? 215 MET B CB  1 
ATOM   4067 C  CG  . MET B 1 215 ? 15.579  17.230  46.596  1.00 13.78  ? 215 MET B CG  1 
ATOM   4068 S  SD  . MET B 1 215 ? 13.890  16.726  46.898  1.00 25.96  ? 215 MET B SD  1 
ATOM   4069 C  CE  . MET B 1 215 ? 13.865  15.242  45.897  1.00 20.80  ? 215 MET B CE  1 
ATOM   4070 N  N   . GLY B 1 216 ? 16.062  21.801  45.174  1.00 25.54  ? 216 GLY B N   1 
ATOM   4071 C  CA  . GLY B 1 216 ? 15.425  23.113  45.130  1.00 25.30  ? 216 GLY B CA  1 
ATOM   4072 C  C   . GLY B 1 216 ? 15.602  23.637  43.757  1.00 26.89  ? 216 GLY B C   1 
ATOM   4073 O  O   . GLY B 1 216 ? 14.717  24.270  43.205  1.00 34.25  ? 216 GLY B O   1 
ATOM   4074 N  N   . VAL B 1 217 ? 16.771  23.382  43.178  1.00 24.83  ? 217 VAL B N   1 
ATOM   4075 C  CA  . VAL B 1 217 ? 17.078  23.874  41.824  1.00 29.04  ? 217 VAL B CA  1 
ATOM   4076 C  C   . VAL B 1 217 ? 16.313  23.091  40.766  1.00 28.02  ? 217 VAL B C   1 
ATOM   4077 O  O   . VAL B 1 217 ? 16.490  23.328  39.571  1.00 32.86  ? 217 VAL B O   1 
ATOM   4078 C  CB  . VAL B 1 217 ? 18.591  23.757  41.541  1.00 24.07  ? 217 VAL B CB  1 
ATOM   4079 C  CG1 . VAL B 1 217 ? 19.358  24.808  42.328  1.00 15.82  ? 217 VAL B CG1 1 
ATOM   4080 C  CG2 . VAL B 1 217 ? 19.102  22.361  41.864  1.00 23.99  ? 217 VAL B CG2 1 
ATOM   4081 N  N   . VAL B 1 218 ? 15.467  22.166  41.209  1.00 27.38  ? 218 VAL B N   1 
ATOM   4082 C  CA  . VAL B 1 218 ? 14.646  21.373  40.300  1.00 35.34  ? 218 VAL B CA  1 
ATOM   4083 C  C   . VAL B 1 218 ? 15.491  20.552  39.330  1.00 34.43  ? 218 VAL B C   1 
ATOM   4084 O  O   . VAL B 1 218 ? 16.024  19.502  39.690  1.00 42.76  ? 218 VAL B O   1 
ATOM   4085 C  CB  . VAL B 1 218 ? 13.679  22.260  39.495  1.00 34.29  ? 218 VAL B CB  1 
ATOM   4086 C  CG1 . VAL B 1 218 ? 13.271  21.565  38.205  1.00 30.48  ? 218 VAL B CG1 1 
ATOM   4087 C  CG2 . VAL B 1 218 ? 12.456  22.607  40.331  1.00 29.63  ? 218 VAL B CG2 1 
ATOM   4088 N  N   . PRO B 1 219 ? 15.606  21.038  38.097  1.00 28.13  ? 219 PRO B N   1 
ATOM   4089 C  CA  . PRO B 1 219 ? 16.361  20.330  37.057  1.00 26.53  ? 219 PRO B CA  1 
ATOM   4090 C  C   . PRO B 1 219 ? 17.225  19.212  37.630  1.00 25.87  ? 219 PRO B C   1 
ATOM   4091 O  O   . PRO B 1 219 ? 17.169  18.081  37.147  1.00 26.75  ? 219 PRO B O   1 
ATOM   4092 C  CB  . PRO B 1 219 ? 17.247  21.429  36.453  1.00 38.73  ? 219 PRO B CB  1 
ATOM   4093 C  CG  . PRO B 1 219 ? 17.287  22.512  37.479  1.00 31.01  ? 219 PRO B CG  1 
ATOM   4094 C  CD  . PRO B 1 219 ? 15.946  22.469  38.146  1.00 30.35  ? 219 PRO B CD  1 
ATOM   4095 N  N   . THR B 1 220 ? 18.014  19.530  38.651  1.00 20.97  ? 220 THR B N   1 
ATOM   4096 C  CA  . THR B 1 220 ? 18.889  18.547  39.280  1.00 16.08  ? 220 THR B CA  1 
ATOM   4097 C  C   . THR B 1 220 ? 18.151  17.762  40.359  1.00 19.32  ? 220 THR B C   1 
ATOM   4098 O  O   . THR B 1 220 ? 18.569  16.668  40.739  1.00 19.06  ? 220 THR B O   1 
ATOM   4099 C  CB  . THR B 1 220 ? 20.131  19.213  39.901  1.00 17.81  ? 220 THR B CB  1 
ATOM   4100 O  OG1 . THR B 1 220 ? 19.743  19.974  41.052  1.00 19.11  ? 220 THR B OG1 1 
ATOM   4101 C  CG2 . THR B 1 220 ? 20.803  20.133  38.893  1.00 23.65  ? 220 THR B CG2 1 
ATOM   4102 N  N   . ALA B 1 221 ? 17.053  18.327  40.849  1.00 27.50  ? 221 ALA B N   1 
ATOM   4103 C  CA  . ALA B 1 221 ? 16.248  17.675  41.895  1.00 22.62  ? 221 ALA B CA  1 
ATOM   4104 C  C   . ALA B 1 221 ? 16.277  16.147  41.958  1.00 19.71  ? 221 ALA B C   1 
ATOM   4105 O  O   . ALA B 1 221 ? 16.399  15.570  43.029  1.00 24.01  ? 221 ALA B O   1 
ATOM   4106 C  CB  . ALA B 1 221 ? 14.767  18.082  41.780  1.00 18.51  ? 221 ALA B CB  1 
ATOM   4107 N  N   . PRO B 1 222 ? 16.276  15.473  40.822  1.00 15.33  ? 222 PRO B N   1 
ATOM   4108 C  CA  . PRO B 1 222 ? 16.274  14.017  40.959  1.00 12.46  ? 222 PRO B CA  1 
ATOM   4109 C  C   . PRO B 1 222 ? 17.618  13.491  41.437  1.00 12.08  ? 222 PRO B C   1 
ATOM   4110 O  O   . PRO B 1 222 ? 17.715  12.303  41.680  1.00 14.97  ? 222 PRO B O   1 
ATOM   4111 C  CB  . PRO B 1 222 ? 16.027  13.527  39.538  1.00 15.80  ? 222 PRO B CB  1 
ATOM   4112 C  CG  . PRO B 1 222 ? 15.317  14.659  38.859  1.00 16.53  ? 222 PRO B CG  1 
ATOM   4113 C  CD  . PRO B 1 222 ? 15.851  15.902  39.464  1.00 18.49  ? 222 PRO B CD  1 
ATOM   4114 N  N   . ASN B 1 223 ? 18.638  14.325  41.557  1.00 13.35  ? 223 ASN B N   1 
ATOM   4115 C  CA  . ASN B 1 223 ? 19.906  13.830  42.084  1.00 21.23  ? 223 ASN B CA  1 
ATOM   4116 C  C   . ASN B 1 223 ? 19.731  13.121  43.423  1.00 25.70  ? 223 ASN B C   1 
ATOM   4117 O  O   . ASN B 1 223 ? 20.429  12.150  43.762  1.00 30.90  ? 223 ASN B O   1 
ATOM   4118 C  CB  . ASN B 1 223 ? 20.875  14.989  42.283  1.00 21.98  ? 223 ASN B CB  1 
ATOM   4119 C  CG  . ASN B 1 223 ? 21.863  15.094  41.179  1.00 20.45  ? 223 ASN B CG  1 
ATOM   4120 O  OD1 . ASN B 1 223 ? 22.764  14.259  41.055  1.00 28.20  ? 223 ASN B OD1 1 
ATOM   4121 N  ND2 . ASN B 1 223 ? 21.703  16.116  40.345  1.00 19.87  ? 223 ASN B ND2 1 
ATOM   4122 N  N   . ASP B 1 224 ? 18.795  13.645  44.193  1.00 19.31  ? 224 ASP B N   1 
ATOM   4123 C  CA  . ASP B 1 224 ? 18.648  13.254  45.563  1.00 14.40  ? 224 ASP B CA  1 
ATOM   4124 C  C   . ASP B 1 224 ? 17.515  12.219  45.624  1.00 14.11  ? 224 ASP B C   1 
ATOM   4125 O  O   . ASP B 1 224 ? 16.399  12.491  45.165  1.00 12.17  ? 224 ASP B O   1 
ATOM   4126 C  CB  . ASP B 1 224 ? 18.372  14.520  46.363  1.00 13.04  ? 224 ASP B CB  1 
ATOM   4127 C  CG  . ASP B 1 224 ? 18.191  14.249  47.809  1.00 19.22  ? 224 ASP B CG  1 
ATOM   4128 O  OD1 . ASP B 1 224 ? 17.964  13.074  48.149  1.00 20.80  ? 224 ASP B OD1 1 
ATOM   4129 O  OD2 . ASP B 1 224 ? 18.249  15.199  48.611  1.00 22.18  ? 224 ASP B OD2 1 
ATOM   4130 N  N   . PRO B 1 225 ? 17.820  11.008  46.146  1.00 13.03  ? 225 PRO B N   1 
ATOM   4131 C  CA  . PRO B 1 225 ? 16.899  9.861   46.174  1.00 14.82  ? 225 PRO B CA  1 
ATOM   4132 C  C   . PRO B 1 225 ? 15.513  10.193  46.687  1.00 13.09  ? 225 PRO B C   1 
ATOM   4133 O  O   . PRO B 1 225 ? 14.536  9.607   46.206  1.00 12.51  ? 225 PRO B O   1 
ATOM   4134 C  CB  . PRO B 1 225 ? 17.589  8.896   47.141  1.00 16.00  ? 225 PRO B CB  1 
ATOM   4135 C  CG  . PRO B 1 225 ? 19.027  9.136   46.898  1.00 23.50  ? 225 PRO B CG  1 
ATOM   4136 C  CD  . PRO B 1 225 ? 19.142  10.641  46.691  1.00 16.37  ? 225 PRO B CD  1 
ATOM   4137 N  N   . VAL B 1 226 ? 15.447  11.117  47.644  1.00 17.69  ? 226 VAL B N   1 
ATOM   4138 C  CA  . VAL B 1 226 ? 14.218  11.460  48.346  1.00 13.21  ? 226 VAL B CA  1 
ATOM   4139 C  C   . VAL B 1 226 ? 13.255  12.260  47.480  1.00 10.57  ? 226 VAL B C   1 
ATOM   4140 O  O   . VAL B 1 226 ? 12.062  12.349  47.776  1.00 10.52  ? 226 VAL B O   1 
ATOM   4141 C  CB  . VAL B 1 226 ? 14.532  12.297  49.553  1.00 7.50   ? 226 VAL B CB  1 
ATOM   4142 C  CG1 . VAL B 1 226 ? 14.760  13.712  49.112  1.00 7.60   ? 226 VAL B CG1 1 
ATOM   4143 C  CG2 . VAL B 1 226 ? 13.400  12.206  50.521  1.00 12.60  ? 226 VAL B CG2 1 
ATOM   4144 N  N   . PHE B 1 227 ? 13.779  12.848  46.411  1.00 10.62  ? 227 PHE B N   1 
ATOM   4145 C  CA  . PHE B 1 227 ? 12.924  13.334  45.347  1.00 11.54  ? 227 PHE B CA  1 
ATOM   4146 C  C   . PHE B 1 227 ? 11.783  12.337  45.155  1.00 8.60   ? 227 PHE B C   1 
ATOM   4147 O  O   . PHE B 1 227 ? 10.628  12.712  45.198  1.00 10.31  ? 227 PHE B O   1 
ATOM   4148 C  CB  . PHE B 1 227 ? 13.727  13.475  44.054  1.00 12.28  ? 227 PHE B CB  1 
ATOM   4149 C  CG  . PHE B 1 227 ? 12.928  13.971  42.885  1.00 10.56  ? 227 PHE B CG  1 
ATOM   4150 C  CD1 . PHE B 1 227 ? 12.129  13.111  42.163  1.00 12.26  ? 227 PHE B CD1 1 
ATOM   4151 C  CD2 . PHE B 1 227 ? 12.990  15.287  42.498  1.00 11.15  ? 227 PHE B CD2 1 
ATOM   4152 C  CE1 . PHE B 1 227 ? 11.404  13.557  41.082  1.00 13.39  ? 227 PHE B CE1 1 
ATOM   4153 C  CE2 . PHE B 1 227 ? 12.266  15.735  41.431  1.00 16.51  ? 227 PHE B CE2 1 
ATOM   4154 C  CZ  . PHE B 1 227 ? 11.474  14.871  40.721  1.00 16.53  ? 227 PHE B CZ  1 
ATOM   4155 N  N   . PHE B 1 228 ? 12.105  11.060  44.992  1.00 7.39   ? 228 PHE B N   1 
ATOM   4156 C  CA  . PHE B 1 228 ? 11.093  10.055  44.685  1.00 8.60   ? 228 PHE B CA  1 
ATOM   4157 C  C   . PHE B 1 228 ? 10.174  9.724   45.852  1.00 12.53  ? 228 PHE B C   1 
ATOM   4158 O  O   . PHE B 1 228 ? 9.022   9.310   45.669  1.00 14.07  ? 228 PHE B O   1 
ATOM   4159 C  CB  . PHE B 1 228 ? 11.776  8.779   44.222  1.00 9.31   ? 228 PHE B CB  1 
ATOM   4160 C  CG  . PHE B 1 228 ? 12.577  8.959   42.982  1.00 14.16  ? 228 PHE B CG  1 
ATOM   4161 C  CD1 . PHE B 1 228 ? 12.079  8.566   41.745  1.00 12.54  ? 228 PHE B CD1 1 
ATOM   4162 C  CD2 . PHE B 1 228 ? 13.832  9.547   43.054  1.00 15.41  ? 228 PHE B CD2 1 
ATOM   4163 C  CE1 . PHE B 1 228 ? 12.829  8.760   40.601  1.00 10.84  ? 228 PHE B CE1 1 
ATOM   4164 C  CE2 . PHE B 1 228 ? 14.587  9.753   41.921  1.00 12.79  ? 228 PHE B CE2 1 
ATOM   4165 C  CZ  . PHE B 1 228 ? 14.085  9.363   40.688  1.00 13.41  ? 228 PHE B CZ  1 
ATOM   4166 N  N   . LEU B 1 229 ? 10.705  9.838   47.055  1.00 11.30  ? 229 LEU B N   1 
ATOM   4167 C  CA  . LEU B 1 229 ? 9.888   9.621   48.223  1.00 14.09  ? 229 LEU B CA  1 
ATOM   4168 C  C   . LEU B 1 229 ? 8.895   10.761  48.209  1.00 14.14  ? 229 LEU B C   1 
ATOM   4169 O  O   . LEU B 1 229 ? 7.696   10.593  48.433  1.00 11.00  ? 229 LEU B O   1 
ATOM   4170 C  CB  . LEU B 1 229 ? 10.776  9.645   49.466  1.00 12.69  ? 229 LEU B CB  1 
ATOM   4171 C  CG  . LEU B 1 229 ? 11.466  8.317   49.797  1.00 16.82  ? 229 LEU B CG  1 
ATOM   4172 C  CD1 . LEU B 1 229 ? 11.850  7.540   48.558  1.00 17.15  ? 229 LEU B CD1 1 
ATOM   4173 C  CD2 . LEU B 1 229 ? 12.674  8.596   50.636  1.00 20.54  ? 229 LEU B CD2 1 
ATOM   4174 N  N   . HIS B 1 230 ? 9.414   11.929  47.883  1.00 13.44  ? 230 HIS B N   1 
ATOM   4175 C  CA  . HIS B 1 230 ? 8.595   13.105  47.843  1.00 11.07  ? 230 HIS B CA  1 
ATOM   4176 C  C   . HIS B 1 230 ? 7.423   12.975  46.884  1.00 13.86  ? 230 HIS B C   1 
ATOM   4177 O  O   . HIS B 1 230 ? 6.273   13.134  47.298  1.00 18.17  ? 230 HIS B O   1 
ATOM   4178 C  CB  . HIS B 1 230 ? 9.399   14.298  47.420  1.00 5.89   ? 230 HIS B CB  1 
ATOM   4179 C  CG  . HIS B 1 230 ? 8.544   15.484  47.186  1.00 8.90   ? 230 HIS B CG  1 
ATOM   4180 N  ND1 . HIS B 1 230 ? 8.909   16.536  46.374  1.00 14.65  ? 230 HIS B ND1 1 
ATOM   4181 C  CD2 . HIS B 1 230 ? 7.307   15.766  47.646  1.00 12.20  ? 230 HIS B CD2 1 
ATOM   4182 C  CE1 . HIS B 1 230 ? 7.932   17.428  46.366  1.00 19.91  ? 230 HIS B CE1 1 
ATOM   4183 N  NE2 . HIS B 1 230 ? 6.949   16.984  47.128  1.00 19.92  ? 230 HIS B NE2 1 
ATOM   4184 N  N   . HIS B 1 231 ? 7.708   12.728  45.604  1.00 12.13  ? 231 HIS B N   1 
ATOM   4185 C  CA  . HIS B 1 231 ? 6.666   12.666  44.583  1.00 8.18   ? 231 HIS B CA  1 
ATOM   4186 C  C   . HIS B 1 231 ? 5.798   11.438  44.745  1.00 11.17  ? 231 HIS B C   1 
ATOM   4187 O  O   . HIS B 1 231 ? 4.814   11.261  44.030  1.00 11.87  ? 231 HIS B O   1 
ATOM   4188 C  CB  . HIS B 1 231 ? 7.291   12.609  43.202  1.00 7.97   ? 231 HIS B CB  1 
