data_4DAJ
# 
_entry.id   4DAJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4DAJ         
RCSB  RCSB070087   
WWPDB D_1000070087 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4DAJ 
_pdbx_database_status.recvd_initial_deposition_date   2012-01-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kruse, A.C.'     1  
'Hu, J.'          2  
'Pan, A.C.'       3  
'Arlow, D.H.'     4  
'Rosenbaum, D.M.' 5  
'Rosemond, E.'    6  
'Green, H.F.'     7  
'Liu, T.'         8  
'Chae, P.S.'      9  
'Dror, R.O.'      10 
'Shaw, D.E.'      11 
'Weis, W.I.'      12 
'Wess, J.'        13 
'Kobilka, B.'     14 
# 
_citation.id                        primary 
_citation.title                     'Structure and dynamics of the M3 muscarinic acetylcholine receptor.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            482 
_citation.page_first                552 
_citation.page_last                 556 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22358844 
_citation.pdbx_database_id_DOI      10.1038/nature10867 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kruse, A.C.'     1  
primary 'Hu, J.'          2  
primary 'Pan, A.C.'       3  
primary 'Arlow, D.H.'     4  
primary 'Rosenbaum, D.M.' 5  
primary 'Rosemond, E.'    6  
primary 'Green, H.F.'     7  
primary 'Liu, T.'         8  
primary 'Chae, P.S.'      9  
primary 'Dror, R.O.'      10 
primary 'Shaw, D.E.'      11 
primary 'Weis, W.I.'      12 
primary 'Wess, J.'        13 
primary 'Kobilka, B.K.'   14 
# 
_cell.entry_id           4DAJ 
_cell.length_a           54.770 
_cell.length_b           61.310 
_cell.length_c           176.910 
_cell.angle_alpha        85.87 
_cell.angle_beta         89.90 
_cell.angle_gamma        84.90 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4DAJ 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Muscarinic acetylcholine receptor M3, Lysozyme' 54990.297 4  3.2.1.17 'C1054T, C1097A' 
'P08483 residues 57-259, 482-589, P00720 residues 1-161' 'Chimeric Protein' 
2 non-polymer syn 
'(1R,2R,4S,5S,7S)-7-{[hydroxy(dithiophen-2-yl)acetyl]oxy}-9,9-dimethyl-3-oxa-9-azoniatricyclo[3.3.1.0~2,4~]nonane' 392.512   4  ? 
?                ?                                                        ?                  
3 non-polymer syn 'PHOSPHATE ION' 94.971    10 ?        ?                ?                                                        
?                  
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Endolysin, Lysis protein, Muramidase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GDPLGGHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWAL
GNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTV
PPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKS
PSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTN
SLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFC
DSCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKTLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQALHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GDPLGGHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWAL
GNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTV
PPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKS
PSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTN
SLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFC
DSCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKTLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQALHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASP n 
1 3   PRO n 
1 4   LEU n 
1 5   GLY n 
1 6   GLY n 
1 7   HIS n 
1 8   THR n 
1 9   ILE n 
1 10  TRP n 
1 11  GLN n 
1 12  VAL n 
1 13  VAL n 
1 14  PHE n 
1 15  ILE n 
1 16  ALA n 
1 17  PHE n 
1 18  LEU n 
1 19  THR n 
1 20  GLY n 
1 21  PHE n 
1 22  LEU n 
1 23  ALA n 
1 24  LEU n 
1 25  VAL n 
1 26  THR n 
1 27  ILE n 
1 28  ILE n 
1 29  GLY n 
1 30  ASN n 
1 31  ILE n 
1 32  LEU n 
1 33  VAL n 
1 34  ILE n 
1 35  VAL n 
1 36  ALA n 
1 37  PHE n 
1 38  LYS n 
1 39  VAL n 
1 40  ASN n 
1 41  LYS n 
1 42  GLN n 
1 43  LEU n 
1 44  LYS n 
1 45  THR n 
1 46  VAL n 
1 47  ASN n 
1 48  ASN n 
1 49  TYR n 
1 50  PHE n 
1 51  LEU n 
1 52  LEU n 
1 53  SER n 
1 54  LEU n 
1 55  ALA n 
1 56  CYS n 
1 57  ALA n 
1 58  ASP n 
1 59  LEU n 
1 60  ILE n 
1 61  ILE n 
1 62  GLY n 
1 63  VAL n 
1 64  ILE n 
1 65  SER n 
1 66  MET n 
1 67  ASN n 
1 68  LEU n 
1 69  PHE n 
1 70  THR n 
1 71  THR n 
1 72  TYR n 
1 73  ILE n 
1 74  ILE n 
1 75  MET n 
1 76  ASN n 
1 77  ARG n 
1 78  TRP n 
1 79  ALA n 
1 80  LEU n 
1 81  GLY n 
1 82  ASN n 
1 83  LEU n 
1 84  ALA n 
1 85  CYS n 
1 86  ASP n 
1 87  LEU n 
1 88  TRP n 
1 89  LEU n 
1 90  SER n 
1 91  ILE n 
1 92  ASP n 
1 93  TYR n 
1 94  VAL n 
1 95  ALA n 
1 96  SER n 
1 97  ASN n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 MET n 
1 102 ASN n 
1 103 LEU n 
1 104 LEU n 
1 105 VAL n 
1 106 ILE n 
1 107 SER n 
1 108 PHE n 
1 109 ASP n 
1 110 ARG n 
1 111 TYR n 
1 112 PHE n 
1 113 SER n 
1 114 ILE n 
1 115 THR n 
1 116 ARG n 
1 117 PRO n 
1 118 LEU n 
1 119 THR n 
1 120 TYR n 
1 121 ARG n 
1 122 ALA n 
1 123 LYS n 
1 124 ARG n 
1 125 THR n 
1 126 THR n 
1 127 LYS n 
1 128 ARG n 
1 129 ALA n 
1 130 GLY n 
1 131 VAL n 
1 132 MET n 
1 133 ILE n 
1 134 GLY n 
1 135 LEU n 
1 136 ALA n 
1 137 TRP n 
1 138 VAL n 
1 139 ILE n 
1 140 SER n 
1 141 PHE n 
1 142 VAL n 
1 143 LEU n 
1 144 TRP n 
1 145 ALA n 
1 146 PRO n 
1 147 ALA n 
1 148 ILE n 
1 149 LEU n 
1 150 PHE n 
1 151 TRP n 
1 152 GLN n 
1 153 TYR n 
1 154 PHE n 
1 155 VAL n 
1 156 GLY n 
1 157 LYS n 
1 158 ARG n 
1 159 THR n 
1 160 VAL n 
1 161 PRO n 
1 162 PRO n 
1 163 GLY n 
1 164 GLU n 
1 165 CYS n 
1 166 PHE n 
1 167 ILE n 
1 168 GLN n 
1 169 PHE n 
1 170 LEU n 
1 171 SER n 
1 172 GLU n 
1 173 PRO n 
1 174 THR n 
1 175 ILE n 
1 176 THR n 
1 177 PHE n 
1 178 GLY n 
1 179 THR n 
1 180 ALA n 
1 181 ILE n 
1 182 ALA n 
1 183 ALA n 
1 184 PHE n 
1 185 TYR n 
1 186 MET n 
1 187 PRO n 
1 188 VAL n 
1 189 THR n 
1 190 ILE n 
1 191 MET n 
1 192 THR n 
1 193 ILE n 
1 194 LEU n 
1 195 TYR n 
1 196 TRP n 
1 197 ARG n 
1 198 ILE n 
1 199 TYR n 
1 200 LYS n 
1 201 GLU n 
1 202 THR n 
1 203 GLU n 
1 204 LYS n 
1 205 MET n 
1 206 ASN n 
1 207 ILE n 
1 208 PHE n 
1 209 GLU n 
1 210 MET n 
1 211 LEU n 
1 212 ARG n 
1 213 ILE n 
1 214 ASP n 
1 215 GLU n 
1 216 GLY n 
1 217 LEU n 
1 218 ARG n 
1 219 LEU n 
1 220 LYS n 
1 221 ILE n 
1 222 TYR n 
1 223 LYS n 
1 224 ASP n 
1 225 THR n 
1 226 GLU n 
1 227 GLY n 
1 228 TYR n 
1 229 TYR n 
1 230 THR n 
1 231 ILE n 
1 232 GLY n 
1 233 ILE n 
1 234 GLY n 
1 235 HIS n 
1 236 LEU n 
1 237 LEU n 
1 238 THR n 
1 239 LYS n 
1 240 SER n 
1 241 PRO n 
1 242 SER n 
1 243 LEU n 
1 244 ASN n 
1 245 ALA n 
1 246 ALA n 
1 247 LYS n 
1 248 SER n 
1 249 GLU n 
1 250 LEU n 
1 251 ASP n 
1 252 LYS n 
1 253 ALA n 
1 254 ILE n 
1 255 GLY n 
1 256 ARG n 
1 257 ASN n 
1 258 THR n 
1 259 ASN n 
1 260 GLY n 
1 261 VAL n 
1 262 ILE n 
1 263 THR n 
1 264 LYS n 
1 265 ASP n 
1 266 GLU n 
1 267 ALA n 
1 268 GLU n 
1 269 LYS n 
1 270 LEU n 
1 271 PHE n 
1 272 ASN n 
1 273 GLN n 
1 274 ASP n 
1 275 VAL n 
1 276 ASP n 
1 277 ALA n 
1 278 ALA n 
1 279 VAL n 
1 280 ARG n 
1 281 GLY n 
1 282 ILE n 
1 283 LEU n 
1 284 ARG n 
1 285 ASN n 
1 286 ALA n 
1 287 LYS n 
1 288 LEU n 
1 289 LYS n 
1 290 PRO n 
1 291 VAL n 
1 292 TYR n 
1 293 ASP n 
1 294 SER n 
1 295 LEU n 
1 296 ASP n 
1 297 ALA n 
1 298 VAL n 
1 299 ARG n 
1 300 ARG n 
1 301 ALA n 
1 302 ALA n 
1 303 LEU n 
1 304 ILE n 
1 305 ASN n 
1 306 MET n 
1 307 VAL n 
1 308 PHE n 
1 309 GLN n 
1 310 MET n 
1 311 GLY n 
1 312 GLU n 
1 313 THR n 
1 314 GLY n 
1 315 VAL n 
1 316 ALA n 
1 317 GLY n 
1 318 PHE n 
1 319 THR n 
1 320 ASN n 
1 321 SER n 
1 322 LEU n 
1 323 ARG n 
1 324 MET n 
1 325 LEU n 
1 326 GLN n 
1 327 GLN n 
1 328 LYS n 
1 329 ARG n 
1 330 TRP n 
1 331 ASP n 
1 332 GLU n 
1 333 ALA n 
1 334 ALA n 
1 335 VAL n 
1 336 ASN n 
1 337 LEU n 
1 338 ALA n 
1 339 LYS n 
1 340 SER n 
1 341 ARG n 
1 342 TRP n 
1 343 TYR n 
1 344 ASN n 
1 345 GLN n 
1 346 THR n 
1 347 PRO n 
1 348 ASN n 
1 349 ARG n 
1 350 ALA n 
1 351 LYS n 
1 352 ARG n 
1 353 VAL n 
1 354 ILE n 
1 355 THR n 
1 356 THR n 
1 357 PHE n 
1 358 ARG n 
1 359 THR n 
1 360 GLY n 
1 361 THR n 
1 362 TRP n 
1 363 ASP n 
1 364 ALA n 
1 365 TYR n 
1 366 LEU n 
1 367 ILE n 
1 368 LYS n 
1 369 GLU n 
1 370 LYS n 
1 371 LYS n 
1 372 ALA n 
1 373 ALA n 
1 374 GLN n 
1 375 THR n 
1 376 LEU n 
1 377 SER n 
1 378 ALA n 
1 379 ILE n 
1 380 LEU n 
1 381 LEU n 
1 382 ALA n 
1 383 PHE n 
1 384 ILE n 
1 385 ILE n 
1 386 THR n 
1 387 TRP n 
1 388 THR n 
1 389 PRO n 
1 390 TYR n 
1 391 ASN n 
1 392 ILE n 
1 393 MET n 
1 394 VAL n 
1 395 LEU n 
1 396 VAL n 
1 397 ASN n 
1 398 THR n 
1 399 PHE n 
1 400 CYS n 
1 401 ASP n 
1 402 SER n 
1 403 CYS n 
1 404 ILE n 
1 405 PRO n 
1 406 LYS n 
1 407 THR n 
1 408 TYR n 
1 409 TRP n 
1 410 ASN n 
1 411 LEU n 
1 412 GLY n 
1 413 TYR n 
1 414 TRP n 
1 415 LEU n 
1 416 CYS n 
1 417 TYR n 
1 418 ILE n 
1 419 ASN n 
1 420 SER n 
1 421 THR n 
1 422 VAL n 
1 423 ASN n 
1 424 PRO n 
1 425 VAL n 
1 426 CYS n 
1 427 TYR n 
1 428 ALA n 
1 429 LEU n 
1 430 CYS n 
1 431 ASN n 
1 432 LYS n 
1 433 THR n 
1 434 PHE n 
1 435 ARG n 
1 436 THR n 
1 437 THR n 
1 438 PHE n 
1 439 LYS n 
1 440 THR n 
1 441 LEU n 
1 442 LEU n 
1 443 LEU n 
1 444 CYS n 
1 445 GLN n 
1 446 CYS n 
1 447 ASP n 
1 448 LYS n 
1 449 ARG n 
1 450 LYS n 
1 451 ARG n 
1 452 ARG n 
1 453 LYS n 
1 454 GLN n 
1 455 GLN n 
1 456 TYR n 
1 457 GLN n 
1 458 GLN n 
1 459 ARG n 
1 460 GLN n 
1 461 SER n 
1 462 VAL n 
1 463 ILE n 
1 464 PHE n 
1 465 HIS n 
1 466 LYS n 
1 467 ARG n 
1 468 VAL n 
1 469 PRO n 
1 470 GLU n 
1 471 GLN n 
1 472 ALA n 
1 473 LEU n 
1 474 HIS n 
1 475 HIS n 
1 476 HIS n 
1 477 HIS n 
1 478 HIS n 
1 479 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 2   204 'brown rat,rat,rats' ? 'Chrm-3, Chrm3, E' ? ? ? ? ? ? 'Rattus norvegicus'       10116 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? Sf9 ? ? ? ? ? ? ? ? ? ? ? PVL1392 ? ? 
1 3 sample ? 366 473 'brown rat,rat,rats' ? 'Chrm-3, Chrm3, E' ? ? ? ? ? ? 'Rattus norvegicus'       10116 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? Sf9 ? ? ? ? ? ? ? ? ? ? ? PVL1392 ? ? 
1 2 sample ? 205 365 'brown rat,rat,rats' ? 'Chrm-3, Chrm3, E' ? ? ? ? ? ? 'Enterobacteria phage T4' 10665 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? Sf9 ? ? ? ? ? ? ? ? ? ? ? PVL1392 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ACM3_RAT P08483 1 
;DPLGGHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALG
NLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVP
PGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEK
;
57  ? 
2 UNP LYS_BPT4 P00720 1 
;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
Y
;
1   ? 
3 UNP ACM3_RAT P08483 1 
;LIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKTLLLCQ
CDKRKRRKQQYQQRQSVIFHKRVPEQAL
;
482 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4DAJ A 2   ? 204 ? P08483 57  ? 259 ? 57   259  
2  2 4DAJ A 205 ? 365 ? P00720 1   ? 161 ? 1001 1161 
3  3 4DAJ A 366 ? 473 ? P08483 482 ? 589 ? 482  589  
4  1 4DAJ B 2   ? 204 ? P08483 57  ? 259 ? 57   259  
5  2 4DAJ B 205 ? 365 ? P00720 1   ? 161 ? 1001 1161 
6  3 4DAJ B 366 ? 473 ? P08483 482 ? 589 ? 482  589  
7  1 4DAJ C 2   ? 204 ? P08483 57  ? 259 ? 57   259  
8  2 4DAJ C 205 ? 365 ? P00720 1   ? 161 ? 1001 1161 
9  3 4DAJ C 366 ? 473 ? P08483 482 ? 589 ? 482  589  
10 1 4DAJ D 2   ? 204 ? P08483 57  ? 259 ? 57   259  
11 2 4DAJ D 205 ? 365 ? P00720 1   ? 161 ? 1001 1161 
12 3 4DAJ D 366 ? 473 ? P08483 482 ? 589 ? 482  589  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  4DAJ GLY A 1   ? UNP P08483 ?   ?  'EXPRESSION TAG'      56   1  
2  4DAJ THR A 258 ? UNP P00720 CYS 54 'ENGINEERED MUTATION' 1054 2  
2  4DAJ ALA A 301 ? UNP P00720 CYS 97 'ENGINEERED MUTATION' 1097 3  
3  4DAJ HIS A 474 ? UNP P08483 ?   ?  'EXPRESSION TAG'      590  4  
3  4DAJ HIS A 475 ? UNP P08483 ?   ?  'EXPRESSION TAG'      591  5  
3  4DAJ HIS A 476 ? UNP P08483 ?   ?  'EXPRESSION TAG'      592  6  
3  4DAJ HIS A 477 ? UNP P08483 ?   ?  'EXPRESSION TAG'      593  7  
3  4DAJ HIS A 478 ? UNP P08483 ?   ?  'EXPRESSION TAG'      594  8  
3  4DAJ HIS A 479 ? UNP P08483 ?   ?  'EXPRESSION TAG'      595  9  
4  4DAJ GLY B 1   ? UNP P08483 ?   ?  'EXPRESSION TAG'      56   10 
5  4DAJ THR B 258 ? UNP P00720 CYS 54 'ENGINEERED MUTATION' 1054 11 
5  4DAJ ALA B 301 ? UNP P00720 CYS 97 'ENGINEERED MUTATION' 1097 12 
6  4DAJ HIS B 474 ? UNP P08483 ?   ?  'EXPRESSION TAG'      590  13 
6  4DAJ HIS B 475 ? UNP P08483 ?   ?  'EXPRESSION TAG'      591  14 
6  4DAJ HIS B 476 ? UNP P08483 ?   ?  'EXPRESSION TAG'      592  15 
6  4DAJ HIS B 477 ? UNP P08483 ?   ?  'EXPRESSION TAG'      593  16 
6  4DAJ HIS B 478 ? UNP P08483 ?   ?  'EXPRESSION TAG'      594  17 
6  4DAJ HIS B 479 ? UNP P08483 ?   ?  'EXPRESSION TAG'      595  18 
7  4DAJ GLY C 1   ? UNP P08483 ?   ?  'EXPRESSION TAG'      56   19 
8  4DAJ THR C 258 ? UNP P00720 CYS 54 'ENGINEERED MUTATION' 1054 20 
8  4DAJ ALA C 301 ? UNP P00720 CYS 97 'ENGINEERED MUTATION' 1097 21 
9  4DAJ HIS C 474 ? UNP P08483 ?   ?  'EXPRESSION TAG'      590  22 
9  4DAJ HIS C 475 ? UNP P08483 ?   ?  'EXPRESSION TAG'      591  23 
9  4DAJ HIS C 476 ? UNP P08483 ?   ?  'EXPRESSION TAG'      592  24 
9  4DAJ HIS C 477 ? UNP P08483 ?   ?  'EXPRESSION TAG'      593  25 
9  4DAJ HIS C 478 ? UNP P08483 ?   ?  'EXPRESSION TAG'      594  26 
9  4DAJ HIS C 479 ? UNP P08483 ?   ?  'EXPRESSION TAG'      595  27 
10 4DAJ GLY D 1   ? UNP P08483 ?   ?  'EXPRESSION TAG'      56   28 
11 4DAJ THR D 258 ? UNP P00720 CYS 54 'ENGINEERED MUTATION' 1054 29 
11 4DAJ ALA D 301 ? UNP P00720 CYS 97 'ENGINEERED MUTATION' 1097 30 
12 4DAJ HIS D 474 ? UNP P08483 ?   ?  'EXPRESSION TAG'      590  31 
12 4DAJ HIS D 475 ? UNP P08483 ?   ?  'EXPRESSION TAG'      591  32 
12 4DAJ HIS D 476 ? UNP P08483 ?   ?  'EXPRESSION TAG'      592  33 
12 4DAJ HIS D 477 ? UNP P08483 ?   ?  'EXPRESSION TAG'      593  34 
12 4DAJ HIS D 478 ? UNP P08483 ?   ?  'EXPRESSION TAG'      594  35 
12 4DAJ HIS D 479 ? UNP P08483 ?   ?  'EXPRESSION TAG'      595  36 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0HK non-polymer         . 
'(1R,2R,4S,5S,7S)-7-{[hydroxy(dithiophen-2-yl)acetyl]oxy}-9,9-dimethyl-3-oxa-9-azoniatricyclo[3.3.1.0~2,4~]nonane' Tiotropium 
'C19 H22 N O4 S2 1' 392.512 
ALA 'L-peptide linking' y ALANINE ?          'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE ?          'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE ?          'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?          'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE ?          'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE ?          'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?          'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE ?          'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE ?          'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE ?          'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE ?          'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE ?          'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE ?          'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?          'C9 H11 N O2'       165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ?          'O4 P -3'           94.971  
PRO 'L-peptide linking' y PROLINE ?          'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE ?          'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE ?          'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?          'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE ?          'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE ?          'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4DAJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   76 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.68 
_exptl_crystal.density_percent_sol   54.17 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;27-38% PEG 300, 100 mM HEPES pH 7.5, 1% (w/w) 1,2,3-heptanetriol, and 100 mM ammonium phosphate. Protein was reconstituted in cubic phase using a 10:1 monolein:cholesterol mix by weight, Lipidic cubic phase, temperature 293K
;
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 78 ? 1 
2 78 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'MARMOSAIC 300 mm CCD' 2011-08-14 mirrors 
2 CCD 'MARMOSAIC 300 mm CCD' 2011-08-23 mirrors 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'Si(111)' 'SINGLE WAVELENGTH' x-ray 
2 1 ? ?         ?                   x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.033 
_diffrn_radiation_wavelength.wt           1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'APS BEAMLINE 23-ID-D' APS 23-ID-D ? 1.033 
2 SYNCHROTRON 'APS BEAMLINE 23-ID-D' APS 23-ID-D ? 1.033 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4DAJ 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40 
_reflns.d_resolution_high            3.4 
_reflns.number_obs                   28385 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         90.6 
_reflns.pdbx_Rmerge_I_obs            0.226 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.4 
_reflns_shell.d_res_low              3.5 
_reflns_shell.percent_possible_all   85.9 
_reflns_shell.Rmerge_I_obs           0.527 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.7 
_reflns_shell.pdbx_redundancy        2.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4DAJ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     26013 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.980 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.90 
_refine.ls_d_res_high                            3.40 
_refine.ls_percent_reflns_obs                    82.9 
_refine.ls_R_factor_obs                          0.254 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.251 
_refine.ls_R_factor_R_free                       0.303 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.910 
_refine.ls_number_reflns_R_free                  1276 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -2.16980 
_refine.aniso_B[2][2]                            6.59920 
_refine.aniso_B[3][3]                            -4.42940 
_refine.aniso_B[1][2]                            2.01780 
_refine.aniso_B[1][3]                            0.10590 
_refine.aniso_B[2][3]                            -1.32220 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.30 
_refine.solvent_model_param_bsol                 49.36 
_refine.pdbx_solvent_vdw_probe_radii             0.60 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.27 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'M2 muscarinic acetylcholine receptor (3UON)' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.590 
_refine.pdbx_overall_phase_error                 33.300 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13435 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         154 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               13589 
_refine_hist.d_res_high                       3.40 
_refine_hist.d_res_low                        39.90 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.011  ? ? 14794 'X-RAY DIFFRACTION' ? 
f_angle_d          0.862  ? ? 19010 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.722 ? ? 4824  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.058  ? ? 2248  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 2303  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.4000 3.5361  1695 0.3367 52.00 0.4295 . . 93  . . . . 
'X-RAY DIFFRACTION' . 3.5361 3.6970  2116 0.3155 64.00 0.3398 . . 114 . . . . 
'X-RAY DIFFRACTION' . 3.6970 3.8917  2535 0.2962 75.00 0.3635 . . 114 . . . . 
'X-RAY DIFFRACTION' . 3.8917 4.1353  2882 0.2733 87.00 0.3447 . . 139 . . . . 
'X-RAY DIFFRACTION' . 4.1353 4.4542  3039 0.2398 91.00 0.3270 . . 158 . . . . 
'X-RAY DIFFRACTION' . 4.4542 4.9018  3052 0.2128 92.00 0.2753 . . 161 . . . . 
'X-RAY DIFFRACTION' . 4.9018 5.6094  3132 0.2438 94.00 0.2849 . . 155 . . . . 
'X-RAY DIFFRACTION' . 5.6094 7.0608  3102 0.2843 94.00 0.3541 . . 168 . . . . 
'X-RAY DIFFRACTION' . 7.0608 39.9065 3184 0.2179 96.00 0.2358 . . 174 . . . . 
# 
_struct.entry_id                  4DAJ 
_struct.title                     'Structure of the M3 Muscarinic Acetylcholine Receptor' 
_struct.pdbx_descriptor           'Muscarinic acetylcholine receptor M3, Lysozyme (E.C.3.2.1.17)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4DAJ 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN, Hydrolase' 
_struct_keywords.text            
'G protein-coupled receptor, muscarinic receptor, Acetylcholine receptor, SIGNALING PROTEIN, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 2 ? 
K N N 3 ? 
L N N 2 ? 
M N N 3 ? 
N N N 3 ? 
O N N 2 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE A 9   ? ASN A 40  ? ILE A 64   ASN A 95   1 ? 32 
HELX_P HELX_P2  2  LYS A 41  ? LYS A 44  ? LYS A 96   LYS A 99   5 ? 4  
HELX_P HELX_P3  3  THR A 45  ? ILE A 64  ? THR A 100  ILE A 119  1 ? 20 
HELX_P HELX_P4  4  ILE A 64  ? ASN A 76  ? ILE A 119  ASN A 131  1 ? 13 
HELX_P HELX_P5  5  GLY A 81  ? ARG A 116 ? GLY A 136  ARG A 171  1 ? 36 
HELX_P HELX_P6  6  THR A 125 ? GLY A 156 ? THR A 180  GLY A 211  1 ? 32 
HELX_P HELX_P7  7  ILE A 167 ? SER A 171 ? ILE A 222  SER A 226  5 ? 5  
HELX_P HELX_P8  8  GLU A 172 ? PHE A 184 ? GLU A 227  PHE A 239  1 ? 13 
HELX_P HELX_P9  9  PHE A 184 ? THR A 202 ? PHE A 239  THR A 257  1 ? 19 
HELX_P HELX_P10 10 GLU A 203 ? GLY A 216 ? GLU A 258  GLY A 1012 1 ? 14 
HELX_P HELX_P11 11 SER A 242 ? GLY A 255 ? SER A 1038 GLY A 1051 1 ? 14 
HELX_P HELX_P12 12 THR A 263 ? ASN A 285 ? THR A 1059 ASN A 1081 1 ? 23 
HELX_P HELX_P13 13 LYS A 287 ? SER A 294 ? LYS A 1083 SER A 1090 1 ? 8  
HELX_P HELX_P14 14 ASP A 296 ? GLY A 311 ? ASP A 1092 GLY A 1107 1 ? 16 
HELX_P HELX_P15 15 GLY A 311 ? ALA A 316 ? GLY A 1107 ALA A 1112 1 ? 6  
HELX_P HELX_P16 16 PHE A 318 ? GLN A 327 ? PHE A 1114 GLN A 1123 1 ? 10 
HELX_P HELX_P17 17 ARG A 329 ? LYS A 339 ? ARG A 1125 LYS A 1135 1 ? 11 
HELX_P HELX_P18 18 SER A 340 ? THR A 346 ? SER A 1136 THR A 1142 1 ? 7  
HELX_P HELX_P19 19 THR A 346 ? GLY A 360 ? THR A 1142 GLY A 1156 1 ? 15 
HELX_P HELX_P20 20 THR A 361 ? TYR A 365 ? THR A 1157 TYR A 1161 5 ? 5  
HELX_P HELX_P21 21 THR A 375 ? CYS A 400 ? THR A 491  CYS A 516  1 ? 26 
HELX_P HELX_P22 22 PRO A 405 ? ASN A 431 ? PRO A 521  ASN A 547  1 ? 27 
HELX_P HELX_P23 23 ASN A 431 ? THR A 440 ? ASN A 547  THR A 556  1 ? 10 
HELX_P HELX_P24 24 ILE B 9   ? ASN B 40  ? ILE B 64   ASN B 95   1 ? 32 
HELX_P HELX_P25 25 THR B 45  ? ILE B 64  ? THR B 100  ILE B 119  1 ? 20 
HELX_P HELX_P26 26 ILE B 64  ? MET B 75  ? ILE B 119  MET B 130  1 ? 12 
HELX_P HELX_P27 27 ASN B 82  ? ARG B 116 ? ASN B 137  ARG B 171  1 ? 35 
HELX_P HELX_P28 28 THR B 125 ? GLY B 156 ? THR B 180  GLY B 211  1 ? 32 
HELX_P HELX_P29 29 ILE B 167 ? SER B 171 ? ILE B 222  SER B 226  5 ? 5  
HELX_P HELX_P30 30 GLU B 172 ? PHE B 184 ? GLU B 227  PHE B 239  1 ? 13 
HELX_P HELX_P31 31 PHE B 184 ? GLU B 201 ? PHE B 239  GLU B 256  1 ? 18 
HELX_P HELX_P32 32 THR B 202 ? GLY B 216 ? THR B 257  GLY B 1012 1 ? 15 
HELX_P HELX_P33 33 SER B 242 ? GLY B 255 ? SER B 1038 GLY B 1051 1 ? 14 
HELX_P HELX_P34 34 THR B 263 ? ASN B 285 ? THR B 1059 ASN B 1081 1 ? 23 
HELX_P HELX_P35 35 LYS B 287 ? LEU B 295 ? LYS B 1083 LEU B 1091 1 ? 9  
HELX_P HELX_P36 36 ASP B 296 ? MET B 310 ? ASP B 1092 MET B 1106 1 ? 15 
HELX_P HELX_P37 37 GLY B 311 ? ALA B 316 ? GLY B 1107 ALA B 1112 1 ? 6  
HELX_P HELX_P38 38 PHE B 318 ? GLN B 327 ? PHE B 1114 GLN B 1123 1 ? 10 
HELX_P HELX_P39 39 TRP B 330 ? LYS B 339 ? TRP B 1126 LYS B 1135 1 ? 10 
HELX_P HELX_P40 40 SER B 340 ? THR B 346 ? SER B 1136 THR B 1142 1 ? 7  
HELX_P HELX_P41 41 THR B 346 ? GLY B 360 ? THR B 1142 GLY B 1156 1 ? 15 
HELX_P HELX_P42 42 THR B 361 ? TYR B 365 ? THR B 1157 TYR B 1161 5 ? 5  
HELX_P HELX_P43 43 THR B 375 ? THR B 398 ? THR B 491  THR B 514  1 ? 24 
HELX_P HELX_P44 44 PRO B 405 ? ASN B 431 ? PRO B 521  ASN B 547  1 ? 27 
HELX_P HELX_P45 45 ASN B 431 ? THR B 440 ? ASN B 547  THR B 556  1 ? 10 
HELX_P HELX_P46 46 ILE C 9   ? ASN C 40  ? ILE C 64   ASN C 95   1 ? 32 
HELX_P HELX_P47 47 THR C 45  ? ILE C 64  ? THR C 100  ILE C 119  1 ? 20 
HELX_P HELX_P48 48 ILE C 64  ? MET C 75  ? ILE C 119  MET C 130  1 ? 12 
HELX_P HELX_P49 49 ASN C 82  ? ARG C 116 ? ASN C 137  ARG C 171  1 ? 35 
HELX_P HELX_P50 50 THR C 125 ? GLY C 156 ? THR C 180  GLY C 211  1 ? 32 
HELX_P HELX_P51 51 ILE C 167 ? SER C 171 ? ILE C 222  SER C 226  5 ? 5  
HELX_P HELX_P52 52 GLU C 172 ? PHE C 184 ? GLU C 227  PHE C 239  1 ? 13 
HELX_P HELX_P53 53 PHE C 184 ? GLU C 201 ? PHE C 239  GLU C 256  1 ? 18 
HELX_P HELX_P54 54 THR C 202 ? GLY C 216 ? THR C 257  GLY C 1012 1 ? 15 
HELX_P HELX_P55 55 SER C 242 ? GLY C 255 ? SER C 1038 GLY C 1051 1 ? 14 
HELX_P HELX_P56 56 THR C 263 ? ARG C 284 ? THR C 1059 ARG C 1080 1 ? 22 
HELX_P HELX_P57 57 LEU C 288 ? SER C 294 ? LEU C 1084 SER C 1090 1 ? 7  
HELX_P HELX_P58 58 ASP C 296 ? MET C 310 ? ASP C 1092 MET C 1106 1 ? 15 
HELX_P HELX_P59 59 GLY C 311 ? GLY C 317 ? GLY C 1107 GLY C 1113 1 ? 7  
HELX_P HELX_P60 60 PHE C 318 ? GLN C 327 ? PHE C 1114 GLN C 1123 1 ? 10 
HELX_P HELX_P61 61 ARG C 329 ? LYS C 339 ? ARG C 1125 LYS C 1135 1 ? 11 
HELX_P HELX_P62 62 SER C 340 ? THR C 346 ? SER C 1136 THR C 1142 1 ? 7  
HELX_P HELX_P63 63 THR C 346 ? THR C 359 ? THR C 1142 THR C 1155 1 ? 14 
HELX_P HELX_P64 64 THR C 375 ? THR C 398 ? THR C 491  THR C 514  1 ? 24 
HELX_P HELX_P65 65 PRO C 405 ? ASN C 431 ? PRO C 521  ASN C 547  1 ? 27 
HELX_P HELX_P66 66 ASN C 431 ? THR C 440 ? ASN C 547  THR C 556  1 ? 10 
HELX_P HELX_P67 67 GLN D 11  ? ASN D 40  ? GLN D 66   ASN D 95   1 ? 30 
HELX_P HELX_P68 68 LYS D 41  ? LYS D 44  ? LYS D 96   LYS D 99   5 ? 4  
HELX_P HELX_P69 69 THR D 45  ? ILE D 64  ? THR D 100  ILE D 119  1 ? 20 
HELX_P HELX_P70 70 ILE D 64  ? ASN D 76  ? ILE D 119  ASN D 131  1 ? 13 
HELX_P HELX_P71 71 ASN D 82  ? ARG D 116 ? ASN D 137  ARG D 171  1 ? 35 
HELX_P HELX_P72 72 THR D 125 ? GLY D 156 ? THR D 180  GLY D 211  1 ? 32 
HELX_P HELX_P73 73 ILE D 167 ? SER D 171 ? ILE D 222  SER D 226  5 ? 5  
HELX_P HELX_P74 74 GLU D 172 ? PHE D 184 ? GLU D 227  PHE D 239  1 ? 13 
HELX_P HELX_P75 75 PHE D 184 ? GLU D 201 ? PHE D 239  GLU D 256  1 ? 18 
HELX_P HELX_P76 76 THR D 202 ? GLY D 216 ? THR D 257  GLY D 1012 1 ? 15 
HELX_P HELX_P77 77 SER D 242 ? GLY D 255 ? SER D 1038 GLY D 1051 1 ? 14 
HELX_P HELX_P78 78 THR D 263 ? ASN D 285 ? THR D 1059 ASN D 1081 1 ? 23 
HELX_P HELX_P79 79 LYS D 287 ? SER D 294 ? LYS D 1083 SER D 1090 1 ? 8  
HELX_P HELX_P80 80 ASP D 296 ? GLY D 311 ? ASP D 1092 GLY D 1107 1 ? 16 
HELX_P HELX_P81 81 GLY D 311 ? ALA D 316 ? GLY D 1107 ALA D 1112 1 ? 6  
HELX_P HELX_P82 82 PHE D 318 ? GLN D 327 ? PHE D 1114 GLN D 1123 1 ? 10 
HELX_P HELX_P83 83 ARG D 329 ? LYS D 339 ? ARG D 1125 LYS D 1135 1 ? 11 
HELX_P HELX_P84 84 SER D 340 ? THR D 346 ? SER D 1136 THR D 1142 1 ? 7  
HELX_P HELX_P85 85 THR D 346 ? GLY D 360 ? THR D 1142 GLY D 1156 1 ? 15 
HELX_P HELX_P86 86 THR D 375 ? PHE D 399 ? THR D 491  PHE D 515  1 ? 25 
HELX_P HELX_P87 87 PRO D 405 ? ASN D 431 ? PRO D 521  ASN D 547  1 ? 27 
HELX_P HELX_P88 88 ASN D 431 ? LEU D 443 ? ASN D 547  LEU D 559  1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 85  SG ? ? ? 1_555 A CYS 165 SG ? ? A CYS 140 A CYS 220 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf2 disulf ? ? A CYS 400 SG ? ? ? 1_555 A CYS 403 SG ? ? A CYS 516 A CYS 519 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf3 disulf ? ? B CYS 85  SG ? ? ? 1_555 B CYS 165 SG ? ? B CYS 140 B CYS 220 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf4 disulf ? ? B CYS 400 SG ? ? ? 1_555 B CYS 403 SG ? ? B CYS 516 B CYS 519 1_555 ? ? ? ? ? ? ? 2.019 ? 
disulf5 disulf ? ? C CYS 85  SG ? ? ? 1_555 C CYS 165 SG ? ? C CYS 140 C CYS 220 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf6 disulf ? ? C CYS 400 SG ? ? ? 1_555 C CYS 403 SG ? ? C CYS 516 C CYS 519 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf7 disulf ? ? D CYS 85  SG ? ? ? 1_555 D CYS 165 SG ? ? D CYS 140 D CYS 220 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf8 disulf ? ? D CYS 400 SG ? ? ? 1_555 D CYS 403 SG ? ? D CYS 516 D CYS 519 1_555 ? ? ? ? ? ? ? 2.026 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 3 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 218 ? LYS A 223 ? ARG A 1014 LYS A 1019 
A 2 TYR A 229 ? GLY A 232 ? TYR A 1025 GLY A 1028 
A 3 HIS A 235 ? THR A 238 ? HIS A 1031 THR A 1034 
B 1 ARG B 218 ? LYS B 223 ? ARG B 1014 LYS B 1019 
B 2 TYR B 229 ? GLY B 232 ? TYR B 1025 GLY B 1028 
B 3 HIS B 235 ? THR B 238 ? HIS B 1031 THR B 1034 
C 1 ARG C 218 ? LYS C 223 ? ARG C 1014 LYS C 1019 
C 2 TYR C 229 ? GLY C 232 ? TYR C 1025 GLY C 1028 
C 3 HIS C 235 ? THR C 238 ? HIS C 1031 THR C 1034 
D 1 ARG D 218 ? LYS D 223 ? ARG D 1014 LYS D 1019 
D 2 TYR D 229 ? GLY D 232 ? TYR D 1025 GLY D 1028 
D 3 LEU D 236 ? THR D 238 ? LEU D 1032 THR D 1034 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 222 ? N TYR A 1018 O THR A 230 ? O THR A 1026 
A 2 3 N ILE A 231 ? N ILE A 1027 O HIS A 235 ? O HIS A 1031 
B 1 2 N TYR B 222 ? N TYR B 1018 O THR B 230 ? O THR B 1026 
B 2 3 N TYR B 229 ? N TYR B 1025 O LEU B 237 ? O LEU B 1033 
C 1 2 N TYR C 222 ? N TYR C 1018 O THR C 230 ? O THR C 1026 
C 2 3 N ILE C 231 ? N ILE C 1027 O HIS C 235 ? O HIS C 1031 
D 1 2 N ARG D 218 ? N ARG D 1014 O GLY D 232 ? O GLY D 1028 
D 2 3 N TYR D 229 ? N TYR D 1025 O THR D 238 ? O THR D 1034 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE 0HK A 2000' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE PO4 A 2001' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE PO4 A 2002' 
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE PO4 A 2003' 
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE PO4 A 2004' 
AC6 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE 0HK B 2000' 
AC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PO4 B 2001' 
AC8 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE 0HK C 2000' 
AC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PO4 C 2001' 
BC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE PO4 C 2002' 
BC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE 0HK D 2000' 
BC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PO4 D 2001' 
BC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PO4 D 2002' 
BC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE PO4 D 2003' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 ASP A 92  ? ASP A 147  . ? 1_555 ? 
2  AC1 12 TYR A 93  ? TYR A 148  . ? 1_555 ? 
3  AC1 12 SER A 96  ? SER A 151  . ? 1_555 ? 
4  AC1 12 ASN A 97  ? ASN A 152  . ? 1_555 ? 
5  AC1 12 TRP A 144 ? TRP A 199  . ? 1_555 ? 
6  AC1 12 ALA A 183 ? ALA A 238  . ? 1_555 ? 
7  AC1 12 PHE A 184 ? PHE A 239  . ? 1_555 ? 
8  AC1 12 TRP A 387 ? TRP A 503  . ? 1_555 ? 
9  AC1 12 TYR A 390 ? TYR A 506  . ? 1_555 ? 
10 AC1 12 ASN A 391 ? ASN A 507  . ? 1_555 ? 
11 AC1 12 TYR A 413 ? TYR A 529  . ? 1_555 ? 
12 AC1 12 CYS A 416 ? CYS A 532  . ? 1_555 ? 
13 AC2 3  ASN A 348 ? ASN A 1144 . ? 1_555 ? 
14 AC2 3  ARG A 352 ? ARG A 1148 . ? 1_555 ? 
15 AC2 3  ARG D 284 ? ARG D 1080 . ? 1_554 ? 
16 AC3 4  ARG A 218 ? ARG A 1014 . ? 1_555 ? 
17 AC3 4  LEU A 219 ? LEU A 1015 . ? 1_555 ? 
18 AC3 4  LYS A 220 ? LYS A 1016 . ? 1_555 ? 
19 AC3 4  LYS D 287 ? LYS D 1083 . ? 1_554 ? 
20 AC4 3  ASN A 320 ? ASN A 1116 . ? 1_555 ? 
21 AC4 3  LYS D 123 ? LYS D 178  . ? 1_454 ? 
22 AC4 3  LYS D 264 ? LYS D 1060 . ? 1_454 ? 
23 AC5 3  LYS A 123 ? LYS A 178  . ? 1_555 ? 
24 AC5 3  LYS A 264 ? LYS A 1060 . ? 1_555 ? 
25 AC5 3  ASN D 320 ? ASN D 1116 . ? 1_554 ? 
26 AC6 14 ASP B 92  ? ASP B 147  . ? 1_555 ? 
27 AC6 14 TYR B 93  ? TYR B 148  . ? 1_555 ? 
28 AC6 14 SER B 96  ? SER B 151  . ? 1_555 ? 
29 AC6 14 ASN B 97  ? ASN B 152  . ? 1_555 ? 
30 AC6 14 TRP B 144 ? TRP B 199  . ? 1_555 ? 
31 AC6 14 THR B 176 ? THR B 231  . ? 1_555 ? 
32 AC6 14 THR B 179 ? THR B 234  . ? 1_555 ? 
33 AC6 14 ALA B 183 ? ALA B 238  . ? 1_555 ? 
34 AC6 14 PHE B 184 ? PHE B 239  . ? 1_555 ? 
35 AC6 14 TRP B 387 ? TRP B 503  . ? 1_555 ? 
36 AC6 14 TYR B 390 ? TYR B 506  . ? 1_555 ? 
37 AC6 14 ASN B 391 ? ASN B 507  . ? 1_555 ? 
38 AC6 14 TYR B 413 ? TYR B 529  . ? 1_555 ? 
39 AC6 14 CYS B 416 ? CYS B 532  . ? 1_555 ? 
40 AC7 2  LYS B 123 ? LYS B 178  . ? 1_555 ? 
41 AC7 2  LYS B 264 ? LYS B 1060 . ? 1_555 ? 
42 AC8 15 ASP C 92  ? ASP C 147  . ? 1_555 ? 
43 AC8 15 TYR C 93  ? TYR C 148  . ? 1_555 ? 
44 AC8 15 SER C 96  ? SER C 151  . ? 1_555 ? 
45 AC8 15 ASN C 97  ? ASN C 152  . ? 1_555 ? 
46 AC8 15 TRP C 144 ? TRP C 199  . ? 1_555 ? 
47 AC8 15 THR C 176 ? THR C 231  . ? 1_555 ? 
48 AC8 15 THR C 179 ? THR C 234  . ? 1_555 ? 
49 AC8 15 ALA C 180 ? ALA C 235  . ? 1_555 ? 
50 AC8 15 ALA C 183 ? ALA C 238  . ? 1_555 ? 
51 AC8 15 PHE C 184 ? PHE C 239  . ? 1_555 ? 
52 AC8 15 TRP C 387 ? TRP C 503  . ? 1_555 ? 
53 AC8 15 TYR C 390 ? TYR C 506  . ? 1_555 ? 
54 AC8 15 ASN C 391 ? ASN C 507  . ? 1_555 ? 
55 AC8 15 TYR C 413 ? TYR C 529  . ? 1_555 ? 
56 AC8 15 CYS C 416 ? CYS C 532  . ? 1_555 ? 
57 AC9 2  LYS C 123 ? LYS C 178  . ? 1_555 ? 
58 AC9 2  LYS C 264 ? LYS C 1060 . ? 1_555 ? 
59 BC1 1  ARG C 323 ? ARG C 1119 . ? 1_555 ? 
60 BC2 11 ASP D 92  ? ASP D 147  . ? 1_555 ? 
61 BC2 11 TYR D 93  ? TYR D 148  . ? 1_555 ? 
62 BC2 11 SER D 96  ? SER D 151  . ? 1_555 ? 
63 BC2 11 ASN D 97  ? ASN D 152  . ? 1_555 ? 
64 BC2 11 TRP D 144 ? TRP D 199  . ? 1_555 ? 
65 BC2 11 PHE D 184 ? PHE D 239  . ? 1_555 ? 
66 BC2 11 TRP D 387 ? TRP D 503  . ? 1_555 ? 
67 BC2 11 TYR D 390 ? TYR D 506  . ? 1_555 ? 
68 BC2 11 ASN D 391 ? ASN D 507  . ? 1_555 ? 
69 BC2 11 TYR D 413 ? TYR D 529  . ? 1_555 ? 
70 BC2 11 CYS D 416 ? CYS D 532  . ? 1_555 ? 
71 BC3 2  ARG A 341 ? ARG A 1137 . ? 1_656 ? 
72 BC3 2  ARG D 121 ? ARG D 176  . ? 1_555 ? 
73 BC4 2  ARG A 121 ? ARG A 176  . ? 1_556 ? 
74 BC4 2  ARG D 341 ? ARG D 1137 . ? 1_555 ? 
75 BC5 4  LYS A 287 ? LYS A 1083 . ? 1_656 ? 
76 BC5 4  ARG D 218 ? ARG D 1014 . ? 1_555 ? 
77 BC5 4  LEU D 219 ? LEU D 1015 . ? 1_555 ? 
78 BC5 4  LYS D 220 ? LYS D 1016 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4DAJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4DAJ 
_atom_sites.fract_transf_matrix[1][1]   0.018258 
_atom_sites.fract_transf_matrix[1][2]   -0.001629 
_atom_sites.fract_transf_matrix[1][3]   0.000086 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016375 
_atom_sites.fract_transf_matrix[2][3]   -0.001185 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005667 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ILE A 1 9   ? -2.885  -29.766 -27.797  1.00 119.79 ? 64   ILE A N   1 
ATOM   2     C CA  . ILE A 1 9   ? -1.962  -28.719 -28.222  1.00 120.06 ? 64   ILE A CA  1 
ATOM   3     C C   . ILE A 1 9   ? -1.058  -29.194 -29.360  1.00 127.43 ? 64   ILE A C   1 
ATOM   4     O O   . ILE A 1 9   ? -0.740  -28.427 -30.267  1.00 135.59 ? 64   ILE A O   1 
ATOM   5     C CB  . ILE A 1 9   ? -1.097  -28.208 -27.053  1.00 108.40 ? 64   ILE A CB  1 
ATOM   6     N N   . TRP A 1 10  ? -0.645  -30.457 -29.308  1.00 122.80 ? 65   TRP A N   1 
ATOM   7     C CA  . TRP A 1 10  ? 0.212   -31.027 -30.346  1.00 117.22 ? 65   TRP A CA  1 
ATOM   8     C C   . TRP A 1 10  ? -0.519  -31.114 -31.687  1.00 119.72 ? 65   TRP A C   1 
ATOM   9     O O   . TRP A 1 10  ? -0.024  -30.638 -32.711  1.00 118.52 ? 65   TRP A O   1 
ATOM   10    C CB  . TRP A 1 10  ? 0.717   -32.407 -29.924  1.00 106.94 ? 65   TRP A CB  1 
ATOM   11    N N   . GLN A 1 11  ? -1.699  -31.725 -31.671  1.00 120.41 ? 66   GLN A N   1 
ATOM   12    C CA  . GLN A 1 11  ? -2.533  -31.823 -32.863  1.00 120.08 ? 66   GLN A CA  1 
ATOM   13    C C   . GLN A 1 11  ? -2.912  -30.434 -33.363  1.00 119.10 ? 66   GLN A C   1 
ATOM   14    O O   . GLN A 1 11  ? -2.976  -30.189 -34.570  1.00 120.14 ? 66   GLN A O   1 
ATOM   15    C CB  . GLN A 1 11  ? -3.798  -32.629 -32.559  1.00 130.65 ? 66   GLN A CB  1 
ATOM   16    C CG  . GLN A 1 11  ? -4.822  -32.639 -33.686  1.00 132.64 ? 66   GLN A CG  1 
ATOM   17    C CD  . GLN A 1 11  ? -6.137  -33.276 -33.275  1.00 118.77 ? 66   GLN A CD  1 
ATOM   18    O OE1 . GLN A 1 11  ? -7.127  -33.208 -34.004  1.00 108.61 ? 66   GLN A OE1 1 
ATOM   19    N NE2 . GLN A 1 11  ? -6.152  -33.897 -32.102  1.00 115.94 ? 66   GLN A NE2 1 
ATOM   20    N N   . VAL A 1 12  ? -3.163  -29.529 -32.423  1.00 114.94 ? 67   VAL A N   1 
ATOM   21    C CA  . VAL A 1 12  ? -3.489  -28.150 -32.753  1.00 116.43 ? 67   VAL A CA  1 
ATOM   22    C C   . VAL A 1 12  ? -2.381  -27.513 -33.589  1.00 114.39 ? 67   VAL A C   1 
ATOM   23    O O   . VAL A 1 12  ? -2.640  -26.938 -34.646  1.00 113.51 ? 67   VAL A O   1 
ATOM   24    C CB  . VAL A 1 12  ? -3.714  -27.307 -31.485  1.00 122.42 ? 67   VAL A CB  1 
ATOM   25    N N   . VAL A 1 13  ? -1.145  -27.621 -33.112  1.00 109.39 ? 68   VAL A N   1 
ATOM   26    C CA  . VAL A 1 13  ? 0.000   -27.083 -33.832  1.00 107.18 ? 68   VAL A CA  1 
ATOM   27    C C   . VAL A 1 13  ? 0.164   -27.770 -35.182  1.00 116.61 ? 68   VAL A C   1 
ATOM   28    O O   . VAL A 1 13  ? 0.442   -27.118 -36.188  1.00 114.49 ? 68   VAL A O   1 
ATOM   29    C CB  . VAL A 1 13  ? 1.300   -27.256 -33.027  1.00 105.58 ? 68   VAL A CB  1 
ATOM   30    N N   . PHE A 1 14  ? -0.018  -29.088 -35.200  1.00 124.10 ? 69   PHE A N   1 
ATOM   31    C CA  . PHE A 1 14  ? 0.109   -29.861 -36.434  1.00 120.53 ? 69   PHE A CA  1 
ATOM   32    C C   . PHE A 1 14  ? -0.861  -29.377 -37.511  1.00 119.21 ? 69   PHE A C   1 
ATOM   33    O O   . PHE A 1 14  ? -0.512  -29.321 -38.688  1.00 121.26 ? 69   PHE A O   1 
ATOM   34    C CB  . PHE A 1 14  ? -0.108  -31.351 -36.161  1.00 122.95 ? 69   PHE A CB  1 
ATOM   35    N N   . ILE A 1 15  ? -2.082  -29.043 -37.105  1.00 118.91 ? 70   ILE A N   1 
ATOM   36    C CA  . ILE A 1 15  ? -3.087  -28.537 -38.038  1.00 117.83 ? 70   ILE A CA  1 
ATOM   37    C C   . ILE A 1 15  ? -2.900  -27.050 -38.357  1.00 119.84 ? 70   ILE A C   1 
ATOM   38    O O   . ILE A 1 15  ? -3.329  -26.573 -39.408  1.00 122.26 ? 70   ILE A O   1 
ATOM   39    C CB  . ILE A 1 15  ? -4.513  -28.790 -37.515  1.00 114.88 ? 70   ILE A CB  1 
ATOM   40    C CG1 . ILE A 1 15  ? -4.754  -30.291 -37.355  1.00 115.32 ? 70   ILE A CG1 1 
ATOM   41    C CG2 . ILE A 1 15  ? -5.543  -28.194 -38.457  1.00 109.46 ? 70   ILE A CG2 1 
ATOM   42    C CD1 . ILE A 1 15  ? -4.587  -31.073 -38.642  1.00 104.23 ? 70   ILE A CD1 1 
ATOM   43    N N   . ALA A 1 16  ? -2.249  -26.329 -37.451  1.00 116.91 ? 71   ALA A N   1 
ATOM   44    C CA  . ALA A 1 16  ? -2.065  -24.884 -37.590  1.00 118.07 ? 71   ALA A CA  1 
ATOM   45    C C   . ALA A 1 16  ? -1.462  -24.454 -38.933  1.00 121.65 ? 71   ALA A C   1 
ATOM   46    O O   . ALA A 1 16  ? -1.872  -23.445 -39.507  1.00 121.85 ? 71   ALA A O   1 
ATOM   47    C CB  . ALA A 1 16  ? -1.221  -24.350 -36.440  1.00 114.70 ? 71   ALA A CB  1 
ATOM   48    N N   . PHE A 1 17  ? -0.491  -25.220 -39.424  1.00 120.81 ? 72   PHE A N   1 
ATOM   49    C CA  . PHE A 1 17  ? 0.252   -24.866 -40.635  1.00 120.08 ? 72   PHE A CA  1 
ATOM   50    C C   . PHE A 1 17  ? -0.612  -24.811 -41.895  1.00 111.29 ? 72   PHE A C   1 
ATOM   51    O O   . PHE A 1 17  ? -0.234  -24.193 -42.898  1.00 110.55 ? 72   PHE A O   1 
ATOM   52    C CB  . PHE A 1 17  ? 1.414   -25.837 -40.843  1.00 132.67 ? 72   PHE A CB  1 
ATOM   53    N N   . LEU A 1 18  ? -1.764  -25.469 -41.843  1.00 104.35 ? 73   LEU A N   1 
ATOM   54    C CA  . LEU A 1 18  ? -2.711  -25.448 -42.947  1.00 102.56 ? 73   LEU A CA  1 
ATOM   55    C C   . LEU A 1 18  ? -2.917  -24.008 -43.415  1.00 102.45 ? 73   LEU A C   1 
ATOM   56    O O   . LEU A 1 18  ? -2.902  -23.707 -44.618  1.00 101.21 ? 73   LEU A O   1 
ATOM   57    C CB  . LEU A 1 18  ? -4.038  -26.047 -42.483  1.00 99.80  ? 73   LEU A CB  1 
ATOM   58    C CG  . LEU A 1 18  ? -5.127  -26.272 -43.528  1.00 100.87 ? 73   LEU A CG  1 
ATOM   59    C CD1 . LEU A 1 18  ? -4.616  -27.165 -44.648  1.00 111.21 ? 73   LEU A CD1 1 
ATOM   60    C CD2 . LEU A 1 18  ? -6.356  -26.876 -42.872  1.00 93.92  ? 73   LEU A CD2 1 
ATOM   61    N N   . THR A 1 19  ? -3.094  -23.119 -42.444  1.00 102.06 ? 74   THR A N   1 
ATOM   62    C CA  . THR A 1 19  ? -3.255  -21.698 -42.714  1.00 102.11 ? 74   THR A CA  1 
ATOM   63    C C   . THR A 1 19  ? -2.089  -21.163 -43.535  1.00 107.52 ? 74   THR A C   1 
ATOM   64    O O   . THR A 1 19  ? -2.287  -20.478 -44.538  1.00 108.09 ? 74   THR A O   1 
ATOM   65    C CB  . THR A 1 19  ? -3.357  -20.891 -41.412  1.00 98.85  ? 74   THR A CB  1 
ATOM   66    O OG1 . THR A 1 19  ? -2.112  -20.956 -40.706  1.00 99.14  ? 74   THR A OG1 1 
ATOM   67    C CG2 . THR A 1 19  ? -4.463  -21.449 -40.533  1.00 101.84 ? 74   THR A CG2 1 
ATOM   68    N N   . GLY A 1 20  ? -0.872  -21.475 -43.100  1.00 111.50 ? 75   GLY A N   1 
ATOM   69    C CA  . GLY A 1 20  ? 0.321   -21.088 -43.830  1.00 111.77 ? 75   GLY A CA  1 
ATOM   70    C C   . GLY A 1 20  ? 0.251   -21.530 -45.279  1.00 109.49 ? 75   GLY A C   1 
ATOM   71    O O   . GLY A 1 20  ? 0.507   -20.741 -46.191  1.00 102.33 ? 75   GLY A O   1 
ATOM   72    N N   . PHE A 1 21  ? -0.095  -22.798 -45.489  1.00 108.28 ? 76   PHE A N   1 
ATOM   73    C CA  . PHE A 1 21  ? -0.293  -23.330 -46.837  1.00 104.36 ? 76   PHE A CA  1 
ATOM   74    C C   . PHE A 1 21  ? -1.224  -22.423 -47.647  1.00 100.81 ? 76   PHE A C   1 
ATOM   75    O O   . PHE A 1 21  ? -0.900  -22.022 -48.776  1.00 94.96  ? 76   PHE A O   1 
ATOM   76    C CB  . PHE A 1 21  ? -0.845  -24.760 -46.757  1.00 105.67 ? 76   PHE A CB  1 
ATOM   77    C CG  . PHE A 1 21  ? -1.392  -25.290 -48.058  1.00 109.05 ? 76   PHE A CG  1 
ATOM   78    C CD1 . PHE A 1 21  ? -0.574  -25.971 -48.946  1.00 103.35 ? 76   PHE A CD1 1 
ATOM   79    C CD2 . PHE A 1 21  ? -2.733  -25.133 -48.377  1.00 110.78 ? 76   PHE A CD2 1 
ATOM   80    C CE1 . PHE A 1 21  ? -1.079  -26.468 -50.137  1.00 100.40 ? 76   PHE A CE1 1 
ATOM   81    C CE2 . PHE A 1 21  ? -3.244  -25.628 -49.565  1.00 108.93 ? 76   PHE A CE2 1 
ATOM   82    C CZ  . PHE A 1 21  ? -2.415  -26.296 -50.446  1.00 101.24 ? 76   PHE A CZ  1 
ATOM   83    N N   . LEU A 1 22  ? -2.372  -22.087 -47.062  1.00 99.37  ? 77   LEU A N   1 
ATOM   84    C CA  . LEU A 1 22  ? -3.339  -21.218 -47.739  1.00 95.63  ? 77   LEU A CA  1 
ATOM   85    C C   . LEU A 1 22  ? -2.771  -19.827 -48.076  1.00 93.14  ? 77   LEU A C   1 
ATOM   86    O O   . LEU A 1 22  ? -3.027  -19.282 -49.158  1.00 90.76  ? 77   LEU A O   1 
ATOM   87    C CB  . LEU A 1 22  ? -4.617  -21.087 -46.906  1.00 90.84  ? 77   LEU A CB  1 
ATOM   88    N N   . ALA A 1 23  ? -1.998  -19.261 -47.153  1.00 93.57  ? 78   ALA A N   1 
ATOM   89    C CA  . ALA A 1 23  ? -1.392  -17.948 -47.359  1.00 88.51  ? 78   ALA A CA  1 
ATOM   90    C C   . ALA A 1 23  ? -0.384  -17.984 -48.500  1.00 85.42  ? 78   ALA A C   1 
ATOM   91    O O   . ALA A 1 23  ? -0.336  -17.079 -49.335  1.00 85.53  ? 78   ALA A O   1 
ATOM   92    C CB  . ALA A 1 23  ? -0.729  -17.462 -46.076  1.00 88.45  ? 78   ALA A CB  1 
ATOM   93    N N   . LEU A 1 24  ? 0.422   -19.038 -48.527  1.00 83.88  ? 79   LEU A N   1 
ATOM   94    C CA  . LEU A 1 24  ? 1.392   -19.225 -49.592  1.00 84.24  ? 79   LEU A CA  1 
ATOM   95    C C   . LEU A 1 24  ? 0.671   -19.289 -50.934  1.00 83.10  ? 79   LEU A C   1 
ATOM   96    O O   . LEU A 1 24  ? 0.954   -18.508 -51.848  1.00 74.46  ? 79   LEU A O   1 
ATOM   97    C CB  . LEU A 1 24  ? 2.199   -20.503 -49.357  1.00 88.23  ? 79   LEU A CB  1 
ATOM   98    C CG  . LEU A 1 24  ? 3.536   -20.637 -50.093  1.00 86.31  ? 79   LEU A CG  1 
ATOM   99    C CD1 . LEU A 1 24  ? 4.532   -19.580 -49.629  1.00 68.05  ? 79   LEU A CD1 1 
ATOM   100   C CD2 . LEU A 1 24  ? 4.109   -22.029 -49.897  1.00 101.70 ? 79   LEU A CD2 1 
ATOM   101   N N   . VAL A 1 25  ? -0.276  -20.217 -51.041  1.00 87.29  ? 80   VAL A N   1 
ATOM   102   C CA  . VAL A 1 25  ? -1.073  -20.344 -52.258  1.00 88.32  ? 80   VAL A CA  1 
ATOM   103   C C   . VAL A 1 25  ? -1.616  -18.984 -52.709  1.00 87.99  ? 80   VAL A C   1 
ATOM   104   O O   . VAL A 1 25  ? -1.584  -18.653 -53.897  1.00 84.78  ? 80   VAL A O   1 
ATOM   105   C CB  . VAL A 1 25  ? -2.243  -21.323 -52.064  1.00 86.51  ? 80   VAL A CB  1 
ATOM   106   C CG1 . VAL A 1 25  ? -3.147  -21.321 -53.283  1.00 85.50  ? 80   VAL A CG1 1 
ATOM   107   C CG2 . VAL A 1 25  ? -1.717  -22.721 -51.778  1.00 80.99  ? 80   VAL A CG2 1 
ATOM   108   N N   . THR A 1 26  ? -2.105  -18.199 -51.753  1.00 90.03  ? 81   THR A N   1 
ATOM   109   C CA  . THR A 1 26  ? -2.619  -16.864 -52.046  1.00 84.64  ? 81   THR A CA  1 
ATOM   110   C C   . THR A 1 26  ? -1.556  -15.959 -52.665  1.00 89.08  ? 81   THR A C   1 
ATOM   111   O O   . THR A 1 26  ? -1.765  -15.374 -53.735  1.00 94.39  ? 81   THR A O   1 
ATOM   112   C CB  . THR A 1 26  ? -3.137  -16.184 -50.774  1.00 81.70  ? 81   THR A CB  1 
ATOM   113   O OG1 . THR A 1 26  ? -4.062  -17.050 -50.107  1.00 82.93  ? 81   THR A OG1 1 
ATOM   114   C CG2 . THR A 1 26  ? -3.820  -14.868 -51.115  1.00 79.43  ? 81   THR A CG2 1 
ATOM   115   N N   . ILE A 1 27  ? -0.417  -15.843 -51.987  1.00 88.38  ? 82   ILE A N   1 
ATOM   116   C CA  . ILE A 1 27  ? 0.646   -14.943 -52.434  1.00 88.12  ? 82   ILE A CA  1 
ATOM   117   C C   . ILE A 1 27  ? 1.233   -15.328 -53.798  1.00 84.23  ? 82   ILE A C   1 
ATOM   118   O O   . ILE A 1 27  ? 1.549   -14.460 -54.617  1.00 75.55  ? 82   ILE A O   1 
ATOM   119   C CB  . ILE A 1 27  ? 1.765   -14.797 -51.370  1.00 83.67  ? 82   ILE A CB  1 
ATOM   120   C CG1 . ILE A 1 27  ? 2.356   -16.156 -50.998  1.00 75.36  ? 82   ILE A CG1 1 
ATOM   121   C CG2 . ILE A 1 27  ? 1.227   -14.115 -50.125  1.00 80.19  ? 82   ILE A CG2 1 
ATOM   122   C CD1 . ILE A 1 27  ? 3.043   -16.163 -49.646  1.00 67.66  ? 82   ILE A CD1 1 
ATOM   123   N N   . ILE A 1 28  ? 1.364   -16.628 -54.047  1.00 83.29  ? 83   ILE A N   1 
ATOM   124   C CA  . ILE A 1 28  ? 1.867   -17.093 -55.336  1.00 84.26  ? 83   ILE A CA  1 
ATOM   125   C C   . ILE A 1 28  ? 0.836   -16.920 -56.451  1.00 85.17  ? 83   ILE A C   1 
ATOM   126   O O   . ILE A 1 28  ? 1.179   -16.521 -57.564  1.00 81.53  ? 83   ILE A O   1 
ATOM   127   C CB  . ILE A 1 28  ? 2.308   -18.561 -55.285  1.00 79.85  ? 83   ILE A CB  1 
ATOM   128   C CG1 . ILE A 1 28  ? 1.133   -19.446 -54.870  1.00 79.52  ? 83   ILE A CG1 1 
ATOM   129   C CG2 . ILE A 1 28  ? 3.487   -18.726 -54.337  1.00 80.74  ? 83   ILE A CG2 1 
ATOM   130   C CD1 . ILE A 1 28  ? 1.422   -20.920 -54.957  1.00 83.93  ? 83   ILE A CD1 1 
ATOM   131   N N   . GLY A 1 29  ? -0.424  -17.229 -56.160  1.00 86.00  ? 84   GLY A N   1 
ATOM   132   C CA  . GLY A 1 29  ? -1.479  -17.046 -57.140  1.00 81.68  ? 84   GLY A CA  1 
ATOM   133   C C   . GLY A 1 29  ? -1.534  -15.594 -57.575  1.00 81.86  ? 84   GLY A C   1 
ATOM   134   O O   . GLY A 1 29  ? -1.422  -15.270 -58.762  1.00 84.00  ? 84   GLY A O   1 
ATOM   135   N N   . ASN A 1 30  ? -1.682  -14.710 -56.596  1.00 82.91  ? 85   ASN A N   1 
ATOM   136   C CA  . ASN A 1 30  ? -1.706  -13.281 -56.870  1.00 84.13  ? 85   ASN A CA  1 
ATOM   137   C C   . ASN A 1 30  ? -0.448  -12.796 -57.604  1.00 80.49  ? 85   ASN A C   1 
ATOM   138   O O   . ASN A 1 30  ? -0.539  -12.085 -58.615  1.00 76.33  ? 85   ASN A O   1 
ATOM   139   C CB  . ASN A 1 30  ? -1.922  -12.503 -55.569  1.00 87.00  ? 85   ASN A CB  1 
ATOM   140   C CG  . ASN A 1 30  ? -3.291  -12.761 -54.956  1.00 84.62  ? 85   ASN A CG  1 
ATOM   141   O OD1 . ASN A 1 30  ? -4.309  -12.748 -55.654  1.00 81.89  ? 85   ASN A OD1 1 
ATOM   142   N ND2 . ASN A 1 30  ? -3.320  -12.999 -53.647  1.00 83.84  ? 85   ASN A ND2 1 
ATOM   143   N N   . ILE A 1 31  ? 0.722   -13.186 -57.102  1.00 77.82  ? 86   ILE A N   1 
ATOM   144   C CA  . ILE A 1 31  ? 1.986   -12.784 -57.718  1.00 79.65  ? 86   ILE A CA  1 
ATOM   145   C C   . ILE A 1 31  ? 2.004   -13.195 -59.197  1.00 79.67  ? 86   ILE A C   1 
ATOM   146   O O   . ILE A 1 31  ? 2.498   -12.459 -60.069  1.00 74.45  ? 86   ILE A O   1 
ATOM   147   C CB  . ILE A 1 31  ? 3.203   -13.362 -56.945  1.00 71.97  ? 86   ILE A CB  1 
ATOM   148   C CG1 . ILE A 1 31  ? 4.479   -12.576 -57.256  1.00 70.63  ? 86   ILE A CG1 1 
ATOM   149   C CG2 . ILE A 1 31  ? 3.395   -14.832 -57.247  1.00 69.81  ? 86   ILE A CG2 1 
ATOM   150   C CD1 . ILE A 1 31  ? 4.478   -11.162 -56.716  1.00 64.77  ? 86   ILE A CD1 1 
ATOM   151   N N   . LEU A 1 32  ? 1.425   -14.364 -59.469  1.00 78.95  ? 87   LEU A N   1 
ATOM   152   C CA  . LEU A 1 32  ? 1.269   -14.861 -60.829  1.00 75.49  ? 87   LEU A CA  1 
ATOM   153   C C   . LEU A 1 32  ? 0.373   -13.944 -61.637  1.00 73.37  ? 87   LEU A C   1 
ATOM   154   O O   . LEU A 1 32  ? 0.678   -13.625 -62.777  1.00 73.62  ? 87   LEU A O   1 
ATOM   155   C CB  . LEU A 1 32  ? 0.676   -16.268 -60.832  1.00 69.85  ? 87   LEU A CB  1 
ATOM   156   C CG  . LEU A 1 32  ? 1.659   -17.423 -60.675  1.00 70.33  ? 87   LEU A CG  1 
ATOM   157   C CD1 . LEU A 1 32  ? 0.925   -18.737 -60.832  1.00 78.79  ? 87   LEU A CD1 1 
ATOM   158   C CD2 . LEU A 1 32  ? 2.770   -17.306 -61.699  1.00 67.19  ? 87   LEU A CD2 1 
ATOM   159   N N   . VAL A 1 33  ? -0.742  -13.529 -61.051  1.00 74.30  ? 88   VAL A N   1 
ATOM   160   C CA  . VAL A 1 33  ? -1.626  -12.601 -61.739  1.00 73.23  ? 88   VAL A CA  1 
ATOM   161   C C   . VAL A 1 33  ? -0.831  -11.379 -62.176  1.00 72.99  ? 88   VAL A C   1 
ATOM   162   O O   . VAL A 1 33  ? -0.807  -11.016 -63.360  1.00 78.24  ? 88   VAL A O   1 
ATOM   163   C CB  . VAL A 1 33  ? -2.780  -12.138 -60.837  1.00 77.45  ? 88   VAL A CB  1 
ATOM   164   C CG1 . VAL A 1 33  ? -3.684  -11.175 -61.593  1.00 76.87  ? 88   VAL A CG1 1 
ATOM   165   C CG2 . VAL A 1 33  ? -3.570  -13.335 -60.327  1.00 82.23  ? 88   VAL A CG2 1 
ATOM   166   N N   . ILE A 1 34  ? -0.158  -10.761 -61.212  1.00 70.37  ? 89   ILE A N   1 
ATOM   167   C CA  . ILE A 1 34  ? 0.589   -9.537  -61.470  1.00 73.89  ? 89   ILE A CA  1 
ATOM   168   C C   . ILE A 1 34  ? 1.570   -9.733  -62.621  1.00 77.51  ? 89   ILE A C   1 
ATOM   169   O O   . ILE A 1 34  ? 1.525   -9.016  -63.634  1.00 81.90  ? 89   ILE A O   1 
ATOM   170   C CB  . ILE A 1 34  ? 1.372   -9.096  -60.222  1.00 70.05  ? 89   ILE A CB  1 
ATOM   171   C CG1 . ILE A 1 34  ? 0.443   -9.030  -59.008  1.00 68.76  ? 89   ILE A CG1 1 
ATOM   172   C CG2 . ILE A 1 34  ? 2.055   -7.756  -60.465  1.00 71.76  ? 89   ILE A CG2 1 
ATOM   173   C CD1 . ILE A 1 34  ? 1.059   -8.369  -57.798  1.00 63.51  ? 89   ILE A CD1 1 
ATOM   174   N N   . VAL A 1 35  ? 2.444   -10.721 -62.467  1.00 73.88  ? 90   VAL A N   1 
ATOM   175   C CA  . VAL A 1 35  ? 3.468   -10.978 -63.469  1.00 70.72  ? 90   VAL A CA  1 
ATOM   176   C C   . VAL A 1 35  ? 2.865   -11.233 -64.850  1.00 74.44  ? 90   VAL A C   1 
ATOM   177   O O   . VAL A 1 35  ? 3.243   -10.593 -65.830  1.00 72.89  ? 90   VAL A O   1 
ATOM   178   C CB  . VAL A 1 35  ? 4.347   -12.170 -63.063  1.00 71.07  ? 90   VAL A CB  1 
ATOM   179   C CG1 . VAL A 1 35  ? 5.367   -12.467 -64.146  1.00 80.30  ? 90   VAL A CG1 1 
ATOM   180   C CG2 . VAL A 1 35  ? 5.033   -11.885 -61.737  1.00 70.62  ? 90   VAL A CG2 1 
ATOM   181   N N   . ALA A 1 36  ? 1.925   -12.170 -64.915  1.00 78.43  ? 91   ALA A N   1 
ATOM   182   C CA  . ALA A 1 36  ? 1.297   -12.567 -66.170  1.00 74.84  ? 91   ALA A CA  1 
ATOM   183   C C   . ALA A 1 36  ? 0.695   -11.378 -66.894  1.00 74.47  ? 91   ALA A C   1 
ATOM   184   O O   . ALA A 1 36  ? 0.822   -11.262 -68.111  1.00 74.92  ? 91   ALA A O   1 
ATOM   185   C CB  . ALA A 1 36  ? 0.231   -13.619 -65.917  1.00 73.82  ? 91   ALA A CB  1 
ATOM   186   N N   . PHE A 1 37  ? 0.039   -10.499 -66.140  1.00 76.66  ? 92   PHE A N   1 
ATOM   187   C CA  . PHE A 1 37  ? -0.570  -9.307  -66.725  1.00 80.31  ? 92   PHE A CA  1 
ATOM   188   C C   . PHE A 1 37  ? 0.479   -8.335  -67.248  1.00 78.53  ? 92   PHE A C   1 
ATOM   189   O O   . PHE A 1 37  ? 0.296   -7.729  -68.305  1.00 74.29  ? 92   PHE A O   1 
ATOM   190   C CB  . PHE A 1 37  ? -1.466  -8.591  -65.709  1.00 85.28  ? 92   PHE A CB  1 
ATOM   191   C CG  . PHE A 1 37  ? -2.148  -7.359  -66.259  1.00 89.95  ? 92   PHE A CG  1 
ATOM   192   C CD1 . PHE A 1 37  ? -1.425  -6.203  -66.523  1.00 90.11  ? 92   PHE A CD1 1 
ATOM   193   C CD2 . PHE A 1 37  ? -3.514  -7.354  -66.500  1.00 87.75  ? 92   PHE A CD2 1 
ATOM   194   C CE1 . PHE A 1 37  ? -2.049  -5.074  -67.027  1.00 90.38  ? 92   PHE A CE1 1 
ATOM   195   C CE2 . PHE A 1 37  ? -4.144  -6.226  -67.002  1.00 83.94  ? 92   PHE A CE2 1 
ATOM   196   C CZ  . PHE A 1 37  ? -3.410  -5.086  -67.266  1.00 84.22  ? 92   PHE A CZ  1 
ATOM   197   N N   . LYS A 1 38  ? 1.565   -8.165  -66.498  1.00 82.68  ? 93   LYS A N   1 
ATOM   198   C CA  . LYS A 1 38  ? 2.602   -7.218  -66.909  1.00 82.97  ? 93   LYS A CA  1 
ATOM   199   C C   . LYS A 1 38  ? 3.395   -7.720  -68.121  1.00 79.16  ? 93   LYS A C   1 
ATOM   200   O O   . LYS A 1 38  ? 3.883   -6.926  -68.925  1.00 74.00  ? 93   LYS A O   1 
ATOM   201   C CB  . LYS A 1 38  ? 3.555   -6.898  -65.746  1.00 80.20  ? 93   LYS A CB  1 
ATOM   202   C CG  . LYS A 1 38  ? 2.897   -6.293  -64.500  1.00 76.70  ? 93   LYS A CG  1 
ATOM   203   C CD  . LYS A 1 38  ? 2.418   -4.860  -64.720  1.00 81.86  ? 93   LYS A CD  1 
ATOM   204   C CE  . LYS A 1 38  ? 1.840   -4.272  -63.430  1.00 89.69  ? 93   LYS A CE  1 
ATOM   205   N NZ  . LYS A 1 38  ? 1.363   -2.862  -63.577  1.00 87.41  ? 93   LYS A NZ  1 
ATOM   206   N N   . VAL A 1 39  ? 3.517   -9.039  -68.249  1.00 83.31  ? 94   VAL A N   1 
ATOM   207   C CA  . VAL A 1 39  ? 4.366   -9.638  -69.280  1.00 89.02  ? 94   VAL A CA  1 
ATOM   208   C C   . VAL A 1 39  ? 3.623   -10.029 -70.562  1.00 90.13  ? 94   VAL A C   1 
ATOM   209   O O   . VAL A 1 39  ? 4.247   -10.433 -71.545  1.00 95.08  ? 94   VAL A O   1 
ATOM   210   C CB  . VAL A 1 39  ? 5.102   -10.887 -68.737  1.00 93.91  ? 94   VAL A CB  1 
ATOM   211   C CG1 . VAL A 1 39  ? 4.147   -12.075 -68.662  1.00 87.17  ? 94   VAL A CG1 1 
ATOM   212   C CG2 . VAL A 1 39  ? 6.317   -11.223 -69.600  1.00 96.48  ? 94   VAL A CG2 1 
ATOM   213   N N   . ASN A 1 40  ? 2.299   -9.901  -70.561  1.00 91.05  ? 95   ASN A N   1 
ATOM   214   C CA  . ASN A 1 40  ? 1.504   -10.260 -71.735  1.00 89.13  ? 95   ASN A CA  1 
ATOM   215   C C   . ASN A 1 40  ? 0.553   -9.139  -72.170  1.00 90.20  ? 95   ASN A C   1 
ATOM   216   O O   . ASN A 1 40  ? -0.419  -8.831  -71.476  1.00 92.14  ? 95   ASN A O   1 
ATOM   217   C CB  . ASN A 1 40  ? 0.724   -11.550 -71.458  1.00 78.03  ? 95   ASN A CB  1 
ATOM   218   C CG  . ASN A 1 40  ? 0.070   -12.114 -72.697  1.00 71.86  ? 95   ASN A CG  1 
ATOM   219   O OD1 . ASN A 1 40  ? -0.218  -11.393 -73.646  1.00 70.76  ? 95   ASN A OD1 1 
ATOM   220   N ND2 . ASN A 1 40  ? -0.166  -13.413 -72.695  1.00 72.84  ? 95   ASN A ND2 1 
ATOM   221   N N   . LYS A 1 41  ? 0.816   -8.553  -73.336  1.00 80.24  ? 96   LYS A N   1 
ATOM   222   C CA  . LYS A 1 41  ? 0.008   -7.437  -73.816  1.00 84.17  ? 96   LYS A CA  1 
ATOM   223   C C   . LYS A 1 41  ? -1.456  -7.831  -73.959  1.00 84.63  ? 96   LYS A C   1 
ATOM   224   O O   . LYS A 1 41  ? -2.348  -7.005  -73.776  1.00 89.99  ? 96   LYS A O   1 
ATOM   225   C CB  . LYS A 1 41  ? 0.532   -6.909  -75.152  1.00 93.61  ? 96   LYS A CB  1 
ATOM   226   C CG  . LYS A 1 41  ? 1.787   -6.057  -75.052  1.00 94.14  ? 96   LYS A CG  1 
ATOM   227   C CD  . LYS A 1 41  ? 2.123   -5.434  -76.403  1.00 87.47  ? 96   LYS A CD  1 
ATOM   228   C CE  . LYS A 1 41  ? 3.424   -4.658  -76.351  1.00 86.15  ? 96   LYS A CE  1 
ATOM   229   N NZ  . LYS A 1 41  ? 3.746   -4.066  -77.674  1.00 88.08  ? 96   LYS A NZ  1 
ATOM   230   N N   . GLN A 1 42  ? -1.697  -9.091  -74.300  1.00 85.36  ? 97   GLN A N   1 
ATOM   231   C CA  . GLN A 1 42  ? -3.056  -9.592  -74.447  1.00 87.54  ? 97   GLN A CA  1 
ATOM   232   C C   . GLN A 1 42  ? -3.864  -9.301  -73.198  1.00 81.29  ? 97   GLN A C   1 
ATOM   233   O O   . GLN A 1 42  ? -5.024  -8.902  -73.271  1.00 81.21  ? 97   GLN A O   1 
ATOM   234   C CB  . GLN A 1 42  ? -3.050  -11.101 -74.689  1.00 89.72  ? 97   GLN A CB  1 
ATOM   235   C CG  . GLN A 1 42  ? -2.515  -11.532 -76.037  1.00 88.11  ? 97   GLN A CG  1 
ATOM   236   C CD  . GLN A 1 42  ? -2.777  -12.995 -76.302  1.00 85.17  ? 97   GLN A CD  1 
ATOM   237   O OE1 . GLN A 1 42  ? -2.555  -13.488 -77.408  1.00 85.01  ? 97   GLN A OE1 1 
ATOM   238   N NE2 . GLN A 1 42  ? -3.259  -13.701 -75.283  1.00 78.57  ? 97   GLN A NE2 1 
ATOM   239   N N   . LEU A 1 43  ? -3.244  -9.514  -72.047  1.00 75.80  ? 98   LEU A N   1 
ATOM   240   C CA  . LEU A 1 43  ? -3.955  -9.398  -70.788  1.00 82.68  ? 98   LEU A CA  1 
ATOM   241   C C   . LEU A 1 43  ? -4.188  -7.944  -70.384  1.00 82.95  ? 98   LEU A C   1 
ATOM   242   O O   . LEU A 1 43  ? -4.949  -7.669  -69.459  1.00 83.76  ? 98   LEU A O   1 
ATOM   243   C CB  . LEU A 1 43  ? -3.218  -10.168 -69.688  1.00 90.02  ? 98   LEU A CB  1 
ATOM   244   C CG  . LEU A 1 43  ? -3.088  -11.683 -69.896  1.00 87.33  ? 98   LEU A CG  1 
ATOM   245   C CD1 . LEU A 1 43  ? -2.197  -12.301 -68.822  1.00 88.09  ? 98   LEU A CD1 1 
ATOM   246   C CD2 . LEU A 1 43  ? -4.455  -12.357 -69.925  1.00 77.07  ? 98   LEU A CD2 1 
ATOM   247   N N   . LYS A 1 44  ? -3.552  -7.011  -71.084  1.00 84.27  ? 99   LYS A N   1 
ATOM   248   C CA  . LYS A 1 44  ? -3.719  -5.602  -70.751  1.00 80.83  ? 99   LYS A CA  1 
ATOM   249   C C   . LYS A 1 44  ? -5.031  -5.083  -71.324  1.00 76.06  ? 99   LYS A C   1 
ATOM   250   O O   . LYS A 1 44  ? -5.205  -4.994  -72.537  1.00 80.98  ? 99   LYS A O   1 
ATOM   251   C CB  . LYS A 1 44  ? -2.549  -4.779  -71.305  1.00 88.69  ? 99   LYS A CB  1 
ATOM   252   C CG  . LYS A 1 44  ? -1.167  -5.286  -70.888  1.00 99.03  ? 99   LYS A CG  1 
ATOM   253   C CD  . LYS A 1 44  ? -0.040  -4.535  -71.602  1.00 101.02 ? 99   LYS A CD  1 
ATOM   254   C CE  . LYS A 1 44  ? 0.065   -3.090  -71.133  1.00 111.69 ? 99   LYS A CE  1 
ATOM   255   N NZ  . LYS A 1 44  ? 0.447   -2.985  -69.695  1.00 100.86 ? 99   LYS A NZ  1 
ATOM   256   N N   . THR A 1 45  ? -5.933  -4.692  -70.435  1.00 77.57  ? 100  THR A N   1 
ATOM   257   C CA  . THR A 1 45  ? -7.232  -4.159  -70.818  1.00 77.14  ? 100  THR A CA  1 
ATOM   258   C C   . THR A 1 45  ? -7.751  -3.398  -69.615  1.00 74.91  ? 100  THR A C   1 
ATOM   259   O O   . THR A 1 45  ? -7.137  -3.421  -68.550  1.00 79.18  ? 100  THR A O   1 
ATOM   260   C CB  . THR A 1 45  ? -8.239  -5.285  -71.134  1.00 74.09  ? 100  THR A CB  1 
ATOM   261   O OG1 . THR A 1 45  ? -7.631  -6.259  -71.987  1.00 68.52  ? 100  THR A OG1 1 
ATOM   262   C CG2 . THR A 1 45  ? -9.485  -4.730  -71.818  1.00 75.03  ? 100  THR A CG2 1 
ATOM   263   N N   . VAL A 1 46  ? -8.894  -2.749  -69.760  1.00 60.34  ? 101  VAL A N   1 
ATOM   264   C CA  . VAL A 1 46  ? -9.473  -2.064  -68.623  1.00 68.55  ? 101  VAL A CA  1 
ATOM   265   C C   . VAL A 1 46  ? -9.915  -3.077  -67.558  1.00 73.18  ? 101  VAL A C   1 
ATOM   266   O O   . VAL A 1 46  ? -9.464  -3.027  -66.404  1.00 72.91  ? 101  VAL A O   1 
ATOM   267   C CB  . VAL A 1 46  ? -10.639 -1.185  -69.054  1.00 75.56  ? 101  VAL A CB  1 
ATOM   268   C CG1 . VAL A 1 46  ? -11.281 -0.526  -67.842  1.00 77.85  ? 101  VAL A CG1 1 
ATOM   269   C CG2 . VAL A 1 46  ? -10.166 -0.136  -70.049  1.00 68.43  ? 101  VAL A CG2 1 
ATOM   270   N N   . ASN A 1 47  ? -10.769 -4.015  -67.963  1.00 73.73  ? 102  ASN A N   1 
ATOM   271   C CA  . ASN A 1 47  ? -11.293 -5.042  -67.061  1.00 77.60  ? 102  ASN A CA  1 
ATOM   272   C C   . ASN A 1 47  ? -10.188 -5.851  -66.371  1.00 77.80  ? 102  ASN A C   1 
ATOM   273   O O   . ASN A 1 47  ? -10.192 -6.043  -65.140  1.00 75.21  ? 102  ASN A O   1 
ATOM   274   C CB  . ASN A 1 47  ? -12.247 -5.970  -67.822  1.00 78.65  ? 102  ASN A CB  1 
ATOM   275   C CG  . ASN A 1 47  ? -12.169 -5.783  -69.331  1.00 69.60  ? 102  ASN A CG  1 
ATOM   276   O OD1 . ASN A 1 47  ? -12.969 -5.055  -69.923  1.00 53.67  ? 102  ASN A OD1 1 
ATOM   277   N ND2 . ASN A 1 47  ? -11.204 -6.444  -69.959  1.00 73.81  ? 102  ASN A ND2 1 
ATOM   278   N N   . ASN A 1 48  ? -9.235  -6.318  -67.171  1.00 73.73  ? 103  ASN A N   1 
ATOM   279   C CA  . ASN A 1 48  ? -8.071  -7.010  -66.641  1.00 70.07  ? 103  ASN A CA  1 
ATOM   280   C C   . ASN A 1 48  ? -7.250  -6.094  -65.742  1.00 66.25  ? 103  ASN A C   1 
ATOM   281   O O   . ASN A 1 48  ? -6.527  -6.555  -64.861  1.00 65.99  ? 103  ASN A O   1 
ATOM   282   C CB  . ASN A 1 48  ? -7.217  -7.545  -67.781  1.00 67.05  ? 103  ASN A CB  1 
ATOM   283   C CG  . ASN A 1 48  ? -7.961  -8.543  -68.636  1.00 71.07  ? 103  ASN A CG  1 
ATOM   284   O OD1 . ASN A 1 48  ? -9.163  -8.744  -68.472  1.00 75.98  ? 103  ASN A OD1 1 
ATOM   285   N ND2 . ASN A 1 48  ? -7.252  -9.173  -69.558  1.00 76.81  ? 103  ASN A ND2 1 
ATOM   286   N N   . TYR A 1 49  ? -7.374  -4.792  -65.968  1.00 63.04  ? 104  TYR A N   1 
ATOM   287   C CA  . TYR A 1 49  ? -6.674  -3.811  -65.155  1.00 65.67  ? 104  TYR A CA  1 
ATOM   288   C C   . TYR A 1 49  ? -7.244  -3.827  -63.742  1.00 66.90  ? 104  TYR A C   1 
ATOM   289   O O   . TYR A 1 49  ? -6.504  -3.921  -62.743  1.00 70.20  ? 104  TYR A O   1 
ATOM   290   C CB  . TYR A 1 49  ? -6.821  -2.423  -65.770  1.00 64.83  ? 104  TYR A CB  1 
ATOM   291   C CG  . TYR A 1 49  ? -5.782  -1.436  -65.305  1.00 68.69  ? 104  TYR A CG  1 
ATOM   292   C CD1 . TYR A 1 49  ? -5.961  -0.715  -64.133  1.00 72.89  ? 104  TYR A CD1 1 
ATOM   293   C CD2 . TYR A 1 49  ? -4.623  -1.220  -66.041  1.00 64.54  ? 104  TYR A CD2 1 
ATOM   294   C CE1 . TYR A 1 49  ? -5.013  0.194   -63.702  1.00 77.31  ? 104  TYR A CE1 1 
ATOM   295   C CE2 . TYR A 1 49  ? -3.671  -0.313  -65.619  1.00 71.86  ? 104  TYR A CE2 1 
ATOM   296   C CZ  . TYR A 1 49  ? -3.870  0.392   -64.447  1.00 78.29  ? 104  TYR A CZ  1 
ATOM   297   O OH  . TYR A 1 49  ? -2.927  1.300   -64.014  1.00 73.08  ? 104  TYR A OH  1 
ATOM   298   N N   . PHE A 1 50  ? -8.567  -3.745  -63.658  1.00 65.15  ? 105  PHE A N   1 
ATOM   299   C CA  . PHE A 1 50  ? -9.227  -3.837  -62.362  1.00 65.25  ? 105  PHE A CA  1 
ATOM   300   C C   . PHE A 1 50  ? -8.874  -5.167  -61.699  1.00 66.48  ? 105  PHE A C   1 
ATOM   301   O O   . PHE A 1 50  ? -8.616  -5.220  -60.490  1.00 65.72  ? 105  PHE A O   1 
ATOM   302   C CB  . PHE A 1 50  ? -10.745 -3.685  -62.507  1.00 68.39  ? 105  PHE A CB  1 
ATOM   303   C CG  . PHE A 1 50  ? -11.178 -2.349  -63.067  1.00 71.62  ? 105  PHE A CG  1 
ATOM   304   C CD1 . PHE A 1 50  ? -10.630 -1.170  -62.595  1.00 72.56  ? 105  PHE A CD1 1 
ATOM   305   C CD2 . PHE A 1 50  ? -12.130 -2.277  -64.075  1.00 68.83  ? 105  PHE A CD2 1 
ATOM   306   C CE1 . PHE A 1 50  ? -11.023 0.050   -63.113  1.00 68.31  ? 105  PHE A CE1 1 
ATOM   307   C CE2 . PHE A 1 50  ? -12.524 -1.058  -64.597  1.00 62.67  ? 105  PHE A CE2 1 
ATOM   308   C CZ  . PHE A 1 50  ? -11.970 0.104   -64.114  1.00 67.07  ? 105  PHE A CZ  1 
ATOM   309   N N   . LEU A 1 51  ? -8.841  -6.237  -62.493  1.00 64.79  ? 106  LEU A N   1 
ATOM   310   C CA  . LEU A 1 51  ? -8.492  -7.552  -61.950  1.00 67.68  ? 106  LEU A CA  1 
ATOM   311   C C   . LEU A 1 51  ? -7.055  -7.605  -61.401  1.00 70.03  ? 106  LEU A C   1 
ATOM   312   O O   . LEU A 1 51  ? -6.747  -8.358  -60.462  1.00 71.38  ? 106  LEU A O   1 
ATOM   313   C CB  . LEU A 1 51  ? -8.742  -8.646  -62.986  1.00 65.46  ? 106  LEU A CB  1 
ATOM   314   C CG  . LEU A 1 51  ? -10.219 -8.743  -63.365  1.00 64.26  ? 106  LEU A CG  1 
ATOM   315   C CD1 . LEU A 1 51  ? -10.498 -9.966  -64.230  1.00 72.92  ? 106  LEU A CD1 1 
ATOM   316   C CD2 . LEU A 1 51  ? -11.069 -8.772  -62.107  1.00 59.67  ? 106  LEU A CD2 1 
ATOM   317   N N   . LEU A 1 52  ? -6.186  -6.785  -61.983  1.00 72.44  ? 107  LEU A N   1 
ATOM   318   C CA  . LEU A 1 52  ? -4.844  -6.590  -61.451  1.00 71.44  ? 107  LEU A CA  1 
ATOM   319   C C   . LEU A 1 52  ? -4.925  -5.911  -60.088  1.00 68.13  ? 107  LEU A C   1 
ATOM   320   O O   . LEU A 1 52  ? -4.307  -6.363  -59.118  1.00 65.73  ? 107  LEU A O   1 
ATOM   321   C CB  . LEU A 1 52  ? -3.994  -5.763  -62.423  1.00 73.77  ? 107  LEU A CB  1 
ATOM   322   C CG  . LEU A 1 52  ? -2.579  -5.366  -61.994  1.00 73.29  ? 107  LEU A CG  1 
ATOM   323   C CD1 . LEU A 1 52  ? -1.695  -5.147  -63.212  1.00 78.95  ? 107  LEU A CD1 1 
ATOM   324   C CD2 . LEU A 1 52  ? -2.597  -4.127  -61.110  1.00 70.45  ? 107  LEU A CD2 1 
ATOM   325   N N   . SER A 1 53  ? -5.696  -4.829  -60.008  1.00 63.70  ? 108  SER A N   1 
ATOM   326   C CA  . SER A 1 53  ? -5.877  -4.171  -58.718  1.00 64.99  ? 108  SER A CA  1 
ATOM   327   C C   . SER A 1 53  ? -6.286  -5.187  -57.648  1.00 60.08  ? 108  SER A C   1 
ATOM   328   O O   . SER A 1 53  ? -5.642  -5.303  -56.593  1.00 53.33  ? 108  SER A O   1 
ATOM   329   C CB  . SER A 1 53  ? -6.926  -3.067  -58.811  1.00 66.20  ? 108  SER A CB  1 
ATOM   330   O OG  . SER A 1 53  ? -7.227  -2.559  -57.524  1.00 67.25  ? 108  SER A OG  1 
ATOM   331   N N   . LEU A 1 54  ? -7.353  -5.932  -57.929  1.00 63.66  ? 109  LEU A N   1 
ATOM   332   C CA  . LEU A 1 54  ? -7.824  -6.944  -56.989  1.00 65.05  ? 109  LEU A CA  1 
ATOM   333   C C   . LEU A 1 54  ? -6.697  -7.874  -56.575  1.00 70.44  ? 109  LEU A C   1 
ATOM   334   O O   . LEU A 1 54  ? -6.414  -8.015  -55.384  1.00 72.65  ? 109  LEU A O   1 
ATOM   335   C CB  . LEU A 1 54  ? -8.975  -7.762  -57.575  1.00 60.68  ? 109  LEU A CB  1 
ATOM   336   C CG  . LEU A 1 54  ? -10.379 -7.202  -57.366  1.00 61.50  ? 109  LEU A CG  1 
ATOM   337   C CD1 . LEU A 1 54  ? -11.400 -8.101  -58.039  1.00 63.48  ? 109  LEU A CD1 1 
ATOM   338   C CD2 . LEU A 1 54  ? -10.681 -7.057  -55.883  1.00 53.61  ? 109  LEU A CD2 1 
ATOM   339   N N   . ALA A 1 55  ? -6.045  -8.497  -57.554  1.00 75.59  ? 110  ALA A N   1 
ATOM   340   C CA  . ALA A 1 55  ? -4.960  -9.423  -57.238  1.00 71.16  ? 110  ALA A CA  1 
ATOM   341   C C   . ALA A 1 55  ? -3.935  -8.762  -56.313  1.00 67.00  ? 110  ALA A C   1 
ATOM   342   O O   . ALA A 1 55  ? -3.325  -9.427  -55.477  1.00 63.89  ? 110  ALA A O   1 
ATOM   343   C CB  . ALA A 1 55  ? -4.299  -9.931  -58.503  1.00 66.75  ? 110  ALA A CB  1 
ATOM   344   N N   . CYS A 1 56  ? -3.759  -7.451  -56.459  1.00 61.51  ? 111  CYS A N   1 
ATOM   345   C CA  . CYS A 1 56  ? -2.863  -6.701  -55.581  1.00 65.16  ? 111  CYS A CA  1 
ATOM   346   C C   . CYS A 1 56  ? -3.366  -6.655  -54.143  1.00 68.00  ? 111  CYS A C   1 
ATOM   347   O O   . CYS A 1 56  ? -2.616  -6.934  -53.197  1.00 61.82  ? 111  CYS A O   1 
ATOM   348   C CB  . CYS A 1 56  ? -2.656  -5.285  -56.106  1.00 61.33  ? 111  CYS A CB  1 
ATOM   349   S SG  . CYS A 1 56  ? -1.361  -5.189  -57.324  1.00 59.51  ? 111  CYS A SG  1 
ATOM   350   N N   . ALA A 1 57  ? -4.632  -6.290  -53.974  1.00 70.33  ? 112  ALA A N   1 
ATOM   351   C CA  . ALA A 1 57  ? -5.222  -6.329  -52.646  1.00 64.24  ? 112  ALA A CA  1 
ATOM   352   C C   . ALA A 1 57  ? -4.973  -7.705  -52.040  1.00 66.80  ? 112  ALA A C   1 
ATOM   353   O O   . ALA A 1 57  ? -4.458  -7.818  -50.927  1.00 72.28  ? 112  ALA A O   1 
ATOM   354   C CB  . ALA A 1 57  ? -6.706  -6.027  -52.710  1.00 62.88  ? 112  ALA A CB  1 
ATOM   355   N N   . ASP A 1 58  ? -5.309  -8.748  -52.795  1.00 68.01  ? 113  ASP A N   1 
ATOM   356   C CA  . ASP A 1 58  ? -5.171  -10.123 -52.321  1.00 70.74  ? 113  ASP A CA  1 
ATOM   357   C C   . ASP A 1 58  ? -3.736  -10.496 -51.975  1.00 73.05  ? 113  ASP A C   1 
ATOM   358   O O   . ASP A 1 58  ? -3.498  -11.321 -51.095  1.00 77.34  ? 113  ASP A O   1 
ATOM   359   C CB  . ASP A 1 58  ? -5.730  -11.110 -53.344  1.00 72.87  ? 113  ASP A CB  1 
ATOM   360   C CG  . ASP A 1 58  ? -7.210  -10.935 -53.572  1.00 81.01  ? 113  ASP A CG  1 
ATOM   361   O OD1 . ASP A 1 58  ? -7.901  -10.434 -52.655  1.00 72.28  ? 113  ASP A OD1 1 
ATOM   362   O OD2 . ASP A 1 58  ? -7.673  -11.303 -54.674  1.00 84.87  ? 113  ASP A OD2 1 
ATOM   363   N N   . LEU A 1 59  ? -2.781  -9.899  -52.678  1.00 71.46  ? 114  LEU A N   1 
ATOM   364   C CA  . LEU A 1 59  ? -1.376  -10.154 -52.393  1.00 78.84  ? 114  LEU A CA  1 
ATOM   365   C C   . LEU A 1 59  ? -0.960  -9.500  -51.080  1.00 80.42  ? 114  LEU A C   1 
ATOM   366   O O   . LEU A 1 59  ? -0.452  -10.166 -50.178  1.00 82.74  ? 114  LEU A O   1 
ATOM   367   C CB  . LEU A 1 59  ? -0.488  -9.671  -53.547  1.00 77.26  ? 114  LEU A CB  1 
ATOM   368   C CG  . LEU A 1 59  ? 1.035   -9.826  -53.425  1.00 70.51  ? 114  LEU A CG  1 
ATOM   369   C CD1 . LEU A 1 59  ? 1.681   -9.876  -54.800  1.00 68.14  ? 114  LEU A CD1 1 
ATOM   370   C CD2 . LEU A 1 59  ? 1.661   -8.716  -52.582  1.00 67.19  ? 114  LEU A CD2 1 
ATOM   371   N N   . ILE A 1 60  ? -1.197  -8.197  -50.963  1.00 76.44  ? 115  ILE A N   1 
ATOM   372   C CA  . ILE A 1 60  ? -0.809  -7.484  -49.751  1.00 72.64  ? 115  ILE A CA  1 
ATOM   373   C C   . ILE A 1 60  ? -1.492  -8.100  -48.523  1.00 68.99  ? 115  ILE A C   1 
ATOM   374   O O   . ILE A 1 60  ? -0.916  -8.147  -47.439  1.00 66.23  ? 115  ILE A O   1 
ATOM   375   C CB  . ILE A 1 60  ? -1.073  -5.957  -49.865  1.00 74.79  ? 115  ILE A CB  1 
ATOM   376   C CG1 . ILE A 1 60  ? -0.749  -5.245  -48.548  1.00 80.85  ? 115  ILE A CG1 1 
ATOM   377   C CG2 . ILE A 1 60  ? -2.505  -5.681  -50.292  1.00 68.87  ? 115  ILE A CG2 1 
ATOM   378   C CD1 . ILE A 1 60  ? -1.015  -3.752  -48.571  1.00 72.61  ? 115  ILE A CD1 1 
ATOM   379   N N   . ILE A 1 61  ? -2.707  -8.606  -48.711  1.00 68.20  ? 116  ILE A N   1 
ATOM   380   C CA  . ILE A 1 61  ? -3.448  -9.243  -47.623  1.00 67.46  ? 116  ILE A CA  1 
ATOM   381   C C   . ILE A 1 61  ? -2.958  -10.667 -47.346  1.00 70.56  ? 116  ILE A C   1 
ATOM   382   O O   . ILE A 1 61  ? -3.021  -11.140 -46.212  1.00 72.20  ? 116  ILE A O   1 
ATOM   383   C CB  . ILE A 1 61  ? -4.973  -9.241  -47.905  1.00 70.02  ? 116  ILE A CB  1 
ATOM   384   C CG1 . ILE A 1 61  ? -5.757  -9.883  -46.765  1.00 77.56  ? 116  ILE A CG1 1 
ATOM   385   C CG2 . ILE A 1 61  ? -5.284  -9.993  -49.161  1.00 73.71  ? 116  ILE A CG2 1 
ATOM   386   C CD1 . ILE A 1 61  ? -7.244  -9.976  -47.052  1.00 74.24  ? 116  ILE A CD1 1 
ATOM   387   N N   . GLY A 1 62  ? -2.460  -11.342 -48.378  1.00 75.00  ? 117  GLY A N   1 
ATOM   388   C CA  . GLY A 1 62  ? -2.021  -12.724 -48.249  1.00 78.32  ? 117  GLY A CA  1 
ATOM   389   C C   . GLY A 1 62  ? -0.610  -12.901 -47.708  1.00 80.59  ? 117  GLY A C   1 
ATOM   390   O O   . GLY A 1 62  ? -0.272  -13.943 -47.142  1.00 76.13  ? 117  GLY A O   1 
ATOM   391   N N   . VAL A 1 63  ? 0.223   -11.884 -47.901  1.00 82.80  ? 118  VAL A N   1 
ATOM   392   C CA  . VAL A 1 63  ? 1.599   -11.913 -47.417  1.00 77.20  ? 118  VAL A CA  1 
ATOM   393   C C   . VAL A 1 63  ? 1.731   -11.286 -46.024  1.00 81.20  ? 118  VAL A C   1 
ATOM   394   O O   . VAL A 1 63  ? 2.770   -11.410 -45.377  1.00 92.04  ? 118  VAL A O   1 
ATOM   395   C CB  . VAL A 1 63  ? 2.544   -11.186 -48.400  1.00 76.39  ? 118  VAL A CB  1 
ATOM   396   C CG1 . VAL A 1 63  ? 2.292   -9.682  -48.364  1.00 80.78  ? 118  VAL A CG1 1 
ATOM   397   C CG2 . VAL A 1 63  ? 3.999   -11.493 -48.083  1.00 73.86  ? 118  VAL A CG2 1 
ATOM   398   N N   . ILE A 1 64  ? 0.671   -10.634 -45.554  1.00 74.44  ? 119  ILE A N   1 
ATOM   399   C CA  . ILE A 1 64  ? 0.733   -9.898  -44.294  1.00 67.60  ? 119  ILE A CA  1 
ATOM   400   C C   . ILE A 1 64  ? -0.341  -10.327 -43.295  1.00 70.35  ? 119  ILE A C   1 
ATOM   401   O O   . ILE A 1 64  ? -0.030  -10.881 -42.244  1.00 72.38  ? 119  ILE A O   1 
ATOM   402   C CB  . ILE A 1 64  ? 0.657   -8.373  -44.532  1.00 71.52  ? 119  ILE A CB  1 
ATOM   403   C CG1 . ILE A 1 64  ? 1.906   -7.895  -45.283  1.00 69.03  ? 119  ILE A CG1 1 
ATOM   404   C CG2 . ILE A 1 64  ? 0.485   -7.629  -43.213  1.00 63.09  ? 119  ILE A CG2 1 
ATOM   405   C CD1 . ILE A 1 64  ? 1.844   -6.456  -45.756  1.00 69.20  ? 119  ILE A CD1 1 
ATOM   406   N N   . SER A 1 65  ? -1.602  -10.072 -43.629  1.00 71.84  ? 120  SER A N   1 
ATOM   407   C CA  . SER A 1 65  ? -2.710  -10.355 -42.720  1.00 73.03  ? 120  SER A CA  1 
ATOM   408   C C   . SER A 1 65  ? -2.829  -11.833 -42.349  1.00 71.57  ? 120  SER A C   1 
ATOM   409   O O   . SER A 1 65  ? -2.855  -12.181 -41.167  1.00 70.58  ? 120  SER A O   1 
ATOM   410   C CB  . SER A 1 65  ? -4.032  -9.843  -43.301  1.00 71.45  ? 120  SER A CB  1 
ATOM   411   O OG  . SER A 1 65  ? -4.055  -8.427  -43.355  1.00 66.71  ? 120  SER A OG  1 
ATOM   412   N N   . MET A 1 66  ? -2.899  -12.697 -43.358  1.00 70.48  ? 121  MET A N   1 
ATOM   413   C CA  . MET A 1 66  ? -3.059  -14.130 -43.122  1.00 74.74  ? 121  MET A CA  1 
ATOM   414   C C   . MET A 1 66  ? -2.006  -14.628 -42.138  1.00 77.84  ? 121  MET A C   1 
ATOM   415   O O   . MET A 1 66  ? -2.293  -15.424 -41.238  1.00 80.57  ? 121  MET A O   1 
ATOM   416   C CB  . MET A 1 66  ? -2.956  -14.913 -44.436  1.00 76.99  ? 121  MET A CB  1 
ATOM   417   C CG  . MET A 1 66  ? -3.930  -14.459 -45.523  1.00 83.77  ? 121  MET A CG  1 
ATOM   418   S SD  . MET A 1 66  ? -3.968  -15.516 -46.997  1.00 94.02  ? 121  MET A SD  1 
ATOM   419   C CE  . MET A 1 66  ? -4.703  -17.012 -46.339  1.00 83.65  ? 121  MET A CE  1 
ATOM   420   N N   . ASN A 1 67  ? -0.791  -14.120 -42.293  1.00 75.17  ? 122  ASN A N   1 
ATOM   421   C CA  . ASN A 1 67  ? 0.340   -14.596 -41.513  1.00 72.28  ? 122  ASN A CA  1 
ATOM   422   C C   . ASN A 1 67  ? 0.290   -14.129 -40.068  1.00 75.69  ? 122  ASN A C   1 
ATOM   423   O O   . ASN A 1 67  ? 0.196   -14.948 -39.160  1.00 74.95  ? 122  ASN A O   1 
ATOM   424   C CB  . ASN A 1 67  ? 1.655   -14.167 -42.158  1.00 76.28  ? 122  ASN A CB  1 
ATOM   425   C CG  . ASN A 1 67  ? 1.719   -14.511 -43.630  1.00 73.06  ? 122  ASN A CG  1 
ATOM   426   O OD1 . ASN A 1 67  ? 0.842   -15.195 -44.161  1.00 67.78  ? 122  ASN A OD1 1 
ATOM   427   N ND2 . ASN A 1 67  ? 2.766   -14.044 -44.298  1.00 65.61  ? 122  ASN A ND2 1 
ATOM   428   N N   . LEU A 1 68  ? 0.369   -12.817 -39.854  1.00 79.46  ? 123  LEU A N   1 
ATOM   429   C CA  . LEU A 1 68  ? 0.320   -12.261 -38.500  1.00 76.64  ? 123  LEU A CA  1 
ATOM   430   C C   . LEU A 1 68  ? -0.934  -12.721 -37.767  1.00 80.23  ? 123  LEU A C   1 
ATOM   431   O O   . LEU A 1 68  ? -0.977  -12.759 -36.532  1.00 86.77  ? 123  LEU A O   1 
ATOM   432   C CB  . LEU A 1 68  ? 0.395   -10.734 -38.530  1.00 55.78  ? 123  LEU A CB  1 
ATOM   433   C CG  . LEU A 1 68  ? 1.783   -10.170 -38.836  1.00 54.81  ? 123  LEU A CG  1 
ATOM   434   C CD1 . LEU A 1 68  ? 2.314   -10.699 -40.164  1.00 64.14  ? 123  LEU A CD1 1 
ATOM   435   C CD2 . LEU A 1 68  ? 1.756   -8.656  -38.829  1.00 53.05  ? 123  LEU A CD2 1 
ATOM   436   N N   . PHE A 1 69  ? -1.949  -13.078 -38.547  1.00 76.23  ? 124  PHE A N   1 
ATOM   437   C CA  . PHE A 1 69  ? -3.168  -13.669 -38.017  1.00 79.39  ? 124  PHE A CA  1 
ATOM   438   C C   . PHE A 1 69  ? -2.875  -15.072 -37.500  1.00 82.82  ? 124  PHE A C   1 
ATOM   439   O O   . PHE A 1 69  ? -3.218  -15.416 -36.365  1.00 86.05  ? 124  PHE A O   1 
ATOM   440   C CB  . PHE A 1 69  ? -4.229  -13.728 -39.114  1.00 81.38  ? 124  PHE A CB  1 
ATOM   441   C CG  . PHE A 1 69  ? -5.582  -14.159 -38.630  1.00 85.26  ? 124  PHE A CG  1 
ATOM   442   C CD1 . PHE A 1 69  ? -6.222  -13.465 -37.617  1.00 81.70  ? 124  PHE A CD1 1 
ATOM   443   C CD2 . PHE A 1 69  ? -6.224  -15.245 -39.204  1.00 86.14  ? 124  PHE A CD2 1 
ATOM   444   C CE1 . PHE A 1 69  ? -7.473  -13.854 -37.174  1.00 83.05  ? 124  PHE A CE1 1 
ATOM   445   C CE2 . PHE A 1 69  ? -7.477  -15.639 -38.768  1.00 88.77  ? 124  PHE A CE2 1 
ATOM   446   C CZ  . PHE A 1 69  ? -8.101  -14.942 -37.749  1.00 88.24  ? 124  PHE A CZ  1 
ATOM   447   N N   . THR A 1 70  ? -2.236  -15.879 -38.341  1.00 76.50  ? 125  THR A N   1 
ATOM   448   C CA  . THR A 1 70  ? -1.807  -17.208 -37.934  1.00 79.52  ? 125  THR A CA  1 
ATOM   449   C C   . THR A 1 70  ? -1.000  -17.129 -36.638  1.00 84.19  ? 125  THR A C   1 
ATOM   450   O O   . THR A 1 70  ? -1.178  -17.942 -35.725  1.00 85.01  ? 125  THR A O   1 
ATOM   451   C CB  . THR A 1 70  ? -0.952  -17.867 -39.023  1.00 87.40  ? 125  THR A CB  1 
ATOM   452   O OG1 . THR A 1 70  ? -1.700  -17.937 -40.244  1.00 89.76  ? 125  THR A OG1 1 
ATOM   453   C CG2 . THR A 1 70  ? -0.541  -19.270 -38.600  1.00 95.67  ? 125  THR A CG2 1 
ATOM   454   N N   . THR A 1 71  ? -0.118  -16.138 -36.566  1.00 85.27  ? 126  THR A N   1 
ATOM   455   C CA  . THR A 1 71  ? 0.705   -15.899 -35.387  1.00 89.01  ? 126  THR A CA  1 
ATOM   456   C C   . THR A 1 71  ? -0.146  -15.632 -34.150  1.00 93.62  ? 126  THR A C   1 
ATOM   457   O O   . THR A 1 71  ? -0.064  -16.358 -33.151  1.00 99.90  ? 126  THR A O   1 
ATOM   458   C CB  . THR A 1 71  ? 1.626   -14.678 -35.599  1.00 83.71  ? 126  THR A CB  1 
ATOM   459   O OG1 . THR A 1 71  ? 2.440   -14.871 -36.764  1.00 71.90  ? 126  THR A OG1 1 
ATOM   460   C CG2 . THR A 1 71  ? 2.513   -14.450 -34.381  1.00 82.20  ? 126  THR A CG2 1 
ATOM   461   N N   . TYR A 1 72  ? -0.970  -14.590 -34.228  1.00 94.89  ? 127  TYR A N   1 
ATOM   462   C CA  . TYR A 1 72  ? -1.842  -14.217 -33.119  1.00 99.49  ? 127  TYR A CA  1 
ATOM   463   C C   . TYR A 1 72  ? -2.662  -15.407 -32.609  1.00 108.29 ? 127  TYR A C   1 
ATOM   464   O O   . TYR A 1 72  ? -2.733  -15.641 -31.397  1.00 109.60 ? 127  TYR A O   1 
ATOM   465   C CB  . TYR A 1 72  ? -2.757  -13.055 -33.522  1.00 97.21  ? 127  TYR A CB  1 
ATOM   466   C CG  . TYR A 1 72  ? -3.798  -12.677 -32.486  1.00 101.86 ? 127  TYR A CG  1 
ATOM   467   C CD1 . TYR A 1 72  ? -3.482  -11.837 -31.425  1.00 97.36  ? 127  TYR A CD1 1 
ATOM   468   C CD2 . TYR A 1 72  ? -5.104  -13.150 -32.581  1.00 99.78  ? 127  TYR A CD2 1 
ATOM   469   C CE1 . TYR A 1 72  ? -4.436  -11.488 -30.484  1.00 97.32  ? 127  TYR A CE1 1 
ATOM   470   C CE2 . TYR A 1 72  ? -6.063  -12.806 -31.645  1.00 85.32  ? 127  TYR A CE2 1 
ATOM   471   C CZ  . TYR A 1 72  ? -5.723  -11.975 -30.602  1.00 90.25  ? 127  TYR A CZ  1 
ATOM   472   O OH  . TYR A 1 72  ? -6.677  -11.635 -29.674  1.00 85.30  ? 127  TYR A OH  1 
ATOM   473   N N   . ILE A 1 73  ? -3.271  -16.158 -33.529  1.00 101.02 ? 128  ILE A N   1 
ATOM   474   C CA  . ILE A 1 73  ? -4.054  -17.335 -33.145  1.00 100.12 ? 128  ILE A CA  1 
ATOM   475   C C   . ILE A 1 73  ? -3.201  -18.375 -32.431  1.00 108.31 ? 128  ILE A C   1 
ATOM   476   O O   . ILE A 1 73  ? -3.569  -18.862 -31.361  1.00 112.21 ? 128  ILE A O   1 
ATOM   477   C CB  . ILE A 1 73  ? -4.716  -18.019 -34.349  1.00 93.66  ? 128  ILE A CB  1 
ATOM   478   C CG1 . ILE A 1 73  ? -5.555  -17.023 -35.148  1.00 99.13  ? 128  ILE A CG1 1 
ATOM   479   C CG2 . ILE A 1 73  ? -5.575  -19.191 -33.882  1.00 82.21  ? 128  ILE A CG2 1 
ATOM   480   C CD1 . ILE A 1 73  ? -6.191  -17.629 -36.385  1.00 98.40  ? 128  ILE A CD1 1 
ATOM   481   N N   . ILE A 1 74  ? -2.064  -18.716 -33.032  1.00 111.80 ? 129  ILE A N   1 
ATOM   482   C CA  . ILE A 1 74  ? -1.161  -19.701 -32.446  1.00 115.42 ? 129  ILE A CA  1 
ATOM   483   C C   . ILE A 1 74  ? -0.778  -19.348 -31.008  1.00 113.18 ? 129  ILE A C   1 
ATOM   484   O O   . ILE A 1 74  ? -0.983  -20.142 -30.085  1.00 103.74 ? 129  ILE A O   1 
ATOM   485   C CB  . ILE A 1 74  ? 0.131   -19.843 -33.277  1.00 109.82 ? 129  ILE A CB  1 
ATOM   486   N N   . MET A 1 75  ? -0.237  -18.149 -30.820  1.00 116.42 ? 130  MET A N   1 
ATOM   487   C CA  . MET A 1 75  ? 0.268   -17.748 -29.512  1.00 122.29 ? 130  MET A CA  1 
ATOM   488   C C   . MET A 1 75  ? -0.829  -17.593 -28.461  1.00 120.54 ? 130  MET A C   1 
ATOM   489   O O   . MET A 1 75  ? -0.544  -17.587 -27.261  1.00 122.27 ? 130  MET A O   1 
ATOM   490   C CB  . MET A 1 75  ? 1.070   -16.452 -29.624  1.00 129.47 ? 130  MET A CB  1 
ATOM   491   C CG  . MET A 1 75  ? 2.275   -16.553 -30.536  1.00 143.69 ? 130  MET A CG  1 
ATOM   492   S SD  . MET A 1 75  ? 3.289   -15.067 -30.497  1.00 248.14 ? 130  MET A SD  1 
ATOM   493   C CE  . MET A 1 75  ? 3.814   -15.068 -28.786  1.00 224.93 ? 130  MET A CE  1 
ATOM   494   N N   . ASN A 1 76  ? -2.074  -17.461 -28.915  1.00 114.58 ? 131  ASN A N   1 
ATOM   495   C CA  . ASN A 1 76  ? -3.191  -17.187 -28.017  1.00 113.52 ? 131  ASN A CA  1 
ATOM   496   C C   . ASN A 1 76  ? -3.054  -15.788 -27.436  1.00 109.73 ? 131  ASN A C   1 
ATOM   497   O O   . ASN A 1 76  ? -3.896  -15.335 -26.661  1.00 109.69 ? 131  ASN A O   1 
ATOM   498   C CB  . ASN A 1 76  ? -3.278  -18.229 -26.900  1.00 117.45 ? 131  ASN A CB  1 
ATOM   499   C CG  . ASN A 1 76  ? -3.492  -19.634 -27.429  1.00 124.55 ? 131  ASN A CG  1 
ATOM   500   O OD1 . ASN A 1 76  ? -4.607  -20.005 -27.796  1.00 126.31 ? 131  ASN A OD1 1 
ATOM   501   N ND2 . ASN A 1 76  ? -2.422  -20.425 -27.471  1.00 120.11 ? 131  ASN A ND2 1 
ATOM   502   N N   . ARG A 1 77  ? -1.968  -15.121 -27.811  1.00 109.36 ? 132  ARG A N   1 
ATOM   503   C CA  . ARG A 1 77  ? -1.633  -13.803 -27.290  1.00 112.07 ? 132  ARG A CA  1 
ATOM   504   C C   . ARG A 1 77  ? -1.029  -12.917 -28.379  1.00 108.40 ? 132  ARG A C   1 
ATOM   505   O O   . ARG A 1 77  ? -0.502  -13.415 -29.373  1.00 109.29 ? 132  ARG A O   1 
ATOM   506   C CB  . ARG A 1 77  ? -0.650  -13.951 -26.128  1.00 106.21 ? 132  ARG A CB  1 
ATOM   507   C CG  . ARG A 1 77  ? 0.187   -12.719 -25.832  1.00 103.58 ? 132  ARG A CG  1 
ATOM   508   C CD  . ARG A 1 77  ? 1.166   -13.001 -24.708  1.00 98.68  ? 132  ARG A CD  1 
ATOM   509   N NE  . ARG A 1 77  ? 2.330   -12.122 -24.743  1.00 92.09  ? 132  ARG A NE  1 
ATOM   510   C CZ  . ARG A 1 77  ? 3.458   -12.409 -25.387  1.00 96.07  ? 132  ARG A CZ  1 
ATOM   511   N NH1 . ARG A 1 77  ? 3.572   -13.549 -26.052  1.00 95.90  ? 132  ARG A NH1 1 
ATOM   512   N NH2 . ARG A 1 77  ? 4.473   -11.556 -25.368  1.00 99.40  ? 132  ARG A NH2 1 
ATOM   513   N N   . TRP A 1 78  ? -1.114  -11.604 -28.194  1.00 102.44 ? 133  TRP A N   1 
ATOM   514   C CA  . TRP A 1 78  ? -0.498  -10.678 -29.132  1.00 98.06  ? 133  TRP A CA  1 
ATOM   515   C C   . TRP A 1 78  ? 0.872   -10.216 -28.643  1.00 104.10 ? 133  TRP A C   1 
ATOM   516   O O   . TRP A 1 78  ? 0.975   -9.457  -27.681  1.00 110.53 ? 133  TRP A O   1 
ATOM   517   C CB  . TRP A 1 78  ? -1.393  -9.467  -29.365  1.00 99.30  ? 133  TRP A CB  1 
ATOM   518   C CG  . TRP A 1 78  ? -0.773  -8.525  -30.327  1.00 99.41  ? 133  TRP A CG  1 
ATOM   519   C CD1 . TRP A 1 78  ? 0.108   -7.525  -30.039  1.00 95.45  ? 133  TRP A CD1 1 
ATOM   520   C CD2 . TRP A 1 78  ? -0.947  -8.513  -31.748  1.00 94.95  ? 133  TRP A CD2 1 
ATOM   521   N NE1 . TRP A 1 78  ? 0.482   -6.882  -31.191  1.00 97.82  ? 133  TRP A NE1 1 
ATOM   522   C CE2 . TRP A 1 78  ? -0.153  -7.468  -32.254  1.00 92.88  ? 133  TRP A CE2 1 
ATOM   523   C CE3 . TRP A 1 78  ? -1.705  -9.279  -32.640  1.00 89.07  ? 133  TRP A CE3 1 
ATOM   524   C CZ2 . TRP A 1 78  ? -0.092  -7.170  -33.610  1.00 83.55  ? 133  TRP A CZ2 1 
ATOM   525   C CZ3 . TRP A 1 78  ? -1.642  -8.982  -33.983  1.00 82.66  ? 133  TRP A CZ3 1 
ATOM   526   C CH2 . TRP A 1 78  ? -0.843  -7.936  -34.456  1.00 81.95  ? 133  TRP A CH2 1 
ATOM   527   N N   . ALA A 1 79  ? 1.920   -10.662 -29.330  1.00 105.19 ? 134  ALA A N   1 
ATOM   528   C CA  . ALA A 1 79  ? 3.297   -10.416 -28.898  1.00 110.24 ? 134  ALA A CA  1 
ATOM   529   C C   . ALA A 1 79  ? 3.874   -9.050  -29.273  1.00 100.42 ? 134  ALA A C   1 
ATOM   530   O O   . ALA A 1 79  ? 4.553   -8.420  -28.460  1.00 100.20 ? 134  ALA A O   1 
ATOM   531   C CB  . ALA A 1 79  ? 4.215   -11.528 -29.398  1.00 120.30 ? 134  ALA A CB  1 
ATOM   532   N N   . LEU A 1 80  ? 3.612   -8.603  -30.499  1.00 93.37  ? 135  LEU A N   1 
ATOM   533   C CA  . LEU A 1 80  ? 4.318   -7.449  -31.062  1.00 93.68  ? 135  LEU A CA  1 
ATOM   534   C C   . LEU A 1 80  ? 3.930   -6.093  -30.482  1.00 94.70  ? 135  LEU A C   1 
ATOM   535   O O   . LEU A 1 80  ? 4.577   -5.082  -30.762  1.00 91.75  ? 135  LEU A O   1 
ATOM   536   C CB  . LEU A 1 80  ? 4.186   -7.424  -32.584  1.00 90.49  ? 135  LEU A CB  1 
ATOM   537   C CG  . LEU A 1 80  ? 5.366   -8.070  -33.308  1.00 96.65  ? 135  LEU A CG  1 
ATOM   538   C CD1 . LEU A 1 80  ? 5.162   -8.022  -34.809  1.00 95.76  ? 135  LEU A CD1 1 
ATOM   539   C CD2 . LEU A 1 80  ? 6.665   -7.377  -32.913  1.00 96.89  ? 135  LEU A CD2 1 
ATOM   540   N N   . GLY A 1 81  ? 2.876   -6.069  -29.679  1.00 98.25  ? 136  GLY A N   1 
ATOM   541   C CA  . GLY A 1 81  ? 2.517   -4.853  -28.979  1.00 100.13 ? 136  GLY A CA  1 
ATOM   542   C C   . GLY A 1 81  ? 1.505   -3.997  -29.705  1.00 101.01 ? 136  GLY A C   1 
ATOM   543   O O   . GLY A 1 81  ? 0.841   -4.440  -30.639  1.00 100.93 ? 136  GLY A O   1 
ATOM   544   N N   . ASN A 1 82  ? 1.398   -2.749  -29.272  1.00 105.25 ? 137  ASN A N   1 
ATOM   545   C CA  . ASN A 1 82  ? 0.325   -1.879  -29.728  1.00 110.16 ? 137  ASN A CA  1 
ATOM   546   C C   . ASN A 1 82  ? 0.425   -1.432  -31.189  1.00 107.54 ? 137  ASN A C   1 
ATOM   547   O O   . ASN A 1 82  ? -0.509  -1.643  -31.970  1.00 104.95 ? 137  ASN A O   1 
ATOM   548   C CB  . ASN A 1 82  ? 0.211   -0.668  -28.798  1.00 113.85 ? 137  ASN A CB  1 
ATOM   549   C CG  . ASN A 1 82  ? 0.226   -1.058  -27.327  1.00 117.01 ? 137  ASN A CG  1 
ATOM   550   O OD1 . ASN A 1 82  ? 0.954   -0.471  -26.526  1.00 124.76 ? 137  ASN A OD1 1 
ATOM   551   N ND2 . ASN A 1 82  ? -0.571  -2.059  -26.968  1.00 113.16 ? 137  ASN A ND2 1 
ATOM   552   N N   . LEU A 1 83  ? 1.554   -0.834  -31.563  1.00 103.84 ? 138  LEU A N   1 
ATOM   553   C CA  . LEU A 1 83  ? 1.695   -0.244  -32.896  1.00 101.49 ? 138  LEU A CA  1 
ATOM   554   C C   . LEU A 1 83  ? 1.660   -1.284  -34.019  1.00 102.78 ? 138  LEU A C   1 
ATOM   555   O O   . LEU A 1 83  ? 1.111   -1.026  -35.092  1.00 98.86  ? 138  LEU A O   1 
ATOM   556   C CB  . LEU A 1 83  ? 2.965   0.610   -32.991  1.00 98.54  ? 138  LEU A CB  1 
ATOM   557   C CG  . LEU A 1 83  ? 3.168   1.443   -34.264  1.00 85.09  ? 138  LEU A CG  1 
ATOM   558   C CD1 . LEU A 1 83  ? 4.168   2.564   -34.021  1.00 90.08  ? 138  LEU A CD1 1 
ATOM   559   C CD2 . LEU A 1 83  ? 3.610   0.584   -35.440  1.00 83.32  ? 138  LEU A CD2 1 
ATOM   560   N N   . ALA A 1 84  ? 2.258   -2.447  -33.781  1.00 103.29 ? 139  ALA A N   1 
ATOM   561   C CA  . ALA A 1 84  ? 2.221   -3.520  -34.766  1.00 94.77  ? 139  ALA A CA  1 
ATOM   562   C C   . ALA A 1 84  ? 0.769   -3.892  -35.022  1.00 90.79  ? 139  ALA A C   1 
ATOM   563   O O   . ALA A 1 84  ? 0.348   -4.085  -36.158  1.00 83.63  ? 139  ALA A O   1 
ATOM   564   C CB  . ALA A 1 84  ? 2.995   -4.721  -34.261  1.00 92.51  ? 139  ALA A CB  1 
ATOM   565   N N   . CYS A 1 85  ? 0.018   -3.974  -33.931  1.00 92.32  ? 140  CYS A N   1 
ATOM   566   C CA  . CYS A 1 85  ? -1.418  -4.260  -33.926  1.00 89.21  ? 140  CYS A CA  1 
ATOM   567   C C   . CYS A 1 85  ? -2.173  -3.213  -34.755  1.00 87.82  ? 140  CYS A C   1 
ATOM   568   O O   . CYS A 1 85  ? -3.072  -3.559  -35.531  1.00 83.58  ? 140  CYS A O   1 
ATOM   569   C CB  . CYS A 1 85  ? -1.938  -4.266  -32.484  1.00 86.58  ? 140  CYS A CB  1 
ATOM   570   S SG  . CYS A 1 85  ? -3.756  -4.243  -32.316  1.00 91.22  ? 140  CYS A SG  1 
ATOM   571   N N   . ASP A 1 86  ? -1.804  -1.950  -34.574  1.00 92.85  ? 141  ASP A N   1 
ATOM   572   C CA  . ASP A 1 86  ? -2.443  -0.854  -35.285  1.00 89.68  ? 141  ASP A CA  1 
ATOM   573   C C   . ASP A 1 86  ? -2.193  -0.948  -36.790  1.00 87.96  ? 141  ASP A C   1 
ATOM   574   O O   . ASP A 1 86  ? -3.135  -0.939  -37.582  1.00 87.19  ? 141  ASP A O   1 
ATOM   575   C CB  . ASP A 1 86  ? -1.952  0.487   -34.734  1.00 99.25  ? 141  ASP A CB  1 
ATOM   576   C CG  . ASP A 1 86  ? -2.060  0.571   -33.221  1.00 103.18 ? 141  ASP A CG  1 
ATOM   577   O OD1 . ASP A 1 86  ? -2.872  -0.181  -32.638  1.00 92.97  ? 141  ASP A OD1 1 
ATOM   578   O OD2 . ASP A 1 86  ? -1.330  1.390   -32.617  1.00 106.78 ? 141  ASP A OD2 1 
ATOM   579   N N   . LEU A 1 87  ? -0.924  -1.052  -37.178  1.00 95.84  ? 142  LEU A N   1 
ATOM   580   C CA  . LEU A 1 87  ? -0.564  -1.153  -38.593  1.00 97.72  ? 142  LEU A CA  1 
ATOM   581   C C   . LEU A 1 87  ? -1.171  -2.385  -39.261  1.00 93.56  ? 142  LEU A C   1 
ATOM   582   O O   . LEU A 1 87  ? -1.691  -2.303  -40.377  1.00 87.32  ? 142  LEU A O   1 
ATOM   583   C CB  . LEU A 1 87  ? 0.955   -1.142  -38.785  1.00 93.31  ? 142  LEU A CB  1 
ATOM   584   C CG  . LEU A 1 87  ? 1.620   0.231   -38.710  1.00 86.21  ? 142  LEU A CG  1 
ATOM   585   C CD1 . LEU A 1 87  ? 3.054   0.158   -39.214  1.00 84.21  ? 142  LEU A CD1 1 
ATOM   586   C CD2 . LEU A 1 87  ? 0.822   1.240   -39.515  1.00 76.32  ? 142  LEU A CD2 1 
ATOM   587   N N   . TRP A 1 88  ? -1.104  -3.524  -38.579  1.00 90.79  ? 143  TRP A N   1 
ATOM   588   C CA  . TRP A 1 88  ? -1.695  -4.744  -39.105  1.00 81.08  ? 143  TRP A CA  1 
ATOM   589   C C   . TRP A 1 88  ? -3.170  -4.515  -39.403  1.00 82.44  ? 143  TRP A C   1 
ATOM   590   O O   . TRP A 1 88  ? -3.628  -4.721  -40.537  1.00 80.45  ? 143  TRP A O   1 
ATOM   591   C CB  . TRP A 1 88  ? -1.536  -5.903  -38.127  1.00 68.50  ? 143  TRP A CB  1 
ATOM   592   C CG  . TRP A 1 88  ? -2.170  -7.155  -38.629  1.00 67.07  ? 143  TRP A CG  1 
ATOM   593   C CD1 . TRP A 1 88  ? -1.840  -7.841  -39.761  1.00 73.04  ? 143  TRP A CD1 1 
ATOM   594   C CD2 . TRP A 1 88  ? -3.247  -7.875  -38.024  1.00 70.34  ? 143  TRP A CD2 1 
ATOM   595   N NE1 . TRP A 1 88  ? -2.647  -8.941  -39.898  1.00 77.09  ? 143  TRP A NE1 1 
ATOM   596   C CE2 . TRP A 1 88  ? -3.520  -8.986  -38.843  1.00 71.94  ? 143  TRP A CE2 1 
ATOM   597   C CE3 . TRP A 1 88  ? -4.007  -7.689  -36.867  1.00 78.72  ? 143  TRP A CE3 1 
ATOM   598   C CZ2 . TRP A 1 88  ? -4.520  -9.908  -38.545  1.00 75.18  ? 143  TRP A CZ2 1 
ATOM   599   C CZ3 . TRP A 1 88  ? -4.999  -8.605  -36.571  1.00 82.27  ? 143  TRP A CZ3 1 
ATOM   600   C CH2 . TRP A 1 88  ? -5.247  -9.701  -37.406  1.00 78.40  ? 143  TRP A CH2 1 
ATOM   601   N N   . LEU A 1 89  ? -3.912  -4.062  -38.395  1.00 83.65  ? 144  LEU A N   1 
ATOM   602   C CA  . LEU A 1 89  ? -5.329  -3.808  -38.611  1.00 81.33  ? 144  LEU A CA  1 
ATOM   603   C C   . LEU A 1 89  ? -5.539  -2.881  -39.804  1.00 75.97  ? 144  LEU A C   1 
ATOM   604   O O   . LEU A 1 89  ? -6.226  -3.233  -40.759  1.00 69.23  ? 144  LEU A O   1 
ATOM   605   C CB  . LEU A 1 89  ? -5.964  -3.200  -37.361  1.00 81.13  ? 144  LEU A CB  1 
ATOM   606   C CG  . LEU A 1 89  ? -6.093  -4.095  -36.131  1.00 81.15  ? 144  LEU A CG  1 
ATOM   607   C CD1 . LEU A 1 89  ? -6.611  -3.281  -34.960  1.00 86.74  ? 144  LEU A CD1 1 
ATOM   608   C CD2 . LEU A 1 89  ? -7.000  -5.284  -36.410  1.00 80.31  ? 144  LEU A CD2 1 
ATOM   609   N N   . SER A 1 90  ? -4.927  -1.703  -39.747  1.00 78.74  ? 145  SER A N   1 
ATOM   610   C CA  . SER A 1 90  ? -5.141  -0.666  -40.753  1.00 76.58  ? 145  SER A CA  1 
ATOM   611   C C   . SER A 1 90  ? -4.871  -1.165  -42.167  1.00 76.61  ? 145  SER A C   1 
ATOM   612   O O   . SER A 1 90  ? -5.706  -1.005  -43.055  1.00 78.02  ? 145  SER A O   1 
ATOM   613   C CB  . SER A 1 90  ? -4.279  0.562   -40.451  1.00 75.57  ? 145  SER A CB  1 
ATOM   614   O OG  . SER A 1 90  ? -2.909  0.210   -40.364  1.00 81.76  ? 145  SER A OG  1 
ATOM   615   N N   . ILE A 1 91  ? -3.704  -1.761  -42.378  1.00 71.66  ? 146  ILE A N   1 
ATOM   616   C CA  . ILE A 1 91  ? -3.399  -2.361  -43.665  1.00 71.19  ? 146  ILE A CA  1 
ATOM   617   C C   . ILE A 1 91  ? -4.511  -3.337  -44.034  1.00 74.44  ? 146  ILE A C   1 
ATOM   618   O O   . ILE A 1 91  ? -4.966  -3.377  -45.184  1.00 78.37  ? 146  ILE A O   1 
ATOM   619   C CB  . ILE A 1 91  ? -2.050  -3.099  -43.645  1.00 75.33  ? 146  ILE A CB  1 
ATOM   620   C CG1 . ILE A 1 91  ? -0.897  -2.100  -43.502  1.00 76.18  ? 146  ILE A CG1 1 
ATOM   621   C CG2 . ILE A 1 91  ? -1.881  -3.934  -44.904  1.00 71.89  ? 146  ILE A CG2 1 
ATOM   622   C CD1 . ILE A 1 91  ? 0.464   -2.747  -43.329  1.00 72.73  ? 146  ILE A CD1 1 
ATOM   623   N N   . ASP A 1 92  ? -4.966  -4.103  -43.047  1.00 68.26  ? 147  ASP A N   1 
ATOM   624   C CA  . ASP A 1 92  ? -5.980  -5.129  -43.283  1.00 72.04  ? 147  ASP A CA  1 
ATOM   625   C C   . ASP A 1 92  ? -7.337  -4.598  -43.785  1.00 75.53  ? 147  ASP A C   1 
ATOM   626   O O   . ASP A 1 92  ? -7.835  -5.031  -44.832  1.00 76.11  ? 147  ASP A O   1 
ATOM   627   C CB  . ASP A 1 92  ? -6.183  -5.972  -42.027  1.00 69.49  ? 147  ASP A CB  1 
ATOM   628   C CG  . ASP A 1 92  ? -6.656  -7.370  -42.346  1.00 79.28  ? 147  ASP A CG  1 
ATOM   629   O OD1 . ASP A 1 92  ? -6.297  -8.302  -41.598  1.00 88.50  ? 147  ASP A OD1 1 
ATOM   630   O OD2 . ASP A 1 92  ? -7.371  -7.539  -43.355  1.00 73.10  ? 147  ASP A OD2 1 
ATOM   631   N N   . TYR A 1 93  ? -7.933  -3.676  -43.031  1.00 73.98  ? 148  TYR A N   1 
ATOM   632   C CA  . TYR A 1 93  ? -9.239  -3.121  -43.373  1.00 65.57  ? 148  TYR A CA  1 
ATOM   633   C C   . TYR A 1 93  ? -9.172  -2.140  -44.535  1.00 62.96  ? 148  TYR A C   1 
ATOM   634   O O   . TYR A 1 93  ? -10.044 -2.142  -45.395  1.00 63.54  ? 148  TYR A O   1 
ATOM   635   C CB  . TYR A 1 93  ? -9.874  -2.445  -42.160  1.00 63.94  ? 148  TYR A CB  1 
ATOM   636   C CG  . TYR A 1 93  ? -10.499 -3.401  -41.174  1.00 61.98  ? 148  TYR A CG  1 
ATOM   637   C CD1 . TYR A 1 93  ? -9.715  -4.225  -40.384  1.00 67.51  ? 148  TYR A CD1 1 
ATOM   638   C CD2 . TYR A 1 93  ? -11.874 -3.465  -41.021  1.00 64.23  ? 148  TYR A CD2 1 
ATOM   639   C CE1 . TYR A 1 93  ? -10.284 -5.092  -39.472  1.00 67.09  ? 148  TYR A CE1 1 
ATOM   640   C CE2 . TYR A 1 93  ? -12.452 -4.326  -40.111  1.00 66.69  ? 148  TYR A CE2 1 
ATOM   641   C CZ  . TYR A 1 93  ? -11.653 -5.138  -39.338  1.00 69.20  ? 148  TYR A CZ  1 
ATOM   642   O OH  . TYR A 1 93  ? -12.234 -6.000  -38.433  1.00 70.67  ? 148  TYR A OH  1 
ATOM   643   N N   . VAL A 1 94  ? -8.155  -1.288  -44.555  1.00 59.85  ? 149  VAL A N   1 
ATOM   644   C CA  . VAL A 1 94  ? -7.967  -0.416  -45.704  1.00 58.07  ? 149  VAL A CA  1 
ATOM   645   C C   . VAL A 1 94  ? -7.929  -1.290  -46.945  1.00 59.09  ? 149  VAL A C   1 
ATOM   646   O O   . VAL A 1 94  ? -8.630  -1.021  -47.922  1.00 55.17  ? 149  VAL A O   1 
ATOM   647   C CB  . VAL A 1 94  ? -6.668  0.404   -45.618  1.00 53.39  ? 149  VAL A CB  1 
ATOM   648   C CG1 . VAL A 1 94  ? -6.331  0.997   -46.974  1.00 45.75  ? 149  VAL A CG1 1 
ATOM   649   C CG2 . VAL A 1 94  ? -6.804  1.494   -44.567  1.00 58.50  ? 149  VAL A CG2 1 
ATOM   650   N N   . ALA A 1 95  ? -7.137  -2.359  -46.882  1.00 62.93  ? 150  ALA A N   1 
ATOM   651   C CA  . ALA A 1 95  ? -6.978  -3.270  -48.013  1.00 66.50  ? 150  ALA A CA  1 
ATOM   652   C C   . ALA A 1 95  ? -8.277  -3.958  -48.444  1.00 64.81  ? 150  ALA A C   1 
ATOM   653   O O   . ALA A 1 95  ? -8.732  -3.771  -49.573  1.00 66.96  ? 150  ALA A O   1 
ATOM   654   C CB  . ALA A 1 95  ? -5.908  -4.308  -47.700  1.00 67.97  ? 150  ALA A CB  1 
ATOM   655   N N   . SER A 1 96  ? -8.880  -4.731  -47.544  1.00 59.63  ? 151  SER A N   1 
ATOM   656   C CA  . SER A 1 96  ? -10.101 -5.465  -47.875  1.00 57.50  ? 151  SER A CA  1 
ATOM   657   C C   . SER A 1 96  ? -11.203 -4.505  -48.333  1.00 59.64  ? 151  SER A C   1 
ATOM   658   O O   . SER A 1 96  ? -12.014 -4.819  -49.216  1.00 63.55  ? 151  SER A O   1 
ATOM   659   C CB  . SER A 1 96  ? -10.564 -6.315  -46.692  1.00 55.54  ? 151  SER A CB  1 
ATOM   660   O OG  . SER A 1 96  ? -10.334 -5.656  -45.467  1.00 62.06  ? 151  SER A OG  1 
ATOM   661   N N   . ASN A 1 97  ? -11.216 -3.324  -47.728  1.00 57.13  ? 152  ASN A N   1 
ATOM   662   C CA  . ASN A 1 97  ? -12.119 -2.260  -48.132  1.00 61.03  ? 152  ASN A CA  1 
ATOM   663   C C   . ASN A 1 97  ? -11.893 -1.937  -49.600  1.00 56.48  ? 152  ASN A C   1 
ATOM   664   O O   . ASN A 1 97  ? -12.801 -2.028  -50.422  1.00 49.82  ? 152  ASN A O   1 
ATOM   665   C CB  . ASN A 1 97  ? -11.874 -1.011  -47.281  1.00 64.57  ? 152  ASN A CB  1 
ATOM   666   C CG  . ASN A 1 97  ? -12.926 0.057   -47.499  1.00 63.39  ? 152  ASN A CG  1 
ATOM   667   O OD1 . ASN A 1 97  ? -14.097 -0.133  -47.164  1.00 61.47  ? 152  ASN A OD1 1 
ATOM   668   N ND2 . ASN A 1 97  ? -12.514 1.193   -48.052  1.00 55.50  ? 152  ASN A ND2 1 
ATOM   669   N N   . ALA A 1 98  ? -10.656 -1.582  -49.921  1.00 58.35  ? 153  ALA A N   1 
ATOM   670   C CA  . ALA A 1 98  ? -10.281 -1.277  -51.291  1.00 57.84  ? 153  ALA A CA  1 
ATOM   671   C C   . ALA A 1 98  ? -10.662 -2.430  -52.206  1.00 54.32  ? 153  ALA A C   1 
ATOM   672   O O   . ALA A 1 98  ? -10.840 -2.236  -53.404  1.00 57.89  ? 153  ALA A O   1 
ATOM   673   C CB  . ALA A 1 98  ? -8.788  -0.993  -51.384  1.00 61.27  ? 153  ALA A CB  1 
ATOM   674   N N   . SER A 1 99  ? -10.781 -3.627  -51.635  1.00 54.92  ? 154  SER A N   1 
ATOM   675   C CA  . SER A 1 99  ? -11.186 -4.821  -52.381  1.00 53.79  ? 154  SER A CA  1 
ATOM   676   C C   . SER A 1 99  ? -12.683 -4.807  -52.723  1.00 48.63  ? 154  SER A C   1 
ATOM   677   O O   . SER A 1 99  ? -13.086 -5.095  -53.863  1.00 47.49  ? 154  SER A O   1 
ATOM   678   C CB  . SER A 1 99  ? -10.811 -6.082  -51.592  1.00 54.64  ? 154  SER A CB  1 
ATOM   679   O OG  . SER A 1 99  ? -11.319 -7.257  -52.202  1.00 45.37  ? 154  SER A OG  1 
ATOM   680   N N   . VAL A 1 100 ? -13.507 -4.456  -51.741  1.00 46.45  ? 155  VAL A N   1 
ATOM   681   C CA  . VAL A 1 100 ? -14.933 -4.296  -52.010  1.00 44.87  ? 155  VAL A CA  1 
ATOM   682   C C   . VAL A 1 100 ? -15.176 -3.144  -52.990  1.00 50.51  ? 155  VAL A C   1 
ATOM   683   O O   . VAL A 1 100 ? -15.859 -3.315  -53.999  1.00 48.87  ? 155  VAL A O   1 
ATOM   684   C CB  . VAL A 1 100 ? -15.773 -4.107  -50.724  1.00 43.38  ? 155  VAL A CB  1 
ATOM   685   C CG1 . VAL A 1 100 ? -15.435 -5.184  -49.720  1.00 53.65  ? 155  VAL A CG1 1 
ATOM   686   C CG2 . VAL A 1 100 ? -15.543 -2.737  -50.115  1.00 51.85  ? 155  VAL A CG2 1 
ATOM   687   N N   . MET A 1 101 ? -14.597 -1.981  -52.702  1.00 54.33  ? 156  MET A N   1 
ATOM   688   C CA  . MET A 1 101 ? -14.737 -0.818  -53.576  1.00 49.95  ? 156  MET A CA  1 
ATOM   689   C C   . MET A 1 101 ? -14.208 -1.113  -54.976  1.00 51.83  ? 156  MET A C   1 
ATOM   690   O O   . MET A 1 101 ? -14.711 -0.586  -55.960  1.00 50.27  ? 156  MET A O   1 
ATOM   691   C CB  . MET A 1 101 ? -14.031 0.401   -52.981  1.00 47.76  ? 156  MET A CB  1 
ATOM   692   C CG  . MET A 1 101 ? -14.598 0.837   -51.648  1.00 55.77  ? 156  MET A CG  1 
ATOM   693   S SD  . MET A 1 101 ? -13.829 2.343   -51.036  1.00 120.15 ? 156  MET A SD  1 
ATOM   694   C CE  . MET A 1 101 ? -14.409 3.529   -52.245  1.00 65.45  ? 156  MET A CE  1 
ATOM   695   N N   . ASN A 1 102 ? -13.190 -1.960  -55.061  1.00 47.44  ? 157  ASN A N   1 
ATOM   696   C CA  . ASN A 1 102 ? -12.687 -2.406  -56.353  1.00 47.15  ? 157  ASN A CA  1 
ATOM   697   C C   . ASN A 1 102 ? -13.750 -3.215  -57.087  1.00 45.98  ? 157  ASN A C   1 
ATOM   698   O O   . ASN A 1 102 ? -14.027 -2.962  -58.264  1.00 45.10  ? 157  ASN A O   1 
ATOM   699   C CB  . ASN A 1 102 ? -11.410 -3.230  -56.192  1.00 52.32  ? 157  ASN A CB  1 
ATOM   700   C CG  . ASN A 1 102 ? -10.293 -2.760  -57.107  1.00 57.10  ? 157  ASN A CG  1 
ATOM   701   O OD1 . ASN A 1 102 ? -10.077 -3.316  -58.185  1.00 59.18  ? 157  ASN A OD1 1 
ATOM   702   N ND2 . ASN A 1 102 ? -9.575  -1.728  -56.678  1.00 60.10  ? 157  ASN A ND2 1 
ATOM   703   N N   . LEU A 1 103 ? -14.350 -4.183  -56.395  1.00 45.73  ? 158  LEU A N   1 
ATOM   704   C CA  . LEU A 1 103 ? -15.463 -4.933  -56.975  1.00 47.17  ? 158  LEU A CA  1 
ATOM   705   C C   . LEU A 1 103 ? -16.575 -4.024  -57.494  1.00 49.16  ? 158  LEU A C   1 
ATOM   706   O O   . LEU A 1 103 ? -17.052 -4.184  -58.624  1.00 49.91  ? 158  LEU A O   1 
ATOM   707   C CB  . LEU A 1 103 ? -16.027 -5.923  -55.963  1.00 45.73  ? 158  LEU A CB  1 
ATOM   708   C CG  . LEU A 1 103 ? -15.175 -7.181  -55.831  1.00 49.14  ? 158  LEU A CG  1 
ATOM   709   C CD1 . LEU A 1 103 ? -15.898 -8.233  -55.008  1.00 56.44  ? 158  LEU A CD1 1 
ATOM   710   C CD2 . LEU A 1 103 ? -14.841 -7.705  -57.214  1.00 41.79  ? 158  LEU A CD2 1 
ATOM   711   N N   . LEU A 1 104 ? -16.982 -3.067  -56.666  1.00 45.02  ? 159  LEU A N   1 
ATOM   712   C CA  . LEU A 1 104 ? -17.978 -2.080  -57.075  1.00 46.92  ? 159  LEU A CA  1 
ATOM   713   C C   . LEU A 1 104 ? -17.544 -1.395  -58.366  1.00 50.62  ? 159  LEU A C   1 
ATOM   714   O O   . LEU A 1 104 ? -18.256 -1.443  -59.372  1.00 47.39  ? 159  LEU A O   1 
ATOM   715   C CB  . LEU A 1 104 ? -18.158 -1.012  -55.992  1.00 42.22  ? 159  LEU A CB  1 
ATOM   716   C CG  . LEU A 1 104 ? -19.196 -1.271  -54.908  1.00 38.67  ? 159  LEU A CG  1 
ATOM   717   C CD1 . LEU A 1 104 ? -19.093 -0.205  -53.832  1.00 37.92  ? 159  LEU A CD1 1 
ATOM   718   C CD2 . LEU A 1 104 ? -20.585 -1.319  -55.513  1.00 37.58  ? 159  LEU A CD2 1 
ATOM   719   N N   . VAL A 1 105 ? -16.361 -0.785  -58.332  1.00 50.07  ? 160  VAL A N   1 
ATOM   720   C CA  . VAL A 1 105 ? -15.819 -0.066  -59.476  1.00 47.50  ? 160  VAL A CA  1 
ATOM   721   C C   . VAL A 1 105 ? -15.967 -0.917  -60.721  1.00 56.35  ? 160  VAL A C   1 
ATOM   722   O O   . VAL A 1 105 ? -16.369 -0.425  -61.777  1.00 59.47  ? 160  VAL A O   1 
ATOM   723   C CB  . VAL A 1 105 ? -14.331 0.259   -59.275  1.00 45.61  ? 160  VAL A CB  1 
ATOM   724   C CG1 . VAL A 1 105 ? -13.659 0.541   -60.609  1.00 53.45  ? 160  VAL A CG1 1 
ATOM   725   C CG2 . VAL A 1 105 ? -14.168 1.430   -58.331  1.00 45.96  ? 160  VAL A CG2 1 
ATOM   726   N N   . ILE A 1 106 ? -15.637 -2.198  -60.588  1.00 57.45  ? 161  ILE A N   1 
ATOM   727   C CA  . ILE A 1 106 ? -15.824 -3.152  -61.671  1.00 53.37  ? 161  ILE A CA  1 
ATOM   728   C C   . ILE A 1 106 ? -17.281 -3.180  -62.161  1.00 56.19  ? 161  ILE A C   1 
ATOM   729   O O   . ILE A 1 106 ? -17.568 -2.822  -63.320  1.00 64.11  ? 161  ILE A O   1 
ATOM   730   C CB  . ILE A 1 106 ? -15.339 -4.550  -61.259  1.00 43.58  ? 161  ILE A CB  1 
ATOM   731   C CG1 . ILE A 1 106 ? -13.823 -4.535  -61.062  1.00 47.04  ? 161  ILE A CG1 1 
ATOM   732   C CG2 . ILE A 1 106 ? -15.709 -5.574  -62.302  1.00 45.11  ? 161  ILE A CG2 1 
ATOM   733   C CD1 . ILE A 1 106 ? -13.228 -5.887  -60.748  1.00 51.44  ? 161  ILE A CD1 1 
ATOM   734   N N   . SER A 1 107 ? -18.200 -3.582  -61.284  1.00 49.42  ? 162  SER A N   1 
ATOM   735   C CA  . SER A 1 107 ? -19.606 -3.695  -61.676  1.00 51.98  ? 162  SER A CA  1 
ATOM   736   C C   . SER A 1 107 ? -20.109 -2.443  -62.378  1.00 52.53  ? 162  SER A C   1 
ATOM   737   O O   . SER A 1 107 ? -20.656 -2.503  -63.485  1.00 53.52  ? 162  SER A O   1 
ATOM   738   C CB  . SER A 1 107 ? -20.488 -3.977  -60.463  1.00 51.00  ? 162  SER A CB  1 
ATOM   739   O OG  . SER A 1 107 ? -20.314 -5.303  -60.009  1.00 55.24  ? 162  SER A OG  1 
ATOM   740   N N   . PHE A 1 108 ? -19.917 -1.307  -61.721  1.00 50.45  ? 163  PHE A N   1 
ATOM   741   C CA  . PHE A 1 108 ? -20.356 -0.033  -62.260  1.00 50.78  ? 163  PHE A CA  1 
ATOM   742   C C   . PHE A 1 108 ? -19.712 0.239   -63.606  1.00 54.56  ? 163  PHE A C   1 
ATOM   743   O O   . PHE A 1 108 ? -20.344 0.799   -64.498  1.00 56.77  ? 163  PHE A O   1 
ATOM   744   C CB  . PHE A 1 108 ? -20.051 1.100   -61.286  1.00 46.85  ? 163  PHE A CB  1 
ATOM   745   C CG  . PHE A 1 108 ? -21.220 1.491   -60.444  1.00 40.38  ? 163  PHE A CG  1 
ATOM   746   C CD1 . PHE A 1 108 ? -21.152 1.436   -59.065  1.00 39.34  ? 163  PHE A CD1 1 
ATOM   747   C CD2 . PHE A 1 108 ? -22.398 1.904   -61.036  1.00 42.61  ? 163  PHE A CD2 1 
ATOM   748   C CE1 . PHE A 1 108 ? -22.238 1.801   -58.291  1.00 42.80  ? 163  PHE A CE1 1 
ATOM   749   C CE2 . PHE A 1 108 ? -23.488 2.265   -60.270  1.00 49.72  ? 163  PHE A CE2 1 
ATOM   750   C CZ  . PHE A 1 108 ? -23.408 2.217   -58.896  1.00 47.32  ? 163  PHE A CZ  1 
ATOM   751   N N   . ASP A 1 109 ? -18.452 -0.158  -63.748  1.00 52.65  ? 164  ASP A N   1 
ATOM   752   C CA  . ASP A 1 109 ? -17.761 -0.017  -65.022  1.00 57.64  ? 164  ASP A CA  1 
ATOM   753   C C   . ASP A 1 109 ? -18.518 -0.739  -66.129  1.00 60.73  ? 164  ASP A C   1 
ATOM   754   O O   . ASP A 1 109 ? -19.002 -0.107  -67.075  1.00 58.82  ? 164  ASP A O   1 
ATOM   755   C CB  . ASP A 1 109 ? -16.325 -0.527  -64.944  1.00 56.89  ? 164  ASP A CB  1 
ATOM   756   C CG  . ASP A 1 109 ? -15.675 -0.631  -66.312  1.00 64.24  ? 164  ASP A CG  1 
ATOM   757   O OD1 . ASP A 1 109 ? -15.307 0.422   -66.879  1.00 62.05  ? 164  ASP A OD1 1 
ATOM   758   O OD2 . ASP A 1 109 ? -15.537 -1.765  -66.821  1.00 64.93  ? 164  ASP A OD2 1 
ATOM   759   N N   . ARG A 1 110 ? -18.620 -2.062  -66.016  1.00 61.24  ? 165  ARG A N   1 
ATOM   760   C CA  . ARG A 1 110 ? -19.339 -2.832  -67.035  1.00 62.67  ? 165  ARG A CA  1 
ATOM   761   C C   . ARG A 1 110 ? -20.748 -2.276  -67.292  1.00 60.31  ? 165  ARG A C   1 
ATOM   762   O O   . ARG A 1 110 ? -21.233 -2.262  -68.435  1.00 60.18  ? 165  ARG A O   1 
ATOM   763   C CB  . ARG A 1 110 ? -19.386 -4.323  -66.683  1.00 57.48  ? 165  ARG A CB  1 
ATOM   764   C CG  . ARG A 1 110 ? -18.141 -5.088  -67.093  1.00 51.03  ? 165  ARG A CG  1 
ATOM   765   C CD  . ARG A 1 110 ? -18.400 -6.579  -67.163  1.00 61.93  ? 165  ARG A CD  1 
ATOM   766   N NE  . ARG A 1 110 ? -17.246 -7.302  -67.694  1.00 74.02  ? 165  ARG A NE  1 
ATOM   767   C CZ  . ARG A 1 110 ? -16.208 -7.696  -66.961  1.00 79.30  ? 165  ARG A CZ  1 
ATOM   768   N NH1 . ARG A 1 110 ? -16.179 -7.441  -65.659  1.00 71.14  ? 165  ARG A NH1 1 
ATOM   769   N NH2 . ARG A 1 110 ? -15.196 -8.344  -67.525  1.00 79.17  ? 165  ARG A NH2 1 
ATOM   770   N N   . TYR A 1 111 ? -21.394 -1.797  -66.232  1.00 55.67  ? 166  TYR A N   1 
ATOM   771   C CA  . TYR A 1 111 ? -22.715 -1.197  -66.366  1.00 49.57  ? 166  TYR A CA  1 
ATOM   772   C C   . TYR A 1 111 ? -22.664 0.007   -67.291  1.00 56.66  ? 166  TYR A C   1 
ATOM   773   O O   . TYR A 1 111 ? -23.397 0.072   -68.270  1.00 59.93  ? 166  TYR A O   1 
ATOM   774   C CB  . TYR A 1 111 ? -23.259 -0.776  -65.008  1.00 49.75  ? 166  TYR A CB  1 
ATOM   775   C CG  . TYR A 1 111 ? -24.749 -0.512  -64.984  1.00 53.59  ? 166  TYR A CG  1 
ATOM   776   C CD1 . TYR A 1 111 ? -25.656 -1.559  -65.041  1.00 52.67  ? 166  TYR A CD1 1 
ATOM   777   C CD2 . TYR A 1 111 ? -25.248 0.781   -64.878  1.00 58.80  ? 166  TYR A CD2 1 
ATOM   778   C CE1 . TYR A 1 111 ? -27.014 -1.330  -65.004  1.00 55.70  ? 166  TYR A CE1 1 
ATOM   779   C CE2 . TYR A 1 111 ? -26.607 1.021   -64.841  1.00 57.21  ? 166  TYR A CE2 1 
ATOM   780   C CZ  . TYR A 1 111 ? -27.485 -0.040  -64.904  1.00 59.37  ? 166  TYR A CZ  1 
ATOM   781   O OH  . TYR A 1 111 ? -28.843 0.184   -64.869  1.00 66.76  ? 166  TYR A OH  1 
ATOM   782   N N   . PHE A 1 112 ? -21.787 0.956   -66.983  1.00 59.11  ? 167  PHE A N   1 
ATOM   783   C CA  . PHE A 1 112 ? -21.663 2.171   -67.785  1.00 61.03  ? 167  PHE A CA  1 
ATOM   784   C C   . PHE A 1 112 ? -21.228 1.849   -69.212  1.00 53.79  ? 167  PHE A C   1 
ATOM   785   O O   . PHE A 1 112 ? -21.489 2.607   -70.142  1.00 49.57  ? 167  PHE A O   1 
ATOM   786   C CB  . PHE A 1 112 ? -20.706 3.153   -67.117  1.00 56.13  ? 167  PHE A CB  1 
ATOM   787   C CG  . PHE A 1 112 ? -21.248 3.756   -65.857  1.00 53.48  ? 167  PHE A CG  1 
ATOM   788   C CD1 . PHE A 1 112 ? -22.515 4.317   -65.831  1.00 54.30  ? 167  PHE A CD1 1 
ATOM   789   C CD2 . PHE A 1 112 ? -20.496 3.752   -64.692  1.00 55.44  ? 167  PHE A CD2 1 
ATOM   790   C CE1 . PHE A 1 112 ? -23.018 4.874   -64.668  1.00 58.98  ? 167  PHE A CE1 1 
ATOM   791   C CE2 . PHE A 1 112 ? -20.992 4.307   -63.520  1.00 55.15  ? 167  PHE A CE2 1 
ATOM   792   C CZ  . PHE A 1 112 ? -22.254 4.870   -63.509  1.00 58.42  ? 167  PHE A CZ  1 
ATOM   793   N N   . SER A 1 113 ? -20.597 0.694   -69.376  1.00 52.51  ? 168  SER A N   1 
ATOM   794   C CA  . SER A 1 113 ? -20.292 0.158   -70.694  1.00 57.59  ? 168  SER A CA  1 
ATOM   795   C C   . SER A 1 113 ? -21.599 -0.148  -71.429  1.00 56.47  ? 168  SER A C   1 
ATOM   796   O O   . SER A 1 113 ? -21.835 0.362   -72.525  1.00 53.03  ? 168  SER A O   1 
ATOM   797   C CB  . SER A 1 113 ? -19.469 -1.102  -70.564  1.00 61.62  ? 168  SER A CB  1 
ATOM   798   O OG  . SER A 1 113 ? -18.259 -0.878  -69.871  1.00 59.53  ? 168  SER A OG  1 
ATOM   799   N N   . ILE A 1 114 ? -22.473 -0.942  -70.803  1.00 57.71  ? 169  ILE A N   1 
ATOM   800   C CA  . ILE A 1 114 ? -23.752 -1.308  -71.444  1.00 58.54  ? 169  ILE A CA  1 
ATOM   801   C C   . ILE A 1 114 ? -24.680 -0.107  -71.668  1.00 58.18  ? 169  ILE A C   1 
ATOM   802   O O   . ILE A 1 114 ? -25.184 0.100   -72.773  1.00 61.09  ? 169  ILE A O   1 
ATOM   803   C CB  . ILE A 1 114 ? -24.541 -2.397  -70.657  1.00 49.87  ? 169  ILE A CB  1 
ATOM   804   C CG1 . ILE A 1 114 ? -24.005 -3.797  -70.956  1.00 52.27  ? 169  ILE A CG1 1 
ATOM   805   C CG2 . ILE A 1 114 ? -26.006 -2.360  -71.020  1.00 47.62  ? 169  ILE A CG2 1 
ATOM   806   C CD1 . ILE A 1 114 ? -22.603 -4.054  -70.440  1.00 61.79  ? 169  ILE A CD1 1 
ATOM   807   N N   . THR A 1 115 ? -24.908 0.678   -70.617  1.00 53.58  ? 170  THR A N   1 
ATOM   808   C CA  . THR A 1 115 ? -25.888 1.765   -70.666  1.00 58.17  ? 170  THR A CA  1 
ATOM   809   C C   . THR A 1 115 ? -25.394 3.055   -71.329  1.00 56.36  ? 170  THR A C   1 
ATOM   810   O O   . THR A 1 115 ? -26.174 3.765   -71.967  1.00 57.89  ? 170  THR A O   1 
ATOM   811   C CB  . THR A 1 115 ? -26.466 2.090   -69.269  1.00 56.72  ? 170  THR A CB  1 
ATOM   812   O OG1 . THR A 1 115 ? -25.404 2.413   -68.363  1.00 61.12  ? 170  THR A OG1 1 
ATOM   813   C CG2 . THR A 1 115 ? -27.252 0.901   -68.725  1.00 54.89  ? 170  THR A CG2 1 
ATOM   814   N N   . ARG A 1 116 ? -24.108 3.357   -71.181  1.00 50.17  ? 171  ARG A N   1 
ATOM   815   C CA  . ARG A 1 116 ? -23.555 4.584   -71.749  1.00 49.56  ? 171  ARG A CA  1 
ATOM   816   C C   . ARG A 1 116 ? -22.474 4.287   -72.786  1.00 53.90  ? 171  ARG A C   1 
ATOM   817   O O   . ARG A 1 116 ? -21.283 4.450   -72.519  1.00 52.78  ? 171  ARG A O   1 
ATOM   818   C CB  . ARG A 1 116 ? -23.030 5.499   -70.637  1.00 52.86  ? 171  ARG A CB  1 
ATOM   819   C CG  . ARG A 1 116 ? -24.144 6.092   -69.786  1.00 58.62  ? 171  ARG A CG  1 
ATOM   820   C CD  . ARG A 1 116 ? -23.651 6.738   -68.499  1.00 55.28  ? 171  ARG A CD  1 
ATOM   821   N NE  . ARG A 1 116 ? -24.775 7.261   -67.719  1.00 55.27  ? 171  ARG A NE  1 
ATOM   822   C CZ  . ARG A 1 116 ? -24.693 7.724   -66.473  1.00 61.07  ? 171  ARG A CZ  1 
ATOM   823   N NH1 . ARG A 1 116 ? -23.533 7.736   -65.834  1.00 65.10  ? 171  ARG A NH1 1 
ATOM   824   N NH2 . ARG A 1 116 ? -25.781 8.175   -65.863  1.00 57.60  ? 171  ARG A NH2 1 
ATOM   825   N N   . PRO A 1 117 ? -22.898 3.840   -73.981  1.00 55.97  ? 172  PRO A N   1 
ATOM   826   C CA  . PRO A 1 117 ? -21.989 3.420   -75.053  1.00 53.47  ? 172  PRO A CA  1 
ATOM   827   C C   . PRO A 1 117 ? -21.059 4.531   -75.540  1.00 56.49  ? 172  PRO A C   1 
ATOM   828   O O   . PRO A 1 117 ? -19.849 4.328   -75.613  1.00 62.39  ? 172  PRO A O   1 
ATOM   829   C CB  . PRO A 1 117 ? -22.947 3.031   -76.189  1.00 52.26  ? 172  PRO A CB  1 
ATOM   830   C CG  . PRO A 1 117 ? -24.272 2.800   -75.534  1.00 47.83  ? 172  PRO A CG  1 
ATOM   831   C CD  . PRO A 1 117 ? -24.313 3.753   -74.387  1.00 50.66  ? 172  PRO A CD  1 
ATOM   832   N N   . LEU A 1 118 ? -21.621 5.698   -75.840  1.00 55.06  ? 173  LEU A N   1 
ATOM   833   C CA  . LEU A 1 118 ? -20.866 6.806   -76.416  1.00 51.69  ? 173  LEU A CA  1 
ATOM   834   C C   . LEU A 1 118 ? -20.017 7.518   -75.383  1.00 50.53  ? 173  LEU A C   1 
ATOM   835   O O   . LEU A 1 118 ? -18.846 7.802   -75.615  1.00 50.16  ? 173  LEU A O   1 
ATOM   836   C CB  . LEU A 1 118 ? -21.825 7.817   -77.041  1.00 54.51  ? 173  LEU A CB  1 
ATOM   837   C CG  . LEU A 1 118 ? -21.894 7.861   -78.566  1.00 53.81  ? 173  LEU A CG  1 
ATOM   838   C CD1 . LEU A 1 118 ? -22.056 6.464   -79.149  1.00 49.04  ? 173  LEU A CD1 1 
ATOM   839   C CD2 . LEU A 1 118 ? -23.022 8.769   -79.003  1.00 50.37  ? 173  LEU A CD2 1 
ATOM   840   N N   . THR A 1 119 ? -20.631 7.813   -74.246  1.00 51.31  ? 174  THR A N   1 
ATOM   841   C CA  . THR A 1 119 ? -19.991 8.594   -73.199  1.00 56.03  ? 174  THR A CA  1 
ATOM   842   C C   . THR A 1 119 ? -18.901 7.816   -72.472  1.00 58.59  ? 174  THR A C   1 
ATOM   843   O O   . THR A 1 119 ? -17.865 8.376   -72.110  1.00 55.86  ? 174  THR A O   1 
ATOM   844   C CB  . THR A 1 119 ? -21.021 9.060   -72.170  1.00 59.76  ? 174  THR A CB  1 
ATOM   845   O OG1 . THR A 1 119 ? -22.106 9.697   -72.850  1.00 57.87  ? 174  THR A OG1 1 
ATOM   846   C CG2 . THR A 1 119 ? -20.390 10.031  -71.190  1.00 68.53  ? 174  THR A CG2 1 
ATOM   847   N N   . TYR A 1 120 ? -19.139 6.522   -72.275  1.00 59.90  ? 175  TYR A N   1 
ATOM   848   C CA  . TYR A 1 120 ? -18.283 5.687   -71.437  1.00 58.01  ? 175  TYR A CA  1 
ATOM   849   C C   . TYR A 1 120 ? -17.392 4.729   -72.236  1.00 61.39  ? 175  TYR A C   1 
ATOM   850   O O   . TYR A 1 120 ? -16.164 4.853   -72.230  1.00 59.34  ? 175  TYR A O   1 
ATOM   851   C CB  . TYR A 1 120 ? -19.152 4.894   -70.462  1.00 52.25  ? 175  TYR A CB  1 
ATOM   852   C CG  . TYR A 1 120 ? -18.397 4.369   -69.276  1.00 53.98  ? 175  TYR A CG  1 
ATOM   853   C CD1 . TYR A 1 120 ? -18.238 5.146   -68.141  1.00 57.89  ? 175  TYR A CD1 1 
ATOM   854   C CD2 . TYR A 1 120 ? -17.845 3.098   -69.285  1.00 58.20  ? 175  TYR A CD2 1 
ATOM   855   C CE1 . TYR A 1 120 ? -17.549 4.677   -67.041  1.00 58.97  ? 175  TYR A CE1 1 
ATOM   856   C CE2 . TYR A 1 120 ? -17.149 2.616   -68.191  1.00 62.70  ? 175  TYR A CE2 1 
ATOM   857   C CZ  . TYR A 1 120 ? -17.005 3.411   -67.068  1.00 66.79  ? 175  TYR A CZ  1 
ATOM   858   O OH  . TYR A 1 120 ? -16.318 2.943   -65.967  1.00 70.48  ? 175  TYR A OH  1 
ATOM   859   N N   . ARG A 1 121 ? -18.016 3.768   -72.910  1.00 60.35  ? 176  ARG A N   1 
ATOM   860   C CA  . ARG A 1 121 ? -17.277 2.787   -73.696  1.00 58.48  ? 176  ARG A CA  1 
ATOM   861   C C   . ARG A 1 121 ? -16.257 3.440   -74.622  1.00 57.31  ? 176  ARG A C   1 
ATOM   862   O O   . ARG A 1 121 ? -15.142 2.952   -74.768  1.00 60.64  ? 176  ARG A O   1 
ATOM   863   C CB  . ARG A 1 121 ? -18.235 1.904   -74.512  1.00 59.53  ? 176  ARG A CB  1 
ATOM   864   C CG  . ARG A 1 121 ? -18.606 0.583   -73.843  1.00 62.47  ? 176  ARG A CG  1 
ATOM   865   C CD  . ARG A 1 121 ? -19.403 -0.332  -74.774  1.00 63.59  ? 176  ARG A CD  1 
ATOM   866   N NE  . ARG A 1 121 ? -18.740 -0.538  -76.060  1.00 70.91  ? 176  ARG A NE  1 
ATOM   867   C CZ  . ARG A 1 121 ? -17.692 -1.337  -76.249  1.00 77.36  ? 176  ARG A CZ  1 
ATOM   868   N NH1 . ARG A 1 121 ? -17.168 -2.010  -75.234  1.00 74.35  ? 176  ARG A NH1 1 
ATOM   869   N NH2 . ARG A 1 121 ? -17.158 -1.457  -77.457  1.00 79.65  ? 176  ARG A NH2 1 
ATOM   870   N N   . ALA A 1 122 ? -16.647 4.553   -75.236  1.00 56.09  ? 177  ALA A N   1 
ATOM   871   C CA  . ALA A 1 122 ? -15.832 5.212   -76.260  1.00 58.70  ? 177  ALA A CA  1 
ATOM   872   C C   . ALA A 1 122 ? -14.548 5.857   -75.734  1.00 57.76  ? 177  ALA A C   1 
ATOM   873   O O   . ALA A 1 122 ? -13.512 5.838   -76.403  1.00 53.95  ? 177  ALA A O   1 
ATOM   874   C CB  . ALA A 1 122 ? -16.667 6.241   -77.009  1.00 58.96  ? 177  ALA A CB  1 
ATOM   875   N N   . LYS A 1 123 ? -14.629 6.463   -74.558  1.00 59.14  ? 178  LYS A N   1 
ATOM   876   C CA  . LYS A 1 123 ? -13.487 7.174   -73.994  1.00 67.21  ? 178  LYS A CA  1 
ATOM   877   C C   . LYS A 1 123 ? -12.687 6.417   -72.922  1.00 65.69  ? 178  LYS A C   1 
ATOM   878   O O   . LYS A 1 123 ? -11.714 6.946   -72.386  1.00 72.69  ? 178  LYS A O   1 
ATOM   879   C CB  . LYS A 1 123 ? -13.925 8.556   -73.500  1.00 80.09  ? 178  LYS A CB  1 
ATOM   880   C CG  . LYS A 1 123 ? -14.560 9.390   -74.614  1.00 82.32  ? 178  LYS A CG  1 
ATOM   881   C CD  . LYS A 1 123 ? -14.858 10.817  -74.192  1.00 87.03  ? 178  LYS A CD  1 
ATOM   882   C CE  . LYS A 1 123 ? -15.235 11.659  -75.402  1.00 91.91  ? 178  LYS A CE  1 
ATOM   883   N NZ  . LYS A 1 123 ? -14.137 11.710  -76.417  1.00 83.48  ? 178  LYS A NZ  1 
ATOM   884   N N   . ARG A 1 124 ? -13.079 5.183   -72.621  1.00 60.53  ? 179  ARG A N   1 
ATOM   885   C CA  . ARG A 1 124 ? -12.458 4.429   -71.529  1.00 59.31  ? 179  ARG A CA  1 
ATOM   886   C C   . ARG A 1 124 ? -11.091 3.834   -71.863  1.00 58.51  ? 179  ARG A C   1 
ATOM   887   O O   . ARG A 1 124 ? -10.928 3.153   -72.869  1.00 65.20  ? 179  ARG A O   1 
ATOM   888   C CB  . ARG A 1 124 ? -13.396 3.320   -71.056  1.00 60.67  ? 179  ARG A CB  1 
ATOM   889   C CG  . ARG A 1 124 ? -14.015 2.521   -72.185  1.00 58.12  ? 179  ARG A CG  1 
ATOM   890   C CD  . ARG A 1 124 ? -14.861 1.381   -71.652  1.00 58.04  ? 179  ARG A CD  1 
ATOM   891   N NE  . ARG A 1 124 ? -14.050 0.242   -71.235  1.00 49.21  ? 179  ARG A NE  1 
ATOM   892   C CZ  . ARG A 1 124 ? -14.398 -0.603  -70.273  1.00 43.94  ? 179  ARG A CZ  1 
ATOM   893   N NH1 . ARG A 1 124 ? -15.535 -0.430  -69.617  1.00 40.94  ? 179  ARG A NH1 1 
ATOM   894   N NH2 . ARG A 1 124 ? -13.607 -1.616  -69.961  1.00 52.48  ? 179  ARG A NH2 1 
ATOM   895   N N   . THR A 1 125 ? -10.120 4.082   -70.991  1.00 68.47  ? 180  THR A N   1 
ATOM   896   C CA  . THR A 1 125 ? -8.756  3.595   -71.175  1.00 63.64  ? 180  THR A CA  1 
ATOM   897   C C   . THR A 1 125 ? -8.163  3.110   -69.855  1.00 67.88  ? 180  THR A C   1 
ATOM   898   O O   . THR A 1 125 ? -8.727  3.344   -68.785  1.00 67.13  ? 180  THR A O   1 
ATOM   899   C CB  . THR A 1 125 ? -7.837  4.684   -71.759  1.00 64.34  ? 180  THR A CB  1 
ATOM   900   O OG1 . THR A 1 125 ? -7.600  5.700   -70.777  1.00 68.93  ? 180  THR A OG1 1 
ATOM   901   C CG2 . THR A 1 125 ? -8.466  5.313   -72.986  1.00 70.30  ? 180  THR A CG2 1 
ATOM   902   N N   . THR A 1 126 ? -7.024  2.428   -69.934  1.00 73.69  ? 181  THR A N   1 
ATOM   903   C CA  . THR A 1 126 ? -6.346  1.936   -68.735  1.00 75.87  ? 181  THR A CA  1 
ATOM   904   C C   . THR A 1 126 ? -5.853  3.082   -67.846  1.00 73.29  ? 181  THR A C   1 
ATOM   905   O O   . THR A 1 126 ? -5.633  2.895   -66.649  1.00 71.38  ? 181  THR A O   1 
ATOM   906   C CB  . THR A 1 126 ? -5.169  0.989   -69.075  1.00 65.22  ? 181  THR A CB  1 
ATOM   907   O OG1 . THR A 1 126 ? -4.244  1.654   -69.944  1.00 65.58  ? 181  THR A OG1 1 
ATOM   908   C CG2 . THR A 1 126 ? -5.673  -0.277  -69.756  1.00 58.60  ? 181  THR A CG2 1 
ATOM   909   N N   . LYS A 1 127 ? -5.680  4.263   -68.433  1.00 72.56  ? 182  LYS A N   1 
ATOM   910   C CA  . LYS A 1 127 ? -5.309  5.446   -67.662  1.00 77.27  ? 182  LYS A CA  1 
ATOM   911   C C   . LYS A 1 127 ? -6.429  5.849   -66.715  1.00 82.12  ? 182  LYS A C   1 
ATOM   912   O O   . LYS A 1 127 ? -6.221  6.025   -65.509  1.00 91.09  ? 182  LYS A O   1 
ATOM   913   C CB  . LYS A 1 127 ? -5.017  6.625   -68.585  1.00 75.01  ? 182  LYS A CB  1 
ATOM   914   C CG  . LYS A 1 127 ? -5.215  7.970   -67.897  1.00 75.49  ? 182  LYS A CG  1 
ATOM   915   C CD  . LYS A 1 127 ? -5.376  9.100   -68.906  1.00 89.00  ? 182  LYS A CD  1 
ATOM   916   C CE  . LYS A 1 127 ? -5.949  10.358  -68.256  1.00 85.66  ? 182  LYS A CE  1 
ATOM   917   N NZ  . LYS A 1 127 ? -6.266  11.422  -69.255  1.00 66.57  ? 182  LYS A NZ  1 
ATOM   918   N N   . ARG A 1 128 ? -7.618  6.012   -67.284  1.00 78.60  ? 183  ARG A N   1 
ATOM   919   C CA  . ARG A 1 128 ? -8.792  6.397   -66.522  1.00 82.09  ? 183  ARG A CA  1 
ATOM   920   C C   . ARG A 1 128 ? -9.046  5.356   -65.433  1.00 88.74  ? 183  ARG A C   1 
ATOM   921   O O   . ARG A 1 128 ? -9.313  5.701   -64.274  1.00 90.43  ? 183  ARG A O   1 
ATOM   922   C CB  . ARG A 1 128 ? -9.992  6.552   -67.462  1.00 77.78  ? 183  ARG A CB  1 
ATOM   923   C CG  . ARG A 1 128 ? -9.718  7.500   -68.635  1.00 74.14  ? 183  ARG A CG  1 
ATOM   924   C CD  . ARG A 1 128 ? -10.806 7.453   -69.697  1.00 76.12  ? 183  ARG A CD  1 
ATOM   925   N NE  . ARG A 1 128 ? -12.078 8.013   -69.239  1.00 98.79  ? 183  ARG A NE  1 
ATOM   926   C CZ  . ARG A 1 128 ? -12.635 9.117   -69.731  1.00 99.38  ? 183  ARG A CZ  1 
ATOM   927   N NH1 . ARG A 1 128 ? -12.033 9.784   -70.709  1.00 97.27  ? 183  ARG A NH1 1 
ATOM   928   N NH2 . ARG A 1 128 ? -13.797 9.553   -69.250  1.00 83.81  ? 183  ARG A NH2 1 
ATOM   929   N N   . ALA A 1 129 ? -8.924  4.083   -65.808  1.00 86.00  ? 184  ALA A N   1 
ATOM   930   C CA  . ALA A 1 129 ? -9.046  2.982   -64.854  1.00 87.61  ? 184  ALA A CA  1 
ATOM   931   C C   . ALA A 1 129 ? -8.053  3.136   -63.701  1.00 84.59  ? 184  ALA A C   1 
ATOM   932   O O   . ALA A 1 129 ? -8.421  3.012   -62.528  1.00 83.55  ? 184  ALA A O   1 
ATOM   933   C CB  . ALA A 1 129 ? -8.852  1.643   -65.550  1.00 76.41  ? 184  ALA A CB  1 
ATOM   934   N N   . GLY A 1 130 ? -6.795  3.401   -64.038  1.00 80.17  ? 185  GLY A N   1 
ATOM   935   C CA  . GLY A 1 130 ? -5.777  3.629   -63.030  1.00 81.11  ? 185  GLY A CA  1 
ATOM   936   C C   . GLY A 1 130 ? -6.206  4.700   -62.049  1.00 81.39  ? 185  GLY A C   1 
ATOM   937   O O   . GLY A 1 130 ? -6.151  4.508   -60.830  1.00 82.61  ? 185  GLY A O   1 
ATOM   938   N N   . VAL A 1 131 ? -6.650  5.832   -62.586  1.00 80.39  ? 186  VAL A N   1 
ATOM   939   C CA  . VAL A 1 131 ? -7.089  6.938   -61.746  1.00 79.89  ? 186  VAL A CA  1 
ATOM   940   C C   . VAL A 1 131 ? -8.174  6.483   -60.791  1.00 74.77  ? 186  VAL A C   1 
ATOM   941   O O   . VAL A 1 131 ? -8.068  6.669   -59.581  1.00 73.60  ? 186  VAL A O   1 
ATOM   942   C CB  . VAL A 1 131 ? -7.632  8.102   -62.576  1.00 75.84  ? 186  VAL A CB  1 
ATOM   943   C CG1 . VAL A 1 131 ? -8.153  9.197   -61.659  1.00 72.51  ? 186  VAL A CG1 1 
ATOM   944   C CG2 . VAL A 1 131 ? -6.545  8.632   -63.498  1.00 82.31  ? 186  VAL A CG2 1 
ATOM   945   N N   . MET A 1 132 ? -9.218  5.877   -61.339  1.00 77.99  ? 187  MET A N   1 
ATOM   946   C CA  . MET A 1 132 ? -10.315 5.396   -60.513  1.00 86.68  ? 187  MET A CA  1 
ATOM   947   C C   . MET A 1 132 ? -9.813  4.502   -59.377  1.00 85.21  ? 187  MET A C   1 
ATOM   948   O O   . MET A 1 132 ? -10.151 4.720   -58.210  1.00 90.70  ? 187  MET A O   1 
ATOM   949   C CB  . MET A 1 132 ? -11.355 4.685   -61.380  1.00 95.11  ? 187  MET A CB  1 
ATOM   950   C CG  . MET A 1 132 ? -11.999 5.615   -62.401  1.00 114.87 ? 187  MET A CG  1 
ATOM   951   S SD  . MET A 1 132 ? -13.017 4.793   -63.641  1.00 272.30 ? 187  MET A SD  1 
ATOM   952   C CE  . MET A 1 132 ? -14.221 3.979   -62.599  1.00 185.87 ? 187  MET A CE  1 
ATOM   953   N N   . ILE A 1 133 ? -8.980  3.520   -59.708  1.00 82.37  ? 188  ILE A N   1 
ATOM   954   C CA  . ILE A 1 133 ? -8.471  2.593   -58.698  1.00 80.30  ? 188  ILE A CA  1 
ATOM   955   C C   . ILE A 1 133 ? -7.682  3.304   -57.591  1.00 76.49  ? 188  ILE A C   1 
ATOM   956   O O   . ILE A 1 133 ? -7.958  3.121   -56.395  1.00 70.77  ? 188  ILE A O   1 
ATOM   957   C CB  . ILE A 1 133 ? -7.614  1.482   -59.328  1.00 78.57  ? 188  ILE A CB  1 
ATOM   958   C CG1 . ILE A 1 133 ? -8.464  0.632   -60.275  1.00 73.19  ? 188  ILE A CG1 1 
ATOM   959   C CG2 . ILE A 1 133 ? -7.000  0.608   -58.250  1.00 81.74  ? 188  ILE A CG2 1 
ATOM   960   C CD1 . ILE A 1 133 ? -7.733  -0.551  -60.872  1.00 64.85  ? 188  ILE A CD1 1 
ATOM   961   N N   . GLY A 1 134 ? -6.704  4.112   -57.993  1.00 75.93  ? 189  GLY A N   1 
ATOM   962   C CA  . GLY A 1 134 ? -5.929  4.894   -57.045  1.00 75.34  ? 189  GLY A CA  1 
ATOM   963   C C   . GLY A 1 134 ? -6.826  5.695   -56.120  1.00 71.56  ? 189  GLY A C   1 
ATOM   964   O O   . GLY A 1 134 ? -6.609  5.743   -54.904  1.00 72.62  ? 189  GLY A O   1 
ATOM   965   N N   . LEU A 1 135 ? -7.843  6.327   -56.698  1.00 68.50  ? 190  LEU A N   1 
ATOM   966   C CA  . LEU A 1 135 ? -8.817  7.077   -55.915  1.00 68.89  ? 190  LEU A CA  1 
ATOM   967   C C   . LEU A 1 135 ? -9.510  6.169   -54.899  1.00 73.73  ? 190  LEU A C   1 
ATOM   968   O O   . LEU A 1 135 ? -9.774  6.579   -53.766  1.00 70.67  ? 190  LEU A O   1 
ATOM   969   C CB  . LEU A 1 135 ? -9.855  7.725   -56.828  1.00 71.68  ? 190  LEU A CB  1 
ATOM   970   C CG  . LEU A 1 135 ? -10.916 8.570   -56.127  1.00 72.88  ? 190  LEU A CG  1 
ATOM   971   C CD1 . LEU A 1 135 ? -10.302 9.846   -55.566  1.00 70.47  ? 190  LEU A CD1 1 
ATOM   972   C CD2 . LEU A 1 135 ? -12.062 8.892   -57.077  1.00 77.93  ? 190  LEU A CD2 1 
ATOM   973   N N   . ALA A 1 136 ? -9.804  4.938   -55.314  1.00 73.93  ? 191  ALA A N   1 
ATOM   974   C CA  . ALA A 1 136 ? -10.440 3.961   -54.430  1.00 67.64  ? 191  ALA A CA  1 
ATOM   975   C C   . ALA A 1 136 ? -9.567  3.633   -53.216  1.00 68.08  ? 191  ALA A C   1 
ATOM   976   O O   . ALA A 1 136 ? -10.033 3.684   -52.072  1.00 62.77  ? 191  ALA A O   1 
ATOM   977   C CB  . ALA A 1 136 ? -10.804 2.700   -55.193  1.00 62.42  ? 191  ALA A CB  1 
ATOM   978   N N   . TRP A 1 137 ? -8.306  3.285   -53.460  1.00 66.57  ? 192  TRP A N   1 
ATOM   979   C CA  . TRP A 1 137 ? -7.392  3.050   -52.343  1.00 66.21  ? 192  TRP A CA  1 
ATOM   980   C C   . TRP A 1 137 ? -7.327  4.281   -51.447  1.00 66.33  ? 192  TRP A C   1 
ATOM   981   O O   . TRP A 1 137 ? -7.365  4.162   -50.223  1.00 71.12  ? 192  TRP A O   1 
ATOM   982   C CB  . TRP A 1 137 ? -5.992  2.649   -52.814  1.00 63.63  ? 192  TRP A CB  1 
ATOM   983   C CG  . TRP A 1 137 ? -5.916  1.234   -53.289  1.00 62.62  ? 192  TRP A CG  1 
ATOM   984   C CD1 . TRP A 1 137 ? -6.318  0.758   -54.503  1.00 64.91  ? 192  TRP A CD1 1 
ATOM   985   C CD2 . TRP A 1 137 ? -5.409  0.106   -52.565  1.00 62.13  ? 192  TRP A CD2 1 
ATOM   986   N NE1 . TRP A 1 137 ? -6.091  -0.594  -54.581  1.00 67.45  ? 192  TRP A NE1 1 
ATOM   987   C CE2 . TRP A 1 137 ? -5.533  -1.020  -53.404  1.00 66.41  ? 192  TRP A CE2 1 
ATOM   988   C CE3 . TRP A 1 137 ? -4.859  -0.063  -51.292  1.00 66.44  ? 192  TRP A CE3 1 
ATOM   989   C CZ2 . TRP A 1 137 ? -5.129  -2.296  -53.013  1.00 61.24  ? 192  TRP A CZ2 1 
ATOM   990   C CZ3 . TRP A 1 137 ? -4.460  -1.335  -50.904  1.00 68.28  ? 192  TRP A CZ3 1 
ATOM   991   C CH2 . TRP A 1 137 ? -4.599  -2.432  -51.763  1.00 61.33  ? 192  TRP A CH2 1 
ATOM   992   N N   . VAL A 1 138 ? -7.239  5.462   -52.052  1.00 60.07  ? 193  VAL A N   1 
ATOM   993   C CA  . VAL A 1 138 ? -7.317  6.695   -51.274  1.00 63.63  ? 193  VAL A CA  1 
ATOM   994   C C   . VAL A 1 138 ? -8.511  6.680   -50.315  1.00 68.40  ? 193  VAL A C   1 
ATOM   995   O O   . VAL A 1 138 ? -8.328  6.728   -49.095  1.00 67.16  ? 193  VAL A O   1 
ATOM   996   C CB  . VAL A 1 138 ? -7.365  7.948   -52.161  1.00 59.47  ? 193  VAL A CB  1 
ATOM   997   C CG1 . VAL A 1 138 ? -7.756  9.164   -51.334  1.00 48.39  ? 193  VAL A CG1 1 
ATOM   998   C CG2 . VAL A 1 138 ? -6.015  8.159   -52.821  1.00 59.73  ? 193  VAL A CG2 1 
ATOM   999   N N   . ILE A 1 139 ? -9.724  6.606   -50.861  1.00 67.17  ? 194  ILE A N   1 
ATOM   1000  C CA  . ILE A 1 139 ? -10.927 6.574   -50.030  1.00 66.59  ? 194  ILE A CA  1 
ATOM   1001  C C   . ILE A 1 139 ? -10.823 5.541   -48.910  1.00 68.64  ? 194  ILE A C   1 
ATOM   1002  O O   . ILE A 1 139 ? -11.040 5.866   -47.742  1.00 63.27  ? 194  ILE A O   1 
ATOM   1003  C CB  . ILE A 1 139 ? -12.194 6.278   -50.855  1.00 66.04  ? 194  ILE A CB  1 
ATOM   1004  C CG1 . ILE A 1 139 ? -12.456 7.401   -51.859  1.00 64.48  ? 194  ILE A CG1 1 
ATOM   1005  C CG2 . ILE A 1 139 ? -13.395 6.102   -49.938  1.00 62.65  ? 194  ILE A CG2 1 
ATOM   1006  C CD1 . ILE A 1 139 ? -13.818 7.322   -52.508  1.00 59.73  ? 194  ILE A CD1 1 
ATOM   1007  N N   . SER A 1 140 ? -10.483 4.304   -49.270  1.00 69.07  ? 195  SER A N   1 
ATOM   1008  C CA  . SER A 1 140 ? -10.350 3.223   -48.293  1.00 62.54  ? 195  SER A CA  1 
ATOM   1009  C C   . SER A 1 140 ? -9.461  3.663   -47.135  1.00 62.17  ? 195  SER A C   1 
ATOM   1010  O O   . SER A 1 140 ? -9.894  3.737   -45.977  1.00 60.61  ? 195  SER A O   1 
ATOM   1011  C CB  . SER A 1 140 ? -9.767  1.977   -48.953  1.00 52.28  ? 195  SER A CB  1 
ATOM   1012  O OG  . SER A 1 140 ? -10.555 1.589   -50.062  1.00 49.01  ? 195  SER A OG  1 
ATOM   1013  N N   . PHE A 1 141 ? -8.214  3.964   -47.473  1.00 58.37  ? 196  PHE A N   1 
ATOM   1014  C CA  . PHE A 1 141 ? -7.229  4.425   -46.512  1.00 65.69  ? 196  PHE A CA  1 
ATOM   1015  C C   . PHE A 1 141 ? -7.795  5.516   -45.606  1.00 64.75  ? 196  PHE A C   1 
ATOM   1016  O O   . PHE A 1 141 ? -7.727  5.411   -44.379  1.00 62.69  ? 196  PHE A O   1 
ATOM   1017  C CB  . PHE A 1 141 ? -6.005  4.943   -47.273  1.00 65.33  ? 196  PHE A CB  1 
ATOM   1018  C CG  . PHE A 1 141 ? -5.024  5.691   -46.422  1.00 65.80  ? 196  PHE A CG  1 
ATOM   1019  C CD1 . PHE A 1 141 ? -4.076  5.011   -45.674  1.00 64.29  ? 196  PHE A CD1 1 
ATOM   1020  C CD2 . PHE A 1 141 ? -5.034  7.077   -46.389  1.00 67.75  ? 196  PHE A CD2 1 
ATOM   1021  C CE1 . PHE A 1 141 ? -3.165  5.696   -44.898  1.00 72.84  ? 196  PHE A CE1 1 
ATOM   1022  C CE2 . PHE A 1 141 ? -4.126  7.773   -45.617  1.00 76.18  ? 196  PHE A CE2 1 
ATOM   1023  C CZ  . PHE A 1 141 ? -3.186  7.081   -44.868  1.00 84.48  ? 196  PHE A CZ  1 
ATOM   1024  N N   . VAL A 1 142 ? -8.369  6.549   -46.213  1.00 60.86  ? 197  VAL A N   1 
ATOM   1025  C CA  . VAL A 1 142 ? -8.838  7.707   -45.466  1.00 58.29  ? 197  VAL A CA  1 
ATOM   1026  C C   . VAL A 1 142 ? -10.030 7.387   -44.566  1.00 61.70  ? 197  VAL A C   1 
ATOM   1027  O O   . VAL A 1 142 ? -10.249 8.055   -43.554  1.00 60.54  ? 197  VAL A O   1 
ATOM   1028  C CB  . VAL A 1 142 ? -9.179  8.881   -46.402  1.00 53.23  ? 197  VAL A CB  1 
ATOM   1029  C CG1 . VAL A 1 142 ? -10.004 9.920   -45.674  1.00 55.29  ? 197  VAL A CG1 1 
ATOM   1030  C CG2 . VAL A 1 142 ? -7.903  9.499   -46.945  1.00 52.41  ? 197  VAL A CG2 1 
ATOM   1031  N N   . LEU A 1 143 ? -10.802 6.369   -44.927  1.00 62.00  ? 198  LEU A N   1 
ATOM   1032  C CA  . LEU A 1 143 ? -11.880 5.914   -44.057  1.00 64.37  ? 198  LEU A CA  1 
ATOM   1033  C C   . LEU A 1 143 ? -11.340 5.144   -42.852  1.00 65.65  ? 198  LEU A C   1 
ATOM   1034  O O   . LEU A 1 143 ? -11.613 5.492   -41.704  1.00 56.34  ? 198  LEU A O   1 
ATOM   1035  C CB  . LEU A 1 143 ? -12.879 5.048   -44.828  1.00 56.74  ? 198  LEU A CB  1 
ATOM   1036  C CG  . LEU A 1 143 ? -13.783 5.767   -45.827  1.00 59.62  ? 198  LEU A CG  1 
ATOM   1037  C CD1 . LEU A 1 143 ? -14.653 4.772   -46.579  1.00 52.18  ? 198  LEU A CD1 1 
ATOM   1038  C CD2 . LEU A 1 143 ? -14.641 6.808   -45.120  1.00 61.92  ? 198  LEU A CD2 1 
ATOM   1039  N N   . TRP A 1 144 ? -10.532 4.123   -43.115  1.00 66.50  ? 199  TRP A N   1 
ATOM   1040  C CA  . TRP A 1 144 ? -10.113 3.223   -42.044  1.00 63.21  ? 199  TRP A CA  1 
ATOM   1041  C C   . TRP A 1 144 ? -8.916  3.723   -41.244  1.00 66.41  ? 199  TRP A C   1 
ATOM   1042  O O   . TRP A 1 144 ? -9.028  3.985   -40.046  1.00 65.87  ? 199  TRP A O   1 
ATOM   1043  C CB  . TRP A 1 144 ? -9.858  1.813   -42.586  1.00 60.55  ? 199  TRP A CB  1 
ATOM   1044  C CG  . TRP A 1 144 ? -11.100 1.169   -43.106  1.00 60.08  ? 199  TRP A CG  1 
ATOM   1045  C CD1 . TRP A 1 144 ? -11.423 0.945   -44.412  1.00 61.59  ? 199  TRP A CD1 1 
ATOM   1046  C CD2 . TRP A 1 144 ? -12.205 0.689   -42.331  1.00 59.00  ? 199  TRP A CD2 1 
ATOM   1047  N NE1 . TRP A 1 144 ? -12.657 0.342   -44.498  1.00 59.06  ? 199  TRP A NE1 1 
ATOM   1048  C CE2 . TRP A 1 144 ? -13.159 0.174   -43.233  1.00 61.96  ? 199  TRP A CE2 1 
ATOM   1049  C CE3 . TRP A 1 144 ? -12.479 0.637   -40.960  1.00 57.12  ? 199  TRP A CE3 1 
ATOM   1050  C CZ2 . TRP A 1 144 ? -14.367 -0.387  -42.811  1.00 58.98  ? 199  TRP A CZ2 1 
ATOM   1051  C CZ3 . TRP A 1 144 ? -13.680 0.079   -40.541  1.00 58.31  ? 199  TRP A CZ3 1 
ATOM   1052  C CH2 . TRP A 1 144 ? -14.608 -0.425  -41.464  1.00 55.31  ? 199  TRP A CH2 1 
ATOM   1053  N N   . ALA A 1 145 ? -7.774  3.853   -41.914  1.00 72.56  ? 200  ALA A N   1 
ATOM   1054  C CA  . ALA A 1 145 ? -6.508  4.143   -41.240  1.00 71.21  ? 200  ALA A CA  1 
ATOM   1055  C C   . ALA A 1 145 ? -6.576  5.248   -40.177  1.00 71.63  ? 200  ALA A C   1 
ATOM   1056  O O   . ALA A 1 145 ? -6.209  5.014   -39.025  1.00 77.82  ? 200  ALA A O   1 
ATOM   1057  C CB  . ALA A 1 145 ? -5.414  4.444   -42.260  1.00 71.62  ? 200  ALA A CB  1 
ATOM   1058  N N   . PRO A 1 146 ? -7.056  6.448   -40.547  1.00 68.17  ? 201  PRO A N   1 
ATOM   1059  C CA  . PRO A 1 146 ? -7.080  7.529   -39.555  1.00 67.03  ? 201  PRO A CA  1 
ATOM   1060  C C   . PRO A 1 146 ? -7.836  7.111   -38.293  1.00 68.93  ? 201  PRO A C   1 
ATOM   1061  O O   . PRO A 1 146 ? -7.371  7.349   -37.181  1.00 63.65  ? 201  PRO A O   1 
ATOM   1062  C CB  . PRO A 1 146 ? -7.837  8.646   -40.278  1.00 60.02  ? 201  PRO A CB  1 
ATOM   1063  C CG  . PRO A 1 146 ? -7.661  8.352   -41.726  1.00 66.57  ? 201  PRO A CG  1 
ATOM   1064  C CD  . PRO A 1 146 ? -7.661  6.861   -41.825  1.00 67.28  ? 201  PRO A CD  1 
ATOM   1065  N N   . ALA A 1 147 ? -8.987  6.472   -38.472  1.00 72.07  ? 202  ALA A N   1 
ATOM   1066  C CA  . ALA A 1 147 ? -9.779  6.009   -37.342  1.00 68.49  ? 202  ALA A CA  1 
ATOM   1067  C C   . ALA A 1 147 ? -8.989  5.006   -36.514  1.00 74.10  ? 202  ALA A C   1 
ATOM   1068  O O   . ALA A 1 147 ? -8.732  5.228   -35.330  1.00 81.98  ? 202  ALA A O   1 
ATOM   1069  C CB  . ALA A 1 147 ? -11.083 5.390   -37.820  1.00 67.72  ? 202  ALA A CB  1 
ATOM   1070  N N   . ILE A 1 148 ? -8.586  3.913   -37.151  1.00 69.86  ? 203  ILE A N   1 
ATOM   1071  C CA  . ILE A 1 148 ? -7.939  2.812   -36.442  1.00 66.40  ? 203  ILE A CA  1 
ATOM   1072  C C   . ILE A 1 148 ? -6.674  3.217   -35.680  1.00 69.72  ? 203  ILE A C   1 
ATOM   1073  O O   . ILE A 1 148 ? -6.439  2.755   -34.566  1.00 72.63  ? 203  ILE A O   1 
ATOM   1074  C CB  . ILE A 1 148 ? -7.617  1.652   -37.391  1.00 67.21  ? 203  ILE A CB  1 
ATOM   1075  C CG1 . ILE A 1 148 ? -8.913  1.004   -37.875  1.00 71.71  ? 203  ILE A CG1 1 
ATOM   1076  C CG2 . ILE A 1 148 ? -6.744  0.632   -36.693  1.00 70.88  ? 203  ILE A CG2 1 
ATOM   1077  C CD1 . ILE A 1 148 ? -8.698  -0.124  -38.862  1.00 76.10  ? 203  ILE A CD1 1 
ATOM   1078  N N   . LEU A 1 149 ? -5.864  4.078   -36.284  1.00 77.88  ? 204  LEU A N   1 
ATOM   1079  C CA  . LEU A 1 149 ? -4.629  4.538   -35.653  1.00 77.87  ? 204  LEU A CA  1 
ATOM   1080  C C   . LEU A 1 149 ? -4.859  5.621   -34.592  1.00 84.88  ? 204  LEU A C   1 
ATOM   1081  O O   . LEU A 1 149 ? -4.326  5.526   -33.482  1.00 80.99  ? 204  LEU A O   1 
ATOM   1082  C CB  . LEU A 1 149 ? -3.642  5.030   -36.717  1.00 76.59  ? 204  LEU A CB  1 
ATOM   1083  C CG  . LEU A 1 149 ? -3.322  4.030   -37.832  1.00 75.25  ? 204  LEU A CG  1 
ATOM   1084  C CD1 . LEU A 1 149 ? -2.738  4.719   -39.054  1.00 66.30  ? 204  LEU A CD1 1 
ATOM   1085  C CD2 . LEU A 1 149 ? -2.396  2.924   -37.341  1.00 77.04  ? 204  LEU A CD2 1 