ATOM   4189 C  CG  . HIS B 1 231 ? 7.594   13.948  42.603  1.00 10.00  ? 231 HIS B CG  1 
ATOM   4190 N  ND1 . HIS B 1 231 ? 6.655   14.677  41.904  1.00 9.38   ? 231 HIS B ND1 1 
ATOM   4191 C  CD2 . HIS B 1 231 ? 8.742   14.674  42.544  1.00 14.93  ? 231 HIS B CD2 1 
ATOM   4192 C  CE1 . HIS B 1 231 ? 7.199   15.802  41.470  1.00 10.45  ? 231 HIS B CE1 1 
ATOM   4193 N  NE2 . HIS B 1 231 ? 8.465   15.824  41.851  1.00 10.69  ? 231 HIS B NE2 1 
ATOM   4194 N  N   . ALA B 1 232 ? 6.195   10.552  45.643  1.00 9.80   ? 232 ALA B N   1 
ATOM   4195 C  CA  . ALA B 1 232 ? 5.359   9.408   45.938  1.00 15.53  ? 232 ALA B CA  1 
ATOM   4196 C  C   . ALA B 1 232 ? 4.165   9.993   46.646  1.00 14.33  ? 232 ALA B C   1 
ATOM   4197 O  O   . ALA B 1 232 ? 3.020   9.725   46.300  1.00 16.13  ? 232 ALA B O   1 
ATOM   4198 C  CB  . ALA B 1 232 ? 6.084   8.441   46.853  1.00 17.90  ? 232 ALA B CB  1 
ATOM   4199 N  N   . ASN B 1 233 ? 4.465   10.830  47.632  1.00 15.33  ? 233 ASN B N   1 
ATOM   4200 C  CA  . ASN B 1 233 ? 3.458   11.420  48.485  1.00 17.05  ? 233 ASN B CA  1 
ATOM   4201 C  C   . ASN B 1 233 ? 2.597   12.327  47.664  1.00 14.84  ? 233 ASN B C   1 
ATOM   4202 O  O   . ASN B 1 233 ? 1.379   12.372  47.829  1.00 14.66  ? 233 ASN B O   1 
ATOM   4203 C  CB  . ASN B 1 233 ? 4.093   12.215  49.611  1.00 15.26  ? 233 ASN B CB  1 
ATOM   4204 C  CG  . ASN B 1 233 ? 3.209   12.270  50.796  1.00 14.21  ? 233 ASN B CG  1 
ATOM   4205 O  OD1 . ASN B 1 233 ? 2.647   11.252  51.191  1.00 12.34  ? 233 ASN B OD1 1 
ATOM   4206 N  ND2 . ASN B 1 233 ? 3.043   13.446  51.359  1.00 14.34  ? 233 ASN B ND2 1 
ATOM   4207 N  N   . VAL B 1 234 ? 3.247   13.069  46.783  1.00 14.71  ? 234 VAL B N   1 
ATOM   4208 C  CA  . VAL B 1 234 ? 2.502   13.909  45.886  1.00 15.80  ? 234 VAL B CA  1 
ATOM   4209 C  C   . VAL B 1 234 ? 1.544   13.006  45.118  1.00 16.35  ? 234 VAL B C   1 
ATOM   4210 O  O   . VAL B 1 234 ? 0.356   13.306  45.019  1.00 17.79  ? 234 VAL B O   1 
ATOM   4211 C  CB  . VAL B 1 234 ? 3.436   14.730  44.979  1.00 12.11  ? 234 VAL B CB  1 
ATOM   4212 C  CG1 . VAL B 1 234 ? 2.653   15.444  43.912  1.00 10.01  ? 234 VAL B CG1 1 
ATOM   4213 C  CG2 . VAL B 1 234 ? 4.215   15.721  45.835  1.00 12.84  ? 234 VAL B CG2 1 
ATOM   4214 N  N   . ASP B 1 235 ? 2.024   11.854  44.661  1.00 17.28  ? 235 ASP B N   1 
ATOM   4215 C  CA  . ASP B 1 235 ? 1.174   11.009  43.821  1.00 19.59  ? 235 ASP B CA  1 
ATOM   4216 C  C   . ASP B 1 235 ? -0.011  10.449  44.596  1.00 16.77  ? 235 ASP B C   1 
ATOM   4217 O  O   . ASP B 1 235 ? -1.143  10.381  44.108  1.00 12.69  ? 235 ASP B O   1 
ATOM   4218 C  CB  . ASP B 1 235 ? 1.955   9.858   43.208  1.00 14.34  ? 235 ASP B CB  1 
ATOM   4219 C  CG  . ASP B 1 235 ? 1.097   9.033   42.280  1.00 16.14  ? 235 ASP B CG  1 
ATOM   4220 O  OD1 . ASP B 1 235 ? 1.099   7.791   42.407  1.00 26.39  ? 235 ASP B OD1 1 
ATOM   4221 O  OD2 . ASP B 1 235 ? 0.407   9.642   41.430  1.00 12.89  ? 235 ASP B OD2 1 
ATOM   4222 N  N   . ARG B 1 236 ? 0.258   10.065  45.834  1.00 17.45  ? 236 ARG B N   1 
ATOM   4223 C  CA  . ARG B 1 236 ? -0.770  9.487   46.666  1.00 16.77  ? 236 ARG B CA  1 
ATOM   4224 C  C   . ARG B 1 236 ? -1.737  10.554  47.113  1.00 21.66  ? 236 ARG B C   1 
ATOM   4225 O  O   . ARG B 1 236 ? -2.893  10.265  47.312  1.00 28.50  ? 236 ARG B O   1 
ATOM   4226 C  CB  . ARG B 1 236 ? -0.169  8.712   47.837  1.00 14.27  ? 236 ARG B CB  1 
ATOM   4227 C  CG  . ARG B 1 236 ? -0.676  9.093   49.212  1.00 17.01  ? 236 ARG B CG  1 
ATOM   4228 C  CD  . ARG B 1 236 ? 0.417   8.884   50.246  1.00 21.22  ? 236 ARG B CD  1 
ATOM   4229 N  NE  . ARG B 1 236 ? 0.257   9.781   51.375  1.00 18.31  ? 236 ARG B NE  1 
ATOM   4230 C  CZ  . ARG B 1 236 ? -0.921  10.208  51.783  1.00 13.84  ? 236 ARG B CZ  1 
ATOM   4231 N  NH1 . ARG B 1 236 ? -1.995  9.813   51.140  1.00 11.97  ? 236 ARG B NH1 1 
ATOM   4232 N  NH2 . ARG B 1 236 ? -1.022  11.022  52.813  1.00 10.45  ? 236 ARG B NH2 1 
ATOM   4233 N  N   . ILE B 1 237 ? -1.315  11.801  47.183  1.00 17.18  ? 237 ILE B N   1 
ATOM   4234 C  CA  . ILE B 1 237 ? -2.298  12.808  47.503  1.00 17.89  ? 237 ILE B CA  1 
ATOM   4235 C  C   . ILE B 1 237 ? -3.246  12.928  46.321  1.00 20.98  ? 237 ILE B C   1 
ATOM   4236 O  O   . ILE B 1 237 ? -4.419  13.217  46.479  1.00 20.30  ? 237 ILE B O   1 
ATOM   4237 C  CB  . ILE B 1 237 ? -1.672  14.165  47.813  1.00 19.83  ? 237 ILE B CB  1 
ATOM   4238 C  CG1 . ILE B 1 237 ? -0.724  14.081  48.995  1.00 14.23  ? 237 ILE B CG1 1 
ATOM   4239 C  CG2 . ILE B 1 237 ? -2.763  15.156  48.132  1.00 23.17  ? 237 ILE B CG2 1 
ATOM   4240 C  CD1 . ILE B 1 237 ? -1.361  14.503  50.290  1.00 17.99  ? 237 ILE B CD1 1 
ATOM   4241 N  N   . TRP B 1 238 ? -2.730  12.685  45.124  1.00 21.20  ? 238 TRP B N   1 
ATOM   4242 C  CA  . TRP B 1 238 ? -3.503  12.860  43.909  1.00 27.87  ? 238 TRP B CA  1 
ATOM   4243 C  C   . TRP B 1 238 ? -4.357  11.683  43.636  1.00 25.89  ? 238 TRP B C   1 
ATOM   4244 O  O   . TRP B 1 238 ? -5.362  11.781  42.919  1.00 28.47  ? 238 TRP B O   1 
ATOM   4245 C  CB  . TRP B 1 238 ? -2.591  13.094  42.718  1.00 34.23  ? 238 TRP B CB  1 
ATOM   4246 C  CG  . TRP B 1 238 ? -3.329  13.320  41.416  1.00 35.19  ? 238 TRP B CG  1 
ATOM   4247 C  CD1 . TRP B 1 238 ? -4.409  14.154  41.188  1.00 37.32  ? 238 TRP B CD1 1 
ATOM   4248 C  CD2 . TRP B 1 238 ? -3.039  12.727  40.112  1.00 23.66  ? 238 TRP B CD2 1 
ATOM   4249 N  NE1 . TRP B 1 238 ? -4.798  14.099  39.881  1.00 29.28  ? 238 TRP B NE1 1 
ATOM   4250 C  CE2 . TRP B 1 238 ? -4.021  13.264  39.191  1.00 22.40  ? 238 TRP B CE2 1 
ATOM   4251 C  CE3 . TRP B 1 238 ? -2.127  11.830  39.655  1.00 23.36  ? 238 TRP B CE3 1 
ATOM   4252 C  CZ2 . TRP B 1 238 ? -4.050  12.916  37.882  1.00 24.69  ? 238 TRP B CZ2 1 
ATOM   4253 C  CZ3 . TRP B 1 238 ? -2.172  11.475  38.331  1.00 29.27  ? 238 TRP B CZ3 1 
ATOM   4254 C  CH2 . TRP B 1 238 ? -3.113  12.009  37.464  1.00 28.03  ? 238 TRP B CH2 1 
ATOM   4255 N  N   . ALA B 1 239 ? -3.956  10.545  44.170  1.00 26.59  ? 239 ALA B N   1 
ATOM   4256 C  CA  . ALA B 1 239 ? -4.779  9.356   44.146  1.00 27.57  ? 239 ALA B CA  1 
ATOM   4257 C  C   . ALA B 1 239 ? -5.956  9.577   45.078  1.00 24.62  ? 239 ALA B C   1 
ATOM   4258 O  O   . ALA B 1 239 ? -7.078  9.181   44.767  1.00 29.08  ? 239 ALA B O   1 
ATOM   4259 C  CB  . ALA B 1 239 ? -3.962  8.143   44.565  1.00 23.35  ? 239 ALA B CB  1 
ATOM   4260 N  N   . VAL B 1 240 ? -5.692  10.230  46.211  1.00 23.91  ? 240 VAL B N   1 
ATOM   4261 C  CA  . VAL B 1 240 ? -6.736  10.602  47.175  1.00 28.49  ? 240 VAL B CA  1 
ATOM   4262 C  C   . VAL B 1 240 ? -7.779  11.553  46.598  1.00 31.87  ? 240 VAL B C   1 
ATOM   4263 O  O   . VAL B 1 240 ? -8.975  11.259  46.613  1.00 32.66  ? 240 VAL B O   1 
ATOM   4264 C  CB  . VAL B 1 240 ? -6.155  11.315  48.418  1.00 26.77  ? 240 VAL B CB  1 
ATOM   4265 C  CG1 . VAL B 1 240 ? -7.284  11.939  49.254  1.00 23.62  ? 240 VAL B CG1 1 
ATOM   4266 C  CG2 . VAL B 1 240 ? -5.274  10.362  49.240  1.00 20.35  ? 240 VAL B CG2 1 
ATOM   4267 N  N   . TRP B 1 241 ? -7.318  12.696  46.101  1.00 32.35  ? 241 TRP B N   1 
ATOM   4268 C  CA  . TRP B 1 241 ? -8.203  13.652  45.459  1.00 37.81  ? 241 TRP B CA  1 
ATOM   4269 C  C   . TRP B 1 241 ? -9.052  12.948  44.399  1.00 41.57  ? 241 TRP B C   1 
ATOM   4270 O  O   . TRP B 1 241 ? -10.212 13.315  44.171  1.00 42.14  ? 241 TRP B O   1 
ATOM   4271 C  CB  . TRP B 1 241 ? -7.373  14.760  44.805  1.00 38.86  ? 241 TRP B CB  1 
ATOM   4272 C  CG  . TRP B 1 241 ? -8.193  15.859  44.181  1.00 41.51  ? 241 TRP B CG  1 
ATOM   4273 C  CD1 . TRP B 1 241 ? -8.679  16.972  44.812  1.00 39.82  ? 241 TRP B CD1 1 
ATOM   4274 C  CD2 . TRP B 1 241 ? -8.611  15.963  42.809  1.00 41.26  ? 241 TRP B CD2 1 
ATOM   4275 N  NE1 . TRP B 1 241 ? -9.375  17.755  43.926  1.00 42.96  ? 241 TRP B NE1 1 
ATOM   4276 C  CE2 . TRP B 1 241 ? -9.352  17.159  42.679  1.00 38.28  ? 241 TRP B CE2 1 
ATOM   4277 C  CE3 . TRP B 1 241 ? -8.435  15.155  41.663  1.00 43.07  ? 241 TRP B CE3 1 
ATOM   4278 C  CZ2 . TRP B 1 241 ? -9.915  17.584  41.474  1.00 41.61  ? 241 TRP B CZ2 1 
ATOM   4279 C  CZ3 . TRP B 1 241 ? -8.995  15.570  40.456  1.00 46.89  ? 241 TRP B CZ3 1 
ATOM   4280 C  CH2 . TRP B 1 241 ? -9.723  16.777  40.372  1.00 54.75  ? 241 TRP B CH2 1 
ATOM   4281 N  N   . GLN B 1 242 ? -8.427  11.971  43.763  1.00 42.10  ? 242 GLN B N   1 
ATOM   4282 C  CA  . GLN B 1 242 ? -8.962  11.331  42.590  1.00 42.58  ? 242 GLN B CA  1 
ATOM   4283 C  C   . GLN B 1 242 ? -10.281 10.733  42.946  1.00 49.57  ? 242 GLN B C   1 
ATOM   4284 O  O   . GLN B 1 242 ? -11.226 10.798  42.171  1.00 65.67  ? 242 GLN B O   1 
ATOM   4285 C  CB  . GLN B 1 242 ? -8.006  10.248  42.087  1.00 39.21  ? 242 GLN B CB  1 
ATOM   4286 C  CG  . GLN B 1 242 ? -6.769  10.758  41.352  1.00 37.01  ? 242 GLN B CG  1 
ATOM   4287 C  CD  . GLN B 1 242 ? -6.418  9.903   40.153  1.00 30.90  ? 242 GLN B CD  1 
ATOM   4288 O  OE1 . GLN B 1 242 ? -5.393  9.221   40.124  1.00 23.09  ? 242 GLN B OE1 1 
ATOM   4289 N  NE2 . GLN B 1 242 ? -7.276  9.935   39.156  1.00 31.38  ? 242 GLN B NE2 1 
ATOM   4290 N  N   . ILE B 1 243 ? -10.341 10.150  44.133  1.00 48.15  ? 243 ILE B N   1 
ATOM   4291 C  CA  . ILE B 1 243 ? -11.533 9.442   44.567  1.00 52.00  ? 243 ILE B CA  1 
ATOM   4292 C  C   . ILE B 1 243 ? -12.574 10.412  45.059  1.00 53.22  ? 243 ILE B C   1 
ATOM   4293 O  O   . ILE B 1 243 ? -13.669 10.515  44.500  1.00 49.85  ? 243 ILE B O   1 
ATOM   4294 C  CB  . ILE B 1 243 ? -11.227 8.478   45.694  1.00 42.67  ? 243 ILE B CB  1 
ATOM   4295 C  CG1 . ILE B 1 243 ? -11.653 7.091   45.264  1.00 43.56  ? 243 ILE B CG1 1 
ATOM   4296 C  CG2 . ILE B 1 243 ? -11.947 8.918   46.946  1.00 44.99  ? 243 ILE B CG2 1 
ATOM   4297 C  CD1 . ILE B 1 243 ? -11.679 6.928   43.764  1.00 43.71  ? 243 ILE B CD1 1 
ATOM   4298 N  N   . ILE B 1 244 ? -12.227 11.143  46.107  1.00 53.22  ? 244 ILE B N   1 
ATOM   4299 C  CA  . ILE B 1 244 ? -13.107 12.187  46.567  1.00 47.40  ? 244 ILE B CA  1 
ATOM   4300 C  C   . ILE B 1 244 ? -13.889 12.812  45.442  1.00 46.08  ? 244 ILE B C   1 
ATOM   4301 O  O   . ILE B 1 244 ? -15.101 12.720  45.400  1.00 37.84  ? 244 ILE B O   1 
ATOM   4302 C  CB  . ILE B 1 244 ? -12.328 13.368  47.125  1.00 43.21  ? 244 ILE B CB  1 
ATOM   4303 C  CG1 . ILE B 1 244 ? -11.892 13.092  48.558  1.00 40.99  ? 244 ILE B CG1 1 
ATOM   4304 C  CG2 . ILE B 1 244 ? -13.186 14.605  47.067  1.00 35.39  ? 244 ILE B CG2 1 
ATOM   4305 C  CD1 . ILE B 1 244 ? -11.807 14.332  49.409  1.00 39.03  ? 244 ILE B CD1 1 
ATOM   4306 N  N   . HIS B 1 245 ? -13.191 13.411  44.489  1.00 51.66  ? 245 HIS B N   1 
ATOM   4307 C  CA  . HIS B 1 245 ? -13.876 13.867  43.308  1.00 52.10  ? 245 HIS B CA  1 
ATOM   4308 C  C   . HIS B 1 245 ? -13.695 12.762  42.260  1.00 60.13  ? 245 HIS B C   1 
ATOM   4309 O  O   . HIS B 1 245 ? -13.131 13.011  41.187  1.00 60.47  ? 245 HIS B O   1 
ATOM   4310 C  CB  . HIS B 1 245 ? -13.292 15.251  42.893  1.00 40.42  ? 245 HIS B CB  1 
ATOM   4311 C  CG  . HIS B 1 245 ? -12.952 16.139  44.071  1.00 42.65  ? 245 HIS B CG  1 