ATOM   1086  N N   . PHE A 1 150 ? -5.666  6.631   -34.933  1.00 85.16  ? 205  PHE A N   1 
ATOM   1087  C CA  . PHE A 1 150 ? -5.812  7.840   -34.107  1.00 88.68  ? 205  PHE A CA  1 
ATOM   1088  C C   . PHE A 1 150 ? -6.983  7.848   -33.119  1.00 86.72  ? 205  PHE A C   1 
ATOM   1089  O O   . PHE A 1 150 ? -7.198  8.846   -32.426  1.00 93.03  ? 205  PHE A O   1 
ATOM   1090  C CB  . PHE A 1 150 ? -5.904  9.095   -34.987  1.00 87.30  ? 205  PHE A CB  1 
ATOM   1091  C CG  . PHE A 1 150 ? -4.668  9.369   -35.801  1.00 87.77  ? 205  PHE A CG  1 
ATOM   1092  C CD1 . PHE A 1 150 ? -3.545  8.563   -35.688  1.00 82.42  ? 205  PHE A CD1 1 
ATOM   1093  C CD2 . PHE A 1 150 ? -4.633  10.442  -36.677  1.00 86.06  ? 205  PHE A CD2 1 
ATOM   1094  C CE1 . PHE A 1 150 ? -2.413  8.818   -36.438  1.00 74.72  ? 205  PHE A CE1 1 
ATOM   1095  C CE2 . PHE A 1 150 ? -3.506  10.703  -37.429  1.00 87.19  ? 205  PHE A CE2 1 
ATOM   1096  C CZ  . PHE A 1 150 ? -2.393  9.890   -37.309  1.00 84.69  ? 205  PHE A CZ  1 
ATOM   1097  N N   . TRP A 1 151 ? -7.744  6.760   -33.058  1.00 82.90  ? 206  TRP A N   1 
ATOM   1098  C CA  . TRP A 1 151 ? -8.886  6.698   -32.145  1.00 87.31  ? 206  TRP A CA  1 
ATOM   1099  C C   . TRP A 1 151 ? -8.440  6.890   -30.692  1.00 91.65  ? 206  TRP A C   1 
ATOM   1100  O O   . TRP A 1 151 ? -9.058  7.646   -29.928  1.00 90.47  ? 206  TRP A O   1 
ATOM   1101  C CB  . TRP A 1 151 ? -9.655  5.383   -32.320  1.00 82.99  ? 206  TRP A CB  1 
ATOM   1102  C CG  . TRP A 1 151 ? -10.944 5.319   -31.547  1.00 90.86  ? 206  TRP A CG  1 
ATOM   1103  C CD1 . TRP A 1 151 ? -11.304 4.367   -30.641  1.00 91.52  ? 206  TRP A CD1 1 
ATOM   1104  C CD2 . TRP A 1 151 ? -12.038 6.247   -31.607  1.00 90.93  ? 206  TRP A CD2 1 
ATOM   1105  N NE1 . TRP A 1 151 ? -12.553 4.638   -30.133  1.00 90.76  ? 206  TRP A NE1 1 
ATOM   1106  C CE2 . TRP A 1 151 ? -13.026 5.787   -30.710  1.00 91.21  ? 206  TRP A CE2 1 
ATOM   1107  C CE3 . TRP A 1 151 ? -12.279 7.420   -32.330  1.00 82.41  ? 206  TRP A CE3 1 
ATOM   1108  C CZ2 . TRP A 1 151 ? -14.233 6.456   -30.518  1.00 89.99  ? 206  TRP A CZ2 1 
ATOM   1109  C CZ3 . TRP A 1 151 ? -13.477 8.085   -32.136  1.00 81.44  ? 206  TRP A CZ3 1 
ATOM   1110  C CH2 . TRP A 1 151 ? -14.439 7.600   -31.239  1.00 90.41  ? 206  TRP A CH2 1 
ATOM   1111  N N   . GLN A 1 152 ? -7.352  6.217   -30.325  1.00 92.65  ? 207  GLN A N   1 
ATOM   1112  C CA  . GLN A 1 152 ? -6.809  6.302   -28.975  1.00 87.85  ? 207  GLN A CA  1 
ATOM   1113  C C   . GLN A 1 152 ? -6.446  7.738   -28.606  1.00 87.59  ? 207  GLN A C   1 
ATOM   1114  O O   . GLN A 1 152 ? -6.905  8.253   -27.589  1.00 92.74  ? 207  GLN A O   1 
ATOM   1115  C CB  . GLN A 1 152 ? -5.599  5.375   -28.816  1.00 84.36  ? 207  GLN A CB  1 
ATOM   1116  C CG  . GLN A 1 152 ? -4.541  5.523   -29.902  1.00 88.04  ? 207  GLN A CG  1 
ATOM   1117  C CD  . GLN A 1 152 ? -3.296  4.707   -29.617  1.00 89.52  ? 207  GLN A CD  1 
ATOM   1118  O OE1 . GLN A 1 152 ? -3.195  4.057   -28.577  1.00 96.87  ? 207  GLN A OE1 1 
ATOM   1119  N NE2 . GLN A 1 152 ? -2.340  4.736   -30.540  1.00 81.48  ? 207  GLN A NE2 1 
ATOM   1120  N N   . TYR A 1 153 ? -5.631  8.380   -29.440  1.00 84.86  ? 208  TYR A N   1 
ATOM   1121  C CA  . TYR A 1 153 ? -5.195  9.757   -29.206  1.00 83.76  ? 208  TYR A CA  1 
ATOM   1122  C C   . TYR A 1 153 ? -6.370  10.714  -29.144  1.00 88.42  ? 208  TYR A C   1 
ATOM   1123  O O   . TYR A 1 153 ? -6.384  11.656  -28.350  1.00 93.05  ? 208  TYR A O   1 
ATOM   1124  C CB  . TYR A 1 153 ? -4.228  10.204  -30.296  1.00 76.10  ? 208  TYR A CB  1 
ATOM   1125  C CG  . TYR A 1 153 ? -2.996  9.346   -30.364  1.00 85.54  ? 208  TYR A CG  1 
ATOM   1126  C CD1 . TYR A 1 153 ? -1.871  9.654   -29.615  1.00 87.19  ? 208  TYR A CD1 1 
ATOM   1127  C CD2 . TYR A 1 153 ? -2.962  8.214   -31.163  1.00 92.40  ? 208  TYR A CD2 1 
ATOM   1128  C CE1 . TYR A 1 153 ? -0.743  8.863   -29.669  1.00 89.09  ? 208  TYR A CE1 1 
ATOM   1129  C CE2 . TYR A 1 153 ? -1.839  7.418   -31.223  1.00 92.37  ? 208  TYR A CE2 1 
ATOM   1130  C CZ  . TYR A 1 153 ? -0.733  7.745   -30.474  1.00 88.95  ? 208  TYR A CZ  1 
ATOM   1131  O OH  . TYR A 1 153 ? 0.389   6.948   -30.537  1.00 93.24  ? 208  TYR A OH  1 
ATOM   1132  N N   . PHE A 1 154 ? -7.352  10.487  -30.002  1.00 88.73  ? 209  PHE A N   1 
ATOM   1133  C CA  . PHE A 1 154 ? -8.562  11.281  -29.945  1.00 85.34  ? 209  PHE A CA  1 
ATOM   1134  C C   . PHE A 1 154 ? -9.168  11.150  -28.549  1.00 88.76  ? 209  PHE A C   1 
ATOM   1135  O O   . PHE A 1 154 ? -9.115  12.091  -27.756  1.00 88.88  ? 209  PHE A O   1 
ATOM   1136  C CB  . PHE A 1 154 ? -9.541  10.823  -31.025  1.00 87.29  ? 209  PHE A CB  1 
ATOM   1137  C CG  . PHE A 1 154 ? -10.745 11.705  -31.171  1.00 92.46  ? 209  PHE A CG  1 
ATOM   1138  C CD1 . PHE A 1 154 ? -10.606 13.040  -31.520  1.00 89.39  ? 209  PHE A CD1 1 
ATOM   1139  C CD2 . PHE A 1 154 ? -12.021 11.194  -30.979  1.00 93.25  ? 209  PHE A CD2 1 
ATOM   1140  C CE1 . PHE A 1 154 ? -11.719 13.854  -31.659  1.00 98.03  ? 209  PHE A CE1 1 
ATOM   1141  C CE2 . PHE A 1 154 ? -13.138 12.000  -31.119  1.00 93.15  ? 209  PHE A CE2 1 
ATOM   1142  C CZ  . PHE A 1 154 ? -12.988 13.331  -31.459  1.00 97.23  ? 209  PHE A CZ  1 
ATOM   1143  N N   . VAL A 1 155 ? -9.696  9.968   -28.235  1.00 90.80  ? 210  VAL A N   1 
ATOM   1144  C CA  . VAL A 1 155 ? -10.413 9.756   -26.972  1.00 93.29  ? 210  VAL A CA  1 
ATOM   1145  C C   . VAL A 1 155 ? -9.561  10.056  -25.735  1.00 93.51  ? 210  VAL A C   1 
ATOM   1146  O O   . VAL A 1 155 ? -10.085 10.395  -24.674  1.00 95.07  ? 210  VAL A O   1 
ATOM   1147  C CB  . VAL A 1 155 ? -10.978 8.320   -26.868  1.00 99.10  ? 210  VAL A CB  1 
ATOM   1148  C CG1 . VAL A 1 155 ? -11.706 8.123   -25.541  1.00 101.48 ? 210  VAL A CG1 1 
ATOM   1149  C CG2 . VAL A 1 155 ? -11.912 8.027   -28.031  1.00 92.94  ? 210  VAL A CG2 1 
ATOM   1150  N N   . GLY A 1 156 ? -8.248  9.930   -25.879  1.00 91.46  ? 211  GLY A N   1 
ATOM   1151  C CA  . GLY A 1 156 ? -7.328  10.224  -24.796  1.00 94.94  ? 211  GLY A CA  1 
ATOM   1152  C C   . GLY A 1 156 ? -6.776  8.998   -24.091  1.00 95.65  ? 211  GLY A C   1 
ATOM   1153  O O   . GLY A 1 156 ? -5.708  9.060   -23.475  1.00 95.49  ? 211  GLY A O   1 
ATOM   1154  N N   . LYS A 1 157 ? -7.488  7.880   -24.190  1.00 91.30  ? 212  LYS A N   1 
ATOM   1155  C CA  . LYS A 1 157 ? -7.038  6.640   -23.566  1.00 88.03  ? 212  LYS A CA  1 
ATOM   1156  C C   . LYS A 1 157 ? -7.121  5.467   -24.535  1.00 92.73  ? 212  LYS A C   1 
ATOM   1157  O O   . LYS A 1 157 ? -7.669  5.583   -25.631  1.00 88.98  ? 212  LYS A O   1 
ATOM   1158  C CB  . LYS A 1 157 ? -7.823  6.341   -22.285  1.00 78.95  ? 212  LYS A CB  1 
ATOM   1159  N N   . ARG A 1 158 ? -6.522  4.350   -24.138  1.00 101.70 ? 213  ARG A N   1 
ATOM   1160  C CA  . ARG A 1 158 ? -6.487  3.159   -24.974  1.00 101.20 ? 213  ARG A CA  1 
ATOM   1161  C C   . ARG A 1 158 ? -7.275  2.015   -24.342  1.00 100.12 ? 213  ARG A C   1 
ATOM   1162  O O   . ARG A 1 158 ? -6.834  1.408   -23.367  1.00 104.12 ? 213  ARG A O   1 
ATOM   1163  C CB  . ARG A 1 158 ? -5.038  2.738   -25.206  1.00 96.84  ? 213  ARG A CB  1 
ATOM   1164  C CG  . ARG A 1 158 ? -4.843  1.788   -26.364  1.00 91.76  ? 213  ARG A CG  1 
ATOM   1165  C CD  . ARG A 1 158 ? -3.368  1.523   -26.592  1.00 101.71 ? 213  ARG A CD  1 
ATOM   1166  N NE  . ARG A 1 158 ? -3.119  1.037   -27.944  1.00 106.32 ? 213  ARG A NE  1 
ATOM   1167  C CZ  . ARG A 1 158 ? -3.042  -0.247  -28.274  1.00 110.43 ? 213  ARG A CZ  1 
ATOM   1168  N NH1 . ARG A 1 158 ? -3.188  -1.183  -27.345  1.00 114.73 ? 213  ARG A NH1 1 
ATOM   1169  N NH2 . ARG A 1 158 ? -2.817  -0.593  -29.535  1.00 105.51 ? 213  ARG A NH2 1 
ATOM   1170  N N   . THR A 1 159 ? -8.430  1.713   -24.931  1.00 99.54  ? 214  THR A N   1 
ATOM   1171  C CA  . THR A 1 159 ? -9.337  0.687   -24.425  1.00 94.88  ? 214  THR A CA  1 
ATOM   1172  C C   . THR A 1 159 ? -8.660  -0.678  -24.493  1.00 95.12  ? 214  THR A C   1 
ATOM   1173  O O   . THR A 1 159 ? -8.867  -1.529  -23.641  1.00 99.77  ? 214  THR A O   1 
ATOM   1174  C CB  . THR A 1 159 ? -10.621 0.626   -25.263  1.00 99.32  ? 214  THR A CB  1 
ATOM   1175  O OG1 . THR A 1 159 ? -11.385 1.813   -25.043  1.00 102.26 ? 214  THR A OG1 1 
ATOM   1176  C CG2 . THR A 1 159 ? -11.460 -0.576  -24.871  1.00 100.75 ? 214  THR A CG2 1 
ATOM   1177  N N   . VAL A 1 160 ? -7.841  -0.873  -25.517  1.00 98.82  ? 215  VAL A N   1 
ATOM   1178  C CA  . VAL A 1 160 ? -7.237  -2.161  -25.757  1.00 101.22 ? 215  VAL A CA  1 
ATOM   1179  C C   . VAL A 1 160 ? -6.245  -2.564  -24.687  1.00 105.65 ? 215  VAL A C   1 
ATOM   1180  O O   . VAL A 1 160 ? -5.289  -1.865  -24.389  1.00 105.01 ? 215  VAL A O   1 
ATOM   1181  C CB  . VAL A 1 160 ? -6.573  -2.236  -27.120  1.00 98.26  ? 215  VAL A CB  1 
ATOM   1182  C CG1 . VAL A 1 160 ? -5.717  -3.488  -27.222  1.00 101.53 ? 215  VAL A CG1 1 
ATOM   1183  C CG2 . VAL A 1 160 ? -7.604  -2.194  -28.219  1.00 91.21  ? 215  VAL A CG2 1 
ATOM   1184  N N   . PRO A 1 161 ? -6.472  -3.738  -24.095  1.00 110.13 ? 216  PRO A N   1 
ATOM   1185  C CA  . PRO A 1 161 ? -5.510  -4.255  -23.125  1.00 117.73 ? 216  PRO A CA  1 
ATOM   1186  C C   . PRO A 1 161 ? -4.402  -4.914  -23.908  1.00 126.39 ? 216  PRO A C   1 
ATOM   1187  O O   . PRO A 1 161 ? -4.645  -5.383  -25.016  1.00 129.45 ? 216  PRO A O   1 
ATOM   1188  C CB  . PRO A 1 161 ? -6.315  -5.327  -22.367  1.00 126.89 ? 216  PRO A CB  1 
ATOM   1189  C CG  . PRO A 1 161 ? -7.353  -5.783  -23.384  1.00 113.30 ? 216  PRO A CG  1 
ATOM   1190  C CD  . PRO A 1 161 ? -7.698  -4.552  -24.148  1.00 105.92 ? 216  PRO A CD  1 
ATOM   1191  N N   . PRO A 1 162 ? -3.177  -4.907  -23.368  1.00 129.26 ? 217  PRO A N   1 
ATOM   1192  C CA  . PRO A 1 162 ? -2.062  -5.619  -23.998  1.00 127.22 ? 217  PRO A CA  1 
ATOM   1193  C C   . PRO A 1 162 ? -2.385  -7.107  -24.007  1.00 124.60 ? 217  PRO A C   1 
ATOM   1194  O O   . PRO A 1 162 ? -2.987  -7.614  -23.019  1.00 123.12 ? 217  PRO A O   1 
ATOM   1195  C CB  . PRO A 1 162 ? -0.877  -5.339  -23.042  1.00 121.18 ? 217  PRO A CB  1 
ATOM   1196  C CG  . PRO A 1 162 ? -1.341  -4.252  -22.136  1.00 119.30 ? 217  PRO A CG  1 
ATOM   1197  C CD  . PRO A 1 162 ? -2.807  -4.374  -22.046  1.00 120.05 ? 217  PRO A CD  1 
ATOM   1198  N N   . GLY A 1 163 ? -1.977  -7.809  -25.057  1.00 116.08 ? 218  GLY A N   1 
ATOM   1199  C CA  . GLY A 1 163 ? -2.171  -9.246  -25.105  1.00 115.99 ? 218  GLY A CA  1 
ATOM   1200  C C   . GLY A 1 163 ? -3.253  -9.722  -26.060  1.00 120.39 ? 218  GLY A C   1 
ATOM   1201  O O   . GLY A 1 163 ? -3.097  -10.730 -26.756  1.00 112.43 ? 218  GLY A O   1 
ATOM   1202  N N   . GLU A 1 164 ? -4.315  -8.943  -26.166  1.00 127.55 ? 219  GLU A N   1 
ATOM   1203  C CA  . GLU A 1 164 ? -5.368  -9.183  -27.132  1.00 117.97 ? 219  GLU A CA  1 
ATOM   1204  C C   . GLU A 1 164 ? -5.631  -7.943  -27.973  1.00 109.41 ? 219  GLU A C   1 
ATOM   1205  O O   . GLU A 1 164 ? -5.880  -6.850  -27.453  1.00 111.14 ? 219  GLU A O   1 
ATOM   1206  C CB  . GLU A 1 164 ? -6.649  -9.582  -26.411  1.00 119.83 ? 219  GLU A CB  1 
ATOM   1207  C CG  . GLU A 1 164 ? -6.712  -10.995 -25.823  1.00 117.47 ? 219  GLU A CG  1 
ATOM   1208  C CD  . GLU A 1 164 ? -8.152  -11.430 -25.604  1.00 122.73 ? 219  GLU A CD  1 
ATOM   1209  O OE1 . GLU A 1 164 ? -8.381  -12.533 -25.071  1.00 116.45 ? 219  GLU A OE1 1 
ATOM   1210  O OE2 . GLU A 1 164 ? -9.061  -10.664 -25.985  1.00 121.65 ? 219  GLU A OE2 1 
ATOM   1211  N N   . CYS A 1 165 ? -5.575  -8.130  -29.282  1.00 98.41  ? 220  CYS A N   1 
ATOM   1212  C CA  . CYS A 1 165 ? -5.646  -7.009  -30.201  1.00 96.72  ? 220  CYS A CA  1 
ATOM   1213  C C   . CYS A 1 165 ? -6.903  -6.990  -31.038  1.00 100.17 ? 220  CYS A C   1 
ATOM   1214  O O   . CYS A 1 165 ? -7.406  -8.044  -31.421  1.00 102.56 ? 220  CYS A O   1 
ATOM   1215  C CB  . CYS A 1 165 ? -4.383  -7.032  -31.097  1.00 95.66  ? 220  CYS A CB  1 
ATOM   1216  S SG  . CYS A 1 165 ? -4.369  -6.151  -32.707  1.00 94.93  ? 220  CYS A SG  1 
ATOM   1217  N N   . PHE A 1 166 ? -7.446  -5.786  -31.228  1.00 103.23 ? 221  PHE A N   1 
ATOM   1218  C CA  . PHE A 1 166 ? -8.578  -5.524  -32.120  1.00 100.79 ? 221  PHE A CA  1 
ATOM   1219  C C   . PHE A 1 166 ? -8.798  -4.008  -32.284  1.00 100.12 ? 221  PHE A C   1 
ATOM   1220  O O   . PHE A 1 166 ? -8.131  -3.203  -31.624  1.00 94.94  ? 221  PHE A O   1 
ATOM   1221  C CB  . PHE A 1 166 ? -9.849  -6.196  -31.598  1.00 90.94  ? 221  PHE A CB  1 
ATOM   1222  C CG  . PHE A 1 166 ? -10.221 -5.783  -30.207  1.00 86.99  ? 221  PHE A CG  1 
ATOM   1223  C CD1 . PHE A 1 166 ? -10.775 -4.541  -29.969  1.00 85.77  ? 221  PHE A CD1 1 
ATOM   1224  C CD2 . PHE A 1 166 ? -10.019 -6.636  -29.136  1.00 95.88  ? 221  PHE A CD2 1 
ATOM   1225  C CE1 . PHE A 1 166 ? -11.121 -4.154  -28.693  1.00 90.95  ? 221  PHE A CE1 1 
ATOM   1226  C CE2 . PHE A 1 166 ? -10.366 -6.255  -27.854  1.00 99.98  ? 221  PHE A CE2 1 
ATOM   1227  C CZ  . PHE A 1 166 ? -10.919 -5.010  -27.634  1.00 95.93  ? 221  PHE A CZ  1 
ATOM   1228  N N   . ILE A 1 167 ? -9.748  -3.620  -33.136  1.00 97.92  ? 222  ILE A N   1 
ATOM   1229  C CA  . ILE A 1 167 ? -9.993  -2.199  -33.405  1.00 82.43  ? 222  ILE A CA  1 
ATOM   1230  C C   . ILE A 1 167 ? -10.709 -1.530  -32.243  1.00 79.26  ? 222  ILE A C   1 
ATOM   1231  O O   . ILE A 1 167 ? -11.768 -1.982  -31.811  1.00 79.52  ? 222  ILE A O   1 
ATOM   1232  C CB  . ILE A 1 167 ? -10.816 -1.976  -34.686  1.00 78.01  ? 222  ILE A CB  1 
ATOM   1233  C CG1 . ILE A 1 167 ? -10.148 -2.642  -35.890  1.00 76.32  ? 222  ILE A CG1 1 
ATOM   1234  C CG2 . ILE A 1 167 ? -10.992 -0.490  -34.952  1.00 70.21  ? 222  ILE A CG2 1 
ATOM   1235  C CD1 . ILE A 1 167 ? -10.832 -2.328  -37.202  1.00 75.85  ? 222  ILE A CD1 1 
ATOM   1236  N N   . GLN A 1 168 ? -10.134 -0.437  -31.757  1.00 81.74  ? 223  GLN A N   1 
ATOM   1237  C CA  . GLN A 1 168 ? -10.612 0.205   -30.539  1.00 89.80  ? 223  GLN A CA  1 
ATOM   1238  C C   . GLN A 1 168 ? -12.093 0.582   -30.595  1.00 82.42  ? 223  GLN A C   1 
ATOM   1239  O O   . GLN A 1 168 ? -12.889 0.111   -29.783  1.00 76.25  ? 223  GLN A O   1 
ATOM   1240  C CB  . GLN A 1 168 ? -9.765  1.446   -30.228  1.00 95.34  ? 223  GLN A CB  1 
ATOM   1241  C CG  . GLN A 1 168 ? -10.079 2.101   -28.885  1.00 95.61  ? 223  GLN A CG  1 
ATOM   1242  C CD  . GLN A 1 168 ? -9.185  3.295   -28.588  1.00 97.19  ? 223  GLN A CD  1 
ATOM   1243  O OE1 . GLN A 1 168 ? -8.049  3.367   -29.060  1.00 101.34 ? 223  GLN A OE1 1 
ATOM   1244  N NE2 . GLN A 1 168 ? -9.696  4.241   -27.803  1.00 94.53  ? 223  GLN A NE2 1 
ATOM   1245  N N   . PHE A 1 169 ? -12.464 1.411   -31.564  1.00 82.24  ? 224  PHE A N   1 
ATOM   1246  C CA  . PHE A 1 169 ? -13.815 1.959   -31.608  1.00 79.51  ? 224  PHE A CA  1 
ATOM   1247  C C   . PHE A 1 169 ? -14.861 0.919   -31.993  1.00 79.42  ? 224  PHE A C   1 
ATOM   1248  O O   . PHE A 1 169 ? -16.058 1.197   -31.967  1.00 79.51  ? 224  PHE A O   1 
ATOM   1249  C CB  . PHE A 1 169 ? -13.888 3.154   -32.559  1.00 78.41  ? 224  PHE A CB  1 
ATOM   1250  C CG  . PHE A 1 169 ? -13.594 2.810   -33.986  1.00 83.31  ? 224  PHE A CG  1 
ATOM   1251  C CD1 . PHE A 1 169 ? -12.287 2.791   -34.451  1.00 83.85  ? 224  PHE A CD1 1 
ATOM   1252  C CD2 . PHE A 1 169 ? -14.622 2.503   -34.865  1.00 79.33  ? 224  PHE A CD2 1 
ATOM   1253  C CE1 . PHE A 1 169 ? -12.006 2.474   -35.770  1.00 80.82  ? 224  PHE A CE1 1 
ATOM   1254  C CE2 . PHE A 1 169 ? -14.352 2.186   -36.182  1.00 80.70  ? 224  PHE A CE2 1 
ATOM   1255  C CZ  . PHE A 1 169 ? -13.037 2.170   -36.636  1.00 83.28  ? 224  PHE A CZ  1 
ATOM   1256  N N   . LEU A 1 170 ? -14.412 -0.276  -32.355  1.00 77.71  ? 225  LEU A N   1 
ATOM   1257  C CA  . LEU A 1 170 ? -15.336 -1.318  -32.790  1.00 77.15  ? 225  LEU A CA  1 
ATOM   1258  C C   . LEU A 1 170 ? -15.827 -2.216  -31.653  1.00 79.80  ? 225  LEU A C   1 
ATOM   1259  O O   . LEU A 1 170 ? -16.527 -3.200  -31.890  1.00 81.48  ? 225  LEU A O   1 
ATOM   1260  C CB  . LEU A 1 170 ? -14.743 -2.141  -33.937  1.00 77.15  ? 225  LEU A CB  1 
ATOM   1261  C CG  . LEU A 1 170 ? -14.775 -1.418  -35.287  1.00 74.62  ? 225  LEU A CG  1 
ATOM   1262  C CD1 . LEU A 1 170 ? -14.244 -2.306  -36.400  1.00 71.11  ? 225  LEU A CD1 1 
ATOM   1263  C CD2 . LEU A 1 170 ? -16.185 -0.949  -35.607  1.00 69.26  ? 225  LEU A CD2 1 
ATOM   1264  N N   . SER A 1 171 ? -15.460 -1.875  -30.423  1.00 78.02  ? 226  SER A N   1 
ATOM   1265  C CA  . SER A 1 171 ? -15.895 -2.647  -29.264  1.00 78.08  ? 226  SER A CA  1 
ATOM   1266  C C   . SER A 1 171 ? -17.401 -2.929  -29.299  1.00 76.53  ? 226  SER A C   1 
ATOM   1267  O O   . SER A 1 171 ? -17.828 -4.075  -29.156  1.00 76.14  ? 226  SER A O   1 
ATOM   1268  C CB  . SER A 1 171 ? -15.531 -1.916  -27.965  1.00 86.07  ? 226  SER A CB  1 
ATOM   1269  O OG  . SER A 1 171 ? -14.135 -1.680  -27.869  1.00 88.82  ? 226  SER A OG  1 
ATOM   1270  N N   . GLU A 1 172 ? -18.197 -1.884  -29.506  1.00 73.40  ? 227  GLU A N   1 
ATOM   1271  C CA  . GLU A 1 172 ? -19.655 -2.001  -29.482  1.00 68.19  ? 227  GLU A CA  1 
ATOM   1272  C C   . GLU A 1 172 ? -20.208 -2.820  -30.642  1.00 68.07  ? 227  GLU A C   1 
ATOM   1273  O O   . GLU A 1 172 ? -19.860 -2.578  -31.795  1.00 75.74  ? 227  GLU A O   1 
ATOM   1274  C CB  . GLU A 1 172 ? -20.292 -0.612  -29.477  1.00 66.26  ? 227  GLU A CB  1 
ATOM   1275  C CG  . GLU A 1 172 ? -20.520 -0.065  -28.090  1.00 71.30  ? 227  GLU A CG  1 
ATOM   1276  C CD  . GLU A 1 172 ? -21.613 -0.818  -27.354  1.00 80.50  ? 227  GLU A CD  1 
ATOM   1277  O OE1 . GLU A 1 172 ? -22.598 -1.218  -28.013  1.00 82.57  ? 227  GLU A OE1 1 
ATOM   1278  O OE2 . GLU A 1 172 ? -21.487 -1.013  -26.124  1.00 79.48  ? 227  GLU A OE2 1 
ATOM   1279  N N   . PRO A 1 173 ? -21.077 -3.796  -30.342  1.00 62.14  ? 228  PRO A N   1 
ATOM   1280  C CA  . PRO A 1 173 ? -21.650 -4.621  -31.413  1.00 69.96  ? 228  PRO A CA  1 
ATOM   1281  C C   . PRO A 1 173 ? -22.526 -3.822  -32.380  1.00 67.94  ? 228  PRO A C   1 
ATOM   1282  O O   . PRO A 1 173 ? -22.704 -4.241  -33.527  1.00 64.26  ? 228  PRO A O   1 
ATOM   1283  C CB  . PRO A 1 173 ? -22.486 -5.661  -30.654  1.00 71.11  ? 228  PRO A CB  1 
ATOM   1284  C CG  . PRO A 1 173 ? -22.702 -5.080  -29.294  1.00 66.71  ? 228  PRO A CG  1 
ATOM   1285  C CD  . PRO A 1 173 ? -21.490 -4.249  -29.005  1.00 62.36  ? 228  PRO A CD  1 
ATOM   1286  N N   . THR A 1 174 ? -23.046 -2.682  -31.930  1.00 64.90  ? 229  THR A N   1 
ATOM   1287  C CA  . THR A 1 174 ? -23.909 -1.860  -32.778  1.00 61.39  ? 229  THR A CA  1 
ATOM   1288  C C   . THR A 1 174 ? -23.141 -1.079  -33.850  1.00 66.06  ? 229  THR A C   1 
ATOM   1289  O O   . THR A 1 174 ? -23.345 -1.314  -35.039  1.00 71.63  ? 229  THR A O   1 
ATOM   1290  C CB  . THR A 1 174 ? -24.794 -0.910  -31.959  1.00 54.42  ? 229  THR A CB  1 
ATOM   1291  O OG1 . THR A 1 174 ? -23.969 -0.091  -31.125  1.00 63.52  ? 229  THR A OG1 1 
ATOM   1292  C CG2 . THR A 1 174 ? -25.745 -1.707  -31.093  1.00 66.32  ? 229  THR A CG2 1 
ATOM   1293  N N   . ILE A 1 175 ? -22.271 -0.155  -33.445  1.00 58.86  ? 230  ILE A N   1 
ATOM   1294  C CA  . ILE A 1 175 ? -21.482 0.606   -34.414  1.00 55.10  ? 230  ILE A CA  1 
ATOM   1295  C C   . ILE A 1 175 ? -20.823 -0.348  -35.406  1.00 58.89  ? 230  ILE A C   1 
ATOM   1296  O O   . ILE A 1 175 ? -20.684 -0.047  -36.598  1.00 62.37  ? 230  ILE A O   1 
ATOM   1297  C CB  . ILE A 1 175 ? -20.417 1.485   -33.730  1.00 51.85  ? 230  ILE A CB  1 
ATOM   1298  C CG1 . ILE A 1 175 ? -19.289 1.824   -34.707  1.00 58.13  ? 230  ILE A CG1 1 
ATOM   1299  C CG2 . ILE A 1 175 ? -19.862 0.793   -32.508  1.00 54.74  ? 230  ILE A CG2 1 
ATOM   1300  C CD1 . ILE A 1 175 ? -18.222 2.727   -34.117  1.00 68.37  ? 230  ILE A CD1 1 
ATOM   1301  N N   . THR A 1 176 ? -20.445 -1.516  -34.903  1.00 56.44  ? 231  THR A N   1 
ATOM   1302  C CA  . THR A 1 176 ? -19.920 -2.575  -35.747  1.00 60.40  ? 231  THR A CA  1 
ATOM   1303  C C   . THR A 1 176 ? -20.977 -3.054  -36.738  1.00 61.80  ? 231  THR A C   1 
ATOM   1304  O O   . THR A 1 176 ? -20.703 -3.180  -37.927  1.00 65.82  ? 231  THR A O   1 
ATOM   1305  C CB  . THR A 1 176 ? -19.425 -3.761  -34.916  1.00 64.50  ? 231  THR A CB  1 
ATOM   1306  O OG1 . THR A 1 176 ? -18.305 -3.350  -34.123  1.00 65.54  ? 231  THR A OG1 1 
ATOM   1307  C CG2 . THR A 1 176 ? -18.995 -4.892  -35.827  1.00 73.22  ? 231  THR A CG2 1 
ATOM   1308  N N   . PHE A 1 177 ? -22.187 -3.314  -36.252  1.00 60.40  ? 232  PHE A N   1 
ATOM   1309  C CA  . PHE A 1 177 ? -23.291 -3.665  -37.144  1.00 61.48  ? 232  PHE A CA  1 
ATOM   1310  C C   . PHE A 1 177 ? -23.454 -2.628  -38.266  1.00 65.72  ? 232  PHE A C   1 
ATOM   1311  O O   . PHE A 1 177 ? -23.277 -2.951  -39.445  1.00 67.24  ? 232  PHE A O   1 
ATOM   1312  C CB  . PHE A 1 177 ? -24.597 -3.842  -36.362  1.00 56.03  ? 232  PHE A CB  1 
ATOM   1313  C CG  . PHE A 1 177 ? -25.775 -4.206  -37.220  1.00 49.03  ? 232  PHE A CG  1 
ATOM   1314  C CD1 . PHE A 1 177 ? -25.691 -5.237  -38.136  1.00 56.13  ? 232  PHE A CD1 1 
ATOM   1315  C CD2 . PHE A 1 177 ? -26.971 -3.531  -37.099  1.00 47.30  ? 232  PHE A CD2 1 
ATOM   1316  C CE1 . PHE A 1 177 ? -26.776 -5.577  -38.928  1.00 49.89  ? 232  PHE A CE1 1 
ATOM   1317  C CE2 . PHE A 1 177 ? -28.057 -3.872  -37.886  1.00 50.09  ? 232  PHE A CE2 1 
ATOM   1318  C CZ  . PHE A 1 177 ? -27.958 -4.895  -38.801  1.00 36.94  ? 232  PHE A CZ  1 
ATOM   1319  N N   . GLY A 1 178 ? -23.788 -1.390  -37.899  1.00 59.93  ? 233  GLY A N   1 
ATOM   1320  C CA  . GLY A 1 178 ? -23.970 -0.316  -38.863  1.00 54.95  ? 233  GLY A CA  1 
ATOM   1321  C C   . GLY A 1 178 ? -22.847 -0.192  -39.878  1.00 56.63  ? 233  GLY A C   1 
ATOM   1322  O O   . GLY A 1 178 ? -23.097 -0.059  -41.081  1.00 50.37  ? 233  GLY A O   1 
ATOM   1323  N N   . THR A 1 179 ? -21.606 -0.240  -39.397  1.00 62.71  ? 234  THR A N   1 
ATOM   1324  C CA  . THR A 1 179 ? -20.446 -0.149  -40.292  1.00 66.31  ? 234  THR A CA  1 
ATOM   1325  C C   . THR A 1 179 ? -20.284 -1.370  -41.210  1.00 61.18  ? 234  THR A C   1 
ATOM   1326  O O   . THR A 1 179 ? -19.796 -1.246  -42.332  1.00 57.34  ? 234  THR A O   1 
ATOM   1327  C CB  . THR A 1 179 ? -19.134 0.102   -39.521  1.00 68.64  ? 234  THR A CB  1 
ATOM   1328  O OG1 . THR A 1 179 ? -19.213 1.363   -38.843  1.00 76.11  ? 234  THR A OG1 1 
ATOM   1329  C CG2 . THR A 1 179 ? -17.946 0.121   -40.477  1.00 62.49  ? 234  THR A CG2 1 
ATOM   1330  N N   . ALA A 1 180 ? -20.681 -2.545  -40.733  1.00 60.39  ? 235  ALA A N   1 
ATOM   1331  C CA  . ALA A 1 180 ? -20.677 -3.734  -41.574  1.00 55.06  ? 235  ALA A CA  1 
ATOM   1332  C C   . ALA A 1 180 ? -21.724 -3.586  -42.674  1.00 57.30  ? 235  ALA A C   1 
ATOM   1333  O O   . ALA A 1 180 ? -21.438 -3.843  -43.841  1.00 57.95  ? 235  ALA A O   1 
ATOM   1334  C CB  . ALA A 1 180 ? -20.927 -4.983  -40.755  1.00 56.40  ? 235  ALA A CB  1 
ATOM   1335  N N   . ILE A 1 181 ? -22.934 -3.168  -42.308  1.00 54.12  ? 236  ILE A N   1 
ATOM   1336  C CA  . ILE A 1 181 ? -23.973 -2.940  -43.312  1.00 57.03  ? 236  ILE A CA  1 
ATOM   1337  C C   . ILE A 1 181 ? -23.509 -1.955  -44.369  1.00 53.82  ? 236  ILE A C   1 
ATOM   1338  O O   . ILE A 1 181 ? -23.519 -2.255  -45.564  1.00 43.41  ? 236  ILE A O   1 
ATOM   1339  C CB  . ILE A 1 181 ? -25.260 -2.372  -42.708  1.00 59.96  ? 236  ILE A CB  1 
ATOM   1340  C CG1 . ILE A 1 181 ? -26.015 -3.444  -41.921  1.00 61.30  ? 236  ILE A CG1 1 
ATOM   1341  C CG2 . ILE A 1 181 ? -26.150 -1.825  -43.817  1.00 57.74  ? 236  ILE A CG2 1 
ATOM   1342  C CD1 . ILE A 1 181 ? -27.399 -2.994  -41.462  1.00 57.99  ? 236  ILE A CD1 1 
ATOM   1343  N N   . ALA A 1 182 ? -23.117 -0.769  -43.913  1.00 57.19  ? 237  ALA A N   1 
ATOM   1344  C CA  . ALA A 1 182 ? -22.656 0.283   -44.806  1.00 51.34  ? 237  ALA A CA  1 
ATOM   1345  C C   . ALA A 1 182 ? -21.536 -0.228  -45.698  1.00 53.08  ? 237  ALA A C   1 
ATOM   1346  O O   . ALA A 1 182 ? -21.585 -0.065  -46.912  1.00 54.66  ? 237  ALA A O   1 
ATOM   1347  C CB  . ALA A 1 182 ? -22.184 1.480   -44.007  1.00 45.01  ? 237  ALA A CB  1 
ATOM   1348  N N   . ALA A 1 183 ? -20.539 -0.856  -45.078  1.00 52.58  ? 238  ALA A N   1 
ATOM   1349  C CA  . ALA A 1 183 ? -19.312 -1.276  -45.756  1.00 47.12  ? 238  ALA A CA  1 
ATOM   1350  C C   . ALA A 1 183 ? -19.426 -2.642  -46.421  1.00 39.14  ? 238  ALA A C   1 
ATOM   1351  O O   . ALA A 1 183 ? -18.548 -3.042  -47.173  1.00 29.59  ? 238  ALA A O   1 
ATOM   1352  C CB  . ALA A 1 183 ? -18.148 -1.263  -44.787  1.00 49.40  ? 238  ALA A CB  1 
ATOM   1353  N N   . PHE A 1 184 ? -20.498 -3.363  -46.123  1.00 43.52  ? 239  PHE A N   1 
ATOM   1354  C CA  . PHE A 1 184 ? -20.708 -4.685  -46.702  1.00 49.39  ? 239  PHE A CA  1 
ATOM   1355  C C   . PHE A 1 184 ? -22.089 -4.823  -47.312  1.00 54.33  ? 239  PHE A C   1 
ATOM   1356  O O   . PHE A 1 184 ? -22.235 -4.945  -48.527  1.00 56.69  ? 239  PHE A O   1 
ATOM   1357  C CB  . PHE A 1 184 ? -20.506 -5.783  -45.655  1.00 53.96  ? 239  PHE A CB  1 
ATOM   1358  C CG  . PHE A 1 184 ? -20.752 -7.177  -46.174  1.00 49.29  ? 239  PHE A CG  1 
ATOM   1359  C CD1 . PHE A 1 184 ? -19.792 -7.822  -46.932  1.00 42.07  ? 239  PHE A CD1 1 
ATOM   1360  C CD2 . PHE A 1 184 ? -21.932 -7.847  -45.885  1.00 48.75  ? 239  PHE A CD2 1 
ATOM   1361  C CE1 . PHE A 1 184 ? -20.002 -9.093  -47.401  1.00 43.01  ? 239  PHE A CE1 1 
ATOM   1362  C CE2 . PHE A 1 184 ? -22.145 -9.128  -46.353  1.00 48.42  ? 239  PHE A CE2 1 
ATOM   1363  C CZ  . PHE A 1 184 ? -21.177 -9.749  -47.112  1.00 47.36  ? 239  PHE A CZ  1 
ATOM   1364  N N   . TYR A 1 185 ? -23.107 -4.809  -46.464  1.00 44.25  ? 240  TYR A N   1 
ATOM   1365  C CA  . TYR A 1 185 ? -24.449 -5.127  -46.925  1.00 46.37  ? 240  TYR A CA  1 
ATOM   1366  C C   . TYR A 1 185 ? -24.911 -4.226  -48.072  1.00 51.20  ? 240  TYR A C   1 
ATOM   1367  O O   . TYR A 1 185 ? -25.386 -4.717  -49.099  1.00 55.46  ? 240  TYR A O   1 
ATOM   1368  C CB  . TYR A 1 185 ? -25.431 -5.136  -45.759  1.00 46.37  ? 240  TYR A CB  1 
ATOM   1369  C CG  . TYR A 1 185 ? -25.170 -6.282  -44.812  1.00 56.76  ? 240  TYR A CG  1 
ATOM   1370  C CD1 . TYR A 1 185 ? -25.708 -7.543  -45.046  1.00 58.58  ? 240  TYR A CD1 1 
ATOM   1371  C CD2 . TYR A 1 185 ? -24.365 -6.113  -43.690  1.00 65.92  ? 240  TYR A CD2 1 
ATOM   1372  C CE1 . TYR A 1 185 ? -25.460 -8.600  -44.176  1.00 66.17  ? 240  TYR A CE1 1 
ATOM   1373  C CE2 . TYR A 1 185 ? -24.113 -7.165  -42.813  1.00 61.78  ? 240  TYR A CE2 1 
ATOM   1374  C CZ  . TYR A 1 185 ? -24.664 -8.403  -43.063  1.00 59.29  ? 240  TYR A CZ  1 
ATOM   1375  O OH  . TYR A 1 185 ? -24.424 -9.443  -42.203  1.00 53.21  ? 240  TYR A OH  1 
ATOM   1376  N N   . MET A 1 186 ? -24.743 -2.916  -47.915  1.00 53.37  ? 241  MET A N   1 
ATOM   1377  C CA  . MET A 1 186 ? -25.079 -1.972  -48.984  1.00 51.92  ? 241  MET A CA  1 
ATOM   1378  C C   . MET A 1 186 ? -24.343 -2.285  -50.294  1.00 42.30  ? 241  MET A C   1 
ATOM   1379  O O   . MET A 1 186 ? -24.976 -2.510  -51.331  1.00 45.74  ? 241  MET A O   1 
ATOM   1380  C CB  . MET A 1 186 ? -24.814 -0.524  -48.542  1.00 51.80  ? 241  MET A CB  1 
ATOM   1381  C CG  . MET A 1 186 ? -25.039 0.528   -49.626  1.00 49.34  ? 241  MET A CG  1 
ATOM   1382  S SD  . MET A 1 186 ? -23.583 0.843   -50.655  1.00 58.52  ? 241  MET A SD  1 
ATOM   1383  C CE  . MET A 1 186 ? -22.609 1.910   -49.596  1.00 44.48  ? 241  MET A CE  1 
ATOM   1384  N N   . PRO A 1 187 ? -23.002 -2.309  -50.255  1.00 37.18  ? 242  PRO A N   1 
ATOM   1385  C CA  . PRO A 1 187 ? -22.247 -2.512  -51.494  1.00 47.00  ? 242  PRO A CA  1 
ATOM   1386  C C   . PRO A 1 187 ? -22.539 -3.863  -52.135  1.00 48.20  ? 242  PRO A C   1 
ATOM   1387  O O   . PRO A 1 187 ? -22.493 -3.982  -53.366  1.00 53.93  ? 242  PRO A O   1 
ATOM   1388  C CB  . PRO A 1 187 ? -20.791 -2.437  -51.032  1.00 38.70  ? 242  PRO A CB  1 
ATOM   1389  C CG  . PRO A 1 187 ? -20.841 -1.634  -49.785  1.00 42.78  ? 242  PRO A CG  1 
ATOM   1390  C CD  . PRO A 1 187 ? -22.111 -2.051  -49.115  1.00 43.13  ? 242  PRO A CD  1 
ATOM   1391  N N   . VAL A 1 188 ? -22.839 -4.866  -51.318  1.00 40.99  ? 243  VAL A N   1 
ATOM   1392  C CA  . VAL A 1 188 ? -23.189 -6.169  -51.860  1.00 42.60  ? 243  VAL A CA  1 
ATOM   1393  C C   . VAL A 1 188 ? -24.540 -6.109  -52.570  1.00 46.64  ? 243  VAL A C   1 
ATOM   1394  O O   . VAL A 1 188 ? -24.661 -6.515  -53.731  1.00 49.35  ? 243  VAL A O   1 
ATOM   1395  C CB  . VAL A 1 188 ? -23.186 -7.261  -50.784  1.00 40.15  ? 243  VAL A CB  1 
ATOM   1396  C CG1 . VAL A 1 188 ? -23.940 -8.488  -51.278  1.00 41.22  ? 243  VAL A CG1 1 
ATOM   1397  C CG2 . VAL A 1 188 ? -21.758 -7.615  -50.411  1.00 35.96  ? 243  VAL A CG2 1 
ATOM   1398  N N   . THR A 1 189 ? -25.552 -5.578  -51.895  1.00 43.91  ? 244  THR A N   1 
ATOM   1399  C CA  . THR A 1 189 ? -26.835 -5.412  -52.561  1.00 49.27  ? 244  THR A CA  1 
ATOM   1400  C C   . THR A 1 189 ? -26.630 -4.722  -53.909  1.00 49.51  ? 244  THR A C   1 
ATOM   1401  O O   . THR A 1 189 ? -27.048 -5.237  -54.952  1.00 51.69  ? 244  THR A O   1 
ATOM   1402  C CB  . THR A 1 189 ? -27.844 -4.622  -51.704  1.00 53.44  ? 244  THR A CB  1 
ATOM   1403  O OG1 . THR A 1 189 ? -27.347 -3.300  -51.461  1.00 54.89  ? 244  THR A OG1 1 
ATOM   1404  C CG2 . THR A 1 189 ? -28.092 -5.335  -50.375  1.00 54.05  ? 244  THR A CG2 1 
ATOM   1405  N N   . ILE A 1 190 ? -25.943 -3.581  -53.895  1.00 48.56  ? 245  ILE A N   1 
ATOM   1406  C CA  . ILE A 1 190 ? -25.734 -2.819  -55.132  1.00 53.33  ? 245  ILE A CA  1 
ATOM   1407  C C   . ILE A 1 190 ? -25.044 -3.640  -56.233  1.00 54.24  ? 245  ILE A C   1 
ATOM   1408  O O   . ILE A 1 190 ? -25.428 -3.577  -57.411  1.00 49.04  ? 245  ILE A O   1 
ATOM   1409  C CB  . ILE A 1 190 ? -24.976 -1.497  -54.883  1.00 40.58  ? 245  ILE A CB  1 
ATOM   1410  C CG1 . ILE A 1 190 ? -25.972 -0.358  -54.686  1.00 35.56  ? 245  ILE A CG1 1 
ATOM   1411  C CG2 . ILE A 1 190 ? -24.066 -1.176  -56.051  1.00 36.67  ? 245  ILE A CG2 1 
ATOM   1412  C CD1 . ILE A 1 190 ? -25.324 0.960   -54.397  1.00 41.10  ? 245  ILE A CD1 1 
ATOM   1413  N N   . MET A 1 191 ? -24.029 -4.408  -55.849  1.00 54.62  ? 246  MET A N   1 
ATOM   1414  C CA  . MET A 1 191 ? -23.359 -5.283  -56.803  1.00 53.56  ? 246  MET A CA  1 
ATOM   1415  C C   . MET A 1 191 ? -24.306 -6.322  -57.379  1.00 55.46  ? 246  MET A C   1 
ATOM   1416  O O   . MET A 1 191 ? -24.169 -6.716  -58.533  1.00 62.36  ? 246  MET A O   1 
ATOM   1417  C CB  . MET A 1 191 ? -22.146 -5.968  -56.175  1.00 50.68  ? 246  MET A CB  1 
ATOM   1418  C CG  . MET A 1 191 ? -20.896 -5.121  -56.190  1.00 53.00  ? 246  MET A CG  1 
ATOM   1419  S SD  . MET A 1 191 ? -19.478 -6.037  -55.577  1.00 70.97  ? 246  MET A SD  1 
ATOM   1420  C CE  . MET A 1 191 ? -20.013 -6.407  -53.907  1.00 59.29  ? 246  MET A CE  1 
ATOM   1421  N N   . THR A 1 192 ? -25.264 -6.767  -56.576  1.00 47.95  ? 247  THR A N   1 
ATOM   1422  C CA  . THR A 1 192 ? -26.246 -7.731  -57.052  1.00 52.53  ? 247  THR A CA  1 
ATOM   1423  C C   . THR A 1 192 ? -27.181 -7.077  -58.063  1.00 53.24  ? 247  THR A C   1 
ATOM   1424  O O   . THR A 1 192 ? -27.455 -7.629  -59.132  1.00 56.93  ? 247  THR A O   1 
ATOM   1425  C CB  . THR A 1 192 ? -27.053 -8.307  -55.891  1.00 48.30  ? 247  THR A CB  1 
ATOM   1426  O OG1 . THR A 1 192 ? -26.153 -8.654  -54.835  1.00 51.12  ? 247  THR A OG1 1 
ATOM   1427  C CG2 . THR A 1 192 ? -27.823 -9.545  -56.331  1.00 46.06  ? 247  THR A CG2 1 
ATOM   1428  N N   . ILE A 1 193 ? -27.663 -5.889  -57.721  1.00 50.51  ? 248  ILE A N   1 
ATOM   1429  C CA  . ILE A 1 193 ? -28.513 -5.126  -58.627  1.00 58.03  ? 248  ILE A CA  1 
ATOM   1430  C C   . ILE A 1 193 ? -27.821 -4.959  -59.976  1.00 58.76  ? 248  ILE A C   1 
ATOM   1431  O O   . ILE A 1 193 ? -28.261 -5.506  -61.010  1.00 57.68  ? 248  ILE A O   1 
ATOM   1432  C CB  . ILE A 1 193 ? -28.842 -3.741  -58.036  1.00 49.26  ? 248  ILE A CB  1 
ATOM   1433  C CG1 . ILE A 1 193 ? -29.759 -3.900  -56.819  1.00 46.22  ? 248  ILE A CG1 1 
ATOM   1434  C CG2 . ILE A 1 193 ? -29.462 -2.837  -59.093  1.00 41.90  ? 248  ILE A CG2 1 
ATOM   1435  C CD1 . ILE A 1 193 ? -30.157 -2.602  -56.174  1.00 50.75  ? 248  ILE A CD1 1 
ATOM   1436  N N   . LEU A 1 194 ? -26.721 -4.210  -59.952  1.00 59.04  ? 249  LEU A N   1 
ATOM   1437  C CA  . LEU A 1 194 ? -25.949 -3.961  -61.156  1.00 58.23  ? 249  LEU A CA  1 
ATOM   1438  C C   . LEU A 1 194 ? -25.711 -5.268  -61.881  1.00 63.10  ? 249  LEU A C   1 
ATOM   1439  O O   . LEU A 1 194 ? -25.865 -5.347  -63.097  1.00 62.24  ? 249  LEU A O   1 
ATOM   1440  C CB  . LEU A 1 194 ? -24.609 -3.307  -60.822  1.00 49.62  ? 249  LEU A CB  1 
ATOM   1441  C CG  . LEU A 1 194 ? -24.705 -1.859  -60.362  1.00 53.05  ? 249  LEU A CG  1 
ATOM   1442  C CD1 . LEU A 1 194 ? -23.314 -1.299  -60.112  1.00 53.20  ? 249  LEU A CD1 1 
ATOM   1443  C CD2 . LEU A 1 194 ? -25.456 -1.030  -61.401  1.00 49.28  ? 249  LEU A CD2 1 
ATOM   1444  N N   . TYR A 1 195 ? -25.354 -6.300  -61.124  1.00 64.26  ? 250  TYR A N   1 
ATOM   1445  C CA  . TYR A 1 195 ? -25.064 -7.593  -61.720  1.00 62.39  ? 250  TYR A CA  1 
ATOM   1446  C C   . TYR A 1 195 ? -26.230 -8.049  -62.576  1.00 60.62  ? 250  TYR A C   1 
ATOM   1447  O O   . TYR A 1 195 ? -26.147 -8.013  -63.798  1.00 60.06  ? 250  TYR A O   1 
ATOM   1448  C CB  . TYR A 1 195 ? -24.757 -8.649  -60.657  1.00 57.50  ? 250  TYR A CB  1 
ATOM   1449  C CG  . TYR A 1 195 ? -24.520 -10.021 -61.244  1.00 57.19  ? 250  TYR A CG  1 
ATOM   1450  C CD1 . TYR A 1 195 ? -23.272 -10.382 -61.727  1.00 52.30  ? 250  TYR A CD1 1 
ATOM   1451  C CD2 . TYR A 1 195 ? -25.548 -10.952 -61.325  1.00 61.10  ? 250  TYR A CD2 1 
ATOM   1452  C CE1 . TYR A 1 195 ? -23.052 -11.632 -62.269  1.00 58.36  ? 250  TYR A CE1 1 
ATOM   1453  C CE2 . TYR A 1 195 ? -25.337 -12.203 -61.866  1.00 63.93  ? 250  TYR A CE2 1 
ATOM   1454  C CZ  . TYR A 1 195 ? -24.087 -12.538 -62.337  1.00 65.19  ? 250  TYR A CZ  1 
ATOM   1455  O OH  . TYR A 1 195 ? -23.867 -13.782 -62.879  1.00 68.75  ? 250  TYR A OH  1 
ATOM   1456  N N   . TRP A 1 196 ? -27.331 -8.433  -61.937  1.00 61.06  ? 251  TRP A N   1 
ATOM   1457  C CA  . TRP A 1 196 ? -28.444 -9.023  -62.674  1.00 64.53  ? 251  TRP A CA  1 
ATOM   1458  C C   . TRP A 1 196 ? -28.835 -8.143  -63.853  1.00 62.21  ? 251  TRP A C   1 
ATOM   1459  O O   . TRP A 1 196 ? -29.234 -8.649  -64.906  1.00 63.46  ? 251  TRP A O   1 
ATOM   1460  C CB  . TRP A 1 196 ? -29.641 -9.317  -61.761  1.00 65.90  ? 251  TRP A CB  1 
ATOM   1461  C CG  . TRP A 1 196 ? -29.418 -10.504 -60.849  1.00 69.74  ? 251  TRP A CG  1 
ATOM   1462  C CD1 . TRP A 1 196 ? -29.358 -10.494 -59.482  1.00 72.11  ? 251  TRP A CD1 1 
ATOM   1463  C CD2 . TRP A 1 196 ? -29.214 -11.868 -61.246  1.00 60.55  ? 251  TRP A CD2 1 
ATOM   1464  N NE1 . TRP A 1 196 ? -29.136 -11.766 -59.008  1.00 70.34  ? 251  TRP A NE1 1 
ATOM   1465  C CE2 . TRP A 1 196 ? -29.044 -12.624 -60.069  1.00 62.53  ? 251  TRP A CE2 1 
ATOM   1466  C CE3 . TRP A 1 196 ? -29.162 -12.520 -62.479  1.00 57.11  ? 251  TRP A CE3 1 
ATOM   1467  C CZ2 . TRP A 1 196 ? -28.828 -13.999 -60.094  1.00 60.36  ? 251  TRP A CZ2 1 
ATOM   1468  C CZ3 . TRP A 1 196 ? -28.947 -13.881 -62.499  1.00 59.99  ? 251  TRP A CZ3 1 
ATOM   1469  C CH2 . TRP A 1 196 ? -28.785 -14.608 -61.317  1.00 60.23  ? 251  TRP A CH2 1 
ATOM   1470  N N   . ARG A 1 197 ? -28.694 -6.828  -63.690  1.00 65.50  ? 252  ARG A N   1 
ATOM   1471  C CA  . ARG A 1 197 ? -28.956 -5.924  -64.812  1.00 62.90  ? 252  ARG A CA  1 
ATOM   1472  C C   . ARG A 1 197 ? -28.007 -6.182  -65.986  1.00 63.83  ? 252  ARG A C   1 
ATOM   1473  O O   . ARG A 1 197 ? -28.441 -6.317  -67.133  1.00 62.94  ? 252  ARG A O   1 
ATOM   1474  C CB  . ARG A 1 197 ? -28.886 -4.459  -64.374  1.00 56.34  ? 252  ARG A CB  1 
ATOM   1475  C CG  . ARG A 1 197 ? -30.009 -4.046  -63.441  1.00 56.11  ? 252  ARG A CG  1 
ATOM   1476  C CD  . ARG A 1 197 ? -30.056 -2.539  -63.275  1.00 54.19  ? 252  ARG A CD  1 
ATOM   1477  N NE  . ARG A 1 197 ? -31.127 -2.127  -62.375  1.00 61.89  ? 252  ARG A NE  1 
ATOM   1478  C CZ  . ARG A 1 197 ? -31.531 -0.869  -62.225  1.00 64.01  ? 252  ARG A CZ  1 
ATOM   1479  N NH1 . ARG A 1 197 ? -30.956 0.102   -62.924  1.00 53.09  ? 252  ARG A NH1 1 
ATOM   1480  N NH2 . ARG A 1 197 ? -32.514 -0.583  -61.381  1.00 72.84  ? 252  ARG A NH2 1 
ATOM   1481  N N   . ILE A 1 198 ? -26.713 -6.250  -65.691  1.00 64.31  ? 253  ILE A N   1 
ATOM   1482  C CA  . ILE A 1 198 ? -25.709 -6.533  -66.707  1.00 66.12  ? 253  ILE A CA  1 
ATOM   1483  C C   . ILE A 1 198 ? -25.975 -7.890  -67.349  1.00 63.57  ? 253  ILE A C   1 
ATOM   1484  O O   . ILE A 1 198 ? -25.965 -8.017  -68.571  1.00 75.38  ? 253  ILE A O   1 
ATOM   1485  C CB  . ILE A 1 198 ? -24.281 -6.496  -66.114  1.00 63.95  ? 253  ILE A CB  1 
ATOM   1486  C CG1 . ILE A 1 198 ? -23.938 -5.079  -65.652  1.00 54.12  ? 253  ILE A CG1 1 
ATOM   1487  C CG2 . ILE A 1 198 ? -23.257 -6.984  -67.128  1.00 65.81  ? 253  ILE A CG2 1 
ATOM   1488  C CD1 . ILE A 1 198 ? -22.467 -4.872  -65.369  1.00 50.65  ? 253  ILE A CD1 1 
ATOM   1489  N N   . TYR A 1 199 ? -26.232 -8.892  -66.515  1.00 59.11  ? 254  TYR A N   1 
ATOM   1490  C CA  . TYR A 1 199 ? -26.496 -10.260 -66.960  1.00 69.96  ? 254  TYR A CA  1 
ATOM   1491  C C   . TYR A 1 199 ? -27.720 -10.337 -67.880  1.00 73.03  ? 254  TYR A C   1 
ATOM   1492  O O   . TYR A 1 199 ? -27.792 -11.203 -68.760  1.00 72.72  ? 254  TYR A O   1 
ATOM   1493  C CB  . TYR A 1 199 ? -26.684 -11.167 -65.739  1.00 76.52  ? 254  TYR A CB  1 
ATOM   1494  C CG  . TYR A 1 199 ? -26.723 -12.655 -66.019  1.00 75.39  ? 254  TYR A CG  1 
ATOM   1495  C CD1 . TYR A 1 199 ? -25.663 -13.482 -65.655  1.00 74.48  ? 254  TYR A CD1 1 
ATOM   1496  C CD2 . TYR A 1 199 ? -27.828 -13.235 -66.621  1.00 74.55  ? 254  TYR A CD2 1 
ATOM   1497  C CE1 . TYR A 1 199 ? -25.703 -14.844 -65.898  1.00 84.27  ? 254  TYR A CE1 1 
ATOM   1498  C CE2 . TYR A 1 199 ? -27.878 -14.592 -66.870  1.00 86.43  ? 254  TYR A CE2 1 
ATOM   1499  C CZ  . TYR A 1 199 ? -26.816 -15.394 -66.507  1.00 94.87  ? 254  TYR A CZ  1 
ATOM   1500  O OH  . TYR A 1 199 ? -26.876 -16.746 -66.758  1.00 104.92 ? 254  TYR A OH  1 
ATOM   1501  N N   . LYS A 1 200 ? -28.681 -9.438  -67.667  1.00 66.40  ? 255  LYS A N   1 
ATOM   1502  C CA  . LYS A 1 200 ? -29.840 -9.321  -68.552  1.00 58.03  ? 255  LYS A CA  1 
ATOM   1503  C C   . LYS A 1 200 ? -29.482 -8.615  -69.867  1.00 57.18  ? 255  LYS A C   1 
ATOM   1504  O O   . LYS A 1 200 ? -29.909 -9.042  -70.944  1.00 48.87  ? 255  LYS A O   1 
ATOM   1505  C CB  . LYS A 1 200 ? -30.978 -8.570  -67.850  1.00 55.93  ? 255  LYS A CB  1 
ATOM   1506  C CG  . LYS A 1 200 ? -32.264 -8.464  -68.665  1.00 54.24  ? 255  LYS A CG  1 
ATOM   1507  C CD  . LYS A 1 200 ? -33.401 -7.828  -67.870  1.00 56.29  ? 255  LYS A CD  1 
ATOM   1508  C CE  . LYS A 1 200 ? -34.694 -7.756  -68.687  1.00 63.07  ? 255  LYS A CE  1 
ATOM   1509  N NZ  . LYS A 1 200 ? -35.414 -9.059  -68.810  1.00 51.94  ? 255  LYS A NZ  1 
ATOM   1510  N N   . GLU A 1 201 ? -28.692 -7.547  -69.764  1.00 62.58  ? 256  GLU A N   1 
ATOM   1511  C CA  . GLU A 1 201 ? -28.433 -6.625  -70.873  1.00 63.68  ? 256  GLU A CA  1 
ATOM   1512  C C   . GLU A 1 201 ? -27.154 -6.826  -71.703  1.00 63.30  ? 256  GLU A C   1 
ATOM   1513  O O   . GLU A 1 201 ? -26.834 -5.985  -72.546  1.00 64.18  ? 256  GLU A O   1 
ATOM   1514  C CB  . GLU A 1 201 ? -28.451 -5.184  -70.361  1.00 58.65  ? 256  GLU A CB  1 
ATOM   1515  C CG  . GLU A 1 201 ? -29.472 -4.302  -71.051  1.00 64.29  ? 256  GLU A CG  1 
ATOM   1516  C CD  . GLU A 1 201 ? -30.751 -4.154  -70.246  1.00 79.27  ? 256  GLU A CD  1 
ATOM   1517  O OE1 . GLU A 1 201 ? -31.842 -4.155  -70.856  1.00 83.44  ? 256  GLU A OE1 1 
ATOM   1518  O OE2 . GLU A 1 201 ? -30.664 -4.018  -69.005  1.00 72.01  ? 256  GLU A OE2 1 
ATOM   1519  N N   . THR A 1 202 ? -26.410 -7.897  -71.455  1.00 62.05  ? 257  THR A N   1 
ATOM   1520  C CA  . THR A 1 202 ? -25.084 -8.062  -72.056  1.00 63.46  ? 257  THR A CA  1 
ATOM   1521  C C   . THR A 1 202 ? -24.997 -7.877  -73.573  1.00 66.63  ? 257  THR A C   1 
ATOM   1522  O O   . THR A 1 202 ? -23.975 -7.411  -74.081  1.00 67.35  ? 257  THR A O   1 
ATOM   1523  C CB  . THR A 1 202 ? -24.460 -9.429  -71.687  1.00 77.84  ? 257  THR A CB  1 
ATOM   1524  O OG1 . THR A 1 202 ? -24.455 -9.580  -70.263  1.00 95.23  ? 257  THR A OG1 1 
ATOM   1525  C CG2 . THR A 1 202 ? -23.025 -9.516  -72.201  1.00 74.20  ? 257  THR A CG2 1 
ATOM   1526  N N   . GLU A 1 203 ? -26.043 -8.249  -74.303  1.00 57.84  ? 258  GLU A N   1 
ATOM   1527  C CA  . GLU A 1 203 ? -25.935 -8.256  -75.760  1.00 61.03  ? 258  GLU A CA  1 
ATOM   1528  C C   . GLU A 1 203 ? -25.938 -6.856  -76.401  1.00 60.69  ? 258  GLU A C   1 
ATOM   1529  O O   . GLU A 1 203 ? -25.466 -6.689  -77.531  1.00 62.32  ? 258  GLU A O   1 
ATOM   1530  C CB  . GLU A 1 203 ? -27.005 -9.153  -76.393  1.00 68.23  ? 258  GLU A CB  1 
ATOM   1531  C CG  . GLU A 1 203 ? -26.733 -9.450  -77.870  1.00 77.63  ? 258  GLU A CG  1 
ATOM   1532  C CD  . GLU A 1 203 ? -27.868 -10.191 -78.557  1.00 79.33  ? 258  GLU A CD  1 
ATOM   1533  O OE1 . GLU A 1 203 ? -27.889 -10.209 -79.810  1.00 72.06  ? 258  GLU A OE1 1 
ATOM   1534  O OE2 . GLU A 1 203 ? -28.730 -10.756 -77.847  1.00 77.20  ? 258  GLU A OE2 1 
ATOM   1535  N N   . LYS A 1 204 ? -26.460 -5.861  -75.682  1.00 59.02  ? 259  LYS A N   1 
ATOM   1536  C CA  . LYS A 1 204 ? -26.530 -4.488  -76.200  1.00 58.15  ? 259  LYS A CA  1 
ATOM   1537  C C   . LYS A 1 204 ? -25.180 -3.902  -76.622  1.00 59.78  ? 259  LYS A C   1 
ATOM   1538  O O   . LYS A 1 204 ? -25.123 -2.955  -77.418  1.00 61.11  ? 259  LYS A O   1 
ATOM   1539  C CB  . LYS A 1 204 ? -27.208 -3.543  -75.213  1.00 55.61  ? 259  LYS A CB  1 
ATOM   1540  C CG  . LYS A 1 204 ? -28.684 -3.342  -75.479  1.00 57.95  ? 259  LYS A CG  1 
ATOM   1541  C CD  . LYS A 1 204 ? -29.214 -2.148  -74.702  1.00 64.59  ? 259  LYS A CD  1 
ATOM   1542  C CE  . LYS A 1 204 ? -30.729 -2.184  -74.607  1.00 63.24  ? 259  LYS A CE  1 
ATOM   1543  N NZ  . LYS A 1 204 ? -31.260 -1.034  -73.829  1.00 54.60  ? 259  LYS A NZ  1 
ATOM   1544  N N   . MET A 1 205 ? -24.102 -4.444  -76.064  1.00 56.11  ? 1001 MET A N   1 
ATOM   1545  C CA  . MET A 1 205 ? -22.749 -4.088  -76.484  1.00 55.72  ? 1001 MET A CA  1 
ATOM   1546  C C   . MET A 1 205 ? -22.456 -4.547  -77.927  1.00 57.93  ? 1001 MET A C   1 
ATOM   1547  O O   . MET A 1 205 ? -22.056 -3.752  -78.778  1.00 58.98  ? 1001 MET A O   1 
ATOM   1548  C CB  . MET A 1 205 ? -21.720 -4.690  -75.513  1.00 47.99  ? 1001 MET A CB  1 
ATOM   1549  C CG  . MET A 1 205 ? -21.619 -3.993  -74.154  1.00 53.69  ? 1001 MET A CG  1 
ATOM   1550  S SD  . MET A 1 205 ? -20.388 -4.745  -73.059  1.00 58.12  ? 1001 MET A SD  1 
ATOM   1551  C CE  . MET A 1 205 ? -21.089 -6.372  -72.812  1.00 65.38  ? 1001 MET A CE  1 
ATOM   1552  N N   . ASN A 1 206 ? -22.649 -5.836  -78.193  1.00 57.01  ? 1002 ASN A N   1 
ATOM   1553  C CA  . ASN A 1 206 ? -22.417 -6.372  -79.533  1.00 54.49  ? 1002 ASN A CA  1 
ATOM   1554  C C   . ASN A 1 206 ? -23.385 -5.751  -80.528  1.00 53.42  ? 1002 ASN A C   1 
ATOM   1555  O O   . ASN A 1 206 ? -22.962 -5.247  -81.580  1.00 53.59  ? 1002 ASN A O   1 
ATOM   1556  C CB  . ASN A 1 206 ? -22.518 -7.896  -79.587  1.00 60.19  ? 1002 ASN A CB  1 
ATOM   1557  C CG  . ASN A 1 206 ? -21.385 -8.586  -78.841  1.00 60.61  ? 1002 ASN A CG  1 
ATOM   1558  O OD1 . ASN A 1 206 ? -21.595 -9.590  -78.157  1.00 62.50  ? 1002 ASN A OD1 1 
ATOM   1559  N ND2 . ASN A 1 206 ? -20.175 -8.051  -78.976  1.00 52.48  ? 1002 ASN A ND2 1 
ATOM   1560  N N   . ILE A 1 207 ? -24.680 -5.783  -80.211  1.00 52.63  ? 1003 ILE A N   1 
ATOM   1561  C CA  . ILE A 1 207 ? -25.673 -5.202  -81.112  1.00 57.18  ? 1003 ILE A CA  1 
ATOM   1562  C C   . ILE A 1 207 ? -25.415 -3.707  -81.295  1.00 55.03  ? 1003 ILE A C   1 
ATOM   1563  O O   . ILE A 1 207 ? -25.747 -3.117  -82.335  1.00 57.50  ? 1003 ILE A O   1 
ATOM   1564  C CB  . ILE A 1 207 ? -27.127 -5.466  -80.626  1.00 48.69  ? 1003 ILE A CB  1 
ATOM   1565  C CG1 . ILE A 1 207 ? -27.590 -4.385  -79.667  1.00 46.71  ? 1003 ILE A CG1 1 
ATOM   1566  C CG2 . ILE A 1 207 ? -27.246 -6.838  -79.986  1.00 48.77  ? 1003 ILE A CG2 1 
ATOM   1567  C CD1 . ILE A 1 207 ? -28.776 -4.824  -78.830  1.00 50.86  ? 1003 ILE A CD1 1 
ATOM   1568  N N   . PHE A 1 208 ? -24.785 -3.102  -80.293  1.00 49.32  ? 1004 PHE A N   1 
ATOM   1569  C CA  . PHE A 1 208 ? -24.414 -1.702  -80.400  1.00 44.33  ? 1004 PHE A CA  1 
ATOM   1570  C C   . PHE A 1 208 ? -23.337 -1.486  -81.435  1.00 51.23  ? 1004 PHE A C   1 
ATOM   1571  O O   . PHE A 1 208 ? -23.500 -0.667  -82.329  1.00 57.18  ? 1004 PHE A O   1 
ATOM   1572  C CB  . PHE A 1 208 ? -23.915 -1.126  -79.088  1.00 48.14  ? 1004 PHE A CB  1 
ATOM   1573  C CG  . PHE A 1 208 ? -23.271 0.218   -79.249  1.00 51.66  ? 1004 PHE A CG  1 
ATOM   1574  C CD1 . PHE A 1 208 ? -24.038 1.375   -79.249  1.00 50.00  ? 1004 PHE A CD1 1 
ATOM   1575  C CD2 . PHE A 1 208 ? -21.901 0.325   -79.430  1.00 49.70  ? 1004 PHE A CD2 1 
ATOM   1576  C CE1 . PHE A 1 208 ? -23.444 2.614   -79.409  1.00 52.01  ? 1004 PHE A CE1 1 
ATOM   1577  C CE2 . PHE A 1 208 ? -21.305 1.564   -79.592  1.00 50.43  ? 1004 PHE A CE2 1 
ATOM   1578  C CZ  . PHE A 1 208 ? -22.077 2.707   -79.579  1.00 49.66  ? 1004 PHE A CZ  1 
ATOM   1579  N N   . GLU A 1 209 ? -22.221 -2.196  -81.302  1.00 43.96  ? 1005 GLU A N   1 
ATOM   1580  C CA  . GLU A 1 209 ? -21.141 -2.037  -82.271  1.00 50.93  ? 1005 GLU A CA  1 
ATOM   1581  C C   . GLU A 1 209 ? -21.677 -2.343  -83.671  1.00 49.52  ? 1005 GLU A C   1 
ATOM   1582  O O   . GLU A 1 209 ? -21.295 -1.697  -84.658  1.00 46.01  ? 1005 GLU A O   1 
ATOM   1583  C CB  . GLU A 1 209 ? -19.968 -2.958  -81.938  1.00 56.45  ? 1005 GLU A CB  1 
ATOM   1584  C CG  . GLU A 1 209 ? -19.430 -2.832  -80.510  1.00 63.88  ? 1005 GLU A CG  1 
ATOM   1585  C CD  . GLU A 1 209 ? -18.208 -3.715  -80.275  1.00 75.16  ? 1005 GLU A CD  1 
ATOM   1586  O OE1 . GLU A 1 209 ? -18.027 -4.223  -79.142  1.00 70.71  ? 1005 GLU A OE1 1 
ATOM   1587  O OE2 . GLU A 1 209 ? -17.427 -3.898  -81.234  1.00 76.20  ? 1005 GLU A OE2 1 
ATOM   1588  N N   . MET A 1 210 ? -22.575 -3.326  -83.739  1.00 47.92  ? 1006 MET A N   1 
ATOM   1589  C CA  . MET A 1 210 ? -23.184 -3.731  -85.002  1.00 50.32  ? 1006 MET A CA  1 
ATOM   1590  C C   . MET A 1 210 ? -23.897 -2.566  -85.686  1.00 42.71  ? 1006 MET A C   1 
ATOM   1591  O O   . MET A 1 210 ? -23.487 -2.113  -86.769  1.00 37.85  ? 1006 MET A O   1 
ATOM   1592  C CB  . MET A 1 210 ? -24.160 -4.886  -84.785  1.00 52.80  ? 1006 MET A CB  1 
ATOM   1593  C CG  . MET A 1 210 ? -24.587 -5.571  -86.077  1.00 56.87  ? 1006 MET A CG  1 
ATOM   1594  S SD  . MET A 1 210 ? -25.829 -6.864  -85.850  1.00 53.78  ? 1006 MET A SD  1 
ATOM   1595  C CE  . MET A 1 210 ? -26.244 -7.263  -87.548  1.00 199.20 ? 1006 MET A CE  1 
ATOM   1596  N N   . LEU A 1 211 ? -24.963 -2.083  -85.050  1.00 44.50  ? 1007 LEU A N   1 
ATOM   1597  C CA  . LEU A 1 211 ? -25.714 -0.959  -85.601  1.00 41.89  ? 1007 LEU A CA  1 
ATOM   1598  C C   . LEU A 1 211 ? -24.845 0.282   -85.787  1.00 47.20  ? 1007 LEU A C   1 
ATOM   1599  O O   . LEU A 1 211 ? -25.135 1.138   -86.628  1.00 52.44  ? 1007 LEU A O   1 
ATOM   1600  C CB  . LEU A 1 211 ? -26.911 -0.635  -84.715  1.00 34.34  ? 1007 LEU A CB  1 
ATOM   1601  C CG  . LEU A 1 211 ? -27.967 -1.740  -84.737  1.00 46.08  ? 1007 LEU A CG  1 
ATOM   1602  C CD1 . LEU A 1 211 ? -29.166 -1.361  -83.884  1.00 53.83  ? 1007 LEU A CD1 1 
ATOM   1603  C CD2 . LEU A 1 211 ? -28.389 -2.029  -86.169  1.00 48.31  ? 1007 LEU A CD2 1 
ATOM   1604  N N   . ARG A 1 212 ? -23.782 0.375   -84.997  1.00 48.90  ? 1008 ARG A N   1 
ATOM   1605  C CA  . ARG A 1 212 ? -22.861 1.501   -85.073  1.00 46.70  ? 1008 ARG A CA  1 
ATOM   1606  C C   . ARG A 1 212 ? -22.129 1.494   -86.402  1.00 44.55  ? 1008 ARG A C   1 
ATOM   1607  O O   . ARG A 1 212 ? -22.106 2.495   -87.112  1.00 51.96  ? 1008 ARG A O   1 
ATOM   1608  C CB  . ARG A 1 212 ? -21.857 1.442   -83.930  1.00 44.60  ? 1008 ARG A CB  1 
ATOM   1609  C CG  . ARG A 1 212 ? -20.731 2.440   -84.054  1.00 49.52  ? 1008 ARG A CG  1 
ATOM   1610  C CD  . ARG A 1 212 ? -21.197 3.850   -83.753  1.00 54.44  ? 1008 ARG A CD  1 
ATOM   1611  N NE  . ARG A 1 212 ? -20.085 4.797   -83.802  1.00 65.50  ? 1008 ARG A NE  1 
ATOM   1612  C CZ  . ARG A 1 212 ? -19.740 5.488   -84.884  1.00 68.11  ? 1008 ARG A CZ  1 
ATOM   1613  N NH1 . ARG A 1 212 ? -20.430 5.351   -86.011  1.00 62.19  ? 1008 ARG A NH1 1 
ATOM   1614  N NH2 . ARG A 1 212 ? -18.708 6.321   -84.837  1.00 70.57  ? 1008 ARG A NH2 1 
ATOM   1615  N N   . ILE A 1 213 ? -21.527 0.356   -86.730  1.00 52.03  ? 1009 ILE A N   1 
ATOM   1616  C CA  . ILE A 1 213 ? -20.906 0.171   -88.036  1.00 51.82  ? 1009 ILE A CA  1 
ATOM   1617  C C   . ILE A 1 213 ? -21.919 0.431   -89.137  1.00 53.10  ? 1009 ILE A C   1 
ATOM   1618  O O   . ILE A 1 213 ? -21.740 1.331   -89.958  1.00 46.60  ? 1009 ILE A O   1 
ATOM   1619  C CB  . ILE A 1 213 ? -20.337 -1.243  -88.209  1.00 45.22  ? 1009 ILE A CB  1 
ATOM   1620  C CG1 . ILE A 1 213 ? -19.162 -1.462  -87.265  1.00 42.42  ? 1009 ILE A CG1 1 
ATOM   1621  C CG2 . ILE A 1 213 ? -19.893 -1.466  -89.640  1.00 42.19  ? 1009 ILE A CG2 1 
ATOM   1622  C CD1 . ILE A 1 213 ? -18.431 -2.740  -87.509  1.00 43.02  ? 1009 ILE A CD1 1 
ATOM   1623  N N   . ASP A 1 214 ? -22.983 -0.372  -89.153  1.00 62.10  ? 1010 ASP A N   1 
ATOM   1624  C CA  . ASP A 1 214 ? -23.956 -0.297  -90.242  1.00 58.16  ? 1010 ASP A CA  1 
ATOM   1625  C C   . ASP A 1 214 ? -24.429 1.131   -90.484  1.00 50.14  ? 1010 ASP A C   1 
ATOM   1626  O O   . ASP A 1 214 ? -24.267 1.668   -91.579  1.00 56.46  ? 1010 ASP A O   1 
ATOM   1627  C CB  . ASP A 1 214 ? -25.155 -1.218  -89.980  1.00 49.20  ? 1010 ASP A CB  1 
ATOM   1628  C CG  . ASP A 1 214 ? -24.814 -2.687  -90.154  1.00 48.86  ? 1010 ASP A CG  1 
ATOM   1629  O OD1 . ASP A 1 214 ? -24.222 -3.052  -91.191  1.00 46.18  ? 1010 ASP A OD1 1 
ATOM   1630  O OD2 . ASP A 1 214 ? -25.129 -3.476  -89.244  1.00 51.49  ? 1010 ASP A OD2 1 
ATOM   1631  N N   . GLU A 1 215 ? -24.989 1.762   -89.463  1.00 49.37  ? 1011 GLU A N   1 
ATOM   1632  C CA  . GLU A 1 215 ? -25.520 3.105   -89.658  1.00 64.43  ? 1011 GLU A CA  1 
ATOM   1633  C C   . GLU A 1 215 ? -24.454 4.201   -89.638  1.00 67.64  ? 1011 GLU A C   1 
ATOM   1634  O O   . GLU A 1 215 ? -24.425 5.069   -90.515  1.00 77.60  ? 1011 GLU A O   1 
ATOM   1635  C CB  . GLU A 1 215 ? -26.623 3.425   -88.648  1.00 69.58  ? 1011 GLU A CB  1 
ATOM   1636  C CG  . GLU A 1 215 ? -27.556 4.527   -89.130  1.00 71.99  ? 1011 GLU A CG  1 
ATOM   1637  C CD  . GLU A 1 215 ? -28.445 4.076   -90.275  1.00 70.43  ? 1011 GLU A CD  1 
ATOM   1638  O OE1 . GLU A 1 215 ? -29.161 3.065   -90.112  1.00 65.14  ? 1011 GLU A OE1 1 
ATOM   1639  O OE2 . GLU A 1 215 ? -28.417 4.725   -91.340  1.00 72.48  ? 1011 GLU A OE2 1 
ATOM   1640  N N   . GLY A 1 216 ? -23.573 4.150   -88.646  1.00 58.65  ? 1012 GLY A N   1 
ATOM   1641  C CA  . GLY A 1 216 ? -22.625 5.227   -88.430  1.00 59.39  ? 1012 GLY A CA  1 
ATOM   1642  C C   . GLY A 1 216 ? -23.209 6.233   -87.461  1.00 56.88  ? 1012 GLY A C   1 
ATOM   1643  O O   . GLY A 1 216 ? -24.333 6.064   -86.994  1.00 66.08  ? 1012 GLY A O   1 
ATOM   1644  N N   . LEU A 1 217 ? -22.460 7.286   -87.164  1.00 51.33  ? 1013 LEU A N   1 
ATOM   1645  C CA  . LEU A 1 217 ? -22.898 8.254   -86.168  1.00 55.00  ? 1013 LEU A CA  1 
ATOM   1646  C C   . LEU A 1 217 ? -22.773 9.696   -86.643  1.00 58.22  ? 1013 LEU A C   1 
ATOM   1647  O O   . LEU A 1 217 ? -21.719 10.102  -87.126  1.00 67.02  ? 1013 LEU A O   1 
ATOM   1648  C CB  . LEU A 1 217 ? -22.106 8.051   -84.876  1.00 63.04  ? 1013 LEU A CB  1 
ATOM   1649  C CG  . LEU A 1 217 ? -22.116 9.135   -83.797  1.00 65.79  ? 1013 LEU A CG  1 
ATOM   1650  C CD1 . LEU A 1 217 ? -21.762 8.537   -82.434  1.00 60.79  ? 1013 LEU A CD1 1 
ATOM   1651  C CD2 . LEU A 1 217 ? -21.156 10.266  -84.152  1.00 66.77  ? 1013 LEU A CD2 1 
ATOM   1652  N N   . ARG A 1 218 ? -23.854 10.459  -86.514  1.00 52.54  ? 1014 ARG A N   1 
ATOM   1653  C CA  . ARG A 1 218 ? -23.810 11.899  -86.750  1.00 59.13  ? 1014 ARG A CA  1 
ATOM   1654  C C   . ARG A 1 218 ? -24.711 12.656  -85.774  1.00 56.57  ? 1014 ARG A C   1 
ATOM   1655  O O   . ARG A 1 218 ? -25.881 12.318  -85.602  1.00 53.34  ? 1014 ARG A O   1 
ATOM   1656  C CB  . ARG A 1 218 ? -24.171 12.228  -88.199  1.00 61.22  ? 1014 ARG A CB  1 
ATOM   1657  C CG  . ARG A 1 218 ? -23.135 11.748  -89.203  1.00 59.74  ? 1014 ARG A CG  1 
ATOM   1658  C CD  . ARG A 1 218 ? -22.764 12.846  -90.176  1.00 61.94  ? 1014 ARG A CD  1 
ATOM   1659  N NE  . ARG A 1 218 ? -23.213 12.549  -91.532  1.00 68.45  ? 1014 ARG A NE  1 
ATOM   1660  C CZ  . ARG A 1 218 ? -23.150 13.411  -92.544  1.00 77.90  ? 1014 ARG A CZ  1 
ATOM   1661  N NH1 . ARG A 1 218 ? -22.662 14.630  -92.351  1.00 82.20  ? 1014 ARG A NH1 1 
ATOM   1662  N NH2 . ARG A 1 218 ? -23.578 13.061  -93.751  1.00 80.38  ? 1014 ARG A NH2 1 
ATOM   1663  N N   . LEU A 1 219 ? -24.161 13.688  -85.144  1.00 59.77  ? 1015 LEU A N   1 
ATOM   1664  C CA  . LEU A 1 219 ? -24.881 14.425  -84.109  1.00 64.81  ? 1015 LEU A CA  1 
ATOM   1665  C C   . LEU A 1 219 ? -25.870 15.423  -84.686  1.00 63.37  ? 1015 LEU A C   1 
ATOM   1666  O O   . LEU A 1 219 ? -26.876 15.750  -84.059  1.00 64.84  ? 1015 LEU A O   1 
ATOM   1667  C CB  . LEU A 1 219 ? -23.903 15.155  -83.181  1.00 74.49  ? 1015 LEU A CB  1 
ATOM   1668  C CG  . LEU A 1 219 ? -23.226 14.341  -82.073  1.00 78.80  ? 1015 LEU A CG  1 
ATOM   1669  C CD1 . LEU A 1 219 ? -22.142 15.161  -81.379  1.00 88.75  ? 1015 LEU A CD1 1 
ATOM   1670  C CD2 . LEU A 1 219 ? -24.249 13.832  -81.064  1.00 66.68  ? 1015 LEU A CD2 1 
ATOM   1671  N N   . LYS A 1 220 ? -25.573 15.915  -85.880  1.00 65.32  ? 1016 LYS A N   1 
ATOM   1672  C CA  . LYS A 1 220 ? -26.381 16.953  -86.497  1.00 68.65  ? 1016 LYS A CA  1 
ATOM   1673  C C   . LYS A 1 220 ? -27.095 16.392  -87.713  1.00 71.26  ? 1016 LYS A C   1 
ATOM   1674  O O   . LYS A 1 220 ? -26.548 15.555  -88.427  1.00 74.65  ? 1016 LYS A O   1 
ATOM   1675  C CB  . LYS A 1 220 ? -25.500 18.137  -86.891  1.00 80.09  ? 1016 LYS A CB  1 
ATOM   1676  C CG  . LYS A 1 220 ? -24.800 18.810  -85.713  1.00 88.98  ? 1016 LYS A CG  1 
ATOM   1677  C CD  . LYS A 1 220 ? -23.995 20.027  -86.157  1.00 101.22 ? 1016 LYS A CD  1 
ATOM   1678  C CE  . LYS A 1 220 ? -22.653 19.642  -86.775  1.00 98.66  ? 1016 LYS A CE  1 
ATOM   1679  N NZ  . LYS A 1 220 ? -21.668 19.200  -85.746  1.00 94.31  ? 1016 LYS A NZ  1 
ATOM   1680  N N   . ILE A 1 221 ? -28.317 16.855  -87.947  1.00 72.17  ? 1017 ILE A N   1 
ATOM   1681  C CA  . ILE A 1 221 ? -29.157 16.297  -89.001  1.00 67.75  ? 1017 ILE A CA  1 
ATOM   1682  C C   . ILE A 1 221 ? -28.444 16.242  -90.355  1.00 68.48  ? 1017 ILE A C   1 
ATOM   1683  O O   . ILE A 1 221 ? -27.845 17.221  -90.795  1.00 71.26  ? 1017 ILE A O   1 
ATOM   1684  C CB  . ILE A 1 221 ? -30.490 17.067  -89.127  1.00 67.04  ? 1017 ILE A CB  1 
ATOM   1685  C CG1 . ILE A 1 221 ? -31.243 17.033  -87.794  1.00 66.10  ? 1017 ILE A CG1 1 
ATOM   1686  C CG2 . ILE A 1 221 ? -31.337 16.476  -90.236  1.00 70.84  ? 1017 ILE A CG2 1 
ATOM   1687  C CD1 . ILE A 1 221 ? -32.553 17.796  -87.799  1.00 64.83  ? 1017 ILE A CD1 1 
ATOM   1688  N N   . TYR A 1 222 ? -28.501 15.079  -90.997  1.00 66.87  ? 1018 TYR A N   1 
ATOM   1689  C CA  . TYR A 1 222 ? -27.855 14.866  -92.287  1.00 69.46  ? 1018 TYR A CA  1 
ATOM   1690  C C   . TYR A 1 222 ? -28.782 14.047  -93.179  1.00 77.88  ? 1018 TYR A C   1 
ATOM   1691  O O   . TYR A 1 222 ? -29.718 13.415  -92.691  1.00 81.03  ? 1018 TYR A O   1 
ATOM   1692  C CB  . TYR A 1 222 ? -26.531 14.126  -92.099  1.00 66.57  ? 1018 TYR A CB  1 
ATOM   1693  C CG  . TYR A 1 222 ? -26.708 12.655  -91.799  1.00 69.96  ? 1018 TYR A CG  1 
ATOM   1694  C CD1 . TYR A 1 222 ? -26.510 11.692  -92.785  1.00 75.72  ? 1018 TYR A CD1 1 
ATOM   1695  C CD2 . TYR A 1 222 ? -27.091 12.228  -90.537  1.00 67.22  ? 1018 TYR A CD2 1 
ATOM   1696  C CE1 . TYR A 1 222 ? -26.677 10.344  -92.515  1.00 72.50  ? 1018 TYR A CE1 1 
ATOM   1697  C CE2 . TYR A 1 222 ? -27.263 10.884  -90.258  1.00 66.44  ? 1018 TYR A CE2 1 
ATOM   1698  C CZ  . TYR A 1 222 ? -27.054 9.946   -91.250  1.00 65.33  ? 1018 TYR A CZ  1 
ATOM   1699  O OH  . TYR A 1 222 ? -27.220 8.608   -90.976  1.00 57.30  ? 1018 TYR A OH  1 
ATOM   1700  N N   . LYS A 1 223 ? -28.520 14.045  -94.481  1.00 76.52  ? 1019 LYS A N   1 
ATOM   1701  C CA  . LYS A 1 223 ? -29.369 13.307  -95.405  1.00 72.22  ? 1019 LYS A CA  1 
ATOM   1702  C C   . LYS A 1 223 ? -28.862 11.887  -95.642  1.00 70.51  ? 1019 LYS A C   1 
ATOM   1703  O O   . LYS A 1 223 ? -27.682 11.661  -95.904  1.00 66.52  ? 1019 LYS A O   1 
ATOM   1704  C CB  . LYS A 1 223 ? -29.512 14.057  -96.727  1.00 81.69  ? 1019 LYS A CB  1 
ATOM   1705  C CG  . LYS A 1 223 ? -29.818 15.541  -96.572  1.00 84.50  ? 1019 LYS A CG  1 
ATOM   1706  C CD  . LYS A 1 223 ? -30.081 16.181  -97.932  1.00 102.10 ? 1019 LYS A CD  1 
ATOM   1707  C CE  . LYS A 1 223 ? -29.408 17.543  -98.059  1.00 104.70 ? 1019 LYS A CE  1 
ATOM   1708  N NZ  . LYS A 1 223 ? -27.918 17.449  -98.014  1.00 84.01  ? 1019 LYS A NZ  1 
ATOM   1709  N N   . ASP A 1 224 ? -29.787 10.941  -95.571  1.00 75.17  ? 1020 ASP A N   1 
ATOM   1710  C CA  . ASP A 1 224 ? -29.498 9.519   -95.697  1.00 82.58  ? 1020 ASP A CA  1 
ATOM   1711  C C   . ASP A 1 224 ? -28.982 9.219   -97.101  1.00 90.88  ? 1020 ASP A C   1 
ATOM   1712  O O   . ASP A 1 224 ? -29.115 10.049  -98.002  1.00 96.11  ? 1020 ASP A O   1 
ATOM   1713  C CB  . ASP A 1 224 ? -30.787 8.731   -95.439  1.00 90.58  ? 1020 ASP A CB  1 
ATOM   1714  C CG  . ASP A 1 224 ? -30.534 7.303   -95.010  1.00 94.02  ? 1020 ASP A CG  1 
ATOM   1715  O OD1 . ASP A 1 224 ? -29.498 6.734   -95.410  1.00 97.43  ? 1020 ASP A OD1 1 
ATOM   1716  O OD2 . ASP A 1 224 ? -31.380 6.752   -94.268  1.00 90.26  ? 1020 ASP A OD2 1 
ATOM   1717  N N   . THR A 1 225 ? -28.344 8.064   -97.280  1.00 90.51  ? 1021 THR A N   1 
ATOM   1718  C CA  . THR A 1 225 ? -27.983 7.603   -98.619  1.00 94.28  ? 1021 THR A CA  1 
ATOM   1719  C C   . THR A 1 225 ? -29.235 7.503   -99.484  1.00 96.70  ? 1021 THR A C   1 
ATOM   1720  O O   . THR A 1 225 ? -29.174 7.620   -100.708 1.00 96.70  ? 1021 THR A O   1 
ATOM   1721  C CB  . THR A 1 225 ? -27.301 6.226   -98.596  1.00 88.07  ? 1021 THR A CB  1 
ATOM   1722  O OG1 . THR A 1 225 ? -28.294 5.194   -98.650  1.00 92.16  ? 1021 THR A OG1 1 
ATOM   1723  C CG2 . THR A 1 225 ? -26.458 6.061   -97.342  1.00 87.45  ? 1021 THR A CG2 1 
ATOM   1724  N N   . GLU A 1 226 ? -30.372 7.264   -98.841  1.00 94.41  ? 1022 GLU A N   1 
ATOM   1725  C CA  . GLU A 1 226 ? -31.642 7.248   -99.549  1.00 89.90  ? 1022 GLU A CA  1 
ATOM   1726  C C   . GLU A 1 226 ? -32.116 8.676   -99.782  1.00 88.20  ? 1022 GLU A C   1 
ATOM   1727  O O   . GLU A 1 226 ? -32.912 8.946   -100.667 1.00 92.77  ? 1022 GLU A O   1 
ATOM   1728  C CB  . GLU A 1 226 ? -32.678 6.443   -98.771  1.00 95.93  ? 1022 GLU A CB  1 
ATOM   1729  C CG  . GLU A 1 226 ? -32.283 4.985   -98.577  1.00 102.47 ? 1022 GLU A CG  1 
ATOM   1730  C CD  . GLU A 1 226 ? -33.459 4.040   -98.734  1.00 106.84 ? 1022 GLU A CD  1 
ATOM   1731  O OE1 . GLU A 1 226 ? -33.473 2.991   -98.057  1.00 112.30 ? 1022 GLU A OE1 1 
ATOM   1732  O OE2 . GLU A 1 226 ? -34.362 4.341   -99.546  1.00 96.07  ? 1022 GLU A OE2 1 
ATOM   1733  N N   . GLY A 1 227 ? -31.590 9.589   -98.978  1.00 89.89  ? 1023 GLY A N   1 
ATOM   1734  C CA  . GLY A 1 227 ? -31.938 10.997  -99.031  1.00 91.32  ? 1023 GLY A CA  1 
ATOM   1735  C C   . GLY A 1 227 ? -32.797 11.423  -97.857  1.00 90.14  ? 1023 GLY A C   1 
ATOM   1736  O O   . GLY A 1 227 ? -32.808 12.599  -97.494  1.00 86.31  ? 1023 GLY A O   1 
ATOM   1737  N N   . TYR A 1 228 ? -33.456 10.453  -97.224  1.00 88.07  ? 1024 TYR A N   1 
ATOM   1738  C CA  . TYR A 1 228 ? -34.319 10.711  -96.073  1.00 82.87  ? 1024 TYR A CA  1 
ATOM   1739  C C   . TYR A 1 228 ? -33.553 11.420  -94.961  1.00 84.39  ? 1024 TYR A C   1 
ATOM   1740  O O   . TYR A 1 228 ? -32.356 11.190  -94.775  1.00 86.59  ? 1024 TYR A O   1 
ATOM   1741  C CB  . TYR A 1 228 ? -34.876 9.399   -95.521  1.00 82.84  ? 1024 TYR A CB  1 
ATOM   1742  C CG  . TYR A 1 228 ? -35.582 8.523   -96.532  1.00 86.66  ? 1024 TYR A CG  1 
ATOM   1743  C CD1 . TYR A 1 228 ? -36.317 9.073   -97.572  1.00 84.90  ? 1024 TYR A CD1 1 
ATOM   1744  C CD2 . TYR A 1 228 ? -35.518 7.138   -96.437  1.00 92.16  ? 1024 TYR A CD2 1 
ATOM   1745  C CE1 . TYR A 1 228 ? -36.969 8.258   -98.494  1.00 92.94  ? 1024 TYR A CE1 1 
ATOM   1746  C CE2 . TYR A 1 228 ? -36.162 6.321   -97.349  1.00 92.18  ? 1024 TYR A CE2 1 
ATOM   1747  C CZ  . TYR A 1 228 ? -36.887 6.884   -98.375  1.00 92.65  ? 1024 TYR A CZ  1 
ATOM   1748  O OH  . TYR A 1 228 ? -37.528 6.067   -99.282  1.00 91.18  ? 1024 TYR A OH  1 
ATOM   1749  N N   . TYR A 1 229 ? -34.241 12.286  -94.225  1.00 77.84  ? 1025 TYR A N   1 
ATOM   1750  C CA  . TYR A 1 229 ? -33.624 12.958  -93.089  1.00 73.85  ? 1025 TYR A CA  1 
ATOM   1751  C C   . TYR A 1 229 ? -33.564 12.026  -91.878  1.00 76.27  ? 1025 TYR A C   1 
ATOM   1752  O O   . TYR A 1 229 ? -34.572 11.420  -91.480  1.00 75.41  ? 1025 TYR A O   1 
ATOM   1753  C CB  . TYR A 1 229 ? -34.346 14.266  -92.769  1.00 69.92  ? 1025 TYR A CB  1 
ATOM   1754  C CG  . TYR A 1 229 ? -34.110 15.342  -93.805  1.00 68.98  ? 1025 TYR A CG  1 
ATOM   1755  C CD1 . TYR A 1 229 ? -33.138 16.312  -93.614  1.00 64.93  ? 1025 TYR A CD1 1 
ATOM   1756  C CD2 . TYR A 1 229 ? -34.849 15.379  -94.982  1.00 73.92  ? 1025 TYR A CD2 1 
ATOM   1757  C CE1 . TYR A 1 229 ? -32.911 17.297  -94.559  1.00 72.14  ? 1025 TYR A CE1 1 
ATOM   1758  C CE2 . TYR A 1 229 ? -34.628 16.361  -95.936  1.00 72.83  ? 1025 TYR A CE2 1 
ATOM   1759  C CZ  . TYR A 1 229 ? -33.657 17.318  -95.717  1.00 74.09  ? 1025 TYR A CZ  1 
ATOM   1760  O OH  . TYR A 1 229 ? -33.426 18.300  -96.650  1.00 75.21  ? 1025 TYR A OH  1 
ATOM   1761  N N   . THR A 1 230 ? -32.360 11.916  -91.320  1.00 73.21  ? 1026 THR A N   1 
ATOM   1762  C CA  . THR A 1 230 ? -32.031 10.917  -90.314  1.00 68.72  ? 1026 THR A CA  1 
ATOM   1763  C C   . THR A 1 230 ? -30.986 11.467  -89.345  1.00 59.11  ? 1026 THR A C   1 
ATOM   1764  O O   . THR A 1 230 ? -30.046 12.137  -89.767  1.00 56.25  ? 1026 THR A O   1 
ATOM   1765  C CB  . THR A 1 230 ? -31.449 9.658   -90.996  1.00 73.55  ? 1026 THR A CB  1 
ATOM   1766  O OG1 . THR A 1 230 ? -32.449 9.037   -91.820  1.00 69.03  ? 1026 THR A OG1 1 
ATOM   1767  C CG2 . THR A 1 230 ? -30.951 8.661   -89.966  1.00 76.93  ? 1026 THR A CG2 1 
ATOM   1768  N N   . ILE A 1 231 ? -31.132 11.158  -88.058  1.00 62.07  ? 1027 ILE A N   1 
ATOM   1769  C CA  . ILE A 1 231 ? -30.202 11.661  -87.046  1.00 61.07  ? 1027 ILE A CA  1 
ATOM   1770  C C   . ILE A 1 231 ? -29.761 10.598  -86.039  1.00 54.24  ? 1027 ILE A C   1 
ATOM   1771  O O   . ILE A 1 231 ? -30.434 9.584   -85.856  1.00 53.86  ? 1027 ILE A O   1 
ATOM   1772  C CB  . ILE A 1 231 ? -30.796 12.855  -86.271  1.00 63.20  ? 1027 ILE A CB  1 
ATOM   1773  C CG1 . ILE A 1 231 ? -29.674 13.722  -85.696  1.00 61.43  ? 1027 ILE A CG1 1 
ATOM   1774  C CG2 . ILE A 1 231 ? -31.739 12.366  -85.174  1.00 51.91  ? 1027 ILE A CG2 1 
ATOM   1775  C CD1 . ILE A 1 231 ? -30.143 15.048  -85.159  1.00 62.46  ? 1027 ILE A CD1 1 
ATOM   1776  N N   . GLY A 1 232 ? -28.628 10.854  -85.387  1.00 43.65  ? 1028 GLY A N   1 
ATOM   1777  C CA  . GLY A 1 232 ? -28.078 9.958   -84.387  1.00 44.43  ? 1028 GLY A CA  1 
ATOM   1778  C C   . GLY A 1 232 ? -27.496 8.683   -84.968  1.00 57.31  ? 1028 GLY A C   1 
ATOM   1779  O O   . GLY A 1 232 ? -26.881 8.698   -86.034  1.00 61.39  ? 1028 GLY A O   1 
ATOM   1780  N N   . ILE A 1 233 ? -27.669 7.576   -84.252  1.00 59.52  ? 1029 ILE A N   1 
ATOM   1781  C CA  . ILE A 1 233 ? -27.335 6.264   -84.790  1.00 55.92  ? 1029 ILE A CA  1 
ATOM   1782  C C   . ILE A 1 233 ? -28.618 5.560   -85.201  1.00 70.21  ? 1029 ILE A C   1 
ATOM   1783  O O   . ILE A 1 233 ? -29.450 5.212   -84.354  1.00 71.94  ? 1029 ILE A O   1 
ATOM   1784  C CB  . ILE A 1 233 ? -26.608 5.371   -83.772  1.00 48.33  ? 1029 ILE A CB  1 
ATOM   1785  C CG1 . ILE A 1 233 ? -25.260 5.969   -83.390  1.00 46.07  ? 1029 ILE A CG1 1 
ATOM   1786  C CG2 . ILE A 1 233 ? -26.411 3.976   -84.343  1.00 52.09  ? 1029 ILE A CG2 1 
ATOM   1787  C CD1 . ILE A 1 233 ? -24.477 5.104   -82.428  1.00 44.32  ? 1029 ILE A CD1 1 
ATOM   1788  N N   . GLY A 1 234 ? -28.787 5.376   -86.504  1.00 65.52  ? 1030 GLY A N   1 
ATOM   1789  C CA  . GLY A 1 234 ? -29.899 4.610   -87.028  1.00 68.52  ? 1030 GLY A CA  1 
ATOM   1790  C C   . GLY A 1 234 ? -31.263 5.161   -86.682  1.00 68.24  ? 1030 GLY A C   1 
ATOM   1791  O O   . GLY A 1 234 ? -32.278 4.488   -86.885  1.00 68.88  ? 1030 GLY A O   1 
ATOM   1792  N N   . HIS A 1 235 ? -31.312 6.389   -86.179  1.00 58.82  ? 1031 HIS A N   1 
ATOM   1793  C CA  . HIS A 1 235 ? -32.612 6.973   -85.900  1.00 61.69  ? 1031 HIS A CA  1 
ATOM   1794  C C   . HIS A 1 235 ? -33.101 7.784   -87.078  1.00 60.76  ? 1031 HIS A C   1 
ATOM   1795  O O   . HIS A 1 235 ? -32.557 8.842   -87.391  1.00 59.97  ? 1031 HIS A O   1 
ATOM   1796  C CB  . HIS A 1 235 ? -32.620 7.839   -84.643  1.00 65.53  ? 1031 HIS A CB  1 
ATOM   1797  C CG  . HIS A 1 235 ? -33.964 8.407   -84.335  1.00 70.34  ? 1031 HIS A CG  1 
ATOM   1798  N ND1 . HIS A 1 235 ? -34.916 7.731   -83.605  1.00 73.31  ? 1031 HIS A ND1 1 
ATOM   1799  C CD2 . HIS A 1 235 ? -34.541 9.584   -84.698  1.00 71.68  ? 1031 HIS A CD2 1 
ATOM   1800  C CE1 . HIS A 1 235 ? -36.011 8.465   -83.512  1.00 73.96  ? 1031 HIS A CE1 1 
ATOM   1801  N NE2 . HIS A 1 235 ? -35.802 9.596   -84.172  1.00 75.77  ? 1031 HIS A NE2 1 
ATOM   1802  N N   . LEU A 1 236 ? -34.148 7.279   -87.716  1.00 63.51  ? 1032 LEU A N   1 
ATOM   1803  C CA  . LEU A 1 236 ? -34.754 7.945   -88.855  1.00 61.74  ? 1032 LEU A CA  1 
ATOM   1804  C C   . LEU A 1 236 ? -35.715 9.012   -88.370  1.00 63.89  ? 1032 LEU A C   1 
ATOM   1805  O O   . LEU A 1 236 ? -36.543 8.763   -87.488  1.00 63.91  ? 1032 LEU A O   1 
ATOM   1806  C CB  . LEU A 1 236 ? -35.487 6.933   -89.735  1.00 62.71  ? 1032 LEU A CB  1 
ATOM   1807  C CG  . LEU A 1 236 ? -36.292 7.479   -90.916  1.00 64.46  ? 1032 LEU A CG  1 
ATOM   1808  C CD1 . LEU A 1 236 ? -35.463 8.449   -91.753  1.00 63.77  ? 1032 LEU A CD1 1 
ATOM   1809  C CD2 . LEU A 1 236 ? -36.812 6.323   -91.761  1.00 59.67  ? 1032 LEU A CD2 1 
ATOM   1810  N N   . LEU A 1 237 ? -35.582 10.206  -88.941  1.00 67.16  ? 1033 LEU A N   1 
ATOM   1811  C CA  . LEU A 1 237 ? -36.435 11.333  -88.588  1.00 64.97  ? 1033 LEU A CA  1 
ATOM   1812  C C   . LEU A 1 237 ? -37.655 11.409  -89.496  1.00 55.64  ? 1033 LEU A C   1 
ATOM   1813  O O   . LEU A 1 237 ? -38.781 11.230  -89.036  1.00 50.68  ? 1033 LEU A O   1 
ATOM   1814  C CB  . LEU A 1 237 ? -35.646 12.643  -88.635  1.00 56.69  ? 1033 LEU A CB  1 
ATOM   1815  C CG  . LEU A 1 237 ? -34.659 12.881  -87.495  1.00 50.30  ? 1033 LEU A CG  1 
ATOM   1816  C CD1 . LEU A 1 237 ? -33.839 14.109  -87.795  1.00 61.82  ? 1033 LEU A CD1 1 
ATOM   1817  C CD2 . LEU A 1 237 ? -35.389 13.035  -86.175  1.00 47.22  ? 1033 LEU A CD2 1 
ATOM   1818  N N   . THR A 1 238 ? -37.442 11.692  -90.778  1.00 60.01  ? 1034 THR A N   1 
ATOM   1819  C CA  . THR A 1 238 ? -38.566 11.700  -91.713  1.00 63.48  ? 1034 THR A CA  1 
ATOM   1820  C C   . THR A 1 238 ? -38.137 11.529  -93.170  1.00 70.35  ? 1034 THR A C   1 
ATOM   1821  O O   . THR A 1 238 ? -36.992 11.807  -93.523  1.00 69.16  ? 1034 THR A O   1 
ATOM   1822  C CB  . THR A 1 238 ? -39.426 12.975  -91.554  1.00 60.87  ? 1034 THR A CB  1 
ATOM   1823  O OG1 . THR A 1 238 ? -40.708 12.767  -92.160  1.00 59.89  ? 1034 THR A OG1 1 
ATOM   1824  C CG2 . THR A 1 238 ? -38.729 14.186  -92.184  1.00 60.52  ? 1034 THR A CG2 1 
ATOM   1825  N N   . LYS A 1 239 ? -39.064 11.066  -94.010  1.00 68.38  ? 1035 LYS A N   1 
ATOM   1826  C CA  . LYS A 1 239 ? -38.800 10.934  -95.439  1.00 61.97  ? 1035 LYS A CA  1 
ATOM   1827  C C   . LYS A 1 239 ? -39.228 12.177  -96.202  1.00 57.76  ? 1035 LYS A C   1 
ATOM   1828  O O   . LYS A 1 239 ? -38.894 12.341  -97.366  1.00 61.51  ? 1035 LYS A O   1 
ATOM   1829  C CB  . LYS A 1 239 ? -39.514 9.712   -96.013  1.00 59.06  ? 1035 LYS A CB  1 
ATOM   1830  C CG  . LYS A 1 239 ? -39.079 8.393   -95.409  1.00 65.02  ? 1035 LYS A CG  1 
ATOM   1831  C CD  . LYS A 1 239 ? -39.764 7.225   -96.103  1.00 73.58  ? 1035 LYS A CD  1 
ATOM   1832  C CE  . LYS A 1 239 ? -39.575 5.912   -95.348  1.00 78.77  ? 1035 LYS A CE  1 
ATOM   1833  N NZ  . LYS A 1 239 ? -38.156 5.462   -95.298  1.00 77.81  ? 1035 LYS A NZ  1 
ATOM   1834  N N   . SER A 1 240 ? -39.964 13.059  -95.541  1.00 59.78  ? 1036 SER A N   1 
ATOM   1835  C CA  . SER A 1 240 ? -40.365 14.305  -96.170  1.00 65.71  ? 1036 SER A CA  1 
ATOM   1836  C C   . SER A 1 240 ? -39.146 15.211  -96.309  1.00 71.09  ? 1036 SER A C   1 
ATOM   1837  O O   . SER A 1 240 ? -38.360 15.358  -95.369  1.00 69.24  ? 1036 SER A O   1 
ATOM   1838  C CB  . SER A 1 240 ? -41.452 15.000  -95.357  1.00 73.18  ? 1036 SER A CB  1 
ATOM   1839  O OG  . SER A 1 240 ? -40.935 15.462  -94.125  1.00 84.57  ? 1036 SER A OG  1 
ATOM   1840  N N   . PRO A 1 241 ? -38.986 15.814  -97.494  1.00 70.48  ? 1037 PRO A N   1 
ATOM   1841  C CA  . PRO A 1 241 ? -37.854 16.669  -97.863  1.00 71.64  ? 1037 PRO A CA  1 
ATOM   1842  C C   . PRO A 1 241 ? -37.832 18.006  -97.125  1.00 78.29  ? 1037 PRO A C   1 
ATOM   1843  O O   . PRO A 1 241 ? -36.792 18.668  -97.099  1.00 79.35  ? 1037 PRO A O   1 
ATOM   1844  C CB  . PRO A 1 241 ? -38.066 16.896  -99.360  1.00 71.40  ? 1037 PRO A CB  1 
ATOM   1845  C CG  . PRO A 1 241 ? -39.525 16.766  -99.549  1.00 66.40  ? 1037 PRO A CG  1 
ATOM   1846  C CD  . PRO A 1 241 ? -39.965 15.703  -98.587  1.00 69.78  ? 1037 PRO A CD  1 
ATOM   1847  N N   . SER A 1 242 ? -38.955 18.411  -96.542  1.00 77.53  ? 1038 SER A N   1 
ATOM   1848  C CA  . SER A 1 242 ? -38.956 19.647  -95.769  1.00 82.06  ? 1038 SER A CA  1 
ATOM   1849  C C   . SER A 1 242 ? -38.161 19.440  -94.491  1.00 80.74  ? 1038 SER A C   1 
ATOM   1850  O O   . SER A 1 242 ? -38.456 18.541  -93.697  1.00 76.83  ? 1038 SER A O   1 
ATOM   1851  C CB  . SER A 1 242 ? -40.374 20.112  -95.437  1.00 86.93  ? 1038 SER A CB  1 
ATOM   1852  O OG  . SER A 1 242 ? -40.343 21.336  -94.722  1.00 83.73  ? 1038 SER A OG  1 
ATOM   1853  N N   . LEU A 1 243 ? -37.151 20.281  -94.300  1.00 77.51  ? 1039 LEU A N   1 
ATOM   1854  C CA  . LEU A 1 243 ? -36.289 20.196  -93.133  1.00 78.90  ? 1039 LEU A CA  1 
ATOM   1855  C C   . LEU A 1 243 ? -37.066 20.478  -91.844  1.00 80.58  ? 1039 LEU A C   1 
ATOM   1856  O O   . LEU A 1 243 ? -36.760 19.922  -90.784  1.00 79.43  ? 1039 LEU A O   1 
ATOM   1857  C CB  . LEU A 1 243 ? -35.115 21.163  -93.282  1.00 73.60  ? 1039 LEU A CB  1 
ATOM   1858  C CG  . LEU A 1 243 ? -34.091 21.155  -92.150  1.00 78.87  ? 1039 LEU A CG  1 
ATOM   1859  C CD1 . LEU A 1 243 ? -33.542 19.754  -91.951  1.00 78.32  ? 1039 LEU A CD1 1 
ATOM   1860  C CD2 . LEU A 1 243 ? -32.967 22.146  -92.426  1.00 81.66  ? 1039 LEU A CD2 1 
ATOM   1861  N N   . ASN A 1 244 ? -38.076 21.339  -91.942  1.00 78.54  ? 1040 ASN A N   1 
ATOM   1862  C CA  . ASN A 1 244 ? -38.888 21.704  -90.786  1.00 74.33  ? 1040 ASN A CA  1 
ATOM   1863  C C   . ASN A 1 244 ? -39.538 20.491  -90.149  1.00 72.48  ? 1040 ASN A C   1 
ATOM   1864  O O   . ASN A 1 244 ? -39.502 20.324  -88.931  1.00 72.20  ? 1040 ASN A O   1 
ATOM   1865  C CB  . ASN A 1 244 ? -39.964 22.709  -91.187  1.00 82.32  ? 1040 ASN A CB  1 
ATOM   1866  C CG  . ASN A 1 244 ? -39.385 23.947  -91.832  1.00 91.77  ? 1040 ASN A CG  1 
ATOM   1867  O OD1 . ASN A 1 244 ? -38.305 24.409  -91.455  1.00 89.67  ? 1040 ASN A OD1 1 
ATOM   1868  N ND2 . ASN A 1 244 ? -40.096 24.491  -92.815  1.00 92.64  ? 1040 ASN A ND2 1 
ATOM   1869  N N   . ALA A 1 245 ? -40.141 19.653  -90.986  1.00 72.10  ? 1041 ALA A N   1 
ATOM   1870  C CA  . ALA A 1 245 ? -40.758 18.413  -90.530  1.00 72.21  ? 1041 ALA A CA  1 
ATOM   1871  C C   . ALA A 1 245 ? -39.770 17.639  -89.671  1.00 69.20  ? 1041 ALA A C   1 
ATOM   1872  O O   . ALA A 1 245 ? -40.005 17.411  -88.481  1.00 61.10  ? 1041 ALA A O   1 
ATOM   1873  C CB  . ALA A 1 245 ? -41.210 17.576  -91.710  1.00 63.74  ? 1041 ALA A CB  1 
ATOM   1874  N N   . ALA A 1 246 ? -38.663 17.239  -90.287  1.00 66.97  ? 1042 ALA A N   1 
ATOM   1875  C CA  . ALA A 1 246 ? -37.621 16.515  -89.584  1.00 60.52  ? 1042 ALA A CA  1 
ATOM   1876  C C   . ALA A 1 246 ? -37.310 17.179  -88.250  1.00 63.56  ? 1042 ALA A C   1 
ATOM   1877  O O   . ALA A 1 246 ? -37.603 16.618  -87.202  1.00 60.80  ? 1042 ALA A O   1 
ATOM   1878  C CB  . ALA A 1 246 ? -36.380 16.425  -90.442  1.00 54.74  ? 1042 ALA A CB  1 
ATOM   1879  N N   . LYS A 1 247 ? -36.762 18.390  -88.292  1.00 69.03  ? 1043 LYS A N   1 
ATOM   1880  C CA  . LYS A 1 247 ? -36.320 19.071  -87.075  1.00 65.91  ? 1043 LYS A CA  1 
ATOM   1881  C C   . LYS A 1 247 ? -37.396 19.056  -85.997  1.00 66.12  ? 1043 LYS A C   1 
ATOM   1882  O O   . LYS A 1 247 ? -37.099 18.903  -84.811  1.00 64.18  ? 1043 LYS A O   1 
ATOM   1883  C CB  . LYS A 1 247 ? -35.920 20.516  -87.383  1.00 65.47  ? 1043 LYS A CB  1 
ATOM   1884  C CG  . LYS A 1 247 ? -34.931 20.643  -88.535  1.00 70.48  ? 1043 LYS A CG  1 
ATOM   1885  C CD  . LYS A 1 247 ? -34.327 22.034  -88.595  1.00 74.10  ? 1043 LYS A CD  1 
ATOM   1886  C CE  . LYS A 1 247 ? -33.636 22.382  -87.283  1.00 77.43  ? 1043 LYS A CE  1 
ATOM   1887  N NZ  . LYS A 1 247 ? -33.157 23.788  -87.255  1.00 84.54  ? 1043 LYS A NZ  1 
ATOM   1888  N N   . SER A 1 248 ? -38.648 19.200  -86.420  1.00 67.01  ? 1044 SER A N   1 
ATOM   1889  C CA  . SER A 1 248 ? -39.770 19.239  -85.492  1.00 68.38  ? 1044 SER A CA  1 
ATOM   1890  C C   . SER A 1 248 ? -40.018 17.873  -84.853  1.00 73.64  ? 1044 SER A C   1 
ATOM   1891  O O   . SER A 1 248 ? -40.162 17.775  -83.631  1.00 72.42  ? 1044 SER A O   1 
ATOM   1892  C CB  . SER A 1 248 ? -41.031 19.739  -86.197  1.00 65.44  ? 1044 SER A CB  1 
ATOM   1893  O OG  . SER A 1 248 ? -41.888 20.405  -85.286  1.00 57.74  ? 1044 SER A OG  1 
ATOM   1894  N N   . GLU A 1 249 ? -40.075 16.827  -85.677  1.00 67.50  ? 1045 GLU A N   1 
ATOM   1895  C CA  . GLU A 1 249 ? -40.244 15.471  -85.169  1.00 69.99  ? 1045 GLU A CA  1 
ATOM   1896  C C   . GLU A 1 249 ? -39.113 15.165  -84.198  1.00 71.16  ? 1045 GLU A C   1 
ATOM   1897  O O   . GLU A 1 249 ? -39.340 14.662  -83.098  1.00 78.28  ? 1045 GLU A O   1 
ATOM   1898  C CB  . GLU A 1 249 ? -40.270 14.452  -86.314  1.00 67.84  ? 1045 GLU A CB  1 
ATOM   1899  C CG  . GLU A 1 249 ? -40.656 13.020  -85.900  1.00 70.91  ? 1045 GLU A CG  1 
ATOM   1900  C CD  . GLU A 1 249 ? -42.153 12.845  -85.651  1.00 74.67  ? 1045 GLU A CD  1 
ATOM   1901  O OE1 . GLU A 1 249 ? -42.611 11.687  -85.546  1.00 63.69  ? 1045 GLU A OE1 1 
ATOM   1902  O OE2 . GLU A 1 249 ? -42.874 13.862  -85.562  1.00 82.40  ? 1045 GLU A OE2 1 
ATOM   1903  N N   . LEU A 1 250 ? -37.893 15.486  -84.610  1.00 63.07  ? 1046 LEU A N   1 
ATOM   1904  C CA  . LEU A 1 250 ? -36.726 15.334  -83.757  1.00 63.24  ? 1046 LEU A CA  1 
ATOM   1905  C C   . LEU A 1 250 ? -36.981 15.984  -82.403  1.00 68.41  ? 1046 LEU A C   1 
ATOM   1906  O O   . LEU A 1 250 ? -36.820 15.347  -81.367  1.00 63.61  ? 1046 LEU A O   1 
ATOM   1907  C CB  . LEU A 1 250 ? -35.501 15.961  -84.421  1.00 62.83  ? 1046 LEU A CB  1 
ATOM   1908  C CG  . LEU A 1 250 ? -34.297 16.276  -83.530  1.00 63.89  ? 1046 LEU A CG  1 
ATOM   1909  C CD1 . LEU A 1 250 ? -33.908 15.067  -82.702  1.00 66.05  ? 1046 LEU A CD1 1 
ATOM   1910  C CD2 . LEU A 1 250 ? -33.117 16.767  -84.362  1.00 56.70  ? 1046 LEU A CD2 1 
ATOM   1911  N N   . ASP A 1 251 ? -37.386 17.250  -82.423  1.00 69.75  ? 1047 ASP A N   1 
ATOM   1912  C CA  . ASP A 1 251 ? -37.677 17.989  -81.197  1.00 68.45  ? 1047 ASP A CA  1 
ATOM   1913  C C   . ASP A 1 251 ? -38.677 17.256  -80.328  1.00 66.06  ? 1047 ASP A C   1 
ATOM   1914  O O   . ASP A 1 251 ? -38.503 17.152  -79.115  1.00 67.82  ? 1047 ASP A O   1 
ATOM   1915  C CB  . ASP A 1 251 ? -38.215 19.370  -81.534  1.00 68.87  ? 1047 ASP A CB  1 
ATOM   1916  C CG  . ASP A 1 251 ? -37.171 20.250  -82.164  1.00 79.77  ? 1047 ASP A CG  1 
ATOM   1917  O OD1 . ASP A 1 251 ? -36.061 20.332  -81.600  1.00 76.54  ? 1047 ASP A OD1 1 
ATOM   1918  O OD2 . ASP A 1 251 ? -37.452 20.843  -83.226  1.00 88.21  ? 1047 ASP A OD2 1 
ATOM   1919  N N   . LYS A 1 252 ? -39.736 16.760  -80.950  1.00 62.52  ? 1048 LYS A N   1 
ATOM   1920  C CA  . LYS A 1 252 ? -40.698 15.947  -80.234  1.00 69.96  ? 1048 LYS A CA  1 
ATOM   1921  C C   . LYS A 1 252 ? -39.955 14.818  -79.539  1.00 65.22  ? 1048 LYS A C   1 
ATOM   1922  O O   . LYS A 1 252 ? -40.216 14.507  -78.375  1.00 58.88  ? 1048 LYS A O   1 
ATOM   1923  C CB  . LYS A 1 252 ? -41.734 15.372  -81.201  1.00 79.17  ? 1048 LYS A CB  1 
ATOM   1924  C CG  . LYS A 1 252 ? -42.715 14.386  -80.563  1.00 81.39  ? 1048 LYS A CG  1 
ATOM   1925  C CD  . LYS A 1 252 ? -43.595 13.694  -81.609  1.00 83.85  ? 1048 LYS A CD  1 
ATOM   1926  C CE  . LYS A 1 252 ? -44.582 14.654  -82.272  1.00 93.22  ? 1048 LYS A CE  1 
ATOM   1927  N NZ  . LYS A 1 252 ? -43.935 15.687  -83.145  1.00 89.91  ? 1048 LYS A NZ  1 
ATOM   1928  N N   . ALA A 1 253 ? -39.010 14.228  -80.264  1.00 62.68  ? 1049 ALA A N   1 
ATOM   1929  C CA  . ALA A 1 253 ? -38.308 13.026  -79.827  1.00 62.70  ? 1049 ALA A CA  1 
ATOM   1930  C C   . ALA A 1 253 ? -37.380 13.271  -78.639  1.00 65.88  ? 1049 ALA A C   1 
ATOM   1931  O O   . ALA A 1 253 ? -37.307 12.459  -77.715  1.00 63.31  ? 1049 ALA A O   1 
ATOM   1932  C CB  . ALA A 1 253 ? -37.531 12.434  -80.989  1.00 57.76  ? 1049 ALA A CB  1 
ATOM   1933  N N   . ILE A 1 254 ? -36.659 14.386  -78.689  1.00 64.47  ? 1050 ILE A N   1 
ATOM   1934  C CA  . ILE A 1 254 ? -35.741 14.793  -77.634  1.00 65.68  ? 1050 ILE A CA  1 
ATOM   1935  C C   . ILE A 1 254 ? -36.466 15.459  -76.471  1.00 74.33  ? 1050 ILE A C   1 
ATOM   1936  O O   . ILE A 1 254 ? -36.096 15.280  -75.313  1.00 80.93  ? 1050 ILE A O   1 
ATOM   1937  C CB  . ILE A 1 254 ? -34.692 15.777  -78.172  1.00 77.61  ? 1050 ILE A CB  1 
ATOM   1938  C CG1 . ILE A 1 254 ? -33.728 15.070  -79.128  1.00 76.60  ? 1050 ILE A CG1 1 
ATOM   1939  C CG2 . ILE A 1 254 ? -33.932 16.427  -77.023  1.00 81.62  ? 1050 ILE A CG2 1 
ATOM   1940  C CD1 . ILE A 1 254 ? -32.859 14.028  -78.455  1.00 75.75  ? 1050 ILE A CD1 1 
ATOM   1941  N N   . GLY A 1 255 ? -37.487 16.246  -76.788  1.00 74.08  ? 1051 GLY A N   1 
ATOM   1942  C CA  . GLY A 1 255 ? -38.212 16.987  -75.773  1.00 83.05  ? 1051 GLY A CA  1 
ATOM   1943  C C   . GLY A 1 255 ? -37.558 18.328  -75.490  1.00 86.84  ? 1051 GLY A C   1 
ATOM   1944  O O   . GLY A 1 255 ? -37.844 18.981  -74.485  1.00 89.21  ? 1051 GLY A O   1 
ATOM   1945  N N   . ARG A 1 256 ? -36.671 18.735  -76.390  1.00 80.82  ? 1052 ARG A N   1 
ATOM   1946  C CA  . ARG A 1 256 ? -36.010 20.024  -76.295  1.00 79.79  ? 1052 ARG A CA  1 
ATOM   1947  C C   . ARG A 1 256 ? -36.111 20.675  -77.664  1.00 80.65  ? 1052 ARG A C   1 
ATOM   1948  O O   . ARG A 1 256 ? -36.633 20.071  -78.603  1.00 77.42  ? 1052 ARG A O   1 
ATOM   1949  C CB  . ARG A 1 256 ? -34.543 19.820  -75.919  1.00 80.06  ? 1052 ARG A CB  1 
ATOM   1950  C CG  . ARG A 1 256 ? -33.828 21.074  -75.445  1.00 92.48  ? 1052 ARG A CG  1 
ATOM   1951  C CD  . ARG A 1 256 ? -32.327 20.848  -75.361  1.00 89.24  ? 1052 ARG A CD  1 
ATOM   1952  N NE  . ARG A 1 256 ? -31.764 20.481  -76.657  1.00 83.37  ? 1052 ARG A NE  1 
ATOM   1953  C CZ  . ARG A 1 256 ? -30.472 20.274  -76.881  1.00 79.24  ? 1052 ARG A CZ  1 
ATOM   1954  N NH1 . ARG A 1 256 ? -29.595 20.398  -75.895  1.00 76.08  ? 1052 ARG A NH1 1 
ATOM   1955  N NH2 . ARG A 1 256 ? -30.058 19.943  -78.094  1.00 77.94  ? 1052 ARG A NH2 1 
ATOM   1956  N N   . ASN A 1 257 ? -35.612 21.898  -77.795  1.00 81.77  ? 1053 ASN A N   1 
ATOM   1957  C CA  . ASN A 1 257 ? -35.464 22.465  -79.124  1.00 80.02  ? 1053 ASN A CA  1 
ATOM   1958  C C   . ASN A 1 257 ? -34.055 22.130  -79.577  1.00 83.32  ? 1053 ASN A C   1 
ATOM   1959  O O   . ASN A 1 257 ? -33.077 22.698  -79.091  1.00 85.13  ? 1053 ASN A O   1 
ATOM   1960  C CB  . ASN A 1 257 ? -35.679 23.977  -79.104  1.00 75.91  ? 1053 ASN A CB  1 
ATOM   1961  N N   . THR A 1 258 ? -33.962 21.203  -80.523  1.00 84.82  ? 1054 THR A N   1 
ATOM   1962  C CA  . THR A 1 258 ? -32.685 20.614  -80.902  1.00 87.54  ? 1054 THR A CA  1 
ATOM   1963  C C   . THR A 1 258 ? -31.900 21.536  -81.816  1.00 83.15  ? 1054 THR A C   1 
ATOM   1964  O O   . THR A 1 258 ? -30.667 21.551  -81.791  1.00 80.05  ? 1054 THR A O   1 
ATOM   1965  C CB  . THR A 1 258 ? -32.875 19.238  -81.577  1.00 84.73  ? 1054 THR A CB  1 
ATOM   1966  O OG1 . THR A 1 258 ? -33.907 19.326  -82.568  1.00 77.92  ? 1054 THR A OG1 1 
ATOM   1967  C CG2 . THR A 1 258 ? -33.259 18.187  -80.545  1.00 76.55  ? 1054 THR A CG2 1 
ATOM   1968  N N   . ASN A 1 259 ? -32.623 22.303  -82.624  1.00 77.53  ? 1055 ASN A N   1 
ATOM   1969  C CA  . ASN A 1 259 ? -31.993 23.223  -83.553  1.00 85.69  ? 1055 ASN A CA  1 
ATOM   1970  C C   . ASN A 1 259 ? -31.123 22.450  -84.542  1.00 90.86  ? 1055 ASN A C   1 
ATOM   1971  O O   . ASN A 1 259 ? -30.196 23.002  -85.135  1.00 99.98  ? 1055 ASN A O   1 
ATOM   1972  C CB  . ASN A 1 259 ? -31.143 24.233  -82.775  1.00 90.80  ? 1055 ASN A CB  1 
ATOM   1973  C CG  . ASN A 1 259 ? -30.958 25.545  -83.514  1.00 100.29 ? 1055 ASN A CG  1 
ATOM   1974  O OD1 . ASN A 1 259 ? -30.923 25.582  -84.744  1.00 104.29 ? 1055 ASN A OD1 1 
ATOM   1975  N ND2 . ASN A 1 259 ? -30.838 26.635  -82.759  1.00 98.62  ? 1055 ASN A ND2 1 
ATOM   1976  N N   . GLY A 1 260 ? -31.435 21.169  -84.721  1.00 87.64  ? 1056 GLY A N   1 
ATOM   1977  C CA  . GLY A 1 260 ? -30.700 20.319  -85.642  1.00 82.63  ? 1056 GLY A CA  1 
ATOM   1978  C C   . GLY A 1 260 ? -29.506 19.594  -85.043  1.00 79.35  ? 1056 GLY A C   1 
ATOM   1979  O O   . GLY A 1 260 ? -28.924 18.721  -85.690  1.00 74.96  ? 1056 GLY A O   1 
ATOM   1980  N N   . VAL A 1 261 ? -29.136 19.950  -83.813  1.00 79.55  ? 1057 VAL A N   1 
ATOM   1981  C CA  . VAL A 1 261 ? -27.965 19.362  -83.162  1.00 75.96  ? 1057 VAL A CA  1 
ATOM   1982  C C   . VAL A 1 261 ? -28.341 18.641  -81.868  1.00 65.53  ? 1057 VAL A C   1 
ATOM   1983  O O   . VAL A 1 261 ? -29.302 19.021  -81.200  1.00 64.12  ? 1057 VAL A O   1 
ATOM   1984  C CB  . VAL A 1 261 ? -26.899 20.436  -82.836  1.00 76.98  ? 1057 VAL A CB  1 
ATOM   1985  C CG1 . VAL A 1 261 ? -25.596 19.778  -82.404  1.00 81.60  ? 1057 VAL A CG1 1 
ATOM   1986  C CG2 . VAL A 1 261 ? -26.667 21.348  -84.033  1.00 71.80  ? 1057 VAL A CG2 1 
ATOM   1987  N N   . ILE A 1 262 ? -27.591 17.595  -81.525  1.00 59.47  ? 1058 ILE A N   1 
ATOM   1988  C CA  . ILE A 1 262 ? -27.758 16.927  -80.236  1.00 65.46  ? 1058 ILE A CA  1 
ATOM   1989  C C   . ILE A 1 262 ? -26.425 16.519  -79.619  1.00 63.04  ? 1058 ILE A C   1 
ATOM   1990  O O   . ILE A 1 262 ? -25.414 16.399  -80.311  1.00 58.89  ? 1058 ILE A O   1 
ATOM   1991  C CB  . ILE A 1 262 ? -28.650 15.660  -80.322  1.00 66.18  ? 1058 ILE A CB  1 
ATOM   1992  C CG1 . ILE A 1 262 ? -27.831 14.451  -80.785  1.00 63.22  ? 1058 ILE A CG1 1 
ATOM   1993  C CG2 . ILE A 1 262 ? -29.863 15.902  -81.202  1.00 60.03  ? 1058 ILE A CG2 1 
ATOM   1994  C CD1 . ILE A 1 262 ? -28.477 13.127  -80.474  1.00 52.01  ? 1058 ILE A CD1 1 
ATOM   1995  N N   . THR A 1 263 ? -26.444 16.317  -78.305  1.00 57.52  ? 1059 THR A N   1 
ATOM   1996  C CA  . THR A 1 263 ? -25.286 15.851  -77.556  1.00 60.39  ? 1059 THR A CA  1 
ATOM   1997  C C   . THR A 1 263 ? -25.107 14.337  -77.673  1.00 66.04  ? 1059 THR A C   1 
ATOM   1998  O O   . THR A 1 263 ? -26.068 13.606  -77.926  1.00 62.20  ? 1059 THR A O   1 
ATOM   1999  C CB  . THR A 1 263 ? -25.411 16.224  -76.071  1.00 62.50  ? 1059 THR A CB  1 
ATOM   2000  O OG1 . THR A 1 263 ? -26.339 15.341  -75.431  1.00 65.41  ? 1059 THR A OG1 1 
ATOM   2001  C CG2 . THR A 1 263 ? -25.895 17.652  -75.927  1.00 59.34  ? 1059 THR A CG2 1 
ATOM   2002  N N   . LYS A 1 264 ? -23.874 13.874  -77.476  1.00 69.76  ? 1060 LYS A N   1 
ATOM   2003  C CA  . LYS A 1 264 ? -23.571 12.446  -77.496  1.00 70.18  ? 1060 LYS A CA  1 
ATOM   2004  C C   . LYS A 1 264 ? -24.445 11.660  -76.518  1.00 64.94  ? 1060 LYS A C   1 
ATOM   2005  O O   . LYS A 1 264 ? -24.891 10.553  -76.822  1.00 62.08  ? 1060 LYS A O   1 
ATOM   2006  C CB  . LYS A 1 264 ? -22.085 12.206  -77.204  1.00 72.14  ? 1060 LYS A CB  1 
ATOM   2007  C CG  . LYS A 1 264 ? -21.149 13.064  -78.043  1.00 80.28  ? 1060 LYS A CG  1 
ATOM   2008  C CD  . LYS A 1 264 ? -19.678 12.842  -77.697  1.00 83.51  ? 1060 LYS A CD  1 
ATOM   2009  C CE  . LYS A 1 264 ? -19.097 11.626  -78.404  1.00 59.47  ? 1060 LYS A CE  1 
ATOM   2010  N NZ  . LYS A 1 264 ? -17.646 11.489  -78.108  1.00 64.29  ? 1060 LYS A NZ  1 
ATOM   2011  N N   . ASP A 1 265 ? -24.692 12.237  -75.346  1.00 64.04  ? 1061 ASP A N   1 
ATOM   2012  C CA  . ASP A 1 265 ? -25.567 11.606  -74.367  1.00 66.66  ? 1061 ASP A CA  1 
ATOM   2013  C C   . ASP A 1 265 ? -26.944 11.374  -74.965  1.00 67.09  ? 1061 ASP A C   1 
ATOM   2014  O O   . ASP A 1 265 ? -27.441 10.242  -75.021  1.00 68.62  ? 1061 ASP A O   1 
ATOM   2015  C CB  . ASP A 1 265 ? -25.706 12.487  -73.122  1.00 71.57  ? 1061 ASP A CB  1 
ATOM   2016  C CG  . ASP A 1 265 ? -24.490 12.427  -72.219  1.00 85.13  ? 1061 ASP A CG  1 
ATOM   2017  O OD1 . ASP A 1 265 ? -23.361 12.539  -72.738  1.00 92.97  ? 1061 ASP A OD1 1 
ATOM   2018  O OD2 . ASP A 1 265 ? -24.669 12.262  -70.989  1.00 81.89  ? 1061 ASP A OD2 1 
ATOM   2019  N N   . GLU A 1 266 ? -27.560 12.460  -75.414  1.00 65.31  ? 1062 GLU A N   1 
ATOM   2020  C CA  . GLU A 1 266 ? -28.872 12.369  -76.019  1.00 63.06  ? 1062 GLU A CA  1 
ATOM   2021  C C   . GLU A 1 266 ? -28.851 11.246  -77.037  1.00 62.93  ? 1062 GLU A C   1 
ATOM   2022  O O   . GLU A 1 266 ? -29.757 10.416  -77.079  1.00 61.13  ? 1062 GLU A O   1 
ATOM   2023  C CB  . GLU A 1 266 ? -29.244 13.689  -76.689  1.00 66.35  ? 1062 GLU A CB  1 
ATOM   2024  C CG  . GLU A 1 266 ? -29.594 14.797  -75.715  1.00 74.71  ? 1062 GLU A CG  1 
ATOM   2025  C CD  . GLU A 1 266 ? -29.763 16.135  -76.405  1.00 81.92  ? 1062 GLU A CD  1 
ATOM   2026  O OE1 . GLU A 1 266 ? -29.072 16.366  -77.421  1.00 76.12  ? 1062 GLU A OE1 1 
ATOM   2027  O OE2 . GLU A 1 266 ? -30.587 16.951  -75.935  1.00 81.49  ? 1062 GLU A OE2 1 
ATOM   2028  N N   . ALA A 1 267 ? -27.790 11.218  -77.837  1.00 62.26  ? 1063 ALA A N   1 
ATOM   2029  C CA  . ALA A 1 267 ? -27.646 10.238  -78.907  1.00 60.17  ? 1063 ALA A CA  1 
ATOM   2030  C C   . ALA A 1 267 ? -27.687 8.791   -78.411  1.00 57.55  ? 1063 ALA A C   1 
ATOM   2031  O O   . ALA A 1 267 ? -28.525 7.999   -78.854  1.00 53.95  ? 1063 ALA A O   1 
ATOM   2032  C CB  . ALA A 1 267 ? -26.366 10.498  -79.680  1.00 58.15  ? 1063 ALA A CB  1 
ATOM   2033  N N   . GLU A 1 268 ? -26.781 8.452   -77.498  1.00 57.01  ? 1064 GLU A N   1 
ATOM   2034  C CA  . GLU A 1 268 ? -26.705 7.097   -76.961  1.00 52.62  ? 1064 GLU A CA  1 
ATOM   2035  C C   . GLU A 1 268 ? -28.058 6.697   -76.383  1.00 53.96  ? 1064 GLU A C   1 
ATOM   2036  O O   . GLU A 1 268 ? -28.510 5.560   -76.543  1.00 54.68  ? 1064 GLU A O   1 
ATOM   2037  C CB  . GLU A 1 268 ? -25.619 7.008   -75.885  1.00 51.87  ? 1064 GLU A CB  1 
ATOM   2038  C CG  . GLU A 1 268 ? -25.876 7.913   -74.685  1.00 61.77  ? 1064 GLU A CG  1 
ATOM   2039  C CD  . GLU A 1 268 ? -24.845 7.764   -73.582  1.00 60.75  ? 1064 GLU A CD  1 
ATOM   2040  O OE1 . GLU A 1 268 ? -25.232 7.866   -72.395  1.00 58.28  ? 1064 GLU A OE1 1 
ATOM   2041  O OE2 . GLU A 1 268 ? -23.653 7.559   -73.901  1.00 59.92  ? 1064 GLU A OE2 1 
ATOM   2042  N N   . LYS A 1 269 ? -28.707 7.648   -75.720  1.00 52.59  ? 1065 LYS A N   1 
ATOM   2043  C CA  . LYS A 1 269 ? -30.016 7.400   -75.127  1.00 50.80  ? 1065 LYS A CA  1 
ATOM   2044  C C   . LYS A 1 269 ? -31.060 7.110   -76.194  1.00 52.11  ? 1065 LYS A C   1 
ATOM   2045  O O   . LYS A 1 269 ? -31.947 6.274   -76.007  1.00 47.65  ? 1065 LYS A O   1 
ATOM   2046  C CB  . LYS A 1 269 ? -30.445 8.594   -74.281  1.00 58.42  ? 1065 LYS A CB  1 
ATOM   2047  C CG  . LYS A 1 269 ? -29.478 8.905   -73.152  1.00 67.63  ? 1065 LYS A CG  1 
ATOM   2048  C CD  . LYS A 1 269 ? -29.883 10.158  -72.406  1.00 71.68  ? 1065 LYS A CD  1 
ATOM   2049  C CE  . LYS A 1 269 ? -28.751 10.620  -71.505  1.00 79.31  ? 1065 LYS A CE  1 
ATOM   2050  N NZ  . LYS A 1 269 ? -29.079 11.907  -70.839  1.00 92.71  ? 1065 LYS A NZ  1 
ATOM   2051  N N   . LEU A 1 270 ? -30.944 7.804   -77.320  1.00 57.29  ? 1066 LEU A N   1 
ATOM   2052  C CA  . LEU A 1 270 ? -31.849 7.601   -78.440  1.00 55.13  ? 1066 LEU A CA  1 
ATOM   2053  C C   . LEU A 1 270 ? -31.669 6.191   -78.959  1.00 54.39  ? 1066 LEU A C   1 
ATOM   2054  O O   . LEU A 1 270 ? -32.626 5.432   -79.024  1.00 52.25  ? 1066 LEU A O   1 
ATOM   2055  C CB  . LEU A 1 270 ? -31.570 8.598   -79.561  1.00 47.61  ? 1066 LEU A CB  1 
ATOM   2056  C CG  . LEU A 1 270 ? -32.772 9.381   -80.091  1.00 46.51  ? 1066 LEU A CG  1 
ATOM   2057  C CD1 . LEU A 1 270 ? -32.344 10.403  -81.120  1.00 43.85  ? 1066 LEU A CD1 1 
ATOM   2058  C CD2 . LEU A 1 270 ? -33.823 8.460   -80.681  1.00 54.73  ? 1066 LEU A CD2 1 
ATOM   2059  N N   . PHE A 1 271 ? -30.435 5.840   -79.306  1.00 56.48  ? 1067 PHE A N   1 
ATOM   2060  C CA  . PHE A 1 271 ? -30.121 4.477   -79.711  1.00 56.07  ? 1067 PHE A CA  1 
ATOM   2061  C C   . PHE A 1 271 ? -30.782 3.487   -78.765  1.00 53.04  ? 1067 PHE A C   1 
ATOM   2062  O O   . PHE A 1 271 ? -31.629 2.706   -79.179  1.00 53.36  ? 1067 PHE A O   1 
ATOM   2063  C CB  . PHE A 1 271 ? -28.614 4.260   -79.709  1.00 57.68  ? 1067 PHE A CB  1 
ATOM   2064  C CG  . PHE A 1 271 ? -28.197 2.845   -80.020  1.00 55.83  ? 1067 PHE A CG  1 
ATOM   2065  C CD1 . PHE A 1 271 ? -27.924 2.461   -81.318  1.00 50.14  ? 1067 PHE A CD1 1 
ATOM   2066  C CD2 . PHE A 1 271 ? -28.056 1.909   -79.010  1.00 61.95  ? 1067 PHE A CD2 1 
ATOM   2067  C CE1 . PHE A 1 271 ? -27.531 1.170   -81.607  1.00 50.44  ? 1067 PHE A CE1 1 
ATOM   2068  C CE2 . PHE A 1 271 ? -27.659 0.614   -79.293  1.00 55.65  ? 1067 PHE A CE2 1 
ATOM   2069  C CZ  . PHE A 1 271 ? -27.398 0.243   -80.592  1.00 44.98  ? 1067 PHE A CZ  1 
ATOM   2070  N N   . ASN A 1 272 ? -30.396 3.520   -77.493  1.00 53.97  ? 1068 ASN A N   1 
ATOM   2071  C CA  . ASN A 1 272 ? -30.989 2.606   -76.522  1.00 56.64  ? 1068 ASN A CA  1 
ATOM   2072  C C   . ASN A 1 272 ? -32.510 2.540   -76.625  1.00 58.77  ? 1068 ASN A C   1 
ATOM   2073  O O   . ASN A 1 272 ? -33.084 1.448   -76.699  1.00 61.58  ? 1068 ASN A O   1 
ATOM   2074  C CB  . ASN A 1 272 ? -30.553 2.951   -75.095  1.00 57.04  ? 1068 ASN A CB  1 
ATOM   2075  C CG  . ASN A 1 272 ? -29.174 2.424   -74.774  1.00 69.86  ? 1068 ASN A CG  1 
ATOM   2076  O OD1 . ASN A 1 272 ? -29.007 1.243   -74.464  1.00 75.43  ? 1068 ASN A OD1 1 
ATOM   2077  N ND2 . ASN A 1 272 ? -28.173 3.296   -74.850  1.00 66.49  ? 1068 ASN A ND2 1 
ATOM   2078  N N   . GLN A 1 273 ? -33.163 3.697   -76.649  1.00 53.55  ? 1069 GLN A N   1 
ATOM   2079  C CA  . GLN A 1 273 ? -34.603 3.710   -76.846  1.00 53.33  ? 1069 GLN A CA  1 
ATOM   2080  C C   . GLN A 1 273 ? -34.932 2.838   -78.047  1.00 57.43  ? 1069 GLN A C   1 
ATOM   2081  O O   . GLN A 1 273 ? -35.726 1.901   -77.955  1.00 59.43  ? 1069 GLN A O   1 
ATOM   2082  C CB  . GLN A 1 273 ? -35.107 5.122   -77.124  1.00 54.23  ? 1069 GLN A CB  1 
ATOM   2083  C CG  . GLN A 1 273 ? -34.995 6.093   -75.970  1.00 56.64  ? 1069 GLN A CG  1 
ATOM   2084  C CD  . GLN A 1 273 ? -35.784 7.362   -76.225  1.00 58.91  ? 1069 GLN A CD  1 
ATOM   2085  O OE1 . GLN A 1 273 ? -35.642 8.355   -75.514  1.00 61.99  ? 1069 GLN A OE1 1 
ATOM   2086  N NE2 . GLN A 1 273 ? -36.628 7.332   -77.249  1.00 63.28  ? 1069 GLN A NE2 1 
ATOM   2087  N N   . ASP A 1 274 ? -34.294 3.148   -79.171  1.00 57.28  ? 1070 ASP A N   1 
ATOM   2088  C CA  . ASP A 1 274 ? -34.551 2.469   -80.434  1.00 60.36  ? 1070 ASP A CA  1 
ATOM   2089  C C   . ASP A 1 274 ? -34.452 0.960   -80.298  1.00 56.86  ? 1070 ASP A C   1 
ATOM   2090  O O   . ASP A 1 274 ? -35.375 0.243   -80.663  1.00 51.98  ? 1070 ASP A O   1 
ATOM   2091  C CB  . ASP A 1 274 ? -33.585 2.950   -81.527  1.00 64.45  ? 1070 ASP A CB  1 
ATOM   2092  C CG  . ASP A 1 274 ? -33.898 4.352   -82.025  1.00 68.63  ? 1070 ASP A CG  1 
ATOM   2093  O OD1 . ASP A 1 274 ? -35.065 4.788   -81.910  1.00 64.71  ? 1070 ASP A OD1 1 
ATOM   2094  O OD2 . ASP A 1 274 ? -32.967 5.009   -82.543  1.00 69.59  ? 1070 ASP A OD2 1 
ATOM   2095  N N   . VAL A 1 275 ? -33.325 0.487   -79.777  1.00 51.33  ? 1071 VAL A N   1 
ATOM   2096  C CA  . VAL A 1 275 ? -33.077 -0.943  -79.663  1.00 50.91  ? 1071 VAL A CA  1 
ATOM   2097  C C   . VAL A 1 275 ? -34.111 -1.617  -78.785  1.00 56.55  ? 1071 VAL A C   1 
ATOM   2098  O O   . VAL A 1 275 ? -34.650 -2.661  -79.151  1.00 54.00  ? 1071 VAL A O   1 
ATOM   2099  C CB  . VAL A 1 275 ? -31.683 -1.235  -79.102  1.00 47.57  ? 1071 VAL A CB  1 
ATOM   2100  C CG1 . VAL A 1 275 ? -31.629 -2.637  -78.539  1.00 43.85  ? 1071 VAL A CG1 1 
ATOM   2101  C CG2 . VAL A 1 275 ? -30.637 -1.044  -80.189  1.00 53.42  ? 1071 VAL A CG2 1 
ATOM   2102  N N   . ASP A 1 276 ? -34.382 -1.018  -77.626  1.00 59.97  ? 1072 ASP A N   1 
ATOM   2103  C CA  . ASP A 1 276 ? -35.419 -1.523  -76.727  1.00 58.07  ? 1072 ASP A CA  1 
ATOM   2104  C C   . ASP A 1 276 ? -36.749 -1.641  -77.460  1.00 60.13  ? 1072 ASP A C   1 
ATOM   2105  O O   . ASP A 1 276 ? -37.499 -2.591  -77.252  1.00 60.40  ? 1072 ASP A O   1 
ATOM   2106  C CB  . ASP A 1 276 ? -35.574 -0.606  -75.512  1.00 60.79  ? 1072 ASP A CB  1 
ATOM   2107  C CG  . ASP A 1 276 ? -34.775 -1.085  -74.308  1.00 72.85  ? 1072 ASP A CG  1 
ATOM   2108  O OD1 . ASP A 1 276 ? -35.058 -0.624  -73.179  1.00 75.48  ? 1072 ASP A OD1 1 
ATOM   2109  O OD2 . ASP A 1 276 ? -33.866 -1.925  -74.484  1.00 75.56  ? 1072 ASP A OD2 1 
ATOM   2110  N N   . ALA A 1 277 ? -37.032 -0.664  -78.318  1.00 58.05  ? 1073 ALA A N   1 
ATOM   2111  C CA  . ALA A 1 277 ? -38.251 -0.661  -79.122  1.00 59.50  ? 1073 ALA A CA  1 
ATOM   2112  C C   . ALA A 1 277 ? -38.231 -1.796  -80.146  1.00 61.59  ? 1073 ALA A C   1 
ATOM   2113  O O   . ALA A 1 277 ? -39.253 -2.421  -80.425  1.00 60.57  ? 1073 ALA A O   1 
ATOM   2114  C CB  . ALA A 1 277 ? -38.415 0.672   -79.817  1.00 54.10  ? 1073 ALA A CB  1 
ATOM   2115  N N   . ALA A 1 278 ? -37.052 -2.040  -80.705  1.00 58.53  ? 1074 ALA A N   1 
ATOM   2116  C CA  . ALA A 1 278 ? -36.845 -3.072  -81.706  1.00 55.31  ? 1074 ALA A CA  1 
ATOM   2117  C C   . ALA A 1 278 ? -37.161 -4.421  -81.098  1.00 50.34  ? 1074 ALA A C   1 
ATOM   2118  O O   . ALA A 1 278 ? -38.003 -5.167  -81.588  1.00 47.13  ? 1074 ALA A O   1 
ATOM   2119  C CB  . ALA A 1 278 ? -35.411 -3.038  -82.187  1.00 52.01  ? 1074 ALA A CB  1 
ATOM   2120  N N   . VAL A 1 279 ? -36.456 -4.717  -80.017  1.00 51.03  ? 1075 VAL A N   1 
ATOM   2121  C CA  . VAL A 1 279 ? -36.634 -5.944  -79.270  1.00 52.71  ? 1075 VAL A CA  1 
ATOM   2122  C C   . VAL A 1 279 ? -38.089 -6.115  -78.882  1.00 56.64  ? 1075 VAL A C   1 
ATOM   2123  O O   . VAL A 1 279 ? -38.713 -7.125  -79.206  1.00 55.81  ? 1075 VAL A O   1 
ATOM   2124  C CB  . VAL A 1 279 ? -35.797 -5.905  -77.985  1.00 50.63  ? 1075 VAL A CB  1 
ATOM   2125  C CG1 . VAL A 1 279 ? -35.966 -7.191  -77.210  1.00 52.54  ? 1075 VAL A CG1 1 
ATOM   2126  C CG2 . VAL A 1 279 ? -34.335 -5.647  -78.315  1.00 45.59  ? 1075 VAL A CG2 1 
ATOM   2127  N N   . ARG A 1 280 ? -38.626 -5.110  -78.196  1.00 59.41  ? 1076 ARG A N   1 
ATOM   2128  C CA  . ARG A 1 280 ? -40.013 -5.139  -77.749  1.00 57.60  ? 1076 ARG A CA  1 
ATOM   2129  C C   . ARG A 1 280 ? -40.915 -5.460  -78.921  1.00 56.72  ? 1076 ARG A C   1 
ATOM   2130  O O   . ARG A 1 280 ? -41.954 -6.104  -78.761  1.00 62.42  ? 1076 ARG A O   1 
ATOM   2131  C CB  . ARG A 1 280 ? -40.407 -3.801  -77.126  1.00 68.84  ? 1076 ARG A CB  1 
ATOM   2132  C CG  . ARG A 1 280 ? -39.888 -3.608  -75.702  1.00 83.98  ? 1076 ARG A CG  1 
ATOM   2133  C CD  . ARG A 1 280 ? -39.714 -2.131  -75.357  1.00 87.69  ? 1076 ARG A CD  1 
ATOM   2134  N NE  . ARG A 1 280 ? -40.820 -1.319  -75.856  1.00 93.91  ? 1076 ARG A NE  1 
ATOM   2135  C CZ  . ARG A 1 280 ? -40.872 0.005   -75.771  1.00 91.53  ? 1076 ARG A CZ  1 
ATOM   2136  N NH1 . ARG A 1 280 ? -39.879 0.675   -75.201  1.00 88.67  ? 1076 ARG A NH1 1 
ATOM   2137  N NH2 . ARG A 1 280 ? -41.918 0.660   -76.256  1.00 96.68  ? 1076 ARG A NH2 1 
ATOM   2138  N N   . GLY A 1 281 ? -40.502 -5.015  -80.103  1.00 58.37  ? 1077 GLY A N   1 
ATOM   2139  C CA  . GLY A 1 281 ? -41.243 -5.278  -81.323  1.00 64.82  ? 1077 GLY A CA  1 
ATOM   2140  C C   . GLY A 1 281 ? -41.169 -6.737  -81.728  1.00 62.80  ? 1077 GLY A C   1 
ATOM   2141  O O   . GLY A 1 281 ? -42.180 -7.348  -82.074  1.00 63.89  ? 1077 GLY A O   1 
ATOM   2142  N N   . ILE A 1 282 ? -39.961 -7.292  -81.680  1.00 63.74  ? 1078 ILE A N   1 
ATOM   2143  C CA  . ILE A 1 282 ? -39.735 -8.697  -81.995  1.00 58.39  ? 1078 ILE A CA  1 
ATOM   2144  C C   . ILE A 1 282 ? -40.533 -9.620  -81.073  1.00 60.37  ? 1078 ILE A C   1 
ATOM   2145  O O   . ILE A 1 282 ? -41.056 -10.644 -81.516  1.00 62.54  ? 1078 ILE A O   1 
ATOM   2146  C CB  . ILE A 1 282 ? -38.250 -9.060  -81.876  1.00 52.76  ? 1078 ILE A CB  1 
ATOM   2147  C CG1 . ILE A 1 282 ? -37.383 -8.005  -82.557  1.00 48.97  ? 1078 ILE A CG1 1 
ATOM   2148  C CG2 . ILE A 1 282 ? -37.996 -10.427 -82.469  1.00 53.37  ? 1078 ILE A CG2 1 
ATOM   2149  C CD1 . ILE A 1 282 ? -35.912 -8.231  -82.351  1.00 52.09  ? 1078 ILE A CD1 1 
ATOM   2150  N N   . LEU A 1 283 ? -40.616 -9.264  -79.793  1.00 57.58  ? 1079 LEU A N   1 
ATOM   2151  C CA  . LEU A 1 283 ? -41.354 -10.075 -78.823  1.00 56.74  ? 1079 LEU A CA  1 
ATOM   2152  C C   . LEU A 1 283 ? -42.869 -9.858  -78.878  1.00 62.36  ? 1079 LEU A C   1 
ATOM   2153  O O   . LEU A 1 283 ? -43.643 -10.763 -78.553  1.00 59.91  ? 1079 LEU A O   1 
ATOM   2154  C CB  . LEU A 1 283 ? -40.842 -9.813  -77.411  1.00 50.41  ? 1079 LEU A CB  1 
ATOM   2155  C CG  . LEU A 1 283 ? -39.379 -10.187 -77.205  1.00 43.35  ? 1079 LEU A CG  1 
ATOM   2156  C CD1 . LEU A 1 283 ? -38.966 -9.938  -75.764  1.00 42.22  ? 1079 LEU A CD1 1 
ATOM   2157  C CD2 . LEU A 1 283 ? -39.163 -11.635 -77.591  1.00 48.94  ? 1079 LEU A CD2 1 
ATOM   2158  N N   . ARG A 1 284 ? -43.293 -8.662  -79.280  1.00 61.75  ? 1080 ARG A N   1 
ATOM   2159  C CA  . ARG A 1 284 ? -44.715 -8.404  -79.452  1.00 60.78  ? 1080 ARG A CA  1 
ATOM   2160  C C   . ARG A 1 284 ? -45.245 -9.100  -80.701  1.00 57.17  ? 1080 ARG A C   1 
ATOM   2161  O O   . ARG A 1 284 ? -46.391 -9.532  -80.743  1.00 65.43  ? 1080 ARG A O   1 
ATOM   2162  C CB  . ARG A 1 284 ? -45.011 -6.899  -79.494  1.00 68.26  ? 1080 ARG A CB  1 
ATOM   2163  C CG  . ARG A 1 284 ? -44.976 -6.214  -78.126  1.00 76.97  ? 1080 ARG A CG  1 
ATOM   2164  C CD  . ARG A 1 284 ? -45.865 -4.971  -78.069  1.00 75.94  ? 1080 ARG A CD  1 
ATOM   2165  N NE  . ARG A 1 284 ? -45.534 -4.013  -79.119  1.00 82.81  ? 1080 ARG A NE  1 
ATOM   2166  C CZ  . ARG A 1 284 ? -46.289 -3.772  -80.187  1.00 77.27  ? 1080 ARG A CZ  1 
ATOM   2167  N NH1 . ARG A 1 284 ? -47.446 -4.402  -80.354  1.00 69.03  ? 1080 ARG A NH1 1 
ATOM   2168  N NH2 . ARG A 1 284 ? -45.889 -2.885  -81.086  1.00 71.54  ? 1080 ARG A NH2 1 
ATOM   2169  N N   . ASN A 1 285 ? -44.399 -9.224  -81.714  1.00 59.42  ? 1081 ASN A N   1 
ATOM   2170  C CA  . ASN A 1 285 ? -44.819 -9.821  -82.975  1.00 61.50  ? 1081 ASN A CA  1 
ATOM   2171  C C   . ASN A 1 285 ? -44.953 -11.344 -82.910  1.00 65.19  ? 1081 ASN A C   1 
ATOM   2172  O O   . ASN A 1 285 ? -44.111 -12.031 -82.325  1.00 61.26  ? 1081 ASN A O   1 
ATOM   2173  C CB  . ASN A 1 285 ? -43.867 -9.427  -84.105  1.00 59.91  ? 1081 ASN A CB  1 
ATOM   2174  C CG  . ASN A 1 285 ? -44.452 -9.694  -85.476  1.00 61.18  ? 1081 ASN A CG  1 
ATOM   2175  O OD1 . ASN A 1 285 ? -44.504 -10.835 -85.928  1.00 61.63  ? 1081 ASN A OD1 1 
ATOM   2176  N ND2 . ASN A 1 285 ? -44.893 -8.637  -86.149  1.00 64.46  ? 1081 ASN A ND2 1 
ATOM   2177  N N   . ALA A 1 286 ? -46.017 -11.858 -83.522  1.00 68.17  ? 1082 ALA A N   1 
ATOM   2178  C CA  . ALA A 1 286 ? -46.277 -13.294 -83.561  1.00 66.56  ? 1082 ALA A CA  1 
ATOM   2179  C C   . ALA A 1 286 ? -45.307 -14.007 -84.493  1.00 65.66  ? 1082 ALA A C   1 
ATOM   2180  O O   . ALA A 1 286 ? -44.992 -15.178 -84.286  1.00 75.30  ? 1082 ALA A O   1 
ATOM   2181  C CB  . ALA A 1 286 ? -47.720 -13.568 -83.984  1.00 64.71  ? 1082 ALA A CB  1 
ATOM   2182  N N   . LYS A 1 287 ? -44.841 -13.298 -85.519  1.00 58.28  ? 1083 LYS A N   1 
ATOM   2183  C CA  . LYS A 1 287 ? -43.898 -13.858 -86.485  1.00 59.52  ? 1083 LYS A CA  1 
ATOM   2184  C C   . LYS A 1 287 ? -42.452 -13.855 -85.982  1.00 62.13  ? 1083 LYS A C   1 
ATOM   2185  O O   . LYS A 1 287 ? -41.843 -14.909 -85.822  1.00 64.47  ? 1083 LYS A O   1 
ATOM   2186  C CB  . LYS A 1 287 ? -43.990 -13.125 -87.826  1.00 56.53  ? 1083 LYS A CB  1 
ATOM   2187  C CG  . LYS A 1 287 ? -45.150 -13.558 -88.698  1.00 61.44  ? 1083 LYS A CG  1 
ATOM   2188  C CD  . LYS A 1 287 ? -45.009 -13.005 -90.108  1.00 62.95  ? 1083 LYS A CD  1 
ATOM   2189  C CE  . LYS A 1 287 ? -46.172 -13.423 -90.997  1.00 74.69  ? 1083 LYS A CE  1 
ATOM   2190  N NZ  . LYS A 1 287 ? -46.091 -12.834 -92.367  1.00 67.19  ? 1083 LYS A NZ  1 
ATOM   2191  N N   . LEU A 1 288 ? -41.907 -12.666 -85.749  1.00 62.39  ? 1084 LEU A N   1 
ATOM   2192  C CA  . LEU A 1 288 ? -40.499 -12.504 -85.388  1.00 54.55  ? 1084 LEU A CA  1 
ATOM   2193  C C   . LEU A 1 288 ? -40.114 -13.170 -84.068  1.00 59.62  ? 1084 LEU A C   1 
ATOM   2194  O O   . LEU A 1 288 ? -38.954 -13.513 -83.859  1.00 57.64  ? 1084 LEU A O   1 
ATOM   2195  C CB  . LEU A 1 288 ? -40.155 -11.018 -85.323  1.00 45.37  ? 1084 LEU A CB  1 
ATOM   2196  C CG  . LEU A 1 288 ? -40.770 -10.209 -86.461  1.00 49.06  ? 1084 LEU A CG  1 
ATOM   2197  C CD1 . LEU A 1 288 ? -40.767 -8.725  -86.136  1.00 58.38  ? 1084 LEU A CD1 1 
ATOM   2198  C CD2 . LEU A 1 288 ? -40.047 -10.488 -87.762  1.00 50.36  ? 1084 LEU A CD2 1 
ATOM   2199  N N   . LYS A 1 289 ? -41.079 -13.330 -83.169  1.00 63.13  ? 1085 LYS A N   1 
ATOM   2200  C CA  . LYS A 1 289 ? -40.778 -13.851 -81.837  1.00 65.93  ? 1085 LYS A CA  1 
ATOM   2201  C C   . LYS A 1 289 ? -40.275 -15.303 -81.785  1.00 64.42  ? 1085 LYS A C   1 
ATOM   2202  O O   . LYS A 1 289 ? -39.175 -15.559 -81.304  1.00 60.64  ? 1085 LYS A O   1 
ATOM   2203  C CB  . LYS A 1 289 ? -41.969 -13.662 -80.891  1.00 63.34  ? 1085 LYS A CB  1 
ATOM   2204  C CG  . LYS A 1 289 ? -41.676 -14.146 -79.489  1.00 68.01  ? 1085 LYS A CG  1 
ATOM   2205  C CD  . LYS A 1 289 ? -42.866 -14.015 -78.573  1.00 73.22  ? 1085 LYS A CD  1 
ATOM   2206  C CE  . LYS A 1 289 ? -42.564 -14.679 -77.242  1.00 85.56  ? 1085 LYS A CE  1 
ATOM   2207  N NZ  . LYS A 1 289 ? -42.063 -16.073 -77.439  1.00 82.40  ? 1085 LYS A NZ  1 
ATOM   2208  N N   . PRO A 1 290 ? -41.080 -16.258 -82.276  1.00 69.61  ? 1086 PRO A N   1 
ATOM   2209  C CA  . PRO A 1 290 ? -40.668 -17.661 -82.166  1.00 69.72  ? 1086 PRO A CA  1 
ATOM   2210  C C   . PRO A 1 290 ? -39.321 -17.885 -82.834  1.00 69.24  ? 1086 PRO A C   1 
ATOM   2211  O O   . PRO A 1 290 ? -38.428 -18.492 -82.244  1.00 70.18  ? 1086 PRO A O   1 
ATOM   2212  C CB  . PRO A 1 290 ? -41.770 -18.404 -82.930  1.00 78.18  ? 1086 PRO A CB  1 
ATOM   2213  C CG  . PRO A 1 290 ? -42.963 -17.504 -82.847  1.00 69.75  ? 1086 PRO A CG  1 
ATOM   2214  C CD  . PRO A 1 290 ? -42.400 -16.115 -82.917  1.00 71.27  ? 1086 PRO A CD  1 
ATOM   2215  N N   . VAL A 1 291 ? -39.184 -17.377 -84.053  1.00 66.51  ? 1087 VAL A N   1 
ATOM   2216  C CA  . VAL A 1 291 ? -37.924 -17.430 -84.777  1.00 67.42  ? 1087 VAL A CA  1 
ATOM   2217  C C   . VAL A 1 291 ? -36.814 -16.834 -83.918  1.00 75.43  ? 1087 VAL A C   1 
ATOM   2218  O O   . VAL A 1 291 ? -35.760 -17.441 -83.723  1.00 75.63  ? 1087 VAL A O   1 
ATOM   2219  C CB  . VAL A 1 291 ? -38.020 -16.651 -86.101  1.00 58.17  ? 1087 VAL A CB  1 
ATOM   2220  C CG1 . VAL A 1 291 ? -36.651 -16.516 -86.748  1.00 59.56  ? 1087 VAL A CG1 1 
ATOM   2221  C CG2 . VAL A 1 291 ? -39.005 -17.324 -87.040  1.00 64.21  ? 1087 VAL A CG2 1 
ATOM   2222  N N   . TYR A 1 292 ? -37.079 -15.642 -83.394  1.00 75.29  ? 1088 TYR A N   1 
ATOM   2223  C CA  . TYR A 1 292 ? -36.131 -14.906 -82.564  1.00 68.58  ? 1088 TYR A CA  1 
ATOM   2224  C C   . TYR A 1 292 ? -35.725 -15.690 -81.319  1.00 70.62  ? 1088 TYR A C   1 
ATOM   2225  O O   . TYR A 1 292 ? -34.699 -15.398 -80.700  1.00 66.44  ? 1088 TYR A O   1 
ATOM   2226  C CB  . TYR A 1 292 ? -36.738 -13.566 -82.158  1.00 60.05  ? 1088 TYR A CB  1 
ATOM   2227  C CG  . TYR A 1 292 ? -35.825 -12.720 -81.316  1.00 58.63  ? 1088 TYR A CG  1 
ATOM   2228  C CD1 . TYR A 1 292 ? -34.961 -11.808 -81.900  1.00 59.25  ? 1088 TYR A CD1 1 
ATOM   2229  C CD2 . TYR A 1 292 ? -35.827 -12.831 -79.933  1.00 63.78  ? 1088 TYR A CD2 1 
ATOM   2230  C CE1 . TYR A 1 292 ? -34.127 -11.024 -81.131  1.00 65.54  ? 1088 TYR A CE1 1 
ATOM   2231  C CE2 . TYR A 1 292 ? -34.996 -12.058 -79.153  1.00 66.81  ? 1088 TYR A CE2 1 
ATOM   2232  C CZ  . TYR A 1 292 ? -34.146 -11.156 -79.756  1.00 73.10  ? 1088 TYR A CZ  1 
ATOM   2233  O OH  . TYR A 1 292 ? -33.309 -10.385 -78.979  1.00 78.15  ? 1088 TYR A OH  1 
ATOM   2234  N N   . ASP A 1 293 ? -36.538 -16.681 -80.960  1.00 73.59  ? 1089 ASP A N   1 
ATOM   2235  C CA  . ASP A 1 293 ? -36.262 -17.541 -79.813  1.00 74.36  ? 1089 ASP A CA  1 
ATOM   2236  C C   . ASP A 1 293 ? -35.190 -18.571 -80.147  1.00 70.82  ? 1089 ASP A C   1 
ATOM   2237  O O   . ASP A 1 293 ? -34.353 -18.899 -79.309  1.00 72.91  ? 1089 ASP A O   1 
ATOM   2238  C CB  . ASP A 1 293 ? -37.540 -18.244 -79.339  1.00 77.31  ? 1089 ASP A CB  1 
ATOM   2239  C CG  . ASP A 1 293 ? -38.285 -17.456 -78.265  1.00 86.04  ? 1089 ASP A CG  1 
ATOM   2240  O OD1 . ASP A 1 293 ? -38.094 -16.224 -78.172  1.00 86.23  ? 1089 ASP A OD1 1 
ATOM   2241  O OD2 . ASP A 1 293 ? -39.068 -18.074 -77.509  1.00 86.82  ? 1089 ASP A OD2 1 
ATOM   2242  N N   . SER A 1 294 ? -35.209 -19.061 -81.382  1.00 64.52  ? 1090 SER A N   1 
ATOM   2243  C CA  . SER A 1 294 ? -34.284 -20.107 -81.808  1.00 72.63  ? 1090 SER A CA  1 
ATOM   2244  C C   . SER A 1 294 ? -32.929 -19.578 -82.288  1.00 78.25  ? 1090 SER A C   1 
ATOM   2245  O O   . SER A 1 294 ? -32.081 -20.353 -82.732  1.00 80.16  ? 1090 SER A O   1 
ATOM   2246  C CB  . SER A 1 294 ? -34.925 -20.968 -82.898  1.00 77.88  ? 1090 SER A CB  1 
ATOM   2247  O OG  . SER A 1 294 ? -35.400 -20.169 -83.969  1.00 71.25  ? 1090 SER A OG  1 
ATOM   2248  N N   . LEU A 1 295 ? -32.730 -18.264 -82.203  1.00 77.66  ? 1091 LEU A N   1 
ATOM   2249  C CA  . LEU A 1 295 ? -31.500 -17.639 -82.699  1.00 73.92  ? 1091 LEU A CA  1 
ATOM   2250  C C   . LEU A 1 295 ? -30.423 -17.431 -81.633  1.00 71.03  ? 1091 LEU A C   1 
ATOM   2251  O O   . LEU A 1 295 ? -30.705 -16.952 -80.530  1.00 65.94  ? 1091 LEU A O   1 
ATOM   2252  C CB  . LEU A 1 295 ? -31.808 -16.301 -83.377  1.00 69.39  ? 1091 LEU A CB  1 
ATOM   2253  C CG  . LEU A 1 295 ? -32.410 -16.378 -84.780  1.00 67.39  ? 1091 LEU A CG  1 
ATOM   2254  C CD1 . LEU A 1 295 ? -32.601 -14.989 -85.378  1.00 62.83  ? 1091 LEU A CD1 1 
ATOM   2255  C CD2 . LEU A 1 295 ? -31.526 -17.225 -85.676  1.00 72.70  ? 1091 LEU A CD2 1 
ATOM   2256  N N   . ASP A 1 296 ? -29.188 -17.792 -81.980  1.00 67.03  ? 1092 ASP A N   1 
ATOM   2257  C CA  . ASP A 1 296 ? -28.033 -17.549 -81.122  1.00 64.15  ? 1092 ASP A CA  1 
ATOM   2258  C C   . ASP A 1 296 ? -27.677 -16.068 -81.142  1.00 65.63  ? 1092 ASP A C   1 
ATOM   2259  O O   . ASP A 1 296 ? -28.095 -15.336 -82.044  1.00 65.81  ? 1092 ASP A O   1 
ATOM   2260  C CB  . ASP A 1 296 ? -26.836 -18.409 -81.543  1.00 69.12  ? 1092 ASP A CB  1 
ATOM   2261  C CG  . ASP A 1 296 ? -26.186 -17.925 -82.825  1.00 73.55  ? 1092 ASP A CG  1 
ATOM   2262  O OD1 . ASP A 1 296 ? -25.062 -17.384 -82.752  1.00 73.70  ? 1092 ASP A OD1 1 
ATOM   2263  O OD2 . ASP A 1 296 ? -26.793 -18.085 -83.905  1.00 68.34  ? 1092 ASP A OD2 1 
ATOM   2264  N N   . ALA A 1 297 ? -26.910 -15.632 -80.147  1.00 63.08  ? 1093 ALA A N   1 
ATOM   2265  C CA  . ALA A 1 297 ? -26.689 -14.206 -79.905  1.00 64.07  ? 1093 ALA A CA  1 
ATOM   2266  C C   . ALA A 1 297 ? -26.331 -13.411 -81.159  1.00 60.16  ? 1093 ALA A C   1 
ATOM   2267  O O   . ALA A 1 297 ? -26.883 -12.336 -81.401  1.00 61.31  ? 1093 ALA A O   1 
ATOM   2268  C CB  . ALA A 1 297 ? -25.634 -14.010 -78.835  1.00 69.54  ? 1093 ALA A CB  1 
ATOM   2269  N N   . VAL A 1 298 ? -25.402 -13.934 -81.947  1.00 53.88  ? 1094 VAL A N   1 
ATOM   2270  C CA  . VAL A 1 298 ? -25.016 -13.275 -83.184  1.00 59.22  ? 1094 VAL A CA  1 
ATOM   2271  C C   . VAL A 1 298 ? -26.233 -13.061 -84.084  1.00 59.85  ? 1094 VAL A C   1 
ATOM   2272  O O   . VAL A 1 298 ? -26.717 -11.934 -84.261  1.00 59.01  ? 1094 VAL A O   1 
ATOM   2273  C CB  . VAL A 1 298 ? -23.971 -14.113 -83.947  1.00 63.22  ? 1094 VAL A CB  1 
ATOM   2274  C CG1 . VAL A 1 298 ? -23.366 -13.311 -85.093  1.00 59.56  ? 1094 VAL A CG1 1 
ATOM   2275  C CG2 . VAL A 1 298 ? -22.889 -14.602 -82.995  1.00 59.74  ? 1094 VAL A CG2 1 
ATOM   2276  N N   . ARG A 1 299 ? -26.736 -14.160 -84.633  1.00 63.86  ? 1095 ARG A N   1 
ATOM   2277  C CA  . ARG A 1 299 ? -27.822 -14.105 -85.600  1.00 65.90  ? 1095 ARG A CA  1 
ATOM   2278  C C   . ARG A 1 299 ? -28.979 -13.291 -85.047  1.00 59.89  ? 1095 ARG A C   1 
ATOM   2279  O O   . ARG A 1 299 ? -29.556 -12.445 -85.731  1.00 53.70  ? 1095 ARG A O   1 
ATOM   2280  C CB  . ARG A 1 299 ? -28.266 -15.522 -85.974  1.00 63.27  ? 1095 ARG A CB  1 
ATOM   2281  C CG  . ARG A 1 299 ? -27.331 -16.193 -86.966  1.00 59.10  ? 1095 ARG A CG  1 
ATOM   2282  C CD  . ARG A 1 299 ? -27.282 -17.701 -86.801  1.00 60.96  ? 1095 ARG A CD  1 
ATOM   2283  N NE  . ARG A 1 299 ? -26.232 -18.273 -87.642  1.00 67.94  ? 1095 ARG A NE  1 
ATOM   2284  C CZ  . ARG A 1 299 ? -25.775 -19.518 -87.544  1.00 68.73  ? 1095 ARG A CZ  1 
ATOM   2285  N NH1 . ARG A 1 299 ? -26.269 -20.342 -86.631  1.00 74.17  ? 1095 ARG A NH1 1 
ATOM   2286  N NH2 . ARG A 1 299 ? -24.814 -19.939 -88.358  1.00 65.73  ? 1095 ARG A NH2 1 
ATOM   2287  N N   . ARG A 1 300 ? -29.299 -13.541 -83.789  1.00 55.26  ? 1096 ARG A N   1 
ATOM   2288  C CA  . ARG A 1 300 ? -30.371 -12.822 -83.136  1.00 57.39  ? 1096 ARG A CA  1 
ATOM   2289  C C   . ARG A 1 300 ? -30.122 -11.330 -83.263  1.00 51.81  ? 1096 ARG A C   1 
ATOM   2290  O O   . ARG A 1 300 ? -30.996 -10.578 -83.688  1.00 52.20  ? 1096 ARG A O   1 
ATOM   2291  C CB  . ARG A 1 300 ? -30.459 -13.247 -81.674  1.00 59.17  ? 1096 ARG A CB  1 
ATOM   2292  C CG  . ARG A 1 300 ? -31.580 -12.614 -80.901  1.00 60.99  ? 1096 ARG A CG  1 
ATOM   2293  C CD  . ARG A 1 300 ? -31.777 -13.320 -79.574  1.00 66.77  ? 1096 ARG A CD  1 
ATOM   2294  N NE  . ARG A 1 300 ? -30.518 -13.458 -78.852  1.00 71.24  ? 1096 ARG A NE  1 
ATOM   2295  C CZ  . ARG A 1 300 ? -30.334 -14.279 -77.825  1.00 69.66  ? 1096 ARG A CZ  1 
ATOM   2296  N NH1 . ARG A 1 300 ? -31.335 -15.038 -77.401  1.00 68.65  ? 1096 ARG A NH1 1 
ATOM   2297  N NH2 . ARG A 1 300 ? -29.150 -14.344 -77.226  1.00 64.81  ? 1096 ARG A NH2 1 
ATOM   2298  N N   . ALA A 1 301 ? -28.911 -10.910 -82.920  1.00 49.12  ? 1097 ALA A N   1 
ATOM   2299  C CA  . ALA A 1 301 ? -28.525 -9.514  -83.066  1.00 56.96  ? 1097 ALA A CA  1 
ATOM   2300  C C   . ALA A 1 301 ? -28.711 -9.024  -84.503  1.00 65.61  ? 1097 ALA A C   1 
ATOM   2301  O O   . ALA A 1 301 ? -29.039 -7.855  -84.736  1.00 67.98  ? 1097 ALA A O   1 
ATOM   2302  C CB  . ALA A 1 301 ? -27.095 -9.311  -82.619  1.00 59.15  ? 1097 ALA A CB  1 
ATOM   2303  N N   . ALA A 1 302 ? -28.497 -9.915  -85.469  1.00 64.43  ? 1098 ALA A N   1 
ATOM   2304  C CA  . ALA A 1 302 ? -28.723 -9.558  -86.871  1.00 64.69  ? 1098 ALA A CA  1 
ATOM   2305  C C   . ALA A 1 302 ? -30.194 -9.210  -87.082  1.00 64.83  ? 1098 ALA A C   1 
ATOM   2306  O O   . ALA A 1 302 ? -30.542 -8.158  -87.650  1.00 61.89  ? 1098 ALA A O   1 
ATOM   2307  C CB  . ALA A 1 302 ? -28.306 -10.693 -87.791  1.00 63.25  ? 1098 ALA A CB  1 
ATOM   2308  N N   . LEU A 1 303 ? -31.052 -10.115 -86.614  1.00 66.35  ? 1099 LEU A N   1 
ATOM   2309  C CA  . LEU A 1 303 ? -32.495 -9.931  -86.670  1.00 61.03  ? 1099 LEU A CA  1 
ATOM   2310  C C   . LEU A 1 303 ? -32.880 -8.588  -86.066  1.00 58.36  ? 1099 LEU A C   1 
ATOM   2311  O O   . LEU A 1 303 ? -33.686 -7.846  -86.635  1.00 61.75  ? 1099 LEU A O   1 
ATOM   2312  C CB  . LEU A 1 303 ? -33.199 -11.065 -85.925  1.00 50.68  ? 1099 LEU A CB  1 
ATOM   2313  C CG  . LEU A 1 303 ? -34.722 -11.116 -86.052  1.00 40.90  ? 1099 LEU A CG  1 
ATOM   2314  C CD1 . LEU A 1 303 ? -35.148 -10.724 -87.450  1.00 36.61  ? 1099 LEU A CD1 1 
ATOM   2315  C CD2 . LEU A 1 303 ? -35.234 -12.502 -85.690  1.00 44.54  ? 1099 LEU A CD2 1 
ATOM   2316  N N   . ILE A 1 304 ? -32.290 -8.275  -84.917  1.00 52.33  ? 1100 ILE A N   1 
ATOM   2317  C CA  . ILE A 1 304 ? -32.553 -7.003  -84.260  1.00 50.25  ? 1100 ILE A CA  1 
ATOM   2318  C C   . ILE A 1 304 ? -32.045 -5.821  -85.089  1.00 54.76  ? 1100 ILE A C   1 
ATOM   2319  O O   . ILE A 1 304 ? -32.563 -4.710  -84.974  1.00 52.42  ? 1100 ILE A O   1 
ATOM   2320  C CB  . ILE A 1 304 ? -31.949 -6.962  -82.853  1.00 47.34  ? 1100 ILE A CB  1 
ATOM   2321  C CG1 . ILE A 1 304 ? -32.544 -8.069  -81.989  1.00 49.80  ? 1100 ILE A CG1 1 
ATOM   2322  C CG2 . ILE A 1 304 ? -32.226 -5.633  -82.197  1.00 56.72  ? 1100 ILE A CG2 1 
ATOM   2323  C CD1 . ILE A 1 304 ? -32.257 -7.892  -80.520  1.00 54.72  ? 1100 ILE A CD1 1 
ATOM   2324  N N   . ASN A 1 305 ? -31.028 -6.058  -85.918  1.00 57.14  ? 1101 ASN A N   1 
ATOM   2325  C CA  . ASN A 1 305 ? -30.585 -5.040  -86.869  1.00 56.67  ? 1101 ASN A CA  1 
ATOM   2326  C C   . ASN A 1 305 ? -31.657 -4.762  -87.917  1.00 58.13  ? 1101 ASN A C   1 
ATOM   2327  O O   . ASN A 1 305 ? -32.078 -3.615  -88.102  1.00 62.52  ? 1101 ASN A O   1 
ATOM   2328  C CB  . ASN A 1 305 ? -29.269 -5.442  -87.549  1.00 57.81  ? 1101 ASN A CB  1 
ATOM   2329  C CG  . ASN A 1 305 ? -28.781 -4.399  -88.551  1.00 55.42  ? 1101 ASN A CG  1 
ATOM   2330  O OD1 . ASN A 1 305 ? -29.571 -3.688  -89.169  1.00 55.80  ? 1101 ASN A OD1 1 
ATOM   2331  N ND2 . ASN A 1 305 ? -27.474 -4.313  -88.717  1.00 54.36  ? 1101 ASN A ND2 1 
ATOM   2332  N N   . MET A 1 306 ? -32.100 -5.813  -88.599  1.00 52.21  ? 1102 MET A N   1 
ATOM   2333  C CA  . MET A 1 306 ? -33.135 -5.662  -89.618  1.00 51.36  ? 1102 MET A CA  1 
ATOM   2334  C C   . MET A 1 306 ? -34.395 -5.002  -89.066  1.00 48.62  ? 1102 MET A C   1 
ATOM   2335  O O   . MET A 1 306 ? -34.974 -4.117  -89.698  1.00 45.82  ? 1102 MET A O   1 
ATOM   2336  C CB  . MET A 1 306 ? -33.516 -7.018  -90.190  1.00 49.56  ? 1102 MET A CB  1 
ATOM   2337  C CG  . MET A 1 306 ? -32.368 -7.793  -90.777  1.00 49.54  ? 1102 MET A CG  1 
ATOM   2338  S SD  . MET A 1 306 ? -33.031 -9.306  -91.460  1.00 52.73  ? 1102 MET A SD  1 
ATOM   2339  C CE  . MET A 1 306 ? -34.327 -8.638  -92.490  1.00 53.45  ? 1102 MET A CE  1 
ATOM   2340  N N   . VAL A 1 307 ? -34.822 -5.455  -87.890  1.00 53.53  ? 1103 VAL A N   1 
ATOM   2341  C CA  . VAL A 1 307 ? -36.005 -4.904  -87.241  1.00 52.27  ? 1103 VAL A CA  1 
ATOM   2342  C C   . VAL A 1 307 ? -35.773 -3.447  -86.849  1.00 55.86  ? 1103 VAL A C   1 
ATOM   2343  O O   . VAL A 1 307 ? -36.658 -2.602  -87.000  1.00 54.04  ? 1103 VAL A O   1 
ATOM   2344  C CB  . VAL A 1 307 ? -36.392 -5.716  -85.993  1.00 45.46  ? 1103 VAL A CB  1 
ATOM   2345  C CG1 . VAL A 1 307 ? -37.484 -5.006  -85.230  1.00 53.81  ? 1103 VAL A CG1 1 
ATOM   2346  C CG2 . VAL A 1 307 ? -36.845 -7.105  -86.388  1.00 41.94  ? 1103 VAL A CG2 1 
ATOM   2347  N N   . PHE A 1 308 ? -34.575 -3.161  -86.347  1.00 53.79  ? 1104 PHE A N   1 
ATOM   2348  C CA  . PHE A 1 308 ? -34.183 -1.798  -86.002  1.00 52.17  ? 1104 PHE A CA  1 
ATOM   2349  C C   . PHE A 1 308 ? -34.174 -0.890  -87.228  1.00 57.04  ? 1104 PHE A C   1 
ATOM   2350  O O   . PHE A 1 308 ? -34.223 0.334   -87.106  1.00 56.33  ? 1104 PHE A O   1 
ATOM   2351  C CB  . PHE A 1 308 ? -32.798 -1.784  -85.353  1.00 52.17  ? 1104 PHE A CB  1 
ATOM   2352  C CG  . PHE A 1 308 ? -32.231 -0.403  -85.168  1.00 59.44  ? 1104 PHE A CG  1 
ATOM   2353  C CD1 . PHE A 1 308 ? -32.240 0.208   -83.923  1.00 59.29  ? 1104 PHE A CD1 1 
ATOM   2354  C CD2 . PHE A 1 308 ? -31.690 0.288   -86.243  1.00 60.75  ? 1104 PHE A CD2 1 
ATOM   2355  C CE1 . PHE A 1 308 ? -31.719 1.480   -83.754  1.00 57.12  ? 1104 PHE A CE1 1 
ATOM   2356  C CE2 . PHE A 1 308 ? -31.174 1.559   -86.081  1.00 61.60  ? 1104 PHE A CE2 1 
ATOM   2357  C CZ  . PHE A 1 308 ? -31.186 2.155   -84.830  1.00 59.73  ? 1104 PHE A CZ  1 
ATOM   2358  N N   . GLN A 1 309 ? -34.090 -1.489  -88.411  1.00 61.53  ? 1105 GLN A N   1 
ATOM   2359  C CA  . GLN A 1 309 ? -34.064 -0.705  -89.638  1.00 57.34  ? 1105 GLN A CA  1 
ATOM   2360  C C   . GLN A 1 309 ? -35.442 -0.517  -90.266  1.00 59.06  ? 1105 GLN A C   1 
ATOM   2361  O O   . GLN A 1 309 ? -35.936 0.608   -90.362  1.00 58.96  ? 1105 GLN A O   1 
ATOM   2362  C CB  . GLN A 1 309 ? -33.115 -1.326  -90.657  1.00 55.11  ? 1105 GLN A CB  1 
ATOM   2363  C CG  . GLN A 1 309 ? -33.112 -0.579  -91.971  1.00 60.62  ? 1105 GLN A CG  1 
ATOM   2364  C CD  . GLN A 1 309 ? -31.994 -1.018  -92.874  1.00 56.93  ? 1105 GLN A CD  1 
ATOM   2365  O OE1 . GLN A 1 309 ? -31.334 -2.023  -92.609  1.00 54.38  ? 1105 GLN A OE1 1 
ATOM   2366  N NE2 . GLN A 1 309 ? -31.761 -0.261  -93.944  1.00 49.06  ? 1105 GLN A NE2 1 
ATOM   2367  N N   . MET A 1 310 ? -36.046 -1.620  -90.706  1.00 62.98  ? 1106 MET A N   1 
ATOM   2368  C CA  . MET A 1 310 ? -37.319 -1.569  -91.429  1.00 63.87  ? 1106 MET A CA  1 
ATOM   2369  C C   . MET A 1 310 ? -38.544 -1.525  -90.528  1.00 62.35  ? 1106 MET A C   1 
ATOM   2370  O O   . MET A 1 310 ? -39.632 -1.175  -90.981  1.00 58.68  ? 1106 MET A O   1 
ATOM   2371  C CB  . MET A 1 310 ? -37.443 -2.757  -92.384  1.00 60.87  ? 1106 MET A CB  1 
ATOM   2372  C CG  . MET A 1 310 ? -36.688 -2.579  -93.684  1.00 68.91  ? 1106 MET A CG  1 
ATOM   2373  S SD  . MET A 1 310 ? -36.669 -4.086  -94.668  1.00 76.17  ? 1106 MET A SD  1 
ATOM   2374  C CE  . MET A 1 310 ? -35.905 -5.221  -93.504  1.00 65.32  ? 1106 MET A CE  1 
ATOM   2375  N N   . GLY A 1 311 ? -38.366 -1.871  -89.256  1.00 65.77  ? 1107 GLY A N   1 
ATOM   2376  C CA  . GLY A 1 311 ? -39.484 -1.967  -88.334  1.00 67.00  ? 1107 GLY A CA  1 
ATOM   2377  C C   . GLY A 1 311 ? -40.049 -3.375  -88.286  1.00 63.95  ? 1107 GLY A C   1 
ATOM   2378  O O   . GLY A 1 311 ? -39.810 -4.176  -89.191  1.00 62.39  ? 1107 GLY A O   1 
ATOM   2379  N N   . GLU A 1 312 ? -40.796 -3.677  -87.226  1.00 66.98  ? 1108 GLU A N   1 
ATOM   2380  C CA  . GLU A 1 312 ? -41.437 -4.984  -87.069  1.00 66.57  ? 1108 GLU A CA  1 
ATOM   2381  C C   . GLU A 1 312 ? -42.336 -5.338  -88.269  1.00 66.37  ? 1108 GLU A C   1 
ATOM   2382  O O   . GLU A 1 312 ? -42.180 -6.398  -88.878  1.00 60.38  ? 1108 GLU A O   1 
ATOM   2383  C CB  . GLU A 1 312 ? -42.234 -5.026  -85.759  1.00 62.09  ? 1108 GLU A CB  1 
ATOM   2384  C CG  . GLU A 1 312 ? -43.312 -6.101  -85.709  1.00 66.52  ? 1108 GLU A CG  1 
ATOM   2385  C CD  . GLU A 1 312 ? -44.404 -5.801  -84.684  1.00 73.51  ? 1108 GLU A CD  1 
ATOM   2386  O OE1 . GLU A 1 312 ? -45.584 -6.109  -84.970  1.00 65.67  ? 1108 GLU A OE1 1 
ATOM   2387  O OE2 . GLU A 1 312 ? -44.083 -5.266  -83.594  1.00 76.22  ? 1108 GLU A OE2 1 
ATOM   2388  N N   . THR A 1 313 ? -43.266 -4.445  -88.607  1.00 68.98  ? 1109 THR A N   1 
ATOM   2389  C CA  . THR A 1 313 ? -44.130 -4.636  -89.767  1.00 60.07  ? 1109 THR A CA  1 
ATOM   2390  C C   . THR A 1 313 ? -43.265 -5.038  -90.949  1.00 59.70  ? 1109 THR A C   1 
ATOM   2391  O O   . THR A 1 313 ? -43.590 -5.970  -91.685  1.00 62.80  ? 1109 THR A O   1 
ATOM   2392  C CB  . THR A 1 313 ? -44.895 -3.340  -90.138  1.00 54.01  ? 1109 THR A CB  1 
ATOM   2393  O OG1 . THR A 1 313 ? -45.777 -2.977  -89.070  1.00 50.39  ? 1109 THR A OG1 1 
ATOM   2394  C CG2 . THR A 1 313 ? -45.703 -3.535  -91.417  1.00 49.13  ? 1109 THR A CG2 1 
ATOM   2395  N N   . GLY A 1 314 ? -42.152 -4.334  -91.116  1.00 60.04  ? 1110 GLY A N   1 
ATOM   2396  C CA  . GLY A 1 314 ? -41.270 -4.561  -92.243  1.00 60.97  ? 1110 GLY A CA  1 
ATOM   2397  C C   . GLY A 1 314 ? -40.650 -5.939  -92.252  1.00 56.40  ? 1110 GLY A C   1 
ATOM   2398  O O   . GLY A 1 314 ? -40.781 -6.686  -93.222  1.00 57.16  ? 1110 GLY A O   1 
ATOM   2399  N N   . VAL A 1 315 ? -39.982 -6.278  -91.159  1.00 51.34  ? 1111 VAL A N   1 
ATOM   2400  C CA  . VAL A 1 315 ? -39.208 -7.510  -91.090  1.00 56.92  ? 1111 VAL A CA  1 
ATOM   2401  C C   . VAL A 1 315 ? -40.105 -8.738  -90.976  1.00 56.86  ? 1111 VAL A C   1 
ATOM   2402  O O   . VAL A 1 315 ? -39.653 -9.869  -91.154  1.00 53.12  ? 1111 VAL A O   1 
ATOM   2403  C CB  . VAL A 1 315 ? -38.227 -7.464  -89.924  1.00 56.70  ? 1111 VAL A CB  1 
ATOM   2404  C CG1 . VAL A 1 315 ? -37.458 -8.762  -89.831  1.00 56.15  ? 1111 VAL A CG1 1 
ATOM   2405  C CG2 . VAL A 1 315 ? -37.277 -6.285  -90.111  1.00 60.88  ? 1111 VAL A CG2 1 
ATOM   2406  N N   . ALA A 1 316 ? -41.384 -8.502  -90.699  1.00 55.23  ? 1112 ALA A N   1 
ATOM   2407  C CA  . ALA A 1 316 ? -42.356 -9.575  -90.568  1.00 48.15  ? 1112 ALA A CA  1 
ATOM   2408  C C   . ALA A 1 316 ? -42.865 -10.065 -91.920  1.00 55.68  ? 1112 ALA A C   1 
ATOM   2409  O O   . ALA A 1 316 ? -43.484 -11.121 -91.994  1.00 66.09  ? 1112 ALA A O   1 
ATOM   2410  C CB  . ALA A 1 316 ? -43.504 -9.135  -89.683  1.00 51.23  ? 1112 ALA A CB  1 
ATOM   2411  N N   . GLY A 1 317 ? -42.616 -9.294  -92.978  1.00 60.30  ? 1113 GLY A N   1 
ATOM   2412  C CA  . GLY A 1 317 ? -43.056 -9.655  -94.322  1.00 67.78  ? 1113 GLY A CA  1 
ATOM   2413  C C   . GLY A 1 317 ? -42.072 -10.538 -95.077  1.00 69.08  ? 1113 GLY A C   1 
ATOM   2414  O O   . GLY A 1 317 ? -42.225 -10.804 -96.273  1.00 67.78  ? 1113 GLY A O   1 
ATOM   2415  N N   . PHE A 1 318 ? -41.063 -10.999 -94.349  1.00 67.76  ? 1114 PHE A N   1 
ATOM   2416  C CA  . PHE A 1 318 ? -39.991 -11.852 -94.865  1.00 71.30  ? 1114 PHE A CA  1 
ATOM   2417  C C   . PHE A 1 318 ? -40.276 -13.351 -94.692  1.00 84.55  ? 1114 PHE A C   1 
ATOM   2418  O O   . PHE A 1 318 ? -39.363 -14.178 -94.768  1.00 88.41  ? 1114 PHE A O   1 
ATOM   2419  C CB  . PHE A 1 318 ? -38.633 -11.458 -94.276  1.00 71.37  ? 1114 PHE A CB  1 
ATOM   2420  C CG  . PHE A 1 318 ? -38.060 -10.193 -94.864  1.00 65.19  ? 1114 PHE A CG  1 
ATOM   2421  C CD1 . PHE A 1 318 ? -36.829 -10.201 -95.502  1.00 64.68  ? 1114 PHE A CD1 1 
ATOM   2422  C CD2 . PHE A 1 318 ? -38.760 -9.000  -94.795  1.00 69.94  ? 1114 PHE A CD2 1 
ATOM   2423  C CE1 . PHE A 1 318 ? -36.299 -9.038  -96.050  1.00 56.79  ? 1114 PHE A CE1 1 
ATOM   2424  C CE2 . PHE A 1 318 ? -38.240 -7.836  -95.343  1.00 66.61  ? 1114 PHE A CE2 1 
ATOM   2425  C CZ  . PHE A 1 318 ? -37.007 -7.856  -95.971  1.00 56.05  ? 1114 PHE A CZ  1 
ATOM   2426  N N   . THR A 1 319 ? -41.532 -13.687 -94.404  1.00 85.79  ? 1115 THR A N   1 
ATOM   2427  C CA  . THR A 1 319 ? -41.920 -15.035 -93.983  1.00 87.47  ? 1115 THR A CA  1 
ATOM   2428  C C   . THR A 1 319 ? -41.215 -16.139 -94.772  1.00 90.85  ? 1115 THR A C   1 
ATOM   2429  O O   . THR A 1 319 ? -40.762 -17.128 -94.186  1.00 93.62  ? 1115 THR A O   1 
ATOM   2430  C CB  . THR A 1 319 ? -43.443 -15.244 -94.149  1.00 86.36  ? 1115 THR A CB  1 
ATOM   2431  O OG1 . THR A 1 319 ? -44.156 -14.229 -93.431  1.00 80.24  ? 1115 THR A OG1 1 
ATOM   2432  C CG2 . THR A 1 319 ? -43.862 -16.620 -93.643  1.00 92.96  ? 1115 THR A CG2 1 
ATOM   2433  N N   . ASN A 1 320 ? -41.113 -15.976 -96.089  1.00 92.27  ? 1116 ASN A N   1 
ATOM   2434  C CA  . ASN A 1 320 ? -40.379 -16.941 -96.900  1.00 96.61  ? 1116 ASN A CA  1 
ATOM   2435  C C   . ASN A 1 320 ? -39.028 -17.252 -96.266  1.00 97.99  ? 1116 ASN A C   1 
ATOM   2436  O O   . ASN A 1 320 ? -38.628 -18.412 -96.160  1.00 107.77 ? 1116 ASN A O   1 
ATOM   2437  C CB  . ASN A 1 320 ? -40.157 -16.409 -98.315  1.00 97.38  ? 1116 ASN A CB  1 
ATOM   2438  C CG  . ASN A 1 320 ? -41.402 -16.469 -99.167  1.00 103.52 ? 1116 ASN A CG  1 
ATOM   2439  O OD1 . ASN A 1 320 ? -42.409 -17.063 -98.782  1.00 107.83 ? 1116 ASN A OD1 1 
ATOM   2440  N ND2 . ASN A 1 320 ? -41.331 -15.866 -100.348 1.00 98.28  ? 1116 ASN A ND2 1 
ATOM   2441  N N   . SER A 1 321 ? -38.338 -16.197 -95.845  1.00 90.86  ? 1117 SER A N   1 
ATOM   2442  C CA  . SER A 1 321 ? -37.026 -16.299 -95.218  1.00 87.24  ? 1117 SER A CA  1 
ATOM   2443  C C   . SER A 1 321 ? -37.105 -16.738 -93.759  1.00 79.15  ? 1117 SER A C   1 
ATOM   2444  O O   . SER A 1 321 ? -36.356 -17.618 -93.320  1.00 79.93  ? 1117 SER A O   1 
ATOM   2445  C CB  . SER A 1 321 ? -36.311 -14.949 -95.298  1.00 86.38  ? 1117 SER A CB  1 
ATOM   2446  O OG  . SER A 1 321 ? -36.124 -14.544 -96.644  1.00 82.97  ? 1117 SER A OG  1 
ATOM   2447  N N   . LEU A 1 322 ? -38.006 -16.112 -93.009  1.00 71.43  ? 1118 LEU A N   1 
ATOM   2448  C CA  . LEU A 1 322 ? -38.168 -16.428 -91.592  1.00 69.46  ? 1118 LEU A CA  1 
ATOM   2449  C C   . LEU A 1 322 ? -38.306 -17.935 -91.382  1.00 83.92  ? 1118 LEU A C   1 
ATOM   2450  O O   . LEU A 1 322 ? -37.709 -18.508 -90.462  1.00 77.53  ? 1118 LEU A O   1 
ATOM   2451  C CB  . LEU A 1 322 ? -39.389 -15.707 -91.019  1.00 68.15  ? 1118 LEU A CB  1 
ATOM   2452  C CG  . LEU A 1 322 ? -39.331 -14.179 -90.975  1.00 58.85  ? 1118 LEU A CG  1 
ATOM   2453  C CD1 . LEU A 1 322 ? -40.696 -13.583 -90.679  1.00 55.50  ? 1118 LEU A CD1 1 
ATOM   2454  C CD2 . LEU A 1 322 ? -38.306 -13.711 -89.959  1.00 53.66  ? 1118 LEU A CD2 1 
ATOM   2455  N N   . ARG A 1 323 ? -39.085 -18.565 -92.260  1.00 98.19  ? 1119 ARG A N   1 
ATOM   2456  C CA  . ARG A 1 323 ? -39.339 -20.002 -92.208  1.00 94.72  ? 1119 ARG A CA  1 
ATOM   2457  C C   . ARG A 1 323 ? -38.037 -20.785 -92.086  1.00 88.68  ? 1119 ARG A C   1 
ATOM   2458  O O   . ARG A 1 323 ? -37.867 -21.593 -91.172  1.00 86.05  ? 1119 ARG A O   1 
ATOM   2459  C CB  . ARG A 1 323 ? -40.073 -20.437 -93.477  1.00 95.51  ? 1119 ARG A CB  1 
ATOM   2460  C CG  . ARG A 1 323 ? -40.672 -21.827 -93.423  1.00 108.99 ? 1119 ARG A CG  1 
ATOM   2461  C CD  . ARG A 1 323 ? -40.899 -22.364 -94.829  1.00 128.84 ? 1119 ARG A CD  1 
ATOM   2462  N NE  . ARG A 1 323 ? -41.570 -21.393 -95.691  1.00 133.61 ? 1119 ARG A NE  1 
ATOM   2463  C CZ  . ARG A 1 323 ? -42.891 -21.284 -95.803  1.00 145.45 ? 1119 ARG A CZ  1 
ATOM   2464  N NH1 . ARG A 1 323 ? -43.686 -22.088 -95.104  1.00 156.80 ? 1119 ARG A NH1 1 
ATOM   2465  N NH2 . ARG A 1 323 ? -43.418 -20.372 -96.611  1.00 127.41 ? 1119 ARG A NH2 1 
ATOM   2466  N N   . MET A 1 324 ? -37.117 -20.529 -93.007  1.00 87.57  ? 1120 MET A N   1 
ATOM   2467  C CA  . MET A 1 324 ? -35.851 -21.241 -93.035  1.00 89.38  ? 1120 MET A CA  1 
ATOM   2468  C C   . MET A 1 324 ? -34.918 -20.794 -91.913  1.00 81.71  ? 1120 MET A C   1 
ATOM   2469  O O   . MET A 1 324 ? -34.169 -21.606 -91.364  1.00 81.15  ? 1120 MET A O   1 
ATOM   2470  C CB  . MET A 1 324 ? -35.191 -21.083 -94.402  1.00 88.60  ? 1120 MET A CB  1 
ATOM   2471  C CG  . MET A 1 324 ? -36.037 -21.630 -95.538  1.00 96.05  ? 1120 MET A CG  1 
ATOM   2472  S SD  . MET A 1 324 ? -35.414 -21.162 -97.159  1.00 160.19 ? 1120 MET A SD  1 
ATOM   2473  C CE  . MET A 1 324 ? -35.550 -19.381 -97.067  1.00 93.64  ? 1120 MET A CE  1 
ATOM   2474  N N   . LEU A 1 325 ? -34.962 -19.510 -91.563  1.00 74.99  ? 1121 LEU A N   1 
ATOM   2475  C CA  . LEU A 1 325 ? -34.141 -19.028 -90.456  1.00 66.81  ? 1121 LEU A CA  1 
ATOM   2476  C C   . LEU A 1 325 ? -34.473 -19.768 -89.179  1.00 65.04  ? 1121 LEU A C   1 
ATOM   2477  O O   . LEU A 1 325 ? -33.602 -19.992 -88.348  1.00 66.78  ? 1121 LEU A O   1 
ATOM   2478  C CB  . LEU A 1 325 ? -34.322 -17.530 -90.237  1.00 62.91  ? 1121 LEU A CB  1 
ATOM   2479  C CG  . LEU A 1 325 ? -33.375 -16.628 -91.027  1.00 62.81  ? 1121 LEU A CG  1 
ATOM   2480  C CD1 . LEU A 1 325 ? -33.752 -15.172 -90.825  1.00 55.50  ? 1121 LEU A CD1 1 
ATOM   2481  C CD2 . LEU A 1 325 ? -31.930 -16.879 -90.623  1.00 57.59  ? 1121 LEU A CD2 1 
ATOM   2482  N N   . GLN A 1 326 ? -35.740 -20.137 -89.023  1.00 70.98  ? 1122 GLN A N   1 
ATOM   2483  C CA  . GLN A 1 326 ? -36.168 -20.882 -87.843  1.00 75.60  ? 1122 GLN A CA  1 
ATOM   2484  C C   . GLN A 1 326 ? -35.825 -22.359 -87.968  1.00 81.49  ? 1122 GLN A C   1 
ATOM   2485  O O   . GLN A 1 326 ? -35.655 -23.060 -86.970  1.00 82.57  ? 1122 GLN A O   1 
ATOM   2486  C CB  . GLN A 1 326 ? -37.668 -20.721 -87.622  1.00 77.07  ? 1122 GLN A CB  1 
ATOM   2487  C CG  . GLN A 1 326 ? -38.185 -21.403 -86.369  1.00 72.33  ? 1122 GLN A CG  1 
ATOM   2488  C CD  . GLN A 1 326 ? -39.700 -21.386 -86.285  1.00 87.89  ? 1122 GLN A CD  1 
ATOM   2489  O OE1 . GLN A 1 326 ? -40.388 -21.139 -87.280  1.00 92.80  ? 1122 GLN A OE1 1 
ATOM   2490  N NE2 . GLN A 1 326 ? -40.231 -21.647 -85.094  1.00 83.53  ? 1122 GLN A NE2 1 
ATOM   2491  N N   . GLN A 1 327 ? -35.718 -22.824 -89.206  1.00 82.70  ? 1123 GLN A N   1 
ATOM   2492  C CA  . GLN A 1 327 ? -35.428 -24.226 -89.479  1.00 88.61  ? 1123 GLN A CA  1 
ATOM   2493  C C   . GLN A 1 327 ? -33.927 -24.481 -89.575  1.00 87.43  ? 1123 GLN A C   1 
ATOM   2494  O O   . GLN A 1 327 ? -33.493 -25.576 -89.935  1.00 92.60  ? 1123 GLN A O   1 
ATOM   2495  C CB  . GLN A 1 327 ? -36.154 -24.692 -90.743  1.00 93.99  ? 1123 GLN A CB  1 
ATOM   2496  C CG  . GLN A 1 327 ? -37.665 -24.635 -90.629  1.00 93.07  ? 1123 GLN A CG  1 
ATOM   2497  C CD  . GLN A 1 327 ? -38.363 -25.198 -91.850  1.00 109.70 ? 1123 GLN A CD  1 
ATOM   2498  O OE1 . GLN A 1 327 ? -37.716 -25.637 -92.803  1.00 121.55 ? 1123 GLN A OE1 1 
ATOM   2499  N NE2 . GLN A 1 327 ? -39.691 -25.190 -91.828  1.00 108.89 ? 1123 GLN A NE2 1 
ATOM   2500  N N   . LYS A 1 328 ? -33.146 -23.449 -89.278  1.00 82.73  ? 1124 LYS A N   1 
ATOM   2501  C CA  . LYS A 1 328 ? -31.694 -23.563 -89.234  1.00 79.20  ? 1124 LYS A CA  1 
ATOM   2502  C C   . LYS A 1 328 ? -31.089 -23.836 -90.609  1.00 82.78  ? 1124 LYS A C   1 
ATOM   2503  O O   . LYS A 1 328 ? -29.991 -24.384 -90.709  1.00 86.02  ? 1124 LYS A O   1 
ATOM   2504  C CB  . LYS A 1 328 ? -31.278 -24.663 -88.250  1.00 76.98  ? 1124 LYS A CB  1 
ATOM   2505  C CG  . LYS A 1 328 ? -31.616 -24.369 -86.789  1.00 83.80  ? 1124 LYS A CG  1 
ATOM   2506  C CD  . LYS A 1 328 ? -30.626 -23.377 -86.183  1.00 92.04  ? 1124 LYS A CD  1 
ATOM   2507  C CE  . LYS A 1 328 ? -30.875 -23.144 -84.693  1.00 93.17  ? 1124 LYS A CE  1 
ATOM   2508  N NZ  . LYS A 1 328 ? -32.206 -22.523 -84.424  1.00 97.77  ? 1124 LYS A NZ  1 
ATOM   2509  N N   . ARG A 1 329 ? -31.794 -23.439 -91.666  1.00 79.83  ? 1125 ARG A N   1 
ATOM   2510  C CA  . ARG A 1 329 ? -31.261 -23.571 -93.018  1.00 85.36  ? 1125 ARG A CA  1 
ATOM   2511  C C   . ARG A 1 329 ? -30.763 -22.212 -93.486  1.00 83.59  ? 1125 ARG A C   1 
ATOM   2512  O O   . ARG A 1 329 ? -31.555 -21.350 -93.861  1.00 84.35  ? 1125 ARG A O   1 
ATOM   2513  C CB  . ARG A 1 329 ? -32.353 -24.070 -93.964  1.00 93.56  ? 1125 ARG A CB  1 
ATOM   2514  C CG  . ARG A 1 329 ? -33.071 -25.319 -93.479  1.00 98.61  ? 1125 ARG A CG  1 
ATOM   2515  C CD  . ARG A 1 329 ? -34.449 -25.462 -94.121  1.00 111.69 ? 1125 ARG A CD  1 
ATOM   2516  N NE  . ARG A 1 329 ? -34.390 -25.749 -95.554  1.00 121.79 ? 1125 ARG A NE  1 
ATOM   2517  C CZ  . ARG A 1 329 ? -35.460 -25.961 -96.315  1.00 119.67 ? 1125 ARG A CZ  1 
ATOM   2518  N NH1 . ARG A 1 329 ? -36.673 -25.917 -95.780  1.00 117.65 ? 1125 ARG A NH1 1 
ATOM   2519  N NH2 . ARG A 1 329 ? -35.322 -26.218 -97.609  1.00 115.72 ? 1125 ARG A NH2 1 
ATOM   2520  N N   . TRP A 1 330 ? -29.444 -22.047 -93.520  1.00 81.42  ? 1126 TRP A N   1 
ATOM   2521  C CA  . TRP A 1 330 ? -28.842 -20.723 -93.669  1.00 79.34  ? 1126 TRP A CA  1 
ATOM   2522  C C   . TRP A 1 330 ? -28.687 -20.266 -95.119  1.00 82.53  ? 1126 TRP A C   1 
ATOM   2523  O O   . TRP A 1 330 ? -29.295 -19.275 -95.525  1.00 83.01  ? 1126 TRP A O   1 
ATOM   2524  C CB  . TRP A 1 330 ? -27.493 -20.651 -92.949  1.00 73.25  ? 1126 TRP A CB  1 
ATOM   2525  C CG  . TRP A 1 330 ? -27.528 -21.193 -91.557  1.00 72.80  ? 1126 TRP A CG  1 
ATOM   2526  C CD1 . TRP A 1 330 ? -26.830 -22.261 -91.081  1.00 85.06  ? 1126 TRP A CD1 1 
ATOM   2527  C CD2 . TRP A 1 330 ? -28.301 -20.699 -90.458  1.00 70.24  ? 1126 TRP A CD2 1 
ATOM   2528  N NE1 . TRP A 1 330 ? -27.116 -22.461 -89.753  1.00 84.58  ? 1126 TRP A NE1 1 
ATOM   2529  C CE2 . TRP A 1 330 ? -28.018 -21.514 -89.346  1.00 72.61  ? 1126 TRP A CE2 1 
ATOM   2530  C CE3 . TRP A 1 330 ? -29.203 -19.644 -90.304  1.00 77.68  ? 1126 TRP A CE3 1 
ATOM   2531  C CZ2 . TRP A 1 330 ? -28.604 -21.314 -88.101  1.00 71.64  ? 1126 TRP A CZ2 1 
ATOM   2532  C CZ3 . TRP A 1 330 ? -29.786 -19.444 -89.061  1.00 76.45  ? 1126 TRP A CZ3 1 
ATOM   2533  C CH2 . TRP A 1 330 ? -29.482 -20.275 -87.977  1.00 73.32  ? 1126 TRP A CH2 1 
ATOM   2534  N N   . ASP A 1 331 ? -27.866 -20.974 -95.892  1.00 86.98  ? 1127 ASP A N   1 
ATOM   2535  C CA  . ASP A 1 331 ? -27.582 -20.570 -97.268  1.00 87.72  ? 1127 ASP A CA  1 
ATOM   2536  C C   . ASP A 1 331 ? -28.873 -20.281 -98.025  1.00 87.75  ? 1127 ASP A C   1 
ATOM   2537  O O   . ASP A 1 331 ? -28.925 -19.386 -98.873  1.00 92.92  ? 1127 ASP A O   1 
ATOM   2538  C CB  . ASP A 1 331 ? -26.778 -21.646 -98.004  1.00 92.78  ? 1127 ASP A CB  1 
ATOM   2539  C CG  . ASP A 1 331 ? -25.401 -21.867 -97.405  1.00 99.10  ? 1127 ASP A CG  1 
ATOM   2540  O OD1 . ASP A 1 331 ? -25.297 -21.974 -96.164  1.00 101.08 ? 1127 ASP A OD1 1 
ATOM   2541  O OD2 . ASP A 1 331 ? -24.421 -21.931 -98.180  1.00 97.04  ? 1127 ASP A OD2 1 
ATOM   2542  N N   . GLU A 1 332 ? -29.918 -21.035 -97.701  1.00 86.14  ? 1128 GLU A N   1 
ATOM   2543  C CA  . GLU A 1 332 ? -31.210 -20.874 -98.350  1.00 90.20  ? 1128 GLU A CA  1 
ATOM   2544  C C   . GLU A 1 332 ? -31.914 -19.601 -97.880  1.00 88.44  ? 1128 GLU A C   1 