ATOM   4312 N  ND1 . HIS B 1 245 ? -13.861 17.006  44.647  1.00 51.25  ? 245 HIS B ND1 1 
ATOM   4313 C  CD2 . HIS B 1 245 ? -11.837 16.216  44.836  1.00 48.12  ? 245 HIS B CD2 1 
ATOM   4314 C  CE1 . HIS B 1 245 ? -13.307 17.610  45.689  1.00 51.16  ? 245 HIS B CE1 1 
ATOM   4315 N  NE2 . HIS B 1 245 ? -12.078 17.146  45.828  1.00 59.79  ? 245 HIS B NE2 1 
ATOM   4316 N  N   . ARG B 1 246 ? -14.130 11.535  42.602  1.00 64.79  ? 246 ARG B N   1 
ATOM   4317 C  CA  . ARG B 1 246 ? -14.072 10.406  41.651  1.00 79.52  ? 246 ARG B CA  1 
ATOM   4318 C  C   . ARG B 1 246 ? -14.492 10.886  40.298  1.00 77.26  ? 246 ARG B C   1 
ATOM   4319 O  O   . ARG B 1 246 ? -13.943 10.462  39.281  1.00 65.60  ? 246 ARG B O   1 
ATOM   4320 C  CB  . ARG B 1 246 ? -14.911 9.178   42.110  1.00 86.31  ? 246 ARG B CB  1 
ATOM   4321 C  CG  . ARG B 1 246 ? -15.175 8.042   41.029  1.00 58.36  ? 246 ARG B CG  1 
ATOM   4322 C  CD  . ARG B 1 246 ? -15.895 6.717   41.544  1.00 55.98  ? 246 ARG B CD  1 
ATOM   4323 N  NE  . ARG B 1 246 ? -16.818 6.888   42.686  1.00 85.82  ? 246 ARG B NE  1 
ATOM   4324 C  CZ  . ARG B 1 246 ? -16.550 6.514   43.941  1.00 70.40  ? 246 ARG B CZ  1 
ATOM   4325 N  NH1 . ARG B 1 246 ? -15.398 5.931   44.233  1.00 69.85  ? 246 ARG B NH1 1 
ATOM   4326 N  NH2 . ARG B 1 246 ? -17.425 6.724   44.911  1.00 70.20  ? 246 ARG B NH2 1 
ATOM   4327 N  N   . ASN B 1 247 ? -15.414 11.834  40.348  1.00 81.75  ? 247 ASN B N   1 
ATOM   4328 C  CA  . ASN B 1 247 ? -15.949 12.502  39.205  1.00 81.17  ? 247 ASN B CA  1 
ATOM   4329 C  C   . ASN B 1 247 ? -15.077 13.460  38.459  1.00 77.78  ? 247 ASN B C   1 
ATOM   4330 O  O   . ASN B 1 247 ? -15.089 13.487  37.229  1.00 63.63  ? 247 ASN B O   1 
ATOM   4331 C  CB  . ASN B 1 247 ? -17.288 13.136  39.633  1.00 63.29  ? 247 ASN B CB  1 
ATOM   4332 C  CG  . ASN B 1 247 ? -18.518 12.246  39.193  1.00 51.17  ? 247 ASN B CG  1 
ATOM   4333 O  OD1 . ASN B 1 247 ? -19.611 12.238  39.835  1.00 51.19  ? 247 ASN B OD1 1 
ATOM   4334 N  ND2 . ASN B 1 247 ? -18.290 11.426  38.122  1.00 46.00  ? 247 ASN B ND2 1 
ATOM   4335 N  N   . GLN B 1 248 ? -14.332 14.211  39.245  1.00 75.88  ? 248 GLN B N   1 
ATOM   4336 C  CA  . GLN B 1 248 ? -13.341 15.058  38.670  1.00 80.58  ? 248 GLN B CA  1 
ATOM   4337 C  C   . GLN B 1 248 ? -12.246 14.295  37.907  1.00 69.42  ? 248 GLN B C   1 
ATOM   4338 O  O   . GLN B 1 248 ? -11.523 13.419  38.436  1.00 67.83  ? 248 GLN B O   1 
ATOM   4339 C  CB  . GLN B 1 248 ? -12.807 16.124  39.665  1.00 81.43  ? 248 GLN B CB  1 
ATOM   4340 C  CG  . GLN B 1 248 ? -13.799 17.220  40.187  1.00 66.45  ? 248 GLN B CG  1 
ATOM   4341 C  CD  . GLN B 1 248 ? -14.628 17.954  39.105  1.00 78.12  ? 248 GLN B CD  1 
ATOM   4342 O  OE1 . GLN B 1 248 ? -14.174 18.138  37.977  1.00 80.34  ? 248 GLN B OE1 1 
ATOM   4343 N  NE2 . GLN B 1 248 ? -15.844 18.397  39.471  1.00 76.34  ? 248 GLN B NE2 1 
ATOM   4344 N  N   . ASN B 1 249 ? -12.143 14.693  36.645  1.00 54.52  ? 249 ASN B N   1 
ATOM   4345 C  CA  . ASN B 1 249 ? -11.223 14.082  35.720  1.00 45.07  ? 249 ASN B CA  1 
ATOM   4346 C  C   . ASN B 1 249 ? -10.238 15.147  35.268  1.00 46.40  ? 249 ASN B C   1 
ATOM   4347 O  O   . ASN B 1 249 ? -10.274 16.277  35.746  1.00 46.42  ? 249 ASN B O   1 
ATOM   4348 C  CB  . ASN B 1 249 ? -12.008 13.517  34.541  1.00 43.87  ? 249 ASN B CB  1 
ATOM   4349 C  CG  . ASN B 1 249 ? -11.414 12.236  34.012  1.00 37.31  ? 249 ASN B CG  1 
ATOM   4350 O  OD1 . ASN B 1 249 ? -10.205 12.125  33.896  1.00 43.56  ? 249 ASN B OD1 1 
ATOM   4351 N  ND2 . ASN B 1 249 ? -12.254 11.255  33.707  1.00 40.40  ? 249 ASN B ND2 1 
ATOM   4352 N  N   . TYR B 1 250 ? -9.381  14.763  34.338  1.00 49.57  ? 250 TYR B N   1 
ATOM   4353 C  CA  . TYR B 1 250 ? -8.364  15.645  33.835  1.00 38.62  ? 250 TYR B CA  1 
ATOM   4354 C  C   . TYR B 1 250 ? -8.970  16.715  32.988  1.00 30.14  ? 250 TYR B C   1 
ATOM   4355 O  O   . TYR B 1 250 ? -9.883  16.471  32.227  1.00 25.36  ? 250 TYR B O   1 
ATOM   4356 C  CB  . TYR B 1 250 ? -7.373  14.875  32.992  1.00 37.81  ? 250 TYR B CB  1 
ATOM   4357 C  CG  . TYR B 1 250 ? -6.154  15.660  32.629  1.00 30.76  ? 250 TYR B CG  1 
ATOM   4358 C  CD1 . TYR B 1 250 ? -4.946  15.046  32.498  1.00 28.58  ? 250 TYR B CD1 1 
ATOM   4359 C  CD2 . TYR B 1 250 ? -6.217  17.014  32.426  1.00 25.48  ? 250 TYR B CD2 1 
ATOM   4360 C  CE1 . TYR B 1 250 ? -3.828  15.743  32.171  1.00 25.73  ? 250 TYR B CE1 1 
ATOM   4361 C  CE2 . TYR B 1 250 ? -5.094  17.725  32.094  1.00 25.03  ? 250 TYR B CE2 1 
ATOM   4362 C  CZ  . TYR B 1 250 ? -3.903  17.065  31.967  1.00 27.36  ? 250 TYR B CZ  1 
ATOM   4363 O  OH  . TYR B 1 250 ? -2.760  17.735  31.640  1.00 26.78  ? 250 TYR B OH  1 
ATOM   4364 N  N   . GLN B 1 251 ? -8.441  17.911  33.143  1.00 29.08  ? 251 GLN B N   1 
ATOM   4365 C  CA  . GLN B 1 251 ? -8.695  18.980  32.232  1.00 36.10  ? 251 GLN B CA  1 
ATOM   4366 C  C   . GLN B 1 251 ? -7.344  19.658  32.083  1.00 39.03  ? 251 GLN B C   1 
ATOM   4367 O  O   . GLN B 1 251 ? -6.590  19.687  33.044  1.00 30.80  ? 251 GLN B O   1 
ATOM   4368 C  CB  . GLN B 1 251 ? -9.772  19.896  32.787  1.00 32.43  ? 251 GLN B CB  1 
ATOM   4369 C  CG  . GLN B 1 251 ? -11.176 19.370  32.551  1.00 32.13  ? 251 GLN B CG  1 
ATOM   4370 C  CD  . GLN B 1 251 ? -11.820 19.906  31.283  1.00 68.34  ? 251 GLN B CD  1 
ATOM   4371 O  OE1 . GLN B 1 251 ? -11.251 20.744  30.591  1.00 86.01  ? 251 GLN B OE1 1 
ATOM   4372 N  NE2 . GLN B 1 251 ? -13.012 19.429  30.978  1.00 60.46  ? 251 GLN B NE2 1 
ATOM   4373 N  N   . PRO B 1 252 ? -6.993  20.134  30.880  1.00 40.73  ? 252 PRO B N   1 
ATOM   4374 C  CA  . PRO B 1 252 ? -7.880  20.212  29.716  1.00 29.42  ? 252 PRO B CA  1 
ATOM   4375 C  C   . PRO B 1 252 ? -8.037  18.923  29.004  1.00 15.97  ? 252 PRO B C   1 
ATOM   4376 O  O   . PRO B 1 252 ? -7.160  18.103  29.042  1.00 12.86  ? 252 PRO B O   1 
ATOM   4377 C  CB  . PRO B 1 252 ? -7.148  21.173  28.792  1.00 33.13  ? 252 PRO B CB  1 
ATOM   4378 C  CG  . PRO B 1 252 ? -5.733  21.105  29.203  1.00 27.20  ? 252 PRO B CG  1 
ATOM   4379 C  CD  . PRO B 1 252 ? -5.797  20.967  30.690  1.00 30.80  ? 252 PRO B CD  1 
ATOM   4380 N  N   . MET B 1 253 ? -9.152  18.782  28.302  1.00 15.64  ? 253 MET B N   1 
ATOM   4381 C  CA  . MET B 1 253 ? -9.430  17.628  27.470  1.00 22.58  ? 253 MET B CA  1 
ATOM   4382 C  C   . MET B 1 253 ? -8.881  17.863  26.065  1.00 32.98  ? 253 MET B C   1 
ATOM   4383 O  O   . MET B 1 253 ? -8.556  16.920  25.341  1.00 29.30  ? 253 MET B O   1 
ATOM   4384 C  CB  . MET B 1 253 ? -10.931 17.389  27.370  1.00 21.19  ? 253 MET B CB  1 
ATOM   4385 C  CG  . MET B 1 253 ? -11.608 16.884  28.631  1.00 30.23  ? 253 MET B CG  1 
ATOM   4386 S  SD  . MET B 1 253 ? -10.947 15.396  29.402  1.00 39.27  ? 253 MET B SD  1 
ATOM   4387 C  CE  . MET B 1 253 ? -11.218 14.189  28.116  1.00 21.48  ? 253 MET B CE  1 
ATOM   4388 N  N   . LYS B 1 254 ? -8.896  19.134  25.737  1.00 46.96  ? 254 LYS B N   1 
ATOM   4389 C  CA  . LYS B 1 254 ? -8.270  19.647  24.579  1.00 43.58  ? 254 LYS B CA  1 
ATOM   4390 C  C   . LYS B 1 254 ? -8.345  21.157  24.424  1.00 35.03  ? 254 LYS B C   1 
ATOM   4391 O  O   . LYS B 1 254 ? -9.213  21.849  24.959  1.00 28.89  ? 254 LYS B O   1 
ATOM   4392 C  CB  . LYS B 1 254 ? -8.944  18.990  23.423  1.00 52.36  ? 254 LYS B CB  1 
ATOM   4393 C  CG  . LYS B 1 254 ? -10.381 19.394  23.173  1.00 50.12  ? 254 LYS B CG  1 
ATOM   4394 C  CD  . LYS B 1 254 ? -10.801 18.782  21.866  1.00 60.53  ? 254 LYS B CD  1 
ATOM   4395 C  CE  . LYS B 1 254 ? -12.250 18.955  21.659  1.00 89.61  ? 254 LYS B CE  1 
ATOM   4396 N  NZ  . LYS B 1 254 ? -12.561 20.070  22.536  1.00 129.56 ? 254 LYS B NZ  1 
ATOM   4397 N  N   . ASN B 1 255 ? -7.377  21.677  23.678  1.00 41.61  ? 255 ASN B N   1 
ATOM   4398 C  CA  . ASN B 1 255 ? -7.160  23.109  23.581  1.00 39.22  ? 255 ASN B CA  1 
ATOM   4399 C  C   . ASN B 1 255 ? -6.003  23.483  24.496  1.00 30.58  ? 255 ASN B C   1 
ATOM   4400 O  O   . ASN B 1 255 ? -5.547  24.626  24.515  1.00 26.67  ? 255 ASN B O   1 
ATOM   4401 C  CB  . ASN B 1 255 ? -8.433  23.875  23.941  1.00 60.83  ? 255 ASN B CB  1 
ATOM   4402 C  CG  . ASN B 1 255 ? -9.548  23.656  22.938  1.00 68.04  ? 255 ASN B CG  1 
ATOM   4403 O  OD1 . ASN B 1 255 ? -10.594 24.303  23.003  1.00 72.22  ? 255 ASN B OD1 1 
ATOM   4404 N  ND2 . ASN B 1 255 ? -9.331  22.740  22.002  1.00 54.53  ? 255 ASN B ND2 1 
ATOM   4405 N  N   . GLY B 1 256 ? -5.540  22.466  25.196  1.00 29.31  ? 256 GLY B N   1 
ATOM   4406 C  CA  . GLY B 1 256 ? -4.312  22.575  25.924  1.00 29.97  ? 256 GLY B CA  1 
ATOM   4407 C  C   . GLY B 1 256 ? -3.106  22.563  25.000  1.00 33.25  ? 256 GLY B C   1 
ATOM   4408 O  O   . GLY B 1 256 ? -2.996  21.787  24.051  1.00 24.76  ? 256 GLY B O   1 
ATOM   4409 N  N   . PRO B 1 257 ? -2.178  23.448  25.283  1.00 28.26  ? 257 PRO B N   1 
ATOM   4410 C  CA  . PRO B 1 257 ? -0.945  23.417  24.538  1.00 21.51  ? 257 PRO B CA  1 
ATOM   4411 C  C   . PRO B 1 257 ? -0.715  21.970  24.282  1.00 18.31  ? 257 PRO B C   1 
ATOM   4412 O  O   . PRO B 1 257 ? -1.050  21.162  25.103  1.00 17.32  ? 257 PRO B O   1 
ATOM   4413 C  CB  . PRO B 1 257 ? 0.076   23.936  25.536  1.00 23.64  ? 257 PRO B CB  1 
ATOM   4414 C  CG  . PRO B 1 257 ? -0.644  24.081  26.832  1.00 31.84  ? 257 PRO B CG  1 
ATOM   4415 C  CD  . PRO B 1 257 ? -2.068  24.249  26.501  1.00 22.22  ? 257 PRO B CD  1 
ATOM   4416 N  N   . PHE B 1 258 ? -0.161  21.647  23.138  1.00 25.62  ? 258 PHE B N   1 
ATOM   4417 C  CA  . PHE B 1 258 ? 0.222   20.288  22.825  1.00 17.95  ? 258 PHE B CA  1 
ATOM   4418 C  C   . PHE B 1 258 ? 1.168   19.858  23.916  1.00 19.55  ? 258 PHE B C   1 
ATOM   4419 O  O   . PHE B 1 258 ? 2.115   20.571  24.268  1.00 14.73  ? 258 PHE B O   1 
ATOM   4420 C  CB  . PHE B 1 258 ? 0.868   20.196  21.448  1.00 15.00  ? 258 PHE B CB  1 
ATOM   4421 C  CG  . PHE B 1 258 ? 1.184   18.798  21.019  1.00 19.46  ? 258 PHE B CG  1 
ATOM   4422 C  CD1 . PHE B 1 258 ? 0.176   17.871  20.848  1.00 29.51  ? 258 PHE B CD1 1 
ATOM   4423 C  CD2 . PHE B 1 258 ? 2.494   18.406  20.792  1.00 19.11  ? 258 PHE B CD2 1 
ATOM   4424 C  CE1 . PHE B 1 258 ? 0.469   16.572  20.450  1.00 30.67  ? 258 PHE B CE1 1 
ATOM   4425 C  CE2 . PHE B 1 258 ? 2.794   17.119  20.393  1.00 17.04  ? 258 PHE B CE2 1 
ATOM   4426 C  CZ  . PHE B 1 258 ? 1.783   16.201  20.222  1.00 23.46  ? 258 PHE B CZ  1 
ATOM   4427 N  N   . GLY B 1 259 ? 0.857   18.699  24.484  1.00 25.63  ? 259 GLY B N   1 
ATOM   4428 C  CA  . GLY B 1 259 ? 1.621   18.134  25.579  1.00 21.45  ? 259 GLY B CA  1 
ATOM   4429 C  C   . GLY B 1 259 ? 0.964   18.316  26.935  1.00 18.42  ? 259 GLY B C   1 
ATOM   4430 O  O   . GLY B 1 259 ? 1.547   17.959  27.955  1.00 25.69  ? 259 GLY B O   1 
ATOM   4431 N  N   . GLN B 1 260 ? -0.244  18.872  26.951  1.00 16.93  ? 260 GLN B N   1 
ATOM   4432 C  CA  . GLN B 1 260 ? -0.935  19.146  28.209  1.00 17.86  ? 260 GLN B CA  1 
ATOM   4433 C  C   . GLN B 1 260 ? -2.338  18.567  28.218  1.00 22.29  ? 260 GLN B C   1 
ATOM   4434 O  O   . GLN B 1 260 ? -2.986  18.469  29.268  1.00 24.97  ? 260 GLN B O   1 