ATOM   2545  O O   . GLU A 1 332 ? -32.566 -18.912 -98.668  1.00 88.60  ? 1128 GLU A O   1 
ATOM   2546  C CB  . GLU A 1 332 ? -32.078 -22.107 -98.102  1.00 100.27 ? 1128 GLU A CB  1 
ATOM   2547  C CG  . GLU A 1 332 ? -31.372 -23.408 -98.437  1.00 107.50 ? 1128 GLU A CG  1 
ATOM   2548  C CD  . GLU A 1 332 ? -32.249 -24.622 -98.231  1.00 111.21 ? 1128 GLU A CD  1 
ATOM   2549  O OE1 . GLU A 1 332 ? -33.487 -24.463 -98.212  1.00 109.29 ? 1128 GLU A OE1 1 
ATOM   2550  O OE2 . GLU A 1 332 ? -31.699 -25.734 -98.086  1.00 110.79 ? 1128 GLU A OE2 1 
ATOM   2551  N N   . ALA A 1 333 ? -31.780 -19.296 -96.594  1.00 87.96  ? 1129 ALA A N   1 
ATOM   2552  C CA  . ALA A 1 333 ? -32.297 -18.047 -96.050  1.00 79.85  ? 1129 ALA A CA  1 
ATOM   2553  C C   . ALA A 1 333 ? -31.654 -16.870 -96.765  1.00 74.21  ? 1129 ALA A C   1 
ATOM   2554  O O   . ALA A 1 333 ? -32.342 -16.012 -97.321  1.00 73.29  ? 1129 ALA A O   1 
ATOM   2555  C CB  . ALA A 1 333 ? -32.029 -17.968 -94.559  1.00 72.09  ? 1129 ALA A CB  1 
ATOM   2556  N N   . ALA A 1 334 ? -30.325 -16.840 -96.750  1.00 78.71  ? 1130 ALA A N   1 
ATOM   2557  C CA  . ALA A 1 334 ? -29.576 -15.775 -97.406  1.00 77.30  ? 1130 ALA A CA  1 
ATOM   2558  C C   . ALA A 1 334 ? -30.011 -15.628 -98.859  1.00 81.54  ? 1130 ALA A C   1 
ATOM   2559  O O   . ALA A 1 334 ? -30.353 -14.530 -99.299  1.00 82.36  ? 1130 ALA A O   1 
ATOM   2560  C CB  . ALA A 1 334 ? -28.079 -16.041 -97.322  1.00 67.95  ? 1130 ALA A CB  1 
ATOM   2561  N N   . VAL A 1 335 ? -30.009 -16.734 -99.601  1.00 85.99  ? 1131 VAL A N   1 
ATOM   2562  C CA  . VAL A 1 335 ? -30.470 -16.700 -100.986 1.00 84.44  ? 1131 VAL A CA  1 
ATOM   2563  C C   . VAL A 1 335 ? -31.854 -16.069 -101.095 1.00 83.93  ? 1131 VAL A C   1 
ATOM   2564  O O   . VAL A 1 335 ? -32.115 -15.283 -102.005 1.00 81.82  ? 1131 VAL A O   1 
ATOM   2565  C CB  . VAL A 1 335 ? -30.513 -18.107 -101.613 1.00 89.90  ? 1131 VAL A CB  1 
ATOM   2566  C CG1 . VAL A 1 335 ? -31.385 -18.103 -102.860 1.00 87.65  ? 1131 VAL A CG1 1 
ATOM   2567  C CG2 . VAL A 1 335 ? -29.105 -18.587 -101.935 1.00 88.19  ? 1131 VAL A CG2 1 
ATOM   2568  N N   . ASN A 1 336 ? -32.737 -16.413 -100.163 1.00 91.62  ? 1132 ASN A N   1 
ATOM   2569  C CA  . ASN A 1 336 ? -34.100 -15.895 -100.182 1.00 93.24  ? 1132 ASN A CA  1 
ATOM   2570  C C   . ASN A 1 336 ? -34.143 -14.392 -99.933  1.00 89.31  ? 1132 ASN A C   1 
ATOM   2571  O O   . ASN A 1 336 ? -35.014 -13.696 -100.455 1.00 86.64  ? 1132 ASN A O   1 
ATOM   2572  C CB  . ASN A 1 336 ? -34.969 -16.622 -99.152  1.00 98.78  ? 1132 ASN A CB  1 
ATOM   2573  C CG  . ASN A 1 336 ? -36.270 -17.131 -99.743  1.00 109.65 ? 1132 ASN A CG  1 
ATOM   2574  O OD1 . ASN A 1 336 ? -37.271 -16.411 -99.791  1.00 111.88 ? 1132 ASN A OD1 1 
ATOM   2575  N ND2 . ASN A 1 336 ? -36.263 -18.381 -100.196 1.00 118.59 ? 1132 ASN A ND2 1 
ATOM   2576  N N   . LEU A 1 337 ? -33.200 -13.902 -99.131  1.00 88.20  ? 1133 LEU A N   1 
ATOM   2577  C CA  . LEU A 1 337 ? -33.130 -12.481 -98.783  1.00 87.48  ? 1133 LEU A CA  1 
ATOM   2578  C C   . LEU A 1 337 ? -32.491 -11.614 -99.872  1.00 80.31  ? 1133 LEU A C   1 
ATOM   2579  O O   . LEU A 1 337 ? -32.868 -10.456 -100.060 1.00 69.91  ? 1133 LEU A O   1 
ATOM   2580  C CB  . LEU A 1 337 ? -32.371 -12.298 -97.468  1.00 81.25  ? 1133 LEU A CB  1 
ATOM   2581  C CG  . LEU A 1 337 ? -32.940 -13.028 -96.252  1.00 77.54  ? 1133 LEU A CG  1 
ATOM   2582  C CD1 . LEU A 1 337 ? -31.914 -13.069 -95.142  1.00 84.26  ? 1133 LEU A CD1 1 
ATOM   2583  C CD2 . LEU A 1 337 ? -34.218 -12.371 -95.771  1.00 73.51  ? 1133 LEU A CD2 1 
ATOM   2584  N N   . ALA A 1 338 ? -31.517 -12.176 -100.577 1.00 81.57  ? 1134 ALA A N   1 
ATOM   2585  C CA  . ALA A 1 338 ? -30.810 -11.436 -101.614 1.00 79.62  ? 1134 ALA A CA  1 
ATOM   2586  C C   . ALA A 1 338 ? -31.753 -11.005 -102.735 1.00 83.73  ? 1134 ALA A C   1 
ATOM   2587  O O   . ALA A 1 338 ? -31.477 -10.057 -103.468 1.00 83.80  ? 1134 ALA A O   1 
ATOM   2588  C CB  . ALA A 1 338 ? -29.672 -12.276 -102.173 1.00 78.51  ? 1134 ALA A CB  1 
ATOM   2589  N N   . LYS A 1 339 ? -32.874 -11.701 -102.863 1.00 84.06  ? 1135 LYS A N   1 
ATOM   2590  C CA  . LYS A 1 339 ? -33.785 -11.455 -103.971 1.00 84.90  ? 1135 LYS A CA  1 
ATOM   2591  C C   . LYS A 1 339 ? -34.835 -10.391 -103.644 1.00 85.47  ? 1135 LYS A C   1 
ATOM   2592  O O   . LYS A 1 339 ? -35.662 -10.048 -104.492 1.00 89.92  ? 1135 LYS A O   1 
ATOM   2593  C CB  . LYS A 1 339 ? -34.456 -12.766 -104.405 1.00 93.53  ? 1135 LYS A CB  1 
ATOM   2594  C CG  . LYS A 1 339 ? -33.465 -13.869 -104.789 1.00 95.21  ? 1135 LYS A CG  1 
ATOM   2595  C CD  . LYS A 1 339 ? -34.152 -15.180 -105.173 1.00 84.81  ? 1135 LYS A CD  1 
ATOM   2596  C CE  . LYS A 1 339 ? -33.132 -16.203 -105.670 1.00 81.94  ? 1135 LYS A CE  1 
ATOM   2597  N NZ  . LYS A 1 339 ? -33.753 -17.459 -106.174 1.00 73.61  ? 1135 LYS A NZ  1 
ATOM   2598  N N   . SER A 1 340 ? -34.797 -9.860  -102.423 1.00 78.32  ? 1136 SER A N   1 
ATOM   2599  C CA  . SER A 1 340 ? -35.812 -8.901  -101.981 1.00 78.51  ? 1136 SER A CA  1 
ATOM   2600  C C   . SER A 1 340 ? -35.446 -7.443  -102.288 1.00 77.44  ? 1136 SER A C   1 
ATOM   2601  O O   . SER A 1 340 ? -34.349 -7.155  -102.769 1.00 81.00  ? 1136 SER A O   1 
ATOM   2602  C CB  . SER A 1 340 ? -36.071 -9.070  -100.487 1.00 74.88  ? 1136 SER A CB  1 
ATOM   2603  O OG  . SER A 1 340 ? -34.858 -9.003  -99.758  1.00 74.65  ? 1136 SER A OG  1 
ATOM   2604  N N   . ARG A 1 341 ? -36.362 -6.525  -101.991 1.00 70.92  ? 1137 ARG A N   1 
ATOM   2605  C CA  . ARG A 1 341 ? -36.158 -5.114  -102.309 1.00 71.92  ? 1137 ARG A CA  1 
ATOM   2606  C C   . ARG A 1 341 ? -35.224 -4.472  -101.292 1.00 72.85  ? 1137 ARG A C   1 
ATOM   2607  O O   . ARG A 1 341 ? -34.522 -3.498  -101.586 1.00 79.28  ? 1137 ARG A O   1 
ATOM   2608  C CB  . ARG A 1 341 ? -37.503 -4.377  -102.406 1.00 69.72  ? 1137 ARG A CB  1 
ATOM   2609  C CG  . ARG A 1 341 ? -37.811 -3.413  -101.274 1.00 75.57  ? 1137 ARG A CG  1 
ATOM   2610  C CD  . ARG A 1 341 ? -39.148 -2.713  -101.524 1.00 81.74  ? 1137 ARG A CD  1 
ATOM   2611  N NE  . ARG A 1 341 ? -39.417 -1.644  -100.560 1.00 97.19  ? 1137 ARG A NE  1 
ATOM   2612  C CZ  . ARG A 1 341 ? -40.411 -0.765  -100.669 1.00 95.21  ? 1137 ARG A CZ  1 
ATOM   2613  N NH1 . ARG A 1 341 ? -41.238 -0.820  -101.706 1.00 95.25  ? 1137 ARG A NH1 1 
ATOM   2614  N NH2 . ARG A 1 341 ? -40.577 0.175   -99.745  1.00 85.51  ? 1137 ARG A NH2 1 
ATOM   2615  N N   . TRP A 1 342 ? -35.211 -5.053  -100.099 1.00 66.38  ? 1138 TRP A N   1 
ATOM   2616  C CA  . TRP A 1 342 ? -34.301 -4.650  -99.038  1.00 73.51  ? 1138 TRP A CA  1 
ATOM   2617  C C   . TRP A 1 342 ? -32.862 -4.604  -99.546  1.00 76.44  ? 1138 TRP A C   1 
ATOM   2618  O O   . TRP A 1 342 ? -32.240 -3.542  -99.583  1.00 79.86  ? 1138 TRP A O   1 
ATOM   2619  C CB  . TRP A 1 342 ? -34.425 -5.628  -97.867  1.00 75.97  ? 1138 TRP A CB  1 
ATOM   2620  C CG  . TRP A 1 342 ? -33.561 -5.319  -96.677  1.00 74.58  ? 1138 TRP A CG  1 
ATOM   2621  C CD1 . TRP A 1 342 ? -33.543 -4.162  -95.957  1.00 71.83  ? 1138 TRP A CD1 1 
ATOM   2622  C CD2 . TRP A 1 342 ? -32.621 -6.198  -96.047  1.00 71.49  ? 1138 TRP A CD2 1 
ATOM   2623  N NE1 . TRP A 1 342 ? -32.637 -4.256  -94.927  1.00 64.56  ? 1138 TRP A NE1 1 
ATOM   2624  C CE2 . TRP A 1 342 ? -32.057 -5.498  -94.959  1.00 65.03  ? 1138 TRP A CE2 1 
ATOM   2625  C CE3 . TRP A 1 342 ? -32.194 -7.507  -96.299  1.00 70.46  ? 1138 TRP A CE3 1 
ATOM   2626  C CZ2 . TRP A 1 342 ? -31.093 -6.059  -94.128  1.00 64.61  ? 1138 TRP A CZ2 1 
ATOM   2627  C CZ3 . TRP A 1 342 ? -31.234 -8.062  -95.473  1.00 68.84  ? 1138 TRP A CZ3 1 
ATOM   2628  C CH2 . TRP A 1 342 ? -30.695 -7.339  -94.401  1.00 69.27  ? 1138 TRP A CH2 1 
ATOM   2629  N N   . TYR A 1 343 ? -32.344 -5.763  -99.937  1.00 71.51  ? 1139 TYR A N   1 
ATOM   2630  C CA  . TYR A 1 343 ? -30.981 -5.878  -100.443 1.00 72.45  ? 1139 TYR A CA  1 
ATOM   2631  C C   . TYR A 1 343 ? -30.715 -4.876  -101.561 1.00 75.60  ? 1139 TYR A C   1 
ATOM   2632  O O   . TYR A 1 343 ? -29.597 -4.382  -101.717 1.00 73.41  ? 1139 TYR A O   1 
ATOM   2633  C CB  . TYR A 1 343 ? -30.729 -7.301  -100.938 1.00 74.46  ? 1139 TYR A CB  1 
ATOM   2634  C CG  . TYR A 1 343 ? -29.339 -7.529  -101.478 1.00 79.02  ? 1139 TYR A CG  1 
ATOM   2635  C CD1 . TYR A 1 343 ? -28.315 -7.961  -100.649 1.00 83.04  ? 1139 TYR A CD1 1 
ATOM   2636  C CD2 . TYR A 1 343 ? -29.049 -7.318  -102.820 1.00 83.91  ? 1139 TYR A CD2 1 
ATOM   2637  C CE1 . TYR A 1 343 ? -27.036 -8.174  -101.139 1.00 89.46  ? 1139 TYR A CE1 1 
ATOM   2638  C CE2 . TYR A 1 343 ? -27.774 -7.530  -103.319 1.00 87.87  ? 1139 TYR A CE2 1 
ATOM   2639  C CZ  . TYR A 1 343 ? -26.771 -7.958  -102.475 1.00 88.22  ? 1139 TYR A CZ  1 
ATOM   2640  O OH  . TYR A 1 343 ? -25.500 -8.173  -102.965 1.00 82.04  ? 1139 TYR A OH  1 
ATOM   2641  N N   . ASN A 1 344 ? -31.758 -4.582  -102.330 1.00 78.81  ? 1140 ASN A N   1 
ATOM   2642  C CA  . ASN A 1 344 ? -31.658 -3.685  -103.477 1.00 81.07  ? 1140 ASN A CA  1 
ATOM   2643  C C   . ASN A 1 344 ? -31.460 -2.221  -103.074 1.00 72.40  ? 1140 ASN A C   1 
ATOM   2644  O O   . ASN A 1 344 ? -30.717 -1.481  -103.726 1.00 61.91  ? 1140 ASN A O   1 
ATOM   2645  C CB  . ASN A 1 344 ? -32.910 -3.829  -104.350 1.00 84.52  ? 1140 ASN A CB  1 
ATOM   2646  C CG  . ASN A 1 344 ? -32.682 -3.387  -105.779 1.00 86.33  ? 1140 ASN A CG  1 
ATOM   2647  O OD1 . ASN A 1 344 ? -33.076 -4.077  -106.723 1.00 83.11  ? 1140 ASN A OD1 1 
ATOM   2648  N ND2 . ASN A 1 344 ? -32.042 -2.235  -105.948 1.00 86.86  ? 1140 ASN A ND2 1 
ATOM   2649  N N   . GLN A 1 345 ? -32.135 -1.814  -102.000 1.00 71.43  ? 1141 GLN A N   1 
ATOM   2650  C CA  . GLN A 1 345 ? -32.060 -0.437  -101.509 1.00 72.20  ? 1141 GLN A CA  1 
ATOM   2651  C C   . GLN A 1 345 ? -30.683 -0.060  -100.952 1.00 74.28  ? 1141 GLN A C   1 
ATOM   2652  O O   . GLN A 1 345 ? -30.096 0.945   -101.352 1.00 70.91  ? 1141 GLN A O   1 
ATOM   2653  C CB  . GLN A 1 345 ? -33.137 -0.192  -100.448 1.00 72.50  ? 1141 GLN A CB  1 
ATOM   2654  C CG  . GLN A 1 345 ? -34.549 -0.522  -100.909 1.00 73.89  ? 1141 GLN A CG  1 
ATOM   2655  C CD  . GLN A 1 345 ? -34.999 0.328   -102.086 1.00 88.92  ? 1141 GLN A CD  1 
ATOM   2656  O OE1 . GLN A 1 345 ? -35.590 -0.177  -103.042 1.00 90.01  ? 1141 GLN A OE1 1 
ATOM   2657  N NE2 . GLN A 1 345 ? -34.729 1.627   -102.017 1.00 97.46  ? 1141 GLN A NE2 1 
ATOM   2658  N N   . THR A 1 346 ? -30.190 -0.853  -100.005 1.00 74.54  ? 1142 THR A N   1 
ATOM   2659  C CA  . THR A 1 346 ? -28.855 -0.661  -99.441  1.00 69.90  ? 1142 THR A CA  1 
ATOM   2660  C C   . THR A 1 346 ? -28.126 -1.999  -99.304  1.00 73.39  ? 1142 THR A C   1 
ATOM   2661  O O   . THR A 1 346 ? -28.177 -2.633  -98.249  1.00 71.18  ? 1142 THR A O   1 
ATOM   2662  C CB  . THR A 1 346 ? -28.909 0.043   -98.076  1.00 69.89  ? 1142 THR A CB  1 
ATOM   2663  O OG1 . THR A 1 346 ? -29.835 -0.635  -97.221  1.00 65.35  ? 1142 THR A OG1 1 
ATOM   2664  C CG2 . THR A 1 346 ? -29.356 1.483   -98.239  1.00 76.16  ? 1142 THR A CG2 1 
ATOM   2665  N N   . PRO A 1 347 ? -27.440 -2.426  -100.376 1.00 73.57  ? 1143 PRO A N   1 
ATOM   2666  C CA  . PRO A 1 347 ? -26.829 -3.759  -100.486 1.00 76.38  ? 1143 PRO A CA  1 
ATOM   2667  C C   . PRO A 1 347 ? -25.704 -4.049  -99.486  1.00 76.96  ? 1143 PRO A C   1 
ATOM   2668  O O   . PRO A 1 347 ? -25.621 -5.169  -98.992  1.00 67.74  ? 1143 PRO A O   1 
ATOM   2669  C CB  . PRO A 1 347 ? -26.285 -3.777  -101.919 1.00 69.09  ? 1143 PRO A CB  1 
ATOM   2670  C CG  . PRO A 1 347 ? -26.056 -2.343  -102.246 1.00 74.94  ? 1143 PRO A CG  1 
ATOM   2671  C CD  . PRO A 1 347 ? -27.150 -1.589  -101.552 1.00 69.77  ? 1143 PRO A CD  1 
ATOM   2672  N N   . ASN A 1 348 ? -24.854 -3.068  -99.200  1.00 82.89  ? 1144 ASN A N   1 
ATOM   2673  C CA  . ASN A 1 348 ? -23.715 -3.286  -98.309  1.00 78.45  ? 1144 ASN A CA  1 
ATOM   2674  C C   . ASN A 1 348 ? -24.149 -3.724  -96.915  1.00 73.10  ? 1144 ASN A C   1 
ATOM   2675  O O   . ASN A 1 348 ? -23.782 -4.804  -96.439  1.00 71.43  ? 1144 ASN A O   1 
ATOM   2676  C CB  . ASN A 1 348 ? -22.875 -2.011  -98.189  1.00 91.49  ? 1144 ASN A CB  1 
ATOM   2677  C CG  . ASN A 1 348 ? -22.268 -1.571  -99.511  1.00 97.33  ? 1144 ASN A CG  1 
ATOM   2678  O OD1 . ASN A 1 348 ? -21.961 -2.395  -100.373 1.00 97.15  ? 1144 ASN A OD1 1 
ATOM   2679  N ND2 . ASN A 1 348 ? -22.079 -0.264  -99.669  1.00 97.44  ? 1144 ASN A ND2 1 
ATOM   2680  N N   . ARG A 1 349 ? -24.943 -2.878  -96.269  1.00 74.12  ? 1145 ARG A N   1 
ATOM   2681  C CA  . ARG A 1 349 ? -25.397 -3.138  -94.914  1.00 69.90  ? 1145 ARG A CA  1 
ATOM   2682  C C   . ARG A 1 349 ? -25.994 -4.531  -94.855  1.00 66.51  ? 1145 ARG A C   1 
ATOM   2683  O O   . ARG A 1 349 ? -25.554 -5.386  -94.082  1.00 70.36  ? 1145 ARG A O   1 
ATOM   2684  C CB  . ARG A 1 349 ? -26.452 -2.101  -94.518  1.00 65.56  ? 1145 ARG A CB  1 
ATOM   2685  C CG  . ARG A 1 349 ? -26.895 -2.173  -93.066  1.00 64.54  ? 1145 ARG A CG  1 
ATOM   2686  C CD  . ARG A 1 349 ? -28.343 -1.748  -92.926  1.00 54.24  ? 1145 ARG A CD  1 
ATOM   2687  N NE  . ARG A 1 349 ? -28.791 -1.773  -91.540  1.00 49.53  ? 1145 ARG A NE  1 
ATOM   2688  C CZ  . ARG A 1 349 ? -28.948 -0.687  -90.796  1.00 54.95  ? 1145 ARG A CZ  1 
ATOM   2689  N NH1 . ARG A 1 349 ? -28.693 0.505   -91.313  1.00 57.14  ? 1145 ARG A NH1 1 
ATOM   2690  N NH2 . ARG A 1 349 ? -29.364 -0.791  -89.540  1.00 58.76  ? 1145 ARG A NH2 1 
ATOM   2691  N N   . ALA A 1 350 ? -26.983 -4.754  -95.711  1.00 64.65  ? 1146 ALA A N   1 
ATOM   2692  C CA  . ALA A 1 350 ? -27.700 -6.021  -95.758  1.00 71.49  ? 1146 ALA A CA  1 
ATOM   2693  C C   . ALA A 1 350 ? -26.761 -7.208  -95.950  1.00 69.88  ? 1146 ALA A C   1 
ATOM   2694  O O   . ALA A 1 350 ? -26.948 -8.253  -95.342  1.00 60.62  ? 1146 ALA A O   1 
ATOM   2695  C CB  . ALA A 1 350 ? -28.740 -5.992  -96.860  1.00 80.47  ? 1146 ALA A CB  1 
ATOM   2696  N N   . LYS A 1 351 ? -25.758 -7.030  -96.805  1.00 74.96  ? 1147 LYS A N   1 
ATOM   2697  C CA  . LYS A 1 351 ? -24.753 -8.053  -97.086  1.00 71.93  ? 1147 LYS A CA  1 
ATOM   2698  C C   . LYS A 1 351 ? -24.000 -8.411  -95.803  1.00 69.77  ? 1147 LYS A C   1 
ATOM   2699  O O   . LYS A 1 351 ? -23.741 -9.588  -95.526  1.00 69.33  ? 1147 LYS A O   1 
ATOM   2700  C CB  . LYS A 1 351 ? -23.793 -7.539  -98.166  1.00 73.38  ? 1147 LYS A CB  1 
ATOM   2701  C CG  . LYS A 1 351 ? -22.898 -8.582  -98.829  1.00 63.23  ? 1147 LYS A CG  1 
ATOM   2702  C CD  . LYS A 1 351 ? -22.150 -7.955  -100.015 1.00 56.39  ? 1147 LYS A CD  1 
ATOM   2703  C CE  . LYS A 1 351 ? -21.013 -8.832  -100.529 1.00 36.54  ? 1147 LYS A CE  1 
ATOM   2704  N NZ  . LYS A 1 351 ? -20.275 -8.189  -101.657 1.00 28.99  ? 1147 LYS A NZ  1 
ATOM   2705  N N   . ARG A 1 352 ? -23.667 -7.394  -95.013  1.00 71.22  ? 1148 ARG A N   1 
ATOM   2706  C CA  . ARG A 1 352 ? -23.046 -7.633  -93.713  1.00 63.77  ? 1148 ARG A CA  1 
ATOM   2707  C C   . ARG A 1 352 ? -23.987 -8.392  -92.772  1.00 62.30  ? 1148 ARG A C   1 
ATOM   2708  O O   . ARG A 1 352 ? -23.581 -9.374  -92.139  1.00 64.35  ? 1148 ARG A O   1 
ATOM   2709  C CB  . ARG A 1 352 ? -22.565 -6.322  -93.087  1.00 62.30  ? 1148 ARG A CB  1 
ATOM   2710  C CG  . ARG A 1 352 ? -21.398 -5.692  -93.844  1.00 66.21  ? 1148 ARG A CG  1 
ATOM   2711  C CD  . ARG A 1 352 ? -20.856 -4.448  -93.142  1.00 74.92  ? 1148 ARG A CD  1 
ATOM   2712  N NE  . ARG A 1 352 ? -21.791 -3.322  -93.165  1.00 73.93  ? 1148 ARG A NE  1 
ATOM   2713  C CZ  . ARG A 1 352 ? -21.777 -2.352  -94.077  1.00 77.04  ? 1148 ARG A CZ  1 
ATOM   2714  N NH1 . ARG A 1 352 ? -20.879 -2.363  -95.054  1.00 83.78  ? 1148 ARG A NH1 1 
ATOM   2715  N NH2 . ARG A 1 352 ? -22.663 -1.368  -94.015  1.00 74.25  ? 1148 ARG A NH2 1 
ATOM   2716  N N   . VAL A 1 353 ? -25.245 -7.957  -92.704  1.00 58.47  ? 1149 VAL A N   1 
ATOM   2717  C CA  . VAL A 1 353 ? -26.235 -8.604  -91.840  1.00 59.48  ? 1149 VAL A CA  1 
ATOM   2718  C C   . VAL A 1 353 ? -26.396 -10.077 -92.192  1.00 62.52  ? 1149 VAL A C   1 
ATOM   2719  O O   . VAL A 1 353 ? -26.405 -10.954 -91.320  1.00 65.38  ? 1149 VAL A O   1 
ATOM   2720  C CB  . VAL A 1 353 ? -27.629 -7.946  -91.962  1.00 56.51  ? 1149 VAL A CB  1 
ATOM   2721  C CG1 . VAL A 1 353 ? -28.616 -8.635  -91.037  1.00 52.64  ? 1149 VAL A CG1 1 
ATOM   2722  C CG2 . VAL A 1 353 ? -27.560 -6.460  -91.652  1.00 59.56  ? 1149 VAL A CG2 1 
ATOM   2723  N N   . ILE A 1 354 ? -26.525 -10.335 -93.485  1.00 60.92  ? 1150 ILE A N   1 
ATOM   2724  C CA  . ILE A 1 354 ? -26.778 -11.668 -94.000  1.00 62.49  ? 1150 ILE A CA  1 
ATOM   2725  C C   . ILE A 1 354 ? -25.580 -12.561 -93.754  1.00 55.60  ? 1150 ILE A C   1 
ATOM   2726  O O   . ILE A 1 354 ? -25.722 -13.673 -93.254  1.00 52.74  ? 1150 ILE A O   1 
ATOM   2727  C CB  . ILE A 1 354 ? -27.087 -11.629 -95.504  1.00 60.16  ? 1150 ILE A CB  1 
ATOM   2728  C CG1 . ILE A 1 354 ? -28.288 -10.721 -95.772  1.00 60.85  ? 1150 ILE A CG1 1 
ATOM   2729  C CG2 . ILE A 1 354 ? -27.363 -13.024 -96.025  1.00 57.11  ? 1150 ILE A CG2 1 
ATOM   2730  C CD1 . ILE A 1 354 ? -28.560 -10.477 -97.231  1.00 60.81  ? 1150 ILE A CD1 1 
ATOM   2731  N N   . THR A 1 355 ? -24.397 -12.077 -94.106  1.00 52.10  ? 1151 THR A N   1 
ATOM   2732  C CA  . THR A 1 355 ? -23.199 -12.843 -93.825  1.00 60.86  ? 1151 THR A CA  1 
ATOM   2733  C C   . THR A 1 355 ? -23.224 -13.240 -92.357  1.00 66.90  ? 1151 THR A C   1 
ATOM   2734  O O   . THR A 1 355 ? -23.003 -14.410 -92.006  1.00 69.45  ? 1151 THR A O   1 
ATOM   2735  C CB  . THR A 1 355 ? -21.926 -12.039 -94.122  1.00 65.75  ? 1151 THR A CB  1 
ATOM   2736  O OG1 . THR A 1 355 ? -21.955 -11.593 -95.483  1.00 70.30  ? 1151 THR A OG1 1 
ATOM   2737  C CG2 . THR A 1 355 ? -20.696 -12.909 -93.907  1.00 71.88  ? 1151 THR A CG2 1 
ATOM   2738  N N   . THR A 1 356 ? -23.515 -12.259 -91.503  1.00 67.87  ? 1152 THR A N   1 
ATOM   2739  C CA  . THR A 1 356 ? -23.672 -12.522 -90.074  1.00 65.44  ? 1152 THR A CA  1 
ATOM   2740  C C   . THR A 1 356 ? -24.654 -13.669 -89.828  1.00 67.02  ? 1152 THR A C   1 
ATOM   2741  O O   . THR A 1 356 ? -24.446 -14.482 -88.932  1.00 63.75  ? 1152 THR A O   1 
ATOM   2742  C CB  . THR A 1 356 ? -24.093 -11.259 -89.297  1.00 59.44  ? 1152 THR A CB  1 
ATOM   2743  O OG1 . THR A 1 356 ? -22.981 -10.356 -89.226  1.00 56.97  ? 1152 THR A OG1 1 
ATOM   2744  C CG2 . THR A 1 356 ? -24.543 -11.616 -87.893  1.00 57.62  ? 1152 THR A CG2 1 
ATOM   2745  N N   . PHE A 1 357 ? -25.716 -13.737 -90.629  1.00 68.24  ? 1153 PHE A N   1 
ATOM   2746  C CA  . PHE A 1 357 ? -26.661 -14.854 -90.543  1.00 65.89  ? 1153 PHE A CA  1 
ATOM   2747  C C   . PHE A 1 357 ? -26.043 -16.204 -90.887  1.00 65.28  ? 1153 PHE A C   1 
ATOM   2748  O O   . PHE A 1 357 ? -26.090 -17.143 -90.103  1.00 70.04  ? 1153 PHE A O   1 
ATOM   2749  C CB  . PHE A 1 357 ? -27.869 -14.613 -91.452  1.00 60.89  ? 1153 PHE A CB  1 
ATOM   2750  C CG  . PHE A 1 357 ? -28.902 -13.726 -90.853  1.00 65.26  ? 1153 PHE A CG  1 
ATOM   2751  C CD1 . PHE A 1 357 ? -29.805 -14.223 -89.928  1.00 63.33  ? 1153 PHE A CD1 1 
ATOM   2752  C CD2 . PHE A 1 357 ? -28.986 -12.397 -91.224  1.00 64.57  ? 1153 PHE A CD2 1 
ATOM   2753  C CE1 . PHE A 1 357 ? -30.769 -13.405 -89.378  1.00 58.36  ? 1153 PHE A CE1 1 
ATOM   2754  C CE2 . PHE A 1 357 ? -29.949 -11.577 -90.674  1.00 63.62  ? 1153 PHE A CE2 1 
ATOM   2755  C CZ  . PHE A 1 357 ? -30.840 -12.085 -89.750  1.00 58.96  ? 1153 PHE A CZ  1 
ATOM   2756  N N   . ARG A 1 358 ? -25.490 -16.293 -92.087  1.00 59.54  ? 1154 ARG A N   1 
ATOM   2757  C CA  . ARG A 1 358 ? -24.911 -17.532 -92.594  1.00 64.14  ? 1154 ARG A CA  1 
ATOM   2758  C C   . ARG A 1 358 ? -23.845 -18.080 -91.648  1.00 65.67  ? 1154 ARG A C   1 
ATOM   2759  O O   . ARG A 1 358 ? -23.961 -19.191 -91.124  1.00 59.81  ? 1154 ARG A O   1 
ATOM   2760  C CB  . ARG A 1 358 ? -24.339 -17.325 -94.001  1.00 69.38  ? 1154 ARG A CB  1 
ATOM   2761  C CG  . ARG A 1 358 ? -23.874 -18.607 -94.669  1.00 83.00  ? 1154 ARG A CG  1 
ATOM   2762  C CD  . ARG A 1 358 ? -23.355 -18.353 -96.077  1.00 80.05  ? 1154 ARG A CD  1 
ATOM   2763  N NE  . ARG A 1 358 ? -22.309 -17.336 -96.092  1.00 86.51  ? 1154 ARG A NE  1 
ATOM   2764  C CZ  . ARG A 1 358 ? -21.646 -16.959 -97.179  1.00 98.09  ? 1154 ARG A CZ  1 
ATOM   2765  N NH1 . ARG A 1 358 ? -21.915 -17.517 -98.351  1.00 101.07 ? 1154 ARG A NH1 1 
ATOM   2766  N NH2 . ARG A 1 358 ? -20.711 -16.022 -97.091  1.00 98.53  ? 1154 ARG A NH2 1 
ATOM   2767  N N   . THR A 1 359 ? -22.798 -17.291 -91.444  1.00 63.73  ? 1155 THR A N   1 
ATOM   2768  C CA  . THR A 1 359 ? -21.652 -17.731 -90.664  1.00 62.08  ? 1155 THR A CA  1 
ATOM   2769  C C   . THR A 1 359 ? -21.992 -17.947 -89.188  1.00 59.16  ? 1155 THR A C   1 
ATOM   2770  O O   . THR A 1 359 ? -21.479 -18.868 -88.550  1.00 58.00  ? 1155 THR A O   1 
ATOM   2771  C CB  . THR A 1 359 ? -20.517 -16.714 -90.771  1.00 65.83  ? 1155 THR A CB  1 
ATOM   2772  O OG1 . THR A 1 359 ? -20.841 -15.535 -90.021  1.00 70.95  ? 1155 THR A OG1 1 
ATOM   2773  C CG2 . THR A 1 359 ? -20.313 -16.321 -92.227  1.00 58.18  ? 1155 THR A CG2 1 
ATOM   2774  N N   . GLY A 1 360 ? -22.859 -17.096 -88.647  1.00 54.80  ? 1156 GLY A N   1 
ATOM   2775  C CA  . GLY A 1 360 ? -23.173 -17.130 -87.230  1.00 56.45  ? 1156 GLY A CA  1 
ATOM   2776  C C   . GLY A 1 360 ? -22.097 -16.446 -86.414  1.00 55.34  ? 1156 GLY A C   1 
ATOM   2777  O O   . GLY A 1 360 ? -22.022 -16.616 -85.199  1.00 48.55  ? 1156 GLY A O   1 
ATOM   2778  N N   . THR A 1 361 ? -21.265 -15.660 -87.090  1.00 64.46  ? 1157 THR A N   1 
ATOM   2779  C CA  . THR A 1 361 ? -20.153 -14.978 -86.434  1.00 64.19  ? 1157 THR A CA  1 
ATOM   2780  C C   . THR A 1 361 ? -20.067 -13.495 -86.790  1.00 66.91  ? 1157 THR A C   1 
ATOM   2781  O O   . THR A 1 361 ? -20.585 -13.037 -87.813  1.00 63.56  ? 1157 THR A O   1 
ATOM   2782  C CB  . THR A 1 361 ? -18.794 -15.649 -86.749  1.00 61.88  ? 1157 THR A CB  1 
ATOM   2783  O OG1 . THR A 1 361 ? -18.497 -15.518 -88.147  1.00 54.02  ? 1157 THR A OG1 1 
ATOM   2784  C CG2 . THR A 1 361 ? -18.829 -17.116 -86.374  1.00 66.52  ? 1157 THR A CG2 1 
ATOM   2785  N N   . TRP A 1 362 ? -19.399 -12.757 -85.912  1.00 67.23  ? 1158 TRP A N   1 
ATOM   2786  C CA  . TRP A 1 362 ? -19.286 -11.313 -86.010  1.00 64.52  ? 1158 TRP A CA  1 
ATOM   2787  C C   . TRP A 1 362 ? -18.154 -10.882 -86.928  1.00 64.68  ? 1158 TRP A C   1 
ATOM   2788  O O   . TRP A 1 362 ? -17.882 -9.693  -87.078  1.00 66.12  ? 1158 TRP A O   1 
ATOM   2789  C CB  . TRP A 1 362 ? -19.083 -10.728 -84.620  1.00 60.20  ? 1158 TRP A CB  1 
ATOM   2790  C CG  . TRP A 1 362 ? -20.298 -10.816 -83.778  1.00 58.03  ? 1158 TRP A CG  1 
ATOM   2791  C CD1 . TRP A 1 362 ? -20.573 -11.752 -82.826  1.00 64.24  ? 1158 TRP A CD1 1 
ATOM   2792  C CD2 . TRP A 1 362 ? -21.416 -9.933  -83.808  1.00 53.13  ? 1158 TRP A CD2 1 
ATOM   2793  N NE1 . TRP A 1 362 ? -21.794 -11.501 -82.256  1.00 58.88  ? 1158 TRP A NE1 1 
ATOM   2794  C CE2 . TRP A 1 362 ? -22.334 -10.385 -82.843  1.00 54.34  ? 1158 TRP A CE2 1 
ATOM   2795  C CE3 . TRP A 1 362 ? -21.730 -8.795  -84.555  1.00 56.71  ? 1158 TRP A CE3 1 
ATOM   2796  C CZ2 . TRP A 1 362 ? -23.542 -9.747  -82.605  1.00 62.01  ? 1158 TRP A CZ2 1 
ATOM   2797  C CZ3 . TRP A 1 362 ? -22.927 -8.161  -84.322  1.00 66.02  ? 1158 TRP A CZ3 1 
ATOM   2798  C CH2 . TRP A 1 362 ? -23.822 -8.636  -83.355  1.00 72.05  ? 1158 TRP A CH2 1 
ATOM   2799  N N   . ASP A 1 363 ? -17.476 -11.858 -87.512  1.00 63.17  ? 1159 ASP A N   1 
ATOM   2800  C CA  . ASP A 1 363 ? -16.299 -11.594 -88.325  1.00 60.58  ? 1159 ASP A CA  1 
ATOM   2801  C C   . ASP A 1 363 ? -16.598 -10.679 -89.507  1.00 61.44  ? 1159 ASP A C   1 
ATOM   2802  O O   . ASP A 1 363 ? -15.710 -9.980  -89.990  1.00 63.71  ? 1159 ASP A O   1 
ATOM   2803  C CB  . ASP A 1 363 ? -15.703 -12.909 -88.824  1.00 81.58  ? 1159 ASP A CB  1 
ATOM   2804  C CG  . ASP A 1 363 ? -15.415 -13.887 -87.698  1.00 84.93  ? 1159 ASP A CG  1 
ATOM   2805  O OD1 . ASP A 1 363 ? -16.039 -13.768 -86.619  1.00 80.29  ? 1159 ASP A OD1 1 
ATOM   2806  O OD2 . ASP A 1 363 ? -14.562 -14.781 -87.894  1.00 88.01  ? 1159 ASP A OD2 1 
ATOM   2807  N N   . ALA A 1 364 ? -17.842 -10.687 -89.979  1.00 60.32  ? 1160 ALA A N   1 
ATOM   2808  C CA  . ALA A 1 364 ? -18.238 -9.795  -91.067  1.00 58.53  ? 1160 ALA A CA  1 
ATOM   2809  C C   . ALA A 1 364 ? -18.015 -8.339  -90.648  1.00 56.91  ? 1160 ALA A C   1 
ATOM   2810  O O   . ALA A 1 364 ? -17.546 -7.512  -91.432  1.00 45.52  ? 1160 ALA A O   1 
ATOM   2811  C CB  . ALA A 1 364 ? -19.687 -10.030 -91.450  1.00 52.46  ? 1160 ALA A CB  1 
ATOM   2812  N N   . TYR A 1 365 ? -18.362 -8.047  -89.398  1.00 61.07  ? 1161 TYR A N   1 
ATOM   2813  C CA  . TYR A 1 365 ? -18.218 -6.721  -88.813  1.00 52.31  ? 1161 TYR A CA  1 
ATOM   2814  C C   . TYR A 1 365 ? -16.904 -6.596  -88.056  1.00 53.50  ? 1161 TYR A C   1 
ATOM   2815  O O   . TYR A 1 365 ? -16.591 -5.536  -87.516  1.00 51.82  ? 1161 TYR A O   1 
ATOM   2816  C CB  . TYR A 1 365 ? -19.371 -6.459  -87.844  1.00 49.42  ? 1161 TYR A CB  1 
ATOM   2817  C CG  . TYR A 1 365 ? -20.719 -6.342  -88.509  1.00 49.35  ? 1161 TYR A CG  1 
ATOM   2818  C CD1 . TYR A 1 365 ? -21.354 -5.112  -88.617  1.00 50.70  ? 1161 TYR A CD1 1 
ATOM   2819  C CD2 . TYR A 1 365 ? -21.352 -7.459  -89.039  1.00 53.82  ? 1161 TYR A CD2 1 
ATOM   2820  C CE1 . TYR A 1 365 ? -22.584 -4.996  -89.230  1.00 56.29  ? 1161 TYR A CE1 1 
ATOM   2821  C CE2 . TYR A 1 365 ? -22.585 -7.353  -89.656  1.00 59.63  ? 1161 TYR A CE2 1 
ATOM   2822  C CZ  . TYR A 1 365 ? -23.195 -6.119  -89.748  1.00 60.30  ? 1161 TYR A CZ  1 
ATOM   2823  O OH  . TYR A 1 365 ? -24.418 -6.004  -90.362  1.00 59.06  ? 1161 TYR A OH  1 
ATOM   2824  N N   . LEU A 1 366 ? -16.139 -7.682  -88.021  1.00 60.22  ? 482  LEU A N   1 
ATOM   2825  C CA  . LEU A 1 366 ? -14.949 -7.750  -87.181  1.00 59.13  ? 482  LEU A CA  1 
ATOM   2826  C C   . LEU A 1 366 ? -15.317 -7.292  -85.778  1.00 63.75  ? 482  LEU A C   1 
ATOM   2827  O O   . LEU A 1 366 ? -14.923 -6.217  -85.328  1.00 61.71  ? 482  LEU A O   1 
ATOM   2828  C CB  . LEU A 1 366 ? -13.821 -6.905  -87.761  1.00 53.93  ? 482  LEU A CB  1 
ATOM   2829  C CG  . LEU A 1 366 ? -13.296 -7.436  -89.095  1.00 53.70  ? 482  LEU A CG  1 
ATOM   2830  C CD1 . LEU A 1 366 ? -12.270 -6.489  -89.694  1.00 54.56  ? 482  LEU A CD1 1 
ATOM   2831  C CD2 . LEU A 1 366 ? -12.716 -8.828  -88.921  1.00 49.45  ? 482  LEU A CD2 1 
ATOM   2832  N N   . ILE A 1 367 ? -16.102 -8.122  -85.102  1.00 66.86  ? 483  ILE A N   1 
ATOM   2833  C CA  . ILE A 1 367 ? -16.638 -7.792  -83.793  1.00 62.06  ? 483  ILE A CA  1 
ATOM   2834  C C   . ILE A 1 367 ? -16.302 -8.867  -82.767  1.00 64.26  ? 483  ILE A C   1 
ATOM   2835  O O   . ILE A 1 367 ? -16.436 -10.066 -83.034  1.00 61.27  ? 483  ILE A O   1 
ATOM   2836  C CB  . ILE A 1 367 ? -18.158 -7.617  -83.858  1.00 59.81  ? 483  ILE A CB  1 
ATOM   2837  C CG1 . ILE A 1 367 ? -18.509 -6.285  -84.513  1.00 60.20  ? 483  ILE A CG1 1 
ATOM   2838  C CG2 . ILE A 1 367 ? -18.771 -7.685  -82.475  1.00 64.98  ? 483  ILE A CG2 1 
ATOM   2839  C CD1 . ILE A 1 367 ? -19.948 -5.873  -84.290  1.00 61.31  ? 483  ILE A CD1 1 
ATOM   2840  N N   . LYS A 1 368 ? -15.868 -8.422  -81.592  1.00 63.96  ? 484  LYS A N   1 
ATOM   2841  C CA  . LYS A 1 368 ? -15.496 -9.319  -80.504  1.00 62.59  ? 484  LYS A CA  1 
ATOM   2842  C C   . LYS A 1 368 ? -16.718 -9.675  -79.673  1.00 62.99  ? 484  LYS A C   1 
ATOM   2843  O O   . LYS A 1 368 ? -17.341 -8.798  -79.076  1.00 69.46  ? 484  LYS A O   1 
ATOM   2844  C CB  . LYS A 1 368 ? -14.457 -8.652  -79.601  1.00 66.44  ? 484  LYS A CB  1 
ATOM   2845  C CG  . LYS A 1 368 ? -13.643 -7.551  -80.273  1.00 78.11  ? 484  LYS A CG  1 
ATOM   2846  C CD  . LYS A 1 368 ? -14.431 -6.252  -80.386  1.00 80.99  ? 484  LYS A CD  1 
ATOM   2847  C CE  . LYS A 1 368 ? -13.607 -5.147  -81.027  1.00 80.63  ? 484  LYS A CE  1 
ATOM   2848  N NZ  . LYS A 1 368 ? -14.480 -4.035  -81.492  1.00 76.18  ? 484  LYS A NZ  1 
ATOM   2849  N N   . GLU A 1 369 ? -17.054 -10.960 -79.625  1.00 64.03  ? 485  GLU A N   1 
ATOM   2850  C CA  . GLU A 1 369 ? -18.233 -11.404 -78.888  1.00 67.45  ? 485  GLU A CA  1 
ATOM   2851  C C   . GLU A 1 369 ? -18.142 -11.024 -77.412  1.00 69.87  ? 485  GLU A C   1 
ATOM   2852  O O   . GLU A 1 369 ? -18.789 -10.080 -76.956  1.00 68.55  ? 485  GLU A O   1 
ATOM   2853  C CB  . GLU A 1 369 ? -18.434 -12.917 -79.034  1.00 71.45  ? 485  GLU A CB  1 
ATOM   2854  C CG  . GLU A 1 369 ? -19.846 -13.376 -78.688  1.00 74.96  ? 485  GLU A CG  1 
ATOM   2855  C CD  . GLU A 1 369 ? -19.992 -14.888 -78.645  1.00 83.21  ? 485  GLU A CD  1 
ATOM   2856  O OE1 . GLU A 1 369 ? -21.140 -15.369 -78.504  1.00 72.39  ? 485  GLU A OE1 1 
ATOM   2857  O OE2 . GLU A 1 369 ? -18.961 -15.591 -78.744  1.00 87.86  ? 485  GLU A OE2 1 
ATOM   2858  N N   . ALA A 1 373 ? -19.712 -9.274  -68.121  1.00 73.38  ? 489  ALA A N   1 
ATOM   2859  C CA  . ALA A 1 373 ? -20.476 -10.383 -67.562  1.00 70.69  ? 489  ALA A CA  1 
ATOM   2860  C C   . ALA A 1 373 ? -19.558 -11.532 -67.153  1.00 68.44  ? 489  ALA A C   1 
ATOM   2861  O O   . ALA A 1 373 ? -19.821 -12.244 -66.184  1.00 59.43  ? 489  ALA A O   1 
ATOM   2862  C CB  . ALA A 1 373 ? -21.515 -10.861 -68.565  1.00 65.77  ? 489  ALA A CB  1 
ATOM   2863  N N   . GLN A 1 374 ? -18.475 -11.703 -67.904  1.00 74.06  ? 490  GLN A N   1 
ATOM   2864  C CA  . GLN A 1 374 ? -17.542 -12.800 -67.677  1.00 78.47  ? 490  GLN A CA  1 
ATOM   2865  C C   . GLN A 1 374 ? -16.712 -12.617 -66.409  1.00 73.23  ? 490  GLN A C   1 
ATOM   2866  O O   . GLN A 1 374 ? -16.193 -11.534 -66.147  1.00 72.98  ? 490  GLN A O   1 
ATOM   2867  C CB  . GLN A 1 374 ? -16.633 -12.998 -68.897  1.00 78.06  ? 490  GLN A CB  1 
ATOM   2868  C CG  . GLN A 1 374 ? -16.076 -11.709 -69.487  1.00 82.68  ? 490  GLN A CG  1 
ATOM   2869  C CD  . GLN A 1 374 ? -14.607 -11.500 -69.165  1.00 92.63  ? 490  GLN A CD  1 
ATOM   2870  O OE1 . GLN A 1 374 ? -13.962 -10.592 -69.698  1.00 100.18 ? 490  GLN A OE1 1 
ATOM   2871  N NE2 . GLN A 1 374 ? -14.069 -12.342 -68.291  1.00 88.34  ? 490  GLN A NE2 1 
ATOM   2872  N N   . THR A 1 375 ? -16.615 -13.687 -65.624  1.00 69.86  ? 491  THR A N   1 
ATOM   2873  C CA  . THR A 1 375 ? -15.775 -13.726 -64.428  1.00 74.62  ? 491  THR A CA  1 
ATOM   2874  C C   . THR A 1 375 ? -16.376 -12.972 -63.241  1.00 70.36  ? 491  THR A C   1 
ATOM   2875  O O   . THR A 1 375 ? -15.967 -13.175 -62.094  1.00 65.47  ? 491  THR A O   1 
ATOM   2876  C CB  . THR A 1 375 ? -14.358 -13.178 -64.719  1.00 80.27  ? 491  THR A CB  1 
ATOM   2877  O OG1 . THR A 1 375 ? -13.785 -13.895 -65.821  1.00 85.44  ? 491  THR A OG1 1 
ATOM   2878  C CG2 . THR A 1 375 ? -13.456 -13.310 -63.495  1.00 76.70  ? 491  THR A CG2 1 
ATOM   2879  N N   . LEU A 1 376 ? -17.366 -12.127 -63.511  1.00 65.27  ? 492  LEU A N   1 
ATOM   2880  C CA  . LEU A 1 376 ? -17.980 -11.344 -62.448  1.00 56.91  ? 492  LEU A CA  1 
ATOM   2881  C C   . LEU A 1 376 ? -18.808 -12.272 -61.576  1.00 58.45  ? 492  LEU A C   1 
ATOM   2882  O O   . LEU A 1 376 ? -18.880 -12.107 -60.357  1.00 56.78  ? 492  LEU A O   1 
ATOM   2883  C CB  . LEU A 1 376 ? -18.853 -10.224 -63.013  1.00 49.96  ? 492  LEU A CB  1 
ATOM   2884  C CG  . LEU A 1 376 ? -19.050 -9.047  -62.053  1.00 38.71  ? 492  LEU A CG  1 
ATOM   2885  C CD1 . LEU A 1 376 ? -17.734 -8.314  -61.843  1.00 32.01  ? 492  LEU A CD1 1 
ATOM   2886  C CD2 . LEU A 1 376 ? -20.129 -8.091  -62.540  1.00 34.16  ? 492  LEU A CD2 1 
ATOM   2887  N N   . SER A 1 377 ? -19.424 -13.259 -62.212  1.00 63.08  ? 493  SER A N   1 
ATOM   2888  C CA  . SER A 1 377 ? -20.177 -14.257 -61.482  1.00 63.43  ? 493  SER A CA  1 
ATOM   2889  C C   . SER A 1 377 ? -19.246 -14.881 -60.462  1.00 67.11  ? 493  SER A C   1 
ATOM   2890  O O   . SER A 1 377 ? -19.509 -14.829 -59.262  1.00 70.87  ? 493  SER A O   1 
ATOM   2891  C CB  . SER A 1 377 ? -20.709 -15.325 -62.433  1.00 63.14  ? 493  SER A CB  1 
ATOM   2892  O OG  . SER A 1 377 ? -21.368 -14.733 -63.536  1.00 74.48  ? 493  SER A OG  1 
ATOM   2893  N N   . ALA A 1 378 ? -18.141 -15.443 -60.944  1.00 70.28  ? 494  ALA A N   1 
ATOM   2894  C CA  . ALA A 1 378 ? -17.183 -16.130 -60.077  1.00 76.31  ? 494  ALA A CA  1 
ATOM   2895  C C   . ALA A 1 378 ? -16.719 -15.269 -58.899  1.00 70.96  ? 494  ALA A C   1 
ATOM   2896  O O   . ALA A 1 378 ? -16.982 -15.588 -57.735  1.00 68.07  ? 494  ALA A O   1 
ATOM   2897  C CB  . ALA A 1 378 ? -15.984 -16.610 -60.888  1.00 77.81  ? 494  ALA A CB  1 
ATOM   2898  N N   . ILE A 1 379 ? -16.029 -14.179 -59.217  1.00 67.78  ? 495  ILE A N   1 
ATOM   2899  C CA  . ILE A 1 379 ? -15.518 -13.260 -58.208  1.00 65.62  ? 495  ILE A CA  1 
ATOM   2900  C C   . ILE A 1 379 ? -16.591 -12.891 -57.192  1.00 62.86  ? 495  ILE A C   1 
ATOM   2901  O O   . ILE A 1 379 ? -16.377 -12.995 -55.979  1.00 58.63  ? 495  ILE A O   1 
ATOM   2902  C CB  . ILE A 1 379 ? -15.002 -11.971 -58.856  1.00 61.92  ? 495  ILE A CB  1 
ATOM   2903  C CG1 . ILE A 1 379 ? -13.945 -12.306 -59.904  1.00 65.59  ? 495  ILE A CG1 1 
ATOM   2904  C CG2 . ILE A 1 379 ? -14.450 -11.034 -57.796  1.00 62.05  ? 495  ILE A CG2 1 
ATOM   2905  C CD1 . ILE A 1 379 ? -12.847 -13.210 -59.371  1.00 80.33  ? 495  ILE A CD1 1 
ATOM   2906  N N   . LEU A 1 380 ? -17.750 -12.472 -57.694  1.00 58.75  ? 496  LEU A N   1 
ATOM   2907  C CA  . LEU A 1 380 ? -18.846 -12.093 -56.823  1.00 54.60  ? 496  LEU A CA  1 
ATOM   2908  C C   . LEU A 1 380 ? -19.176 -13.217 -55.852  1.00 59.96  ? 496  LEU A C   1 
ATOM   2909  O O   . LEU A 1 380 ? -19.153 -13.028 -54.637  1.00 61.76  ? 496  LEU A O   1 
ATOM   2910  C CB  . LEU A 1 380 ? -20.088 -11.763 -57.635  1.00 48.89  ? 496  LEU A CB  1 
ATOM   2911  C CG  . LEU A 1 380 ? -21.192 -11.320 -56.683  1.00 48.30  ? 496  LEU A CG  1 
ATOM   2912  C CD1 . LEU A 1 380 ? -20.799 -9.989  -56.070  1.00 43.38  ? 496  LEU A CD1 1 
ATOM   2913  C CD2 . LEU A 1 380 ? -22.535 -11.231 -57.381  1.00 54.43  ? 496  LEU A CD2 1 
ATOM   2914  N N   . LEU A 1 381 ? -19.475 -14.390 -56.403  1.00 59.94  ? 497  LEU A N   1 
ATOM   2915  C CA  . LEU A 1 381 ? -19.854 -15.562 -55.613  1.00 60.61  ? 497  LEU A CA  1 
ATOM   2916  C C   . LEU A 1 381 ? -18.836 -15.887 -54.525  1.00 63.43  ? 497  LEU A C   1 
ATOM   2917  O O   . LEU A 1 381 ? -19.189 -16.041 -53.345  1.00 63.41  ? 497  LEU A O   1 
ATOM   2918  C CB  . LEU A 1 381 ? -20.045 -16.777 -56.520  1.00 58.16  ? 497  LEU A CB  1 
ATOM   2919  C CG  . LEU A 1 381 ? -21.491 -17.077 -56.904  1.00 47.94  ? 497  LEU A CG  1 
ATOM   2920  C CD1 . LEU A 1 381 ? -21.562 -18.301 -57.804  1.00 50.18  ? 497  LEU A CD1 1 
ATOM   2921  C CD2 . LEU A 1 381 ? -22.314 -17.273 -55.648  1.00 39.55  ? 497  LEU A CD2 1 
ATOM   2922  N N   . ALA A 1 382 ? -17.574 -15.990 -54.927  1.00 59.97  ? 498  ALA A N   1 
ATOM   2923  C CA  . ALA A 1 382 ? -16.503 -16.218 -53.973  1.00 64.81  ? 498  ALA A CA  1 
ATOM   2924  C C   . ALA A 1 382 ? -16.602 -15.192 -52.842  1.00 71.77  ? 498  ALA A C   1 
ATOM   2925  O O   . ALA A 1 382 ? -16.675 -15.553 -51.657  1.00 76.08  ? 498  ALA A O   1 
ATOM   2926  C CB  . ALA A 1 382 ? -15.154 -16.142 -54.659  1.00 69.41  ? 498  ALA A CB  1 
ATOM   2927  N N   . PHE A 1 383 ? -16.623 -13.915 -53.214  1.00 67.77  ? 499  PHE A N   1 
ATOM   2928  C CA  . PHE A 1 383 ? -16.680 -12.825 -52.239  1.00 67.71  ? 499  PHE A CA  1 
ATOM   2929  C C   . PHE A 1 383 ? -17.827 -12.982 -51.235  1.00 61.95  ? 499  PHE A C   1 
ATOM   2930  O O   . PHE A 1 383 ? -17.610 -13.141 -50.022  1.00 62.37  ? 499  PHE A O   1 
ATOM   2931  C CB  . PHE A 1 383 ? -16.783 -11.476 -52.957  1.00 60.16  ? 499  PHE A CB  1 
ATOM   2932  C CG  . PHE A 1 383 ? -17.069 -10.324 -52.040  1.00 54.48  ? 499  PHE A CG  1 
ATOM   2933  C CD1 . PHE A 1 383 ? -18.307 -9.721  -52.041  1.00 53.17  ? 499  PHE A CD1 1 
ATOM   2934  C CD2 . PHE A 1 383 ? -16.100 -9.849  -51.176  1.00 59.13  ? 499  PHE A CD2 1 
ATOM   2935  C CE1 . PHE A 1 383 ? -18.575 -8.665  -51.203  1.00 59.65  ? 499  PHE A CE1 1 
ATOM   2936  C CE2 . PHE A 1 383 ? -16.362 -8.791  -50.331  1.00 53.68  ? 499  PHE A CE2 1 
ATOM   2937  C CZ  . PHE A 1 383 ? -17.601 -8.198  -50.345  1.00 56.43  ? 499  PHE A CZ  1 
ATOM   2938  N N   . ILE A 1 384 ? -19.047 -12.940 -51.749  1.00 55.17  ? 500  ILE A N   1 
ATOM   2939  C CA  . ILE A 1 384 ? -20.223 -13.026 -50.911  1.00 56.17  ? 500  ILE A CA  1 
ATOM   2940  C C   . ILE A 1 384 ? -20.135 -14.219 -49.967  1.00 61.75  ? 500  ILE A C   1 
ATOM   2941  O O   . ILE A 1 384 ? -20.272 -14.062 -48.759  1.00 65.90  ? 500  ILE A O   1 
ATOM   2942  C CB  . ILE A 1 384 ? -21.510 -13.092 -51.783  1.00 56.83  ? 500  ILE A CB  1 
ATOM   2943  C CG1 . ILE A 1 384 ? -22.713 -12.551 -51.018  1.00 63.79  ? 500  ILE A CG1 1 
ATOM   2944  C CG2 . ILE A 1 384 ? -21.750 -14.502 -52.330  1.00 50.44  ? 500  ILE A CG2 1 
ATOM   2945  C CD1 . ILE A 1 384 ? -23.847 -12.107 -51.926  1.00 56.90  ? 500  ILE A CD1 1 
ATOM   2946  N N   . ILE A 1 385 ? -19.852 -15.396 -50.518  1.00 60.17  ? 501  ILE A N   1 
ATOM   2947  C CA  . ILE A 1 385 ? -19.896 -16.629 -49.742  1.00 64.54  ? 501  ILE A CA  1 
ATOM   2948  C C   . ILE A 1 385 ? -18.765 -16.759 -48.719  1.00 66.60  ? 501  ILE A C   1 
ATOM   2949  O O   . ILE A 1 385 ? -18.877 -17.542 -47.782  1.00 64.15  ? 501  ILE A O   1 
ATOM   2950  C CB  . ILE A 1 385 ? -19.857 -17.858 -50.657  1.00 60.21  ? 501  ILE A CB  1 
ATOM   2951  C CG1 . ILE A 1 385 ? -20.200 -19.133 -49.881  1.00 66.15  ? 501  ILE A CG1 1 
ATOM   2952  C CG2 . ILE A 1 385 ? -18.507 -17.978 -51.299  1.00 58.05  ? 501  ILE A CG2 1 
ATOM   2953  C CD1 . ILE A 1 385 ? -19.921 -20.358 -50.670  1.00 77.98  ? 501  ILE A CD1 1 
ATOM   2954  N N   . THR A 1 386 ? -17.668 -16.023 -48.910  1.00 65.53  ? 502  THR A N   1 
ATOM   2955  C CA  . THR A 1 386 ? -16.577 -16.029 -47.924  1.00 66.15  ? 502  THR A CA  1 
ATOM   2956  C C   . THR A 1 386 ? -16.682 -14.874 -46.923  1.00 69.83  ? 502  THR A C   1 
ATOM   2957  O O   . THR A 1 386 ? -15.979 -14.868 -45.911  1.00 67.75  ? 502  THR A O   1 
ATOM   2958  C CB  . THR A 1 386 ? -15.170 -16.022 -48.544  1.00 57.07  ? 502  THR A CB  1 
ATOM   2959  O OG1 . THR A 1 386 ? -14.939 -14.803 -49.256  1.00 60.27  ? 502  THR A OG1 1 
ATOM   2960  C CG2 . THR A 1 386 ? -14.981 -17.199 -49.482  1.00 55.13  ? 502  THR A CG2 1 
ATOM   2961  N N   . TRP A 1 387 ? -17.572 -13.917 -47.188  1.00 64.38  ? 503  TRP A N   1 
ATOM   2962  C CA  . TRP A 1 387 ? -17.773 -12.767 -46.299  1.00 57.83  ? 503  TRP A CA  1 
ATOM   2963  C C   . TRP A 1 387 ? -19.023 -12.896 -45.420  1.00 57.61  ? 503  TRP A C   1 
ATOM   2964  O O   . TRP A 1 387 ? -18.961 -12.757 -44.186  1.00 63.33  ? 503  TRP A O   1 
ATOM   2965  C CB  . TRP A 1 387 ? -17.692 -11.431 -47.058  1.00 59.75  ? 503  TRP A CB  1 
ATOM   2966  C CG  . TRP A 1 387 ? -16.280 -11.075 -47.485  1.00 61.20  ? 503  TRP A CG  1 
ATOM   2967  C CD1 . TRP A 1 387 ? -15.335 -11.931 -47.967  1.00 64.58  ? 503  TRP A CD1 1 
ATOM   2968  C CD2 . TRP A 1 387 ? -15.654 -9.780  -47.431  1.00 58.89  ? 503  TRP A CD2 1 
ATOM   2969  N NE1 . TRP A 1 387 ? -14.166 -11.253 -48.232  1.00 64.15  ? 503  TRP A NE1 1 
ATOM   2970  C CE2 . TRP A 1 387 ? -14.337 -9.933  -47.912  1.00 61.30  ? 503  TRP A CE2 1 
ATOM   2971  C CE3 . TRP A 1 387 ? -16.080 -8.510  -47.031  1.00 57.96  ? 503  TRP A CE3 1 
ATOM   2972  C CZ2 . TRP A 1 387 ? -13.447 -8.865  -48.003  1.00 60.04  ? 503  TRP A CZ2 1 
ATOM   2973  C CZ3 . TRP A 1 387 ? -15.190 -7.452  -47.122  1.00 55.41  ? 503  TRP A CZ3 1 
ATOM   2974  C CH2 . TRP A 1 387 ? -13.893 -7.637  -47.605  1.00 54.30  ? 503  TRP A CH2 1 
ATOM   2975  N N   . THR A 1 388 ? -20.166 -13.091 -46.069  1.00 53.30  ? 504  THR A N   1 
ATOM   2976  C CA  . THR A 1 388 ? -21.460 -13.187 -45.381  1.00 58.18  ? 504  THR A CA  1 
ATOM   2977  C C   . THR A 1 388 ? -21.527 -14.074 -44.133  1.00 61.69  ? 504  THR A C   1 
ATOM   2978  O O   . THR A 1 388 ? -22.296 -13.782 -43.233  1.00 64.07  ? 504  THR A O   1 
ATOM   2979  C CB  . THR A 1 388 ? -22.601 -13.615 -46.328  1.00 66.50  ? 504  THR A CB  1 
ATOM   2980  O OG1 . THR A 1 388 ? -22.186 -14.764 -47.079  1.00 77.79  ? 504  THR A OG1 1 
ATOM   2981  C CG2 . THR A 1 388 ? -22.969 -12.473 -47.277  1.00 65.15  ? 504  THR A CG2 1 
ATOM   2982  N N   . PRO A 1 389 ? -20.787 -15.194 -44.098  1.00 58.18  ? 505  PRO A N   1 
ATOM   2983  C CA  . PRO A 1 389 ? -20.748 -15.913 -42.817  1.00 56.41  ? 505  PRO A CA  1 
ATOM   2984  C C   . PRO A 1 389 ? -20.361 -14.983 -41.665  1.00 58.26  ? 505  PRO A C   1 
ATOM   2985  O O   . PRO A 1 389 ? -21.005 -14.961 -40.611  1.00 57.90  ? 505  PRO A O   1 
ATOM   2986  C CB  . PRO A 1 389 ? -19.647 -16.942 -43.045  1.00 45.57  ? 505  PRO A CB  1 
ATOM   2987  C CG  . PRO A 1 389 ? -19.745 -17.243 -44.503  1.00 54.21  ? 505  PRO A CG  1 
ATOM   2988  C CD  . PRO A 1 389 ? -20.142 -15.954 -45.181  1.00 56.09  ? 505  PRO A CD  1 
ATOM   2989  N N   . TYR A 1 390 ? -19.318 -14.196 -41.898  1.00 64.33  ? 506  TYR A N   1 
ATOM   2990  C CA  . TYR A 1 390 ? -18.801 -13.265 -40.905  1.00 65.44  ? 506  TYR A CA  1 
ATOM   2991  C C   . TYR A 1 390 ? -19.746 -12.096 -40.679  1.00 61.82  ? 506  TYR A C   1 
ATOM   2992  O O   . TYR A 1 390 ? -20.013 -11.722 -39.540  1.00 62.61  ? 506  TYR A O   1 
ATOM   2993  C CB  . TYR A 1 390 ? -17.430 -12.748 -41.338  1.00 70.70  ? 506  TYR A CB  1 
ATOM   2994  C CG  . TYR A 1 390 ? -16.781 -11.803 -40.356  1.00 65.93  ? 506  TYR A CG  1 
ATOM   2995  C CD1 . TYR A 1 390 ? -15.698 -12.209 -39.587  1.00 69.84  ? 506  TYR A CD1 1 
ATOM   2996  C CD2 . TYR A 1 390 ? -17.244 -10.504 -40.205  1.00 58.00  ? 506  TYR A CD2 1 
ATOM   2997  C CE1 . TYR A 1 390 ? -15.093 -11.351 -38.694  1.00 69.87  ? 506  TYR A CE1 1 
ATOM   2998  C CE2 . TYR A 1 390 ? -16.647 -9.638  -39.314  1.00 62.41  ? 506  TYR A CE2 1 
ATOM   2999  C CZ  . TYR A 1 390 ? -15.571 -10.067 -38.561  1.00 67.09  ? 506  TYR A CZ  1 
ATOM   3000  O OH  . TYR A 1 390 ? -14.962 -9.213  -37.673  1.00 63.62  ? 506  TYR A OH  1 
ATOM   3001  N N   . ASN A 1 391 ? -20.247 -11.501 -41.757  1.00 62.07  ? 507  ASN A N   1 
ATOM   3002  C CA  . ASN A 1 391 ? -21.183 -10.388 -41.576  1.00 63.38  ? 507  ASN A CA  1 
ATOM   3003  C C   . ASN A 1 391 ? -22.468 -10.797 -40.852  1.00 59.65  ? 507  ASN A C   1 
ATOM   3004  O O   . ASN A 1 391 ? -23.035 -10.015 -40.087  1.00 56.33  ? 507  ASN A O   1 
ATOM   3005  C CB  . ASN A 1 391 ? -21.501 -9.694  -42.904  1.00 60.60  ? 507  ASN A CB  1 
ATOM   3006  C CG  . ASN A 1 391 ? -20.356 -8.838  -43.397  1.00 56.52  ? 507  ASN A CG  1 
ATOM   3007  O OD1 . ASN A 1 391 ? -20.194 -7.690  -42.974  1.00 53.92  ? 507  ASN A OD1 1 
ATOM   3008  N ND2 . ASN A 1 391 ? -19.550 -9.394  -44.294  1.00 53.74  ? 507  ASN A ND2 1 
ATOM   3009  N N   . ILE A 1 392 ? -22.910 -12.027 -41.103  1.00 59.46  ? 508  ILE A N   1 
ATOM   3010  C CA  . ILE A 1 392 ? -24.095 -12.597 -40.477  1.00 59.34  ? 508  ILE A CA  1 
ATOM   3011  C C   . ILE A 1 392 ? -23.780 -12.887 -39.027  1.00 65.20  ? 508  ILE A C   1 
ATOM   3012  O O   . ILE A 1 392 ? -24.633 -12.759 -38.152  1.00 71.06  ? 508  ILE A O   1 
ATOM   3013  C CB  . ILE A 1 392 ? -24.528 -13.915 -41.155  1.00 54.07  ? 508  ILE A CB  1 
ATOM   3014  C CG1 . ILE A 1 392 ? -25.165 -13.640 -42.516  1.00 65.93  ? 508  ILE A CG1 1 
ATOM   3015  C CG2 . ILE A 1 392 ? -25.515 -14.665 -40.288  1.00 48.04  ? 508  ILE A CG2 1 
ATOM   3016  C CD1 . ILE A 1 392 ? -25.736 -14.880 -43.181  1.00 67.61  ? 508  ILE A CD1 1 
ATOM   3017  N N   . MET A 1 393 ? -22.539 -13.281 -38.777  1.00 63.21  ? 509  MET A N   1 
ATOM   3018  C CA  . MET A 1 393 ? -22.093 -13.537 -37.419  1.00 63.32  ? 509  MET A CA  1 
ATOM   3019  C C   . MET A 1 393 ? -22.063 -12.238 -36.606  1.00 66.09  ? 509  MET A C   1 
ATOM   3020  O O   . MET A 1 393 ? -22.295 -12.246 -35.394  1.00 64.76  ? 509  MET A O   1 
ATOM   3021  C CB  . MET A 1 393 ? -20.722 -14.204 -37.449  1.00 65.84  ? 509  MET A CB  1 
ATOM   3022  C CG  . MET A 1 393 ? -20.280 -14.781 -36.127  1.00 75.69  ? 509  MET A CG  1 
ATOM   3023  S SD  . MET A 1 393 ? -18.844 -15.847 -36.331  1.00 89.75  ? 509  MET A SD  1 
ATOM   3024  C CE  . MET A 1 393 ? -17.931 -14.933 -37.569  1.00 74.63  ? 509  MET A CE  1 
ATOM   3025  N N   . VAL A 1 394 ? -21.776 -11.129 -37.287  1.00 70.75  ? 510  VAL A N   1 
ATOM   3026  C CA  . VAL A 1 394 ? -21.782 -9.794  -36.682  1.00 71.14  ? 510  VAL A CA  1 
ATOM   3027  C C   . VAL A 1 394 ? -23.202 -9.300  -36.415  1.00 68.04  ? 510  VAL A C   1 
ATOM   3028  O O   . VAL A 1 394 ? -23.539 -8.885  -35.302  1.00 68.90  ? 510  VAL A O   1 
ATOM   3029  C CB  . VAL A 1 394 ? -21.094 -8.772  -37.614  1.00 64.80  ? 510  VAL A CB  1 
ATOM   3030  C CG1 . VAL A 1 394 ? -21.285 -7.358  -37.093  1.00 54.71  ? 510  VAL A CG1 1 
ATOM   3031  C CG2 . VAL A 1 394 ? -19.621 -9.109  -37.770  1.00 64.06  ? 510  VAL A CG2 1 
ATOM   3032  N N   . LEU A 1 395 ? -24.026 -9.350  -37.454  1.00 63.18  ? 511  LEU A N   1 
ATOM   3033  C CA  . LEU A 1 395 ? -25.442 -9.046  -37.335  1.00 65.61  ? 511  LEU A CA  1 
ATOM   3034  C C   . LEU A 1 395 ? -26.004 -9.802  -36.143  1.00 78.39  ? 511  LEU A C   1 
ATOM   3035  O O   . LEU A 1 395 ? -26.774 -9.254  -35.354  1.00 87.88  ? 511  LEU A O   1 
ATOM   3036  C CB  . LEU A 1 395 ? -26.168 -9.458  -38.618  1.00 64.50  ? 511  LEU A CB  1 
ATOM   3037  C CG  . LEU A 1 395 ? -27.656 -9.799  -38.576  1.00 59.52  ? 511  LEU A CG  1 
ATOM   3038  C CD1 . LEU A 1 395 ? -28.467 -8.656  -37.994  1.00 62.06  ? 511  LEU A CD1 1 
ATOM   3039  C CD2 . LEU A 1 395 ? -28.140 -10.143 -39.977  1.00 61.50  ? 511  LEU A CD2 1 
ATOM   3040  N N   . VAL A 1 396 ? -25.605 -11.063 -36.010  1.00 81.38  ? 512  VAL A N   1 
ATOM   3041  C CA  . VAL A 1 396 ? -26.033 -11.881 -34.883  1.00 83.27  ? 512  VAL A CA  1 
ATOM   3042  C C   . VAL A 1 396 ? -25.505 -11.323 -33.564  1.00 83.63  ? 512  VAL A C   1 
ATOM   3043  O O   . VAL A 1 396 ? -26.281 -11.056 -32.649  1.00 88.63  ? 512  VAL A O   1 
ATOM   3044  C CB  . VAL A 1 396 ? -25.599 -13.354 -35.046  1.00 77.05  ? 512  VAL A CB  1 
ATOM   3045  C CG1 . VAL A 1 396 ? -25.880 -14.133 -33.776  1.00 72.64  ? 512  VAL A CG1 1 
ATOM   3046  C CG2 . VAL A 1 396 ? -26.317 -13.985 -36.225  1.00 73.29  ? 512  VAL A CG2 1 
ATOM   3047  N N   . ASN A 1 397 ? -24.192 -11.130 -33.471  1.00 82.74  ? 513  ASN A N   1 
ATOM   3048  C CA  . ASN A 1 397 ? -23.599 -10.637 -32.228  1.00 90.16  ? 513  ASN A CA  1 
ATOM   3049  C C   . ASN A 1 397 ? -24.223 -9.327  -31.762  1.00 84.92  ? 513  ASN A C   1 
ATOM   3050  O O   . ASN A 1 397 ? -24.157 -8.980  -30.584  1.00 90.95  ? 513  ASN A O   1 
ATOM   3051  C CB  . ASN A 1 397 ? -22.080 -10.487 -32.347  1.00 92.65  ? 513  ASN A CB  1 
ATOM   3052  C CG  . ASN A 1 397 ? -21.448 -9.923  -31.079  1.00 87.44  ? 513  ASN A CG  1 
ATOM   3053  O OD1 . ASN A 1 397 ? -21.335 -8.706  -30.912  1.00 80.93  ? 513  ASN A OD1 1 
ATOM   3054  N ND2 . ASN A 1 397 ? -21.034 -10.810 -30.180  1.00 84.41  ? 513  ASN A ND2 1 
ATOM   3055  N N   . THR A 1 398 ? -24.820 -8.594  -32.691  1.00 76.40  ? 514  THR A N   1 
ATOM   3056  C CA  . THR A 1 398 ? -25.538 -7.387  -32.320  1.00 78.90  ? 514  THR A CA  1 
ATOM   3057  C C   . THR A 1 398 ? -26.571 -7.684  -31.242  1.00 82.75  ? 514  THR A C   1 
ATOM   3058  O O   . THR A 1 398 ? -26.676 -6.956  -30.256  1.00 83.85  ? 514  THR A O   1 
ATOM   3059  C CB  . THR A 1 398 ? -26.257 -6.769  -33.522  1.00 80.28  ? 514  THR A CB  1 
ATOM   3060  O OG1 . THR A 1 398 ? -25.291 -6.321  -34.483  1.00 71.66  ? 514  THR A OG1 1 
ATOM   3061  C CG2 . THR A 1 398 ? -27.108 -5.593  -33.074  1.00 80.69  ? 514  THR A CG2 1 
ATOM   3062  N N   . PHE A 1 399 ? -27.339 -8.753  -31.438  1.00 91.16  ? 515  PHE A N   1 
ATOM   3063  C CA  . PHE A 1 399 ? -28.438 -9.086  -30.528  1.00 102.25 ? 515  PHE A CA  1 
ATOM   3064  C C   . PHE A 1 399 ? -28.160 -10.067 -29.360  1.00 110.02 ? 515  PHE A C   1 
ATOM   3065  O O   . PHE A 1 399 ? -28.975 -10.153 -28.450  1.00 107.59 ? 515  PHE A O   1 
ATOM   3066  C CB  . PHE A 1 399 ? -29.659 -9.567  -31.327  1.00 101.87 ? 515  PHE A CB  1 
ATOM   3067  C CG  . PHE A 1 399 ? -30.319 -8.491  -32.152  1.00 100.42 ? 515  PHE A CG  1 
ATOM   3068  C CD1 . PHE A 1 399 ? -31.473 -7.865  -31.706  1.00 110.29 ? 515  PHE A CD1 1 
ATOM   3069  C CD2 . PHE A 1 399 ? -29.791 -8.113  -33.378  1.00 92.06  ? 515  PHE A CD2 1 
ATOM   3070  C CE1 . PHE A 1 399 ? -32.085 -6.877  -32.464  1.00 102.77 ? 515  PHE A CE1 1 
ATOM   3071  C CE2 . PHE A 1 399 ? -30.400 -7.124  -34.138  1.00 85.26  ? 515  PHE A CE2 1 
ATOM   3072  C CZ  . PHE A 1 399 ? -31.546 -6.508  -33.680  1.00 85.63  ? 515  PHE A CZ  1 
ATOM   3073  N N   . CYS A 1 400 ? -27.047 -10.802 -29.346  1.00 111.23 ? 516  CYS A N   1 
ATOM   3074  C CA  . CYS A 1 400 ? -26.759 -11.624 -28.151  1.00 119.70 ? 516  CYS A CA  1 
ATOM   3075  C C   . CYS A 1 400 ? -25.264 -11.587 -27.870  1.00 126.18 ? 516  CYS A C   1 
ATOM   3076  O O   . CYS A 1 400 ? -24.420 -11.950 -28.684  1.00 122.80 ? 516  CYS A O   1 
ATOM   3077  C CB  . CYS A 1 400 ? -27.248 -13.063 -28.263  1.00 124.19 ? 516  CYS A CB  1 
ATOM   3078  S SG  . CYS A 1 400 ? -26.695 -13.851 -29.785  1.00 157.69 ? 516  CYS A SG  1 
ATOM   3079  N N   . ASP A 1 401 ? -24.965 -11.216 -26.634  1.00 126.89 ? 517  ASP A N   1 
ATOM   3080  C CA  . ASP A 1 401 ? -23.617 -10.910 -26.171  1.00 127.65 ? 517  ASP A CA  1 
ATOM   3081  C C   . ASP A 1 401 ? -22.641 -12.083 -26.224  1.00 132.44 ? 517  ASP A C   1 
ATOM   3082  O O   . ASP A 1 401 ? -21.529 -11.972 -26.749  1.00 129.64 ? 517  ASP A O   1 
ATOM   3083  C CB  . ASP A 1 401 ? -23.709 -10.392 -24.733  1.00 129.28 ? 517  ASP A CB  1 
ATOM   3084  C CG  . ASP A 1 401 ? -24.954 -9.551  -24.494  1.00 120.36 ? 517  ASP A CG  1 
ATOM   3085  O OD1 . ASP A 1 401 ? -25.844 -9.501  -25.374  1.00 121.86 ? 517  ASP A OD1 1 
ATOM   3086  O OD2 . ASP A 1 401 ? -25.048 -8.944  -23.408  1.00 106.87 ? 517  ASP A OD2 1 
ATOM   3087  N N   . SER A 1 402 ? -23.064 -13.191 -25.629  1.00 137.35 ? 518  SER A N   1 
ATOM   3088  C CA  . SER A 1 402 ? -22.222 -14.365 -25.415  1.00 136.86 ? 518  SER A CA  1 
ATOM   3089  C C   . SER A 1 402 ? -22.395 -15.541 -26.388  1.00 136.29 ? 518  SER A C   1 
ATOM   3090  O O   . SER A 1 402 ? -21.772 -16.579 -26.203  1.00 141.05 ? 518  SER A O   1 
ATOM   3091  C CB  . SER A 1 402 ? -22.406 -14.844 -23.965  1.00 144.27 ? 518  SER A CB  1 
ATOM   3092  O OG  . SER A 1 402 ? -23.769 -14.682 -23.558  1.00 147.04 ? 518  SER A OG  1 
ATOM   3093  N N   . CYS A 1 403 ? -23.252 -15.408 -27.392  1.00 139.15 ? 519  CYS A N   1 
ATOM   3094  C CA  . CYS A 1 403 ? -23.541 -16.534 -28.261  1.00 137.16 ? 519  CYS A CA  1 
ATOM   3095  C C   . CYS A 1 403 ? -22.430 -16.939 -29.219  1.00 123.25 ? 519  CYS A C   1 
ATOM   3096  O O   . CYS A 1 403 ? -22.443 -18.038 -29.765  1.00 121.10 ? 519  CYS A O   1 
ATOM   3097  C CB  . CYS A 1 403 ? -24.800 -16.182 -29.028  1.00 146.38 ? 519  CYS A CB  1 
ATOM   3098  S SG  . CYS A 1 403 ? -24.753 -14.417 -29.502  1.00 160.31 ? 519  CYS A SG  1 
ATOM   3099  N N   . ILE A 1 404 ? -21.445 -16.068 -29.404  1.00 118.78 ? 520  ILE A N   1 
ATOM   3100  C CA  . ILE A 1 404 ? -20.350 -16.350 -30.329  1.00 109.95 ? 520  ILE A CA  1 
ATOM   3101  C C   . ILE A 1 404 ? -18.982 -16.459 -29.652  1.00 102.30 ? 520  ILE A C   1 
ATOM   3102  O O   . ILE A 1 404 ? -18.461 -15.472 -29.133  1.00 102.97 ? 520  ILE A O   1 
ATOM   3103  C CB  . ILE A 1 404 ? -20.267 -15.287 -31.441  1.00 111.71 ? 520  ILE A CB  1 
ATOM   3104  C CG1 . ILE A 1 404 ? -21.660 -14.963 -31.982  1.00 111.31 ? 520  ILE A CG1 1 
ATOM   3105  C CG2 . ILE A 1 404 ? -19.353 -15.765 -32.561  1.00 108.51 ? 520  ILE A CG2 1 
ATOM   3106  C CD1 . ILE A 1 404 ? -22.333 -16.134 -32.670  1.00 113.98 ? 520  ILE A CD1 1 
ATOM   3107  N N   . PRO A 1 405 ? -18.393 -17.665 -29.661  1.00 92.04  ? 521  PRO A N   1 
ATOM   3108  C CA  . PRO A 1 405 ? -17.037 -17.874 -29.133  1.00 87.23  ? 521  PRO A CA  1 
ATOM   3109  C C   . PRO A 1 405 ? -15.967 -17.356 -30.103  1.00 87.17  ? 521  PRO A C   1 
ATOM   3110  O O   . PRO A 1 405 ? -16.212 -17.335 -31.309  1.00 93.40  ? 521  PRO A O   1 
ATOM   3111  C CB  . PRO A 1 405 ? -16.943 -19.402 -28.996  1.00 85.11  ? 521  PRO A CB  1 
ATOM   3112  C CG  . PRO A 1 405 ? -18.371 -19.909 -29.137  1.00 85.32  ? 521  PRO A CG  1 
ATOM   3113  C CD  . PRO A 1 405 ? -19.036 -18.932 -30.039  1.00 84.14  ? 521  PRO A CD  1 
ATOM   3114  N N   . LYS A 1 406 ? -14.805 -16.954 -29.589  1.00 79.81  ? 522  LYS A N   1 
ATOM   3115  C CA  . LYS A 1 406 ? -13.761 -16.331 -30.415  1.00 82.21  ? 522  LYS A CA  1 
ATOM   3116  C C   . LYS A 1 406 ? -13.364 -17.181 -31.624  1.00 87.35  ? 522  LYS A C   1 
ATOM   3117  O O   . LYS A 1 406 ? -12.981 -16.655 -32.684  1.00 88.86  ? 522  LYS A O   1 
ATOM   3118  C CB  . LYS A 1 406 ? -12.528 -15.994 -29.571  1.00 80.55  ? 522  LYS A CB  1 
ATOM   3119  C CG  . LYS A 1 406 ? -12.764 -14.897 -28.540  1.00 87.48  ? 522  LYS A CG  1 
ATOM   3120  C CD  . LYS A 1 406 ? -11.535 -14.668 -27.669  1.00 82.73  ? 522  LYS A CD  1 
ATOM   3121  C CE  . LYS A 1 406 ? -11.864 -13.842 -26.431  1.00 72.92  ? 522  LYS A CE  1 
ATOM   3122  N NZ  . LYS A 1 406 ? -10.662 -13.610 -25.587  1.00 75.16  ? 522  LYS A NZ  1 
ATOM   3123  N N   . THR A 1 407 ? -13.463 -18.495 -31.453  1.00 83.40  ? 523  THR A N   1 
ATOM   3124  C CA  . THR A 1 407 ? -13.220 -19.441 -32.534  1.00 82.56  ? 523  THR A CA  1 
ATOM   3125  C C   . THR A 1 407 ? -13.963 -19.033 -33.803  1.00 86.06  ? 523  THR A C   1 
ATOM   3126  O O   . THR A 1 407 ? -13.345 -18.772 -34.836  1.00 88.93  ? 523  THR A O   1 
ATOM   3127  C CB  . THR A 1 407 ? -13.627 -20.866 -32.133  1.00 78.75  ? 523  THR A CB  1 
ATOM   3128  O OG1 . THR A 1 407 ? -12.710 -21.365 -31.153  1.00 80.58  ? 523  THR A OG1 1 
ATOM   3129  C CG2 . THR A 1 407 ? -13.604 -21.781 -33.338  1.00 82.16  ? 523  THR A CG2 1 
ATOM   3130  N N   . TYR A 1 408 ? -15.289 -18.992 -33.724  1.00 84.48  ? 524  TYR A N   1 
ATOM   3131  C CA  . TYR A 1 408 ? -16.121 -18.631 -34.869  1.00 83.35  ? 524  TYR A CA  1 
ATOM   3132  C C   . TYR A 1 408 ? -15.665 -17.338 -35.558  1.00 83.35  ? 524  TYR A C   1 
ATOM   3133  O O   . TYR A 1 408 ? -15.661 -17.250 -36.793  1.00 81.54  ? 524  TYR A O   1 
ATOM   3134  C CB  . TYR A 1 408 ? -17.590 -18.545 -34.454  1.00 87.93  ? 524  TYR A CB  1 
ATOM   3135  C CG  . TYR A 1 408 ? -18.203 -19.887 -34.101  1.00 92.52  ? 524  TYR A CG  1 
ATOM   3136  C CD1 . TYR A 1 408 ? -17.509 -21.068 -34.324  1.00 88.35  ? 524  TYR A CD1 1 
ATOM   3137  C CD2 . TYR A 1 408 ? -19.480 -19.972 -33.557  1.00 96.08  ? 524  TYR A CD2 1 
ATOM   3138  C CE1 . TYR A 1 408 ? -18.062 -22.298 -34.011  1.00 95.50  ? 524  TYR A CE1 1 
ATOM   3139  C CE2 . TYR A 1 408 ? -20.043 -21.196 -33.240  1.00 99.84  ? 524  TYR A CE2 1 
ATOM   3140  C CZ  . TYR A 1 408 ? -19.331 -22.357 -33.469  1.00 106.19 ? 524  TYR A CZ  1 
ATOM   3141  O OH  . TYR A 1 408 ? -19.884 -23.582 -33.157  1.00 109.90 ? 524  TYR A OH  1 
ATOM   3142  N N   . TRP A 1 409 ? -15.274 -16.348 -34.757  1.00 84.15  ? 525  TRP A N   1 
ATOM   3143  C CA  . TRP A 1 409 ? -14.736 -15.093 -35.282  1.00 88.09  ? 525  TRP A CA  1 
ATOM   3144  C C   . TRP A 1 409 ? -13.499 -15.340 -36.130  1.00 84.56  ? 525  TRP A C   1 
ATOM   3145  O O   . TRP A 1 409 ? -13.387 -14.862 -37.271  1.00 77.74  ? 525  TRP A O   1 
ATOM   3146  C CB  . TRP A 1 409 ? -14.382 -14.143 -34.139  1.00 81.59  ? 525  TRP A CB  1 
ATOM   3147  C CG  . TRP A 1 409 ? -15.570 -13.682 -33.371  1.00 87.02  ? 525  TRP A CG  1 
ATOM   3148  C CD1 . TRP A 1 409 ? -15.883 -13.986 -32.079  1.00 91.94  ? 525  TRP A CD1 1 
ATOM   3149  C CD2 . TRP A 1 409 ? -16.621 -12.841 -33.852  1.00 83.45  ? 525  TRP A CD2 1 
ATOM   3150  N NE1 . TRP A 1 409 ? -17.062 -13.378 -31.723  1.00 91.16  ? 525  TRP A NE1 1 
ATOM   3151  C CE2 . TRP A 1 409 ? -17.535 -12.671 -32.795  1.00 89.86  ? 525  TRP A CE2 1 
ATOM   3152  C CE3 . TRP A 1 409 ? -16.875 -12.212 -35.072  1.00 82.96  ? 525  TRP A CE3 1 
ATOM   3153  C CZ2 . TRP A 1 409 ? -18.687 -11.897 -32.924  1.00 94.61  ? 525  TRP A CZ2 1 
ATOM   3154  C CZ3 . TRP A 1 409 ? -18.019 -11.445 -35.197  1.00 86.08  ? 525  TRP A CZ3 1 
ATOM   3155  C CH2 . TRP A 1 409 ? -18.909 -11.293 -34.130  1.00 89.20  ? 525  TRP A CH2 1 
ATOM   3156  N N   . ASN A 1 410 ? -12.565 -16.089 -35.558  1.00 79.36  ? 526  ASN A N   1 
ATOM   3157  C CA  . ASN A 1 410 ? -11.350 -16.446 -36.273  1.00 79.82  ? 526  ASN A CA  1 
ATOM   3158  C C   . ASN A 1 410 ? -11.660 -17.152 -37.595  1.00 75.92  ? 526  ASN A C   1 
ATOM   3159  O O   . ASN A 1 410 ? -11.058 -16.855 -38.626  1.00 73.13  ? 526  ASN A O   1 
ATOM   3160  C CB  . ASN A 1 410 ? -10.450 -17.308 -35.387  1.00 79.17  ? 526  ASN A CB  1 
ATOM   3161  C CG  . ASN A 1 410 ? -10.280 -16.726 -33.995  1.00 82.84  ? 526  ASN A CG  1 
ATOM   3162  O OD1 . ASN A 1 410 ? -10.262 -15.509 -33.817  1.00 87.37  ? 526  ASN A OD1 1 
ATOM   3163  N ND2 . ASN A 1 410 ? -10.160 -17.596 -32.998  1.00 82.88  ? 526  ASN A ND2 1 
ATOM   3164  N N   . LEU A 1 411 ? -12.611 -18.080 -37.559  1.00 76.51  ? 527  LEU A N   1 
ATOM   3165  C CA  . LEU A 1 411 ? -12.991 -18.847 -38.744  1.00 77.83  ? 527  LEU A CA  1 
ATOM   3166  C C   . LEU A 1 411 ? -13.541 -17.956 -39.850  1.00 77.75  ? 527  LEU A C   1 
ATOM   3167  O O   . LEU A 1 411 ? -13.070 -18.001 -41.000  1.00 75.44  ? 527  LEU A O   1 
ATOM   3168  C CB  . LEU A 1 411 ? -14.010 -19.930 -38.382  1.00 74.50  ? 527  LEU A CB  1 
ATOM   3169  C CG  . LEU A 1 411 ? -13.412 -21.294 -38.026  1.00 67.24  ? 527  LEU A CG  1 
ATOM   3170  C CD1 . LEU A 1 411 ? -12.521 -21.202 -36.800  1.00 64.19  ? 527  LEU A CD1 1 
ATOM   3171  C CD2 . LEU A 1 411 ? -14.502 -22.330 -37.825  1.00 73.18  ? 527  LEU A CD2 1 
ATOM   3172  N N   . GLY A 1 412 ? -14.542 -17.153 -39.500  1.00 74.47  ? 528  GLY A N   1 
ATOM   3173  C CA  . GLY A 1 412 ? -15.071 -16.169 -40.424  1.00 79.31  ? 528  GLY A CA  1 
ATOM   3174  C C   . GLY A 1 412 ? -13.951 -15.343 -41.034  1.00 83.55  ? 528  GLY A C   1 
ATOM   3175  O O   . GLY A 1 412 ? -13.895 -15.152 -42.257  1.00 82.52  ? 528  GLY A O   1 
ATOM   3176  N N   . TYR A 1 413 ? -13.048 -14.864 -40.182  1.00 78.06  ? 529  TYR A N   1 
ATOM   3177  C CA  . TYR A 1 413 ? -11.887 -14.121 -40.653  1.00 71.06  ? 529  TYR A CA  1 
ATOM   3178  C C   . TYR A 1 413 ? -11.151 -14.899 -41.744  1.00 77.58  ? 529  TYR A C   1 
ATOM   3179  O O   . TYR A 1 413 ? -10.930 -14.399 -42.864  1.00 74.73  ? 529  TYR A O   1 
ATOM   3180  C CB  . TYR A 1 413 ? -10.942 -13.842 -39.489  1.00 61.24  ? 529  TYR A CB  1 
ATOM   3181  C CG  . TYR A 1 413 ? -10.633 -12.383 -39.315  1.00 65.72  ? 529  TYR A CG  1 
ATOM   3182  C CD1 . TYR A 1 413 ? -9.374  -11.875 -39.618  1.00 67.92  ? 529  TYR A CD1 1 
ATOM   3183  C CD2 . TYR A 1 413 ? -11.606 -11.502 -38.865  1.00 70.97  ? 529  TYR A CD2 1 
ATOM   3184  C CE1 . TYR A 1 413 ? -9.088  -10.527 -39.466  1.00 68.01  ? 529  TYR A CE1 1 
ATOM   3185  C CE2 . TYR A 1 413 ? -11.334 -10.150 -38.711  1.00 75.49  ? 529  TYR A CE2 1 
ATOM   3186  C CZ  . TYR A 1 413 ? -10.072 -9.668  -39.014  1.00 75.51  ? 529  TYR A CZ  1 
ATOM   3187  O OH  . TYR A 1 413 ? -9.794  -8.327  -38.863  1.00 71.66  ? 529  TYR A OH  1 
ATOM   3188  N N   . TRP A 1 414 ? -10.790 -16.138 -41.422  1.00 79.08  ? 530  TRP A N   1 
ATOM   3189  C CA  . TRP A 1 414 ? -10.088 -16.972 -42.380  1.00 79.24  ? 530  TRP A CA  1 
ATOM   3190  C C   . TRP A 1 414 ? -10.823 -16.997 -43.712  1.00 78.70  ? 530  TRP A C   1 
ATOM   3191  O O   . TRP A 1 414 ? -10.219 -16.727 -44.745  1.00 78.20  ? 530  TRP A O   1 
ATOM   3192  C CB  . TRP A 1 414 ? -9.850  -18.385 -41.843  1.00 76.40  ? 530  TRP A CB  1 
ATOM   3193  C CG  . TRP A 1 414 ? -8.602  -18.482 -41.015  1.00 81.27  ? 530  TRP A CG  1 
ATOM   3194  C CD1 . TRP A 1 414 ? -8.496  -18.957 -39.741  1.00 87.87  ? 530  TRP A CD1 1 
ATOM   3195  C CD2 . TRP A 1 414 ? -7.282  -18.072 -41.399  1.00 89.91  ? 530  TRP A CD2 1 
ATOM   3196  N NE1 . TRP A 1 414 ? -7.192  -18.880 -39.311  1.00 83.39  ? 530  TRP A NE1 1 
ATOM   3197  C CE2 . TRP A 1 414 ? -6.427  -18.339 -40.309  1.00 91.25  ? 530  TRP A CE2 1 
ATOM   3198  C CE3 . TRP A 1 414 ? -6.739  -17.510 -42.561  1.00 92.01  ? 530  TRP A CE3 1 
ATOM   3199  C CZ2 . TRP A 1 414 ? -5.060  -18.061 -40.345  1.00 95.72  ? 530  TRP A CZ2 1 
ATOM   3200  C CZ3 . TRP A 1 414 ? -5.379  -17.234 -42.596  1.00 89.70  ? 530  TRP A CZ3 1 
ATOM   3201  C CH2 . TRP A 1 414 ? -4.555  -17.510 -41.494  1.00 93.71  ? 530  TRP A CH2 1 
ATOM   3202  N N   . LEU A 1 415 ? -12.121 -17.293 -43.695  1.00 69.35  ? 531  LEU A N   1 
ATOM   3203  C CA  . LEU A 1 415 ? -12.888 -17.262 -44.938  1.00 71.92  ? 531  LEU A CA  1 
ATOM   3204  C C   . LEU A 1 415 ? -12.647 -15.956 -45.684  1.00 76.11  ? 531  LEU A C   1 
ATOM   3205  O O   . LEU A 1 415 ? -12.376 -15.940 -46.901  1.00 71.72  ? 531  LEU A O   1 
ATOM   3206  C CB  . LEU A 1 415 ? -14.379 -17.410 -44.659  1.00 70.47  ? 531  LEU A CB  1 
ATOM   3207  C CG  . LEU A 1 415 ? -14.785 -18.740 -44.044  1.00 79.09  ? 531  LEU A CG  1 
ATOM   3208  C CD1 . LEU A 1 415 ? -16.287 -18.892 -44.162  1.00 75.34  ? 531  LEU A CD1 1 
ATOM   3209  C CD2 . LEU A 1 415 ? -14.068 -19.879 -44.745  1.00 78.94  ? 531  LEU A CD2 1 
ATOM   3210  N N   . CYS A 1 416 ? -12.747 -14.862 -44.935  1.00 80.00  ? 532  CYS A N   1 
ATOM   3211  C CA  . CYS A 1 416 ? -12.558 -13.535 -45.494  1.00 78.23  ? 532  CYS A CA  1 
ATOM   3212  C C   . CYS A 1 416 ? -11.227 -13.478 -46.228  1.00 80.05  ? 532  CYS A C   1 
ATOM   3213  O O   . CYS A 1 416 ? -11.058 -12.718 -47.185  1.00 77.01  ? 532  CYS A O   1 
ATOM   3214  C CB  . CYS A 1 416 ? -12.603 -12.493 -44.388  1.00 69.99  ? 532  CYS A CB  1 
ATOM   3215  S SG  . CYS A 1 416 ? -14.048 -12.595 -43.314  1.00 75.56  ? 532  CYS A SG  1 
ATOM   3216  N N   . TYR A 1 417 ? -10.284 -14.295 -45.771  1.00 75.61  ? 533  TYR A N   1 
ATOM   3217  C CA  . TYR A 1 417 ? -9.002  -14.445 -46.460  1.00 75.11  ? 533  TYR A CA  1 
ATOM   3218  C C   . TYR A 1 417 ? -9.060  -15.330 -47.708  1.00 70.75  ? 533  TYR A C   1 
ATOM   3219  O O   . TYR A 1 417 ? -8.523  -14.984 -48.774  1.00 63.74  ? 533  TYR A O   1 
ATOM   3220  C CB  . TYR A 1 417 ? -7.963  -14.984 -45.485  1.00 77.93  ? 533  TYR A CB  1 
ATOM   3221  C CG  . TYR A 1 417 ? -7.617  -13.994 -44.409  1.00 78.13  ? 533  TYR A CG  1 
ATOM   3222  C CD1 . TYR A 1 417 ? -7.801  -12.636 -44.616  1.00 78.00  ? 533  TYR A CD1 1 
ATOM   3223  C CD2 . TYR A 1 417 ? -7.108  -14.410 -43.192  1.00 76.74  ? 533  TYR A CD2 1 
ATOM   3224  C CE1 . TYR A 1 417 ? -7.484  -11.720 -43.646  1.00 66.53  ? 533  TYR A CE1 1 
ATOM   3225  C CE2 . TYR A 1 417 ? -6.788  -13.499 -42.213  1.00 70.31  ? 533  TYR A CE2 1 
ATOM   3226  C CZ  . TYR A 1 417 ? -6.979  -12.157 -42.450  1.00 62.31  ? 533  TYR A CZ  1 
ATOM   3227  O OH  . TYR A 1 417 ? -6.667  -11.238 -41.487  1.00 72.34  ? 533  TYR A OH  1 
ATOM   3228  N N   . ILE A 1 418 ? -9.708  -16.481 -47.566  1.00 69.79  ? 534  ILE A N   1 
ATOM   3229  C CA  . ILE A 1 418 ? -9.746  -17.449 -48.646  1.00 68.91  ? 534  ILE A CA  1 
ATOM   3230  C C   . ILE A 1 418 ? -10.483 -16.867 -49.841  1.00 72.89  ? 534  ILE A C   1 
ATOM   3231  O O   . ILE A 1 418 ? -10.406 -17.410 -50.939  1.00 70.88  ? 534  ILE A O   1 
ATOM   3232  C CB  . ILE A 1 418 ? -10.364 -18.799 -48.224  1.00 61.09  ? 534  ILE A CB  1 
ATOM   3233  C CG1 . ILE A 1 418 ? -11.870 -18.807 -48.479  1.00 63.23  ? 534  ILE A CG1 1 
ATOM   3234  C CG2 . ILE A 1 418 ? -10.020 -19.113 -46.774  1.00 55.46  ? 534  ILE A CG2 1 
ATOM   3235  C CD1 . ILE A 1 418 ? -12.462 -20.199 -48.531  1.00 63.67  ? 534  ILE A CD1 1 
ATOM   3236  N N   . ASN A 1 419 ? -11.199 -15.764 -49.630  1.00 72.12  ? 535  ASN A N   1 
ATOM   3237  C CA  . ASN A 1 419 ? -11.634 -14.959 -50.768  1.00 73.67  ? 535  ASN A CA  1 
ATOM   3238  C C   . ASN A 1 419 ? -10.419 -14.552 -51.588  1.00 71.72  ? 535  ASN A C   1 
ATOM   3239  O O   . ASN A 1 419 ? -10.275 -14.920 -52.759  1.00 68.03  ? 535  ASN A O   1 
ATOM   3240  C CB  . ASN A 1 419 ? -12.391 -13.711 -50.316  1.00 72.65  ? 535  ASN A CB  1 
ATOM   3241  C CG  . ASN A 1 419 ? -12.516 -12.672 -51.423  1.00 76.82  ? 535  ASN A CG  1 
ATOM   3242  O OD1 . ASN A 1 419 ? -11.804 -11.667 -51.427  1.00 79.70  ? 535  ASN A OD1 1 
ATOM   3243  N ND2 . ASN A 1 419 ? -13.419 -12.912 -52.369  1.00 72.25  ? 535  ASN A ND2 1 
ATOM   3244  N N   . SER A 1 420 ? -9.548  -13.781 -50.945  1.00 73.43  ? 536  SER A N   1 
ATOM   3245  C CA  . SER A 1 420 ? -8.322  -13.297 -51.562  1.00 76.07  ? 536  SER A CA  1 
ATOM   3246  C C   . SER A 1 420 ? -7.519  -14.442 -52.157  1.00 74.39  ? 536  SER A C   1 
ATOM   3247  O O   . SER A 1 420 ? -6.801  -14.264 -53.141  1.00 74.71  ? 536  SER A O   1 
ATOM   3248  C CB  . SER A 1 420 ? -7.475  -12.541 -50.539  1.00 77.66  ? 536  SER A CB  1 
ATOM   3249  O OG  . SER A 1 420 ? -8.167  -11.403 -50.057  1.00 85.43  ? 536  SER A OG  1 
ATOM   3250  N N   . THR A 1 421 ? -7.643  -15.620 -51.558  1.00 73.24  ? 537  THR A N   1 
ATOM   3251  C CA  . THR A 1 421 ? -6.997  -16.802 -52.119  1.00 71.85  ? 537  THR A CA  1 
ATOM   3252  C C   . THR A 1 421 ? -7.653  -17.214 -53.435  1.00 66.16  ? 537  THR A C   1 
ATOM   3253  O O   . THR A 1 421 ? -6.977  -17.457 -54.435  1.00 61.41  ? 537  THR A O   1 
ATOM   3254  C CB  . THR A 1 421 ? -7.071  -17.997 -51.150  1.00 77.30  ? 537  THR A CB  1 
ATOM   3255  O OG1 . THR A 1 421 ? -6.532  -17.622 -49.876  1.00 83.97  ? 537  THR A OG1 1 
ATOM   3256  C CG2 . THR A 1 421 ? -6.294  -19.184 -51.705  1.00 81.55  ? 537  THR A CG2 1 
ATOM   3257  N N   . VAL A 1 422 ? -8.980  -17.274 -53.421  1.00 65.08  ? 538  VAL A N   1 
ATOM   3258  C CA  . VAL A 1 422 ? -9.758  -17.861 -54.505  1.00 65.92  ? 538  VAL A CA  1 
ATOM   3259  C C   . VAL A 1 422 ? -9.906  -16.955 -55.727  1.00 70.86  ? 538  VAL A C   1 
ATOM   3260  O O   . VAL A 1 422 ? -10.201 -17.435 -56.819  1.00 68.23  ? 538  VAL A O   1 
ATOM   3261  C CB  . VAL A 1 422 ? -11.159 -18.280 -54.007  1.00 62.64  ? 538  VAL A CB  1 
ATOM   3262  C CG1 . VAL A 1 422 ? -11.986 -18.846 -55.147  1.00 61.15  ? 538  VAL A CG1 1 
ATOM   3263  C CG2 . VAL A 1 422 ? -11.038 -19.294 -52.885  1.00 62.77  ? 538  VAL A CG2 1 
ATOM   3264  N N   . ASN A 1 423 ? -9.700  -15.652 -55.548  1.00 76.79  ? 539  ASN A N   1 
ATOM   3265  C CA  . ASN A 1 423 ? -9.898  -14.694 -56.644  1.00 71.29  ? 539  ASN A CA  1 
ATOM   3266  C C   . ASN A 1 423 ? -9.021  -14.916 -57.889  1.00 70.74  ? 539  ASN A C   1 
ATOM   3267  O O   . ASN A 1 423 ? -9.531  -14.893 -59.017  1.00 64.28  ? 539  ASN A O   1 
ATOM   3268  C CB  . ASN A 1 423 ? -9.797  -13.253 -56.133  1.00 71.33  ? 539  ASN A CB  1 
ATOM   3269  C CG  . ASN A 1 423 ? -10.950 -12.880 -55.210  1.00 81.01  ? 539  ASN A CG  1 
ATOM   3270  O OD1 . ASN A 1 423 ? -12.118 -12.989 -55.581  1.00 82.81  ? 539  ASN A OD1 1 
ATOM   3271  N ND2 . ASN A 1 423 ? -10.623 -12.457 -53.993  1.00 77.87  ? 539  ASN A ND2 1 
ATOM   3272  N N   . PRO A 1 424 ? -7.706  -15.136 -57.692  1.00 72.79  ? 540  PRO A N   1 
ATOM   3273  C CA  . PRO A 1 424 ? -6.857  -15.512 -58.829  1.00 68.82  ? 540  PRO A CA  1 
ATOM   3274  C C   . PRO A 1 424 ? -7.352  -16.803 -59.457  1.00 71.14  ? 540  PRO A C   1 
ATOM   3275  O O   . PRO A 1 424 ? -7.427  -16.910 -60.682  1.00 75.63  ? 540  PRO A O   1 
ATOM   3276  C CB  . PRO A 1 424 ? -5.490  -15.756 -58.185  1.00 62.68  ? 540  PRO A CB  1 
ATOM   3277  C CG  . PRO A 1 424 ? -5.503  -14.957 -56.957  1.00 72.75  ? 540  PRO A CG  1 
ATOM   3278  C CD  . PRO A 1 424 ? -6.922  -14.973 -56.455  1.00 71.29  ? 540  PRO A CD  1 
ATOM   3279  N N   . VAL A 1 425 ? -7.688  -17.774 -58.613  1.00 69.49  ? 541  VAL A N   1 
ATOM   3280  C CA  . VAL A 1 425 ? -8.216  -19.053 -59.075  1.00 69.40  ? 541  VAL A CA  1 
ATOM   3281  C C   . VAL A 1 425 ? -9.382  -18.852 -60.038  1.00 75.45  ? 541  VAL A C   1 
ATOM   3282  O O   . VAL A 1 425 ? -9.427  -19.457 -61.108  1.00 78.10  ? 541  VAL A O   1 
ATOM   3283  C CB  . VAL A 1 425 ? -8.695  -19.921 -57.900  1.00 70.47  ? 541  VAL A CB  1 
ATOM   3284  C CG1 . VAL A 1 425 ? -9.127  -21.288 -58.403  1.00 67.06  ? 541  VAL A CG1 1 
ATOM   3285  C CG2 . VAL A 1 425 ? -7.591  -20.052 -56.859  1.00 73.14  ? 541  VAL A CG2 1 
ATOM   3286  N N   . CYS A 1 426 ? -10.320 -17.992 -59.653  1.00 78.93  ? 542  CYS A N   1 
ATOM   3287  C CA  . CYS A 1 426 ? -11.465 -17.669 -60.497  1.00 80.21  ? 542  CYS A CA  1 
ATOM   3288  C C   . CYS A 1 426 ? -11.018 -16.970 -61.778  1.00 78.09  ? 542  CYS A C   1 
ATOM   3289  O O   . CYS A 1 426 ? -11.576 -17.212 -62.854  1.00 78.44  ? 542  CYS A O   1 
ATOM   3290  C CB  . CYS A 1 426 ? -12.457 -16.790 -59.734  1.00 81.90  ? 542  CYS A CB  1 
ATOM   3291  S SG  . CYS A 1 426 ? -13.004 -17.486 -58.155  1.00 88.01  ? 542  CYS A SG  1 
ATOM   3292  N N   . TYR A 1 427 ? -10.014 -16.103 -61.658  1.00 72.75  ? 543  TYR A N   1 
ATOM   3293  C CA  . TYR A 1 427 ? -9.425  -15.471 -62.833  1.00 74.95  ? 543  TYR A CA  1 
ATOM   3294  C C   . TYR A 1 427 ? -9.038  -16.518 -63.864  1.00 78.58  ? 543  TYR A C   1 
ATOM   3295  O O   . TYR A 1 427 ? -9.591  -16.561 -64.963  1.00 83.02  ? 543  TYR A O   1 
ATOM   3296  C CB  . TYR A 1 427 ? -8.167  -14.685 -62.467  1.00 77.42  ? 543  TYR A CB  1 
ATOM   3297  C CG  . TYR A 1 427 ? -8.414  -13.365 -61.792  1.00 69.76  ? 543  TYR A CG  1 
ATOM   3298  C CD1 . TYR A 1 427 ? -9.692  -12.968 -61.452  1.00 71.06  ? 543  TYR A CD1 1 
ATOM   3299  C CD2 . TYR A 1 427 ? -7.361  -12.508 -61.508  1.00 70.26  ? 543  TYR A CD2 1 
ATOM   3300  C CE1 . TYR A 1 427 ? -9.915  -11.761 -60.836  1.00 77.71  ? 543  TYR A CE1 1 
ATOM   3301  C CE2 . TYR A 1 427 ? -7.572  -11.300 -60.894  1.00 71.06  ? 543  TYR A CE2 1 
ATOM   3302  C CZ  . TYR A 1 427 ? -8.850  -10.930 -60.559  1.00 77.38  ? 543  TYR A CZ  1 
ATOM   3303  O OH  . TYR A 1 427 ? -9.070  -9.723  -59.938  1.00 83.26  ? 543  TYR A OH  1 
ATOM   3304  N N   . ALA A 1 428 ? -8.066  -17.349 -63.501  1.00 73.90  ? 544  ALA A N   1 
ATOM   3305  C CA  . ALA A 1 428 ? -7.538  -18.357 -64.408  1.00 78.85  ? 544  ALA A CA  1 
ATOM   3306  C C   . ALA A 1 428 ? -8.639  -19.269 -64.923  1.00 89.11  ? 544  ALA A C   1 
ATOM   3307  O O   . ALA A 1 428 ? -8.768  -19.470 -66.129  1.00 98.72  ? 544  ALA A O   1 
ATOM   3308  C CB  . ALA A 1 428 ? -6.455  -19.169 -63.723  1.00 82.19  ? 544  ALA A CB  1 
ATOM   3309  N N   . LEU A 1 429 ? -9.436  -19.810 -64.006  1.00 88.85  ? 545  LEU A N   1 
ATOM   3310  C CA  . LEU A 1 429 ? -10.484 -20.766 -64.364  1.00 87.65  ? 545  LEU A CA  1 
ATOM   3311  C C   . LEU A 1 429 ? -11.498 -20.199 -65.354  1.00 88.87  ? 545  LEU A C   1 
ATOM   3312  O O   . LEU A 1 429 ? -12.002 -20.917 -66.216  1.00 87.00  ? 545  LEU A O   1 
ATOM   3313  C CB  . LEU A 1 429 ? -11.194 -21.283 -63.113  1.00 82.74  ? 545  LEU A CB  1 
ATOM   3314  C CG  . LEU A 1 429 ? -10.316 -22.106 -62.169  1.00 86.29  ? 545  LEU A CG  1 
ATOM   3315  C CD1 . LEU A 1 429 ? -11.136 -22.625 -61.002  1.00 88.87  ? 545  LEU A CD1 1 
ATOM   3316  C CD2 . LEU A 1 429 ? -9.651  -23.253 -62.915  1.00 84.43  ? 545  LEU A CD2 1 
ATOM   3317  N N   . CYS A 1 430 ? -11.803 -18.913 -65.227  1.00 88.99  ? 546  CYS A N   1 
ATOM   3318  C CA  . CYS A 1 430 ? -12.724 -18.272 -66.155  1.00 89.75  ? 546  CYS A CA  1 
ATOM   3319  C C   . CYS A 1 430 ? -12.094 -17.995 -67.521  1.00 97.03  ? 546  CYS A C   1 
ATOM   3320  O O   . CYS A 1 430 ? -12.648 -18.372 -68.553  1.00 101.82 ? 546  CYS A O   1 
ATOM   3321  C CB  . CYS A 1 430 ? -13.282 -16.988 -65.544  1.00 87.87  ? 546  CYS A CB  1 
ATOM   3322  S SG  . CYS A 1 430 ? -14.442 -17.286 -64.203  1.00 102.83 ? 546  CYS A SG  1 
ATOM   3323  N N   . ASN A 1 431 ? -10.927 -17.357 -67.525  1.00 100.62 ? 547  ASN A N   1 
ATOM   3324  C CA  . ASN A 1 431 ? -10.238 -17.033 -68.771  1.00 103.65 ? 547  ASN A CA  1 
ATOM   3325  C C   . ASN A 1 431 ? -9.132  -18.026 -69.096  1.00 102.94 ? 547  ASN A C   1 
ATOM   3326  O O   . ASN A 1 431 ? -8.171  -18.165 -68.337  1.00 98.41  ? 547  ASN A O   1 
ATOM   3327  C CB  . ASN A 1 431 ? -9.637  -15.625 -68.717  1.00 100.52 ? 547  ASN A CB  1 
ATOM   3328  C CG  . ASN A 1 431 ? -10.684 -14.545 -68.548  1.00 94.11  ? 547  ASN A CG  1 
ATOM   3329  O OD1 . ASN A 1 431 ? -11.824 -14.819 -68.176  1.00 91.34  ? 547  ASN A OD1 1 
ATOM   3330  N ND2 . ASN A 1 431 ? -10.297 -13.303 -68.820  1.00 87.95  ? 547  ASN A ND2 1 
ATOM   3331  N N   . LYS A 1 432 ? -9.265  -18.711 -70.226  1.00 103.68 ? 548  LYS A N   1 
ATOM   3332  C CA  . LYS A 1 432 ? -8.209  -19.601 -70.687  1.00 109.77 ? 548  LYS A CA  1 
ATOM   3333  C C   . LYS A 1 432 ? -6.921  -18.818 -70.923  1.00 117.44 ? 548  LYS A C   1 
ATOM   3334  O O   . LYS A 1 432 ? -5.821  -19.373 -70.844  1.00 122.60 ? 548  LYS A O   1 
ATOM   3335  C CB  . LYS A 1 432 ? -8.630  -20.330 -71.962  1.00 114.17 ? 548  LYS A CB  1 
ATOM   3336  C CG  . LYS A 1 432 ? -9.690  -21.396 -71.742  1.00 122.64 ? 548  LYS A CG  1 
ATOM   3337  C CD  . LYS A 1 432 ? -9.844  -22.282 -72.974  1.00 127.70 ? 548  LYS A CD  1 
ATOM   3338  C CE  . LYS A 1 432 ? -10.857 -23.396 -72.743  1.00 107.13 ? 548  LYS A CE  1 
ATOM   3339  N NZ  . LYS A 1 432 ? -10.973 -24.299 -73.923  1.00 60.17  ? 548  LYS A NZ  1 
ATOM   3340  N N   . THR A 1 433 ? -7.069  -17.524 -71.200  1.00 116.21 ? 549  THR A N   1 
ATOM   3341  C CA  . THR A 1 433 ? -5.929  -16.637 -71.401  1.00 110.49 ? 549  THR A CA  1 
ATOM   3342  C C   . THR A 1 433 ? -5.004  -16.690 -70.188  1.00 106.82 ? 549  THR A C   1 
ATOM   3343  O O   . THR A 1 433 ? -3.812  -16.999 -70.305  1.00 105.81 ? 549  THR A O   1 
ATOM   3344  C CB  . THR A 1 433 ? -6.382  -15.179 -71.613  1.00 105.56 ? 549  THR A CB  1 
ATOM   3345  O OG1 . THR A 1 433 ? -7.616  -15.153 -72.343  1.00 97.04  ? 549  THR A OG1 1 
ATOM   3346  C CG2 . THR A 1 433 ? -5.323  -14.397 -72.373  1.00 101.17 ? 549  THR A CG2 1 
ATOM   3347  N N   . PHE A 1 434 ? -5.566  -16.400 -69.019  1.00 103.49 ? 550  PHE A N   1 
ATOM   3348  C CA  . PHE A 1 434 ? -4.815  -16.475 -67.774  1.00 105.53 ? 550  PHE A CA  1 
ATOM   3349  C C   . PHE A 1 434 ? -4.260  -17.884 -67.542  1.00 113.08 ? 550  PHE A C   1 
ATOM   3350  O O   . PHE A 1 434 ? -3.177  -18.043 -66.978  1.00 113.57 ? 550  PHE A O   1 
ATOM   3351  C CB  . PHE A 1 434 ? -5.680  -16.030 -66.588  1.00 99.41  ? 550  PHE A CB  1 
ATOM   3352  C CG  . PHE A 1 434 ? -6.063  -14.568 -66.621  1.00 104.33 ? 550  PHE A CG  1 
ATOM   3353  C CD1 . PHE A 1 434 ? -5.281  -13.612 -65.987  1.00 99.75  ? 550  PHE A CD1 1 
ATOM   3354  C CD2 . PHE A 1 434 ? -7.211  -14.150 -67.280  1.00 107.25 ? 550  PHE A CD2 1 
ATOM   3355  C CE1 . PHE A 1 434 ? -5.635  -12.267 -66.016  1.00 92.90  ? 550  PHE A CE1 1 
ATOM   3356  C CE2 . PHE A 1 434 ? -7.571  -12.806 -67.312  1.00 98.76  ? 550  PHE A CE2 1 
ATOM   3357  C CZ  . PHE A 1 434 ? -6.782  -11.866 -66.679  1.00 87.35  ? 550  PHE A CZ  1 
ATOM   3358  N N   . ARG A 1 435 ? -5.000  -18.901 -67.984  1.00 116.57 ? 551  ARG A N   1 
ATOM   3359  C CA  . ARG A 1 435 ? -4.545  -20.291 -67.888  1.00 112.96 ? 551  ARG A CA  1 
ATOM   3360  C C   . ARG A 1 435 ? -3.201  -20.487 -68.575  1.00 117.70 ? 551  ARG A C   1 
ATOM   3361  O O   . ARG A 1 435 ? -2.192  -20.810 -67.937  1.00 117.42 ? 551  ARG A O   1 
ATOM   3362  C CB  . ARG A 1 435 ? -5.553  -21.242 -68.530  1.00 103.58 ? 551  ARG A CB  1 
ATOM   3363  C CG  . ARG A 1 435 ? -6.905  -21.282 -67.866  1.00 106.48 ? 551  ARG A CG  1 
ATOM   3364  C CD  . ARG A 1 435 ? -7.806  -22.278 -68.571  1.00 109.92 ? 551  ARG A CD  1 
ATOM   3365  N NE  . ARG A 1 435 ? -9.157  -22.284 -68.021  1.00 111.76 ? 551  ARG A NE  1 
ATOM   3366  C CZ  . ARG A 1 435 ? -10.134 -23.078 -68.446  1.00 112.90 ? 551  ARG A CZ  1 
ATOM   3367  N NH1 . ARG A 1 435 ? -9.911  -23.938 -69.432  1.00 110.24 ? 551  ARG A NH1 1 
ATOM   3368  N NH2 . ARG A 1 435 ? -11.333 -23.013 -67.883  1.00 111.77 ? 551  ARG A NH2 1 
ATOM   3369  N N   . THR A 1 436 ? -3.209  -20.302 -69.891  1.00 119.73 ? 552  THR A N   1 
ATOM   3370  C CA  . THR A 1 436 ? -2.022  -20.507 -70.709  1.00 123.00 ? 552  THR A CA  1 
ATOM   3371  C C   . THR A 1 436 ? -0.898  -19.549 -70.331  1.00 120.43 ? 552  THR A C   1 
ATOM   3372  O O   . THR A 1 436 ? 0.279   -19.870 -70.500  1.00 123.94 ? 552  THR A O   1 
ATOM   3373  C CB  . THR A 1 436 ? -2.342  -20.349 -72.207  1.00 121.80 ? 552  THR A CB  1 
ATOM   3374  O OG1 . THR A 1 436 ? -2.730  -18.995 -72.476  1.00 114.40 ? 552  THR A OG1 1 
ATOM   3375  C CG2 . THR A 1 436 ? -3.472  -21.292 -72.610  1.00 115.83 ? 552  THR A CG2 1 
ATOM   3376  N N   . THR A 1 437 ? -1.256  -18.375 -69.817  1.00 111.63 ? 553  THR A N   1 
ATOM   3377  C CA  . THR A 1 437 ? -0.242  -17.413 -69.399  1.00 110.89 ? 553  THR A CA  1 
ATOM   3378  C C   . THR A 1 437 ? 0.443   -17.831 -68.098  1.00 114.05 ? 553  THR A C   1 
ATOM   3379  O O   . THR A 1 437 ? 1.634   -17.582 -67.906  1.00 112.53 ? 553  THR A O   1 
ATOM   3380  C CB  . THR A 1 437 ? -0.818  -16.003 -69.237  1.00 111.94 ? 553  THR A CB  1 
ATOM   3381  O OG1 . THR A 1 437 ? -1.572  -15.660 -70.406  1.00 117.90 ? 553  THR A OG1 1 
ATOM   3382  C CG2 . THR A 1 437 ? 0.308   -14.994 -69.050  1.00 110.24 ? 553  THR A CG2 1 
ATOM   3383  N N   . PHE A 1 438 ? -0.314  -18.463 -67.206  1.00 116.74 ? 554  PHE A N   1 
ATOM   3384  C CA  . PHE A 1 438 ? 0.250   -18.988 -65.968  1.00 117.22 ? 554  PHE A CA  1 
ATOM   3385  C C   . PHE A 1 438 ? 1.117   -20.203 -66.251  1.00 121.57 ? 554  PHE A C   1 
ATOM   3386  O O   . PHE A 1 438 ? 2.244   -20.304 -65.760  1.00 120.07 ? 554  PHE A O   1 
ATOM   3387  C CB  . PHE A 1 438 ? -0.858  -19.358 -64.984  1.00 109.89 ? 554  PHE A CB  1 
ATOM   3388  C CG  . PHE A 1 438 ? -1.540  -18.173 -64.375  1.00 107.62 ? 554  PHE A CG  1 
ATOM   3389  C CD1 . PHE A 1 438 ? -2.820  -18.279 -63.859  1.00 102.54 ? 554  PHE A CD1 1 
ATOM   3390  C CD2 . PHE A 1 438 ? -0.896  -16.947 -64.320  1.00 105.25 ? 554  PHE A CD2 1 
ATOM   3391  C CE1 . PHE A 1 438 ? -3.449  -17.180 -63.299  1.00 98.96  ? 554  PHE A CE1 1 
ATOM   3392  C CE2 . PHE A 1 438 ? -1.517  -15.844 -63.762  1.00 100.32 ? 554  PHE A CE2 1 
ATOM   3393  C CZ  . PHE A 1 438 ? -2.797  -15.961 -63.250  1.00 96.83  ? 554  PHE A CZ  1 
ATOM   3394  N N   . LYS A 1 439 ? 0.585   -21.117 -67.059  1.00 121.05 ? 555  LYS A N   1 
ATOM   3395  C CA  . LYS A 1 439 ? 1.277   -22.360 -67.376  1.00 124.68 ? 555  LYS A CA  1 
ATOM   3396  C C   . LYS A 1 439 ? 2.732   -22.105 -67.765  1.00 127.67 ? 555  LYS A C   1 
ATOM   3397  O O   . LYS A 1 439 ? 3.644   -22.764 -67.263  1.00 131.37 ? 555  LYS A O   1 
ATOM   3398  C CB  . LYS A 1 439 ? 0.551   -23.097 -68.504  1.00 118.06 ? 555  LYS A CB  1 
ATOM   3399  N N   . THR A 1 440 ? 2.944   -21.137 -68.649  1.00 125.65 ? 556  THR A N   1 
ATOM   3400  C CA  . THR A 1 440 ? 4.286   -20.802 -69.106  1.00 130.89 ? 556  THR A CA  1 
ATOM   3401  C C   . THR A 1 440 ? 5.084   -20.094 -68.013  1.00 127.13 ? 556  THR A C   1 
ATOM   3402  O O   . THR A 1 440 ? 4.833   -20.281 -66.822  1.00 113.45 ? 556  THR A O   1 
ATOM   3403  C CB  . THR A 1 440 ? 4.244   -19.925 -70.377  1.00 132.76 ? 556  THR A CB  1 
ATOM   3404  O OG1 . THR A 1 440 ? 3.808   -18.602 -70.043  1.00 126.80 ? 556  THR A OG1 1 
ATOM   3405  C CG2 . THR A 1 440 ? 3.292   -20.523 -71.403  1.00 132.69 ? 556  THR A CG2 1 
ATOM   3406  N N   . THR B 1 8   ? -53.020 28.241  -63.105  1.00 131.83 ? 63   THR B N   1 
ATOM   3407  C CA  . THR B 1 8   ? -51.915 27.452  -62.571  1.00 138.83 ? 63   THR B CA  1 
ATOM   3408  C C   . THR B 1 8   ? -50.877 28.332  -61.882  1.00 143.01 ? 63   THR B C   1 
ATOM   3409  O O   . THR B 1 8   ? -50.528 28.101  -60.724  1.00 139.86 ? 63   THR B O   1 
ATOM   3410  C CB  . THR B 1 8   ? -51.220 26.627  -63.672  1.00 128.29 ? 63   THR B CB  1 
ATOM   3411  N N   . ILE B 1 9   ? -50.382 29.338  -62.598  1.00 148.31 ? 64   ILE B N   1 
ATOM   3412  C CA  . ILE B 1 9   ? -49.360 30.230  -62.057  1.00 147.48 ? 64   ILE B CA  1 
ATOM   3413  C C   . ILE B 1 9   ? -49.870 30.972  -60.822  1.00 139.74 ? 64   ILE B C   1 
ATOM   3414  O O   . ILE B 1 9   ? -49.114 31.248  -59.888  1.00 142.23 ? 64   ILE B O   1 
ATOM   3415  C CB  . ILE B 1 9   ? -48.883 31.253  -63.111  1.00 131.07 ? 64   ILE B CB  1 
ATOM   3416  N N   . TRP B 1 10  ? -51.159 31.285  -60.825  1.00 129.39 ? 65   TRP B N   1 
ATOM   3417  C CA  . TRP B 1 10  ? -51.781 31.993  -59.719  1.00 129.01 ? 65   TRP B CA  1 
ATOM   3418  C C   . TRP B 1 10  ? -51.671 31.186  -58.428  1.00 134.52 ? 65   TRP B C   1 
ATOM   3419  O O   . TRP B 1 10  ? -51.072 31.634  -57.444  1.00 141.08 ? 65   TRP B O   1 
ATOM   3420  C CB  . TRP B 1 10  ? -53.246 32.250  -60.060  1.00 134.75 ? 65   TRP B CB  1 
ATOM   3421  C CG  . TRP B 1 10  ? -54.000 33.025  -59.039  1.00 138.13 ? 65   TRP B CG  1 
ATOM   3422  C CD1 . TRP B 1 10  ? -54.114 34.379  -58.963  1.00 135.13 ? 65   TRP B CD1 1 
ATOM   3423  C CD2 . TRP B 1 10  ? -54.776 32.493  -57.958  1.00 149.76 ? 65   TRP B CD2 1 
ATOM   3424  N NE1 . TRP B 1 10  ? -54.904 34.728  -57.895  1.00 145.53 ? 65   TRP B NE1 1 
ATOM   3425  C CE2 . TRP B 1 10  ? -55.323 33.588  -57.261  1.00 153.81 ? 65   TRP B CE2 1 
ATOM   3426  C CE3 . TRP B 1 10  ? -55.056 31.199  -57.508  1.00 152.59 ? 65   TRP B CE3 1 
ATOM   3427  C CZ2 . TRP B 1 10  ? -56.135 33.429  -56.138  1.00 158.30 ? 65   TRP B CZ2 1 
ATOM   3428  C CZ3 . TRP B 1 10  ? -55.862 31.043  -56.391  1.00 153.25 ? 65   TRP B CZ3 1 
ATOM   3429  C CH2 . TRP B 1 10  ? -56.392 32.152  -55.720  1.00 154.52 ? 65   TRP B CH2 1 
ATOM   3430  N N   . GLN B 1 11  ? -52.227 29.981  -58.443  1.00 134.76 ? 66   GLN B N   1 
ATOM   3431  C CA  . GLN B 1 11  ? -52.190 29.120  -57.269  1.00 137.09 ? 66   GLN B CA  1 
ATOM   3432  C C   . GLN B 1 11  ? -50.753 28.799  -56.868  1.00 133.42 ? 66   GLN B C   1 
ATOM   3433  O O   . GLN B 1 11  ? -50.438 28.710  -55.681  1.00 133.50 ? 66   GLN B O   1 
ATOM   3434  C CB  . GLN B 1 11  ? -52.974 27.829  -57.516  1.00 142.78 ? 66   GLN B CB  1 
ATOM   3435  C CG  . GLN B 1 11  ? -52.452 26.998  -58.674  1.00 140.34 ? 66   GLN B CG  1 
ATOM   3436  C CD  . GLN B 1 11  ? -53.222 25.708  -58.861  1.00 131.72 ? 66   GLN B CD  1 
ATOM   3437  O OE1 . GLN B 1 11  ? -52.834 24.850  -59.654  1.00 124.96 ? 66   GLN B OE1 1 
ATOM   3438  N NE2 . GLN B 1 11  ? -54.322 25.564  -58.130  1.00 127.46 ? 66   GLN B NE2 1 
ATOM   3439  N N   . VAL B 1 12  ? -49.883 28.623  -57.858  1.00 129.94 ? 67   VAL B N   1 
ATOM   3440  C CA  . VAL B 1 12  ? -48.479 28.347  -57.579  1.00 131.18 ? 67   VAL B CA  1 
ATOM   3441  C C   . VAL B 1 12  ? -47.881 29.476  -56.750  1.00 127.32 ? 67   VAL B C   1 
ATOM   3442  O O   . VAL B 1 12  ? -47.265 29.240  -55.702  1.00 130.69 ? 67   VAL B O   1 
ATOM   3443  C CB  . VAL B 1 12  ? -47.658 28.156  -58.872  1.00 137.65 ? 67   VAL B CB  1 
ATOM   3444  C CG1 . VAL B 1 12  ? -46.165 28.196  -58.571  1.00 138.03 ? 67   VAL B CG1 1 
ATOM   3445  C CG2 . VAL B 1 12  ? -48.030 26.849  -59.554  1.00 135.20 ? 67   VAL B CG2 1 
ATOM   3446  N N   . VAL B 1 13  ? -48.071 30.707  -57.215  1.00 124.86 ? 68   VAL B N   1 
ATOM   3447  C CA  . VAL B 1 13  ? -47.596 31.861  -56.469  1.00 127.49 ? 68   VAL B CA  1 
ATOM   3448  C C   . VAL B 1 13  ? -48.291 31.928  -55.109  1.00 128.91 ? 68   VAL B C   1 
ATOM   3449  O O   . VAL B 1 13  ? -47.776 32.539  -54.172  1.00 124.82 ? 68   VAL B O   1 
ATOM   3450  C CB  . VAL B 1 13  ? -47.820 33.175  -57.244  1.00 122.36 ? 68   VAL B CB  1 
ATOM   3451  N N   . PHE B 1 14  ? -49.456 31.292  -55.006  1.00 130.09 ? 69   PHE B N   1 
ATOM   3452  C CA  . PHE B 1 14  ? -50.144 31.175  -53.721  1.00 125.42 ? 69   PHE B CA  1 
ATOM   3453  C C   . PHE B 1 14  ? -49.380 30.312  -52.721  1.00 125.49 ? 69   PHE B C   1 
ATOM   3454  O O   . PHE B 1 14  ? -49.050 30.761  -51.629  1.00 126.25 ? 69   PHE B O   1 
ATOM   3455  C CB  . PHE B 1 14  ? -51.565 30.631  -53.910  1.00 132.61 ? 69   PHE B CB  1 
ATOM   3456  N N   . ILE B 1 15  ? -49.094 29.071  -53.100  1.00 128.38 ? 70   ILE B N   1 
ATOM   3457  C CA  . ILE B 1 15  ? -48.384 28.139  -52.210  1.00 125.86 ? 70   ILE B CA  1 
ATOM   3458  C C   . ILE B 1 15  ? -46.939 28.584  -51.958  1.00 127.74 ? 70   ILE B C   1 
ATOM   3459  O O   . ILE B 1 15  ? -46.315 28.223  -50.956  1.00 126.11 ? 70   ILE B O   1 
ATOM   3460  C CB  . ILE B 1 15  ? -48.389 26.710  -52.769  1.00 118.21 ? 70   ILE B CB  1 
ATOM   3461  N N   . ALA B 1 16  ? -46.431 29.395  -52.884  1.00 129.92 ? 71   ALA B N   1 
ATOM   3462  C CA  . ALA B 1 16  ? -45.064 29.917  -52.824  1.00 124.41 ? 71   ALA B CA  1 
ATOM   3463  C C   . ALA B 1 16  ? -44.712 30.488  -51.451  1.00 122.74 ? 71   ALA B C   1 
ATOM   3464  O O   . ALA B 1 16  ? -43.679 30.156  -50.863  1.00 124.53 ? 71   ALA B O   1 
ATOM   3465  C CB  . ALA B 1 16  ? -44.855 30.965  -53.885  1.00 122.71 ? 71   ALA B CB  1 
ATOM   3466  N N   . PHE B 1 17  ? -45.548 31.388  -50.963  1.00 117.14 ? 72   PHE B N   1 
ATOM   3467  C CA  . PHE B 1 17  ? -45.279 32.017  -49.687  1.00 123.54 ? 72   PHE B CA  1 
ATOM   3468  C C   . PHE B 1 17  ? -45.893 31.218  -48.547  1.00 128.15 ? 72   PHE B C   1 
ATOM   3469  O O   . PHE B 1 17  ? -45.790 31.590  -47.382  1.00 134.79 ? 72   PHE B O   1 
ATOM   3470  C CB  . PHE B 1 17  ? -45.700 33.488  -49.696  1.00 132.39 ? 72   PHE B CB  1 
ATOM   3471  C CG  . PHE B 1 17  ? -44.570 34.420  -50.039  1.00 138.94 ? 72   PHE B CG  1 
ATOM   3472  C CD1 . PHE B 1 17  ? -43.833 35.025  -49.033  1.00 130.23 ? 72   PHE B CD1 1 
ATOM   3473  C CD2 . PHE B 1 17  ? -44.211 34.653  -51.360  1.00 141.10 ? 72   PHE B CD2 1 
ATOM   3474  C CE1 . PHE B 1 17  ? -42.783 35.862  -49.329  1.00 128.99 ? 72   PHE B CE1 1 
ATOM   3475  C CE2 . PHE B 1 17  ? -43.153 35.496  -51.665  1.00 140.43 ? 72   PHE B CE2 1 
ATOM   3476  C CZ  . PHE B 1 17  ? -42.439 36.099  -50.646  1.00 139.41 ? 72   PHE B CZ  1 
ATOM   3477  N N   . LEU B 1 18  ? -46.519 30.101  -48.904  1.00 125.81 ? 73   LEU B N   1 
ATOM   3478  C CA  . LEU B 1 18  ? -46.889 29.075  -47.937  1.00 124.21 ? 73   LEU B CA  1 
ATOM   3479  C C   . LEU B 1 18  ? -45.586 28.485  -47.439  1.00 117.14 ? 73   LEU B C   1 
ATOM   3480  O O   . LEU B 1 18  ? -45.374 28.276  -46.242  1.00 116.71 ? 73   LEU B O   1 
ATOM   3481  C CB  . LEU B 1 18  ? -47.710 27.979  -48.619  1.00 120.40 ? 73   LEU B CB  1 
ATOM   3482  C CG  . LEU B 1 18  ? -47.801 26.628  -47.912  1.00 114.64 ? 73   LEU B CG  1 
ATOM   3483  C CD1 . LEU B 1 18  ? -48.306 26.790  -46.491  1.00 115.21 ? 73   LEU B CD1 1 
ATOM   3484  C CD2 . LEU B 1 18  ? -48.691 25.667  -48.683  1.00 111.48 ? 73   LEU B CD2 1 
ATOM   3485  N N   . THR B 1 19  ? -44.708 28.220  -48.396  1.00 110.63 ? 74   THR B N   1 
ATOM   3486  C CA  . THR B 1 19  ? -43.361 27.770  -48.086  1.00 111.99 ? 74   THR B CA  1 
ATOM   3487  C C   . THR B 1 19  ? -42.653 28.841  -47.267  1.00 116.88 ? 74   THR B C   1 
ATOM   3488  O O   . THR B 1 19  ? -41.876 28.535  -46.363  1.00 124.97 ? 74   THR B O   1 
ATOM   3489  C CB  . THR B 1 19  ? -42.567 27.546  -49.351  1.00 114.80 ? 74   THR B CB  1 
ATOM   3490  O OG1 . THR B 1 19  ? -42.009 28.791  -49.791  1.00 116.35 ? 74   THR B OG1 1 
ATOM   3491  C CG2 . THR B 1 19  ? -43.477 26.969  -50.438  1.00 119.45 ? 74   THR B CG2 1 
ATOM   3492  N N   . GLY B 1 20  ? -42.903 30.103  -47.607  1.00 114.16 ? 75   GLY B N   1 
ATOM   3493  C CA  . GLY B 1 20  ? -42.369 31.206  -46.831  1.00 116.16 ? 75   GLY B CA  1 
ATOM   3494  C C   . GLY B 1 20  ? -42.785 31.074  -45.386  1.00 114.97 ? 75   GLY B C   1 
ATOM   3495  O O   . GLY B 1 20  ? -41.982 31.221  -44.483  1.00 110.73 ? 75   GLY B O   1 
ATOM   3496  N N   . PHE B 1 21  ? -44.067 30.792  -45.194  1.00 110.93 ? 76   PHE B N   1 
ATOM   3497  C CA  . PHE B 1 21  ? -44.658 30.558  -43.882  1.00 108.54 ? 76   PHE B CA  1 
ATOM   3498  C C   . PHE B 1 21  ? -43.920 29.456  -43.131  1.00 109.03 ? 76   PHE B C   1 
ATOM   3499  O O   . PHE B 1 21  ? -43.511 29.652  -41.972  1.00 108.61 ? 76   PHE B O   1 
ATOM   3500  C CB  . PHE B 1 21  ? -46.143 30.203  -44.049  1.00 109.64 ? 76   PHE B CB  1 
ATOM   3501  C CG  . PHE B 1 21  ? -46.705 29.346  -42.950  1.00 113.13 ? 76   PHE B CG  1 
ATOM   3502  C CD1 . PHE B 1 21  ? -47.129 29.916  -41.760  1.00 109.71 ? 76   PHE B CD1 1 
ATOM   3503  C CD2 . PHE B 1 21  ? -46.842 27.972  -43.118  1.00 109.60 ? 76   PHE B CD2 1 
ATOM   3504  C CE1 . PHE B 1 21  ? -47.661 29.130  -40.748  1.00 102.14 ? 76   PHE B CE1 1 
ATOM   3505  C CE2 . PHE B 1 21  ? -47.376 27.186  -42.104  1.00 100.89 ? 76   PHE B CE2 1 
ATOM   3506  C CZ  . PHE B 1 21  ? -47.782 27.770  -40.924  1.00 100.07 ? 76   PHE B CZ  1 
ATOM   3507  N N   . LEU B 1 22  ? -43.726 28.310  -43.781  1.00 108.33 ? 77   LEU B N   1 
ATOM   3508  C CA  . LEU B 1 22  ? -43.028 27.211  -43.126  1.00 103.60 ? 77   LEU B CA  1 
ATOM   3509  C C   . LEU B 1 22  ? -41.575 27.579  -42.815  1.00 99.74  ? 77   LEU B C   1 
ATOM   3510  O O   . LEU B 1 22  ? -41.062 27.273  -41.733  1.00 103.72 ? 77   LEU B O   1 
ATOM   3511  C CB  . LEU B 1 22  ? -43.112 25.947  -43.983  1.00 100.05 ? 77   LEU B CB  1 
ATOM   3512  C CG  . LEU B 1 22  ? -44.532 25.414  -44.241  1.00 90.65  ? 77   LEU B CG  1 
ATOM   3513  C CD1 . LEU B 1 22  ? -44.518 24.278  -45.251  1.00 88.76  ? 77   LEU B CD1 1 
ATOM   3514  C CD2 . LEU B 1 22  ? -45.184 24.983  -42.940  1.00 85.17  ? 77   LEU B CD2 1 
ATOM   3515  N N   . ALA B 1 23  ? -40.918 28.257  -43.747  1.00 102.69 ? 78   ALA B N   1 
ATOM   3516  C CA  . ALA B 1 23  ? -39.528 28.672  -43.568  1.00 113.31 ? 78   ALA B CA  1 
ATOM   3517  C C   . ALA B 1 23  ? -39.333 29.708  -42.463  1.00 109.47 ? 78   ALA B C   1 
ATOM   3518  O O   . ALA B 1 23  ? -38.357 29.646  -41.718  1.00 105.96 ? 78   ALA B O   1 
ATOM   3519  C CB  . ALA B 1 23  ? -38.957 29.205  -44.890  1.00 119.75 ? 78   ALA B CB  1 
ATOM   3520  N N   . LEU B 1 24  ? -40.260 30.654  -42.360  1.00 110.59 ? 79   LEU B N   1 
ATOM   3521  C CA  . LEU B 1 24  ? -40.211 31.682  -41.327  1.00 104.41 ? 79   LEU B CA  1 
ATOM   3522  C C   . LEU B 1 24  ? -40.393 31.018  -39.975  1.00 99.12  ? 79   LEU B C   1 
ATOM   3523  O O   . LEU B 1 24  ? -39.638 31.284  -39.043  1.00 98.93  ? 79   LEU B O   1 
ATOM   3524  C CB  . LEU B 1 24  ? -41.281 32.758  -41.560  1.00 104.73 ? 79   LEU B CB  1 
ATOM   3525  C CG  . LEU B 1 24  ? -41.079 33.641  -42.801  1.00 110.76 ? 79   LEU B CG  1 
ATOM   3526  C CD1 . LEU B 1 24  ? -42.259 34.580  -43.029  1.00 120.14 ? 79   LEU B CD1 1 
ATOM   3527  C CD2 . LEU B 1 24  ? -39.785 34.428  -42.691  1.00 109.09 ? 79   LEU B CD2 1 
ATOM   3528  N N   . VAL B 1 25  ? -41.390 30.139  -39.885  1.00 99.61  ? 80   VAL B N   1 
ATOM   3529  C CA  . VAL B 1 25  ? -41.592 29.332  -38.684  1.00 99.17  ? 80   VAL B CA  1 
ATOM   3530  C C   . VAL B 1 25  ? -40.321 28.573  -38.291  1.00 103.05 ? 80   VAL B C   1 
ATOM   3531  O O   . VAL B 1 25  ? -39.983 28.482  -37.104  1.00 100.57 ? 80   VAL B O   1 
ATOM   3532  C CB  . VAL B 1 25  ? -42.725 28.325  -38.882  1.00 108.64 ? 80   VAL B CB  1 
ATOM   3533  C CG1 . VAL B 1 25  ? -42.837 27.401  -37.675  1.00 106.91 ? 80   VAL B CG1 1 
ATOM   3534  C CG2 . VAL B 1 25  ? -44.029 29.061  -39.143  1.00 108.81 ? 80   VAL B CG2 1 
ATOM   3535  N N   . THR B 1 26  ? -39.626 28.020  -39.285  1.00 107.15 ? 81   THR B N   1 
ATOM   3536  C CA  . THR B 1 26  ? -38.355 27.342  -39.038  1.00 104.09 ? 81   THR B CA  1 
ATOM   3537  C C   . THR B 1 26  ? -37.324 28.293  -38.432  1.00 106.89 ? 81   THR B C   1 
ATOM   3538  O O   . THR B 1 26  ? -36.761 28.023  -37.367  1.00 103.86 ? 81   THR B O   1 
ATOM   3539  C CB  . THR B 1 26  ? -37.769 26.740  -40.327  1.00 97.87  ? 81   THR B CB  1 
ATOM   3540  O OG1 . THR B 1 26  ? -38.718 25.840  -40.908  1.00 108.76 ? 81   THR B OG1 1 
ATOM   3541  C CG2 . THR B 1 26  ? -36.485 25.987  -40.023  1.00 94.36  ? 81   THR B CG2 1 
ATOM   3542  N N   . ILE B 1 27  ? -37.083 29.409  -39.113  1.00 104.54 ? 82   ILE B N   1 
ATOM   3543  C CA  . ILE B 1 27  ? -36.035 30.338  -38.702  1.00 96.60  ? 82   ILE B CA  1 
ATOM   3544  C C   . ILE B 1 27  ? -36.283 30.947  -37.323  1.00 94.08  ? 82   ILE B C   1 
ATOM   3545  O O   . ILE B 1 27  ? -35.358 31.068  -36.518  1.00 94.53  ? 82   ILE B O   1 
ATOM   3546  C CB  . ILE B 1 27  ? -35.816 31.444  -39.744  1.00 93.78  ? 82   ILE B CB  1 
ATOM   3547  C CG1 . ILE B 1 27  ? -37.092 32.255  -39.938  1.00 88.12  ? 82   ILE B CG1 1 
ATOM   3548  C CG2 . ILE B 1 27  ? -35.369 30.840  -41.063  1.00 95.83  ? 82   ILE B CG2 1 
ATOM   3549  C CD1 . ILE B 1 27  ? -37.027 33.194  -41.110  1.00 94.33  ? 82   ILE B CD1 1 
ATOM   3550  N N   . ILE B 1 28  ? -37.525 31.330  -37.046  1.00 99.70  ? 83   ILE B N   1 
ATOM   3551  C CA  . ILE B 1 28  ? -37.848 31.883  -35.733  1.00 102.51 ? 83   ILE B CA  1 
ATOM   3552  C C   . ILE B 1 28  ? -37.795 30.796  -34.662  1.00 96.89  ? 83   ILE B C   1 
ATOM   3553  O O   . ILE B 1 28  ? -37.313 31.031  -33.556  1.00 99.02  ? 83   ILE B O   1 
ATOM   3554  C CB  . ILE B 1 28  ? -39.221 32.610  -35.696  1.00 98.34  ? 83   ILE B CB  1 
ATOM   3555  C CG1 . ILE B 1 28  ? -40.381 31.616  -35.815  1.00 97.97  ? 83   ILE B CG1 1 
ATOM   3556  C CG2 . ILE B 1 28  ? -39.292 33.682  -36.779  1.00 97.22  ? 83   ILE B CG2 1 
ATOM   3557  C CD1 . ILE B 1 28  ? -41.746 32.267  -35.788  1.00 82.71  ? 83   ILE B CD1 1 
ATOM   3558  N N   . GLY B 1 29  ? -38.276 29.602  -34.993  1.00 92.73  ? 84   GLY B N   1 
ATOM   3559  C CA  . GLY B 1 29  ? -38.213 28.503  -34.051  1.00 89.87  ? 84   GLY B CA  1 
ATOM   3560  C C   . GLY B 1 29  ? -36.780 28.275  -33.615  1.00 86.44  ? 84   GLY B C   1 
ATOM   3561  O O   . GLY B 1 29  ? -36.454 28.335  -32.427  1.00 87.53  ? 84   GLY B O   1 
ATOM   3562  N N   . ASN B 1 30  ? -35.908 28.044  -34.587  1.00 87.98  ? 85   ASN B N   1 
ATOM   3563  C CA  . ASN B 1 30  ? -34.513 27.758  -34.286  1.00 92.71  ? 85   ASN B CA  1 
ATOM   3564  C C   . ASN B 1 30  ? -33.783 28.920  -33.619  1.00 93.90  ? 85   ASN B C   1 
ATOM   3565  O O   . ASN B 1 30  ? -32.994 28.710  -32.698  1.00 99.39  ? 85   ASN B O   1 
ATOM   3566  C CB  . ASN B 1 30  ? -33.768 27.312  -35.543  1.00 94.62  ? 85   ASN B CB  1 
ATOM   3567  C CG  . ASN B 1 30  ? -34.264 25.985  -36.069  1.00 91.01  ? 85   ASN B CG  1 
ATOM   3568  O OD1 . ASN B 1 30  ? -34.455 25.034  -35.310  1.00 86.91  ? 85   ASN B OD1 1 
ATOM   3569  N ND2 . ASN B 1 30  ? -34.485 25.916  -37.376  1.00 97.26  ? 85   ASN B ND2 1 
ATOM   3570  N N   . ILE B 1 31  ? -34.037 30.143  -34.078  1.00 89.71  ? 86   ILE B N   1 
ATOM   3571  C CA  . ILE B 1 31  ? -33.363 31.293  -33.489  1.00 86.87  ? 86   ILE B CA  1 
ATOM   3572  C C   . ILE B 1 31  ? -33.798 31.446  -32.034  1.00 91.12  ? 86   ILE B C   1 
ATOM   3573  O O   . ILE B 1 31  ? -33.013 31.867  -31.180  1.00 93.45  ? 86   ILE B O   1 
ATOM   3574  C CB  . ILE B 1 31  ? -33.621 32.591  -34.272  1.00 82.15  ? 86   ILE B CB  1 
ATOM   3575  C CG1 . ILE B 1 31  ? -32.610 33.661  -33.856  1.00 82.01  ? 86   ILE B CG1 1 
ATOM   3576  C CG2 . ILE B 1 31  ? -35.046 33.068  -34.070  1.00 79.41  ? 86   ILE B CG2 1 
ATOM   3577  C CD1 . ILE B 1 31  ? -32.743 34.954  -34.617  1.00 86.77  ? 86   ILE B CD1 1 
ATOM   3578  N N   . LEU B 1 32  ? -35.050 31.085  -31.759  1.00 85.24  ? 87   LEU B N   1 
ATOM   3579  C CA  . LEU B 1 32  ? -35.536 31.005  -30.390  1.00 81.44  ? 87   LEU B CA  1 
ATOM   3580  C C   . LEU B 1 32  ? -34.714 29.981  -29.640  1.00 86.01  ? 87   LEU B C   1 
ATOM   3581  O O   . LEU B 1 32  ? -34.251 30.236  -28.536  1.00 92.15  ? 87   LEU B O   1 
ATOM   3582  C CB  . LEU B 1 32  ? -37.004 30.586  -30.347  1.00 76.02  ? 87   LEU B CB  1 
ATOM   3583  C CG  . LEU B 1 32  ? -38.063 31.665  -30.551  1.00 79.26  ? 87   LEU B CG  1 
ATOM   3584  C CD1 . LEU B 1 32  ? -39.429 31.123  -30.165  1.00 69.99  ? 87   LEU B CD1 1 
ATOM   3585  C CD2 . LEU B 1 32  ? -37.720 32.894  -29.732  1.00 84.36  ? 87   LEU B CD2 1 
ATOM   3586  N N   . VAL B 1 33  ? -34.542 28.812  -30.244  1.00 83.49  ? 88   VAL B N   1 
ATOM   3587  C CA  . VAL B 1 33  ? -33.761 27.756  -29.617  1.00 80.53  ? 88   VAL B CA  1 
ATOM   3588  C C   . VAL B 1 33  ? -32.379 28.254  -29.194  1.00 90.51  ? 88   VAL B C   1 
ATOM   3589  O O   . VAL B 1 33  ? -31.979 28.095  -28.038  1.00 98.27  ? 88   VAL B O   1 
ATOM   3590  C CB  . VAL B 1 33  ? -33.607 26.544  -30.545  1.00 81.26  ? 88   VAL B CB  1 
ATOM   3591  C CG1 . VAL B 1 33  ? -32.793 25.465  -29.859  1.00 83.46  ? 88   VAL B CG1 1 
ATOM   3592  C CG2 . VAL B 1 33  ? -34.976 26.014  -30.948  1.00 81.45  ? 88   VAL B CG2 1 
ATOM   3593  N N   . ILE B 1 34  ? -31.657 28.859  -30.133  1.00 92.06  ? 89   ILE B N   1 
ATOM   3594  C CA  . ILE B 1 34  ? -30.310 29.360  -29.869  1.00 95.12  ? 89   ILE B CA  1 
ATOM   3595  C C   . ILE B 1 34  ? -30.303 30.439  -28.800  1.00 93.52  ? 89   ILE B C   1 
ATOM   3596  O O   . ILE B 1 34  ? -29.608 30.327  -27.786  1.00 97.59  ? 89   ILE B O   1 
ATOM   3597  C CB  . ILE B 1 34  ? -29.660 29.956  -31.133  1.00 90.95  ? 89   ILE B CB  1 
ATOM   3598  C CG1 . ILE B 1 34  ? -29.545 28.904  -32.233  1.00 94.63  ? 89   ILE B CG1 1 
ATOM   3599  C CG2 . ILE B 1 34  ? -28.285 30.524  -30.805  1.00 80.17  ? 89   ILE B CG2 1 
ATOM   3600  C CD1 . ILE B 1 34  ? -28.767 29.381  -33.432  1.00 96.46  ? 89   ILE B CD1 1 
ATOM   3601  N N   . VAL B 1 35  ? -31.073 31.494  -29.038  1.00 87.71  ? 90   VAL B N   1 
ATOM   3602  C CA  . VAL B 1 35  ? -31.110 32.611  -28.113  1.00 96.25  ? 90   VAL B CA  1 
ATOM   3603  C C   . VAL B 1 35  ? -31.401 32.111  -26.708  1.00 100.19 ? 90   VAL B C   1 
ATOM   3604  O O   . VAL B 1 35  ? -30.633 32.355  -25.778  1.00 105.24 ? 90   VAL B O   1 
ATOM   3605  C CB  . VAL B 1 35  ? -32.171 33.644  -28.524  1.00 98.02  ? 90   VAL B CB  1 
ATOM   3606  C CG1 . VAL B 1 35  ? -32.408 34.644  -27.397  1.00 97.85  ? 90   VAL B CG1 1 
ATOM   3607  C CG2 . VAL B 1 35  ? -31.748 34.353  -29.804  1.00 99.28  ? 90   VAL B CG2 1 
ATOM   3608  N N   . ALA B 1 36  ? -32.508 31.389  -26.573  1.00 99.98  ? 91   ALA B N   1 
ATOM   3609  C CA  . ALA B 1 36  ? -32.950 30.857  -25.288  1.00 107.69 ? 91   ALA B CA  1 
ATOM   3610  C C   . ALA B 1 36  ? -31.874 30.013  -24.617  1.00 107.87 ? 91   ALA B C   1 
ATOM   3611  O O   . ALA B 1 36  ? -31.581 30.195  -23.433  1.00 105.87 ? 91   ALA B O   1 
ATOM   3612  C CB  . ALA B 1 36  ? -34.227 30.049  -25.462  1.00 106.79 ? 91   ALA B CB  1 
ATOM   3613  N N   . PHE B 1 37  ? -31.294 29.086  -25.374  1.00 107.71 ? 92   PHE B N   1 
ATOM   3614  C CA  . PHE B 1 37  ? -30.232 28.236  -24.851  1.00 107.66 ? 92   PHE B CA  1 
ATOM   3615  C C   . PHE B 1 37  ? -29.115 29.086  -24.259  1.00 105.05 ? 92   PHE B C   1 
ATOM   3616  O O   . PHE B 1 37  ? -28.748 28.923  -23.095  1.00 104.48 ? 92   PHE B O   1 
ATOM   3617  C CB  . PHE B 1 37  ? -29.667 27.333  -25.953  1.00 102.14 ? 92   PHE B CB  1 
ATOM   3618  C CG  . PHE B 1 37  ? -28.531 26.454  -25.498  1.00 102.27 ? 92   PHE B CG  1 
ATOM   3619  C CD1 . PHE B 1 37  ? -28.752 25.129  -25.170  1.00 105.34 ? 92   PHE B CD1 1 
ATOM   3620  C CD2 . PHE B 1 37  ? -27.240 26.954  -25.397  1.00 102.40 ? 92   PHE B CD2 1 
ATOM   3621  C CE1 . PHE B 1 37  ? -27.707 24.316  -24.752  1.00 107.84 ? 92   PHE B CE1 1 
ATOM   3622  C CE2 . PHE B 1 37  ? -26.191 26.146  -24.976  1.00 99.56  ? 92   PHE B CE2 1 
ATOM   3623  C CZ  . PHE B 1 37  ? -26.427 24.826  -24.654  1.00 100.87 ? 92   PHE B CZ  1 
ATOM   3624  N N   . LYS B 1 38  ? -28.583 29.999  -25.065  1.00 97.37  ? 93   LYS B N   1 
ATOM   3625  C CA  . LYS B 1 38  ? -27.434 30.793  -24.655  1.00 92.81  ? 93   LYS B CA  1 
ATOM   3626  C C   . LYS B 1 38  ? -27.769 31.712  -23.492  1.00 102.94 ? 93   LYS B C   1 
ATOM   3627  O O   . LYS B 1 38  ? -26.895 32.075  -22.709  1.00 112.73 ? 93   LYS B O   1 
ATOM   3628  C CB  . LYS B 1 38  ? -26.910 31.615  -25.831  1.00 91.85  ? 93   LYS B CB  1 
ATOM   3629  N N   . VAL B 1 39  ? -29.038 32.085  -23.377  1.00 102.57 ? 94   VAL B N   1 
ATOM   3630  C CA  . VAL B 1 39  ? -29.451 33.047  -22.363  1.00 108.78 ? 94   VAL B CA  1 
ATOM   3631  C C   . VAL B 1 39  ? -29.872 32.372  -21.059  1.00 110.58 ? 94   VAL B C   1 
ATOM   3632  O O   . VAL B 1 39  ? -30.060 33.036  -20.039  1.00 108.68 ? 94   VAL B O   1 
ATOM   3633  C CB  . VAL B 1 39  ? -30.605 33.930  -22.869  1.00 109.35 ? 94   VAL B CB  1 
ATOM   3634  C CG1 . VAL B 1 39  ? -31.924 33.187  -22.763  1.00 111.25 ? 94   VAL B CG1 1 
ATOM   3635  C CG2 . VAL B 1 39  ? -30.663 35.232  -22.087  1.00 108.00 ? 94   VAL B CG2 1 
ATOM   3636  N N   . ASN B 1 40  ? -30.006 31.050  -21.092  1.00 114.35 ? 95   ASN B N   1 
ATOM   3637  C CA  . ASN B 1 40  ? -30.442 30.297  -19.919  1.00 119.14 ? 95   ASN B CA  1 
ATOM   3638  C C   . ASN B 1 40  ? -29.402 29.272  -19.473  1.00 116.16 ? 95   ASN B C   1 
ATOM   3639  O O   . ASN B 1 40  ? -28.911 28.478  -20.276  1.00 118.24 ? 95   ASN B O   1 
ATOM   3640  C CB  . ASN B 1 40  ? -31.784 29.608  -20.195  1.00 119.94 ? 95   ASN B CB  1 
ATOM   3641  C CG  . ASN B 1 40  ? -32.359 28.923  -18.965  1.00 117.56 ? 95   ASN B CG  1 
ATOM   3642  O OD1 . ASN B 1 40  ? -31.625 28.464  -18.090  1.00 107.85 ? 95   ASN B OD1 1 
ATOM   3643  N ND2 . ASN B 1 40  ? -33.684 28.849  -18.897  1.00 120.65 ? 95   ASN B ND2 1 
ATOM   3644  N N   . LYS B 1 41  ? -29.068 29.296  -18.187  1.00 110.59 ? 96   LYS B N   1 
ATOM   3645  C CA  . LYS B 1 41  ? -28.113 28.345  -17.637  1.00 113.01 ? 96   LYS B CA  1 
ATOM   3646  C C   . LYS B 1 41  ? -28.675 26.929  -17.653  1.00 117.41 ? 96   LYS B C   1 
ATOM   3647  O O   . LYS B 1 41  ? -28.027 26.002  -18.142  1.00 114.59 ? 96   LYS B O   1 
ATOM   3648  C CB  . LYS B 1 41  ? -27.723 28.732  -16.211  1.00 119.69 ? 96   LYS B CB  1 
ATOM   3649  C CG  . LYS B 1 41  ? -26.718 29.867  -16.126  1.00 120.91 ? 96   LYS B CG  1 
ATOM   3650  C CD  . LYS B 1 41  ? -26.260 30.071  -14.690  1.00 129.16 ? 96   LYS B CD  1 
ATOM   3651  C CE  . LYS B 1 41  ? -25.134 31.087  -14.602  1.00 128.69 ? 96   LYS B CE  1 
ATOM   3652  N NZ  . LYS B 1 41  ? -24.641 31.239  -13.203  1.00 128.05 ? 96   LYS B NZ  1 
ATOM   3653  N N   . GLN B 1 42  ? -29.882 26.769  -17.118  1.00 122.26 ? 97   GLN B N   1 
ATOM   3654  C CA  . GLN B 1 42  ? -30.536 25.465  -17.066  1.00 124.40 ? 97   GLN B CA  1 
ATOM   3655  C C   . GLN B 1 42  ? -30.528 24.798  -18.437  1.00 120.60 ? 97   GLN B C   1 
ATOM   3656  O O   . GLN B 1 42  ? -30.434 23.577  -18.547  1.00 120.09 ? 97   GLN B O   1 
ATOM   3657  C CB  . GLN B 1 42  ? -31.977 25.606  -16.565  1.00 116.87 ? 97   GLN B CB  1 
ATOM   3658  N N   . LEU B 1 43  ? -30.617 25.611  -19.483  1.00 117.73 ? 98   LEU B N   1 
ATOM   3659  C CA  . LEU B 1 43  ? -30.667 25.092  -20.841  1.00 113.97 ? 98   LEU B CA  1 
ATOM   3660  C C   . LEU B 1 43  ? -29.302 24.647  -21.350  1.00 110.27 ? 98   LEU B C   1 
ATOM   3661  O O   . LEU B 1 43  ? -29.203 24.066  -22.422  1.00 110.38 ? 98   LEU B O   1 
ATOM   3662  C CB  . LEU B 1 43  ? -31.281 26.117  -21.795  1.00 113.02 ? 98   LEU B CB  1 
ATOM   3663  C CG  . LEU B 1 43  ? -32.778 26.386  -21.655  1.00 113.92 ? 98   LEU B CG  1 
ATOM   3664  C CD1 . LEU B 1 43  ? -33.225 27.414  -22.679  1.00 119.42 ? 98   LEU B CD1 1 
ATOM   3665  C CD2 . LEU B 1 43  ? -33.587 25.107  -21.804  1.00 110.88 ? 98   LEU B CD2 1 
ATOM   3666  N N   . LYS B 1 44  ? -28.248 24.924  -20.589  1.00 107.40 ? 99   LYS B N   1 
ATOM   3667  C CA  . LYS B 1 44  ? -26.919 24.460  -20.973  1.00 107.94 ? 99   LYS B CA  1 
ATOM   3668  C C   . LYS B 1 44  ? -26.583 23.139  -20.285  1.00 110.63 ? 99   LYS B C   1 
ATOM   3669  O O   . LYS B 1 44  ? -26.329 23.095  -19.080  1.00 112.82 ? 99   LYS B O   1 
ATOM   3670  C CB  . LYS B 1 44  ? -25.859 25.516  -20.644  1.00 104.45 ? 99   LYS B CB  1 
ATOM   3671  N N   . THR B 1 45  ? -26.573 22.073  -21.078  1.00 108.32 ? 100  THR B N   1 
ATOM   3672  C CA  . THR B 1 45  ? -26.229 20.732  -20.624  1.00 101.59 ? 100  THR B CA  1 
ATOM   3673  C C   . THR B 1 45  ? -25.729 19.984  -21.846  1.00 101.75 ? 100  THR B C   1 
ATOM   3674  O O   . THR B 1 45  ? -25.696 20.536  -22.945  1.00 104.02 ? 100  THR B O   1 
ATOM   3675  C CB  . THR B 1 45  ? -27.453 19.957  -20.088  1.00 94.76  ? 100  THR B CB  1 
ATOM   3676  O OG1 . THR B 1 45  ? -28.394 19.752  -21.150  1.00 96.75  ? 100  THR B OG1 1 
ATOM   3677  C CG2 . THR B 1 45  ? -28.126 20.706  -18.952  1.00 93.52  ? 100  THR B CG2 1 
ATOM   3678  N N   . VAL B 1 46  ? -25.336 18.731  -21.662  1.00 95.90  ? 101  VAL B N   1 
ATOM   3679  C CA  . VAL B 1 46  ? -24.945 17.901  -22.790  1.00 93.94  ? 101  VAL B CA  1 
ATOM   3680  C C   . VAL B 1 46  ? -26.098 17.761  -23.792  1.00 95.37  ? 101  VAL B C   1 
ATOM   3681  O O   . VAL B 1 46  ? -26.021 18.237  -24.936  1.00 98.25  ? 101  VAL B O   1 
ATOM   3682  C CB  . VAL B 1 46  ? -24.489 16.517  -22.325  1.00 92.49  ? 101  VAL B CB  1 
ATOM   3683  C CG1 . VAL B 1 46  ? -23.667 15.850  -23.411  1.00 91.74  ? 101  VAL B CG1 1 
ATOM   3684  C CG2 . VAL B 1 46  ? -23.677 16.638  -21.049  1.00 86.73  ? 101  VAL B CG2 1 
ATOM   3685  N N   . ASN B 1 47  ? -27.165 17.103  -23.351  1.00 88.73  ? 102  ASN B N   1 
ATOM   3686  C CA  . ASN B 1 47  ? -28.322 16.856  -24.200  1.00 92.85  ? 102  ASN B CA  1 
ATOM   3687  C C   . ASN B 1 47  ? -28.791 18.137  -24.896  1.00 93.52  ? 102  ASN B C   1 
ATOM   3688  O O   . ASN B 1 47  ? -29.013 18.171  -26.121  1.00 96.53  ? 102  ASN B O   1 
ATOM   3689  C CB  . ASN B 1 47  ? -29.455 16.258  -23.362  1.00 93.96  ? 102  ASN B CB  1 
ATOM   3690  C CG  . ASN B 1 47  ? -28.951 15.277  -22.316  1.00 89.68  ? 102  ASN B CG  1 
ATOM   3691  O OD1 . ASN B 1 47  ? -28.828 14.081  -22.578  1.00 92.34  ? 102  ASN B OD1 1 
ATOM   3692  N ND2 . ASN B 1 47  ? -28.653 15.783  -21.125  1.00 84.98  ? 102  ASN B ND2 1 
ATOM   3693  N N   . ASN B 1 48  ? -28.918 19.198  -24.107  1.00 85.64  ? 103  ASN B N   1 
ATOM   3694  C CA  . ASN B 1 48  ? -29.351 20.484  -24.628  1.00 87.89  ? 103  ASN B CA  1 
ATOM   3695  C C   . ASN B 1 48  ? -28.363 21.054  -25.643  1.00 90.75  ? 103  ASN B C   1 
ATOM   3696  O O   . ASN B 1 48  ? -28.747 21.786  -26.554  1.00 90.62  ? 103  ASN B O   1 
ATOM   3697  C CB  . ASN B 1 48  ? -29.569 21.476  -23.488  1.00 89.44  ? 103  ASN B CB  1 
ATOM   3698  C CG  . ASN B 1 48  ? -30.537 20.961  -22.445  1.00 89.27  ? 103  ASN B CG  1 
ATOM   3699  O OD1 . ASN B 1 48  ? -31.300 20.029  -22.697  1.00 95.95  ? 103  ASN B OD1 1 
ATOM   3700  N ND2 . ASN B 1 48  ? -30.515 21.568  -21.265  1.00 84.86  ? 103  ASN B ND2 1 
ATOM   3701  N N   . TYR B 1 49  ? -27.089 20.717  -25.475  1.00 87.67  ? 104  TYR B N   1 
ATOM   3702  C CA  . TYR B 1 49  ? -26.049 21.129  -26.406  1.00 84.47  ? 104  TYR B CA  1 
ATOM   3703  C C   . TYR B 1 49  ? -26.314 20.465  -27.755  1.00 87.95  ? 104  TYR B C   1 
ATOM   3704  O O   . TYR B 1 49  ? -26.308 21.121  -28.805  1.00 92.92  ? 104  TYR B O   1 
ATOM   3705  C CB  . TYR B 1 49  ? -24.685 20.703  -25.863  1.00 87.16  ? 104  TYR B CB  1 
ATOM   3706  C CG  . TYR B 1 49  ? -23.517 21.589  -26.244  1.00 95.56  ? 104  TYR B CG  1 
ATOM   3707  C CD1 . TYR B 1 49  ? -22.749 21.316  -27.370  1.00 95.79  ? 104  TYR B CD1 1 
ATOM   3708  C CD2 . TYR B 1 49  ? -23.161 22.680  -25.458  1.00 102.79 ? 104  TYR B CD2 1 
ATOM   3709  C CE1 . TYR B 1 49  ? -21.669 22.116  -27.715  1.00 98.84  ? 104  TYR B CE1 1 
ATOM   3710  C CE2 . TYR B 1 49  ? -22.082 23.486  -25.793  1.00 103.56 ? 104  TYR B CE2 1 
ATOM   3711  C CZ  . TYR B 1 49  ? -21.340 23.199  -26.922  1.00 105.27 ? 104  TYR B CZ  1 
ATOM   3712  O OH  . TYR B 1 49  ? -20.268 23.999  -27.257  1.00 103.45 ? 104  TYR B OH  1 
ATOM   3713  N N   . PHE B 1 50  ? -26.560 19.157  -27.720  1.00 88.97  ? 105  PHE B N   1 
ATOM   3714  C CA  . PHE B 1 50  ? -26.854 18.408  -28.946  1.00 87.22  ? 105  PHE B CA  1 
ATOM   3715  C C   . PHE B 1 50  ? -28.070 18.974  -29.676  1.00 82.57  ? 105  PHE B C   1 
ATOM   3716  O O   . PHE B 1 50  ? -28.063 19.146  -30.910  1.00 80.29  ? 105  PHE B O   1 
ATOM   3717  C CB  . PHE B 1 50  ? -27.073 16.926  -28.636  1.00 88.27  ? 105  PHE B CB  1 
ATOM   3718  C CG  . PHE B 1 50  ? -25.847 16.232  -28.116  1.00 90.16  ? 105  PHE B CG  1 
ATOM   3719  C CD1 . PHE B 1 50  ? -24.581 16.745  -28.375  1.00 86.68  ? 105  PHE B CD1 1 
ATOM   3720  C CD2 . PHE B 1 50  ? -25.956 15.072  -27.365  1.00 85.30  ? 105  PHE B CD2 1 
ATOM   3721  C CE1 . PHE B 1 50  ? -23.445 16.115  -27.897  1.00 77.79  ? 105  PHE B CE1 1 
ATOM   3722  C CE2 . PHE B 1 50  ? -24.823 14.436  -26.882  1.00 92.71  ? 105  PHE B CE2 1 
ATOM   3723  C CZ  . PHE B 1 50  ? -23.565 14.959  -27.149  1.00 85.58  ? 105  PHE B CZ  1 
ATOM   3724  N N   . LEU B 1 51  ? -29.114 19.265  -28.910  1.00 80.43  ? 106  LEU B N   1 
ATOM   3725  C CA  . LEU B 1 51  ? -30.302 19.879  -29.488  1.00 81.16  ? 106  LEU B CA  1 
ATOM   3726  C C   . LEU B 1 51  ? -30.012 21.289  -30.017  1.00 81.94  ? 106  LEU B C   1 
ATOM   3727  O O   . LEU B 1 51  ? -30.669 21.761  -30.948  1.00 77.01  ? 106  LEU B O   1 
ATOM   3728  C CB  . LEU B 1 51  ? -31.432 19.890  -28.466  1.00 84.45  ? 106  LEU B CB  1 
ATOM   3729  C CG  . LEU B 1 51  ? -31.773 18.466  -28.026  1.00 84.37  ? 106  LEU B CG  1 
ATOM   3730  C CD1 . LEU B 1 51  ? -32.594 18.446  -26.740  1.00 81.78  ? 106  LEU B CD1 1 
ATOM   3731  C CD2 . LEU B 1 51  ? -32.478 17.728  -29.157  1.00 81.67  ? 106  LEU B CD2 1 
ATOM   3732  N N   . LEU B 1 52  ? -29.026 21.954  -29.421  1.00 79.92  ? 107  LEU B N   1 
ATOM   3733  C CA  . LEU B 1 52  ? -28.565 23.239  -29.929  1.00 77.04  ? 107  LEU B CA  1 
ATOM   3734  C C   . LEU B 1 52  ? -28.030 23.047  -31.339  1.00 77.97  ? 107  LEU B C   1 
ATOM   3735  O O   . LEU B 1 52  ? -28.490 23.689  -32.278  1.00 77.72  ? 107  LEU B O   1 
ATOM   3736  C CB  . LEU B 1 52  ? -27.477 23.830  -29.027  1.00 77.16  ? 107  LEU B CB  1 
ATOM   3737  C CG  . LEU B 1 52  ? -27.038 25.278  -29.277  1.00 78.15  ? 107  LEU B CG  1 
ATOM   3738  C CD1 . LEU B 1 52  ? -26.065 25.722  -28.207  1.00 85.29  ? 107  LEU B CD1 1 
ATOM   3739  C CD2 . LEU B 1 52  ? -26.421 25.475  -30.653  1.00 73.43  ? 107  LEU B CD2 1 
ATOM   3740  N N   . SER B 1 53  ? -27.051 22.161  -31.487  1.00 83.09  ? 108  SER B N   1 
ATOM   3741  C CA  . SER B 1 53  ? -26.497 21.894  -32.811  1.00 80.94  ? 108  SER B CA  1 
ATOM   3742  C C   . SER B 1 53  ? -27.584 21.545  -33.827  1.00 80.25  ? 108  SER B C   1 
ATOM   3743  O O   . SER B 1 53  ? -27.563 22.040  -34.959  1.00 76.02  ? 108  SER B O   1 
ATOM   3744  C CB  . SER B 1 53  ? -25.452 20.782  -32.769  1.00 84.59  ? 108  SER B CB  1 
ATOM   3745  O OG  . SER B 1 53  ? -25.068 20.426  -34.086  1.00 91.39  ? 108  SER B OG  1 
ATOM   3746  N N   . LEU B 1 54  ? -28.524 20.685  -33.435  1.00 82.22  ? 109  LEU B N   1 
ATOM   3747  C CA  . LEU B 1 54  ? -29.647 20.386  -34.323  1.00 78.60  ? 109  LEU B CA  1 
ATOM   3748  C C   . LEU B 1 54  ? -30.349 21.682  -34.715  1.00 82.88  ? 109  LEU B C   1 
ATOM   3749  O O   . LEU B 1 54  ? -30.701 21.891  -35.881  1.00 82.58  ? 109  LEU B O   1 
ATOM   3750  C CB  . LEU B 1 54  ? -30.635 19.422  -33.664  1.00 74.26  ? 109  LEU B CB  1 
ATOM   3751  C CG  . LEU B 1 54  ? -30.299 17.929  -33.706  1.00 71.22  ? 109  LEU B CG  1 
ATOM   3752  C CD1 . LEU B 1 54  ? -31.120 17.158  -32.682  1.00 74.13  ? 109  LEU B CD1 1 
ATOM   3753  C CD2 . LEU B 1 54  ? -30.508 17.364  -35.103  1.00 67.31  ? 109  LEU B CD2 1 
ATOM   3754  N N   . ALA B 1 55  ? -30.532 22.554  -33.728  1.00 84.77  ? 110  ALA B N   1 
ATOM   3755  C CA  . ALA B 1 55  ? -31.161 23.854  -33.943  1.00 90.90  ? 110  ALA B CA  1 
ATOM   3756  C C   . ALA B 1 55  ? -30.410 24.679  -34.981  1.00 90.04  ? 110  ALA B C   1 
ATOM   3757  O O   . ALA B 1 55  ? -31.020 25.401  -35.766  1.00 90.22  ? 110  ALA B O   1 
ATOM   3758  C CB  . ALA B 1 55  ? -31.257 24.620  -32.635  1.00 87.54  ? 110  ALA B CB  1 
ATOM   3759  N N   . CYS B 1 56  ? -29.084 24.580  -34.972  1.00 87.12  ? 111  CYS B N   1 
ATOM   3760  C CA  . CYS B 1 56  ? -28.267 25.279  -35.956  1.00 86.10  ? 111  CYS B CA  1 
ATOM   3761  C C   . CYS B 1 56  ? -28.478 24.689  -37.342  1.00 90.91  ? 111  CYS B C   1 
ATOM   3762  O O   . CYS B 1 56  ? -28.673 25.420  -38.317  1.00 87.29  ? 111  CYS B O   1 
ATOM   3763  C CB  . CYS B 1 56  ? -26.788 25.221  -35.578  1.00 87.08  ? 111  CYS B CB  1 
ATOM   3764  S SG  . CYS B 1 56  ? -26.285 26.448  -34.357  1.00 93.64  ? 111  CYS B SG  1 
ATOM   3765  N N   . ALA B 1 57  ? -28.448 23.362  -37.426  1.00 93.84  ? 112  ALA B N   1 
ATOM   3766  C CA  . ALA B 1 57  ? -28.664 22.700  -38.703  1.00 91.02  ? 112  ALA B CA  1 
ATOM   3767  C C   . ALA B 1 57  ? -29.971 23.202  -39.304  1.00 86.00  ? 112  ALA B C   1 
ATOM   3768  O O   . ALA B 1 57  ? -29.991 23.748  -40.408  1.00 81.39  ? 112  ALA B O   1 
ATOM   3769  C CB  . ALA B 1 57  ? -28.702 21.189  -38.518  1.00 82.17  ? 112  ALA B CB  1 
ATOM   3770  N N   . ASP B 1 58  ? -31.056 23.046  -38.555  1.00 83.38  ? 113  ASP B N   1 
ATOM   3771  C CA  . ASP B 1 58  ? -32.366 23.473  -39.031  1.00 88.98  ? 113  ASP B CA  1 
ATOM   3772  C C   . ASP B 1 58  ? -32.395 24.968  -39.356  1.00 88.54  ? 113  ASP B C   1 
ATOM   3773  O O   . ASP B 1 58  ? -33.030 25.400  -40.323  1.00 87.94  ? 113  ASP B O   1 
ATOM   3774  C CB  . ASP B 1 58  ? -33.441 23.129  -38.000  1.00 93.98  ? 113  ASP B CB  1 
ATOM   3775  C CG  . ASP B 1 58  ? -33.453 21.659  -37.645  1.00 92.01  ? 113  ASP B CG  1 
ATOM   3776  O OD1 . ASP B 1 58  ? -33.041 20.844  -38.496  1.00 86.97  ? 113  ASP B OD1 1 
ATOM   3777  O OD2 . ASP B 1 58  ? -33.874 21.323  -36.516  1.00 95.59  ? 113  ASP B OD2 1 
ATOM   3778  N N   . LEU B 1 59  ? -31.699 25.757  -38.547  1.00 85.68  ? 114  LEU B N   1 
ATOM   3779  C CA  . LEU B 1 59  ? -31.646 27.191  -38.774  1.00 86.84  ? 114  LEU B CA  1 
ATOM   3780  C C   . LEU B 1 59  ? -31.133 27.443  -40.181  1.00 92.37  ? 114  LEU B C   1 
ATOM   3781  O O   . LEU B 1 59  ? -31.808 28.072  -40.997  1.00 98.47  ? 114  LEU B O   1 
ATOM   3782  C CB  . LEU B 1 59  ? -30.737 27.875  -37.748  1.00 87.98  ? 114  LEU B CB  1 
ATOM   3783  C CG  . LEU B 1 59  ? -30.582 29.398  -37.858  1.00 80.54  ? 114  LEU B CG  1 
ATOM   3784  C CD1 . LEU B 1 59  ? -30.277 30.017  -36.503  1.00 87.37  ? 114  LEU B CD1 1 
ATOM   3785  C CD2 . LEU B 1 59  ? -29.522 29.790  -38.881  1.00 71.83  ? 114  LEU B CD2 1 
ATOM   3786  N N   . ILE B 1 60  ? -29.945 26.919  -40.468  1.00 93.62  ? 115  ILE B N   1 
ATOM   3787  C CA  . ILE B 1 60  ? -29.269 27.204  -41.729  1.00 92.89  ? 115  ILE B CA  1 
ATOM   3788  C C   . ILE B 1 60  ? -30.003 26.592  -42.923  1.00 88.63  ? 115  ILE B C   1 
ATOM   3789  O O   . ILE B 1 60  ? -30.057 27.194  -43.997  1.00 85.83  ? 115  ILE B O   1 
ATOM   3790  C CB  . ILE B 1 60  ? -27.790 26.754  -41.700  1.00 86.47  ? 115  ILE B CB  1 
ATOM   3791  C CG1 . ILE B 1 60  ? -27.010 27.375  -42.862  1.00 79.25  ? 115  ILE B CG1 1 
ATOM   3792  C CG2 . ILE B 1 60  ? -27.682 25.239  -41.711  1.00 85.73  ? 115  ILE B CG2 1 
ATOM   3793  C CD1 . ILE B 1 60  ? -25.511 27.256  -42.716  1.00 76.36  ? 115  ILE B CD1 1 
ATOM   3794  N N   . ILE B 1 61  ? -30.577 25.407  -42.733  1.00 86.07  ? 116  ILE B N   1 
ATOM   3795  C CA  . ILE B 1 61  ? -31.369 24.782  -43.788  1.00 84.52  ? 116  ILE B CA  1 
ATOM   3796  C C   . ILE B 1 61  ? -32.523 25.710  -44.134  1.00 89.47  ? 116  ILE B C   1 
ATOM   3797  O O   . ILE B 1 61  ? -32.894 25.854  -45.298  1.00 88.91  ? 116  ILE B O   1 
ATOM   3798  C CB  . ILE B 1 61  ? -31.906 23.389  -43.365  1.00 85.89  ? 116  ILE B CB  1 
ATOM   3799  C CG1 . ILE B 1 61  ? -32.470 22.622  -44.560  1.00 84.15  ? 116  ILE B CG1 1 
ATOM   3800  C CG2 . ILE B 1 61  ? -32.982 23.513  -42.317  1.00 91.31  ? 116  ILE B CG2 1 
ATOM   3801  C CD1 . ILE B 1 61  ? -33.210 21.349  -44.158  1.00 72.41  ? 116  ILE B CD1 1 
ATOM   3802  N N   . GLY B 1 62  ? -33.074 26.359  -43.114  1.00 97.13  ? 117  GLY B N   1 
ATOM   3803  C CA  . GLY B 1 62  ? -34.203 27.248  -43.312  1.00 101.13 ? 117  GLY B CA  1 
ATOM   3804  C C   . GLY B 1 62  ? -33.842 28.555  -43.991  1.00 95.50  ? 117  GLY B C   1 
ATOM   3805  O O   . GLY B 1 62  ? -34.505 28.972  -44.938  1.00 92.27  ? 117  GLY B O   1 
ATOM   3806  N N   . VAL B 1 63  ? -32.781 29.196  -43.509  1.00 92.25  ? 118  VAL B N   1 
ATOM   3807  C CA  . VAL B 1 63  ? -32.410 30.532  -43.970  1.00 86.52  ? 118  VAL B CA  1 
ATOM   3808  C C   . VAL B 1 63  ? -32.083 30.586  -45.461  1.00 86.25  ? 118  VAL B C   1 
ATOM   3809  O O   . VAL B 1 63  ? -32.355 31.586  -46.125  1.00 86.24  ? 118  VAL B O   1 
ATOM   3810  C CB  . VAL B 1 63  ? -31.220 31.090  -43.166  1.00 88.58  ? 118  VAL B CB  1 
ATOM   3811  C CG1 . VAL B 1 63  ? -29.969 30.255  -43.413  1.00 84.18  ? 118  VAL B CG1 1 
ATOM   3812  C CG2 . VAL B 1 63  ? -30.975 32.543  -43.525  1.00 90.83  ? 118  VAL B CG2 1 
ATOM   3813  N N   . ILE B 1 64  ? -31.504 29.510  -45.985  1.00 85.12  ? 119  ILE B N   1 
ATOM   3814  C CA  . ILE B 1 64  ? -31.072 29.486  -47.380  1.00 82.01  ? 119  ILE B CA  1 
ATOM   3815  C C   . ILE B 1 64  ? -31.859 28.492  -48.226  1.00 74.65  ? 119  ILE B C   1 
ATOM   3816  O O   . ILE B 1 64  ? -32.563 28.873  -49.160  1.00 73.38  ? 119  ILE B O   1 
ATOM   3817  C CB  . ILE B 1 64  ? -29.566 29.159  -47.507  1.00 79.29  ? 119  ILE B CB  1 
ATOM   3818  C CG1 . ILE B 1 64  ? -28.714 30.245  -46.851  1.00 77.36  ? 119  ILE B CG1 1 
ATOM   3819  C CG2 . ILE B 1 64  ? -29.173 29.015  -48.964  1.00 75.35  ? 119  ILE B CG2 1 
ATOM   3820  C CD1 . ILE B 1 64  ? -27.223 30.065  -47.085  1.00 70.65  ? 119  ILE B CD1 1 
ATOM   3821  N N   . SER B 1 65  ? -31.727 27.215  -47.891  1.00 72.00  ? 120  SER B N   1 
ATOM   3822  C CA  . SER B 1 65  ? -32.258 26.135  -48.718  1.00 82.28  ? 120  SER B CA  1 
ATOM   3823  C C   . SER B 1 65  ? -33.779 26.169  -48.938  1.00 82.72  ? 120  SER B C   1 
ATOM   3824  O O   . SER B 1 65  ? -34.253 26.043  -50.074  1.00 80.40  ? 120  SER B O   1 
ATOM   3825  C CB  . SER B 1 65  ? -31.815 24.781  -48.157  1.00 83.63  ? 120  SER B CB  1 
ATOM   3826  O OG  . SER B 1 65  ? -30.399 24.697  -48.098  1.00 70.24  ? 120  SER B OG  1 
ATOM   3827  N N   . MET B 1 66  ? -34.536 26.334  -47.857  1.00 83.43  ? 121  MET B N   1 
ATOM   3828  C CA  . MET B 1 66  ? -35.990 26.385  -47.950  1.00 86.48  ? 121  MET B CA  1 
ATOM   3829  C C   . MET B 1 66  ? -36.434 27.532  -48.861  1.00 87.46  ? 121  MET B C   1 
ATOM   3830  O O   . MET B 1 66  ? -37.548 27.519  -49.386  1.00 82.31  ? 121  MET B O   1 
ATOM   3831  C CB  . MET B 1 66  ? -36.622 26.534  -46.560  1.00 94.11  ? 121  MET B CB  1 
ATOM   3832  C CG  . MET B 1 66  ? -36.174 25.491  -45.550  1.00 97.19  ? 121  MET B CG  1 
ATOM   3833  S SD  . MET B 1 66  ? -37.075 25.578  -43.987  1.00 330.49 ? 121  MET B SD  1 
ATOM   3834  C CE  . MET B 1 66  ? -38.647 24.856  -44.451  1.00 112.72 ? 121  MET B CE  1 
ATOM   3835  N N   . ASN B 1 67  ? -35.553 28.516  -49.042  1.00 91.83  ? 122  ASN B N   1 
ATOM   3836  C CA  . ASN B 1 67  ? -35.833 29.688  -49.875  1.00 83.31  ? 122  ASN B CA  1 
ATOM   3837  C C   . ASN B 1 67  ? -35.407 29.491  -51.315  1.00 80.37  ? 122  ASN B C   1 
ATOM   3838  O O   . ASN B 1 67  ? -36.241 29.427  -52.219  1.00 90.43  ? 122  ASN B O   1 
ATOM   3839  C CB  . ASN B 1 67  ? -35.132 30.931  -49.326  1.00 75.46  ? 122  ASN B CB  1 
ATOM   3840  C CG  . ASN B 1 67  ? -35.935 31.626  -48.255  1.00 82.29  ? 122  ASN B CG  1 
ATOM   3841  O OD1 . ASN B 1 67  ? -37.163 31.553  -48.241  1.00 82.55  ? 122  ASN B OD1 1 
ATOM   3842  N ND2 . ASN B 1 67  ? -35.244 32.309  -47.347  1.00 86.85  ? 122  ASN B ND2 1 
ATOM   3843  N N   . LEU B 1 68  ? -34.101 29.402  -51.529  1.00 70.32  ? 123  LEU B N   1 
ATOM   3844  C CA  . LEU B 1 68  ? -33.584 29.237  -52.874  1.00 69.04  ? 123  LEU B CA  1 
ATOM   3845  C C   . LEU B 1 68  ? -34.338 28.110  -53.557  1.00 77.33  ? 123  LEU B C   1 
ATOM   3846  O O   . LEU B 1 68  ? -34.640 28.188  -54.750  1.00 83.70  ? 123  LEU B O   1 
ATOM   3847  C CB  . LEU B 1 68  ? -32.085 28.953  -52.852  1.00 68.56  ? 123  LEU B CB  1 
ATOM   3848  C CG  . LEU B 1 68  ? -31.182 30.166  -52.617  1.00 65.67  ? 123  LEU B CG  1 
ATOM   3849  C CD1 . LEU B 1 68  ? -31.528 30.859  -51.308  1.00 77.37  ? 123  LEU B CD1 1 
ATOM   3850  C CD2 . LEU B 1 68  ? -29.716 29.769  -52.644  1.00 60.48  ? 123  LEU B CD2 1 
ATOM   3851  N N   . PHE B 1 69  ? -34.671 27.075  -52.791  1.00 79.65  ? 124  PHE B N   1 
ATOM   3852  C CA  . PHE B 1 69  ? -35.487 25.989  -53.320  1.00 80.51  ? 124  PHE B CA  1 
ATOM   3853  C C   . PHE B 1 69  ? -36.806 26.521  -53.867  1.00 80.57  ? 124  PHE B C   1 
ATOM   3854  O O   . PHE B 1 69  ? -37.143 26.296  -55.033  1.00 83.49  ? 124  PHE B O   1 
ATOM   3855  C CB  . PHE B 1 69  ? -35.760 24.941  -52.244  1.00 81.05  ? 124  PHE B CB  1 
ATOM   3856  C CG  . PHE B 1 69  ? -36.501 23.740  -52.750  1.00 80.30  ? 124  PHE B CG  1 
ATOM   3857  C CD1 . PHE B 1 69  ? -35.933 22.924  -53.714  1.00 75.59  ? 124  PHE B CD1 1 
ATOM   3858  C CD2 . PHE B 1 69  ? -37.759 23.424  -52.266  1.00 78.48  ? 124  PHE B CD2 1 
ATOM   3859  C CE1 . PHE B 1 69  ? -36.604 21.816  -54.187  1.00 72.06  ? 124  PHE B CE1 1 
ATOM   3860  C CE2 . PHE B 1 69  ? -38.434 22.315  -52.736  1.00 83.16  ? 124  PHE B CE2 1 
ATOM   3861  C CZ  . PHE B 1 69  ? -37.855 21.510  -53.698  1.00 80.83  ? 124  PHE B CZ  1 
ATOM   3862  N N   . THR B 1 70  ? -37.544 27.236  -53.025  1.00 79.69  ? 125  THR B N   1 
ATOM   3863  C CA  . THR B 1 70  ? -38.809 27.829  -53.441  1.00 84.74  ? 125  THR B CA  1 
ATOM   3864  C C   . THR B 1 70  ? -38.617 28.558  -54.769  1.00 90.42  ? 125  THR B C   1 
ATOM   3865  O O   . THR B 1 70  ? -39.420 28.415  -55.695  1.00 91.81  ? 125  THR B O   1 
ATOM   3866  C CB  . THR B 1 70  ? -39.346 28.829  -52.395  1.00 85.90  ? 125  THR B CB  1 
ATOM   3867  O OG1 . THR B 1 70  ? -39.279 28.249  -51.087  1.00 91.82  ? 125  THR B OG1 1 
ATOM   3868  C CG2 . THR B 1 70  ? -40.783 29.207  -52.707  1.00 85.58  ? 125  THR B CG2 1 
ATOM   3869  N N   . THR B 1 71  ? -37.534 29.328  -54.858  1.00 89.10  ? 126  THR B N   1 
ATOM   3870  C CA  . THR B 1 71  ? -37.212 30.082  -56.069  1.00 88.31  ? 126  THR B CA  1 
ATOM   3871  C C   . THR B 1 71  ? -37.099 29.178  -57.291  1.00 90.92  ? 126  THR B C   1 
ATOM   3872  O O   . THR B 1 71  ? -37.703 29.443  -58.337  1.00 95.18  ? 126  THR B O   1 
ATOM   3873  C CB  . THR B 1 71  ? -35.887 30.852  -55.910  1.00 86.09  ? 126  THR B CB  1 
ATOM   3874  O OG1 . THR B 1 71  ? -36.034 31.853  -54.895  1.00 85.65  ? 126  THR B OG1 1 
ATOM   3875  C CG2 . THR B 1 71  ? -35.490 31.515  -57.222  1.00 82.06  ? 126  THR B CG2 1 
ATOM   3876  N N   . TYR B 1 72  ? -36.311 28.117  -57.154  1.00 86.18  ? 127  TYR B N   1 
ATOM   3877  C CA  . TYR B 1 72  ? -36.122 27.168  -58.238  1.00 87.31  ? 127  TYR B CA  1 
ATOM   3878  C C   . TYR B 1 72  ? -37.453 26.560  -58.667  1.00 89.35  ? 127  TYR B C   1 
ATOM   3879  O O   . TYR B 1 72  ? -37.668 26.302  -59.852  1.00 94.33  ? 127  TYR B O   1 
ATOM   3880  C CB  . TYR B 1 72  ? -35.137 26.078  -57.822  1.00 85.69  ? 127  TYR B CB  1 
ATOM   3881  C CG  . TYR B 1 72  ? -34.856 25.049  -58.891  1.00 84.63  ? 127  TYR B CG  1 
ATOM   3882  C CD1 . TYR B 1 72  ? -33.635 25.021  -59.552  1.00 83.84  ? 127  TYR B CD1 1 
ATOM   3883  C CD2 . TYR B 1 72  ? -35.811 24.099  -59.233  1.00 86.23  ? 127  TYR B CD2 1 
ATOM   3884  C CE1 . TYR B 1 72  ? -33.378 24.075  -60.525  1.00 93.21  ? 127  TYR B CE1 1 
ATOM   3885  C CE2 . TYR B 1 72  ? -35.565 23.155  -60.202  1.00 88.33  ? 127  TYR B CE2 1 
ATOM   3886  C CZ  . TYR B 1 72  ? -34.347 23.144  -60.845  1.00 97.30  ? 127  TYR B CZ  1 
ATOM   3887  O OH  . TYR B 1 72  ? -34.104 22.196  -61.814  1.00 101.86 ? 127  TYR B OH  1 
ATOM   3888  N N   . ILE B 1 73  ? -38.346 26.329  -57.709  1.00 84.86  ? 128  ILE B N   1 
ATOM   3889  C CA  . ILE B 1 73  ? -39.672 25.817  -58.048  1.00 93.75  ? 128  ILE B CA  1 
ATOM   3890  C C   . ILE B 1 73  ? -40.446 26.837  -58.882  1.00 104.90 ? 128  ILE B C   1 
ATOM   3891  O O   . ILE B 1 73  ? -40.940 26.521  -59.967  1.00 109.59 ? 128  ILE B O   1 
ATOM   3892  C CB  . ILE B 1 73  ? -40.512 25.460  -56.800  1.00 92.63  ? 128  ILE B CB  1 
ATOM   3893  C CG1 . ILE B 1 73  ? -39.838 24.359  -55.983  1.00 90.16  ? 128  ILE B CG1 1 
ATOM   3894  C CG2 . ILE B 1 73  ? -41.910 25.013  -57.211  1.00 86.64  ? 128  ILE B CG2 1 
ATOM   3895  C CD1 . ILE B 1 73  ? -40.609 23.974  -54.730  1.00 83.97  ? 128  ILE B CD1 1 
ATOM   3896  N N   . ILE B 1 74  ? -40.550 28.061  -58.370  1.00 103.98 ? 129  ILE B N   1 
ATOM   3897  C CA  . ILE B 1 74  ? -41.335 29.104  -59.030  1.00 104.35 ? 129  ILE B CA  1 
ATOM   3898  C C   . ILE B 1 74  ? -40.846 29.422  -60.440  1.00 98.34  ? 129  ILE B C   1 
ATOM   3899  O O   . ILE B 1 74  ? -41.595 29.309  -61.412  1.00 89.36  ? 129  ILE B O   1 
ATOM   3900  C CB  . ILE B 1 74  ? -41.312 30.413  -58.223  1.00 106.44 ? 129  ILE B CB  1 
ATOM   3901  C CG1 . ILE B 1 74  ? -41.811 30.173  -56.798  1.00 105.99 ? 129  ILE B CG1 1 
ATOM   3902  C CG2 . ILE B 1 74  ? -42.146 31.481  -58.920  1.00 116.78 ? 129  ILE B CG2 1 
ATOM   3903  C CD1 . ILE B 1 74  ? -41.762 31.408  -55.924  1.00 113.15 ? 129  ILE B CD1 1 
ATOM   3904  N N   . MET B 1 75  ? -39.585 29.826  -60.539  1.00 95.58  ? 130  MET B N   1 
ATOM   3905  C CA  . MET B 1 75  ? -39.026 30.257  -61.807  1.00 97.66  ? 130  MET B CA  1 
ATOM   3906  C C   . MET B 1 75  ? -38.999 29.120  -62.809  1.00 101.94 ? 130  MET B C   1 
ATOM   3907  O O   . MET B 1 75  ? -38.738 29.339  -63.998  1.00 104.51 ? 130  MET B O   1 
ATOM   3908  C CB  . MET B 1 75  ? -37.610 30.789  -61.612  1.00 98.55  ? 130  MET B CB  1 
ATOM   3909  C CG  . MET B 1 75  ? -37.519 31.976  -60.683  1.00 95.63  ? 130  MET B CG  1 
ATOM   3910  S SD  . MET B 1 75  ? -35.884 32.727  -60.753  1.00 104.01 ? 130  MET B SD  1 
ATOM   3911  C CE  . MET B 1 75  ? -35.773 33.114  -62.495  1.00 106.20 ? 130  MET B CE  1 
ATOM   3912  N N   . ASN B 1 76  ? -39.238 27.904  -62.323  1.00 103.36 ? 131  ASN B N   1 
ATOM   3913  C CA  . ASN B 1 76  ? -39.228 26.732  -63.183  1.00 107.98 ? 131  ASN B CA  1 
ATOM   3914  C C   . ASN B 1 76  ? -37.820 26.460  -63.699  1.00 104.68 ? 131  ASN B C   1 
ATOM   3915  O O   . ASN B 1 76  ? -37.572 25.469  -64.376  1.00 101.06 ? 131  ASN B O   1 
ATOM   3916  C CB  . ASN B 1 76  ? -40.196 26.940  -64.350  1.00 113.99 ? 131  ASN B CB  1 
ATOM   3917  C CG  . ASN B 1 76  ? -40.702 25.638  -64.930  1.00 113.46 ? 131  ASN B CG  1 
ATOM   3918  O OD1 . ASN B 1 76  ? -40.472 24.562  -64.375  1.00 114.71 ? 131  ASN B OD1 1 
ATOM   3919  N ND2 . ASN B 1 76  ? -41.411 25.729  -66.047  1.00 111.54 ? 131  ASN B ND2 1 
ATOM   3920  N N   . ARG B 1 77  ? -36.904 27.366  -63.376  1.00 104.64 ? 132  ARG B N   1 
ATOM   3921  C CA  . ARG B 1 77  ? -35.544 27.328  -63.899  1.00 102.14 ? 132  ARG B CA  1 
ATOM   3922  C C   . ARG B 1 77  ? -34.541 27.843  -62.870  1.00 101.98 ? 132  ARG B C   1 
ATOM   3923  O O   . ARG B 1 77  ? -34.928 28.469  -61.882  1.00 99.65  ? 132  ARG B O   1 
ATOM   3924  C CB  . ARG B 1 77  ? -35.461 28.161  -65.176  1.00 98.97  ? 132  ARG B CB  1 
ATOM   3925  C CG  . ARG B 1 77  ? -35.846 29.617  -64.965  1.00 105.97 ? 132  ARG B CG  1 
ATOM   3926  C CD  . ARG B 1 77  ? -35.890 30.386  -66.274  1.00 114.23 ? 132  ARG B CD  1 
ATOM   3927  N NE  . ARG B 1 77  ? -36.244 31.785  -66.051  1.00 117.18 ? 132  ARG B NE  1 
ATOM   3928  C CZ  . ARG B 1 77  ? -35.359 32.756  -65.845  1.00 110.52 ? 132  ARG B CZ  1 
ATOM   3929  N NH1 . ARG B 1 77  ? -34.061 32.486  -65.841  1.00 104.72 ? 132  ARG B NH1 1 
ATOM   3930  N NH2 . ARG B 1 77  ? -35.774 33.999  -65.645  1.00 108.97 ? 132  ARG B NH2 1 
ATOM   3931  N N   . TRP B 1 78  ? -33.258 27.576  -63.099  1.00 102.60 ? 133  TRP B N   1 
ATOM   3932  C CA  . TRP B 1 78  ? -32.221 28.047  -62.187  1.00 95.03  ? 133  TRP B CA  1 
ATOM   3933  C C   . TRP B 1 78  ? -31.447 29.229  -62.770  1.00 99.14  ? 133  TRP B C   1 
ATOM   3934  O O   . TRP B 1 78  ? -30.610 29.056  -63.659  1.00 100.26 ? 133  TRP B O   1 
ATOM   3935  C CB  . TRP B 1 78  ? -31.261 26.912  -61.868  1.00 91.06  ? 133  TRP B CB  1 
ATOM   3936  C CG  . TRP B 1 78  ? -30.105 27.328  -61.035  1.00 87.91  ? 133  TRP B CG  1 
ATOM   3937  C CD1 . TRP B 1 78  ? -28.861 27.659  -61.475  1.00 84.11  ? 133  TRP B CD1 1 
ATOM   3938  C CD2 . TRP B 1 78  ? -30.078 27.462  -59.610  1.00 91.43  ? 133  TRP B CD2 1 
ATOM   3939  N NE1 . TRP B 1 78  ? -28.056 27.986  -60.413  1.00 85.78  ? 133  TRP B NE1 1 
ATOM   3940  C CE2 . TRP B 1 78  ? -28.779 27.873  -59.255  1.00 90.11  ? 133  TRP B CE2 1 
ATOM   3941  C CE3 . TRP B 1 78  ? -31.024 27.269  -58.599  1.00 90.75  ? 133  TRP B CE3 1 
ATOM   3942  C CZ2 . TRP B 1 78  ? -28.401 28.102  -57.935  1.00 84.83  ? 133  TRP B CZ2 1 
ATOM   3943  C CZ3 . TRP B 1 78  ? -30.644 27.495  -57.287  1.00 91.43  ? 133  TRP B CZ3 1 
ATOM   3944  C CH2 . TRP B 1 78  ? -29.344 27.907  -56.968  1.00 81.87  ? 133  TRP B CH2 1 
ATOM   3945  N N   . ALA B 1 79  ? -31.697 30.417  -62.221  1.00 100.07 ? 134  ALA B N   1 
ATOM   3946  C CA  . ALA B 1 79  ? -31.189 31.670  -62.792  1.00 103.38 ? 134  ALA B CA  1 
ATOM   3947  C C   . ALA B 1 79  ? -29.897 32.222  -62.174  1.00 98.36  ? 134  ALA B C   1 
ATOM   3948  O O   . ALA B 1 79  ? -29.452 33.309  -62.537  1.00 90.37  ? 134  ALA B O   1 
ATOM   3949  C CB  . ALA B 1 79  ? -32.283 32.737  -62.793  1.00 101.35 ? 134  ALA B CB  1 
ATOM   3950  N N   . LEU B 1 80  ? -29.308 31.490  -61.236  1.00 98.71  ? 135  LEU B N   1 
ATOM   3951  C CA  . LEU B 1 80  ? -28.064 31.930  -60.606  1.00 98.64  ? 135  LEU B CA  1 
ATOM   3952  C C   . LEU B 1 80  ? -26.814 31.355  -61.279  1.00 91.76  ? 135  LEU B C   1 
ATOM   3953  O O   . LEU B 1 80  ? -25.688 31.594  -60.834  1.00 85.01  ? 135  LEU B O   1 
ATOM   3954  C CB  . LEU B 1 80  ? -28.060 31.585  -59.116  1.00 108.36 ? 135  LEU B CB  1 
ATOM   3955  C CG  . LEU B 1 80  ? -28.339 32.727  -58.140  1.00 104.62 ? 135  LEU B CG  1 
ATOM   3956  C CD1 . LEU B 1 80  ? -28.425 32.200  -56.716  1.00 101.20 ? 135  LEU B CD1 1 
ATOM   3957  C CD2 . LEU B 1 80  ? -27.271 33.806  -58.250  1.00 104.13 ? 135  LEU B CD2 1 
ATOM   3958  N N   . GLY B 1 81  ? -27.016 30.597  -62.349  1.00 87.17  ? 136  GLY B N   1 
ATOM   3959  C CA  . GLY B 1 81  ? -25.908 30.004  -63.070  1.00 92.89  ? 136  GLY B CA  1 
ATOM   3960  C C   . GLY B 1 81  ? -25.422 28.713  -62.440  1.00 102.53 ? 136  GLY B C   1 
ATOM   3961  O O   . GLY B 1 81  ? -26.203 27.940  -61.889  1.00 99.58  ? 136  GLY B O   1 
ATOM   3962  N N   . ASN B 1 82  ? -24.121 28.471  -62.529  1.00 102.02 ? 137  ASN B N   1 
ATOM   3963  C CA  . ASN B 1 82  ? -23.545 27.236  -62.014  1.00 99.40  ? 137  ASN B CA  1 
ATOM   3964  C C   . ASN B 1 82  ? -23.174 27.285  -60.529  1.00 100.07 ? 137  ASN B C   1 
ATOM   3965  O O   . ASN B 1 82  ? -23.841 26.676  -59.697  1.00 97.07  ? 137  ASN B O   1 
ATOM   3966  C CB  . ASN B 1 82  ? -22.335 26.822  -62.859  1.00 103.46 ? 137  ASN B CB  1 
ATOM   3967  C CG  . ASN B 1 82  ? -21.440 27.996  -63.219  1.00 107.34 ? 137  ASN B CG  1 
ATOM   3968  O OD1 . ASN B 1 82  ? -21.489 29.051  -62.585  1.00 113.83 ? 137  ASN B OD1 1 
ATOM   3969  N ND2 . ASN B 1 82  ? -20.616 27.817  -64.244  1.00 102.64 ? 137  ASN B ND2 1 
ATOM   3970  N N   . LEU B 1 83  ? -22.123 28.033  -60.208  1.00 97.87  ? 138  LEU B N   1 
ATOM   3971  C CA  . LEU B 1 83  ? -21.532 28.027  -58.872  1.00 91.44  ? 138  LEU B CA  1 
ATOM   3972  C C   . LEU B 1 83  ? -22.565 28.132  -57.740  1.00 88.11  ? 138  LEU B C   1 
ATOM   3973  O O   . LEU B 1 83  ? -22.520 27.351  -56.789  1.00 84.40  ? 138  LEU B O   1 
ATOM   3974  C CB  . LEU B 1 83  ? -20.476 29.137  -58.764  1.00 91.23  ? 138  LEU B CB  1 
ATOM   3975  C CG  . LEU B 1 83  ? -19.620 29.267  -57.501  1.00 84.03  ? 138  LEU B CG  1 
ATOM   3976  C CD1 . LEU B 1 83  ? -18.302 29.962  -57.823  1.00 79.23  ? 138  LEU B CD1 1 
ATOM   3977  C CD2 . LEU B 1 83  ? -20.365 30.005  -56.398  1.00 80.34  ? 138  LEU B CD2 1 
ATOM   3978  N N   . ALA B 1 84  ? -23.491 29.082  -57.843  1.00 89.48  ? 139  ALA B N   1 
ATOM   3979  C CA  . ALA B 1 84  ? -24.506 29.281  -56.808  1.00 85.94  ? 139  ALA B CA  1 
ATOM   3980  C C   . ALA B 1 84  ? -25.282 27.989  -56.558  1.00 88.28  ? 139  ALA B C   1 
ATOM   3981  O O   . ALA B 1 84  ? -25.678 27.679  -55.431  1.00 93.96  ? 139  ALA B O   1 
ATOM   3982  C CB  . ALA B 1 84  ? -25.451 30.394  -57.220  1.00 78.49  ? 139  ALA B CB  1 
ATOM   3983  N N   . CYS B 1 85  ? -25.477 27.248  -57.640  1.00 85.09  ? 140  CYS B N   1 
ATOM   3984  C CA  . CYS B 1 85  ? -26.122 25.956  -57.662  1.00 86.77  ? 140  CYS B CA  1 
ATOM   3985  C C   . CYS B 1 85  ? -25.324 24.892  -56.856  1.00 87.29  ? 140  CYS B C   1 
ATOM   3986  O O   . CYS B 1 85  ? -25.918 24.020  -56.237  1.00 84.11  ? 140  CYS B O   1 
ATOM   3987  C CB  . CYS B 1 85  ? -26.322 25.544  -59.108  1.00 88.60  ? 140  CYS B CB  1 
ATOM   3988  S SG  . CYS B 1 85  ? -26.694 23.791  -59.148  1.00 87.17  ? 140  CYS B SG  1 
ATOM   3989  N N   . ASP B 1 86  ? -23.994 25.032  -56.878  1.00 88.37  ? 141  ASP B N   1 
ATOM   3990  C CA  . ASP B 1 86  ? -23.053 24.200  -56.121  1.00 89.31  ? 141  ASP B CA  1 
ATOM   3991  C C   . ASP B 1 86  ? -23.059 24.555  -54.632  1.00 86.55  ? 141  ASP B C   1 
ATOM   3992  O O   . ASP B 1 86  ? -23.128 23.674  -53.770  1.00 79.61  ? 141  ASP B O   1 
ATOM   3993  C CB  . ASP B 1 86  ? -21.628 24.371  -56.665  1.00 92.79  ? 141  ASP B CB  1 
ATOM   3994  C CG  . ASP B 1 86  ? -21.555 24.230  -58.175  1.00 99.51  ? 141  ASP B CG  1 
ATOM   3995  O OD1 . ASP B 1 86  ? -20.633 24.820  -58.783  1.00 99.83  ? 141  ASP B OD1 1 
ATOM   3996  O OD2 . ASP B 1 86  ? -22.413 23.525  -58.752  1.00 98.92  ? 141  ASP B OD2 1 
ATOM   3997  N N   . LEU B 1 87  ? -22.966 25.850  -54.334  1.00 91.04  ? 142  LEU B N   1 
ATOM   3998  C CA  . LEU B 1 87  ? -23.007 26.322  -52.952  1.00 82.34  ? 142  LEU B CA  1 
ATOM   3999  C C   . LEU B 1 87  ? -24.304 25.890  -52.286  1.00 77.34  ? 142  LEU B C   1 
ATOM   4000  O O   . LEU B 1 87  ? -24.294 25.378  -51.165  1.00 77.46  ? 142  LEU B O   1 
ATOM   4001  C CB  . LEU B 1 87  ? -22.868 27.847  -52.880  1.00 79.03  ? 142  LEU B CB  1 
ATOM   4002  C CG  . LEU B 1 87  ? -21.522 28.469  -53.262  1.00 76.52  ? 142  LEU B CG  1 
ATOM   4003  C CD1 . LEU B 1 87  ? -21.498 29.934  -52.871  1.00 76.78  ? 142  LEU B CD1 1 
ATOM   4004  C CD2 . LEU B 1 87  ? -20.379 27.725  -52.597  1.00 75.14  ? 142  LEU B CD2 1 