ATOM   4435 C  CB  . GLN B 1 260 ? -1.045  20.648  28.449  1.00 19.51  ? 260 GLN B CB  1 
ATOM   4436 C  CG  . GLN B 1 260 ? 0.257   21.322  28.644  1.00 16.91  ? 260 GLN B CG  1 
ATOM   4437 C  CD  . GLN B 1 260 ? 0.932   20.843  29.884  1.00 17.06  ? 260 GLN B CD  1 
ATOM   4438 O  OE1 . GLN B 1 260 ? 2.031   21.269  30.191  1.00 23.78  ? 260 GLN B OE1 1 
ATOM   4439 N  NE2 . GLN B 1 260 ? 0.276   19.957  30.618  1.00 16.50  ? 260 GLN B NE2 1 
ATOM   4440 N  N   . ASN B 1 261 ? -2.864  18.323  27.024  1.00 20.60  ? 261 ASN B N   1 
ATOM   4441 C  CA  . ASN B 1 261 ? -4.214  17.824  26.871  1.00 20.19  ? 261 ASN B CA  1 
ATOM   4442 C  C   . ASN B 1 261 ? -4.264  16.414  27.418  1.00 20.71  ? 261 ASN B C   1 
ATOM   4443 O  O   . ASN B 1 261 ? -3.292  15.967  27.986  1.00 21.78  ? 261 ASN B O   1 
ATOM   4444 C  CB  . ASN B 1 261 ? -4.659  17.912  25.415  1.00 26.47  ? 261 ASN B CB  1 
ATOM   4445 C  CG  . ASN B 1 261 ? -5.277  19.261  25.070  1.00 31.93  ? 261 ASN B CG  1 
ATOM   4446 O  OD1 . ASN B 1 261 ? -4.588  20.266  25.022  1.00 42.00  ? 261 ASN B OD1 1 
ATOM   4447 N  ND2 . ASN B 1 261 ? -6.583  19.283  24.830  1.00 25.46  ? 261 ASN B ND2 1 
ATOM   4448 N  N   . PHE B 1 262 ? -5.386  15.722  27.285  1.00 23.46  ? 262 PHE B N   1 
ATOM   4449 C  CA  . PHE B 1 262 ? -5.604  14.458  27.985  1.00 22.00  ? 262 PHE B CA  1 
ATOM   4450 C  C   . PHE B 1 262 ? -5.307  13.261  27.135  1.00 22.98  ? 262 PHE B C   1 
ATOM   4451 O  O   . PHE B 1 262 ? -5.372  12.143  27.605  1.00 20.65  ? 262 PHE B O   1 
ATOM   4452 C  CB  . PHE B 1 262 ? -7.050  14.385  28.431  1.00 25.75  ? 262 PHE B CB  1 
ATOM   4453 C  CG  . PHE B 1 262 ? -7.421  13.127  29.151  1.00 28.09  ? 262 PHE B CG  1 
ATOM   4454 C  CD1 . PHE B 1 262 ? -7.461  13.099  30.517  1.00 27.08  ? 262 PHE B CD1 1 
ATOM   4455 C  CD2 . PHE B 1 262 ? -7.799  12.003  28.463  1.00 32.31  ? 262 PHE B CD2 1 
ATOM   4456 C  CE1 . PHE B 1 262 ? -7.830  11.957  31.190  1.00 26.15  ? 262 PHE B CE1 1 
ATOM   4457 C  CE2 . PHE B 1 262 ? -8.171  10.852  29.126  1.00 31.40  ? 262 PHE B CE2 1 
ATOM   4458 C  CZ  . PHE B 1 262 ? -8.193  10.835  30.492  1.00 27.72  ? 262 PHE B CZ  1 
ATOM   4459 N  N   . ARG B 1 263 ? -4.979  13.517  25.875  1.00 26.64  ? 263 ARG B N   1 
ATOM   4460 C  CA  . ARG B 1 263 ? -4.655  12.484  24.907  1.00 24.45  ? 263 ARG B CA  1 
ATOM   4461 C  C   . ARG B 1 263 ? -3.460  12.915  24.086  1.00 18.59  ? 263 ARG B C   1 
ATOM   4462 O  O   . ARG B 1 263 ? -3.303  12.506  22.942  1.00 11.19  ? 263 ARG B O   1 
ATOM   4463 C  CB  . ARG B 1 263 ? -5.828  12.231  23.989  1.00 21.38  ? 263 ARG B CB  1 
ATOM   4464 C  CG  . ARG B 1 263 ? -6.421  10.851  24.138  1.00 27.62  ? 263 ARG B CG  1 
ATOM   4465 C  CD  . ARG B 1 263 ? -7.397  10.556  23.017  1.00 26.53  ? 263 ARG B CD  1 
ATOM   4466 N  NE  . ARG B 1 263 ? -8.697  11.132  23.283  1.00 42.03  ? 263 ARG B NE  1 
ATOM   4467 C  CZ  . ARG B 1 263 ? -9.559  10.634  24.147  1.00 49.46  ? 263 ARG B CZ  1 
ATOM   4468 N  NH1 . ARG B 1 263 ? -9.263  9.541   24.826  1.00 36.36  ? 263 ARG B NH1 1 
ATOM   4469 N  NH2 . ARG B 1 263 ? -10.727 11.215  24.319  1.00 63.46  ? 263 ARG B NH2 1 
ATOM   4470 N  N   . ASP B 1 264 ? -2.595  13.719  24.696  1.00 17.76  ? 264 ASP B N   1 
ATOM   4471 C  CA  . ASP B 1 264 ? -1.349  14.138  24.065  1.00 19.37  ? 264 ASP B CA  1 
ATOM   4472 C  C   . ASP B 1 264 ? -0.150  13.605  24.847  1.00 19.08  ? 264 ASP B C   1 
ATOM   4473 O  O   . ASP B 1 264 ? 0.060   13.973  26.003  1.00 14.03  ? 264 ASP B O   1 
ATOM   4474 C  CB  . ASP B 1 264 ? -1.281  15.663  23.969  1.00 16.61  ? 264 ASP B CB  1 
ATOM   4475 C  CG  . ASP B 1 264 ? -2.151  16.216  22.858  1.00 20.52  ? 264 ASP B CG  1 
ATOM   4476 O  OD1 . ASP B 1 264 ? -3.257  15.676  22.642  1.00 23.32  ? 264 ASP B OD1 1 
ATOM   4477 O  OD2 . ASP B 1 264 ? -1.730  17.191  22.200  1.00 21.60  ? 264 ASP B OD2 1 
ATOM   4478 N  N   . PRO B 1 265 ? 0.630   12.734  24.212  1.00 19.01  ? 265 PRO B N   1 
ATOM   4479 C  CA  . PRO B 1 265 ? 1.795   12.138  24.843  1.00 12.14  ? 265 PRO B CA  1 
ATOM   4480 C  C   . PRO B 1 265 ? 2.660   13.105  25.649  1.00 7.92   ? 265 PRO B C   1 
ATOM   4481 O  O   . PRO B 1 265 ? 2.611   14.309  25.396  1.00 7.57   ? 265 PRO B O   1 
ATOM   4482 C  CB  . PRO B 1 265 ? 2.678   11.726  23.668  1.00 15.60  ? 265 PRO B CB  1 
ATOM   4483 C  CG  . PRO B 1 265 ? 1.715   11.505  22.553  1.00 16.98  ? 265 PRO B CG  1 
ATOM   4484 C  CD  . PRO B 1 265 ? 0.615   12.507  22.757  1.00 17.97  ? 265 PRO B CD  1 
ATOM   4485 N  N   . MET B 1 266 ? 3.437   12.603  26.582  1.00 9.04   ? 266 MET B N   1 
ATOM   4486 C  CA  . MET B 1 266 ? 4.200   13.448  27.490  1.00 12.51  ? 266 MET B CA  1 
ATOM   4487 C  C   . MET B 1 266 ? 5.707   13.282  27.311  1.00 14.47  ? 266 MET B C   1 
ATOM   4488 O  O   . MET B 1 266 ? 6.307   12.344  27.839  1.00 11.43  ? 266 MET B O   1 
ATOM   4489 C  CB  . MET B 1 266 ? 3.846   13.106  28.947  1.00 13.16  ? 266 MET B CB  1 
ATOM   4490 C  CG  . MET B 1 266 ? 2.455   13.530  29.332  1.00 14.39  ? 266 MET B CG  1 
ATOM   4491 S  SD  . MET B 1 266 ? 2.058   13.055  31.012  1.00 16.55  ? 266 MET B SD  1 
ATOM   4492 C  CE  . MET B 1 266 ? 2.095   11.257  30.924  1.00 14.31  ? 266 MET B CE  1 
ATOM   4493 N  N   . TYR B 1 267 ? 6.308   14.190  26.542  1.00 14.69  ? 267 TYR B N   1 
ATOM   4494 C  CA  . TYR B 1 267 ? 7.749   14.220  26.419  1.00 11.51  ? 267 TYR B CA  1 
ATOM   4495 C  C   . TYR B 1 267 ? 8.184   13.904  27.823  1.00 12.66  ? 267 TYR B C   1 
ATOM   4496 O  O   . TYR B 1 267 ? 7.579   14.389  28.772  1.00 14.37  ? 267 TYR B O   1 
ATOM   4497 C  CB  . TYR B 1 267 ? 8.224   15.623  25.986  1.00 11.68  ? 267 TYR B CB  1 
ATOM   4498 C  CG  . TYR B 1 267 ? 9.724   15.773  25.692  1.00 13.72  ? 267 TYR B CG  1 
ATOM   4499 C  CD1 . TYR B 1 267 ? 10.286  15.278  24.510  1.00 14.23  ? 267 TYR B CD1 1 
ATOM   4500 C  CD2 . TYR B 1 267 ? 10.566  16.455  26.572  1.00 16.40  ? 267 TYR B CD2 1 
ATOM   4501 C  CE1 . TYR B 1 267 ? 11.647  15.423  24.238  1.00 13.36  ? 267 TYR B CE1 1 
ATOM   4502 C  CE2 . TYR B 1 267 ? 11.929  16.601  26.306  1.00 17.27  ? 267 TYR B CE2 1 
ATOM   4503 C  CZ  . TYR B 1 267 ? 12.464  16.079  25.138  1.00 17.84  ? 267 TYR B CZ  1 
ATOM   4504 O  OH  . TYR B 1 267 ? 13.820  16.217  24.856  1.00 18.83  ? 267 TYR B OH  1 
ATOM   4505 N  N   . PRO B 1 268 ? 9.209   13.059  27.970  1.00 12.21  ? 268 PRO B N   1 
ATOM   4506 C  CA  . PRO B 1 268 ? 9.929   12.423  26.861  1.00 9.68   ? 268 PRO B CA  1 
ATOM   4507 C  C   . PRO B 1 268 ? 9.405   11.039  26.437  1.00 9.39   ? 268 PRO B C   1 
ATOM   4508 O  O   . PRO B 1 268 ? 10.109  10.300  25.751  1.00 7.20   ? 268 PRO B O   1 
ATOM   4509 C  CB  . PRO B 1 268 ? 11.350  12.328  27.407  1.00 8.85   ? 268 PRO B CB  1 
ATOM   4510 C  CG  . PRO B 1 268 ? 11.176  12.188  28.913  1.00 8.41   ? 268 PRO B CG  1 
ATOM   4511 C  CD  . PRO B 1 268 ? 9.842   12.805  29.277  1.00 8.77   ? 268 PRO B CD  1 
ATOM   4512 N  N   . TRP B 1 269 ? 8.182   10.696  26.813  1.00 8.80   ? 269 TRP B N   1 
ATOM   4513 C  CA  . TRP B 1 269 ? 7.653   9.399   26.429  1.00 9.95   ? 269 TRP B CA  1 
ATOM   4514 C  C   . TRP B 1 269 ? 6.530   9.686   25.462  1.00 8.23   ? 269 TRP B C   1 
ATOM   4515 O  O   . TRP B 1 269 ? 6.283   10.844  25.109  1.00 3.95   ? 269 TRP B O   1 
ATOM   4516 C  CB  . TRP B 1 269 ? 7.126   8.602   27.638  1.00 13.06  ? 269 TRP B CB  1 
ATOM   4517 C  CG  . TRP B 1 269 ? 8.030   8.676   28.850  1.00 14.58  ? 269 TRP B CG  1 
ATOM   4518 C  CD1 . TRP B 1 269 ? 9.184   7.962   29.062  1.00 15.55  ? 269 TRP B CD1 1 
ATOM   4519 C  CD2 . TRP B 1 269 ? 7.852   9.502   30.020  1.00 11.79  ? 269 TRP B CD2 1 
ATOM   4520 N  NE1 . TRP B 1 269 ? 9.731   8.301   30.277  1.00 11.85  ? 269 TRP B NE1 1 
ATOM   4521 C  CE2 . TRP B 1 269 ? 8.938   9.244   30.884  1.00 12.24  ? 269 TRP B CE2 1 
ATOM   4522 C  CE3 . TRP B 1 269 ? 6.890   10.440  30.415  1.00 8.84   ? 269 TRP B CE3 1 
ATOM   4523 C  CZ2 . TRP B 1 269 ? 9.088   9.882   32.115  1.00 11.79  ? 269 TRP B CZ2 1 
ATOM   4524 C  CZ3 . TRP B 1 269 ? 7.038   11.074  31.633  1.00 11.80  ? 269 TRP B CZ3 1 
ATOM   4525 C  CH2 . TRP B 1 269 ? 8.130   10.793  32.472  1.00 11.26  ? 269 TRP B CH2 1 
ATOM   4526 N  N   . ASN B 1 270 ? 5.843   8.630   25.042  1.00 11.74  ? 270 ASN B N   1 
ATOM   4527 C  CA  . ASN B 1 270 ? 4.661   8.773   24.212  1.00 11.87  ? 270 ASN B CA  1 
ATOM   4528 C  C   . ASN B 1 270 ? 3.461   8.554   25.086  1.00 6.22   ? 270 ASN B C   1 
ATOM   4529 O  O   . ASN B 1 270 ? 2.334   8.489   24.610  1.00 6.01   ? 270 ASN B O   1 
ATOM   4530 C  CB  . ASN B 1 270 ? 4.647   7.745   23.094  1.00 20.15  ? 270 ASN B CB  1 
ATOM   4531 C  CG  . ASN B 1 270 ? 5.775   7.939   22.121  1.00 22.64  ? 270 ASN B CG  1 
ATOM   4532 O  OD1 . ASN B 1 270 ? 6.479   6.992   21.776  1.00 40.89  ? 270 ASN B OD1 1 
ATOM   4533 N  ND2 . ASN B 1 270 ? 5.964   9.170   21.680  1.00 12.48  ? 270 ASN B ND2 1 
ATOM   4534 N  N   . THR B 1 271 ? 3.727   8.424   26.378  1.00 7.55   ? 271 THR B N   1 
ATOM   4535 C  CA  . THR B 1 271 ? 2.690   8.206   27.377  1.00 12.08  ? 271 THR B CA  1 
ATOM   4536 C  C   . THR B 1 271 ? 1.784   9.425   27.543  1.00 11.29  ? 271 THR B C   1 
ATOM   4537 O  O   . THR B 1 271 ? 2.235   10.566  27.451  1.00 9.73   ? 271 THR B O   1 
ATOM   4538 C  CB  . THR B 1 271 ? 3.328   7.826   28.727  1.00 12.94  ? 271 THR B CB  1 
ATOM   4539 O  OG1 . THR B 1 271 ? 4.196   6.692   28.549  1.00 13.25  ? 271 THR B OG1 1 
ATOM   4540 C  CG2 . THR B 1 271 ? 2.253   7.504   29.741  1.00 11.98  ? 271 THR B CG2 1 
ATOM   4541 N  N   . THR B 1 272 ? 0.503   9.171   27.790  1.00 12.23  ? 272 THR B N   1 
ATOM   4542 C  CA  . THR B 1 272 ? -0.469  10.242  27.976  1.00 14.38  ? 272 THR B CA  1 
ATOM   4543 C  C   . THR B 1 272 ? -1.255  10.051  29.269  1.00 16.17  ? 272 THR B C   1 
ATOM   4544 O  O   . THR B 1 272 ? -1.423  8.928   29.745  1.00 19.36  ? 272 THR B O   1 
ATOM   4545 C  CB  . THR B 1 272 ? -1.454  10.322  26.795  1.00 14.32  ? 272 THR B CB  1 
ATOM   4546 O  OG1 . THR B 1 272 ? -2.221  9.113   26.726  1.00 14.68  ? 272 THR B OG1 1 
ATOM   4547 C  CG2 . THR B 1 272 ? -0.702  10.516  25.487  1.00 16.11  ? 272 THR B CG2 1 
ATOM   4548 N  N   . PRO B 1 273 ? -1.734  11.155  29.834  1.00 13.75  ? 273 PRO B N   1 
ATOM   4549 C  CA  . PRO B 1 273 ? -2.506  11.111  31.080  1.00 12.58  ? 273 PRO B CA  1 
ATOM   4550 C  C   . PRO B 1 273 ? -3.577  10.026  31.045  1.00 22.45  ? 273 PRO B C   1 
ATOM   4551 O  O   . PRO B 1 273 ? -3.743  9.293   32.020  1.00 25.33  ? 273 PRO B O   1 
ATOM   4552 C  CB  . PRO B 1 273 ? -3.159  12.493  31.130  1.00 17.78  ? 273 PRO B CB  1 
ATOM   4553 C  CG  . PRO B 1 273 ? -2.224  13.372  30.373  1.00 20.78  ? 273 PRO B CG  1 
ATOM   4554 C  CD  . PRO B 1 273 ? -1.657  12.517  29.276  1.00 22.90  ? 273 PRO B CD  1 
ATOM   4555 N  N   . GLU B 1 274 ? -4.293  9.930   29.930  1.00 24.32  ? 274 GLU B N   1 
ATOM   4556 C  CA  . GLU B 1 274 ? -5.339  8.940   29.779  1.00 23.46  ? 274 GLU B CA  1 