ATOM   4005  N N   . TRP B 1 88  ? -25.416 26.093  -52.988  1.00 75.50  ? 143  TRP B N   1 
ATOM   4006  C CA  . TRP B 1 88  ? -26.723 25.703  -52.477  1.00 76.28  ? 143  TRP B CA  1 
ATOM   4007  C C   . TRP B 1 88  ? -26.785 24.208  -52.199  1.00 78.58  ? 143  TRP B C   1 
ATOM   4008  O O   . TRP B 1 88  ? -27.164 23.783  -51.091  1.00 80.95  ? 143  TRP B O   1 
ATOM   4009  C CB  . TRP B 1 88  ? -27.830 26.075  -53.461  1.00 80.11  ? 143  TRP B CB  1 
ATOM   4010  C CG  . TRP B 1 88  ? -29.192 25.676  -52.975  1.00 79.58  ? 143  TRP B CG  1 
ATOM   4011  C CD1 . TRP B 1 88  ? -29.830 26.146  -51.867  1.00 84.29  ? 143  TRP B CD1 1 
ATOM   4012  C CD2 . TRP B 1 88  ? -30.079 24.722  -53.573  1.00 78.02  ? 143  TRP B CD2 1 
ATOM   4013  N NE1 . TRP B 1 88  ? -31.058 25.548  -51.736  1.00 85.47  ? 143  TRP B NE1 1 
ATOM   4014  C CE2 . TRP B 1 88  ? -31.237 24.670  -52.771  1.00 82.39  ? 143  TRP B CE2 1 
ATOM   4015  C CE3 . TRP B 1 88  ? -30.009 23.910  -54.708  1.00 79.03  ? 143  TRP B CE3 1 
ATOM   4016  C CZ2 . TRP B 1 88  ? -32.316 23.839  -53.066  1.00 83.06  ? 143  TRP B CZ2 1 
ATOM   4017  C CZ3 . TRP B 1 88  ? -31.081 23.084  -55.000  1.00 82.29  ? 143  TRP B CZ3 1 
ATOM   4018  C CH2 . TRP B 1 88  ? -32.219 23.055  -54.182  1.00 83.49  ? 143  TRP B CH2 1 
ATOM   4019  N N   . LEU B 1 89  ? -26.420 23.409  -53.204  1.00 77.85  ? 144  LEU B N   1 
ATOM   4020  C CA  . LEU B 1 89  ? -26.441 21.966  -53.005  1.00 77.75  ? 144  LEU B CA  1 
ATOM   4021  C C   . LEU B 1 89  ? -25.594 21.497  -51.811  1.00 78.09  ? 144  LEU B C   1 
ATOM   4022  O O   . LEU B 1 89  ? -26.095 20.816  -50.901  1.00 72.17  ? 144  LEU B O   1 
ATOM   4023  C CB  . LEU B 1 89  ? -26.011 21.263  -54.283  1.00 72.09  ? 144  LEU B CB  1 
ATOM   4024  C CG  . LEU B 1 89  ? -27.088 21.261  -55.360  1.00 72.07  ? 144  LEU B CG  1 
ATOM   4025  C CD1 . LEU B 1 89  ? -26.558 20.571  -56.595  1.00 80.91  ? 144  LEU B CD1 1 
ATOM   4026  C CD2 . LEU B 1 89  ? -28.350 20.580  -54.854  1.00 67.03  ? 144  LEU B CD2 1 
ATOM   4027  N N   . SER B 1 90  ? -24.315 21.865  -51.823  1.00 79.61  ? 145  SER B N   1 
ATOM   4028  C CA  . SER B 1 90  ? -23.374 21.450  -50.782  1.00 80.09  ? 145  SER B CA  1 
ATOM   4029  C C   . SER B 1 90  ? -23.791 21.922  -49.382  1.00 77.04  ? 145  SER B C   1 
ATOM   4030  O O   . SER B 1 90  ? -23.622 21.200  -48.396  1.00 68.66  ? 145  SER B O   1 
ATOM   4031  C CB  . SER B 1 90  ? -21.955 21.922  -51.118  1.00 79.06  ? 145  SER B CB  1 
ATOM   4032  O OG  . SER B 1 90  ? -21.923 23.321  -51.336  1.00 86.13  ? 145  SER B OG  1 
ATOM   4033  N N   . ILE B 1 91  ? -24.345 23.130  -49.302  1.00 79.90  ? 146  ILE B N   1 
ATOM   4034  C CA  . ILE B 1 91  ? -24.843 23.661  -48.034  1.00 74.12  ? 146  ILE B CA  1 
ATOM   4035  C C   . ILE B 1 91  ? -26.028 22.841  -47.516  1.00 70.87  ? 146  ILE B C   1 
ATOM   4036  O O   . ILE B 1 91  ? -26.040 22.404  -46.356  1.00 74.88  ? 146  ILE B O   1 
ATOM   4037  C CB  . ILE B 1 91  ? -25.236 25.150  -48.156  1.00 70.93  ? 146  ILE B CB  1 
ATOM   4038  C CG1 . ILE B 1 91  ? -23.987 26.041  -48.115  1.00 66.54  ? 146  ILE B CG1 1 
ATOM   4039  C CG2 . ILE B 1 91  ? -26.203 25.536  -47.054  1.00 63.90  ? 146  ILE B CG2 1 
ATOM   4040  C CD1 . ILE B 1 91  ? -24.243 27.491  -48.488  1.00 71.00  ? 146  ILE B CD1 1 
ATOM   4041  N N   . ASP B 1 92  ? -27.015 22.620  -48.381  1.00 69.82  ? 147  ASP B N   1 
ATOM   4042  C CA  . ASP B 1 92  ? -28.185 21.829  -48.006  1.00 75.83  ? 147  ASP B CA  1 
ATOM   4043  C C   . ASP B 1 92  ? -27.785 20.446  -47.498  1.00 71.49  ? 147  ASP B C   1 
ATOM   4044  O O   . ASP B 1 92  ? -28.142 20.046  -46.385  1.00 65.44  ? 147  ASP B O   1 
ATOM   4045  C CB  . ASP B 1 92  ? -29.127 21.673  -49.201  1.00 82.85  ? 147  ASP B CB  1 
ATOM   4046  C CG  . ASP B 1 92  ? -30.537 21.287  -48.788  1.00 86.06  ? 147  ASP B CG  1 
ATOM   4047  O OD1 . ASP B 1 92  ? -31.464 21.422  -49.616  1.00 79.15  ? 147  ASP B OD1 1 
ATOM   4048  O OD2 . ASP B 1 92  ? -30.718 20.858  -47.628  1.00 90.50  ? 147  ASP B OD2 1 
ATOM   4049  N N   . TYR B 1 93  ? -27.040 19.722  -48.326  1.00 74.57  ? 148  TYR B N   1 
ATOM   4050  C CA  . TYR B 1 93  ? -26.622 18.363  -47.985  1.00 72.58  ? 148  TYR B CA  1 
ATOM   4051  C C   . TYR B 1 93  ? -25.739 18.278  -46.741  1.00 63.75  ? 148  TYR B C   1 
ATOM   4052  O O   . TYR B 1 93  ? -26.031 17.508  -45.826  1.00 67.19  ? 148  TYR B O   1 
ATOM   4053  C CB  . TYR B 1 93  ? -25.961 17.682  -49.187  1.00 71.20  ? 148  TYR B CB  1 
ATOM   4054  C CG  . TYR B 1 93  ? -26.975 17.159  -50.176  1.00 71.90  ? 148  TYR B CG  1 
ATOM   4055  C CD1 . TYR B 1 93  ? -27.745 18.031  -50.928  1.00 78.84  ? 148  TYR B CD1 1 
ATOM   4056  C CD2 . TYR B 1 93  ? -27.178 15.797  -50.340  1.00 69.70  ? 148  TYR B CD2 1 
ATOM   4057  C CE1 . TYR B 1 93  ? -28.684 17.564  -51.824  1.00 79.62  ? 148  TYR B CE1 1 
ATOM   4058  C CE2 . TYR B 1 93  ? -28.113 15.318  -51.235  1.00 70.69  ? 148  TYR B CE2 1 
ATOM   4059  C CZ  . TYR B 1 93  ? -28.864 16.208  -51.976  1.00 73.30  ? 148  TYR B CZ  1 
ATOM   4060  O OH  . TYR B 1 93  ? -29.802 15.749  -52.869  1.00 72.58  ? 148  TYR B OH  1 
ATOM   4061  N N   . VAL B 1 94  ? -24.667 19.060  -46.697  1.00 58.36  ? 149  VAL B N   1 
ATOM   4062  C CA  . VAL B 1 94  ? -23.824 19.055  -45.508  1.00 62.52  ? 149  VAL B CA  1 
ATOM   4063  C C   . VAL B 1 94  ? -24.675 19.316  -44.267  1.00 62.98  ? 149  VAL B C   1 
ATOM   4064  O O   . VAL B 1 94  ? -24.479 18.683  -43.229  1.00 62.02  ? 149  VAL B O   1 
ATOM   4065  C CB  . VAL B 1 94  ? -22.677 20.076  -45.595  1.00 63.83  ? 149  VAL B CB  1 
ATOM   4066  C CG1 . VAL B 1 94  ? -21.874 20.082  -44.302  1.00 53.93  ? 149  VAL B CG1 1 
ATOM   4067  C CG2 . VAL B 1 94  ? -21.775 19.750  -46.773  1.00 72.96  ? 149  VAL B CG2 1 
ATOM   4068  N N   . ALA B 1 95  ? -25.636 20.230  -44.384  1.00 66.93  ? 150  ALA B N   1 
ATOM   4069  C CA  . ALA B 1 95  ? -26.506 20.558  -43.253  1.00 65.37  ? 150  ALA B CA  1 
ATOM   4070  C C   . ALA B 1 95  ? -27.380 19.379  -42.814  1.00 65.51  ? 150  ALA B C   1 
ATOM   4071  O O   . ALA B 1 95  ? -27.441 19.039  -41.629  1.00 66.49  ? 150  ALA B O   1 
ATOM   4072  C CB  . ALA B 1 95  ? -27.364 21.768  -43.580  1.00 64.00  ? 150  ALA B CB  1 
ATOM   4073  N N   . SER B 1 96  ? -28.052 18.760  -43.781  1.00 66.92  ? 151  SER B N   1 
ATOM   4074  C CA  . SER B 1 96  ? -28.955 17.638  -43.518  1.00 68.58  ? 151  SER B CA  1 
ATOM   4075  C C   . SER B 1 96  ? -28.249 16.408  -42.946  1.00 62.63  ? 151  SER B C   1 
ATOM   4076  O O   . SER B 1 96  ? -28.693 15.823  -41.954  1.00 58.18  ? 151  SER B O   1 
ATOM   4077  C CB  . SER B 1 96  ? -29.697 17.254  -44.799  1.00 69.94  ? 151  SER B CB  1 
ATOM   4078  O OG  . SER B 1 96  ? -28.799 17.051  -45.877  1.00 65.87  ? 151  SER B OG  1 
ATOM   4079  N N   . ASN B 1 97  ? -27.160 16.004  -43.588  1.00 60.40  ? 152  ASN B N   1 
ATOM   4080  C CA  . ASN B 1 97  ? -26.393 14.865  -43.109  1.00 60.97  ? 152  ASN B CA  1 
ATOM   4081  C C   . ASN B 1 97  ? -25.748 15.153  -41.759  1.00 63.67  ? 152  ASN B C   1 
ATOM   4082  O O   . ASN B 1 97  ? -25.721 14.294  -40.873  1.00 62.34  ? 152  ASN B O   1 
ATOM   4083  C CB  . ASN B 1 97  ? -25.333 14.455  -44.125  1.00 59.99  ? 152  ASN B CB  1 
ATOM   4084  C CG  . ASN B 1 97  ? -24.601 13.202  -43.714  1.00 66.24  ? 152  ASN B CG  1 
ATOM   4085  O OD1 . ASN B 1 97  ? -25.032 12.088  -44.024  1.00 66.86  ? 152  ASN B OD1 1 
ATOM   4086  N ND2 . ASN B 1 97  ? -23.492 13.371  -42.999  1.00 61.89  ? 152  ASN B ND2 1 
ATOM   4087  N N   . ALA B 1 98  ? -25.216 16.363  -41.609  1.00 68.29  ? 153  ALA B N   1 
ATOM   4088  C CA  . ALA B 1 98  ? -24.720 16.807  -40.313  1.00 69.09  ? 153  ALA B CA  1 
ATOM   4089  C C   . ALA B 1 98  ? -25.834 16.618  -39.295  1.00 63.32  ? 153  ALA B C   1 
ATOM   4090  O O   . ALA B 1 98  ? -25.592 16.282  -38.134  1.00 66.97  ? 153  ALA B O   1 
ATOM   4091  C CB  . ALA B 1 98  ? -24.293 18.263  -40.373  1.00 71.77  ? 153  ALA B CB  1 
ATOM   4092  N N   . SER B 1 99  ? -27.067 16.827  -39.744  1.00 58.49  ? 154  SER B N   1 
ATOM   4093  C CA  . SER B 1 99  ? -28.218 16.626  -38.879  1.00 57.80  ? 154  SER B CA  1 
ATOM   4094  C C   . SER B 1 99  ? -28.370 15.158  -38.480  1.00 57.11  ? 154  SER B C   1 
ATOM   4095  O O   . SER B 1 99  ? -28.387 14.829  -37.290  1.00 54.40  ? 154  SER B O   1 
ATOM   4096  C CB  . SER B 1 99  ? -29.491 17.134  -39.559  1.00 64.62  ? 154  SER B CB  1 
ATOM   4097  O OG  . SER B 1 99  ? -30.584 17.136  -38.666  1.00 67.60  ? 154  SER B OG  1 
ATOM   4098  N N   . VAL B 1 100 ? -28.465 14.272  -39.468  1.00 61.40  ? 155  VAL B N   1 
ATOM   4099  C CA  . VAL B 1 100 ? -28.680 12.856  -39.164  1.00 54.59  ? 155  VAL B CA  1 
ATOM   4100  C C   . VAL B 1 100 ? -27.589 12.339  -38.226  1.00 56.20  ? 155  VAL B C   1 
ATOM   4101  O O   . VAL B 1 100 ? -27.878 11.670  -37.227  1.00 58.35  ? 155  VAL B O   1 
ATOM   4102  C CB  . VAL B 1 100 ? -28.795 11.981  -40.435  1.00 43.49  ? 155  VAL B CB  1 
ATOM   4103  C CG1 . VAL B 1 100 ? -29.706 12.653  -41.439  1.00 53.09  ? 155  VAL B CG1 1 
ATOM   4104  C CG2 . VAL B 1 100 ? -27.436 11.738  -41.050  1.00 48.30  ? 155  VAL B CG2 1 
ATOM   4105  N N   . MET B 1 101 ? -26.340 12.681  -38.531  1.00 54.44  ? 156  MET B N   1 
ATOM   4106  C CA  . MET B 1 101 ? -25.222 12.319  -37.669  1.00 53.33  ? 156  MET B CA  1 
ATOM   4107  C C   . MET B 1 101 ? -25.443 12.874  -36.270  1.00 54.11  ? 156  MET B C   1 
ATOM   4108  O O   . MET B 1 101 ? -25.219 12.186  -35.280  1.00 58.73  ? 156  MET B O   1 
ATOM   4109  C CB  . MET B 1 101 ? -23.897 12.815  -38.249  1.00 55.71  ? 156  MET B CB  1 
ATOM   4110  C CG  . MET B 1 101 ? -23.494 12.097  -39.523  1.00 60.41  ? 156  MET B CG  1 
ATOM   4111  S SD  . MET B 1 101 ? -21.815 12.480  -40.054  1.00 80.78  ? 156  MET B SD  1 
ATOM   4112  C CE  . MET B 1 101 ? -20.876 11.960  -38.614  1.00 59.47  ? 156  MET B CE  1 
ATOM   4113  N N   . ASN B 1 102 ? -25.919 14.110  -36.193  1.00 54.69  ? 157  ASN B N   1 
ATOM   4114  C CA  . ASN B 1 102 ? -26.269 14.706  -34.911  1.00 55.52  ? 157  ASN B CA  1 
ATOM   4115  C C   . ASN B 1 102 ? -27.161 13.764  -34.110  1.00 56.88  ? 157  ASN B C   1 
ATOM   4116  O O   . ASN B 1 102 ? -26.850 13.410  -32.963  1.00 55.08  ? 157  ASN B O   1 
ATOM   4117  C CB  . ASN B 1 102 ? -27.017 16.011  -35.153  1.00 62.05  ? 157  ASN B CB  1 
ATOM   4118  C CG  . ASN B 1 102 ? -26.561 17.119  -34.248  1.00 64.45  ? 157  ASN B CG  1 
ATOM   4119  O OD1 . ASN B 1 102 ? -25.629 17.852  -34.577  1.00 62.81  ? 157  ASN B OD1 1 
ATOM   4120  N ND2 . ASN B 1 102 ? -27.216 17.257  -33.100  1.00 65.64  ? 157  ASN B ND2 1 
ATOM   4121  N N   . LEU B 1 103 ? -28.263 13.347  -34.730  1.00 61.62  ? 158  LEU B N   1 
ATOM   4122  C CA  . LEU B 1 103 ? -29.198 12.417  -34.089  1.00 61.84  ? 158  LEU B CA  1 
ATOM   4123  C C   . LEU B 1 103 ? -28.498 11.137  -33.626  1.00 67.59  ? 158  LEU B C   1 
ATOM   4124  O O   . LEU B 1 103 ? -28.693 10.685  -32.485  1.00 66.32  ? 158  LEU B O   1 
ATOM   4125  C CB  . LEU B 1 103 ? -30.358 12.083  -35.028  1.00 57.65  ? 158  LEU B CB  1 
ATOM   4126  C CG  . LEU B 1 103 ? -31.106 13.323  -35.518  1.00 60.56  ? 158  LEU B CG  1 
ATOM   4127  C CD1 . LEU B 1 103 ? -32.171 12.968  -36.544  1.00 58.75  ? 158  LEU B CD1 1 
ATOM   4128  C CD2 . LEU B 1 103 ? -31.714 14.055  -34.339  1.00 67.98  ? 158  LEU B CD2 1 
ATOM   4129  N N   . LEU B 1 104 ? -27.680 10.559  -34.505  1.00 60.86  ? 159  LEU B N   1 
ATOM   4130  C CA  . LEU B 1 104 ? -26.903 9.377   -34.143  1.00 57.16  ? 159  LEU B CA  1 
ATOM   4131  C C   . LEU B 1 104 ? -26.122 9.604   -32.843  1.00 60.63  ? 159  LEU B C   1 
ATOM   4132  O O   . LEU B 1 104 ? -26.260 8.851   -31.874  1.00 65.20  ? 159  LEU B O   1 
ATOM   4133  C CB  . LEU B 1 104 ? -25.956 9.002   -35.281  1.00 49.42  ? 159  LEU B CB  1 
ATOM   4134  C CG  . LEU B 1 104 ? -26.678 8.450   -36.508  1.00 58.80  ? 159  LEU B CG  1 
ATOM   4135  C CD1 . LEU B 1 104 ? -25.738 8.304   -37.713  1.00 58.25  ? 159  LEU B CD1 1 
ATOM   4136  C CD2 . LEU B 1 104 ? -27.328 7.125   -36.151  1.00 54.84  ? 159  LEU B CD2 1 
ATOM   4137  N N   . VAL B 1 105 ? -25.321 10.662  -32.824  1.00 53.44  ? 160  VAL B N   1 
ATOM   4138  C CA  . VAL B 1 105 ? -24.527 11.006  -31.654  1.00 54.42  ? 160  VAL B CA  1 
ATOM   4139  C C   . VAL B 1 105 ? -25.408 11.148  -30.421  1.00 52.81  ? 160  VAL B C   1 
ATOM   4140  O O   . VAL B 1 105 ? -24.983 10.835  -29.312  1.00 54.99  ? 160  VAL B O   1 
ATOM   4141  C CB  . VAL B 1 105 ? -23.706 12.295  -31.883  1.00 64.04  ? 160  VAL B CB  1 
ATOM   4142  C CG1 . VAL B 1 105 ? -23.245 12.898  -30.565  1.00 70.70  ? 160  VAL B CG1 1 
ATOM   4143  C CG2 . VAL B 1 105 ? -22.513 12.004  -32.784  1.00 67.38  ? 160  VAL B CG2 1 
ATOM   4144  N N   . ILE B 1 106 ? -26.637 11.613  -30.605  1.00 49.95  ? 161  ILE B N   1 
ATOM   4145  C CA  . ILE B 1 106 ? -27.532 11.701  -29.462  1.00 50.01  ? 161  ILE B CA  1 
ATOM   4146  C C   . ILE B 1 106 ? -27.899 10.301  -28.964  1.00 52.35  ? 161  ILE B C   1 
ATOM   4147  O O   . ILE B 1 106 ? -27.728 9.993   -27.773  1.00 54.57  ? 161  ILE B O   1 
ATOM   4148  C CB  . ILE B 1 106 ? -28.773 12.542  -29.770  1.00 47.38  ? 161  ILE B CB  1 
ATOM   4149  C CG1 . ILE B 1 106 ? -28.337 13.933  -30.232  1.00 52.74  ? 161  ILE B CG1 1 
ATOM   4150  C CG2 . ILE B 1 106 ? -29.641 12.667  -28.537  1.00 50.35  ? 161  ILE B CG2 1 
ATOM   4151  C CD1 . ILE B 1 106 ? -29.481 14.865  -30.554  1.00 59.85  ? 161  ILE B CD1 1 
ATOM   4152  N N   . SER B 1 107 ? -28.375 9.449   -29.872  1.00 50.58  ? 162  SER B N   1 
ATOM   4153  C CA  . SER B 1 107 ? -28.738 8.075   -29.516  1.00 55.33  ? 162  SER B CA  1 
ATOM   4154  C C   . SER B 1 107 ? -27.610 7.359   -28.766  1.00 60.50  ? 162  SER B C   1 
ATOM   4155  O O   . SER B 1 107 ? -27.787 6.898   -27.631  1.00 61.45  ? 162  SER B O   1 
ATOM   4156  C CB  . SER B 1 107 ? -29.106 7.279   -30.769  1.00 52.45  ? 162  SER B CB  1 
ATOM   4157  O OG  . SER B 1 107 ? -30.007 8.000   -31.587  1.00 54.35  ? 162  SER B OG  1 
ATOM   4158  N N   . PHE B 1 108 ? -26.440 7.292   -29.395  1.00 59.94  ? 163  PHE B N   1 
ATOM   4159  C CA  . PHE B 1 108 ? -25.278 6.673   -28.761  1.00 55.83  ? 163  PHE B CA  1 
ATOM   4160  C C   . PHE B 1 108 ? -24.883 7.366   -27.463  1.00 59.04  ? 163  PHE B C   1 
ATOM   4161  O O   . PHE B 1 108 ? -24.401 6.721   -26.542  1.00 59.85  ? 163  PHE B O   1 
ATOM   4162  C CB  . PHE B 1 108 ? -24.078 6.627   -29.710  1.00 53.57  ? 163  PHE B CB  1 
ATOM   4163  C CG  . PHE B 1 108 ? -24.127 5.498   -30.694  1.00 56.11  ? 163  PHE B CG  1 
ATOM   4164  C CD1 . PHE B 1 108 ? -24.169 5.746   -32.054  1.00 60.80  ? 163  PHE B CD1 1 
ATOM   4165  C CD2 . PHE B 1 108 ? -24.140 4.185   -30.257  1.00 60.48  ? 163  PHE B CD2 1 
ATOM   4166  C CE1 . PHE B 1 108 ? -24.217 4.703   -32.963  1.00 65.09  ? 163  PHE B CE1 1 
ATOM   4167  C CE2 . PHE B 1 108 ? -24.192 3.137   -31.159  1.00 60.53  ? 163  PHE B CE2 1 
ATOM   4168  C CZ  . PHE B 1 108 ? -24.230 3.398   -32.515  1.00 64.70  ? 163  PHE B CZ  1 
ATOM   4169  N N   . ASP B 1 109 ? -25.077 8.680   -27.399  1.00 64.54  ? 164  ASP B N   1 
ATOM   4170  C CA  . ASP B 1 109 ? -24.786 9.443   -26.189  1.00 62.83  ? 164  ASP B CA  1 
ATOM   4171  C C   . ASP B 1 109 ? -25.567 8.865   -25.024  1.00 61.65  ? 164  ASP B C   1 
ATOM   4172  O O   . ASP B 1 109 ? -24.987 8.355   -24.057  1.00 62.04  ? 164  ASP B O   1 
ATOM   4173  C CB  . ASP B 1 109 ? -25.143 10.921  -26.372  1.00 62.21  ? 164  ASP B CB  1 
ATOM   4174  C CG  . ASP B 1 109 ? -25.094 11.703  -25.070  1.00 65.02  ? 164  ASP B CG  1 
ATOM   4175  O OD1 . ASP B 1 109 ? -24.045 12.316  -24.787  1.00 63.29  ? 164  ASP B OD1 1 
ATOM   4176  O OD2 . ASP B 1 109 ? -26.105 11.712  -24.333  1.00 64.26  ? 164  ASP B OD2 1 
ATOM   4177  N N   . ARG B 1 110 ? -26.891 8.948   -25.118  1.00 59.68  ? 165  ARG B N   1 
ATOM   4178  C CA  . ARG B 1 110 ? -27.730 8.450   -24.036  1.00 63.20  ? 165  ARG B CA  1 
ATOM   4179  C C   . ARG B 1 110 ? -27.511 6.955   -23.755  1.00 61.88  ? 165  ARG B C   1 
ATOM   4180  O O   . ARG B 1 110 ? -27.455 6.538   -22.595  1.00 68.10  ? 165  ARG B O   1 
ATOM   4181  C CB  . ARG B 1 110 ? -29.206 8.786   -24.280  1.00 61.60  ? 165  ARG B CB  1 
ATOM   4182  C CG  . ARG B 1 110 ? -29.607 10.173  -23.779  1.00 65.88  ? 165  ARG B CG  1 
ATOM   4183  C CD  . ARG B 1 110 ? -31.074 10.480  -24.062  1.00 81.83  ? 165  ARG B CD  1 
ATOM   4184  N NE  . ARG B 1 110 ? -31.551 11.654  -23.333  1.00 92.90  ? 165  ARG B NE  1 
ATOM   4185  C CZ  . ARG B 1 110 ? -31.418 12.909  -23.756  1.00 94.88  ? 165  ARG B CZ  1 
ATOM   4186  N NH1 . ARG B 1 110 ? -30.814 13.168  -24.910  1.00 81.38  ? 165  ARG B NH1 1 
ATOM   4187  N NH2 . ARG B 1 110 ? -31.886 13.908  -23.018  1.00 99.01  ? 165  ARG B NH2 1 
ATOM   4188  N N   . TYR B 1 111 ? -27.353 6.155   -24.805  1.00 55.71  ? 166  TYR B N   1 
ATOM   4189  C CA  . TYR B 1 111 ? -27.156 4.713   -24.618  1.00 55.41  ? 166  TYR B CA  1 
ATOM   4190  C C   . TYR B 1 111 ? -25.855 4.355   -23.894  1.00 58.91  ? 166  TYR B C   1 
ATOM   4191  O O   . TYR B 1 111 ? -25.828 3.424   -23.090  1.00 57.04  ? 166  TYR B O   1 
ATOM   4192  C CB  . TYR B 1 111 ? -27.236 3.972   -25.955  1.00 63.76  ? 166  TYR B CB  1 
ATOM   4193  C CG  . TYR B 1 111 ? -26.998 2.479   -25.860  1.00 64.19  ? 166  TYR B CG  1 
ATOM   4194  C CD1 . TYR B 1 111 ? -28.034 1.607   -25.546  1.00 63.60  ? 166  TYR B CD1 1 
ATOM   4195  C CD2 . TYR B 1 111 ? -25.739 1.941   -26.105  1.00 66.46  ? 166  TYR B CD2 1 
ATOM   4196  C CE1 . TYR B 1 111 ? -27.821 0.237   -25.467  1.00 67.20  ? 166  TYR B CE1 1 
ATOM   4197  C CE2 . TYR B 1 111 ? -25.514 0.574   -26.029  1.00 72.02  ? 166  TYR B CE2 1 
ATOM   4198  C CZ  . TYR B 1 111 ? -26.559 -0.274  -25.709  1.00 77.50  ? 166  TYR B CZ  1 
ATOM   4199  O OH  . TYR B 1 111 ? -26.341 -1.635  -25.632  1.00 79.90  ? 166  TYR B OH  1 
ATOM   4200  N N   . PHE B 1 112 ? -24.779 5.083   -24.187  1.00 63.36  ? 167  PHE B N   1 
ATOM   4201  C CA  . PHE B 1 112 ? -23.503 4.890   -23.497  1.00 61.25  ? 167  PHE B CA  1 
ATOM   4202  C C   . PHE B 1 112 ? -23.616 5.370   -22.073  1.00 60.10  ? 167  PHE B C   1 
ATOM   4203  O O   . PHE B 1 112 ? -23.030 4.793   -21.160  1.00 65.36  ? 167  PHE B O   1 
ATOM   4204  C CB  . PHE B 1 112 ? -22.389 5.675   -24.176  1.00 65.58  ? 167  PHE B CB  1 
ATOM   4205  C CG  . PHE B 1 112 ? -21.820 4.996   -25.376  1.00 67.41  ? 167  PHE B CG  1 
ATOM   4206  C CD1 . PHE B 1 112 ? -21.918 3.626   -25.520  1.00 60.99  ? 167  PHE B CD1 1 
ATOM   4207  C CD2 . PHE B 1 112 ? -21.187 5.731   -26.365  1.00 67.96  ? 167  PHE B CD2 1 
ATOM   4208  C CE1 . PHE B 1 112 ? -21.395 3.000   -26.631  1.00 67.41  ? 167  PHE B CE1 1 
ATOM   4209  C CE2 . PHE B 1 112 ? -20.661 5.112   -27.476  1.00 59.70  ? 167  PHE B CE2 1 
ATOM   4210  C CZ  . PHE B 1 112 ? -20.765 3.743   -27.611  1.00 56.54  ? 167  PHE B CZ  1 
ATOM   4211  N N   . SER B 1 113 ? -24.353 6.456   -21.893  1.00 56.59  ? 168  SER B N   1 
ATOM   4212  C CA  . SER B 1 113 ? -24.638 6.928   -20.556  1.00 57.78  ? 168  SER B CA  1 
ATOM   4213  C C   . SER B 1 113 ? -25.250 5.789   -19.743  1.00 64.53  ? 168  SER B C   1 
ATOM   4214  O O   . SER B 1 113 ? -24.814 5.517   -18.626  1.00 71.46  ? 168  SER B O   1 
ATOM   4215  C CB  . SER B 1 113 ? -25.571 8.131   -20.606  1.00 57.85  ? 168  SER B CB  1 
ATOM   4216  O OG  . SER B 1 113 ? -24.979 9.166   -21.369  1.00 62.06  ? 168  SER B OG  1 
ATOM   4217  N N   . ILE B 1 114 ? -26.241 5.102   -20.308  1.00 65.53  ? 169  ILE B N   1 
ATOM   4218  C CA  . ILE B 1 114 ? -26.857 3.973   -19.602  1.00 59.27  ? 169  ILE B CA  1 
ATOM   4219  C C   . ILE B 1 114 ? -25.910 2.785   -19.394  1.00 56.48  ? 169  ILE B C   1 
ATOM   4220  O O   . ILE B 1 114 ? -25.719 2.334   -18.267  1.00 58.53  ? 169  ILE B O   1 
ATOM   4221  C CB  . ILE B 1 114 ? -28.154 3.474   -20.290  1.00 58.26  ? 169  ILE B CB  1 
ATOM   4222  C CG1 . ILE B 1 114 ? -29.341 4.369   -19.922  1.00 63.48  ? 169  ILE B CG1 1 
ATOM   4223  C CG2 . ILE B 1 114 ? -28.454 2.039   -19.879  1.00 48.48  ? 169  ILE B CG2 1 
ATOM   4224  C CD1 . ILE B 1 114 ? -29.392 5.686   -20.660  1.00 53.82  ? 169  ILE B CD1 1 
ATOM   4225  N N   . THR B 1 115 ? -25.315 2.279   -20.468  1.00 55.82  ? 170  THR B N   1 
ATOM   4226  C CA  . THR B 1 115 ? -24.506 1.065   -20.367  1.00 62.44  ? 170  THR B CA  1 
ATOM   4227  C C   . THR B 1 115 ? -23.169 1.249   -19.650  1.00 68.38  ? 170  THR B C   1 
ATOM   4228  O O   . THR B 1 115 ? -22.766 0.398   -18.857  1.00 75.69  ? 170  THR B O   1 
ATOM   4229  C CB  . THR B 1 115 ? -24.251 0.416   -21.744  1.00 65.45  ? 170  THR B CB  1 
ATOM   4230  O OG1 . THR B 1 115 ? -23.589 1.345   -22.613  1.00 68.04  ? 170  THR B OG1 1 
ATOM   4231  C CG2 . THR B 1 115 ? -25.557 -0.025  -22.371  1.00 66.92  ? 170  THR B CG2 1 
ATOM   4232  N N   . ARG B 1 116 ? -22.486 2.355   -19.926  1.00 66.24  ? 171  ARG B N   1 
ATOM   4233  C CA  . ARG B 1 116 ? -21.150 2.578   -19.386  1.00 68.39  ? 171  ARG B CA  1 
ATOM   4234  C C   . ARG B 1 116 ? -21.135 3.791   -18.470  1.00 72.14  ? 171  ARG B C   1 
ATOM   4235  O O   . ARG B 1 116 ? -20.634 4.850   -18.847  1.00 75.45  ? 171  ARG B O   1 
ATOM   4236  C CB  . ARG B 1 116 ? -20.137 2.762   -20.520  1.00 66.08  ? 171  ARG B CB  1 
ATOM   4237  N N   . PRO B 1 117 ? -21.678 3.628   -17.254  1.00 76.16  ? 172  PRO B N   1 
ATOM   4238  C CA  . PRO B 1 117 ? -21.838 4.714   -16.280  1.00 81.69  ? 172  PRO B CA  1 
ATOM   4239  C C   . PRO B 1 117 ? -20.490 5.307   -15.890  1.00 82.89  ? 172  PRO B C   1 
ATOM   4240  O O   . PRO B 1 117 ? -20.327 6.528   -15.830  1.00 77.69  ? 172  PRO B O   1 
ATOM   4241  C CB  . PRO B 1 117 ? -22.455 4.008   -15.062  1.00 83.71  ? 172  PRO B CB  1 
ATOM   4242  C CG  . PRO B 1 117 ? -22.918 2.667   -15.550  1.00 76.74  ? 172  PRO B CG  1 
ATOM   4243  C CD  . PRO B 1 117 ? -22.003 2.314   -16.672  1.00 78.65  ? 172  PRO B CD  1 
ATOM   4244  N N   . LEU B 1 118 ? -19.537 4.422   -15.620  1.00 87.63  ? 173  LEU B N   1 
ATOM   4245  C CA  . LEU B 1 118 ? -18.198 4.805   -15.194  1.00 86.38  ? 173  LEU B CA  1 
ATOM   4246  C C   . LEU B 1 118 ? -17.409 5.442   -16.327  1.00 81.59  ? 173  LEU B C   1 
ATOM   4247  O O   . LEU B 1 118 ? -16.913 6.562   -16.204  1.00 79.22  ? 173  LEU B O   1 
ATOM   4248  C CB  . LEU B 1 118 ? -17.443 3.564   -14.719  1.00 84.47  ? 173  LEU B CB  1 
ATOM   4249  C CG  . LEU B 1 118 ? -17.180 3.399   -13.227  1.00 78.13  ? 173  LEU B CG  1 
ATOM   4250  C CD1 . LEU B 1 118 ? -18.416 3.732   -12.422  1.00 79.39  ? 173  LEU B CD1 1 
ATOM   4251  C CD2 . LEU B 1 118 ? -16.709 1.982   -12.948  1.00 81.76  ? 173  LEU B CD2 1 
ATOM   4252  N N   . THR B 1 119 ? -17.302 4.717   -17.434  1.00 78.76  ? 174  THR B N   1 
ATOM   4253  C CA  . THR B 1 119 ? -16.473 5.147   -18.547  1.00 82.22  ? 174  THR B CA  1 
ATOM   4254  C C   . THR B 1 119 ? -17.037 6.387   -19.226  1.00 84.37  ? 174  THR B C   1 
ATOM   4255  O O   . THR B 1 119 ? -16.290 7.276   -19.629  1.00 93.16  ? 174  THR B O   1 
ATOM   4256  C CB  . THR B 1 119 ? -16.310 4.025   -19.594  1.00 84.23  ? 174  THR B CB  1 
ATOM   4257  O OG1 . THR B 1 119 ? -15.863 2.827   -18.948  1.00 83.26  ? 174  THR B OG1 1 
ATOM   4258  C CG2 . THR B 1 119 ? -15.297 4.428   -20.658  1.00 88.22  ? 174  THR B CG2 1 
ATOM   4259  N N   . TYR B 1 120 ? -18.357 6.447   -19.352  1.00 77.60  ? 175  TYR B N   1 
ATOM   4260  C CA  . TYR B 1 120 ? -18.982 7.523   -20.107  1.00 72.84  ? 175  TYR B CA  1 
ATOM   4261  C C   . TYR B 1 120 ? -19.711 8.549   -19.239  1.00 77.48  ? 175  TYR B C   1 
ATOM   4262  O O   . TYR B 1 120 ? -19.330 9.720   -19.209  1.00 76.89  ? 175  TYR B O   1 
ATOM   4263  C CB  . TYR B 1 120 ? -19.917 6.962   -21.176  1.00 65.59  ? 175  TYR B CB  1 
ATOM   4264  C CG  . TYR B 1 120 ? -20.317 7.991   -22.200  1.00 68.70  ? 175  TYR B CG  1 
ATOM   4265  C CD1 . TYR B 1 120 ? -19.497 8.271   -23.282  1.00 66.75  ? 175  TYR B CD1 1 
ATOM   4266  C CD2 . TYR B 1 120 ? -21.505 8.695   -22.079  1.00 73.44  ? 175  TYR B CD2 1 
ATOM   4267  C CE1 . TYR B 1 120 ? -19.853 9.217   -24.222  1.00 67.14  ? 175  TYR B CE1 1 
ATOM   4268  C CE2 . TYR B 1 120 ? -21.870 9.645   -23.015  1.00 73.98  ? 175  TYR B CE2 1 
ATOM   4269  C CZ  . TYR B 1 120 ? -21.039 9.901   -24.085  1.00 69.84  ? 175  TYR B CZ  1 
ATOM   4270  O OH  . TYR B 1 120 ? -21.397 10.843  -25.021  1.00 72.87  ? 175  TYR B OH  1 
ATOM   4271  N N   . ARG B 1 121 ? -20.749 8.111   -18.529  1.00 81.91  ? 176  ARG B N   1 
ATOM   4272  C CA  . ARG B 1 121 ? -21.605 9.035   -17.785  1.00 78.77  ? 176  ARG B CA  1 
ATOM   4273  C C   . ARG B 1 121 ? -20.772 10.044  -17.012  1.00 83.38  ? 176  ARG B C   1 
ATOM   4274  O O   . ARG B 1 121 ? -21.094 11.227  -16.972  1.00 86.13  ? 176  ARG B O   1 
ATOM   4275  C CB  . ARG B 1 121 ? -22.515 8.281   -16.804  1.00 70.79  ? 176  ARG B CB  1 
ATOM   4276  C CG  . ARG B 1 121 ? -23.925 8.002   -17.306  1.00 67.60  ? 176  ARG B CG  1 
ATOM   4277  C CD  . ARG B 1 121 ? -24.887 7.717   -16.153  1.00 64.01  ? 176  ARG B CD  1 
ATOM   4278  N NE  . ARG B 1 121 ? -25.092 8.891   -15.307  1.00 69.59  ? 176  ARG B NE  1 
ATOM   4279  C CZ  . ARG B 1 121 ? -25.752 8.884   -14.150  1.00 72.19  ? 176  ARG B CZ  1 
ATOM   4280  N NH1 . ARG B 1 121 ? -26.278 7.758   -13.691  1.00 76.87  ? 176  ARG B NH1 1 
ATOM   4281  N NH2 . ARG B 1 121 ? -25.884 10.003  -13.447  1.00 71.19  ? 176  ARG B NH2 1 
ATOM   4282  N N   . ALA B 1 122 ? -19.689 9.570   -16.408  1.00 83.65  ? 177  ALA B N   1 
ATOM   4283  C CA  . ALA B 1 122 ? -18.851 10.418  -15.569  1.00 89.55  ? 177  ALA B CA  1 
ATOM   4284  C C   . ALA B 1 122 ? -18.027 11.426  -16.374  1.00 88.79  ? 177  ALA B C   1 
ATOM   4285  O O   . ALA B 1 122 ? -17.966 12.607  -16.031  1.00 88.14  ? 177  ALA B O   1 
ATOM   4286  C CB  . ALA B 1 122 ? -17.947 9.566   -14.694  1.00 88.09  ? 177  ALA B CB  1 
ATOM   4287  N N   . LYS B 1 123 ? -17.391 10.953  -17.439  1.00 86.26  ? 178  LYS B N   1 
ATOM   4288  C CA  . LYS B 1 123 ? -16.460 11.778  -18.201  1.00 82.57  ? 178  LYS B CA  1 
ATOM   4289  C C   . LYS B 1 123 ? -17.126 12.756  -19.170  1.00 87.80  ? 178  LYS B C   1 
ATOM   4290  O O   . LYS B 1 123 ? -16.456 13.634  -19.717  1.00 90.73  ? 178  LYS B O   1 
ATOM   4291  C CB  . LYS B 1 123 ? -15.470 10.897  -18.966  1.00 87.05  ? 178  LYS B CB  1 
ATOM   4292  C CG  . LYS B 1 123 ? -14.426 10.221  -18.090  1.00 88.31  ? 178  LYS B CG  1 
ATOM   4293  C CD  . LYS B 1 123 ? -13.484 9.370   -18.935  1.00 94.00  ? 178  LYS B CD  1 
ATOM   4294  C CE  . LYS B 1 123 ? -12.342 8.789   -18.111  1.00 99.10  ? 178  LYS B CE  1 
ATOM   4295  N NZ  . LYS B 1 123 ? -11.202 9.735   -17.948  1.00 90.53  ? 178  LYS B NZ  1 
ATOM   4296  N N   . ARG B 1 124 ? -18.433 12.613  -19.385  1.00 89.67  ? 179  ARG B N   1 
ATOM   4297  C CA  . ARG B 1 124 ? -19.125 13.435  -20.382  1.00 89.38  ? 179  ARG B CA  1 
ATOM   4298  C C   . ARG B 1 124 ? -19.244 14.900  -19.962  1.00 78.25  ? 179  ARG B C   1 
ATOM   4299  O O   . ARG B 1 124 ? -19.677 15.212  -18.854  1.00 65.80  ? 179  ARG B O   1 
ATOM   4300  C CB  . ARG B 1 124 ? -20.496 12.844  -20.747  1.00 86.79  ? 179  ARG B CB  1 
ATOM   4301  C CG  . ARG B 1 124 ? -21.480 12.746  -19.592  1.00 87.45  ? 179  ARG B CG  1 
ATOM   4302  C CD  . ARG B 1 124 ? -22.801 12.120  -20.029  1.00 85.85  ? 179  ARG B CD  1 
ATOM   4303  N NE  . ARG B 1 124 ? -23.493 12.910  -21.048  1.00 90.91  ? 179  ARG B NE  1 
ATOM   4304  C CZ  . ARG B 1 124 ? -24.756 12.712  -21.420  1.00 93.38  ? 179  ARG B CZ  1 
ATOM   4305  N NH1 . ARG B 1 124 ? -25.473 11.752  -20.853  1.00 99.76  ? 179  ARG B NH1 1 
ATOM   4306  N NH2 . ARG B 1 124 ? -25.310 13.473  -22.355  1.00 90.37  ? 179  ARG B NH2 1 
ATOM   4307  N N   . THR B 1 125 ? -18.862 15.794  -20.868  1.00 80.77  ? 180  THR B N   1 
ATOM   4308  C CA  . THR B 1 125 ? -18.857 17.225  -20.585  1.00 84.73  ? 180  THR B CA  1 
ATOM   4309  C C   . THR B 1 125 ? -19.264 18.053  -21.808  1.00 89.27  ? 180  THR B C   1 
ATOM   4310  O O   . THR B 1 125 ? -19.307 17.541  -22.929  1.00 87.21  ? 180  THR B O   1 
ATOM   4311  C CB  . THR B 1 125 ? -17.471 17.693  -20.099  1.00 80.56  ? 180  THR B CB  1 
ATOM   4312  O OG1 . THR B 1 125 ? -16.488 17.433  -21.110  1.00 83.79  ? 180  THR B OG1 1 
ATOM   4313  C CG2 . THR B 1 125 ? -17.086 16.958  -18.829  1.00 70.75  ? 180  THR B CG2 1 
ATOM   4314  N N   . THR B 1 126 ? -19.590 19.324  -21.579  1.00 84.18  ? 181  THR B N   1 
ATOM   4315  C CA  . THR B 1 126 ? -19.939 20.242  -22.662  1.00 85.62  ? 181  THR B CA  1 
ATOM   4316  C C   . THR B 1 126 ? -18.766 20.398  -23.626  1.00 84.26  ? 181  THR B C   1 
ATOM   4317  O O   . THR B 1 126 ? -18.939 20.684  -24.816  1.00 82.04  ? 181  THR B O   1 
ATOM   4318  C CB  . THR B 1 126 ? -20.355 21.622  -22.120  1.00 89.60  ? 181  THR B CB  1 
ATOM   4319  O OG1 . THR B 1 126 ? -19.378 22.079  -21.176  1.00 89.54  ? 181  THR B OG1 1 
ATOM   4320  C CG2 . THR B 1 126 ? -21.708 21.535  -21.434  1.00 93.30  ? 181  THR B CG2 1 
ATOM   4321  N N   . LYS B 1 127 ? -17.567 20.206  -23.090  1.00 79.34  ? 182  LYS B N   1 
ATOM   4322  C CA  . LYS B 1 127 ? -16.364 20.122  -23.901  1.00 83.22  ? 182  LYS B CA  1 
ATOM   4323  C C   . LYS B 1 127 ? -16.477 18.945  -24.869  1.00 86.95  ? 182  LYS B C   1 
ATOM   4324  O O   . LYS B 1 127 ? -16.432 19.117  -26.093  1.00 83.98  ? 182  LYS B O   1 
ATOM   4325  C CB  . LYS B 1 127 ? -15.152 19.942  -22.988  1.00 89.55  ? 182  LYS B CB  1 
ATOM   4326  C CG  . LYS B 1 127 ? -13.890 19.469  -23.681  1.00 99.12  ? 182  LYS B CG  1 
ATOM   4327  C CD  . LYS B 1 127 ? -12.703 19.501  -22.723  1.00 107.47 ? 182  LYS B CD  1 
ATOM   4328  C CE  . LYS B 1 127 ? -11.521 18.706  -23.254  1.00 106.57 ? 182  LYS B CE  1 
ATOM   4329  N NZ  . LYS B 1 127 ? -11.827 17.251  -23.297  1.00 102.62 ? 182  LYS B NZ  1 
ATOM   4330  N N   . ARG B 1 128 ? -16.661 17.753  -24.307  1.00 90.35  ? 183  ARG B N   1 
ATOM   4331  C CA  . ARG B 1 128 ? -16.799 16.530  -25.086  1.00 88.49  ? 183  ARG B CA  1 
ATOM   4332  C C   . ARG B 1 128 ? -17.825 16.734  -26.190  1.00 80.37  ? 183  ARG B C   1 
ATOM   4333  O O   . ARG B 1 128 ? -17.536 16.528  -27.373  1.00 76.69  ? 183  ARG B O   1 
ATOM   4334  C CB  . ARG B 1 128 ? -17.268 15.394  -24.177  1.00 88.94  ? 183  ARG B CB  1 
ATOM   4335  C CG  . ARG B 1 128 ? -16.297 15.031  -23.064  1.00 89.34  ? 183  ARG B CG  1 
ATOM   4336  C CD  . ARG B 1 128 ? -15.296 13.995  -23.542  1.00 97.87  ? 183  ARG B CD  1 
ATOM   4337  N NE  . ARG B 1 128 ? -14.396 13.556  -22.479  1.00 97.72  ? 183  ARG B NE  1 
ATOM   4338  C CZ  . ARG B 1 128 ? -13.624 12.477  -22.560  1.00 98.71  ? 183  ARG B CZ  1 
ATOM   4339  N NH1 . ARG B 1 128 ? -13.650 11.721  -23.650  1.00 102.48 ? 183  ARG B NH1 1 
ATOM   4340  N NH2 . ARG B 1 128 ? -12.831 12.147  -21.550  1.00 95.16  ? 183  ARG B NH2 1 
ATOM   4341  N N   . ALA B 1 129 ? -19.021 17.154  -25.790  1.00 77.72  ? 184  ALA B N   1 
ATOM   4342  C CA  . ALA B 1 129 ? -20.112 17.391  -26.725  1.00 77.59  ? 184  ALA B CA  1 
ATOM   4343  C C   . ALA B 1 129 ? -19.703 18.344  -27.842  1.00 81.39  ? 184  ALA B C   1 
ATOM   4344  O O   . ALA B 1 129 ? -19.846 18.022  -29.024  1.00 81.68  ? 184  ALA B O   1 
ATOM   4345  C CB  . ALA B 1 129 ? -21.327 17.927  -25.990  1.00 77.20  ? 184  ALA B CB  1 
ATOM   4346  N N   . GLY B 1 130 ? -19.187 19.513  -27.476  1.00 79.40  ? 185  GLY B N   1 
ATOM   4347  C CA  . GLY B 1 130 ? -18.771 20.471  -28.481  1.00 78.13  ? 185  GLY B CA  1 
ATOM   4348  C C   . GLY B 1 130 ? -17.881 19.801  -29.508  1.00 76.36  ? 185  GLY B C   1 
ATOM   4349  O O   . GLY B 1 130 ? -18.122 19.881  -30.718  1.00 75.06  ? 185  GLY B O   1 
ATOM   4350  N N   . VAL B 1 131 ? -16.860 19.112  -29.009  1.00 78.98  ? 186  VAL B N   1 
ATOM   4351  C CA  . VAL B 1 131 ? -15.875 18.454  -29.861  1.00 77.06  ? 186  VAL B CA  1 
ATOM   4352  C C   . VAL B 1 131 ? -16.483 17.443  -30.820  1.00 72.28  ? 186  VAL B C   1 
ATOM   4353  O O   . VAL B 1 131 ? -16.148 17.419  -32.001  1.00 62.33  ? 186  VAL B O   1 
ATOM   4354  C CB  . VAL B 1 131 ? -14.830 17.725  -29.025  1.00 77.18  ? 186  VAL B CB  1 
ATOM   4355  C CG1 . VAL B 1 131 ? -13.911 16.927  -29.930  1.00 80.17  ? 186  VAL B CG1 1 
ATOM   4356  C CG2 . VAL B 1 131 ? -14.050 18.719  -28.183  1.00 84.03  ? 186  VAL B CG2 1 
ATOM   4357  N N   . MET B 1 132 ? -17.357 16.590  -30.300  1.00 78.12  ? 187  MET B N   1 
ATOM   4358  C CA  . MET B 1 132 ? -18.003 15.580  -31.129  1.00 74.42  ? 187  MET B CA  1 
ATOM   4359  C C   . MET B 1 132 ? -18.899 16.235  -32.177  1.00 77.10  ? 187  MET B C   1 
ATOM   4360  O O   . MET B 1 132 ? -19.076 15.699  -33.273  1.00 76.73  ? 187  MET B O   1 
ATOM   4361  C CB  . MET B 1 132 ? -18.790 14.592  -30.268  1.00 69.62  ? 187  MET B CB  1 
ATOM   4362  C CG  . MET B 1 132 ? -17.911 13.780  -29.330  1.00 81.57  ? 187  MET B CG  1 
ATOM   4363  S SD  . MET B 1 132 ? -18.845 12.756  -28.181  1.00 101.67 ? 187  MET B SD  1 
ATOM   4364  C CE  . MET B 1 132 ? -19.729 11.704  -29.327  1.00 82.97  ? 187  MET B CE  1 
ATOM   4365  N N   . ILE B 1 133 ? -19.448 17.402  -31.840  1.00 79.88  ? 188  ILE B N   1 
ATOM   4366  C CA  . ILE B 1 133 ? -20.261 18.175  -32.783  1.00 81.61  ? 188  ILE B CA  1 
ATOM   4367  C C   . ILE B 1 133 ? -19.423 18.697  -33.952  1.00 79.20  ? 188  ILE B C   1 
ATOM   4368  O O   . ILE B 1 133 ? -19.749 18.465  -35.129  1.00 71.00  ? 188  ILE B O   1 
ATOM   4369  C CB  . ILE B 1 133 ? -20.943 19.369  -32.095  1.00 78.97  ? 188  ILE B CB  1 
ATOM   4370  C CG1 . ILE B 1 133 ? -22.023 18.883  -31.131  1.00 88.33  ? 188  ILE B CG1 1 
ATOM   4371  C CG2 . ILE B 1 133 ? -21.544 20.305  -33.127  1.00 77.94  ? 188  ILE B CG2 1 
ATOM   4372  C CD1 . ILE B 1 133 ? -22.757 20.003  -30.426  1.00 96.16  ? 188  ILE B CD1 1 
ATOM   4373  N N   . GLY B 1 134 ? -18.346 19.406  -33.618  1.00 78.56  ? 189  GLY B N   1 
ATOM   4374  C CA  . GLY B 1 134 ? -17.416 19.882  -34.625  1.00 76.88  ? 189  GLY B CA  1 
ATOM   4375  C C   . GLY B 1 134 ? -16.929 18.737  -35.496  1.00 77.18  ? 189  GLY B C   1 
ATOM   4376  O O   . GLY B 1 134 ? -16.905 18.835  -36.730  1.00 82.13  ? 189  GLY B O   1 
ATOM   4377  N N   . LEU B 1 135 ? -16.547 17.639  -34.850  1.00 72.38  ? 190  LEU B N   1 
ATOM   4378  C CA  . LEU B 1 135 ? -16.106 16.451  -35.565  1.00 67.39  ? 190  LEU B CA  1 
ATOM   4379  C C   . LEU B 1 135 ? -17.151 15.991  -36.568  1.00 64.75  ? 190  LEU B C   1 
ATOM   4380  O O   . LEU B 1 135 ? -16.839 15.775  -37.739  1.00 61.82  ? 190  LEU B O   1 
ATOM   4381  C CB  . LEU B 1 135 ? -15.810 15.312  -34.595  1.00 68.64  ? 190  LEU B CB  1 
ATOM   4382  C CG  . LEU B 1 135 ? -15.321 14.067  -35.332  1.00 60.94  ? 190  LEU B CG  1 
ATOM   4383  C CD1 . LEU B 1 135 ? -14.093 14.416  -36.157  1.00 49.75  ? 190  LEU B CD1 1 
ATOM   4384  C CD2 . LEU B 1 135 ? -15.034 12.930  -34.366  1.00 69.63  ? 190  LEU B CD2 1 
ATOM   4385  N N   . ALA B 1 136 ? -18.387 15.835  -36.098  1.00 64.76  ? 191  ALA B N   1 
ATOM   4386  C CA  . ALA B 1 136 ? -19.481 15.373  -36.950  1.00 63.39  ? 191  ALA B CA  1 
ATOM   4387  C C   . ALA B 1 136 ? -19.666 16.265  -38.167  1.00 64.94  ? 191  ALA B C   1 
ATOM   4388  O O   . ALA B 1 136 ? -19.593 15.795  -39.304  1.00 65.78  ? 191  ALA B O   1 
ATOM   4389  C CB  . ALA B 1 136 ? -20.769 15.283  -36.162  1.00 62.23  ? 191  ALA B CB  1 
ATOM   4390  N N   . TRP B 1 137 ? -19.898 17.553  -37.939  1.00 64.96  ? 192  TRP B N   1 
ATOM   4391  C CA  . TRP B 1 137 ? -20.039 18.461  -39.070  1.00 65.98  ? 192  TRP B CA  1 
ATOM   4392  C C   . TRP B 1 137 ? -18.887 18.250  -40.036  1.00 62.43  ? 192  TRP B C   1 
ATOM   4393  O O   . TRP B 1 137 ? -19.102 18.026  -41.220  1.00 59.59  ? 192  TRP B O   1 
ATOM   4394  C CB  . TRP B 1 137 ? -20.086 19.918  -38.618  1.00 70.84  ? 192  TRP B CB  1 
ATOM   4395  C CG  . TRP B 1 137 ? -21.429 20.326  -38.123  1.00 78.66  ? 192  TRP B CG  1 
ATOM   4396  C CD1 . TRP B 1 137 ? -22.028 19.928  -36.965  1.00 84.75  ? 192  TRP B CD1 1 
ATOM   4397  C CD2 . TRP B 1 137 ? -22.351 21.214  -38.768  1.00 79.37  ? 192  TRP B CD2 1 
ATOM   4398  N NE1 . TRP B 1 137 ? -23.266 20.513  -36.846  1.00 87.60  ? 192  TRP B NE1 1 
ATOM   4399  C CE2 . TRP B 1 137 ? -23.488 21.307  -37.938  1.00 88.02  ? 192  TRP B CE2 1 
ATOM   4400  C CE3 . TRP B 1 137 ? -22.327 21.939  -39.963  1.00 75.18  ? 192  TRP B CE3 1 
ATOM   4401  C CZ2 . TRP B 1 137 ? -24.590 22.097  -38.266  1.00 91.94  ? 192  TRP B CZ2 1 
ATOM   4402  C CZ3 . TRP B 1 137 ? -23.421 22.723  -40.287  1.00 80.86  ? 192  TRP B CZ3 1 
ATOM   4403  C CH2 . TRP B 1 137 ? -24.537 22.796  -39.440  1.00 91.02  ? 192  TRP B CH2 1 
ATOM   4404  N N   . VAL B 1 138 ? -17.664 18.282  -39.520  1.00 62.33  ? 193  VAL B N   1 
ATOM   4405  C CA  . VAL B 1 138 ? -16.497 18.047  -40.357  1.00 58.83  ? 193  VAL B CA  1 
ATOM   4406  C C   . VAL B 1 138 ? -16.696 16.825  -41.243  1.00 61.80  ? 193  VAL B C   1 
ATOM   4407  O O   . VAL B 1 138 ? -16.672 16.937  -42.465  1.00 60.69  ? 193  VAL B O   1 
ATOM   4408  C CB  . VAL B 1 138 ? -15.235 17.863  -39.530  1.00 58.09  ? 193  VAL B CB  1 
ATOM   4409  C CG1 . VAL B 1 138 ? -14.149 17.234  -40.384  1.00 57.86  ? 193  VAL B CG1 1 
ATOM   4410  C CG2 . VAL B 1 138 ? -14.786 19.201  -38.974  1.00 60.16  ? 193  VAL B CG2 1 
ATOM   4411  N N   . ILE B 1 139 ? -16.884 15.663  -40.624  1.00 62.39  ? 194  ILE B N   1 
ATOM   4412  C CA  . ILE B 1 139 ? -17.112 14.428  -41.366  1.00 58.36  ? 194  ILE B CA  1 
ATOM   4413  C C   . ILE B 1 139 ? -18.145 14.641  -42.470  1.00 66.25  ? 194  ILE B C   1 
ATOM   4414  O O   . ILE B 1 139 ? -17.964 14.168  -43.593  1.00 70.60  ? 194  ILE B O   1 
ATOM   4415  C CB  . ILE B 1 139 ? -17.604 13.293  -40.447  1.00 49.18  ? 194  ILE B CB  1 
ATOM   4416  C CG1 . ILE B 1 139 ? -16.603 13.038  -39.321  1.00 48.36  ? 194  ILE B CG1 1 
ATOM   4417  C CG2 . ILE B 1 139 ? -17.831 12.032  -41.247  1.00 46.37  ? 194  ILE B CG2 1 
ATOM   4418  C CD1 . ILE B 1 139 ? -17.003 11.914  -38.398  1.00 47.15  ? 194  ILE B CD1 1 
ATOM   4419  N N   . SER B 1 140 ? -19.221 15.363  -42.156  1.00 67.57  ? 195  SER B N   1 
ATOM   4420  C CA  . SER B 1 140 ? -20.259 15.649  -43.149  1.00 70.98  ? 195  SER B CA  1 
ATOM   4421  C C   . SER B 1 140 ? -19.713 16.443  -44.336  1.00 69.92  ? 195  SER B C   1 
ATOM   4422  O O   . SER B 1 140 ? -19.766 15.980  -45.478  1.00 68.98  ? 195  SER B O   1 
ATOM   4423  C CB  . SER B 1 140 ? -21.433 16.404  -42.518  1.00 70.61  ? 195  SER B CB  1 
ATOM   4424  O OG  . SER B 1 140 ? -22.239 15.552  -41.728  1.00 70.51  ? 195  SER B OG  1 
ATOM   4425  N N   . PHE B 1 141 ? -19.174 17.627  -44.055  1.00 64.48  ? 196  PHE B N   1 
ATOM   4426  C CA  . PHE B 1 141 ? -18.607 18.489  -45.084  1.00 60.42  ? 196  PHE B CA  1 
ATOM   4427  C C   . PHE B 1 141 ? -17.615 17.729  -45.957  1.00 64.23  ? 196  PHE B C   1 
ATOM   4428  O O   . PHE B 1 141 ? -17.562 17.928  -47.165  1.00 65.16  ? 196  PHE B O   1 
ATOM   4429  C CB  . PHE B 1 141 ? -17.912 19.695  -44.457  1.00 54.61  ? 196  PHE B CB  1 
ATOM   4430  C CG  . PHE B 1 141 ? -16.967 20.390  -45.389  1.00 60.87  ? 196  PHE B CG  1 
ATOM   4431  C CD1 . PHE B 1 141 ? -17.397 21.449  -46.170  1.00 60.36  ? 196  PHE B CD1 1 
ATOM   4432  C CD2 . PHE B 1 141 ? -15.649 19.974  -45.496  1.00 63.30  ? 196  PHE B CD2 1 
ATOM   4433  C CE1 . PHE B 1 141 ? -16.525 22.089  -47.036  1.00 65.83  ? 196  PHE B CE1 1 
ATOM   4434  C CE2 . PHE B 1 141 ? -14.773 20.607  -46.361  1.00 64.67  ? 196  PHE B CE2 1 
ATOM   4435  C CZ  . PHE B 1 141 ? -15.211 21.665  -47.132  1.00 67.92  ? 196  PHE B CZ  1 
ATOM   4436  N N   . VAL B 1 142 ? -16.823 16.869  -45.331  1.00 60.94  ? 197  VAL B N   1 
ATOM   4437  C CA  . VAL B 1 142 ? -15.851 16.054  -46.040  1.00 56.08  ? 197  VAL B CA  1 
ATOM   4438  C C   . VAL B 1 142 ? -16.539 15.041  -46.944  1.00 63.58  ? 197  VAL B C   1 
ATOM   4439  O O   . VAL B 1 142 ? -16.092 14.796  -48.062  1.00 68.03  ? 197  VAL B O   1 
ATOM   4440  C CB  . VAL B 1 142 ? -14.951 15.300  -45.054  1.00 60.69  ? 197  VAL B CB  1 
ATOM   4441  C CG1 . VAL B 1 142 ? -14.080 14.291  -45.784  1.00 57.72  ? 197  VAL B CG1 1 
ATOM   4442  C CG2 . VAL B 1 142 ? -14.104 16.282  -44.273  1.00 70.30  ? 197  VAL B CG2 1 
ATOM   4443  N N   . LEU B 1 143 ? -17.631 14.458  -46.462  1.00 62.91  ? 198  LEU B N   1 
ATOM   4444  C CA  . LEU B 1 143 ? -18.341 13.436  -47.225  1.00 67.59  ? 198  LEU B CA  1 
ATOM   4445  C C   . LEU B 1 143 ? -19.187 14.002  -48.372  1.00 73.83  ? 198  LEU B C   1 
ATOM   4446  O O   . LEU B 1 143 ? -19.503 13.288  -49.325  1.00 75.14  ? 198  LEU B O   1 
ATOM   4447  C CB  . LEU B 1 143 ? -19.213 12.580  -46.304  1.00 65.92  ? 198  LEU B CB  1 
ATOM   4448  C CG  . LEU B 1 143 ? -18.486 11.654  -45.329  1.00 70.19  ? 198  LEU B CG  1 
ATOM   4449  C CD1 . LEU B 1 143 ? -19.488 10.831  -44.540  1.00 76.62  ? 198  LEU B CD1 1 
ATOM   4450  C CD2 . LEU B 1 143 ? -17.512 10.743  -46.062  1.00 71.91  ? 198  LEU B CD2 1 
ATOM   4451  N N   . TRP B 1 144 ? -19.547 15.279  -48.289  1.00 71.06  ? 199  TRP B N   1 
ATOM   4452  C CA  . TRP B 1 144 ? -20.418 15.886  -49.296  1.00 62.90  ? 199  TRP B CA  1 
ATOM   4453  C C   . TRP B 1 144 ? -19.718 16.937  -50.147  1.00 66.83  ? 199  TRP B C   1 
ATOM   4454  O O   . TRP B 1 144 ? -19.604 16.792  -51.366  1.00 74.38  ? 199  TRP B O   1 
ATOM   4455  C CB  . TRP B 1 144 ? -21.672 16.468  -48.651  1.00 57.84  ? 199  TRP B CB  1 
ATOM   4456  C CG  . TRP B 1 144 ? -22.627 15.410  -48.202  1.00 62.05  ? 199  TRP B CG  1 
ATOM   4457  C CD1 . TRP B 1 144 ? -22.965 15.096  -46.918  1.00 65.08  ? 199  TRP B CD1 1 
ATOM   4458  C CD2 . TRP B 1 144 ? -23.360 14.512  -49.039  1.00 58.78  ? 199  TRP B CD2 1 
ATOM   4459  N NE1 . TRP B 1 144 ? -23.873 14.068  -46.906  1.00 60.05  ? 199  TRP B NE1 1 
ATOM   4460  C CE2 . TRP B 1 144 ? -24.131 13.689  -48.198  1.00 60.23  ? 199  TRP B CE2 1 
ATOM   4461  C CE3 . TRP B 1 144 ? -23.448 14.329  -50.421  1.00 58.63  ? 199  TRP B CE3 1 
ATOM   4462  C CZ2 . TRP B 1 144 ? -24.977 12.697  -48.689  1.00 60.58  ? 199  TRP B CZ2 1 
ATOM   4463  C CZ3 . TRP B 1 144 ? -24.289 13.345  -50.908  1.00 59.65  ? 199  TRP B CZ3 1 
ATOM   4464  C CH2 . TRP B 1 144 ? -25.042 12.541  -50.045  1.00 57.02  ? 199  TRP B CH2 1 
ATOM   4465  N N   . ALA B 1 145 ? -19.256 17.994  -49.494  1.00 63.63  ? 200  ALA B N   1 
ATOM   4466  C CA  . ALA B 1 145 ? -18.663 19.142  -50.176  1.00 71.96  ? 200  ALA B CA  1 
ATOM   4467  C C   . ALA B 1 145 ? -17.694 18.803  -51.322  1.00 70.87  ? 200  ALA B C   1 
ATOM   4468  O O   . ALA B 1 145 ? -17.870 19.279  -52.450  1.00 73.70  ? 200  ALA B O   1 
ATOM   4469  C CB  . ALA B 1 145 ? -17.982 20.055  -49.162  1.00 71.97  ? 200  ALA B CB  1 
ATOM   4470  N N   . PRO B 1 146 ? -16.668 17.984  -51.044  1.00 64.20  ? 201  PRO B N   1 
ATOM   4471  C CA  . PRO B 1 146 ? -15.669 17.753  -52.090  1.00 66.67  ? 201  PRO B CA  1 
ATOM   4472  C C   . PRO B 1 146 ? -16.306 17.120  -53.314  1.00 74.56  ? 201  PRO B C   1 
ATOM   4473  O O   . PRO B 1 146 ? -16.089 17.577  -54.437  1.00 74.71  ? 201  PRO B O   1 
ATOM   4474  C CB  . PRO B 1 146 ? -14.702 16.757  -51.440  1.00 58.51  ? 201  PRO B CB  1 
ATOM   4475  C CG  . PRO B 1 146 ? -14.963 16.855  -49.975  1.00 67.04  ? 201  PRO B CG  1 
ATOM   4476  C CD  . PRO B 1 146 ? -16.415 17.164  -49.850  1.00 65.33  ? 201  PRO B CD  1 
ATOM   4477  N N   . ALA B 1 147 ? -17.106 16.084  -53.084  1.00 76.04  ? 202  ALA B N   1 
ATOM   4478  C CA  . ALA B 1 147 ? -17.749 15.350  -54.164  1.00 73.68  ? 202  ALA B CA  1 
ATOM   4479  C C   . ALA B 1 147 ? -18.630 16.278  -54.988  1.00 72.91  ? 202  ALA B C   1 
ATOM   4480  O O   . ALA B 1 147 ? -18.499 16.361  -56.215  1.00 76.80  ? 202  ALA B O   1 
ATOM   4481  C CB  . ALA B 1 147 ? -18.569 14.200  -53.600  1.00 69.98  ? 202  ALA B CB  1 
ATOM   4482  N N   . ILE B 1 148 ? -19.526 16.977  -54.299  1.00 72.52  ? 203  ILE B N   1 
ATOM   4483  C CA  . ILE B 1 148 ? -20.430 17.912  -54.956  1.00 73.41  ? 203  ILE B CA  1 
ATOM   4484  C C   . ILE B 1 148 ? -19.663 18.900  -55.821  1.00 75.43  ? 203  ILE B C   1 
ATOM   4485  O O   . ILE B 1 148 ? -19.790 18.895  -57.046  1.00 78.56  ? 203  ILE B O   1 
ATOM   4486  C CB  . ILE B 1 148 ? -21.290 18.676  -53.930  1.00 71.90  ? 203  ILE B CB  1 
ATOM   4487  C CG1 . ILE B 1 148 ? -22.235 17.706  -53.220  1.00 74.79  ? 203  ILE B CG1 1 
ATOM   4488  C CG2 . ILE B 1 148 ? -22.071 19.787  -54.609  1.00 67.42  ? 203  ILE B CG2 1 
ATOM   4489  C CD1 . ILE B 1 148 ? -23.129 18.354  -52.196  1.00 76.64  ? 203  ILE B CD1 1 
ATOM   4490  N N   . LEU B 1 149 ? -18.848 19.728  -55.179  1.00 75.47  ? 204  LEU B N   1 
ATOM   4491  C CA  . LEU B 1 149 ? -18.145 20.796  -55.877  1.00 77.19  ? 204  LEU B CA  1 
ATOM   4492  C C   . LEU B 1 149 ? -17.233 20.303  -56.999  1.00 84.37  ? 204  LEU B C   1 
ATOM   4493  O O   . LEU B 1 149 ? -17.397 20.695  -58.154  1.00 87.89  ? 204  LEU B O   1 
ATOM   4494  C CB  . LEU B 1 149 ? -17.337 21.627  -54.881  1.00 81.20  ? 204  LEU B CB  1 
ATOM   4495  C CG  . LEU B 1 149 ? -18.183 22.331  -53.817  1.00 83.02  ? 204  LEU B CG  1 
ATOM   4496  C CD1 . LEU B 1 149 ? -17.311 22.857  -52.692  1.00 76.09  ? 204  LEU B CD1 1 
ATOM   4497  C CD2 . LEU B 1 149 ? -19.015 23.448  -54.437  1.00 81.84  ? 204  LEU B CD2 1 
ATOM   4498  N N   . PHE B 1 150 ? -16.284 19.436  -56.661  1.00 86.01  ? 205  PHE B N   1 
ATOM   4499  C CA  . PHE B 1 150 ? -15.219 19.086  -57.601  1.00 88.91  ? 205  PHE B CA  1 
ATOM   4500  C C   . PHE B 1 150 ? -15.465 17.845  -58.460  1.00 86.06  ? 205  PHE B C   1 
ATOM   4501  O O   . PHE B 1 150 ? -14.603 17.474  -59.254  1.00 86.24  ? 205  PHE B O   1 
ATOM   4502  C CB  . PHE B 1 150 ? -13.876 18.940  -56.873  1.00 89.45  ? 205  PHE B CB  1 
ATOM   4503  C CG  . PHE B 1 150 ? -13.357 20.223  -56.282  1.00 83.95  ? 205  PHE B CG  1 
ATOM   4504  C CD1 . PHE B 1 150 ? -14.050 21.412  -56.441  1.00 81.64  ? 205  PHE B CD1 1 
ATOM   4505  C CD2 . PHE B 1 150 ? -12.168 20.237  -55.575  1.00 79.69  ? 205  PHE B CD2 1 
ATOM   4506  C CE1 . PHE B 1 150 ? -13.569 22.585  -55.896  1.00 82.75  ? 205  PHE B CE1 1 
ATOM   4507  C CE2 . PHE B 1 150 ? -11.683 21.406  -55.031  1.00 73.58  ? 205  PHE B CE2 1 
ATOM   4508  C CZ  . PHE B 1 150 ? -12.382 22.580  -55.191  1.00 80.08  ? 205  PHE B CZ  1 
ATOM   4509  N N   . TRP B 1 151 ? -16.616 17.196  -58.311  1.00 83.73  ? 206  TRP B N   1 
ATOM   4510  C CA  . TRP B 1 151 ? -16.893 16.023  -59.135  1.00 85.12  ? 206  TRP B CA  1 
ATOM   4511  C C   . TRP B 1 151 ? -16.907 16.397  -60.612  1.00 90.52  ? 206  TRP B C   1 
ATOM   4512  O O   . TRP B 1 151 ? -16.536 15.597  -61.474  1.00 93.81  ? 206  TRP B O   1 
ATOM   4513  C CB  . TRP B 1 151 ? -18.212 15.363  -58.746  1.00 78.89  ? 206  TRP B CB  1 
ATOM   4514  C CG  . TRP B 1 151 ? -18.596 14.235  -59.658  1.00 84.32  ? 206  TRP B CG  1 
ATOM   4515  C CD1 . TRP B 1 151 ? -19.448 14.299  -60.721  1.00 91.17  ? 206  TRP B CD1 1 
ATOM   4516  C CD2 . TRP B 1 151 ? -18.137 12.877  -59.595  1.00 84.74  ? 206  TRP B CD2 1 
ATOM   4517  N NE1 . TRP B 1 151 ? -19.554 13.064  -61.321  1.00 93.66  ? 206  TRP B NE1 1 
ATOM   4518  C CE2 . TRP B 1 151 ? -18.759 12.174  -60.648  1.00 86.82  ? 206  TRP B CE2 1 
ATOM   4519  C CE3 . TRP B 1 151 ? -17.263 12.187  -58.750  1.00 82.18  ? 206  TRP B CE3 1 
ATOM   4520  C CZ2 . TRP B 1 151 ? -18.537 10.816  -60.877  1.00 78.23  ? 206  TRP B CZ2 1 
ATOM   4521  C CZ3 . TRP B 1 151 ? -17.045 10.840  -58.981  1.00 80.92  ? 206  TRP B CZ3 1 
ATOM   4522  C CH2 . TRP B 1 151 ? -17.680 10.170  -60.035  1.00 76.03  ? 206  TRP B CH2 1 
ATOM   4523  N N   . GLN B 1 152 ? -17.338 17.620  -60.895  1.00 89.34  ? 207  GLN B N   1 
ATOM   4524  C CA  . GLN B 1 152 ? -17.394 18.107  -62.265  1.00 94.02  ? 207  GLN B CA  1 
ATOM   4525  C C   . GLN B 1 152 ? -15.999 18.250  -62.878  1.00 101.54 ? 207  GLN B C   1 
ATOM   4526  O O   . GLN B 1 152 ? -15.762 17.829  -64.012  1.00 104.46 ? 207  GLN B O   1 
ATOM   4527  C CB  . GLN B 1 152 ? -18.163 19.429  -62.331  1.00 92.17  ? 207  GLN B CB  1 
ATOM   4528  C CG  . GLN B 1 152 ? -17.760 20.452  -61.283  1.00 97.19  ? 207  GLN B CG  1 
ATOM   4529  C CD  . GLN B 1 152 ? -18.568 21.734  -61.386  1.00 105.15 ? 207  GLN B CD  1 
ATOM   4530  O OE1 . GLN B 1 152 ? -19.486 21.838  -62.199  1.00 101.74 ? 207  GLN B OE1 1 
ATOM   4531  N NE2 . GLN B 1 152 ? -18.228 22.719  -60.560  1.00 109.69 ? 207  GLN B NE2 1 
ATOM   4532  N N   . TYR B 1 153 ? -15.078 18.840  -62.123  1.00 100.09 ? 208  TYR B N   1 
ATOM   4533  C CA  . TYR B 1 153 ? -13.702 19.004  -62.583  1.00 97.77  ? 208  TYR B CA  1 
ATOM   4534  C C   . TYR B 1 153 ? -12.947 17.679  -62.562  1.00 100.98 ? 208  TYR B C   1 
ATOM   4535  O O   . TYR B 1 153 ? -11.920 17.528  -63.219  1.00 99.16  ? 208  TYR B O   1 
ATOM   4536  C CB  . TYR B 1 153 ? -12.971 20.034  -61.723  1.00 95.23  ? 208  TYR B CB  1 
ATOM   4537  C CG  . TYR B 1 153 ? -13.599 21.405  -61.749  1.00 97.92  ? 208  TYR B CG  1 
ATOM   4538  C CD1 . TYR B 1 153 ? -13.192 22.355  -62.672  1.00 102.98 ? 208  TYR B CD1 1 
ATOM   4539  C CD2 . TYR B 1 153 ? -14.599 21.753  -60.848  1.00 99.30  ? 208  TYR B CD2 1 
ATOM   4540  C CE1 . TYR B 1 153 ? -13.761 23.614  -62.701  1.00 110.27 ? 208  TYR B CE1 1 
ATOM   4541  C CE2 . TYR B 1 153 ? -15.174 23.011  -60.869  1.00 101.00 ? 208  TYR B CE2 1 
ATOM   4542  C CZ  . TYR B 1 153 ? -14.751 23.938  -61.799  1.00 108.79 ? 208  TYR B CZ  1 
ATOM   4543  O OH  . TYR B 1 153 ? -15.313 25.195  -61.834  1.00 113.30 ? 208  TYR B OH  1 
ATOM   4544  N N   . PHE B 1 154 ? -13.455 16.723  -61.792  1.00 103.31 ? 209  PHE B N   1 
ATOM   4545  C CA  . PHE B 1 154 ? -12.876 15.388  -61.768  1.00 104.29 ? 209  PHE B CA  1 
ATOM   4546  C C   . PHE B 1 154 ? -13.248 14.633  -63.039  1.00 107.89 ? 209  PHE B C   1 
ATOM   4547  O O   . PHE B 1 154 ? -12.395 14.014  -63.675  1.00 110.15 ? 209  PHE B O   1 
ATOM   4548  C CB  . PHE B 1 154 ? -13.337 14.609  -60.534  1.00 105.67 ? 209  PHE B CB  1 
ATOM   4549  C CG  . PHE B 1 154 ? -12.971 13.155  -60.573  1.00 108.50 ? 209  PHE B CG  1 
ATOM   4550  C CD1 . PHE B 1 154 ? -11.675 12.744  -60.294  1.00 113.36 ? 209  PHE B CD1 1 
ATOM   4551  C CD2 . PHE B 1 154 ? -13.919 12.199  -60.902  1.00 104.72 ? 209  PHE B CD2 1 
ATOM   4552  C CE1 . PHE B 1 154 ? -11.331 11.403  -60.338  1.00 112.61 ? 209  PHE B CE1 1 
ATOM   4553  C CE2 . PHE B 1 154 ? -13.583 10.858  -60.948  1.00 113.06 ? 209  PHE B CE2 1 
ATOM   4554  C CZ  . PHE B 1 154 ? -12.286 10.459  -60.665  1.00 118.04 ? 209  PHE B CZ  1 
ATOM   4555  N N   . VAL B 1 155 ? -14.526 14.688  -63.404  1.00 106.28 ? 210  VAL B N   1 
ATOM   4556  C CA  . VAL B 1 155 ? -14.992 14.066  -64.640  1.00 107.91 ? 210  VAL B CA  1 
ATOM   4557  C C   . VAL B 1 155 ? -14.408 14.783  -65.857  1.00 109.25 ? 210  VAL B C   1 
ATOM   4558  O O   . VAL B 1 155 ? -14.073 14.152  -66.862  1.00 107.64 ? 210  VAL B O   1 
ATOM   4559  C CB  . VAL B 1 155 ? -16.532 14.075  -64.738  1.00 108.69 ? 210  VAL B CB  1 
ATOM   4560  C CG1 . VAL B 1 155 ? -16.988 13.454  -66.051  1.00 114.34 ? 210  VAL B CG1 1 
ATOM   4561  C CG2 . VAL B 1 155 ? -17.144 13.340  -63.555  1.00 103.79 ? 210  VAL B CG2 1 
ATOM   4562  N N   . GLY B 1 156 ? -14.283 16.104  -65.755  1.00 104.87 ? 211  GLY B N   1 
ATOM   4563  C CA  . GLY B 1 156 ? -13.749 16.909  -66.836  1.00 100.22 ? 211  GLY B CA  1 
ATOM   4564  C C   . GLY B 1 156 ? -14.837 17.651  -67.586  1.00 100.74 ? 211  GLY B C   1 
ATOM   4565  O O   . GLY B 1 156 ? -14.561 18.586  -68.335  1.00 99.73  ? 211  GLY B O   1 
ATOM   4566  N N   . LYS B 1 157 ? -16.083 17.240  -67.378  1.00 97.40  ? 212  LYS B N   1 
ATOM   4567  C CA  . LYS B 1 157 ? -17.212 17.884  -68.036  1.00 99.12  ? 212  LYS B CA  1 
ATOM   4568  C C   . LYS B 1 157 ? -18.316 18.180  -67.031  1.00 95.80  ? 212  LYS B C   1 
ATOM   4569  O O   . LYS B 1 157 ? -18.275 17.713  -65.896  1.00 101.59 ? 212  LYS B O   1 
ATOM   4570  C CB  . LYS B 1 157 ? -17.756 17.007  -69.167  1.00 106.05 ? 212  LYS B CB  1 
ATOM   4571  N N   . ARG B 1 158 ? -19.290 18.977  -67.452  1.00 95.49  ? 213  ARG B N   1 
ATOM   4572  C CA  . ARG B 1 158 ? -20.442 19.296  -66.619  1.00 98.82  ? 213  ARG B CA  1 
ATOM   4573  C C   . ARG B 1 158 ? -21.711 18.604  -67.126  1.00 105.58 ? 213  ARG B C   1 
ATOM   4574  O O   . ARG B 1 158 ? -22.235 18.945  -68.186  1.00 106.27 ? 213  ARG B O   1 
ATOM   4575  C CB  . ARG B 1 158 ? -20.638 20.812  -66.548  1.00 96.03  ? 213  ARG B CB  1 
ATOM   4576  C CG  . ARG B 1 158 ? -22.021 21.246  -66.097  1.00 99.28  ? 213  ARG B CG  1 
ATOM   4577  C CD  . ARG B 1 158 ? -22.087 22.751  -65.886  1.00 96.11  ? 213  ARG B CD  1 
ATOM   4578  N NE  . ARG B 1 158 ? -21.555 23.147  -64.583  1.00 95.74  ? 213  ARG B NE  1 
ATOM   4579  C CZ  . ARG B 1 158 ? -22.305 23.503  -63.544  1.00 89.40  ? 213  ARG B CZ  1 
ATOM   4580  N NH1 . ARG B 1 158 ? -23.626 23.525  -63.647  1.00 85.85  ? 213  ARG B NH1 1 
ATOM   4581  N NH2 . ARG B 1 158 ? -21.731 23.842  -62.399  1.00 92.36  ? 213  ARG B NH2 1 
ATOM   4582  N N   . THR B 1 159 ? -22.196 17.632  -66.354  1.00 103.86 ? 214  THR B N   1 
ATOM   4583  C CA  . THR B 1 159 ? -23.368 16.839  -66.723  1.00 100.29 ? 214  THR B CA  1 
ATOM   4584  C C   . THR B 1 159 ? -24.648 17.661  -66.580  1.00 99.85  ? 214  THR B C   1 
ATOM   4585  O O   . THR B 1 159 ? -25.657 17.384  -67.236  1.00 92.34  ? 214  THR B O   1 
ATOM   4586  C CB  . THR B 1 159 ? -23.465 15.559  -65.852  1.00 99.23  ? 214  THR B CB  1 
ATOM   4587  O OG1 . THR B 1 159 ? -22.246 14.815  -65.953  1.00 99.55  ? 214  THR B OG1 1 
ATOM   4588  C CG2 . THR B 1 159 ? -24.628 14.673  -66.285  1.00 101.87 ? 214  THR B CG2 1 
ATOM   4589  N N   . VAL B 1 160 ? -24.594 18.675  -65.720  1.00 105.48 ? 215  VAL B N   1 
ATOM   4590  C CA  . VAL B 1 160 ? -25.750 19.526  -65.463  1.00 107.68 ? 215  VAL B CA  1 
ATOM   4591  C C   . VAL B 1 160 ? -25.790 20.705  -66.421  1.00 107.73 ? 215  VAL B C   1 
ATOM   4592  O O   . VAL B 1 160 ? -25.020 21.656  -66.287  1.00 100.47 ? 215  VAL B O   1 
ATOM   4593  C CB  . VAL B 1 160 ? -25.736 20.075  -64.028  1.00 104.37 ? 215  VAL B CB  1 
ATOM   4594  C CG1 . VAL B 1 160 ? -26.888 21.055  -63.815  1.00 105.21 ? 215  VAL B CG1 1 
ATOM   4595  C CG2 . VAL B 1 160 ? -25.796 18.932  -63.027  1.00 97.00  ? 215  VAL B CG2 1 
ATOM   4596  N N   . PRO B 1 161 ? -26.729 20.666  -67.373  1.00 112.08 ? 216  PRO B N   1 
ATOM   4597  C CA  . PRO B 1 161 ? -26.861 21.771  -68.317  1.00 110.28 ? 216  PRO B CA  1 
ATOM   4598  C C   . PRO B 1 161 ? -27.565 22.936  -67.644  1.00 108.30 ? 216  PRO B C   1 
ATOM   4599  O O   . PRO B 1 161 ? -28.316 22.739  -66.697  1.00 106.26 ? 216  PRO B O   1 
ATOM   4600  C CB  . PRO B 1 161 ? -27.746 21.183  -69.417  1.00 110.96 ? 216  PRO B CB  1 
ATOM   4601  C CG  . PRO B 1 161 ? -28.571 20.159  -68.725  1.00 106.56 ? 216  PRO B CG  1 
ATOM   4602  C CD  . PRO B 1 161 ? -27.746 19.623  -67.585  1.00 106.03 ? 216  PRO B CD  1 
ATOM   4603  N N   . PRO B 1 162 ? -27.304 24.160  -68.115  1.00 106.66 ? 217  PRO B N   1 
ATOM   4604  C CA  . PRO B 1 162 ? -28.031 25.337  -67.631  1.00 106.70 ? 217  PRO B CA  1 
ATOM   4605  C C   . PRO B 1 162 ? -29.542 25.151  -67.791  1.00 111.52 ? 217  PRO B C   1 
ATOM   4606  O O   . PRO B 1 162 ? -29.995 24.609  -68.825  1.00 110.16 ? 217  PRO B O   1 
ATOM   4607  C CB  . PRO B 1 162 ? -27.560 26.429  -68.588  1.00 109.92 ? 217  PRO B CB  1 
ATOM   4608  C CG  . PRO B 1 162 ? -27.140 25.688  -69.826  1.00 104.99 ? 217  PRO B CG  1 
ATOM   4609  C CD  . PRO B 1 162 ? -26.460 24.490  -69.275  1.00 104.97 ? 217  PRO B CD  1 
ATOM   4610  N N   . GLY B 1 163 ? -30.316 25.600  -66.804  1.00 113.83 ? 218  GLY B N   1 
ATOM   4611  C CA  . GLY B 1 163 ? -31.755 25.370  -66.785  1.00 112.87 ? 218  GLY B CA  1 
ATOM   4612  C C   . GLY B 1 163 ? -32.266 24.492  -65.648  1.00 109.86 ? 218  GLY B C   1 
ATOM   4613  O O   . GLY B 1 163 ? -33.443 24.522  -65.309  1.00 108.90 ? 218  GLY B O   1 
ATOM   4614  N N   . GLU B 1 164 ? -31.364 23.757  -65.014  1.00 110.40 ? 219  GLU B N   1 
ATOM   4615  C CA  . GLU B 1 164 ? -31.704 22.879  -63.908  1.00 110.04 ? 219  GLU B CA  1 
ATOM   4616  C C   . GLU B 1 164 ? -30.497 22.748  -63.014  1.00 107.88 ? 219  GLU B C   1 
ATOM   4617  O O   . GLU B 1 164 ? -29.377 22.973  -63.453  1.00 103.77 ? 219  GLU B O   1 
ATOM   4618  C CB  . GLU B 1 164 ? -32.114 21.520  -64.458  1.00 111.12 ? 219  GLU B CB  1 
ATOM   4619  C CG  . GLU B 1 164 ? -30.937 20.727  -65.014  1.00 110.98 ? 219  GLU B CG  1 
ATOM   4620  C CD  . GLU B 1 164 ? -31.180 20.263  -66.428  1.00 107.67 ? 219  GLU B CD  1 
ATOM   4621  O OE1 . GLU B 1 164 ? -30.678 19.184  -66.789  1.00 107.15 ? 219  GLU B OE1 1 
ATOM   4622  O OE2 . GLU B 1 164 ? -31.866 20.984  -67.183  1.00 108.85 ? 219  GLU B OE2 1 
ATOM   4623  N N   . CYS B 1 165 ? -30.732 22.355  -61.772  1.00 103.35 ? 220  CYS B N   1 
ATOM   4624  C CA  . CYS B 1 165 ? -29.646 22.296  -60.779  1.00 97.56  ? 220  CYS B CA  1 
ATOM   4625  C C   . CYS B 1 165 ? -29.857 21.037  -59.937  1.00 95.82  ? 220  CYS B C   1 
ATOM   4626  O O   . CYS B 1 165 ? -30.965 20.815  -59.435  1.00 92.55  ? 220  CYS B O   1 
ATOM   4627  C CB  . CYS B 1 165 ? -29.658 23.585  -59.894  1.00 97.43  ? 220  CYS B CB  1 
ATOM   4628  S SG  . CYS B 1 165 ? -28.574 23.716  -58.406  1.00 80.83  ? 220  CYS B SG  1 
ATOM   4629  N N   . PHE B 1 166 ? -28.818 20.212  -59.828  1.00 94.71  ? 221  PHE B N   1 
ATOM   4630  C CA  . PHE B 1 166 ? -28.865 18.976  -59.050  1.00 91.17  ? 221  PHE B CA  1 
ATOM   4631  C C   . PHE B 1 166 ? -27.455 18.417  -58.857  1.00 89.50  ? 221  PHE B C   1 
ATOM   4632  O O   . PHE B 1 166 ? -26.488 18.963  -59.393  1.00 90.57  ? 221  PHE B O   1 
ATOM   4633  C CB  . PHE B 1 166 ? -29.742 17.932  -59.743  1.00 93.36  ? 221  PHE B CB  1 
ATOM   4634  C CG  . PHE B 1 166 ? -29.257 17.547  -61.111  1.00 92.02  ? 221  PHE B CG  1 
ATOM   4635  C CD1 . PHE B 1 166 ? -28.241 16.619  -61.261  1.00 93.69  ? 221  PHE B CD1 1 
ATOM   4636  C CD2 . PHE B 1 166 ? -29.815 18.113  -62.245  1.00 90.23  ? 221  PHE B CD2 1 
ATOM   4637  C CE1 . PHE B 1 166 ? -27.788 16.261  -62.516  1.00 95.19  ? 221  PHE B CE1 1 
ATOM   4638  C CE2 . PHE B 1 166 ? -29.368 17.761  -63.501  1.00 92.96  ? 221  PHE B CE2 1 
ATOM   4639  C CZ  . PHE B 1 166 ? -28.353 16.832  -63.638  1.00 98.53  ? 221  PHE B CZ  1 
ATOM   4640  N N   . ILE B 1 167 ? -27.337 17.324  -58.108  1.00 89.63  ? 222  ILE B N   1 
ATOM   4641  C CA  . ILE B 1 167 ? -26.022 16.738  -57.850  1.00 87.93  ? 222  ILE B CA  1 
ATOM   4642  C C   . ILE B 1 167 ? -25.578 15.856  -59.008  1.00 77.50  ? 222  ILE B C   1 
ATOM   4643  O O   . ILE B 1 167 ? -26.300 14.959  -59.432  1.00 74.77  ? 222  ILE B O   1 
ATOM   4644  C CB  . ILE B 1 167 ? -25.977 15.944  -56.531  1.00 86.09  ? 222  ILE B CB  1 
ATOM   4645  C CG1 . ILE B 1 167 ? -26.139 16.889  -55.333  1.00 86.69  ? 222  ILE B CG1 1 
ATOM   4646  C CG2 . ILE B 1 167 ? -24.662 15.186  -56.412  1.00 78.53  ? 222  ILE B CG2 1 
ATOM   4647  C CD1 . ILE B 1 167 ? -25.827 16.255  -53.990  1.00 83.17  ? 222  ILE B CD1 1 
ATOM   4648  N N   . GLN B 1 168 ? -24.377 16.114  -59.508  1.00 76.19  ? 223  GLN B N   1 
ATOM   4649  C CA  . GLN B 1 168 ? -23.915 15.452  -60.712  1.00 80.53  ? 223  GLN B CA  1 
ATOM   4650  C C   . GLN B 1 168 ? -23.826 13.942  -60.543  1.00 69.84  ? 223  GLN B C   1 
ATOM   4651  O O   . GLN B 1 168 ? -24.532 13.198  -61.219  1.00 66.11  ? 223  GLN B O   1 
ATOM   4652  C CB  . GLN B 1 168 ? -22.558 16.017  -61.129  1.00 88.16  ? 223  GLN B CB  1 
ATOM   4653  C CG  . GLN B 1 168 ? -22.197 15.752  -62.580  1.00 95.59  ? 223  GLN B CG  1 
ATOM   4654  C CD  . GLN B 1 168 ? -21.008 16.567  -63.041  1.00 100.22 ? 223  GLN B CD  1 
ATOM   4655  O OE1 . GLN B 1 168 ? -20.683 17.598  -62.452  1.00 101.70 ? 223  GLN B OE1 1 
ATOM   4656  N NE2 . GLN B 1 168 ? -20.344 16.105  -64.096  1.00 107.98 ? 223  GLN B NE2 1 
ATOM   4657  N N   . PHE B 1 169 ? -22.996 13.495  -59.607  1.00 69.65  ? 224  PHE B N   1 
ATOM   4658  C CA  . PHE B 1 169 ? -22.659 12.073  -59.493  1.00 75.03  ? 224  PHE B CA  1 
ATOM   4659  C C   . PHE B 1 169 ? -23.840 11.179  -59.108  1.00 76.74  ? 224  PHE B C   1 
ATOM   4660  O O   . PHE B 1 169 ? -23.736 9.951   -59.143  1.00 78.85  ? 224  PHE B O   1 
ATOM   4661  C CB  . PHE B 1 169 ? -21.499 11.862  -58.515  1.00 64.72  ? 224  PHE B CB  1 
ATOM   4662  C CG  . PHE B 1 169 ? -21.772 12.377  -57.137  1.00 67.24  ? 224  PHE B CG  1 
ATOM   4663  C CD1 . PHE B 1 169 ? -21.267 13.598  -56.727  1.00 73.91  ? 224  PHE B CD1 1 
ATOM   4664  C CD2 . PHE B 1 169 ? -22.538 11.643  -56.251  1.00 70.05  ? 224  PHE B CD2 1 
ATOM   4665  C CE1 . PHE B 1 169 ? -21.519 14.075  -55.453  1.00 72.78  ? 224  PHE B CE1 1 
ATOM   4666  C CE2 . PHE B 1 169 ? -22.795 12.117  -54.975  1.00 69.66  ? 224  PHE B CE2 1 
ATOM   4667  C CZ  . PHE B 1 169 ? -22.285 13.334  -54.577  1.00 65.67  ? 224  PHE B CZ  1 
ATOM   4668  N N   . LEU B 1 170 ? -24.960 11.790  -58.744  1.00 71.95  ? 225  LEU B N   1 
ATOM   4669  C CA  . LEU B 1 170 ? -26.129 11.017  -58.349  1.00 64.16  ? 225  LEU B CA  1 
ATOM   4670  C C   . LEU B 1 170 ? -27.017 10.680  -59.537  1.00 68.77  ? 225  LEU B C   1 
ATOM   4671  O O   . LEU B 1 170 ? -28.089 10.099  -59.369  1.00 71.98  ? 225  LEU B O   1 
ATOM   4672  C CB  . LEU B 1 170 ? -26.931 11.751  -57.277  1.00 62.36  ? 225  LEU B CB  1 
ATOM   4673  C CG  . LEU B 1 170 ? -26.319 11.649  -55.882  1.00 61.68  ? 225  LEU B CG  1 
ATOM   4674  C CD1 . LEU B 1 170 ? -27.262 12.213  -54.834  1.00 59.05  ? 225  LEU B CD1 1 
ATOM   4675  C CD2 . LEU B 1 170 ? -25.978 10.200  -55.578  1.00 58.17  ? 225  LEU B CD2 1 
ATOM   4676  N N   . SER B 1 171 ? -26.571 11.036  -60.736  1.00 64.40  ? 226  SER B N   1 
ATOM   4677  C CA  . SER B 1 171 ? -27.383 10.826  -61.927  1.00 70.70  ? 226  SER B CA  1 
ATOM   4678  C C   . SER B 1 171 ? -27.944 9.404   -61.975  1.00 67.19  ? 226  SER B C   1 
ATOM   4679  O O   . SER B 1 171 ? -29.154 9.207   -62.106  1.00 54.32  ? 226  SER B O   1 
ATOM   4680  C CB  . SER B 1 171 ? -26.561 11.115  -63.187  1.00 81.71  ? 226  SER B CB  1 
ATOM   4681  O OG  . SER B 1 171 ? -26.126 12.465  -63.221  1.00 82.55  ? 226  SER B OG  1 
ATOM   4682  N N   . GLU B 1 172 ? -27.067 8.415   -61.840  1.00 69.74  ? 227  GLU B N   1 
ATOM   4683  C CA  . GLU B 1 172 ? -27.499 7.023   -61.855  1.00 64.57  ? 227  GLU B CA  1 
ATOM   4684  C C   . GLU B 1 172 ? -28.375 6.727   -60.648  1.00 59.09  ? 227  GLU B C   1 
ATOM   4685  O O   . GLU B 1 172 ? -28.049 7.130   -59.535  1.00 60.05  ? 227  GLU B O   1 
ATOM   4686  C CB  . GLU B 1 172 ? -26.296 6.081   -61.873  1.00 68.20  ? 227  GLU B CB  1 
ATOM   4687  C CG  . GLU B 1 172 ? -26.670 4.619   -62.081  1.00 74.09  ? 227  GLU B CG  1 
ATOM   4688  C CD  . GLU B 1 172 ? -27.343 4.371   -63.424  1.00 73.30  ? 227  GLU B CD  1 
ATOM   4689  O OE1 . GLU B 1 172 ? -26.946 5.016   -64.417  1.00 70.08  ? 227  GLU B OE1 1 
ATOM   4690  O OE2 . GLU B 1 172 ? -28.274 3.541   -63.489  1.00 69.22  ? 227  GLU B OE2 1 
ATOM   4691  N N   . PRO B 1 173 ? -29.497 6.024   -60.869  1.00 64.58  ? 228  PRO B N   1 
ATOM   4692  C CA  . PRO B 1 173 ? -30.451 5.684   -59.804  1.00 72.51  ? 228  PRO B CA  1 
ATOM   4693  C C   . PRO B 1 173 ? -29.823 4.803   -58.717  1.00 68.84  ? 228  PRO B C   1 
ATOM   4694  O O   . PRO B 1 173 ? -30.081 4.991   -57.522  1.00 63.42  ? 228  PRO B O   1 
ATOM   4695  C CB  . PRO B 1 173 ? -31.550 4.911   -60.551  1.00 65.12  ? 228  PRO B CB  1 
ATOM   4696  C CG  . PRO B 1 173 ? -30.888 4.409   -61.795  1.00 60.71  ? 228  PRO B CG  1 
ATOM   4697  C CD  . PRO B 1 173 ? -29.919 5.488   -62.174  1.00 61.57  ? 228  PRO B CD  1 
ATOM   4698  N N   . THR B 1 174 ? -28.997 3.855   -59.144  1.00 61.39  ? 229  THR B N   1 
ATOM   4699  C CA  . THR B 1 174 ? -28.393 2.889   -58.237  1.00 57.84  ? 229  THR B CA  1 
ATOM   4700  C C   . THR B 1 174 ? -27.471 3.538   -57.198  1.00 59.71  ? 229  THR B C   1 
ATOM   4701  O O   . THR B 1 174 ? -27.604 3.298   -55.994  1.00 54.99  ? 229  THR B O   1 
ATOM   4702  C CB  . THR B 1 174 ? -27.624 1.826   -59.023  1.00 63.25  ? 229  THR B CB  1 
ATOM   4703  O OG1 . THR B 1 174 ? -26.749 2.468   -59.957  1.00 61.63  ? 229  THR B OG1 1 
ATOM   4704  C CG2 . THR B 1 174 ? -28.591 0.937   -59.791  1.00 71.16  ? 229  THR B CG2 1 
ATOM   4705  N N   . ILE B 1 175 ? -26.533 4.350   -57.680  1.00 64.58  ? 230  ILE B N   1 
ATOM   4706  C CA  . ILE B 1 175 ? -25.561 5.054   -56.840  1.00 54.90  ? 230  ILE B CA  1 
ATOM   4707  C C   . ILE B 1 175 ? -26.267 5.949   -55.806  1.00 51.87  ? 230  ILE B C   1 
ATOM   4708  O O   . ILE B 1 175 ? -25.894 6.000   -54.626  1.00 42.30  ? 230  ILE B O   1 
ATOM   4709  C CB  . ILE B 1 175 ? -24.550 5.829   -57.735  1.00 51.09  ? 230  ILE B CB  1 
ATOM   4710  C CG1 . ILE B 1 175 ? -23.577 6.661   -56.910  1.00 54.70  ? 230  ILE B CG1 1 
ATOM   4711  C CG2 . ILE B 1 175 ? -25.265 6.715   -58.742  1.00 56.85  ? 230  ILE B CG2 1 
ATOM   4712  C CD1 . ILE B 1 175 ? -22.566 7.387   -57.772  1.00 63.30  ? 230  ILE B CD1 1 
ATOM   4713  N N   . THR B 1 176 ? -27.318 6.622   -56.259  1.00 56.78  ? 231  THR B N   1 
ATOM   4714  C CA  . THR B 1 176 ? -28.208 7.353   -55.368  1.00 54.83  ? 231  THR B CA  1 
ATOM   4715  C C   . THR B 1 176 ? -28.796 6.422   -54.307  1.00 51.24  ? 231  THR B C   1 
ATOM   4716  O O   . THR B 1 176 ? -28.840 6.761   -53.123  1.00 50.99  ? 231  THR B O   1 
ATOM   4717  C CB  . THR B 1 176 ? -29.351 8.021   -56.148  1.00 50.73  ? 231  THR B CB  1 
ATOM   4718  O OG1 . THR B 1 176 ? -28.799 8.877   -57.153  1.00 48.87  ? 231  THR B OG1 1 
ATOM   4719  C CG2 . THR B 1 176 ? -30.216 8.844   -55.220  1.00 57.00  ? 231  THR B CG2 1 
ATOM   4720  N N   . PHE B 1 177 ? -29.246 5.247   -54.735  1.00 49.07  ? 232  PHE B N   1 
ATOM   4721  C CA  . PHE B 1 177 ? -29.762 4.253   -53.803  1.00 46.11  ? 232  PHE B CA  1 
ATOM   4722  C C   . PHE B 1 177 ? -28.756 3.922   -52.705  1.00 44.46  ? 232  PHE B C   1 
ATOM   4723  O O   . PHE B 1 177 ? -29.022 4.132   -51.513  1.00 50.58  ? 232  PHE B O   1 
ATOM   4724  C CB  . PHE B 1 177 ? -30.166 2.980   -54.537  1.00 47.95  ? 232  PHE B CB  1 
ATOM   4725  C CG  . PHE B 1 177 ? -30.705 1.916   -53.636  1.00 48.89  ? 232  PHE B CG  1 
ATOM   4726  C CD1 . PHE B 1 177 ? -31.819 2.159   -52.854  1.00 52.61  ? 232  PHE B CD1 1 
ATOM   4727  C CD2 . PHE B 1 177 ? -30.102 0.672   -53.569  1.00 49.86  ? 232  PHE B CD2 1 
ATOM   4728  C CE1 . PHE B 1 177 ? -32.324 1.186   -52.017  1.00 56.53  ? 232  PHE B CE1 1 
ATOM   4729  C CE2 . PHE B 1 177 ? -30.604 -0.310  -52.733  1.00 54.05  ? 232  PHE B CE2 1 
ATOM   4730  C CZ  . PHE B 1 177 ? -31.717 -0.054  -51.956  1.00 53.50  ? 232  PHE B CZ  1 
ATOM   4731  N N   . GLY B 1 178 ? -27.611 3.380   -53.102  1.00 36.96  ? 233  GLY B N   1 
ATOM   4732  C CA  . GLY B 1 178 ? -26.584 3.034   -52.141  1.00 40.26  ? 233  GLY B CA  1 
ATOM   4733  C C   . GLY B 1 178 ? -26.325 4.182   -51.188  1.00 44.74  ? 233  GLY B C   1 