ATOM   4557 C  C   . GLU B 1 274 ? -4.699  7.688   30.270  1.00 16.16  ? 274 GLU B C   1 
ATOM   4558 O  O   . GLU B 1 274 ? -5.328  6.902   30.934  1.00 13.03  ? 274 GLU B O   1 
ATOM   4559 C  CB  . GLU B 1 274 ? -5.732  8.788   28.310  1.00 26.28  ? 274 GLU B CB  1 
ATOM   4560 C  CG  . GLU B 1 274 ? -7.201  8.493   28.050  1.00 32.09  ? 274 GLU B CG  1 
ATOM   4561 C  CD  . GLU B 1 274 ? -7.442  7.716   26.754  1.00 57.87  ? 274 GLU B CD  1 
ATOM   4562 O  OE1 . GLU B 1 274 ? -8.553  7.819   26.198  1.00 61.20  ? 274 GLU B OE1 1 
ATOM   4563 O  OE2 . GLU B 1 274 ? -6.534  6.996   26.282  1.00 62.43  ? 274 GLU B OE2 1 
ATOM   4564 N  N   . ASP B 1 275 ? -3.400  7.559   29.998  1.00 17.53  ? 275 ASP B N   1 
ATOM   4565 C  CA  . ASP B 1 275 ? -2.683  6.322   30.260  1.00 13.24  ? 275 ASP B CA  1 
ATOM   4566 C  C   . ASP B 1 275 ? -2.296  6.155   31.721  1.00 8.72   ? 275 ASP B C   1 
ATOM   4567 O  O   . ASP B 1 275 ? -1.912  5.069   32.130  1.00 10.28  ? 275 ASP B O   1 
ATOM   4568 C  CB  . ASP B 1 275 ? -1.413  6.258   29.394  1.00 14.25  ? 275 ASP B CB  1 
ATOM   4569 C  CG  . ASP B 1 275 ? -1.715  6.236   27.912  1.00 14.83  ? 275 ASP B CG  1 
ATOM   4570 O  OD1 . ASP B 1 275 ? -2.762  5.673   27.544  1.00 16.84  ? 275 ASP B OD1 1 
ATOM   4571 O  OD2 . ASP B 1 275 ? -0.905  6.772   27.122  1.00 12.14  ? 275 ASP B OD2 1 
ATOM   4572 N  N   . VAL B 1 276 ? -2.373  7.224   32.503  1.00 9.20   ? 276 VAL B N   1 
ATOM   4573 C  CA  . VAL B 1 276 ? -1.921  7.169   33.891  1.00 18.45  ? 276 VAL B CA  1 
ATOM   4574 C  C   . VAL B 1 276 ? -2.918  7.777   34.868  1.00 27.56  ? 276 VAL B C   1 
ATOM   4575 O  O   . VAL B 1 276 ? -2.545  8.230   35.957  1.00 22.10  ? 276 VAL B O   1 
ATOM   4576 C  CB  . VAL B 1 276 ? -0.571  7.899   34.073  1.00 11.44  ? 276 VAL B CB  1 
ATOM   4577 C  CG1 . VAL B 1 276 ? 0.550   7.132   33.403  1.00 13.19  ? 276 VAL B CG1 1 
ATOM   4578 C  CG2 . VAL B 1 276 ? -0.652  9.302   33.537  1.00 11.48  ? 276 VAL B CG2 1 
ATOM   4579 N  N   . MET B 1 277 ? -4.191  7.698   34.508  1.00 33.33  ? 277 MET B N   1 
ATOM   4580 C  CA  . MET B 1 277 ? -5.274  8.240   35.311  1.00 31.60  ? 277 MET B CA  1 
ATOM   4581 C  C   . MET B 1 277 ? -5.730  7.296   36.377  1.00 27.24  ? 277 MET B C   1 
ATOM   4582 O  O   . MET B 1 277 ? -6.680  7.593   37.073  1.00 32.04  ? 277 MET B O   1 
ATOM   4583 C  CB  . MET B 1 277 ? -6.481  8.504   34.432  1.00 29.32  ? 277 MET B CB  1 
ATOM   4584 C  CG  . MET B 1 277 ? -7.033  9.891   34.566  1.00 26.58  ? 277 MET B CG  1 
ATOM   4585 S  SD  . MET B 1 277 ? -5.785  11.070  34.102  1.00 30.26  ? 277 MET B SD  1 
ATOM   4586 C  CE  . MET B 1 277 ? -6.186  12.377  35.242  1.00 39.77  ? 277 MET B CE  1 
ATOM   4587 N  N   . ASN B 1 278 ? -5.095  6.141   36.476  1.00 26.25  ? 278 ASN B N   1 
ATOM   4588 C  CA  . ASN B 1 278 ? -5.439  5.194   37.519  1.00 35.13  ? 278 ASN B CA  1 
ATOM   4589 C  C   . ASN B 1 278 ? -4.177  4.665   38.142  1.00 31.27  ? 278 ASN B C   1 
ATOM   4590 O  O   . ASN B 1 278 ? -3.242  4.355   37.446  1.00 48.79  ? 278 ASN B O   1 
ATOM   4591 C  CB  . ASN B 1 278 ? -6.227  4.045   36.933  1.00 35.83  ? 278 ASN B CB  1 
ATOM   4592 C  CG  . ASN B 1 278 ? -7.477  3.755   37.709  1.00 35.25  ? 278 ASN B CG  1 
ATOM   4593 O  OD1 . ASN B 1 278 ? -7.539  4.029   38.897  1.00 34.09  ? 278 ASN B OD1 1 
ATOM   4594 N  ND2 . ASN B 1 278 ? -8.484  3.208   37.043  1.00 50.18  ? 278 ASN B ND2 1 
ATOM   4595 N  N   . HIS B 1 279 ? -4.104  4.576   39.448  1.00 23.74  ? 279 HIS B N   1 
ATOM   4596 C  CA  . HIS B 1 279 ? -2.900  4.051   39.973  1.00 22.58  ? 279 HIS B CA  1 
ATOM   4597 C  C   . HIS B 1 279 ? -3.162  2.627   40.165  1.00 27.47  ? 279 HIS B C   1 
ATOM   4598 O  O   . HIS B 1 279 ? -2.262  1.852   40.508  1.00 29.48  ? 279 HIS B O   1 
ATOM   4599 C  CB  . HIS B 1 279 ? -2.493  4.708   41.275  1.00 24.43  ? 279 HIS B CB  1 
ATOM   4600 C  CG  . HIS B 1 279 ? -3.596  4.821   42.286  1.00 27.68  ? 279 HIS B CG  1 
ATOM   4601 N  ND1 . HIS B 1 279 ? -3.864  3.860   43.161  1.00 31.23  ? 279 HIS B ND1 1 
ATOM   4602 C  CD2 . HIS B 1 279 ? -4.479  5.846   42.548  1.00 22.48  ? 279 HIS B CD2 1 
ATOM   4603 C  CE1 . HIS B 1 279 ? -4.881  4.237   43.933  1.00 25.63  ? 279 HIS B CE1 1 
ATOM   4604 N  NE2 . HIS B 1 279 ? -5.253  5.456   43.555  1.00 19.48  ? 279 HIS B NE2 1 
ATOM   4605 N  N   . ARG B 1 280 ? -4.399  2.220   39.954  1.00 29.08  ? 280 ARG B N   1 
ATOM   4606 C  CA  . ARG B 1 280 ? -4.658  0.809   40.168  1.00 36.29  ? 280 ARG B CA  1 
ATOM   4607 C  C   . ARG B 1 280 ? -4.309  0.031   38.888  1.00 34.82  ? 280 ARG B C   1 
ATOM   4608 O  O   . ARG B 1 280 ? -3.499  -0.892  38.922  1.00 37.14  ? 280 ARG B O   1 
ATOM   4609 C  CB  . ARG B 1 280 ? -6.119  0.614   40.594  1.00 48.92  ? 280 ARG B CB  1 
ATOM   4610 C  CG  . ARG B 1 280 ? -6.400  -0.656  41.367  1.00 62.70  ? 280 ARG B CG  1 
ATOM   4611 C  CD  . ARG B 1 280 ? -6.992  -0.407  42.757  1.00 75.76  ? 280 ARG B CD  1 
ATOM   4612 N  NE  . ARG B 1 280 ? -8.343  0.148   42.702  1.00 105.82 ? 280 ARG B NE  1 
ATOM   4613 C  CZ  . ARG B 1 280 ? -9.127  0.326   43.760  1.00 98.04  ? 280 ARG B CZ  1 
ATOM   4614 N  NH1 . ARG B 1 280 ? -8.704  -0.012  44.968  1.00 69.68  ? 280 ARG B NH1 1 
ATOM   4615 N  NH2 . ARG B 1 280 ? -10.340 0.839   43.606  1.00 105.57 ? 280 ARG B NH2 1 
ATOM   4616 N  N   . LYS B 1 281 ? -4.912  0.428   37.765  1.00 31.54  ? 281 LYS B N   1 
ATOM   4617 C  CA  . LYS B 1 281 ? -4.561  -0.104  36.445  1.00 33.19  ? 281 LYS B CA  1 
ATOM   4618 C  C   . LYS B 1 281 ? -3.053  -0.117  36.244  1.00 31.57  ? 281 LYS B C   1 
ATOM   4619 O  O   . LYS B 1 281 ? -2.534  -0.887  35.440  1.00 36.32  ? 281 LYS B O   1 
ATOM   4620 C  CB  . LYS B 1 281 ? -5.208  0.717   35.321  1.00 31.00  ? 281 LYS B CB  1 
ATOM   4621 C  CG  . LYS B 1 281 ? -6.248  -0.039  34.516  1.00 37.77  ? 281 LYS B CG  1 
ATOM   4622 C  CD  . LYS B 1 281 ? -7.368  -0.505  35.431  1.00 64.89  ? 281 LYS B CD  1 
ATOM   4623 C  CE  . LYS B 1 281 ? -8.502  -1.172  34.665  1.00 76.35  ? 281 LYS B CE  1 
ATOM   4624 N  NZ  . LYS B 1 281 ? -9.095  -0.269  33.641  1.00 69.99  ? 281 LYS B NZ  1 
ATOM   4625 N  N   . LEU B 1 282 ? -2.344  0.750   36.956  1.00 30.98  ? 282 LEU B N   1 
ATOM   4626 C  CA  . LEU B 1 282 ? -0.892  0.770   36.859  1.00 29.64  ? 282 LEU B CA  1 
ATOM   4627 C  C   . LEU B 1 282 ? -0.322  -0.357  37.724  1.00 39.15  ? 282 LEU B C   1 
ATOM   4628 O  O   . LEU B 1 282 ? 0.842   -0.732  37.593  1.00 47.91  ? 282 LEU B O   1 
ATOM   4629 C  CB  . LEU B 1 282 ? -0.330  2.160   37.201  1.00 22.99  ? 282 LEU B CB  1 
ATOM   4630 C  CG  . LEU B 1 282 ? -0.850  3.250   36.241  1.00 20.22  ? 282 LEU B CG  1 
ATOM   4631 C  CD1 . LEU B 1 282 ? -0.318  4.634   36.557  1.00 16.21  ? 282 LEU B CD1 1 
ATOM   4632 C  CD2 . LEU B 1 282 ? -0.555  2.910   34.796  1.00 21.25  ? 282 LEU B CD2 1 
ATOM   4633 N  N   . GLY B 1 283 ? -1.169  -0.923  38.578  1.00 36.62  ? 283 GLY B N   1 
ATOM   4634 C  CA  . GLY B 1 283 ? -0.820  -2.131  39.298  1.00 39.25  ? 283 GLY B CA  1 
ATOM   4635 C  C   . GLY B 1 283 ? -0.133  -1.793  40.598  1.00 36.59  ? 283 GLY B C   1 
ATOM   4636 O  O   . GLY B 1 283 ? 0.704   -2.541  41.104  1.00 39.33  ? 283 GLY B O   1 
ATOM   4637 N  N   . TYR B 1 284 ? -0.460  -0.639  41.165  1.00 31.78  ? 284 TYR B N   1 
ATOM   4638 C  CA  . TYR B 1 284 ? 0.047   -0.279  42.487  1.00 32.37  ? 284 TYR B CA  1 
ATOM   4639 C  C   . TYR B 1 284 ? -0.926  0.564   43.253  1.00 34.43  ? 284 TYR B C   1 
ATOM   4640 O  O   . TYR B 1 284 ? -1.541  1.447   42.701  1.00 36.39  ? 284 TYR B O   1 
ATOM   4641 C  CB  . TYR B 1 284 ? 1.402   0.424   42.440  1.00 28.45  ? 284 TYR B CB  1 
ATOM   4642 C  CG  . TYR B 1 284 ? 1.409   1.865   41.944  1.00 36.53  ? 284 TYR B CG  1 
ATOM   4643 C  CD1 . TYR B 1 284 ? 0.303   2.423   41.341  1.00 32.01  ? 284 TYR B CD1 1 
ATOM   4644 C  CD2 . TYR B 1 284 ? 2.553   2.653   42.058  1.00 38.84  ? 284 TYR B CD2 1 
ATOM   4645 C  CE1 . TYR B 1 284 ? 0.329   3.718   40.869  1.00 28.47  ? 284 TYR B CE1 1 
ATOM   4646 C  CE2 . TYR B 1 284 ? 2.576   3.947   41.593  1.00 30.54  ? 284 TYR B CE2 1 
ATOM   4647 C  CZ  . TYR B 1 284 ? 1.460   4.465   40.992  1.00 24.09  ? 284 TYR B CZ  1 
ATOM   4648 O  OH  . TYR B 1 284 ? 1.462   5.748   40.535  1.00 13.28  ? 284 TYR B OH  1 
ATOM   4649 N  N   . VAL B 1 285 ? -1.050  0.284   44.540  1.00 30.10  ? 285 VAL B N   1 
ATOM   4650 C  CA  . VAL B 1 285 ? -1.993  0.959   45.392  1.00 28.05  ? 285 VAL B CA  1 
ATOM   4651 C  C   . VAL B 1 285 ? -1.306  1.273   46.686  1.00 29.57  ? 285 VAL B C   1 
ATOM   4652 O  O   . VAL B 1 285 ? -0.493  0.493   47.135  1.00 27.20  ? 285 VAL B O   1 
ATOM   4653 C  CB  . VAL B 1 285 ? -3.086  0.008   45.792  1.00 33.15  ? 285 VAL B CB  1 
ATOM   4654 C  CG1 . VAL B 1 285 ? -2.735  -0.544  47.152  1.00 27.56  ? 285 VAL B CG1 1 
ATOM   4655 C  CG2 . VAL B 1 285 ? -4.418  0.727   45.828  1.00 32.94  ? 285 VAL B CG2 1 
ATOM   4656 N  N   . TYR B 1 286 ? -1.613  2.441   47.217  1.00 33.96  ? 286 TYR B N   1 
ATOM   4657 C  CA  . TYR B 1 286 ? -0.870  3.021   48.303  1.00 40.09  ? 286 TYR B CA  1 
ATOM   4658 C  C   . TYR B 1 286 ? -1.384  2.442   49.603  1.00 43.70  ? 286 TYR B C   1 
ATOM   4659 O  O   . TYR B 1 286 ? -2.544  2.102   49.693  1.00 48.32  ? 286 TYR B O   1 
ATOM   4660 C  CB  . TYR B 1 286 ? -0.990  4.542   48.230  1.00 40.35  ? 286 TYR B CB  1 
ATOM   4661 C  CG  . TYR B 1 286 ? -0.082  5.140   47.181  1.00 28.46  ? 286 TYR B CG  1 
ATOM   4662 C  CD1 . TYR B 1 286 ? -0.491  5.283   45.868  1.00 28.10  ? 286 TYR B CD1 1 
ATOM   4663 C  CD2 . TYR B 1 286 ? 1.195   5.526   47.505  1.00 28.59  ? 286 TYR B CD2 1 
ATOM   4664 C  CE1 . TYR B 1 286 ? 0.349   5.807   44.913  1.00 23.95  ? 286 TYR B CE1 1 
ATOM   4665 C  CE2 . TYR B 1 286 ? 2.041   6.050   46.556  1.00 31.96  ? 286 TYR B CE2 1 
ATOM   4666 C  CZ  . TYR B 1 286 ? 1.618   6.192   45.266  1.00 30.47  ? 286 TYR B CZ  1 
ATOM   4667 O  OH  . TYR B 1 286 ? 2.499   6.716   44.358  1.00 25.30  ? 286 TYR B OH  1 
ATOM   4668 N  N   . ASP B 1 287 ? -0.502  2.291   50.585  1.00 37.39  ? 287 ASP B N   1 
ATOM   4669 C  CA  . ASP B 1 287 ? -0.808  1.551   51.801  1.00 31.12  ? 287 ASP B CA  1 
ATOM   4670 C  C   . ASP B 1 287 ? -2.005  2.467   51.955  1.00 35.53  ? 287 ASP B C   1 
ATOM   4671 O  O   . ASP B 1 287 ? -1.868  3.656   52.164  1.00 36.73  ? 287 ASP B O   1 
ATOM   4672 C  CB  . ASP B 1 287 ? 0.418   1.467   52.721  1.00 27.21  ? 287 ASP B CB  1 
ATOM   4673 C  CG  . ASP B 1 287 ? 0.523   2.615   53.681  1.00 28.00  ? 287 ASP B CG  1 
ATOM   4674 O  OD1 . ASP B 1 287 ? 0.809   3.742   53.250  1.00 34.00  ? 287 ASP B OD1 1 
ATOM   4675 O  OD2 . ASP B 1 287 ? 0.354   2.386   54.881  1.00 24.87  ? 287 ASP B OD2 1 
ATOM   4676 N  N   . ILE B 1 288 ? -3.187  1.877   51.882  1.00 37.76  ? 288 ILE B N   1 
ATOM   4677 C  CA  . ILE B 1 288 ? -4.458  2.318   52.416  1.00 39.87  ? 288 ILE B CA  1 
ATOM   4678 C  C   . ILE B 1 288 ? -5.478  2.537   51.294  1.00 33.10  ? 288 ILE B C   1 
ATOM   4679 O  O   . ILE B 1 288 ? -6.502  3.192   51.474  1.00 40.41  ? 288 ILE B O   1 
ATOM   4680 C  CB  . ILE B 1 288 ? -4.280  3.597   53.214  1.00 42.63  ? 288 ILE B CB  1 
ATOM   4681 C  CG1 . ILE B 1 288 ? -3.910  3.250   54.640  1.00 47.67  ? 288 ILE B CG1 1 
ATOM   4682 C  CG2 . ILE B 1 288 ? -5.554  4.406   53.183  1.00 40.61  ? 288 ILE B CG2 1 
ATOM   4683 C  CD1 . ILE B 1 288 ? -4.324  4.299   55.636  1.00 45.57  ? 288 ILE B CD1 1 
HETATM 4684 CU CU  . CU  C 2 .   ? 22.582  13.223  16.313  0.60 22.77  ? 401 CU  A CU  1 
HETATM 4685 S  S   . SDS D 3 .   ? 34.515  22.152  18.047  1.00 179.95 ? 402 SDS A S   1 
HETATM 4686 O  O1S . SDS D 3 .   ? 35.718  21.822  18.754  1.00 109.50 ? 402 SDS A O1S 1 
HETATM 4687 O  O2S . SDS D 3 .   ? 34.858  22.550  16.609  1.00 107.42 ? 402 SDS A O2S 1 
HETATM 4688 O  O3S . SDS D 3 .   ? 33.506  20.883  18.005  1.00 144.79 ? 402 SDS A O3S 1 
HETATM 4689 O  O4  . SDS D 3 .   ? 33.854  23.227  18.724  1.00 121.23 ? 402 SDS A O4  1 
HETATM 4690 C  C1  . SDS D 3 .   ? 34.203  23.643  15.978  1.00 64.18  ? 402 SDS A C1  1 
HETATM 4691 C  C2  . SDS D 3 .   ? 44.278  24.198  19.976  1.00 51.74  ? 402 SDS A C2  1 
HETATM 4692 C  C3  . SDS D 3 .   ? 43.379  24.627  18.844  1.00 68.68  ? 402 SDS A C3  1 
HETATM 4693 C  C4  . SDS D 3 .   ? 41.920  24.340  19.151  1.00 68.23  ? 402 SDS A C4  1 
HETATM 4694 C  C5  . SDS D 3 .   ? 41.251  23.673  17.967  1.00 72.94  ? 402 SDS A C5  1 
HETATM 4695 C  C6  . SDS D 3 .   ? 39.854  24.217  17.711  1.00 34.45  ? 402 SDS A C6  1 
HETATM 4696 C  C7  . SDS D 3 .   ? 39.236  24.926  18.900  1.00 34.75  ? 402 SDS A C7  1 
HETATM 4697 C  C8  . SDS D 3 .   ? 37.881  25.403  18.436  1.00 28.86  ? 402 SDS A C8  1 
HETATM 4698 C  C9  . SDS D 3 .   ? 37.906  25.366  16.927  1.00 29.32  ? 402 SDS A C9  1 
HETATM 4699 C  C10 . SDS D 3 .   ? 36.916  24.366  16.376  1.00 27.43  ? 402 SDS A C10 1 
HETATM 4700 C  C11 . SDS D 3 .   ? 36.115  25.047  15.291  1.00 40.43  ? 402 SDS A C11 1 
HETATM 4701 C  C12 . SDS D 3 .   ? 35.029  24.117  14.797  1.00 38.40  ? 402 SDS A C12 1 
HETATM 4702 CU CU  . CU  E 2 .   ? 9.818   18.114  39.545  0.60 30.11  ? 401 CU  B CU  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   ASN 3   3   ?   ?   ?   A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   TYR 5   5   5   TYR TYR A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  HIS 13  13  13  HIS HIS A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  THR 15  15  15  THR THR A . n 
A 1 16  ASP 16  16  16  ASP ASP A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  PHE 22  22  22  PHE PHE A . n 
A 1 23  VAL 23  23  23  VAL VAL A . n 
A 1 24  ARG 24  24  24  ARG ARG A . n 
A 1 25  THR 25  25  25  THR THR A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  ILE 28  28  28  ILE ILE A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  ILE 34  34  34  ILE ILE A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  TYR 38  38  38  TYR TYR A . n 
A 1 39  ILE 39  39  39  ILE ILE A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  TRP 41  41  41  TRP TRP A . n 
A 1 42  HIS 42  42  42  HIS HIS A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  LYS 47  47  47  LYS LYS A . n 
A 1 48  PHE 48  48  48  PHE PHE A . n 
A 1 49  HIS 49  49  49  HIS HIS A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  GLY 53  53  53  GLY GLY A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  HIS 60  60  60  HIS HIS A . n 
A 1 61  MET 61  61  61  MET MET A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  PRO 67  67  67  PRO PRO A . n 
A 1 68  TRP 68  68  68  TRP TRP A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  ARG 75  75  75  ARG ARG A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  ASP 79  79  79  ASP ASP A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  GLN 81  81  81  GLN GLN A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  PRO 85  85  85  PRO PRO A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  THR 88  88  88  THR THR A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  TYR 91  91  91  TYR TYR A . n 
A 1 92  TRP 92  92  92  TRP TRP A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  TRP 94  94  94  TRP TRP A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 MET 100 100 100 MET MET A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 PRO 103 103 103 PRO PRO A . n 
A 1 104 SER 104 104 104 SER SER A . n 
A 1 105 GLN 105 105 105 GLN GLN A . n 
A 1 106 SER 106 106 106 SER SER A . n 
A 1 107 GLN 107 107 107 GLN GLN A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 TRP 109 109 109 TRP TRP A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 PHE 113 113 113 PHE PHE A . n 
A 1 114 MET 114 114 114 MET MET A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 PRO 120 120 120 PRO PRO A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 LYS 122 122 122 LYS LYS A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 ASP 127 127 127 ASP ASP A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 PHE 131 131 131 PHE PHE A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 ARG 135 135 135 ARG ARG A . n 
A 1 136 TRP 136 136 136 TRP TRP A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 GLN 142 142 142 GLN GLN A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 GLY 147 147 147 GLY GLY A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 ARG 151 151 151 ARG ARG A . n 
A 1 152 ASN 152 152 152 ASN ASN A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 LYS 157 157 157 LYS LYS A . n 
A 1 158 GLU 158 158 158 GLU GLU A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 THR 161 161 161 THR THR A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 THR 164 164 164 THR THR A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 TYR 177 177 177 TYR TYR A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 THR 179 179 179 THR THR A . n 
A 1 180 PRO 180 180 180 PRO PRO A . n 
A 1 181 PRO 181 181 181 PRO PRO A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 MET 184 184 184 MET MET A . n 
A 1 185 THR 185 185 185 THR THR A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 GLN 187 187 187 GLN GLN A . n 
A 1 188 ASN 188 188 188 ASN ASN A . n 
A 1 189 SER 189 189 189 SER SER A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 ASN 192 192 192 ASN ASN A . n 
A 1 193 GLN 193 193 193 GLN GLN A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 GLU 195 195 195 GLU GLU A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 ILE 198 198 198 ILE ILE A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 PRO 201 201 201 PRO PRO A . n 
A 1 202 GLN 202 202 202 GLN GLN A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 HIS 204 204 204 HIS HIS A . n 
A 1 205 ASN 205 205 205 ASN ASN A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 VAL 207 207 207 VAL VAL A . n 
A 1 208 HIS 208 208 208 HIS HIS A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 TRP 210 210 210 TRP TRP A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 GLN 214 214 214 GLN GLN A . n 
A 1 215 MET 215 215 215 MET MET A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 VAL 217 217 217 VAL VAL A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 PRO 219 219 219 PRO PRO A . n 
A 1 220 THR 220 220 220 THR THR A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 PRO 222 222 222 PRO PRO A . n 
A 1 223 ASN 223 223 223 ASN ASN A . n 
A 1 224 ASP 224 224 224 ASP ASP A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 PHE 228 228 228 PHE PHE A . n 
A 1 229 LEU 229 229 229 LEU LEU A . n 
A 1 230 HIS 230 230 230 HIS HIS A . n 
A 1 231 HIS 231 231 231 HIS HIS A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 VAL 234 234 234 VAL VAL A . n 
A 1 235 ASP 235 235 235 ASP ASP A . n 
A 1 236 ARG 236 236 236 ARG ARG A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 TRP 238 238 238 TRP TRP A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 VAL 240 240 240 VAL VAL A . n 
A 1 241 TRP 241 241 241 TRP TRP A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 ILE 243 243 243 ILE ILE A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 HIS 245 245 245 HIS HIS A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ASN 247 247 247 ASN ASN A . n 
A 1 248 GLN 248 248 248 GLN GLN A . n 
A 1 249 ASN 249 249 249 ASN ASN A . n 
A 1 250 TYR 250 250 250 TYR TYR A . n 
A 1 251 GLN 251 251 251 GLN GLN A . n 
A 1 252 PRO 252 252 252 PRO PRO A . n 
A 1 253 MET 253 253 253 MET MET A . n 
A 1 254 LYS 254 254 254 LYS LYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 PRO 257 257 257 PRO PRO A . n 
A 1 258 PHE 258 258 258 PHE PHE A . n 
A 1 259 GLY 259 259 259 GLY GLY A . n 
A 1 260 GLN 260 260 260 GLN GLN A . n 
A 1 261 ASN 261 261 261 ASN ASN A . n 
A 1 262 PHE 262 262 262 PHE PHE A . n 
A 1 263 ARG 263 263 263 ARG ARG A . n 
A 1 264 ASP 264 264 264 ASP ASP A . n 
A 1 265 PRO 265 265 265 PRO PRO A . n 
A 1 266 MET 266 266 266 MET MET A . n 
A 1 267 TYR 267 267 267 TYR TYR A . n 
A 1 268 PRO 268 268 268 PRO PRO A . n 
A 1 269 TRP 269 269 269 TRP TRP A . n 
A 1 270 ASN 270 270 270 ASN ASN A . n 
A 1 271 THR 271 271 271 THR THR A . n 
A 1 272 THR 272 272 272 THR THR A . n 
A 1 273 PRO 273 273 273 PRO PRO A . n 
A 1 274 GLU 274 274 274 GLU GLU A . n 
A 1 275 ASP 275 275 275 ASP ASP A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 MET 277 277 277 MET MET A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 HIS 279 279 279 HIS HIS A . n 
A 1 280 ARG 280 280 280 ARG ARG A . n 
A 1 281 LYS 281 281 281 LYS LYS A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 TYR 284 284 284 TYR TYR A . n 
A 1 285 VAL 285 285 285 VAL VAL A . n 
A 1 286 TYR 286 286 286 TYR TYR A . n 
A 1 287 ASP 287 287 287 ASP ASP A . n 
A 1 288 ILE 288 288 288 ILE ILE A . n 
A 1 289 GLU 289 289 289 GLU GLU A . n 
A 1 290 LEU 290 290 ?   ?   ?   A . n 
A 1 291 ARG 291 291 ?   ?   ?   A . n 
A 1 292 LYS 292 292 ?   ?   ?   A . n 
A 1 293 SER 293 293 ?   ?   ?   A . n 
A 1 294 LYS 294 294 ?   ?   ?   A . n 
A 1 295 ARG 295 295 ?   ?   ?   A . n 
A 1 296 SER 296 296 ?   ?   ?   A . n 
A 1 297 SER 297 297 ?   ?   ?   A . n 
A 1 298 HIS 298 298 ?   ?   ?   A . n 
A 1 299 HIS 299 299 ?   ?   ?   A . n 
A 1 300 HIS 300 300 ?   ?   ?   A . n 
A 1 301 HIS 301 301 ?   ?   ?   A . n 
A 1 302 HIS 302 302 ?   ?   ?   A . n 
A 1 303 HIS 303 303 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   ASN 3   3   ?   ?   ?   B . n 
B 1 4   LYS 4   4   4   LYS LYS B . n 
B 1 5   TYR 5   5   5   TYR TYR B . n 
B 1 6   ARG 6   6   6   ARG ARG B . n 
B 1 7   VAL 7   7   7   VAL VAL B . n 
B 1 8   ARG 8   8   8   ARG ARG B . n 
B 1 9   LYS 9   9   9   LYS LYS B . n 
B 1 10  ASN 10  10  10  ASN ASN B . n 
B 1 11  VAL 11  11  11  VAL VAL B . n 
B 1 12  LEU 12  12  12  LEU LEU B . n 
B 1 13  HIS 13  13  13  HIS HIS B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  THR 15  15  15  THR THR B . n 
B 1 16  ASP 16  16  16  ASP ASP B . n 
B 1 17  THR 17  17  17  THR THR B . n 
B 1 18  GLU 18  18  18  GLU GLU B . n 
B 1 19  LYS 19  19  19  LYS LYS B . n 
B 1 20  ARG 20  20  20  ARG ARG B . n 
B 1 21  ASP 21  21  21  ASP ASP B . n 
B 1 22  PHE 22  22  22  PHE PHE B . n 
B 1 23  VAL 23  23  23  VAL VAL B . n 
B 1 24  ARG 24  24  24  ARG ARG B . n 
B 1 25  THR 25  25  25  THR THR B . n 
B 1 26  VAL 26  26  26  VAL VAL B . n 
B 1 27  LEU 27  27  27  LEU LEU B . n 
B 1 28  ILE 28  28  28  ILE ILE B . n 
B 1 29  LEU 29  29  29  LEU LEU B . n 
B 1 30  LYS 30  30  30  LYS LYS B . n 
B 1 31  GLU 31  31  31  GLU GLU B . n 
B 1 32  LYS 32  32  32  LYS LYS B . n 
B 1 33  GLY 33  33  33  GLY GLY B . n 
B 1 34  ILE 34  34  34  ILE ILE B . n 
B 1 35  TYR 35  35  35  TYR TYR B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  ARG 37  37  37  ARG ARG B . n 
B 1 38  TYR 38  38  38  TYR TYR B . n 
B 1 39  ILE 39  39  39  ILE ILE B . n 
B 1 40  ALA 40  40  40  ALA ALA B . n 
B 1 41  TRP 41  41  41  TRP TRP B . n 
B 1 42  HIS 42  42  42  HIS HIS B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  ALA 44  44  44  ALA ALA B . n 
B 1 45  ALA 45  45  45  ALA ALA B . n 
B 1 46  GLY 46  46  46  GLY GLY B . n 
B 1 47  LYS 47  47  47  LYS LYS B . n 
B 1 48  PHE 48  48  48  PHE PHE B . n 
B 1 49  HIS 49  49  49  HIS HIS B . n 
B 1 50  THR 50  50  50  THR THR B . n 
B 1 51  PRO 51  51  51  PRO PRO B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  GLY 53  53  53  GLY GLY B . n 
B 1 54  SER 54  54  54  SER SER B . n 
B 1 55  ASP 55  55  55  ASP ASP B . n 
B 1 56  ARG 56  56  56  ARG ARG B . n 
B 1 57  ASN 57  57  57  ASN ASN B . n 
B 1 58  ALA 58  58  58  ALA ALA B . n 
B 1 59  ALA 59  59  59  ALA ALA B . n 
B 1 60  HIS 60  60  60  HIS HIS B . n 
B 1 61  MET 61  61  61  MET MET B . n 
B 1 62  SER 62  62  62  SER SER B . n 
B 1 63  SER 63  63  63  SER SER B . n 
B 1 64  ALA 64  64  64  ALA ALA B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  LEU 66  66  66  LEU LEU B . n 
B 1 67  PRO 67  67  67  PRO PRO B . n 
B 1 68  TRP 68  68  68  TRP TRP B . n 
B 1 69  HIS 69  69  69  HIS HIS B . n 
B 1 70  ARG 70  70  70  ARG ARG B . n 
B 1 71  GLU 71  71  71  GLU GLU B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  LEU 73  73  73  LEU LEU B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  ARG 75  75  75  ARG ARG B . n 
B 1 76  PHE 76  76  76  PHE PHE B . n 
B 1 77  GLU 77  77  77  GLU GLU B . n 
B 1 78  ARG 78  78  78  ARG ARG B . n 
B 1 79  ASP 79  79  79  ASP ASP B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  GLN 81  81  81  GLN GLN B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  ILE 83  83  83  ILE ILE B . n 
B 1 84  ASN 84  84  84  ASN ASN B . n 
B 1 85  PRO 85  85  85  PRO PRO B . n 
B 1 86  GLU 86  86  86  GLU GLU B . n 
B 1 87  VAL 87  87  87  VAL VAL B . n 
B 1 88  THR 88  88  88  THR THR B . n 
B 1 89  LEU 89  89  89  LEU LEU B . n 
B 1 90  PRO 90  90  90  PRO PRO B . n 
B 1 91  TYR 91  91  91  TYR TYR B . n 
B 1 92  TRP 92  92  92  TRP TRP B . n 
B 1 93  GLU 93  93  93  GLU GLU B . n 
B 1 94  TRP 94  94  94  TRP TRP B . n 
B 1 95  GLU 95  95  95  GLU GLU B . n 
B 1 96  THR 96  96  96  THR THR B . n 
B 1 97  ASP 97  97  97  ASP ASP B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  GLN 99  99  99  GLN GLN B . n 
B 1 100 MET 100 100 100 MET MET B . n 
B 1 101 GLN 101 101 101 GLN GLN B . n 
B 1 102 ASP 102 102 102 ASP ASP B . n 
B 1 103 PRO 103 103 103 PRO PRO B . n 
B 1 104 SER 104 104 104 SER SER B . n 
B 1 105 GLN 105 105 105 GLN GLN B . n 
B 1 106 SER 106 106 106 SER SER B . n 
B 1 107 GLN 107 107 107 GLN GLN B . n 
B 1 108 ILE 108 108 108 ILE ILE B . n 
B 1 109 TRP 109 109 109 TRP TRP B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 ALA 111 111 111 ALA ALA B . n 
B 1 112 ASP 112 112 112 ASP ASP B . n 
B 1 113 PHE 113 113 113 PHE PHE B . n 
B 1 114 MET 114 114 114 MET MET B . n 
B 1 115 GLY 115 115 115 GLY GLY B . n 
B 1 116 GLY 116 116 116 GLY GLY B . n 
B 1 117 ASN 117 117 117 ASN ASN B . n 
B 1 118 GLY 118 118 118 GLY GLY B . n 
B 1 119 ASN 119 119 119 ASN ASN B . n 
B 1 120 PRO 120 120 120 PRO PRO B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 LYS 122 122 122 LYS LYS B . n 
B 1 123 ASP 123 123 123 ASP ASP B . n 
B 1 124 PHE 124 124 124 PHE PHE B . n 
B 1 125 ILE 125 125 125 ILE ILE B . n 
B 1 126 VAL 126 126 126 VAL VAL B . n 
B 1 127 ASP 127 127 127 ASP ASP B . n 
B 1 128 THR 128 128 128 THR THR B . n 
B 1 129 GLY 129 129 129 GLY GLY B . n 
B 1 130 PRO 130 130 130 PRO PRO B . n 
B 1 131 PHE 131 131 131 PHE PHE B . n 
B 1 132 ALA 132 132 132 ALA ALA B . n 
B 1 133 ALA 133 133 133 ALA ALA B . n 
B 1 134 GLY 134 134 134 GLY GLY B . n 
B 1 135 ARG 135 135 135 ARG ARG B . n 
B 1 136 TRP 136 136 136 TRP TRP B . n 
B 1 137 THR 137 137 137 THR THR B . n 
B 1 138 THR 138 138 138 THR THR B . n 
B 1 139 ILE 139 139 139 ILE ILE B . n 
B 1 140 ASP 140 140 140 ASP ASP B . n 
B 1 141 GLU 141 141 141 GLU GLU B . n 
B 1 142 GLN 142 142 142 GLN GLN B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ASN 144 144 144 ASN ASN B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 SER 146 146 146 SER SER B . n 
B 1 147 GLY 147 147 147 GLY GLY B . n 
B 1 148 GLY 148 148 148 GLY GLY B . n 
B 1 149 LEU 149 149 149 LEU LEU B . n 
B 1 150 LYS 150 150 150 LYS LYS B . n 
B 1 151 ARG 151 151 151 ARG ARG B . n 
B 1 152 ASN 152 152 152 ASN ASN B . n 
B 1 153 PHE 153 153 153 PHE PHE B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 ALA 155 155 155 ALA ALA B . n 
B 1 156 THR 156 156 156 THR THR B . n 
B 1 157 LYS 157 157 157 LYS LYS B . n 
B 1 158 GLU 158 158 158 GLU GLU B . n 
B 1 159 ALA 159 159 159 ALA ALA B . n 
B 1 160 PRO 160 160 160 PRO PRO B . n 
B 1 161 THR 161 161 161 THR THR B . n 
B 1 162 LEU 162 162 162 LEU LEU B . n 
B 1 163 PRO 163 163 163 PRO PRO B . n 
B 1 164 THR 164 164 164 THR THR B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 ASP 166 166 166 ASP ASP B . n 
B 1 167 ASP 167 167 167 ASP ASP B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 LEU 169 169 169 LEU LEU B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 ALA 171 171 171 ALA ALA B . n 
B 1 172 LEU 172 172 172 LEU LEU B . n 
B 1 173 LYS 173 173 173 LYS LYS B . n 
B 1 174 ILE 174 174 174 ILE ILE B . n 
B 1 175 THR 175 175 175 THR THR B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 TYR 177 177 177 TYR TYR B . n 
B 1 178 ASP 178 178 178 ASP ASP B . n 
B 1 179 THR 179 179 179 THR THR B . n 
B 1 180 PRO 180 180 180 PRO PRO B . n 
B 1 181 PRO 181 181 181 PRO PRO B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 ASP 183 183 183 ASP ASP B . n 
B 1 184 MET 184 184 184 MET MET B . n 
B 1 185 THR 185 185 185 THR THR B . n 
B 1 186 SER 186 186 186 SER SER B . n 
B 1 187 GLN 187 187 187 GLN GLN B . n 
B 1 188 ASN 188 188 188 ASN ASN B . n 
B 1 189 SER 189 189 189 SER SER B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 ARG 191 191 191 ARG ARG B . n 
B 1 192 ASN 192 192 192 ASN ASN B . n 
B 1 193 GLN 193 193 193 GLN GLN B . n 
B 1 194 LEU 194 194 194 LEU LEU B . n 
B 1 195 GLU 195 195 195 GLU GLU B . n 
B 1 196 GLY 196 196 196 GLY GLY B . n 
B 1 197 PHE 197 197 197 PHE PHE B . n 
B 1 198 ILE 198 198 198 ILE ILE B . n 
B 1 199 ASN 199 199 199 ASN ASN B . n 
B 1 200 GLY 200 200 200 GLY GLY B . n 
B 1 201 PRO 201 201 201 PRO PRO B . n 
B 1 202 GLN 202 202 202 GLN GLN B . n 
B 1 203 LEU 203 203 203 LEU LEU B . n 
B 1 204 HIS 204 204 204 HIS HIS B . n 
B 1 205 ASN 205 205 205 ASN ASN B . n 
B 1 206 ARG 206 206 206 ARG ARG B . n 
B 1 207 VAL 207 207 207 VAL VAL B . n 
B 1 208 HIS 208 208 208 HIS HIS B . n 
B 1 209 ARG 209 209 209 ARG ARG B . n 
B 1 210 TRP 210 210 210 TRP TRP B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 GLY 212 212 212 GLY GLY B . n 
B 1 213 GLY 213 213 213 GLY GLY B . n 
B 1 214 GLN 214 214 214 GLN GLN B . n 
B 1 215 MET 215 215 215 MET MET B . n 
B 1 216 GLY 216 216 216 GLY GLY B . n 
B 1 217 VAL 217 217 217 VAL VAL B . n 
B 1 218 VAL 218 218 218 VAL VAL B . n 
B 1 219 PRO 219 219 219 PRO PRO B . n 
B 1 220 THR 220 220 220 THR THR B . n 
B 1 221 ALA 221 221 221 ALA ALA B . n 
B 1 222 PRO 222 222 222 PRO PRO B . n 
B 1 223 ASN 223 223 223 ASN ASN B . n 
B 1 224 ASP 224 224 224 ASP ASP B . n 
B 1 225 PRO 225 225 225 PRO PRO B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 PHE 227 227 227 PHE PHE B . n 
B 1 228 PHE 228 228 228 PHE PHE B . n 
B 1 229 LEU 229 229 229 LEU LEU B . n 
B 1 230 HIS 230 230 230 HIS HIS B . n 
B 1 231 HIS 231 231 231 HIS HIS B . n 
B 1 232 ALA 232 232 232 ALA ALA B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 VAL 234 234 234 VAL VAL B . n 
B 1 235 ASP 235 235 235 ASP ASP B . n 
B 1 236 ARG 236 236 236 ARG ARG B . n 
B 1 237 ILE 237 237 237 ILE ILE B . n 
B 1 238 TRP 238 238 238 TRP TRP B . n 
B 1 239 ALA 239 239 239 ALA ALA B . n 
B 1 240 VAL 240 240 240 VAL VAL B . n 
B 1 241 TRP 241 241 241 TRP TRP B . n 
B 1 242 GLN 242 242 242 GLN GLN B . n 
B 1 243 ILE 243 243 243 ILE ILE B . n 
B 1 244 ILE 244 244 244 ILE ILE B . n 
B 1 245 HIS 245 245 245 HIS HIS B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ASN 247 247 247 ASN ASN B . n 
B 1 248 GLN 248 248 248 GLN GLN B . n 
B 1 249 ASN 249 249 249 ASN ASN B . n 
B 1 250 TYR 250 250 250 TYR TYR B . n 
B 1 251 GLN 251 251 251 GLN GLN B . n 
B 1 252 PRO 252 252 252 PRO PRO B . n 
B 1 253 MET 253 253 253 MET MET B . n 
B 1 254 LYS 254 254 254 LYS LYS B . n 
B 1 255 ASN 255 255 255 ASN ASN B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 PRO 257 257 257 PRO PRO B . n 
B 1 258 PHE 258 258 258 PHE PHE B . n 
B 1 259 GLY 259 259 259 GLY GLY B . n 
B 1 260 GLN 260 260 260 GLN GLN B . n 
B 1 261 ASN 261 261 261 ASN ASN B . n 
B 1 262 PHE 262 262 262 PHE PHE B . n 
B 1 263 ARG 263 263 263 ARG ARG B . n 
B 1 264 ASP 264 264 264 ASP ASP B . n 
B 1 265 PRO 265 265 265 PRO PRO B . n 
B 1 266 MET 266 266 266 MET MET B . n 
B 1 267 TYR 267 267 267 TYR TYR B . n 
B 1 268 PRO 268 268 268 PRO PRO B . n 
B 1 269 TRP 269 269 269 TRP TRP B . n 
B 1 270 ASN 270 270 270 ASN ASN B . n 
B 1 271 THR 271 271 271 THR THR B . n 
B 1 272 THR 272 272 272 THR THR B . n 
B 1 273 PRO 273 273 273 PRO PRO B . n 
B 1 274 GLU 274 274 274 GLU GLU B . n 
B 1 275 ASP 275 275 275 ASP ASP B . n 
B 1 276 VAL 276 276 276 VAL VAL B . n 
B 1 277 MET 277 277 277 MET MET B . n 
B 1 278 ASN 278 278 278 ASN ASN B . n 
B 1 279 HIS 279 279 279 HIS HIS B . n 
B 1 280 ARG 280 280 280 ARG ARG B . n 
B 1 281 LYS 281 281 281 LYS LYS B . n 
B 1 282 LEU 282 282 282 LEU LEU B . n 
B 1 283 GLY 283 283 283 GLY GLY B . n 
B 1 284 TYR 284 284 284 TYR TYR B . n 
B 1 285 VAL 285 285 285 VAL VAL B . n 
B 1 286 TYR 286 286 286 TYR TYR B . n 
B 1 287 ASP 287 287 287 ASP ASP B . n 
B 1 288 ILE 288 288 288 ILE ILE B . n 
B 1 289 GLU 289 289 ?   ?   ?   B . n 
B 1 290 LEU 290 290 ?   ?   ?   B . n 
B 1 291 ARG 291 291 ?   ?   ?   B . n 
B 1 292 LYS 292 292 ?   ?   ?   B . n 
B 1 293 SER 293 293 ?   ?   ?   B . n 
B 1 294 LYS 294 294 ?   ?   ?   B . n 
B 1 295 ARG 295 295 ?   ?   ?   B . n 
B 1 296 SER 296 296 ?   ?   ?   B . n 
B 1 297 SER 297 297 ?   ?   ?   B . n 
B 1 298 HIS 298 298 ?   ?   ?   B . n 
B 1 299 HIS 299 299 ?   ?   ?   B . n 
B 1 300 HIS 300 300 ?   ?   ?   B . n 
B 1 301 HIS 301 301 ?   ?   ?   B . n 
B 1 302 HIS 302 302 ?   ?   ?   B . n 
B 1 303 HIS 303 303 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CU  1 401 2    CU  CU  A . 
D 3 SDS 1 402 6806 SDS SDS A . 
E 2 CU  1 401 1    CU  CU  B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    dimeric   2 
2 software_defined_assembly PISA monomeric 1 
3 software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E 
2 1 A,C,D     
3 1 B,E       
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   NE2 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   B 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   HIS 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    60 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    B 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    HIS 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     60 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   CU 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   E 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   CU 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    B 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    CU 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     401 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   NE2 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   B 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   HIS 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    42 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    B 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    HIS 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     42 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 83.5 
_pdbx_struct_conn_angle.value_esd             ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-06-20 
2 'Structure model' 1 1 2013-02-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.5.0109 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 CG2 A THR 138 ? ? O   A GLY 148 ? ? 1.17 
2  1 O   A THR 17  ? ? OD2 A ASP 21  ? ? 1.35 
3  1 NE2 A HIS 60  ? ? CU  A CU  401 ? ? 1.49 
4  1 OD1 A ASN 57  ? ? O   A HIS 60  ? ? 1.50 
5  1 NE2 A HIS 42  ? ? CU  A CU  401 ? ? 1.59 
6  1 OG  B SER 63  ? ? OD2 B ASP 178 ? ? 1.61 
7  1 OG  B SER 62  ? ? OE1 B GLN 260 ? ? 1.63 
8  1 NH1 B ARG 8   ? ? CE2 B TYR 284 ? ? 1.63 
9  1 CG  B LYS 4   ? ? CD  B ARG 280 ? ? 1.68 
10 1 OH  B TYR 38  ? ? O   B ARG 75  ? ? 1.70 
11 1 OH  B TYR 91  ? ? OD1 B ASP 287 ? ? 1.72 
12 1 CG2 B THR 138 ? ? OD1 B ASN 223 ? ? 1.74 
13 1 CA  B LYS 254 ? ? ND2 B ASN 261 ? ? 1.74 
14 1 O   B VAL 217 ? ? CD  B PRO 219 ? ? 1.75 
15 1 CG  B LYS 4   ? ? CG  B ARG 280 ? ? 1.77 
16 1 NH2 B ARG 70  ? ? OE1 B GLN 242 ? ? 1.80 
17 1 NH1 A ARG 8   ? ? OE1 A GLU 77  ? ? 1.81 
18 1 OE1 B GLU 71  ? ? CG2 B THR 271 ? ? 1.82 
19 1 CG2 B THR 15  ? ? OE1 B GLU 18  ? ? 1.84 
20 1 OE2 B GLU 71  ? ? NH2 B ARG 75  ? ? 1.86 
21 1 NH2 B ARG 8   ? ? OH  B TYR 286 ? ? 1.87 
22 1 O   B TYR 38  ? ? OH  B TYR 72  ? ? 1.88 
23 1 NH1 B ARG 8   ? ? CD2 B TYR 284 ? ? 1.90 
24 1 O   A ASP 16  ? ? N   A GLU 18  ? ? 1.91 
25 1 CG2 A THR 15  ? ? OE1 A GLU 18  ? ? 1.93 
26 1 NH1 B ARG 70  ? ? O   B VAL 276 ? ? 1.93 
27 1 O   B THR 138 ? ? OG  B SER 146 ? ? 1.94 
28 1 NH1 A ARG 8   ? ? CD  A GLU 77  ? ? 1.94 
29 1 O   B VAL 218 ? ? N   B ALA 221 ? ? 1.94 
30 1 NE2 A GLN 142 ? ? CE  B LYS 47  ? ? 1.97 
31 1 OD1 A ASP 102 ? ? OG  A SER 104 ? ? 1.98 
32 1 OG  B SER 62  ? ? CD  B GLN 260 ? ? 1.99 
33 1 O   B SER 63  ? ? OH  B TYR 250 ? ? 2.03 
34 1 O   A TYR 38  ? ? OH  A TYR 72  ? ? 2.03 
35 1 O   B GLU 71  ? ? CG  B ARG 75  ? ? 2.04 
36 1 CG2 A THR 138 ? ? C   A GLY 148 ? ? 2.05 
37 1 CG  A ARG 8   ? ? O   A LEU 89  ? ? 2.05 
38 1 CG2 A VAL 217 ? ? OG1 A THR 220 ? ? 2.05 
39 1 OG  B SER 54  ? ? N   B ARG 56  ? ? 2.06 
40 1 CD2 B PHE 153 ? ? CH2 B TRP 210 ? ? 2.06 
41 1 O   A ARG 280 ? ? N   A GLY 283 ? ? 2.08 
42 1 NE2 B GLN 81  ? ? O   B PRO 85  ? ? 2.10 
43 1 NH1 A ARG 8   ? ? OE2 A GLU 77  ? ? 2.11 
44 1 NE2 A GLN 142 ? ? NZ  B LYS 47  ? ? 2.12 
45 1 O   A ASP 16  ? ? N   A LYS 19  ? ? 2.13 
46 1 NE2 A HIS 42  ? ? NE2 A HIS 69  ? ? 2.13 
47 1 O   A SER 54  ? ? N   A ARG 56  ? ? 2.13 
48 1 CB  A GLU 158 ? ? NH2 A ARG 209 ? ? 2.14 
49 1 O   A TYR 286 ? ? N   A ILE 288 ? ? 2.14 
50 1 CZ  B ARG 8   ? ? CE2 B TYR 284 ? ? 2.15 
51 1 CD1 B LEU 66  ? ? OH  B TYR 177 ? ? 2.15 
52 1 NH1 A ARG 70  ? ? O   A VAL 276 ? ? 2.16 
53 1 CB  A THR 138 ? ? O   A GLY 148 ? ? 2.16 
54 1 O   B GLU 77  ? ? N   B LEU 80  ? ? 2.18 
55 1 OE1 A GLN 81  ? ? O   A VAL 87  ? ? 2.18 
56 1 O   A GLY 256 ? ? OD1 A ASN 261 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A ILE 139 ? ? CA A ILE 139 ? ? C  A ILE 139 ? ? 94.95  111.60 -16.65 2.00 N 
2  1 CB B PHE 22  ? ? CA B PHE 22  ? ? C  B PHE 22  ? ? 94.84  110.40 -15.56 2.00 N 
3  1 CB B SER 54  ? ? CA B SER 54  ? ? C  B SER 54  ? ? 90.93  110.10 -19.17 1.90 N 
4  1 CB B ALA 58  ? ? CA B ALA 58  ? ? C  B ALA 58  ? ? 121.32 110.10 11.22  1.50 N 
5  1 N  B ALA 59  ? ? CA B ALA 59  ? ? CB B ALA 59  ? ? 96.76  110.10 -13.34 1.40 N 
6  1 CB B SER 62  ? ? CA B SER 62  ? ? C  B SER 62  ? ? 125.88 110.10 15.78  1.90 N 
7  1 C  B ASN 84  ? ? N  B PRO 85  ? ? CD B PRO 85  ? ? 110.64 128.40 -17.76 2.10 Y 
8  1 CB B SER 110 ? ? CA B SER 110 ? ? C  B SER 110 ? ? 98.61  110.10 -11.49 1.90 N 
9  1 N  B GLY 147 ? ? CA B GLY 147 ? ? C  B GLY 147 ? ? 94.18  113.10 -18.92 2.50 N 
10 1 N  B GLY 148 ? ? CA B GLY 148 ? ? C  B GLY 148 ? ? 130.75 113.10 17.65  2.50 N 
11 1 N  B ASP 183 ? ? CA B ASP 183 ? ? CB B ASP 183 ? ? 98.49  110.60 -12.11 1.80 N 
12 1 CB B VAL 207 ? ? CA B VAL 207 ? ? C  B VAL 207 ? ? 93.81  111.40 -17.59 1.90 N 
13 1 CB B HIS 208 ? ? CA B HIS 208 ? ? C  B HIS 208 ? ? 85.59  110.40 -24.81 2.00 N 
14 1 C  B VAL 218 ? ? N  B PRO 219 ? ? CD B PRO 219 ? ? 110.14 128.40 -18.26 2.10 Y 
15 1 CB B ASP 287 ? ? CA B ASP 287 ? ? C  B ASP 287 ? ? 127.09 110.40 16.69  2.00 N 
16 1 N  B ASP 287 ? ? CA B ASP 287 ? ? C  B ASP 287 ? ? 86.77  111.00 -24.23 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 5   ? ? -124.22 -76.09  
2  1 ARG A 6   ? ? -31.27  143.03  
3  1 THR A 17  ? ? -26.19  -32.28  
4  1 ASP A 55  ? ? -7.14   -45.31  
5  1 MET A 61  ? ? 95.13   -2.60   
6  1 MET A 100 ? ? -39.11  145.06  
7  1 PRO A 103 ? ? -61.42  12.07   
8  1 GLN A 105 ? ? -59.59  -5.28   
9  1 SER A 106 ? ? -45.12  157.81  
10 1 PHE A 113 ? ? -112.96 -88.42  
11 1 LYS A 122 ? ? -96.54  36.84   
12 1 PRO A 130 ? ? -58.10  12.39   
13 1 PHE A 131 ? ? -142.06 12.45   
14 1 ALA A 133 ? ? -20.91  126.17  
15 1 ASP A 140 ? ? -120.77 -161.54 
16 1 PRO A 145 ? ? -37.48  136.33  
17 1 ASN A 152 ? ? -152.73 89.92   
18 1 ALA A 159 ? ? -150.42 63.75   
19 1 PRO A 163 ? ? -44.88  163.08  
20 1 PRO A 180 ? ? -28.00  143.59  
21 1 PRO A 181 ? ? -79.93  21.23   
22 1 LEU A 203 ? ? 44.77   -115.72 
23 1 PRO A 222 ? ? -61.41  7.11    
24 1 ASN A 255 ? ? 55.58   3.40    
25 1 LYS A 281 ? ? -47.86  -16.35  
26 1 ASP A 287 ? ? -52.66  66.96   
27 1 ILE A 288 ? ? -170.06 119.68  
28 1 TYR B 5   ? ? -99.36  -159.09 
29 1 ARG B 6   ? ? 46.79   72.17   
30 1 ASN B 10  ? ? -38.24  137.43  
31 1 THR B 15  ? ? -75.44  -164.21 
32 1 ASP B 21  ? ? -75.42  -72.11  
33 1 ASP B 36  ? ? -36.48  -33.26  
34 1 ALA B 45  ? ? -78.11  41.62   
35 1 PHE B 48  ? ? -100.73 74.77   
36 1 PRO B 51  ? ? -73.50  -166.89 
37 1 SER B 54  ? ? -67.28  -179.24 
38 1 ALA B 58  ? ? -47.12  -11.73  
39 1 ALA B 59  ? ? -120.45 -67.65  
40 1 MET B 61  ? ? 39.33   57.45   
41 1 SER B 62  ? ? -174.24 -167.37 
42 1 ASP B 79  ? ? -55.35  -5.65   
43 1 ASN B 84  ? ? -157.90 77.37   
44 1 PRO B 85  ? ? -27.29  -46.56  
45 1 SER B 104 ? ? -52.88  -8.73   
46 1 GLN B 105 ? ? -109.75 45.67   
47 1 GLN B 107 ? ? -57.60  -7.45   
48 1 ALA B 111 ? ? -108.81 48.07   
49 1 ASP B 112 ? ? -151.07 -2.00   
50 1 PHE B 113 ? ? -116.11 -92.52  
51 1 PRO B 145 ? ? -29.44  144.40  
52 1 SER B 146 ? ? -120.31 -53.16  
53 1 LEU B 149 ? ? -46.93  158.81  
54 1 ASN B 152 ? ? -169.43 92.51   
55 1 ALA B 159 ? ? -161.46 76.62   
56 1 PRO B 180 ? ? -38.67  151.13  
57 1 TRP B 182 ? ? 89.14   13.06   
58 1 ASP B 183 ? ? -123.35 -153.65 
59 1 ASN B 188 ? ? 38.25   49.60   
60 1 LEU B 203 ? ? 46.56   -123.87 
61 1 HIS B 208 ? ? -74.96  41.26   
62 1 ARG B 209 ? ? -141.23 -29.71  
63 1 GLN B 214 ? ? -64.05  12.45   
64 1 VAL B 218 ? ? 60.35   -101.39 
65 1 PRO B 219 ? ? -13.34  -50.57  
66 1 ALA B 221 ? ? -27.77  -39.41  
67 1 HIS B 245 ? ? -96.46  57.19   
68 1 ASN B 255 ? ? 100.36  -3.69   
69 1 PRO B 257 ? ? -34.80  144.98  
70 1 ASN B 261 ? ? -67.66  -174.83 
71 1 PRO B 265 ? ? -43.20  157.80  
72 1 TYR B 267 ? ? -38.69  138.11  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A ASN 3   ? A ASN 3   
4  1 Y 1 A LEU 290 ? A LEU 290 
5  1 Y 1 A ARG 291 ? A ARG 291 
6  1 Y 1 A LYS 292 ? A LYS 292 
7  1 Y 1 A SER 293 ? A SER 293 
8  1 Y 1 A LYS 294 ? A LYS 294 
9  1 Y 1 A ARG 295 ? A ARG 295 
10 1 Y 1 A SER 296 ? A SER 296 
11 1 Y 1 A SER 297 ? A SER 297 
12 1 Y 1 A HIS 298 ? A HIS 298 
13 1 Y 1 A HIS 299 ? A HIS 299 
14 1 Y 1 A HIS 300 ? A HIS 300 
15 1 Y 1 A HIS 301 ? A HIS 301 
16 1 Y 1 A HIS 302 ? A HIS 302 
17 1 Y 1 A HIS 303 ? A HIS 303 
18 1 Y 1 B MET 1   ? B MET 1   
19 1 Y 1 B SER 2   ? B SER 2   
20 1 Y 1 B ASN 3   ? B ASN 3   
21 1 Y 1 B GLU 289 ? B GLU 289 
22 1 Y 1 B LEU 290 ? B LEU 290 
23 1 Y 1 B ARG 291 ? B ARG 291 
24 1 Y 1 B LYS 292 ? B LYS 292 
25 1 Y 1 B SER 293 ? B SER 293 
26 1 Y 1 B LYS 294 ? B LYS 294 
27 1 Y 1 B ARG 295 ? B ARG 295 
28 1 Y 1 B SER 296 ? B SER 296 
29 1 Y 1 B SER 297 ? B SER 297 
30 1 Y 1 B HIS 298 ? B HIS 298 
31 1 Y 1 B HIS 299 ? B HIS 299 
32 1 Y 1 B HIS 300 ? B HIS 300 
33 1 Y 1 B HIS 301 ? B HIS 301 
34 1 Y 1 B HIS 302 ? B HIS 302 
35 1 Y 1 B HIS 303 ? B HIS 303 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'COPPER (II) ION' CU  
3 'DODECYL SULFATE' SDS 
#