ATOM   4734  O O   . GLY B 1 178 ? -26.212 3.988   -49.975  1.00 40.74  ? 233  GLY B O   1 
ATOM   4735  N N   . THR B 1 179 ? -26.245 5.389   -51.737  1.00 49.83  ? 234  THR B N   1 
ATOM   4736  C CA  . THR B 1 179 ? -26.054 6.570   -50.902  1.00 44.63  ? 234  THR B CA  1 
ATOM   4737  C C   . THR B 1 179 ? -27.155 6.703   -49.853  1.00 44.09  ? 234  THR B C   1 
ATOM   4738  O O   . THR B 1 179 ? -26.879 6.996   -48.693  1.00 47.77  ? 234  THR B O   1 
ATOM   4739  C CB  . THR B 1 179 ? -26.008 7.851   -51.737  1.00 47.58  ? 234  THR B CB  1 
ATOM   4740  O OG1 . THR B 1 179 ? -24.947 7.755   -52.696  1.00 50.74  ? 234  THR B OG1 1 
ATOM   4741  C CG2 . THR B 1 179 ? -25.778 9.050   -50.834  1.00 42.50  ? 234  THR B CG2 1 
ATOM   4742  N N   . ALA B 1 180 ? -28.402 6.496   -50.264  1.00 47.72  ? 235  ALA B N   1 
ATOM   4743  C CA  . ALA B 1 180 ? -29.521 6.536   -49.329  1.00 49.54  ? 235  ALA B CA  1 
ATOM   4744  C C   . ALA B 1 180 ? -29.297 5.542   -48.204  1.00 50.10  ? 235  ALA B C   1 
ATOM   4745  O O   . ALA B 1 180 ? -29.433 5.888   -47.029  1.00 52.38  ? 235  ALA B O   1 
ATOM   4746  C CB  . ALA B 1 180 ? -30.822 6.241   -50.038  1.00 48.88  ? 235  ALA B CB  1 
ATOM   4747  N N   . ILE B 1 181 ? -28.947 4.309   -48.565  1.00 51.74  ? 236  ILE B N   1 
ATOM   4748  C CA  . ILE B 1 181 ? -28.691 3.269   -47.564  1.00 50.44  ? 236  ILE B CA  1 
ATOM   4749  C C   . ILE B 1 181 ? -27.635 3.705   -46.549  1.00 44.80  ? 236  ILE B C   1 
ATOM   4750  O O   . ILE B 1 181 ? -27.847 3.628   -45.338  1.00 37.23  ? 236  ILE B O   1 
ATOM   4751  C CB  . ILE B 1 181 ? -28.220 1.963   -48.215  1.00 44.85  ? 236  ILE B CB  1 
ATOM   4752  C CG1 . ILE B 1 181 ? -29.130 1.592   -49.383  1.00 42.76  ? 236  ILE B CG1 1 
ATOM   4753  C CG2 . ILE B 1 181 ? -28.159 0.841   -47.185  1.00 36.94  ? 236  ILE B CG2 1 
ATOM   4754  C CD1 . ILE B 1 181 ? -28.639 0.397   -50.164  1.00 45.70  ? 236  ILE B CD1 1 
ATOM   4755  N N   . ALA B 1 182 ? -26.492 4.148   -47.057  1.00 51.11  ? 237  ALA B N   1 
ATOM   4756  C CA  . ALA B 1 182 ? -25.411 4.622   -46.201  1.00 50.22  ? 237  ALA B CA  1 
ATOM   4757  C C   . ALA B 1 182 ? -25.861 5.759   -45.298  1.00 60.69  ? 237  ALA B C   1 
ATOM   4758  O O   . ALA B 1 182 ? -25.950 5.600   -44.083  1.00 67.39  ? 237  ALA B O   1 
ATOM   4759  C CB  . ALA B 1 182 ? -24.227 5.068   -47.043  1.00 46.84  ? 237  ALA B CB  1 
ATOM   4760  N N   . ALA B 1 183 ? -26.149 6.905   -45.910  1.00 63.68  ? 238  ALA B N   1 
ATOM   4761  C CA  . ALA B 1 183 ? -26.437 8.142   -45.185  1.00 59.95  ? 238  ALA B CA  1 
ATOM   4762  C C   . ALA B 1 183 ? -27.776 8.149   -44.444  1.00 57.13  ? 238  ALA B C   1 
ATOM   4763  O O   . ALA B 1 183 ? -27.974 8.963   -43.542  1.00 56.24  ? 238  ALA B O   1 
ATOM   4764  C CB  . ALA B 1 183 ? -26.352 9.336   -46.125  1.00 53.52  ? 238  ALA B CB  1 
ATOM   4765  N N   . PHE B 1 184 ? -28.694 7.261   -44.812  1.00 53.11  ? 239  PHE B N   1 
ATOM   4766  C CA  . PHE B 1 184 ? -30.018 7.299   -44.199  1.00 52.39  ? 239  PHE B CA  1 
ATOM   4767  C C   . PHE B 1 184 ? -30.458 6.014   -43.509  1.00 54.21  ? 239  PHE B C   1 
ATOM   4768  O O   . PHE B 1 184 ? -30.512 5.956   -42.284  1.00 60.60  ? 239  PHE B O   1 
ATOM   4769  C CB  . PHE B 1 184 ? -31.080 7.717   -45.212  1.00 55.20  ? 239  PHE B CB  1 
ATOM   4770  C CG  . PHE B 1 184 ? -32.436 7.922   -44.606  1.00 55.75  ? 239  PHE B CG  1 
ATOM   4771  C CD1 . PHE B 1 184 ? -32.780 9.141   -44.051  1.00 53.31  ? 239  PHE B CD1 1 
ATOM   4772  C CD2 . PHE B 1 184 ? -33.365 6.895   -44.584  1.00 58.41  ? 239  PHE B CD2 1 
ATOM   4773  C CE1 . PHE B 1 184 ? -34.027 9.335   -43.490  1.00 53.81  ? 239  PHE B CE1 1 
ATOM   4774  C CE2 . PHE B 1 184 ? -34.615 7.082   -44.026  1.00 57.90  ? 239  PHE B CE2 1 
ATOM   4775  C CZ  . PHE B 1 184 ? -34.947 8.305   -43.478  1.00 56.12  ? 239  PHE B CZ  1 
ATOM   4776  N N   . TYR B 1 185 ? -30.783 4.992   -44.294  1.00 53.06  ? 240  TYR B N   1 
ATOM   4777  C CA  . TYR B 1 185 ? -31.424 3.796   -43.755  1.00 50.74  ? 240  TYR B CA  1 
ATOM   4778  C C   . TYR B 1 185 ? -30.699 3.277   -42.525  1.00 49.70  ? 240  TYR B C   1 
ATOM   4779  O O   . TYR B 1 185 ? -31.294 3.088   -41.462  1.00 49.01  ? 240  TYR B O   1 
ATOM   4780  C CB  . TYR B 1 185 ? -31.476 2.703   -44.818  1.00 47.14  ? 240  TYR B CB  1 
ATOM   4781  C CG  . TYR B 1 185 ? -32.449 3.007   -45.925  1.00 53.84  ? 240  TYR B CG  1 
ATOM   4782  C CD1 . TYR B 1 185 ? -33.786 2.652   -45.810  1.00 57.07  ? 240  TYR B CD1 1 
ATOM   4783  C CD2 . TYR B 1 185 ? -32.038 3.662   -47.080  1.00 56.69  ? 240  TYR B CD2 1 
ATOM   4784  C CE1 . TYR B 1 185 ? -34.691 2.934   -46.817  1.00 58.45  ? 240  TYR B CE1 1 
ATOM   4785  C CE2 . TYR B 1 185 ? -32.935 3.948   -48.094  1.00 59.55  ? 240  TYR B CE2 1 
ATOM   4786  C CZ  . TYR B 1 185 ? -34.260 3.581   -47.955  1.00 63.83  ? 240  TYR B CZ  1 
ATOM   4787  O OH  . TYR B 1 185 ? -35.161 3.857   -48.953  1.00 69.86  ? 240  TYR B OH  1 
ATOM   4788  N N   . MET B 1 186 ? -29.397 3.082   -42.671  1.00 50.85  ? 241  MET B N   1 
ATOM   4789  C CA  . MET B 1 186 ? -28.590 2.538   -41.592  1.00 52.04  ? 241  MET B CA  1 
ATOM   4790  C C   . MET B 1 186 ? -28.596 3.415   -40.332  1.00 53.67  ? 241  MET B C   1 
ATOM   4791  O O   . MET B 1 186 ? -28.868 2.909   -39.244  1.00 58.08  ? 241  MET B O   1 
ATOM   4792  C CB  . MET B 1 186 ? -27.171 2.219   -42.077  1.00 53.63  ? 241  MET B CB  1 
ATOM   4793  C CG  . MET B 1 186 ? -26.219 1.833   -40.979  1.00 51.78  ? 241  MET B CG  1 
ATOM   4794  S SD  . MET B 1 186 ? -25.409 3.300   -40.323  1.00 52.75  ? 241  MET B SD  1 
ATOM   4795  C CE  . MET B 1 186 ? -23.911 3.340   -41.320  1.00 51.61  ? 241  MET B CE  1 
ATOM   4796  N N   . PRO B 1 187 ? -28.303 4.726   -40.465  1.00 51.84  ? 242  PRO B N   1 
ATOM   4797  C CA  . PRO B 1 187 ? -28.444 5.578   -39.277  1.00 52.25  ? 242  PRO B CA  1 
ATOM   4798  C C   . PRO B 1 187 ? -29.811 5.397   -38.617  1.00 53.48  ? 242  PRO B C   1 
ATOM   4799  O O   . PRO B 1 187 ? -29.937 5.393   -37.388  1.00 53.37  ? 242  PRO B O   1 
ATOM   4800  C CB  . PRO B 1 187 ? -28.312 6.990   -39.850  1.00 47.32  ? 242  PRO B CB  1 
ATOM   4801  C CG  . PRO B 1 187 ? -27.401 6.820   -41.013  1.00 53.08  ? 242  PRO B CG  1 
ATOM   4802  C CD  . PRO B 1 187 ? -27.759 5.475   -41.613  1.00 54.32  ? 242  PRO B CD  1 
ATOM   4803  N N   . VAL B 1 188 ? -30.834 5.226   -39.441  1.00 50.35  ? 243  VAL B N   1 
ATOM   4804  C CA  . VAL B 1 188 ? -32.179 5.053   -38.924  1.00 52.88  ? 243  VAL B CA  1 
ATOM   4805  C C   . VAL B 1 188 ? -32.331 3.791   -38.083  1.00 57.12  ? 243  VAL B C   1 
ATOM   4806  O O   . VAL B 1 188 ? -32.730 3.872   -36.918  1.00 59.52  ? 243  VAL B O   1 
ATOM   4807  C CB  . VAL B 1 188 ? -33.215 5.027   -40.044  1.00 54.10  ? 243  VAL B CB  1 
ATOM   4808  C CG1 . VAL B 1 188 ? -34.585 4.717   -39.470  1.00 52.42  ? 243  VAL B CG1 1 
ATOM   4809  C CG2 . VAL B 1 188 ? -33.222 6.359   -40.773  1.00 58.29  ? 243  VAL B CG2 1 
ATOM   4810  N N   . THR B 1 189 ? -32.015 2.633   -38.667  1.00 58.08  ? 244  THR B N   1 
ATOM   4811  C CA  . THR B 1 189 ? -32.188 1.353   -37.962  1.00 62.93  ? 244  THR B CA  1 
ATOM   4812  C C   . THR B 1 189 ? -31.251 1.206   -36.752  1.00 58.83  ? 244  THR B C   1 
ATOM   4813  O O   . THR B 1 189 ? -31.597 0.557   -35.756  1.00 59.08  ? 244  THR B O   1 
ATOM   4814  C CB  . THR B 1 189 ? -32.103 0.123   -38.905  1.00 53.13  ? 244  THR B CB  1 
ATOM   4815  O OG1 . THR B 1 189 ? -30.755 -0.055  -39.355  1.00 48.26  ? 244  THR B OG1 1 
ATOM   4816  C CG2 . THR B 1 189 ? -33.050 0.292   -40.100  1.00 44.76  ? 244  THR B CG2 1 
ATOM   4817  N N   . ILE B 1 190 ? -30.069 1.810   -36.833  1.00 52.65  ? 245  ILE B N   1 
ATOM   4818  C CA  . ILE B 1 190 ? -29.212 1.889   -35.660  1.00 41.83  ? 245  ILE B CA  1 
ATOM   4819  C C   . ILE B 1 190 ? -29.917 2.676   -34.563  1.00 47.69  ? 245  ILE B C   1 
ATOM   4820  O O   . ILE B 1 190 ? -30.039 2.199   -33.434  1.00 50.45  ? 245  ILE B O   1 
ATOM   4821  C CB  . ILE B 1 190 ? -27.868 2.550   -35.957  1.00 46.22  ? 245  ILE B CB  1 
ATOM   4822  C CG1 . ILE B 1 190 ? -26.879 1.510   -36.466  1.00 60.74  ? 245  ILE B CG1 1 
ATOM   4823  C CG2 . ILE B 1 190 ? -27.303 3.175   -34.708  1.00 43.94  ? 245  ILE B CG2 1 
ATOM   4824  C CD1 . ILE B 1 190 ? -25.444 2.016   -36.529  1.00 72.72  ? 245  ILE B CD1 1 
ATOM   4825  N N   . MET B 1 191 ? -30.388 3.877   -34.894  1.00 52.60  ? 246  MET B N   1 
ATOM   4826  C CA  . MET B 1 191 ? -31.053 4.714   -33.897  1.00 57.64  ? 246  MET B CA  1 
ATOM   4827  C C   . MET B 1 191 ? -32.320 4.070   -33.343  1.00 56.89  ? 246  MET B C   1 
ATOM   4828  O O   . MET B 1 191 ? -32.782 4.433   -32.263  1.00 55.54  ? 246  MET B O   1 
ATOM   4829  C CB  . MET B 1 191 ? -31.345 6.113   -34.452  1.00 57.99  ? 246  MET B CB  1 
ATOM   4830  C CG  . MET B 1 191 ? -30.120 7.014   -34.519  1.00 58.57  ? 246  MET B CG  1 
ATOM   4831  S SD  . MET B 1 191 ? -30.478 8.635   -35.206  1.00 59.65  ? 246  MET B SD  1 
ATOM   4832  C CE  . MET B 1 191 ? -31.133 8.183   -36.814  1.00 52.01  ? 246  MET B CE  1 
ATOM   4833  N N   . THR B 1 192 ? -32.898 3.148   -34.110  1.00 55.18  ? 247  THR B N   1 
ATOM   4834  C CA  . THR B 1 192 ? -34.068 2.388   -33.672  1.00 52.87  ? 247  THR B CA  1 
ATOM   4835  C C   . THR B 1 192 ? -33.719 1.281   -32.684  1.00 53.06  ? 247  THR B C   1 
ATOM   4836  O O   . THR B 1 192 ? -34.273 1.205   -31.579  1.00 55.29  ? 247  THR B O   1 
ATOM   4837  C CB  . THR B 1 192 ? -34.772 1.749   -34.872  1.00 48.57  ? 247  THR B CB  1 
ATOM   4838  O OG1 . THR B 1 192 ? -35.282 2.782   -35.722  1.00 49.07  ? 247  THR B OG1 1 
ATOM   4839  C CG2 . THR B 1 192 ? -35.910 0.851   -34.412  1.00 47.52  ? 247  THR B CG2 1 
ATOM   4840  N N   . ILE B 1 193 ? -32.776 0.438   -33.086  1.00 49.30  ? 248  ILE B N   1 
ATOM   4841  C CA  . ILE B 1 193 ? -32.346 -0.672  -32.249  1.00 54.13  ? 248  ILE B CA  1 
ATOM   4842  C C   . ILE B 1 193 ? -31.724 -0.147  -30.959  1.00 55.61  ? 248  ILE B C   1 
ATOM   4843  O O   . ILE B 1 193 ? -31.755 -0.819  -29.927  1.00 50.88  ? 248  ILE B O   1 
ATOM   4844  C CB  . ILE B 1 193 ? -31.360 -1.578  -33.000  1.00 51.12  ? 248  ILE B CB  1 
ATOM   4845  C CG1 . ILE B 1 193 ? -31.966 -2.005  -34.340  1.00 50.15  ? 248  ILE B CG1 1 
ATOM   4846  C CG2 . ILE B 1 193 ? -31.008 -2.793  -32.165  1.00 56.87  ? 248  ILE B CG2 1 
ATOM   4847  C CD1 . ILE B 1 193 ? -31.014 -2.765  -35.223  1.00 52.00  ? 248  ILE B CD1 1 
ATOM   4848  N N   . LEU B 1 194 ? -31.155 1.056   -31.028  1.00 59.07  ? 249  LEU B N   1 
ATOM   4849  C CA  . LEU B 1 194 ? -30.645 1.739   -29.839  1.00 65.19  ? 249  LEU B CA  1 
ATOM   4850  C C   . LEU B 1 194 ? -31.763 2.377   -29.019  1.00 67.63  ? 249  LEU B C   1 
ATOM   4851  O O   . LEU B 1 194 ? -31.844 2.195   -27.801  1.00 69.83  ? 249  LEU B O   1 
ATOM   4852  C CB  . LEU B 1 194 ? -29.629 2.821   -30.216  1.00 58.72  ? 249  LEU B CB  1 
ATOM   4853  C CG  . LEU B 1 194 ? -28.231 2.399   -30.662  1.00 55.54  ? 249  LEU B CG  1 
ATOM   4854  C CD1 . LEU B 1 194 ? -27.392 3.633   -30.925  1.00 62.86  ? 249  LEU B CD1 1 
ATOM   4855  C CD2 . LEU B 1 194 ? -27.572 1.532   -29.616  1.00 57.23  ? 249  LEU B CD2 1 
ATOM   4856  N N   . TYR B 1 195 ? -32.628 3.124   -29.694  1.00 68.01  ? 250  TYR B N   1 
ATOM   4857  C CA  . TYR B 1 195 ? -33.687 3.853   -29.011  1.00 70.85  ? 250  TYR B CA  1 
ATOM   4858  C C   . TYR B 1 195 ? -34.555 2.898   -28.202  1.00 69.84  ? 250  TYR B C   1 
ATOM   4859  O O   . TYR B 1 195 ? -35.051 3.263   -27.136  1.00 69.10  ? 250  TYR B O   1 
ATOM   4860  C CB  . TYR B 1 195 ? -34.529 4.665   -30.003  1.00 68.17  ? 250  TYR B CB  1 
ATOM   4861  C CG  . TYR B 1 195 ? -35.807 5.224   -29.417  1.00 67.69  ? 250  TYR B CG  1 
ATOM   4862  C CD1 . TYR B 1 195 ? -35.833 6.469   -28.803  1.00 64.48  ? 250  TYR B CD1 1 
ATOM   4863  C CD2 . TYR B 1 195 ? -36.989 4.502   -29.480  1.00 74.57  ? 250  TYR B CD2 1 
ATOM   4864  C CE1 . TYR B 1 195 ? -37.006 6.975   -28.267  1.00 66.65  ? 250  TYR B CE1 1 
ATOM   4865  C CE2 . TYR B 1 195 ? -38.159 4.997   -28.951  1.00 75.59  ? 250  TYR B CE2 1 
ATOM   4866  C CZ  . TYR B 1 195 ? -38.165 6.231   -28.346  1.00 71.56  ? 250  TYR B CZ  1 
ATOM   4867  O OH  . TYR B 1 195 ? -39.342 6.710   -27.824  1.00 77.47  ? 250  TYR B OH  1 
ATOM   4868  N N   . TRP B 1 196 ? -34.724 1.673   -28.699  1.00 69.51  ? 251  TRP B N   1 
ATOM   4869  C CA  . TRP B 1 196 ? -35.515 0.679   -27.973  1.00 72.35  ? 251  TRP B CA  1 
ATOM   4870  C C   . TRP B 1 196 ? -34.798 0.137   -26.727  1.00 72.55  ? 251  TRP B C   1 
ATOM   4871  O O   . TRP B 1 196 ? -35.441 -0.266  -25.755  1.00 72.48  ? 251  TRP B O   1 
ATOM   4872  C CB  . TRP B 1 196 ? -35.972 -0.458  -28.893  1.00 69.42  ? 251  TRP B CB  1 
ATOM   4873  C CG  . TRP B 1 196 ? -37.055 -0.061  -29.853  1.00 65.04  ? 251  TRP B CG  1 
ATOM   4874  C CD1 . TRP B 1 196 ? -37.132 -0.382  -31.179  1.00 72.89  ? 251  TRP B CD1 1 
ATOM   4875  C CD2 . TRP B 1 196 ? -38.214 0.732   -29.566  1.00 69.65  ? 251  TRP B CD2 1 
ATOM   4876  N NE1 . TRP B 1 196 ? -38.268 0.156   -31.732  1.00 84.18  ? 251  TRP B NE1 1 
ATOM   4877  C CE2 . TRP B 1 196 ? -38.951 0.848   -30.762  1.00 83.05  ? 251  TRP B CE2 1 
ATOM   4878  C CE3 . TRP B 1 196 ? -38.704 1.357   -28.413  1.00 67.30  ? 251  TRP B CE3 1 
ATOM   4879  C CZ2 . TRP B 1 196 ? -40.149 1.564   -30.842  1.00 85.17  ? 251  TRP B CZ2 1 
ATOM   4880  C CZ3 . TRP B 1 196 ? -39.893 2.065   -28.491  1.00 68.89  ? 251  TRP B CZ3 1 
ATOM   4881  C CH2 . TRP B 1 196 ? -40.602 2.163   -29.696  1.00 76.00  ? 251  TRP B CH2 1 
ATOM   4882  N N   . ARG B 1 197 ? -33.470 0.129   -26.753  1.00 66.39  ? 252  ARG B N   1 
ATOM   4883  C CA  . ARG B 1 197 ? -32.703 -0.266  -25.576  1.00 67.05  ? 252  ARG B CA  1 
ATOM   4884  C C   . ARG B 1 197 ? -32.740 0.848   -24.533  1.00 70.35  ? 252  ARG B C   1 
ATOM   4885  O O   . ARG B 1 197 ? -32.863 0.588   -23.337  1.00 73.62  ? 252  ARG B O   1 
ATOM   4886  C CB  . ARG B 1 197 ? -31.257 -0.603  -25.948  1.00 65.56  ? 252  ARG B CB  1 
ATOM   4887  N N   . ILE B 1 198 ? -32.643 2.090   -24.998  1.00 73.77  ? 253  ILE B N   1 
ATOM   4888  C CA  . ILE B 1 198 ? -32.741 3.261   -24.128  1.00 70.68  ? 253  ILE B CA  1 
ATOM   4889  C C   . ILE B 1 198 ? -34.117 3.347   -23.478  1.00 69.60  ? 253  ILE B C   1 
ATOM   4890  O O   . ILE B 1 198 ? -34.249 3.740   -22.325  1.00 67.41  ? 253  ILE B O   1 
ATOM   4891  C CB  . ILE B 1 198 ? -32.483 4.558   -24.914  1.00 65.57  ? 253  ILE B CB  1 
ATOM   4892  C CG1 . ILE B 1 198 ? -31.084 4.531   -25.535  1.00 67.40  ? 253  ILE B CG1 1 
ATOM   4893  C CG2 . ILE B 1 198 ? -32.661 5.771   -24.014  1.00 64.22  ? 253  ILE B CG2 1 
ATOM   4894  C CD1 . ILE B 1 198 ? -30.858 5.604   -26.572  1.00 68.14  ? 253  ILE B CD1 1 
ATOM   4895  N N   . TYR B 1 199 ? -35.144 2.986   -24.236  1.00 76.81  ? 254  TYR B N   1 
ATOM   4896  C CA  . TYR B 1 199 ? -36.506 2.949   -23.721  1.00 76.03  ? 254  TYR B CA  1 
ATOM   4897  C C   . TYR B 1 199 ? -36.637 1.820   -22.700  1.00 77.59  ? 254  TYR B C   1 
ATOM   4898  O O   . TYR B 1 199 ? -37.074 2.051   -21.573  1.00 75.71  ? 254  TYR B O   1 
ATOM   4899  C CB  . TYR B 1 199 ? -37.493 2.772   -24.881  1.00 76.95  ? 254  TYR B CB  1 
ATOM   4900  C CG  . TYR B 1 199 ? -38.966 2.890   -24.539  1.00 84.48  ? 254  TYR B CG  1 
ATOM   4901  C CD1 . TYR B 1 199 ? -39.604 4.125   -24.522  1.00 90.18  ? 254  TYR B CD1 1 
ATOM   4902  C CD2 . TYR B 1 199 ? -39.729 1.759   -24.276  1.00 91.31  ? 254  TYR B CD2 1 
ATOM   4903  C CE1 . TYR B 1 199 ? -40.961 4.232   -24.228  1.00 99.04  ? 254  TYR B CE1 1 
ATOM   4904  C CE2 . TYR B 1 199 ? -41.085 1.854   -23.983  1.00 96.44  ? 254  TYR B CE2 1 
ATOM   4905  C CZ  . TYR B 1 199 ? -41.696 3.092   -23.961  1.00 100.34 ? 254  TYR B CZ  1 
ATOM   4906  O OH  . TYR B 1 199 ? -43.040 3.184   -23.670  1.00 94.51  ? 254  TYR B OH  1 
ATOM   4907  N N   . LYS B 1 200 ? -36.226 0.611   -23.087  1.00 78.99  ? 255  LYS B N   1 
ATOM   4908  C CA  . LYS B 1 200 ? -36.405 -0.591  -22.258  1.00 81.78  ? 255  LYS B CA  1 
ATOM   4909  C C   . LYS B 1 200 ? -35.855 -0.452  -20.838  1.00 80.07  ? 255  LYS B C   1 
ATOM   4910  O O   . LYS B 1 200 ? -36.576 -0.677  -19.866  1.00 83.03  ? 255  LYS B O   1 
ATOM   4911  C CB  . LYS B 1 200 ? -35.793 -1.820  -22.944  1.00 84.50  ? 255  LYS B CB  1 
ATOM   4912  C CG  . LYS B 1 200 ? -36.191 -3.171  -22.342  1.00 80.92  ? 255  LYS B CG  1 
ATOM   4913  C CD  . LYS B 1 200 ? -36.565 -4.152  -23.447  1.00 81.18  ? 255  LYS B CD  1 
ATOM   4914  C CE  . LYS B 1 200 ? -35.493 -4.193  -24.540  1.00 77.40  ? 255  LYS B CE  1 
ATOM   4915  N NZ  . LYS B 1 200 ? -35.939 -4.854  -25.800  1.00 47.33  ? 255  LYS B NZ  1 
ATOM   4916  N N   . GLU B 1 201 ? -34.580 -0.102  -20.712  1.00 82.52  ? 256  GLU B N   1 
ATOM   4917  C CA  . GLU B 1 201 ? -34.015 0.128   -19.390  1.00 88.66  ? 256  GLU B CA  1 
ATOM   4918  C C   . GLU B 1 201 ? -33.439 1.538   -19.231  1.00 87.35  ? 256  GLU B C   1 
ATOM   4919  O O   . GLU B 1 201 ? -32.370 1.860   -19.767  1.00 76.39  ? 256  GLU B O   1 
ATOM   4920  C CB  . GLU B 1 201 ? -32.945 -0.924  -19.094  1.00 90.40  ? 256  GLU B CB  1 
ATOM   4921  N N   . THR B 1 202 ? -34.161 2.367   -18.480  1.00 85.41  ? 257  THR B N   1 
ATOM   4922  C CA  . THR B 1 202 ? -33.670 3.657   -18.016  1.00 82.95  ? 257  THR B CA  1 
ATOM   4923  C C   . THR B 1 202 ? -33.241 3.508   -16.568  1.00 84.63  ? 257  THR B C   1 
ATOM   4924  O O   . THR B 1 202 ? -32.684 4.424   -15.969  1.00 83.31  ? 257  THR B O   1 
ATOM   4925  C CB  . THR B 1 202 ? -34.773 4.726   -18.095  1.00 89.28  ? 257  THR B CB  1 
ATOM   4926  O OG1 . THR B 1 202 ? -35.257 4.824   -19.440  1.00 95.42  ? 257  THR B OG1 1 
ATOM   4927  C CG2 . THR B 1 202 ? -34.246 6.082   -17.655  1.00 88.12  ? 257  THR B CG2 1 
ATOM   4928  N N   . GLU B 1 203 ? -33.488 2.320   -16.029  1.00 89.83  ? 258  GLU B N   1 
ATOM   4929  C CA  . GLU B 1 203 ? -33.362 2.052   -14.602  1.00 91.53  ? 258  GLU B CA  1 
ATOM   4930  C C   . GLU B 1 203 ? -31.912 2.025   -14.115  1.00 87.63  ? 258  GLU B C   1 
ATOM   4931  O O   . GLU B 1 203 ? -31.566 2.645   -13.101  1.00 83.84  ? 258  GLU B O   1 
ATOM   4932  C CB  . GLU B 1 203 ? -34.041 0.720   -14.275  1.00 95.59  ? 258  GLU B CB  1 
ATOM   4933  C CG  . GLU B 1 203 ? -33.461 -0.471  -15.043  1.00 102.85 ? 258  GLU B CG  1 
ATOM   4934  C CD  . GLU B 1 203 ? -34.041 -1.804  -14.599  1.00 114.27 ? 258  GLU B CD  1 
ATOM   4935  O OE1 . GLU B 1 203 ? -33.273 -2.655  -14.094  1.00 110.54 ? 258  GLU B OE1 1 
ATOM   4936  O OE2 . GLU B 1 203 ? -35.264 -2.003  -14.761  1.00 122.12 ? 258  GLU B OE2 1 
ATOM   4937  N N   . LYS B 1 204 ? -31.072 1.292   -14.836  1.00 78.16  ? 259  LYS B N   1 
ATOM   4938  C CA  . LYS B 1 204 ? -29.683 1.128   -14.443  1.00 78.10  ? 259  LYS B CA  1 
ATOM   4939  C C   . LYS B 1 204 ? -28.993 2.481   -14.308  1.00 83.44  ? 259  LYS B C   1 
ATOM   4940  O O   . LYS B 1 204 ? -27.998 2.615   -13.592  1.00 87.41  ? 259  LYS B O   1 
ATOM   4941  C CB  . LYS B 1 204 ? -28.952 0.235   -15.443  1.00 81.18  ? 259  LYS B CB  1 
ATOM   4942  C CG  . LYS B 1 204 ? -29.697 -1.055  -15.745  1.00 82.19  ? 259  LYS B CG  1 
ATOM   4943  C CD  . LYS B 1 204 ? -28.760 -2.107  -16.308  1.00 88.43  ? 259  LYS B CD  1 
ATOM   4944  C CE  . LYS B 1 204 ? -29.452 -3.449  -16.457  1.00 93.33  ? 259  LYS B CE  1 
ATOM   4945  N NZ  . LYS B 1 204 ? -28.469 -4.521  -16.764  1.00 99.16  ? 259  LYS B NZ  1 
ATOM   4946  N N   . MET B 1 205 ? -29.533 3.484   -14.994  1.00 80.93  ? 1001 MET B N   1 
ATOM   4947  C CA  . MET B 1 205 ? -29.050 4.853   -14.865  1.00 84.28  ? 1001 MET B CA  1 
ATOM   4948  C C   . MET B 1 205 ? -28.918 5.247   -13.390  1.00 83.88  ? 1001 MET B C   1 
ATOM   4949  O O   . MET B 1 205 ? -27.813 5.429   -12.877  1.00 80.44  ? 1001 MET B O   1 
ATOM   4950  C CB  . MET B 1 205 ? -30.005 5.809   -15.592  1.00 82.08  ? 1001 MET B CB  1 
ATOM   4951  C CG  . MET B 1 205 ? -29.687 7.289   -15.421  1.00 84.96  ? 1001 MET B CG  1 
ATOM   4952  S SD  . MET B 1 205 ? -28.498 7.908   -16.626  1.00 90.78  ? 1001 MET B SD  1 
ATOM   4953  C CE  . MET B 1 205 ? -29.483 7.860   -18.116  1.00 77.81  ? 1001 MET B CE  1 
ATOM   4954  N N   . ASN B 1 206 ? -30.058 5.369   -12.717  1.00 80.16  ? 1002 ASN B N   1 
ATOM   4955  C CA  . ASN B 1 206 ? -30.104 5.774   -11.315  1.00 71.55  ? 1002 ASN B CA  1 
ATOM   4956  C C   . ASN B 1 206 ? -29.747 4.651   -10.346  1.00 69.48  ? 1002 ASN B C   1 
ATOM   4957  O O   . ASN B 1 206 ? -28.961 4.848   -9.410   1.00 66.00  ? 1002 ASN B O   1 
ATOM   4958  C CB  . ASN B 1 206 ? -31.485 6.339   -10.981  1.00 74.50  ? 1002 ASN B CB  1 
ATOM   4959  C CG  . ASN B 1 206 ? -31.805 7.597   -11.773  1.00 79.60  ? 1002 ASN B CG  1 
ATOM   4960  O OD1 . ASN B 1 206 ? -31.074 8.589   -11.708  1.00 81.40  ? 1002 ASN B OD1 1 
ATOM   4961  N ND2 . ASN B 1 206 ? -32.893 7.559   -12.534  1.00 74.67  ? 1002 ASN B ND2 1 
ATOM   4962  N N   . ILE B 1 207 ? -30.320 3.469   -10.571  1.00 72.53  ? 1003 ILE B N   1 
ATOM   4963  C CA  . ILE B 1 207 ? -30.073 2.339   -9.671   1.00 75.43  ? 1003 ILE B CA  1 
ATOM   4964  C C   . ILE B 1 207 ? -28.582 2.018   -9.615   1.00 69.74  ? 1003 ILE B C   1 
ATOM   4965  O O   . ILE B 1 207 ? -28.074 1.504   -8.612   1.00 64.59  ? 1003 ILE B O   1 
ATOM   4966  C CB  . ILE B 1 207 ? -30.867 1.068   -10.059  1.00 67.94  ? 1003 ILE B CB  1 
ATOM   4967  C CG1 . ILE B 1 207 ? -30.069 0.215   -11.046  1.00 66.23  ? 1003 ILE B CG1 1 
ATOM   4968  C CG2 . ILE B 1 207 ? -32.252 1.438   -10.582  1.00 60.62  ? 1003 ILE B CG2 1 
ATOM   4969  C CD1 . ILE B 1 207 ? -30.454 -1.248  -11.031  1.00 69.31  ? 1003 ILE B CD1 1 
ATOM   4970  N N   . PHE B 1 208 ? -27.881 2.327   -10.700  1.00 71.49  ? 1004 PHE B N   1 
ATOM   4971  C CA  . PHE B 1 208 ? -26.436 2.273   -10.668  1.00 72.50  ? 1004 PHE B CA  1 
ATOM   4972  C C   . PHE B 1 208 ? -25.990 3.140   -9.515   1.00 73.37  ? 1004 PHE B C   1 
ATOM   4973  O O   . PHE B 1 208 ? -25.436 2.641   -8.545   1.00 73.93  ? 1004 PHE B O   1 
ATOM   4974  C CB  . PHE B 1 208 ? -25.802 2.800   -11.951  1.00 73.41  ? 1004 PHE B CB  1 
ATOM   4975  C CG  . PHE B 1 208 ? -24.310 2.959   -11.851  1.00 71.35  ? 1004 PHE B CG  1 
ATOM   4976  C CD1 . PHE B 1 208 ? -23.469 1.874   -12.054  1.00 68.52  ? 1004 PHE B CD1 1 
ATOM   4977  C CD2 . PHE B 1 208 ? -23.749 4.183   -11.526  1.00 69.89  ? 1004 PHE B CD2 1 
ATOM   4978  C CE1 . PHE B 1 208 ? -22.101 2.010   -11.950  1.00 63.68  ? 1004 PHE B CE1 1 
ATOM   4979  C CE2 . PHE B 1 208 ? -22.379 4.324   -11.422  1.00 70.20  ? 1004 PHE B CE2 1 
ATOM   4980  C CZ  . PHE B 1 208 ? -21.556 3.235   -11.632  1.00 67.74  ? 1004 PHE B CZ  1 
ATOM   4981  N N   . GLU B 1 209 ? -26.267 4.438   -9.617   1.00 73.16  ? 1005 GLU B N   1 
ATOM   4982  C CA  . GLU B 1 209 ? -25.821 5.401   -8.618   1.00 75.20  ? 1005 GLU B CA  1 
ATOM   4983  C C   . GLU B 1 209 ? -26.107 4.873   -7.214   1.00 77.01  ? 1005 GLU B C   1 
ATOM   4984  O O   . GLU B 1 209 ? -25.290 5.030   -6.296   1.00 77.00  ? 1005 GLU B O   1 
ATOM   4985  C CB  . GLU B 1 209 ? -26.515 6.751   -8.826   1.00 77.93  ? 1005 GLU B CB  1 
ATOM   4986  C CG  . GLU B 1 209 ? -26.612 7.194   -10.280  1.00 79.37  ? 1005 GLU B CG  1 
ATOM   4987  C CD  . GLU B 1 209 ? -26.941 8.672   -10.423  1.00 84.73  ? 1005 GLU B CD  1 
ATOM   4988  O OE1 . GLU B 1 209 ? -27.603 9.051   -11.414  1.00 77.35  ? 1005 GLU B OE1 1 
ATOM   4989  O OE2 . GLU B 1 209 ? -26.530 9.456   -9.541   1.00 88.00  ? 1005 GLU B OE2 1 
ATOM   4990  N N   . MET B 1 210 ? -27.264 4.232   -7.057   1.00 72.82  ? 1006 MET B N   1 
ATOM   4991  C CA  . MET B 1 210 ? -27.637 3.644   -5.773   1.00 66.59  ? 1006 MET B CA  1 
ATOM   4992  C C   . MET B 1 210 ? -26.678 2.545   -5.307   1.00 66.08  ? 1006 MET B C   1 
ATOM   4993  O O   . MET B 1 210 ? -26.082 2.639   -4.227   1.00 62.59  ? 1006 MET B O   1 
ATOM   4994  C CB  . MET B 1 210 ? -29.056 3.094   -5.840   1.00 59.22  ? 1006 MET B CB  1 
ATOM   4995  C CG  . MET B 1 210 ? -29.450 2.281   -4.636   1.00 59.18  ? 1006 MET B CG  1 
ATOM   4996  S SD  . MET B 1 210 ? -31.221 1.981   -4.605   1.00 85.86  ? 1006 MET B SD  1 
ATOM   4997  C CE  . MET B 1 210 ? -31.436 1.406   -2.922   1.00 73.34  ? 1006 MET B CE  1 
ATOM   4998  N N   . LEU B 1 211 ? -26.525 1.508   -6.125   1.00 61.99  ? 1007 LEU B N   1 
ATOM   4999  C CA  . LEU B 1 211 ? -25.675 0.384   -5.751   1.00 63.14  ? 1007 LEU B CA  1 
ATOM   5000  C C   . LEU B 1 211 ? -24.203 0.767   -5.669   1.00 65.76  ? 1007 LEU B C   1 
ATOM   5001  O O   . LEU B 1 211 ? -23.411 0.066   -5.050   1.00 68.80  ? 1007 LEU B O   1 
ATOM   5002  C CB  . LEU B 1 211 ? -25.870 -0.779  -6.717   1.00 64.93  ? 1007 LEU B CB  1 
ATOM   5003  C CG  . LEU B 1 211 ? -27.220 -1.483  -6.591   1.00 66.85  ? 1007 LEU B CG  1 
ATOM   5004  C CD1 . LEU B 1 211 ? -27.363 -2.558  -7.644   1.00 73.56  ? 1007 LEU B CD1 1 
ATOM   5005  C CD2 . LEU B 1 211 ? -27.372 -2.076  -5.210   1.00 65.95  ? 1007 LEU B CD2 1 
ATOM   5006  N N   . ARG B 1 212 ? -23.846 1.875   -6.311   1.00 68.52  ? 1008 ARG B N   1 
ATOM   5007  C CA  . ARG B 1 212 ? -22.482 2.398   -6.281   1.00 68.27  ? 1008 ARG B CA  1 
ATOM   5008  C C   . ARG B 1 212 ? -22.209 3.117   -4.975   1.00 69.50  ? 1008 ARG B C   1 
ATOM   5009  O O   . ARG B 1 212 ? -21.191 2.885   -4.329   1.00 66.91  ? 1008 ARG B O   1 
ATOM   5010  C CB  . ARG B 1 212 ? -22.249 3.373   -7.435   1.00 68.83  ? 1008 ARG B CB  1 
ATOM   5011  C CG  . ARG B 1 212 ? -21.024 4.268   -7.254   1.00 69.88  ? 1008 ARG B CG  1 
ATOM   5012  C CD  . ARG B 1 212 ? -19.733 3.478   -7.377   1.00 69.42  ? 1008 ARG B CD  1 
ATOM   5013  N NE  . ARG B 1 212 ? -18.544 4.318   -7.268   1.00 63.03  ? 1008 ARG B NE  1 
ATOM   5014  C CZ  . ARG B 1 212 ? -17.939 4.607   -6.121   1.00 72.30  ? 1008 ARG B CZ  1 
ATOM   5015  N NH1 . ARG B 1 212 ? -18.413 4.133   -4.978   1.00 74.89  ? 1008 ARG B NH1 1 
ATOM   5016  N NH2 . ARG B 1 212 ? -16.859 5.374   -6.115   1.00 79.45  ? 1008 ARG B NH2 1 
ATOM   5017  N N   . ILE B 1 213 ? -23.124 3.999   -4.590   1.00 71.64  ? 1009 ILE B N   1 
ATOM   5018  C CA  . ILE B 1 213 ? -22.983 4.703   -3.324   1.00 74.25  ? 1009 ILE B CA  1 
ATOM   5019  C C   . ILE B 1 213 ? -22.979 3.683   -2.188   1.00 72.30  ? 1009 ILE B C   1 
ATOM   5020  O O   . ILE B 1 213 ? -22.045 3.635   -1.381   1.00 62.32  ? 1009 ILE B O   1 
ATOM   5021  C CB  . ILE B 1 213 ? -24.115 5.730   -3.119   1.00 68.20  ? 1009 ILE B CB  1 
ATOM   5022  C CG1 . ILE B 1 213 ? -24.087 6.777   -4.235   1.00 65.48  ? 1009 ILE B CG1 1 
ATOM   5023  C CG2 . ILE B 1 213 ? -23.995 6.395   -1.753   1.00 63.14  ? 1009 ILE B CG2 1 
ATOM   5024  C CD1 . ILE B 1 213 ? -25.287 7.699   -4.247   1.00 71.02  ? 1009 ILE B CD1 1 
ATOM   5025  N N   . ASP B 1 214 ? -24.027 2.863   -2.149   1.00 73.28  ? 1010 ASP B N   1 
ATOM   5026  C CA  . ASP B 1 214 ? -24.177 1.820   -1.140   1.00 71.26  ? 1010 ASP B CA  1 
ATOM   5027  C C   . ASP B 1 214 ? -23.017 0.839   -1.122   1.00 70.39  ? 1010 ASP B C   1 
ATOM   5028  O O   . ASP B 1 214 ? -22.269 0.747   -0.147   1.00 68.25  ? 1010 ASP B O   1 
ATOM   5029  C CB  . ASP B 1 214 ? -25.468 1.045   -1.388   1.00 69.27  ? 1010 ASP B CB  1 
ATOM   5030  C CG  . ASP B 1 214 ? -26.666 1.691   -0.739   1.00 68.43  ? 1010 ASP B CG  1 
ATOM   5031  O OD1 . ASP B 1 214 ? -26.523 2.805   -0.198   1.00 67.32  ? 1010 ASP B OD1 1 
ATOM   5032  O OD2 . ASP B 1 214 ? -27.752 1.081   -0.770   1.00 68.12  ? 1010 ASP B OD2 1 
ATOM   5033  N N   . GLU B 1 215 ? -22.896 0.097   -2.215   1.00 70.03  ? 1011 GLU B N   1 
ATOM   5034  C CA  . GLU B 1 215 ? -21.930 -0.983  -2.330   1.00 73.35  ? 1011 GLU B CA  1 
ATOM   5035  C C   . GLU B 1 215 ? -20.491 -0.482  -2.430   1.00 69.37  ? 1011 GLU B C   1 
ATOM   5036  O O   . GLU B 1 215 ? -19.576 -1.080  -1.865   1.00 68.30  ? 1011 GLU B O   1 
ATOM   5037  C CB  . GLU B 1 215 ? -22.270 -1.844  -3.545   1.00 80.39  ? 1011 GLU B CB  1 
ATOM   5038  C CG  . GLU B 1 215 ? -21.426 -3.091  -3.664   1.00 87.62  ? 1011 GLU B CG  1 
ATOM   5039  C CD  . GLU B 1 215 ? -21.758 -4.122  -2.606   1.00 87.73  ? 1011 GLU B CD  1 
ATOM   5040  O OE1 . GLU B 1 215 ? -22.914 -4.135  -2.131   1.00 81.85  ? 1011 GLU B OE1 1 
ATOM   5041  O OE2 . GLU B 1 215 ? -20.862 -4.919  -2.254   1.00 86.21  ? 1011 GLU B OE2 1 
ATOM   5042  N N   . GLY B 1 216 ? -20.290 0.614   -3.150   1.00 68.63  ? 1012 GLY B N   1 
ATOM   5043  C CA  . GLY B 1 216 ? -18.958 1.167   -3.307   1.00 76.96  ? 1012 GLY B CA  1 
ATOM   5044  C C   . GLY B 1 216 ? -18.229 0.595   -4.508   1.00 77.35  ? 1012 GLY B C   1 
ATOM   5045  O O   . GLY B 1 216 ? -18.744 -0.280  -5.204   1.00 74.40  ? 1012 GLY B O   1 
ATOM   5046  N N   . LEU B 1 217 ? -17.021 1.093   -4.748   1.00 75.96  ? 1013 LEU B N   1 
ATOM   5047  C CA  . LEU B 1 217 ? -16.261 0.718   -5.932   1.00 74.82  ? 1013 LEU B CA  1 
ATOM   5048  C C   . LEU B 1 217 ? -14.801 0.412   -5.587   1.00 83.88  ? 1013 LEU B C   1 
ATOM   5049  O O   . LEU B 1 217 ? -14.077 1.276   -5.095   1.00 84.96  ? 1013 LEU B O   1 
ATOM   5050  C CB  . LEU B 1 217 ? -16.344 1.855   -6.955   1.00 65.47  ? 1013 LEU B CB  1 
ATOM   5051  C CG  . LEU B 1 217 ? -15.780 1.679   -8.364   1.00 61.12  ? 1013 LEU B CG  1 
ATOM   5052  C CD1 . LEU B 1 217 ? -16.463 2.644   -9.311   1.00 59.18  ? 1013 LEU B CD1 1 
ATOM   5053  C CD2 . LEU B 1 217 ? -14.278 1.876   -8.388   1.00 56.14  ? 1013 LEU B CD2 1 
ATOM   5054  N N   . ARG B 1 218 ? -14.374 -0.825  -5.825   1.00 81.60  ? 1014 ARG B N   1 
ATOM   5055  C CA  . ARG B 1 218 ? -12.974 -1.196  -5.633   1.00 83.59  ? 1014 ARG B CA  1 
ATOM   5056  C C   . ARG B 1 218 ? -12.505 -2.123  -6.753   1.00 99.85  ? 1014 ARG B C   1 
ATOM   5057  O O   . ARG B 1 218 ? -13.059 -3.208  -6.938   1.00 97.45  ? 1014 ARG B O   1 
ATOM   5058  C CB  . ARG B 1 218 ? -12.786 -1.864  -4.272   1.00 86.64  ? 1014 ARG B CB  1 
ATOM   5059  C CG  . ARG B 1 218 ? -13.575 -1.202  -3.154   1.00 90.68  ? 1014 ARG B CG  1 
ATOM   5060  C CD  . ARG B 1 218 ? -13.415 -1.941  -1.839   1.00 92.14  ? 1014 ARG B CD  1 
ATOM   5061  N NE  . ARG B 1 218 ? -12.079 -1.766  -1.287   1.00 94.13  ? 1014 ARG B NE  1 
ATOM   5062  C CZ  . ARG B 1 218 ? -11.694 -2.231  -0.103   1.00 103.12 ? 1014 ARG B CZ  1 
ATOM   5063  N NH1 . ARG B 1 218 ? -12.548 -2.901  0.657    1.00 109.00 ? 1014 ARG B NH1 1 
ATOM   5064  N NH2 . ARG B 1 218 ? -10.456 -2.024  0.323    1.00 106.38 ? 1014 ARG B NH2 1 
ATOM   5065  N N   . LEU B 1 219 ? -11.469 -1.707  -7.479   1.00 109.41 ? 1015 LEU B N   1 
ATOM   5066  C CA  . LEU B 1 219 ? -11.002 -2.441  -8.659   1.00 113.77 ? 1015 LEU B CA  1 
ATOM   5067  C C   . LEU B 1 219 ? -10.262 -3.723  -8.300   1.00 110.46 ? 1015 LEU B C   1 
ATOM   5068  O O   . LEU B 1 219 ? -10.180 -4.658  -9.099   1.00 111.63 ? 1015 LEU B O   1 
ATOM   5069  C CB  . LEU B 1 219 ? -10.110 -1.551  -9.527   1.00 116.12 ? 1015 LEU B CB  1 
ATOM   5070  C CG  . LEU B 1 219 ? -10.811 -0.436  -10.307  1.00 118.49 ? 1015 LEU B CG  1 
ATOM   5071  C CD1 . LEU B 1 219 ? -9.796  0.539   -10.889  1.00 122.45 ? 1015 LEU B CD1 1 
ATOM   5072  C CD2 . LEU B 1 219 ? -11.696 -1.024  -11.402  1.00 115.36 ? 1015 LEU B CD2 1 
ATOM   5073  N N   . LYS B 1 220 ? -9.731  -3.763  -7.087   1.00 109.49 ? 1016 LYS B N   1 
ATOM   5074  C CA  . LYS B 1 220 ? -8.991  -4.921  -6.621   1.00 110.14 ? 1016 LYS B CA  1 
ATOM   5075  C C   . LYS B 1 220 ? -9.879  -5.708  -5.677   1.00 117.80 ? 1016 LYS B C   1 
ATOM   5076  O O   . LYS B 1 220 ? -10.730 -5.136  -4.993   1.00 116.94 ? 1016 LYS B O   1 
ATOM   5077  C CB  . LYS B 1 220 ? -7.711  -4.489  -5.906   1.00 104.31 ? 1016 LYS B CB  1 
ATOM   5078  N N   . ILE B 1 221 ? -9.694  -7.023  -5.661   1.00 124.18 ? 1017 ILE B N   1 
ATOM   5079  C CA  . ILE B 1 221 ? -10.487 -7.890  -4.803   1.00 125.54 ? 1017 ILE B CA  1 
ATOM   5080  C C   . ILE B 1 221 ? -10.445 -7.373  -3.367   1.00 120.92 ? 1017 ILE B C   1 
ATOM   5081  O O   . ILE B 1 221 ? -9.388  -6.993  -2.862   1.00 118.36 ? 1017 ILE B O   1 
ATOM   5082  C CB  . ILE B 1 221 ? -9.973  -9.344  -4.844   1.00 120.80 ? 1017 ILE B CB  1 
ATOM   5083  C CG1 . ILE B 1 221 ? -9.800  -9.805  -6.293   1.00 123.27 ? 1017 ILE B CG1 1 
ATOM   5084  C CG2 . ILE B 1 221 ? -10.911 -10.268 -4.079   1.00 110.62 ? 1017 ILE B CG2 1 
ATOM   5085  C CD1 . ILE B 1 221 ? -9.270  -11.215 -6.428   1.00 130.68 ? 1017 ILE B CD1 1 
ATOM   5086  N N   . TYR B 1 222 ? -11.605 -7.339  -2.723   1.00 114.59 ? 1018 TYR B N   1 
ATOM   5087  C CA  . TYR B 1 222 ? -11.692 -6.922  -1.332   1.00 109.39 ? 1018 TYR B CA  1 
ATOM   5088  C C   . TYR B 1 222 ? -12.523 -7.931  -0.549   1.00 112.33 ? 1018 TYR B C   1 
ATOM   5089  O O   . TYR B 1 222 ? -13.187 -8.790  -1.133   1.00 103.26 ? 1018 TYR B O   1 
ATOM   5090  C CB  . TYR B 1 222 ? -12.268 -5.504  -1.209   1.00 106.23 ? 1018 TYR B CB  1 
ATOM   5091  C CG  . TYR B 1 222 ? -13.741 -5.373  -1.546   1.00 106.67 ? 1018 TYR B CG  1 
ATOM   5092  C CD1 . TYR B 1 222 ? -14.694 -5.224  -0.543   1.00 103.69 ? 1018 TYR B CD1 1 
ATOM   5093  C CD2 . TYR B 1 222 ? -14.179 -5.388  -2.863   1.00 101.28 ? 1018 TYR B CD2 1 
ATOM   5094  C CE1 . TYR B 1 222 ? -16.037 -5.100  -0.843   1.00 97.19  ? 1018 TYR B CE1 1 
ATOM   5095  C CE2 . TYR B 1 222 ? -15.521 -5.267  -3.172   1.00 94.89  ? 1018 TYR B CE2 1 
ATOM   5096  C CZ  . TYR B 1 222 ? -16.444 -5.123  -2.160   1.00 93.62  ? 1018 TYR B CZ  1 
ATOM   5097  O OH  . TYR B 1 222 ? -17.780 -5.000  -2.466   1.00 90.09  ? 1018 TYR B OH  1 
ATOM   5098  N N   . LYS B 1 223 ? -12.472 -7.832  0.775    1.00 120.06 ? 1019 LYS B N   1 
ATOM   5099  C CA  . LYS B 1 223 ? -13.165 -8.786  1.627    1.00 120.06 ? 1019 LYS B CA  1 
ATOM   5100  C C   . LYS B 1 223 ? -14.476 -8.209  2.158    1.00 117.21 ? 1019 LYS B C   1 
ATOM   5101  O O   . LYS B 1 223 ? -14.515 -7.096  2.680    1.00 107.15 ? 1019 LYS B O   1 
ATOM   5102  C CB  . LYS B 1 223 ? -12.258 -9.240  2.777    1.00 113.92 ? 1019 LYS B CB  1 
ATOM   5103  C CG  . LYS B 1 223 ? -12.638 -10.587 3.364    1.00 111.38 ? 1019 LYS B CG  1 
ATOM   5104  C CD  . LYS B 1 223 ? -11.678 -11.017 4.457    1.00 112.83 ? 1019 LYS B CD  1 
ATOM   5105  C CE  . LYS B 1 223 ? -12.163 -12.291 5.132    1.00 116.97 ? 1019 LYS B CE  1 
ATOM   5106  N NZ  . LYS B 1 223 ? -11.304 -12.699 6.280    1.00 124.01 ? 1019 LYS B NZ  1 
ATOM   5107  N N   . ASP B 1 224 ? -15.544 -8.989  2.017    1.00 125.29 ? 1020 ASP B N   1 
ATOM   5108  C CA  . ASP B 1 224 ? -16.884 -8.596  2.447    1.00 129.77 ? 1020 ASP B CA  1 
ATOM   5109  C C   . ASP B 1 224 ? -16.924 -8.457  3.964    1.00 138.17 ? 1020 ASP B C   1 
ATOM   5110  O O   . ASP B 1 224 ? -16.057 -8.977  4.666    1.00 140.95 ? 1020 ASP B O   1 
ATOM   5111  C CB  . ASP B 1 224 ? -17.899 -9.659  2.004    1.00 123.56 ? 1020 ASP B CB  1 
ATOM   5112  C CG  . ASP B 1 224 ? -19.345 -9.223  2.193    1.00 121.66 ? 1020 ASP B CG  1 
ATOM   5113  O OD1 . ASP B 1 224 ? -20.241 -9.938  1.698    1.00 113.80 ? 1020 ASP B OD1 1 
ATOM   5114  O OD2 . ASP B 1 224 ? -19.594 -8.173  2.820    1.00 124.05 ? 1020 ASP B OD2 1 
ATOM   5115  N N   . THR B 1 225 ? -17.921 -7.733  4.462    1.00 139.83 ? 1021 THR B N   1 
ATOM   5116  C CA  . THR B 1 225 ? -18.182 -7.655  5.894    1.00 140.32 ? 1021 THR B CA  1 
ATOM   5117  C C   . THR B 1 225 ? -18.349 -9.054  6.472    1.00 140.23 ? 1021 THR B C   1 
ATOM   5118  O O   . THR B 1 225 ? -17.930 -9.327  7.599    1.00 136.85 ? 1021 THR B O   1 
ATOM   5119  C CB  . THR B 1 225 ? -19.461 -6.862  6.181    1.00 136.67 ? 1021 THR B CB  1 
ATOM   5120  O OG1 . THR B 1 225 ? -20.570 -7.499  5.534    1.00 133.60 ? 1021 THR B OG1 1 
ATOM   5121  C CG2 . THR B 1 225 ? -19.330 -5.439  5.666    1.00 141.29 ? 1021 THR B CG2 1 
ATOM   5122  N N   . GLU B 1 226 ? -18.970 -9.934  5.692    1.00 139.75 ? 1022 GLU B N   1 
ATOM   5123  C CA  . GLU B 1 226 ? -19.177 -11.319 6.100    1.00 137.13 ? 1022 GLU B CA  1 
ATOM   5124  C C   . GLU B 1 226 ? -17.921 -12.151 5.861    1.00 138.78 ? 1022 GLU B C   1 
ATOM   5125  O O   . GLU B 1 226 ? -17.828 -13.294 6.307    1.00 140.02 ? 1022 GLU B O   1 
ATOM   5126  C CB  . GLU B 1 226 ? -20.362 -11.926 5.350    1.00 125.15 ? 1022 GLU B CB  1 
ATOM   5127  N N   . GLY B 1 227 ? -16.959 -11.569 5.152    1.00 135.60 ? 1023 GLY B N   1 
ATOM   5128  C CA  . GLY B 1 227 ? -15.682 -12.216 4.916    1.00 125.89 ? 1023 GLY B CA  1 
ATOM   5129  C C   . GLY B 1 227 ? -15.569 -12.821 3.533    1.00 126.60 ? 1023 GLY B C   1 
ATOM   5130  O O   . GLY B 1 227 ? -14.467 -13.105 3.063    1.00 128.35 ? 1023 GLY B O   1 
ATOM   5131  N N   . TYR B 1 228 ? -16.711 -13.015 2.879    1.00 126.91 ? 1024 TYR B N   1 
ATOM   5132  C CA  . TYR B 1 228 ? -16.746 -13.635 1.558    1.00 128.33 ? 1024 TYR B CA  1 
ATOM   5133  C C   . TYR B 1 228 ? -16.130 -12.724 0.502    1.00 124.09 ? 1024 TYR B C   1 
ATOM   5134  O O   . TYR B 1 228 ? -16.488 -11.554 0.393    1.00 124.17 ? 1024 TYR B O   1 
ATOM   5135  C CB  . TYR B 1 228 ? -18.182 -13.996 1.176    1.00 124.39 ? 1024 TYR B CB  1 
ATOM   5136  N N   . TYR B 1 229 ? -15.203 -13.266 -0.280   1.00 120.10 ? 1025 TYR B N   1 
ATOM   5137  C CA  . TYR B 1 229 ? -14.476 -12.470 -1.262   1.00 125.86 ? 1025 TYR B CA  1 
ATOM   5138  C C   . TYR B 1 229 ? -15.395 -11.804 -2.281   1.00 126.09 ? 1025 TYR B C   1 
ATOM   5139  O O   . TYR B 1 229 ? -16.226 -12.458 -2.913   1.00 120.98 ? 1025 TYR B O   1 
ATOM   5140  C CB  . TYR B 1 229 ? -13.414 -13.316 -1.968   1.00 139.60 ? 1025 TYR B CB  1 
ATOM   5141  C CG  . TYR B 1 229 ? -12.269 -13.705 -1.065   1.00 148.38 ? 1025 TYR B CG  1 
ATOM   5142  C CD1 . TYR B 1 229 ? -12.205 -14.970 -0.499   1.00 148.94 ? 1025 TYR B CD1 1 
ATOM   5143  C CD2 . TYR B 1 229 ? -11.259 -12.799 -0.766   1.00 153.54 ? 1025 TYR B CD2 1 
ATOM   5144  C CE1 . TYR B 1 229 ? -11.163 -15.327 0.333    1.00 157.08 ? 1025 TYR B CE1 1 
ATOM   5145  C CE2 . TYR B 1 229 ? -10.213 -13.145 0.066    1.00 161.94 ? 1025 TYR B CE2 1 
ATOM   5146  C CZ  . TYR B 1 229 ? -10.169 -14.410 0.613    1.00 165.11 ? 1025 TYR B CZ  1 
ATOM   5147  O OH  . TYR B 1 229 ? -9.128  -14.759 1.442    1.00 171.85 ? 1025 TYR B OH  1 
ATOM   5148  N N   . THR B 1 230 ? -15.228 -10.492 -2.429   1.00 124.42 ? 1026 THR B N   1 
ATOM   5149  C CA  . THR B 1 230 ? -16.014 -9.700  -3.367   1.00 113.90 ? 1026 THR B CA  1 
ATOM   5150  C C   . THR B 1 230 ? -15.094 -8.816  -4.199   1.00 107.74 ? 1026 THR B C   1 
ATOM   5151  O O   . THR B 1 230 ? -14.017 -8.434  -3.746   1.00 109.59 ? 1026 THR B O   1 
ATOM   5152  C CB  . THR B 1 230 ? -17.029 -8.809  -2.626   1.00 111.00 ? 1026 THR B CB  1 
ATOM   5153  O OG1 . THR B 1 230 ? -17.953 -9.630  -1.902   1.00 115.36 ? 1026 THR B OG1 1 
ATOM   5154  C CG2 . THR B 1 230 ? -17.798 -7.940  -3.604   1.00 110.71 ? 1026 THR B CG2 1 
ATOM   5155  N N   . ILE B 1 231 ? -15.520 -8.499  -5.416   1.00 105.20 ? 1027 ILE B N   1 
ATOM   5156  C CA  . ILE B 1 231 ? -14.773 -7.595  -6.282   1.00 105.81 ? 1027 ILE B CA  1 
ATOM   5157  C C   . ILE B 1 231 ? -15.741 -6.662  -7.012   1.00 101.16 ? 1027 ILE B C   1 
ATOM   5158  O O   . ILE B 1 231 ? -16.923 -6.975  -7.158   1.00 93.92  ? 1027 ILE B O   1 
ATOM   5159  C CB  . ILE B 1 231 ? -13.906 -8.376  -7.298   1.00 113.47 ? 1027 ILE B CB  1 
ATOM   5160  C CG1 . ILE B 1 231 ? -12.947 -7.434  -8.035   1.00 114.45 ? 1027 ILE B CG1 1 
ATOM   5161  C CG2 . ILE B 1 231 ? -14.786 -9.152  -8.273   1.00 118.95 ? 1027 ILE B CG2 1 
ATOM   5162  C CD1 . ILE B 1 231 ? -12.032 -8.135  -9.024   1.00 119.80 ? 1027 ILE B CD1 1 
ATOM   5163  N N   . GLY B 1 232 ? -15.244 -5.511  -7.454   1.00 99.77  ? 1028 GLY B N   1 
ATOM   5164  C CA  . GLY B 1 232 ? -16.068 -4.560  -8.179   1.00 96.55  ? 1028 GLY B CA  1 
ATOM   5165  C C   . GLY B 1 232 ? -17.206 -3.998  -7.347   1.00 91.81  ? 1028 GLY B C   1 
ATOM   5166  O O   . GLY B 1 232 ? -16.983 -3.433  -6.275   1.00 88.37  ? 1028 GLY B O   1 
ATOM   5167  N N   . ILE B 1 233 ? -18.430 -4.141  -7.845   1.00 88.01  ? 1029 ILE B N   1 
ATOM   5168  C CA  . ILE B 1 233 ? -19.596 -3.696  -7.097   1.00 90.86  ? 1029 ILE B CA  1 
ATOM   5169  C C   . ILE B 1 233 ? -20.424 -4.902  -6.671   1.00 87.76  ? 1029 ILE B C   1 
ATOM   5170  O O   . ILE B 1 233 ? -21.118 -5.510  -7.483   1.00 88.31  ? 1029 ILE B O   1 
ATOM   5171  C CB  . ILE B 1 233 ? -20.479 -2.746  -7.941   1.00 82.38  ? 1029 ILE B CB  1 
ATOM   5172  C CG1 . ILE B 1 233 ? -19.650 -1.578  -8.480   1.00 76.38  ? 1029 ILE B CG1 1 
ATOM   5173  C CG2 . ILE B 1 233 ? -21.664 -2.240  -7.126   1.00 70.51  ? 1029 ILE B CG2 1 
ATOM   5174  C CD1 . ILE B 1 233 ? -20.451 -0.593  -9.299   1.00 69.13  ? 1029 ILE B CD1 1 
ATOM   5175  N N   . GLY B 1 234 ? -20.355 -5.225  -5.384   1.00 89.48  ? 1030 GLY B N   1 
ATOM   5176  C CA  . GLY B 1 234 ? -21.147 -6.292  -4.796   1.00 91.80  ? 1030 GLY B CA  1 
ATOM   5177  C C   . GLY B 1 234 ? -21.123 -7.638  -5.496   1.00 100.13 ? 1030 GLY B C   1 
ATOM   5178  O O   . GLY B 1 234 ? -22.114 -8.365  -5.454   1.00 105.51 ? 1030 GLY B O   1 
ATOM   5179  N N   . HIS B 1 235 ? -20.003 -7.990  -6.122   1.00 100.44 ? 1031 HIS B N   1 
ATOM   5180  C CA  . HIS B 1 235 ? -19.920 -9.264  -6.830   1.00 96.19  ? 1031 HIS B CA  1 
ATOM   5181  C C   . HIS B 1 235 ? -19.348 -10.358 -5.936   1.00 97.45  ? 1031 HIS B C   1 
ATOM   5182  O O   . HIS B 1 235 ? -18.163 -10.351 -5.600   1.00 95.77  ? 1031 HIS B O   1 
ATOM   5183  C CB  . HIS B 1 235 ? -19.086 -9.131  -8.104   1.00 97.84  ? 1031 HIS B CB  1 
ATOM   5184  C CG  . HIS B 1 235 ? -19.206 -10.305 -9.030   1.00 95.18  ? 1031 HIS B CG  1 
ATOM   5185  N ND1 . HIS B 1 235 ? -20.428 -10.769 -9.490   1.00 93.60  ? 1031 HIS B ND1 1 
ATOM   5186  C CD2 . HIS B 1 235 ? -18.272 -11.100 -9.584   1.00 94.98  ? 1031 HIS B CD2 1 
ATOM   5187  C CE1 . HIS B 1 235 ? -20.229 -11.794 -10.279  1.00 97.07  ? 1031 HIS B CE1 1 
ATOM   5188  N NE2 . HIS B 1 235 ? -18.932 -12.032 -10.365  1.00 95.99  ? 1031 HIS B NE2 1 
ATOM   5189  N N   . LEU B 1 236 ? -20.199 -11.312 -5.574   1.00 101.10 ? 1032 LEU B N   1 
ATOM   5190  C CA  . LEU B 1 236 ? -19.804 -12.391 -4.678   1.00 106.51 ? 1032 LEU B CA  1 
ATOM   5191  C C   . LEU B 1 236 ? -19.293 -13.588 -5.474   1.00 117.34 ? 1032 LEU B C   1 
ATOM   5192  O O   . LEU B 1 236 ? -20.040 -14.209 -6.235   1.00 111.49 ? 1032 LEU B O   1 
ATOM   5193  C CB  . LEU B 1 236 ? -20.976 -12.796 -3.781   1.00 97.36  ? 1032 LEU B CB  1 
ATOM   5194  C CG  . LEU B 1 236 ? -20.713 -13.865 -2.720   1.00 101.98 ? 1032 LEU B CG  1 
ATOM   5195  C CD1 . LEU B 1 236 ? -19.428 -13.578 -1.961   1.00 111.03 ? 1032 LEU B CD1 1 
ATOM   5196  C CD2 . LEU B 1 236 ? -21.895 -13.971 -1.768   1.00 101.35 ? 1032 LEU B CD2 1 
ATOM   5197  N N   . LEU B 1 237 ? -18.013 -13.902 -5.286   1.00 125.42 ? 1033 LEU B N   1 
ATOM   5198  C CA  . LEU B 1 237 ? -17.345 -14.972 -6.024   1.00 126.22 ? 1033 LEU B CA  1 
ATOM   5199  C C   . LEU B 1 237 ? -17.573 -16.325 -5.362   1.00 128.78 ? 1033 LEU B C   1 
ATOM   5200  O O   . LEU B 1 237 ? -18.192 -17.223 -5.931   1.00 125.64 ? 1033 LEU B O   1 
ATOM   5201  C CB  . LEU B 1 237 ? -15.844 -14.693 -6.095   1.00 122.01 ? 1033 LEU B CB  1 
ATOM   5202  C CG  . LEU B 1 237 ? -15.447 -13.255 -6.421   1.00 112.53 ? 1033 LEU B CG  1 
ATOM   5203  C CD1 . LEU B 1 237 ? -13.948 -13.071 -6.288   1.00 117.34 ? 1033 LEU B CD1 1 
ATOM   5204  C CD2 . LEU B 1 237 ? -15.914 -12.879 -7.815   1.00 114.90 ? 1033 LEU B CD2 1 
ATOM   5205  N N   . THR B 1 238 ? -17.042 -16.462 -4.155   1.00 136.34 ? 1034 THR B N   1 
ATOM   5206  C CA  . THR B 1 238 ? -17.226 -17.662 -3.359   1.00 137.77 ? 1034 THR B CA  1 
ATOM   5207  C C   . THR B 1 238 ? -17.097 -17.301 -1.892   1.00 144.99 ? 1034 THR B C   1 
ATOM   5208  O O   . THR B 1 238 ? -16.556 -16.250 -1.543   1.00 143.76 ? 1034 THR B O   1 
ATOM   5209  C CB  . THR B 1 238 ? -16.189 -18.737 -3.700   1.00 135.96 ? 1034 THR B CB  1 
ATOM   5210  O OG1 . THR B 1 238 ? -16.248 -19.778 -2.718   1.00 143.74 ? 1034 THR B OG1 1 
ATOM   5211  C CG2 . THR B 1 238 ? -14.789 -18.143 -3.701   1.00 138.33 ? 1034 THR B CG2 1 
ATOM   5212  N N   . LYS B 1 239 ? -17.598 -18.175 -1.032   1.00 147.39 ? 1035 LYS B N   1 
ATOM   5213  C CA  . LYS B 1 239 ? -17.536 -17.941 0.399    1.00 152.36 ? 1035 LYS B CA  1 
ATOM   5214  C C   . LYS B 1 239 ? -16.322 -18.635 1.016    1.00 159.32 ? 1035 LYS B C   1 
ATOM   5215  O O   . LYS B 1 239 ? -16.111 -18.571 2.228    1.00 167.21 ? 1035 LYS B O   1 
ATOM   5216  C CB  . LYS B 1 239 ? -18.838 -18.404 1.052    1.00 153.16 ? 1035 LYS B CB  1 
ATOM   5217  C CG  . LYS B 1 239 ? -19.815 -19.001 0.052    1.00 145.42 ? 1035 LYS B CG  1 
ATOM   5218  C CD  . LYS B 1 239 ? -21.242 -18.947 0.558    1.00 142.62 ? 1035 LYS B CD  1 
ATOM   5219  C CE  . LYS B 1 239 ? -22.217 -19.395 -0.517   1.00 144.08 ? 1035 LYS B CE  1 
ATOM   5220  N NZ  . LYS B 1 239 ? -23.633 -19.168 -0.114   1.00 152.18 ? 1035 LYS B NZ  1 
ATOM   5221  N N   . SER B 1 240 ? -15.527 -19.290 0.173    1.00 154.59 ? 1036 SER B N   1 
ATOM   5222  C CA  . SER B 1 240 ? -14.330 -19.990 0.630    1.00 161.80 ? 1036 SER B CA  1 
ATOM   5223  C C   . SER B 1 240 ? -13.227 -19.012 1.017    1.00 168.49 ? 1036 SER B C   1 
ATOM   5224  O O   . SER B 1 240 ? -12.995 -18.023 0.322    1.00 164.12 ? 1036 SER B O   1 
ATOM   5225  C CB  . SER B 1 240 ? -13.810 -20.932 -0.455   1.00 157.02 ? 1036 SER B CB  1 
ATOM   5226  O OG  . SER B 1 240 ? -13.144 -20.210 -1.475   1.00 154.66 ? 1036 SER B OG  1 
ATOM   5227  N N   . PRO B 1 241 ? -12.532 -19.298 2.128    1.00 174.66 ? 1037 PRO B N   1 
ATOM   5228  C CA  . PRO B 1 241 ? -11.457 -18.430 2.618    1.00 171.17 ? 1037 PRO B CA  1 
ATOM   5229  C C   . PRO B 1 241 ? -10.256 -18.425 1.679    1.00 168.69 ? 1037 PRO B C   1 
ATOM   5230  O O   . PRO B 1 241 ? -9.413  -17.535 1.768    1.00 171.42 ? 1037 PRO B O   1 
ATOM   5231  C CB  . PRO B 1 241 ? -11.081 -19.067 3.960    1.00 169.86 ? 1037 PRO B CB  1 
ATOM   5232  C CG  . PRO B 1 241 ? -11.466 -20.497 3.814    1.00 173.00 ? 1037 PRO B CG  1 
ATOM   5233  C CD  . PRO B 1 241 ? -12.712 -20.487 2.979    1.00 175.04 ? 1037 PRO B CD  1 
ATOM   5234  N N   . SER B 1 242 ? -10.183 -19.411 0.791    1.00 161.18 ? 1038 SER B N   1 
ATOM   5235  C CA  . SER B 1 242 ? -9.066  -19.515 -0.140   1.00 154.78 ? 1038 SER B CA  1 
ATOM   5236  C C   . SER B 1 242 ? -9.165  -18.475 -1.250   1.00 149.12 ? 1038 SER B C   1 
ATOM   5237  O O   . SER B 1 242 ? -10.201 -18.350 -1.902   1.00 146.12 ? 1038 SER B O   1 
ATOM   5238  C CB  . SER B 1 242 ? -9.000  -20.916 -0.746   1.00 157.08 ? 1038 SER B CB  1 
ATOM   5239  O OG  . SER B 1 242 ? -7.898  -21.034 -1.629   1.00 159.28 ? 1038 SER B OG  1 
ATOM   5240  N N   . LEU B 1 243 ? -8.080  -17.734 -1.456   1.00 149.98 ? 1039 LEU B N   1 
ATOM   5241  C CA  . LEU B 1 243 ? -8.033  -16.701 -2.487   1.00 146.11 ? 1039 LEU B CA  1 
ATOM   5242  C C   . LEU B 1 243 ? -7.897  -17.304 -3.877   1.00 138.73 ? 1039 LEU B C   1 
ATOM   5243  O O   . LEU B 1 243 ? -8.439  -16.779 -4.843   1.00 138.72 ? 1039 LEU B O   1 
ATOM   5244  C CB  . LEU B 1 243 ? -6.880  -15.727 -2.230   1.00 142.06 ? 1039 LEU B CB  1 
ATOM   5245  C CG  . LEU B 1 243 ? -6.651  -14.670 -3.315   1.00 137.06 ? 1039 LEU B CG  1 
ATOM   5246  C CD1 . LEU B 1 243 ? -7.891  -13.806 -3.499   1.00 140.30 ? 1039 LEU B CD1 1 
ATOM   5247  C CD2 . LEU B 1 243 ? -5.440  -13.810 -2.991   1.00 137.01 ? 1039 LEU B CD2 1 
ATOM   5248  N N   . ASN B 1 244 ? -7.160  -18.403 -3.978   1.00 136.75 ? 1040 ASN B N   1 
ATOM   5249  C CA  . ASN B 1 244 ? -6.992  -19.079 -5.255   1.00 138.57 ? 1040 ASN B CA  1 
ATOM   5250  C C   . ASN B 1 244 ? -8.344  -19.446 -5.859   1.00 137.28 ? 1040 ASN B C   1 
ATOM   5251  O O   . ASN B 1 244 ? -8.537  -19.363 -7.072   1.00 135.98 ? 1040 ASN B O   1 
ATOM   5252  C CB  . ASN B 1 244 ? -6.121  -20.326 -5.096   1.00 142.34 ? 1040 ASN B CB  1 
ATOM   5253  N N   . ALA B 1 245 ? -9.278  -19.842 -4.999   1.00 138.29 ? 1041 ALA B N   1 
ATOM   5254  C CA  . ALA B 1 245 ? -10.620 -20.215 -5.431   1.00 135.75 ? 1041 ALA B CA  1 
ATOM   5255  C C   . ALA B 1 245 ? -11.368 -19.009 -5.989   1.00 137.27 ? 1041 ALA B C   1 
ATOM   5256  O O   . ALA B 1 245 ? -11.926 -19.061 -7.088   1.00 139.26 ? 1041 ALA B O   1 
ATOM   5257  C CB  . ALA B 1 245 ? -11.392 -20.831 -4.276   1.00 128.72 ? 1041 ALA B CB  1 
ATOM   5258  N N   . ALA B 1 246 ? -11.374 -17.924 -5.221   1.00 137.42 ? 1042 ALA B N   1 
ATOM   5259  C CA  . ALA B 1 246 ? -12.038 -16.695 -5.638   1.00 135.49 ? 1042 ALA B CA  1 
ATOM   5260  C C   . ALA B 1 246 ? -11.477 -16.198 -6.968   1.00 140.04 ? 1042 ALA B C   1 
ATOM   5261  O O   . ALA B 1 246 ? -12.230 -15.874 -7.886   1.00 141.95 ? 1042 ALA B O   1 
ATOM   5262  C CB  . ALA B 1 246 ? -11.900 -15.624 -4.563   1.00 133.98 ? 1042 ALA B CB  1 
ATOM   5263  N N   . LYS B 1 247 ? -10.152 -16.147 -7.068   1.00 139.72 ? 1043 LYS B N   1 
ATOM   5264  C CA  . LYS B 1 247 ? -9.490  -15.706 -8.290   1.00 129.95 ? 1043 LYS B CA  1 
ATOM   5265  C C   . LYS B 1 247 ? -9.805  -16.644 -9.450   1.00 134.36 ? 1043 LYS B C   1 
ATOM   5266  O O   . LYS B 1 247 ? -9.887  -16.213 -10.599  1.00 133.02 ? 1043 LYS B O   1 
ATOM   5267  C CB  . LYS B 1 247 ? -7.979  -15.606 -8.082   1.00 128.36 ? 1043 LYS B CB  1 
ATOM   5268  C CG  . LYS B 1 247 ? -7.224  -15.116 -9.304   1.00 131.80 ? 1043 LYS B CG  1 
ATOM   5269  C CD  . LYS B 1 247 ? -5.730  -15.090 -9.052   1.00 128.92 ? 1043 LYS B CD  1 
ATOM   5270  C CE  . LYS B 1 247 ? -4.965  -14.778 -10.322  1.00 121.05 ? 1043 LYS B CE  1 
ATOM   5271  N NZ  . LYS B 1 247 ? -3.499  -14.734 -10.072  1.00 125.27 ? 1043 LYS B NZ  1 
ATOM   5272  N N   . SER B 1 248 ? -9.985  -17.927 -9.144   1.00 138.46 ? 1044 SER B N   1 
ATOM   5273  C CA  . SER B 1 248 ? -10.366 -18.910 -10.155  1.00 139.88 ? 1044 SER B CA  1 
ATOM   5274  C C   . SER B 1 248 ? -11.752 -18.601 -10.715  1.00 135.31 ? 1044 SER B C   1 
ATOM   5275  O O   . SER B 1 248 ? -11.960 -18.604 -11.931  1.00 131.92 ? 1044 SER B O   1 
ATOM   5276  C CB  . SER B 1 248 ? -10.343 -20.323 -9.571   1.00 144.49 ? 1044 SER B CB  1 
ATOM   5277  O OG  . SER B 1 248 ? -10.791 -21.275 -10.522  1.00 142.93 ? 1044 SER B OG  1 
ATOM   5278  N N   . GLU B 1 249 ? -12.702 -18.333 -9.823   1.00 136.15 ? 1045 GLU B N   1 
ATOM   5279  C CA  . GLU B 1 249 ? -14.041 -17.941 -10.249  1.00 134.17 ? 1045 GLU B CA  1 
ATOM   5280  C C   . GLU B 1 249 ? -13.989 -16.635 -11.040  1.00 128.99 ? 1045 GLU B C   1 
ATOM   5281  O O   . GLU B 1 249 ? -14.761 -16.435 -11.976  1.00 130.18 ? 1045 GLU B O   1 
ATOM   5282  C CB  . GLU B 1 249 ? -14.980 -17.807 -9.047   1.00 137.60 ? 1045 GLU B CB  1 
ATOM   5283  C CG  . GLU B 1 249 ? -15.383 -19.131 -8.402   1.00 139.94 ? 1045 GLU B CG  1 
ATOM   5284  C CD  . GLU B 1 249 ? -16.426 -19.892 -9.205   1.00 133.76 ? 1045 GLU B CD  1 
ATOM   5285  O OE1 . GLU B 1 249 ? -17.166 -20.700 -8.604   1.00 134.59 ? 1045 GLU B OE1 1 
ATOM   5286  O OE2 . GLU B 1 249 ? -16.508 -19.687 -10.435  1.00 126.43 ? 1045 GLU B OE2 1 
ATOM   5287  N N   . LEU B 1 250 ? -13.070 -15.752 -10.661  1.00 126.11 ? 1046 LEU B N   1 
ATOM   5288  C CA  . LEU B 1 250 ? -12.895 -14.484 -11.360  1.00 124.85 ? 1046 LEU B CA  1 
ATOM   5289  C C   . LEU B 1 250 ? -12.418 -14.718 -12.789  1.00 132.28 ? 1046 LEU B C   1 
ATOM   5290  O O   . LEU B 1 250 ? -12.881 -14.063 -13.725  1.00 130.22 ? 1046 LEU B O   1 
ATOM   5291  C CB  . LEU B 1 250 ? -11.903 -13.591 -10.611  1.00 124.19 ? 1046 LEU B CB  1 
ATOM   5292  C CG  . LEU B 1 250 ? -11.584 -12.237 -11.249  1.00 119.88 ? 1046 LEU B CG  1 
ATOM   5293  C CD1 . LEU B 1 250 ? -12.856 -11.515 -11.653  1.00 112.52 ? 1046 LEU B CD1 1 
ATOM   5294  C CD2 . LEU B 1 250 ? -10.755 -11.379 -10.305  1.00 119.04 ? 1046 LEU B CD2 1 
ATOM   5295  N N   . ASP B 1 251 ? -11.487 -15.655 -12.947  1.00 139.43 ? 1047 ASP B N   1 
ATOM   5296  C CA  . ASP B 1 251 ? -10.982 -16.035 -14.262  1.00 140.57 ? 1047 ASP B CA  1 
ATOM   5297  C C   . ASP B 1 251 ? -12.093 -16.671 -15.089  1.00 134.73 ? 1047 ASP B C   1 
ATOM   5298  O O   . ASP B 1 251 ? -12.175 -16.468 -16.301  1.00 131.78 ? 1047 ASP B O   1 
ATOM   5299  C CB  . ASP B 1 251 ? -9.809  -17.014 -14.136  1.00 144.01 ? 1047 ASP B CB  1 
ATOM   5300  C CG  . ASP B 1 251 ? -8.635  -16.432 -13.367  1.00 145.69 ? 1047 ASP B CG  1 
ATOM   5301  O OD1 . ASP B 1 251 ? -7.926  -17.210 -12.690  1.00 138.67 ? 1047 ASP B OD1 1 
ATOM   5302  O OD2 . ASP B 1 251 ? -8.420  -15.203 -13.442  1.00 146.37 ? 1047 ASP B OD2 1 
ATOM   5303  N N   . LYS B 1 252 ? -12.943 -17.448 -14.426  1.00 134.68 ? 1048 LYS B N   1 
ATOM   5304  C CA  . LYS B 1 252 ? -14.063 -18.096 -15.095  1.00 130.31 ? 1048 LYS B CA  1 
ATOM   5305  C C   . LYS B 1 252 ? -15.063 -17.068 -15.620  1.00 132.22 ? 1048 LYS B C   1 
ATOM   5306  O O   . LYS B 1 252 ? -15.525 -17.166 -16.756  1.00 130.61 ? 1048 LYS B O   1 
ATOM   5307  C CB  . LYS B 1 252 ? -14.758 -19.078 -14.148  1.00 123.27 ? 1048 LYS B CB  1 
ATOM   5308  N N   . ALA B 1 253 ? -15.387 -16.079 -14.791  1.00 130.66 ? 1049 ALA B N   1 
ATOM   5309  C CA  . ALA B 1 253 ? -16.370 -15.062 -15.155  1.00 124.15 ? 1049 ALA B CA  1 
ATOM   5310  C C   . ALA B 1 253 ? -15.840 -14.085 -16.201  1.00 126.58 ? 1049 ALA B C   1 
ATOM   5311  O O   . ALA B 1 253 ? -16.493 -13.840 -17.215  1.00 128.30 ? 1049 ALA B O   1 
ATOM   5312  C CB  . ALA B 1 253 ? -16.848 -14.314 -13.919  1.00 118.82 ? 1049 ALA B CB  1 
ATOM   5313  N N   . ILE B 1 254 ? -14.658 -13.527 -15.953  1.00 126.67 ? 1050 ILE B N   1 
ATOM   5314  C CA  . ILE B 1 254 ? -14.040 -12.599 -16.896  1.00 127.12 ? 1050 ILE B CA  1 
ATOM   5315  C C   . ILE B 1 254 ? -13.680 -13.292 -18.208  1.00 133.18 ? 1050 ILE B C   1 
ATOM   5316  O O   . ILE B 1 254 ? -13.910 -12.751 -19.291  1.00 132.38 ? 1050 ILE B O   1 
ATOM   5317  C CB  . ILE B 1 254 ? -12.779 -11.941 -16.305  1.00 117.68 ? 1050 ILE B CB  1 
ATOM   5318  C CG1 . ILE B 1 254 ? -13.168 -10.920 -15.240  1.00 107.14 ? 1050 ILE B CG1 1 
ATOM   5319  C CG2 . ILE B 1 254 ? -11.978 -11.258 -17.397  1.00 119.70 ? 1050 ILE B CG2 1 
ATOM   5320  C CD1 . ILE B 1 254 ? -14.002 -9.783  -15.774  1.00 98.00  ? 1050 ILE B CD1 1 
ATOM   5321  N N   . GLY B 1 255 ? -13.119 -14.492 -18.104  1.00 136.40 ? 1051 GLY B N   1 
ATOM   5322  C CA  . GLY B 1 255 ? -12.731 -15.259 -19.275  1.00 137.80 ? 1051 GLY B CA  1 
ATOM   5323  C C   . GLY B 1 255 ? -11.251 -15.123 -19.561  1.00 133.47 ? 1051 GLY B C   1 
ATOM   5324  O O   . GLY B 1 255 ? -10.748 -15.619 -20.569  1.00 131.87 ? 1051 GLY B O   1 
ATOM   5325  N N   . ARG B 1 256 ? -10.552 -14.446 -18.659  1.00 131.54 ? 1052 ARG B N   1 
ATOM   5326  C CA  . ARG B 1 256 ? -9.129  -14.191 -18.815  1.00 132.15 ? 1052 ARG B CA  1 
ATOM   5327  C C   . ARG B 1 256 ? -8.460  -14.244 -17.447  1.00 138.22 ? 1052 ARG B C   1 
ATOM   5328  O O   . ARG B 1 256 ? -9.131  -14.444 -16.433  1.00 138.74 ? 1052 ARG B O   1 
ATOM   5329  C CB  . ARG B 1 256 ? -8.928  -12.814 -19.448  1.00 133.13 ? 1052 ARG B CB  1 
ATOM   5330  C CG  . ARG B 1 256 ? -7.495  -12.478 -19.812  1.00 130.93 ? 1052 ARG B CG  1 
ATOM   5331  C CD  . ARG B 1 256 ? -7.321  -10.978 -19.930  1.00 132.91 ? 1052 ARG B CD  1 
ATOM   5332  N NE  . ARG B 1 256 ? -7.755  -10.291 -18.716  1.00 133.74 ? 1052 ARG B NE  1 
ATOM   5333  C CZ  . ARG B 1 256 ? -7.669  -8.979  -18.526  1.00 131.03 ? 1052 ARG B CZ  1 
ATOM   5334  N NH1 . ARG B 1 256 ? -7.162  -8.203  -19.474  1.00 130.05 ? 1052 ARG B NH1 1 
ATOM   5335  N NH2 . ARG B 1 256 ? -8.089  -8.442  -17.388  1.00 123.45 ? 1052 ARG B NH2 1 
ATOM   5336  N N   . ASN B 1 257 ? -7.144  -14.051 -17.413  1.00 137.68 ? 1053 ASN B N   1 
ATOM   5337  C CA  . ASN B 1 257 ? -6.431  -13.993 -16.146  1.00 133.64 ? 1053 ASN B CA  1 
ATOM   5338  C C   . ASN B 1 257 ? -6.353  -12.557 -15.673  1.00 137.63 ? 1053 ASN B C   1 
ATOM   5339  O O   . ASN B 1 257 ? -5.637  -11.740 -16.249  1.00 139.83 ? 1053 ASN B O   1 
ATOM   5340  C CB  . ASN B 1 257 ? -5.017  -14.559 -16.286  1.00 131.04 ? 1053 ASN B CB  1 
ATOM   5341  C CG  . ASN B 1 257 ? -4.988  -16.073 -16.267  1.00 143.93 ? 1053 ASN B CG  1 
ATOM   5342  O OD1 . ASN B 1 257 ? -4.441  -16.706 -17.171  1.00 146.17 ? 1053 ASN B OD1 1 
ATOM   5343  N ND2 . ASN B 1 257 ? -5.573  -16.664 -15.231  1.00 147.48 ? 1053 ASN B ND2 1 
ATOM   5344  N N   . THR B 1 258 ? -7.092  -12.257 -14.613  1.00 140.11 ? 1054 THR B N   1 
ATOM   5345  C CA  . THR B 1 258 ? -7.115  -10.915 -14.051  1.00 140.40 ? 1054 THR B CA  1 
ATOM   5346  C C   . THR B 1 258 ? -5.896  -10.694 -13.165  1.00 141.33 ? 1054 THR B C   1 
ATOM   5347  O O   . THR B 1 258 ? -5.398  -9.573  -13.043  1.00 137.45 ? 1054 THR B O   1 
ATOM   5348  C CB  . THR B 1 258 ? -8.393  -10.677 -13.235  1.00 134.34 ? 1054 THR B CB  1 
ATOM   5349  O OG1 . THR B 1 258 ? -8.467  -11.640 -12.177  1.00 137.64 ? 1054 THR B OG1 1 
ATOM   5350  C CG2 . THR B 1 258 ? -9.622  -10.810 -14.124  1.00 125.87 ? 1054 THR B CG2 1 
ATOM   5351  N N   . ASN B 1 259 ? -5.422  -11.775 -12.553  1.00 141.53 ? 1055 ASN B N   1 
ATOM   5352  C CA  . ASN B 1 259 ? -4.303  -11.704 -11.624  1.00 141.32 ? 1055 ASN B CA  1 
ATOM   5353  C C   . ASN B 1 259 ? -4.618  -10.784 -10.452  1.00 140.42 ? 1055 ASN B C   1 
ATOM   5354  O O   . ASN B 1 259 ? -3.715  -10.229 -9.826   1.00 132.49 ? 1055 ASN B O   1 
ATOM   5355  C CB  . ASN B 1 259 ? -3.022  -11.260 -12.338  1.00 138.38 ? 1055 ASN B CB  1 
ATOM   5356  C CG  . ASN B 1 259 ? -2.570  -12.251 -13.395  1.00 138.45 ? 1055 ASN B CG  1 
ATOM   5357  O OD1 . ASN B 1 259 ? -2.876  -13.440 -13.316  1.00 140.26 ? 1055 ASN B OD1 1 
ATOM   5358  N ND2 . ASN B 1 259 ? -1.837  -11.765 -14.390  1.00 132.77 ? 1055 ASN B ND2 1 
ATOM   5359  N N   . GLY B 1 260 ? -5.909  -10.639 -10.162  1.00 141.87 ? 1056 GLY B N   1 
ATOM   5360  C CA  . GLY B 1 260 ? -6.370  -9.851  -9.033   1.00 135.54 ? 1056 GLY B CA  1 
ATOM   5361  C C   . GLY B 1 260 ? -6.924  -8.480  -9.379   1.00 139.12 ? 1056 GLY B C   1 
ATOM   5362  O O   . GLY B 1 260 ? -7.679  -7.900  -8.597   1.00 134.80 ? 1056 GLY B O   1 
ATOM   5363  N N   . VAL B 1 261 ? -6.559  -7.963  -10.549  1.00 140.00 ? 1057 VAL B N   1 
ATOM   5364  C CA  . VAL B 1 261 ? -6.935  -6.605  -10.942  1.00 130.64 ? 1057 VAL B CA  1 
ATOM   5365  C C   . VAL B 1 261 ? -7.796  -6.583  -12.205  1.00 129.59 ? 1057 VAL B C   1 
ATOM   5366  O O   . VAL B 1 261 ? -7.556  -7.350  -13.138  1.00 133.95 ? 1057 VAL B O   1 
ATOM   5367  C CB  . VAL B 1 261 ? -5.683  -5.731  -11.169  1.00 128.77 ? 1057 VAL B CB  1 
ATOM   5368  C CG1 . VAL B 1 261 ? -6.072  -4.355  -11.686  1.00 128.60 ? 1057 VAL B CG1 1 
ATOM   5369  C CG2 . VAL B 1 261 ? -4.873  -5.619  -9.886   1.00 126.61 ? 1057 VAL B CG2 1 
ATOM   5370  N N   . ILE B 1 262 ? -8.796  -5.704  -12.228  1.00 121.27 ? 1058 ILE B N   1 
ATOM   5371  C CA  . ILE B 1 262 ? -9.651  -5.541  -13.403  1.00 119.47 ? 1058 ILE B CA  1 
ATOM   5372  C C   . ILE B 1 262 ? -9.807  -4.076  -13.783  1.00 115.58 ? 1058 ILE B C   1 
ATOM   5373  O O   . ILE B 1 262 ? -9.712  -3.188  -12.937  1.00 107.64 ? 1058 ILE B O   1 
ATOM   5374  C CB  . ILE B 1 262 ? -11.058 -6.128  -13.187  1.00 111.99 ? 1058 ILE B CB  1 
ATOM   5375  C CG1 . ILE B 1 262 ? -11.838 -5.288  -12.176  1.00 106.19 ? 1058 ILE B CG1 1 
ATOM   5376  C CG2 . ILE B 1 262 ? -10.976 -7.581  -12.755  1.00 121.34 ? 1058 ILE B CG2 1 
ATOM   5377  C CD1 . ILE B 1 262 ? -13.218 -5.823  -11.877  1.00 102.78 ? 1058 ILE B CD1 1 
ATOM   5378  N N   . THR B 1 263 ? -10.059 -3.833  -15.064  1.00 118.22 ? 1059 THR B N   1 
ATOM   5379  C CA  . THR B 1 263 ? -10.292 -2.482  -15.555  1.00 109.47 ? 1059 THR B CA  1 
ATOM   5380  C C   . THR B 1 263 ? -11.715 -2.034  -15.249  1.00 100.01 ? 1059 THR B C   1 
ATOM   5381  O O   . THR B 1 263 ? -12.629 -2.851  -15.150  1.00 99.01  ? 1059 THR B O   1 
ATOM   5382  C CB  . THR B 1 263 ? -10.040 -2.380  -17.069  1.00 104.52 ? 1059 THR B CB  1 
ATOM   5383  O OG1 . THR B 1 263 ? -10.997 -3.182  -17.773  1.00 102.79 ? 1059 THR B OG1 1 
ATOM   5384  C CG2 . THR B 1 263 ? -8.639  -2.863  -17.402  1.00 105.01 ? 1059 THR B CG2 1 
ATOM   5385  N N   . LYS B 1 264 ? -11.892 -0.729  -15.097  1.00 96.39  ? 1060 LYS B N   1 
ATOM   5386  C CA  . LYS B 1 264 ? -13.186 -0.159  -14.759  1.00 93.75  ? 1060 LYS B CA  1 
ATOM   5387  C C   . LYS B 1 264 ? -14.277 -0.647  -15.714  1.00 94.71  ? 1060 LYS B C   1 
ATOM   5388  O O   . LYS B 1 264 ? -15.414 -0.894  -15.302  1.00 97.19  ? 1060 LYS B O   1 
ATOM   5389  C CB  . LYS B 1 264 ? -13.096 1.363   -14.793  1.00 98.16  ? 1060 LYS B CB  1 
ATOM   5390  C CG  . LYS B 1 264 ? -11.880 1.922   -14.074  1.00 93.91  ? 1060 LYS B CG  1 
ATOM   5391  C CD  . LYS B 1 264 ? -11.588 3.340   -14.515  1.00 96.32  ? 1060 LYS B CD  1 
ATOM   5392  C CE  . LYS B 1 264 ? -12.783 4.239   -14.274  1.00 88.99  ? 1060 LYS B CE  1 
ATOM   5393  N NZ  . LYS B 1 264 ? -12.545 5.608   -14.797  1.00 96.38  ? 1060 LYS B NZ  1 
ATOM   5394  N N   . ASP B 1 265 ? -13.920 -0.794  -16.987  1.00 90.07  ? 1061 ASP B N   1 
ATOM   5395  C CA  . ASP B 1 265 ? -14.860 -1.261  -18.001  1.00 92.95  ? 1061 ASP B CA  1 
ATOM   5396  C C   . ASP B 1 265 ? -15.459 -2.615  -17.618  1.00 98.28  ? 1061 ASP B C   1 
ATOM   5397  O O   . ASP B 1 265 ? -16.681 -2.775  -17.557  1.00 94.09  ? 1061 ASP B O   1 
ATOM   5398  C CB  . ASP B 1 265 ? -14.173 -1.369  -19.367  1.00 97.33  ? 1061 ASP B CB  1 
ATOM   5399  C CG  . ASP B 1 265 ? -13.511 -0.072  -19.797  1.00 96.34  ? 1061 ASP B CG  1 
ATOM   5400  O OD1 . ASP B 1 265 ? -13.832 0.986   -19.217  1.00 97.81  ? 1061 ASP B OD1 1 
ATOM   5401  O OD2 . ASP B 1 265 ? -12.672 -0.113  -20.723  1.00 87.17  ? 1061 ASP B OD2 1 
ATOM   5402  N N   . GLU B 1 266 ? -14.589 -3.588  -17.361  1.00 103.54 ? 1062 GLU B N   1 
ATOM   5403  C CA  . GLU B 1 266 ? -15.024 -4.928  -16.980  1.00 101.23 ? 1062 GLU B CA  1 
ATOM   5404  C C   . GLU B 1 266 ? -15.826 -4.900  -15.682  1.00 94.47  ? 1062 GLU B C   1 
ATOM   5405  O O   . GLU B 1 266 ? -16.748 -5.693  -15.493  1.00 93.72  ? 1062 GLU B O   1 
ATOM   5406  C CB  . GLU B 1 266 ? -13.822 -5.854  -16.819  1.00 103.68 ? 1062 GLU B CB  1 
ATOM   5407  C CG  . GLU B 1 266 ? -12.883 -5.866  -18.006  1.00 105.77 ? 1062 GLU B CG  1 
ATOM   5408  C CD  . GLU B 1 266 ? -11.642 -6.684  -17.733  1.00 119.51 ? 1062 GLU B CD  1 
ATOM   5409  O OE1 . GLU B 1 266 ? -11.697 -7.567  -16.848  1.00 122.80 ? 1062 GLU B OE1 1 
ATOM   5410  O OE2 . GLU B 1 266 ? -10.610 -6.439  -18.392  1.00 123.10 ? 1062 GLU B OE2 1 
ATOM   5411  N N   . ALA B 1 267 ? -15.466 -3.988  -14.787  1.00 94.67  ? 1063 ALA B N   1 
ATOM   5412  C CA  . ALA B 1 267 ? -16.186 -3.825  -13.532  1.00 87.30  ? 1063 ALA B CA  1 
ATOM   5413  C C   . ALA B 1 267 ? -17.636 -3.438  -13.789  1.00 87.51  ? 1063 ALA B C   1 
ATOM   5414  O O   . ALA B 1 267 ? -18.557 -4.096  -13.302  1.00 90.35  ? 1063 ALA B O   1 
ATOM   5415  C CB  . ALA B 1 267 ? -15.505 -2.784  -12.663  1.00 89.91  ? 1063 ALA B CB  1 
ATOM   5416  N N   . GLU B 1 268 ? -17.839 -2.371  -14.559  1.00 89.25  ? 1064 GLU B N   1 
ATOM   5417  C CA  . GLU B 1 268 ? -19.194 -1.922  -14.871  1.00 88.71  ? 1064 GLU B CA  1 
ATOM   5418  C C   . GLU B 1 268 ? -19.973 -2.988  -15.638  1.00 86.95  ? 1064 GLU B C   1 
ATOM   5419  O O   . GLU B 1 268 ? -21.157 -3.219  -15.373  1.00 83.63  ? 1064 GLU B O   1 
ATOM   5420  C CB  . GLU B 1 268 ? -19.181 -0.588  -15.633  1.00 91.56  ? 1064 GLU B CB  1 
ATOM   5421  C CG  . GLU B 1 268 ? -18.386 -0.587  -16.928  1.00 94.75  ? 1064 GLU B CG  1 
ATOM   5422  C CD  . GLU B 1 268 ? -18.330 0.783   -17.581  1.00 89.92  ? 1064 GLU B CD  1 
ATOM   5423  O OE1 . GLU B 1 268 ? -17.581 0.941   -18.567  1.00 88.21  ? 1064 GLU B OE1 1 
ATOM   5424  O OE2 . GLU B 1 268 ? -19.035 1.700   -17.107  1.00 87.20  ? 1064 GLU B OE2 1 
ATOM   5425  N N   . LYS B 1 269 ? -19.304 -3.643  -16.581  1.00 89.16  ? 1065 LYS B N   1 
ATOM   5426  C CA  . LYS B 1 269 ? -19.922 -4.739  -17.318  1.00 89.81  ? 1065 LYS B CA  1 
ATOM   5427  C C   . LYS B 1 269 ? -20.463 -5.785  -16.344  1.00 89.47  ? 1065 LYS B C   1 
ATOM   5428  O O   . LYS B 1 269 ? -21.638 -6.166  -16.407  1.00 85.60  ? 1065 LYS B O   1 
ATOM   5429  C CB  . LYS B 1 269 ? -18.915 -5.364  -18.284  1.00 93.22  ? 1065 LYS B CB  1 
ATOM   5430  C CG  . LYS B 1 269 ? -18.409 -4.395  -19.346  1.00 95.76  ? 1065 LYS B CG  1 
ATOM   5431  C CD  . LYS B 1 269 ? -17.188 -4.937  -20.077  1.00 97.67  ? 1065 LYS B CD  1 
ATOM   5432  C CE  . LYS B 1 269 ? -16.667 -3.938  -21.100  1.00 91.00  ? 1065 LYS B CE  1 
ATOM   5433  N NZ  . LYS B 1 269 ? -15.478 -4.454  -21.832  1.00 77.93  ? 1065 LYS B NZ  1 
ATOM   5434  N N   . LEU B 1 270 ? -19.599 -6.228  -15.433  1.00 91.46  ? 1066 LEU B N   1 
ATOM   5435  C CA  . LEU B 1 270 ? -19.984 -7.181  -14.397  1.00 84.75  ? 1066 LEU B CA  1 
ATOM   5436  C C   . LEU B 1 270 ? -21.145 -6.666  -13.557  1.00 87.13  ? 1066 LEU B C   1 
ATOM   5437  O O   . LEU B 1 270 ? -21.995 -7.444  -13.131  1.00 91.66  ? 1066 LEU B O   1 
ATOM   5438  C CB  . LEU B 1 270 ? -18.800 -7.492  -13.485  1.00 76.20  ? 1066 LEU B CB  1 
ATOM   5439  C CG  . LEU B 1 270 ? -17.665 -8.304  -14.100  1.00 78.51  ? 1066 LEU B CG  1 
ATOM   5440  C CD1 . LEU B 1 270 ? -16.576 -8.514  -13.068  1.00 85.45  ? 1066 LEU B CD1 1 
ATOM   5441  C CD2 . LEU B 1 270 ? -18.180 -9.632  -14.627  1.00 80.08  ? 1066 LEU B CD2 1 
ATOM   5442  N N   . PHE B 1 271 ? -21.178 -5.358  -13.319  1.00 84.48  ? 1067 PHE B N   1 
ATOM   5443  C CA  . PHE B 1 271 ? -22.263 -4.759  -12.551  1.00 84.75  ? 1067 PHE B CA  1 
ATOM   5444  C C   . PHE B 1 271 ? -23.599 -4.916  -13.265  1.00 89.14  ? 1067 PHE B C   1 
ATOM   5445  O O   . PHE B 1 271 ? -24.575 -5.382  -12.675  1.00 89.34  ? 1067 PHE B O   1 
ATOM   5446  C CB  . PHE B 1 271 ? -22.001 -3.281  -12.281  1.00 83.77  ? 1067 PHE B CB  1 
ATOM   5447  C CG  . PHE B 1 271 ? -23.198 -2.549  -11.740  1.00 81.47  ? 1067 PHE B CG  1 
ATOM   5448  C CD1 . PHE B 1 271 ? -23.485 -2.566  -10.385  1.00 82.32  ? 1067 PHE B CD1 1 
ATOM   5449  C CD2 . PHE B 1 271 ? -24.040 -1.849  -12.590  1.00 82.87  ? 1067 PHE B CD2 1 
ATOM   5450  C CE1 . PHE B 1 271 ? -24.589 -1.897  -9.886   1.00 83.38  ? 1067 PHE B CE1 1 
ATOM   5451  C CE2 . PHE B 1 271 ? -25.144 -1.177  -12.100  1.00 82.39  ? 1067 PHE B CE2 1 
ATOM   5452  C CZ  . PHE B 1 271 ? -25.420 -1.201  -10.745  1.00 81.66  ? 1067 PHE B CZ  1 
ATOM   5453  N N   . ASN B 1 272 ? -23.643 -4.511  -14.531  1.00 91.51  ? 1068 ASN B N   1 
ATOM   5454  C CA  . ASN B 1 272 ? -24.836 -4.721  -15.347  1.00 97.56  ? 1068 ASN B CA  1 
ATOM   5455  C C   . ASN B 1 272 ? -25.261 -6.191  -15.326  1.00 99.70  ? 1068 ASN B C   1 
ATOM   5456  O O   . ASN B 1 272 ? -26.440 -6.505  -15.130  1.00 96.79  ? 1068 ASN B O   1 
ATOM   5457  C CB  . ASN B 1 272 ? -24.612 -4.241  -16.786  1.00 95.29  ? 1068 ASN B CB  1 
ATOM   5458  C CG  . ASN B 1 272 ? -24.715 -2.726  -16.925  1.00 92.30  ? 1068 ASN B CG  1 
ATOM   5459  O OD1 . ASN B 1 272 ? -25.792 -2.183  -17.188  1.00 82.51  ? 1068 ASN B OD1 1 
ATOM   5460  N ND2 . ASN B 1 272 ? -23.590 -2.039  -16.757  1.00 91.04  ? 1068 ASN B ND2 1 
ATOM   5461  N N   . GLN B 1 273 ? -24.289 -7.084  -15.512  1.00 101.00 ? 1069 GLN B N   1 
ATOM   5462  C CA  . GLN B 1 273 ? -24.541 -8.525  -15.453  1.00 97.62  ? 1069 GLN B CA  1 
ATOM   5463  C C   . GLN B 1 273 ? -25.254 -8.927  -14.162  1.00 95.05  ? 1069 GLN B C   1 
ATOM   5464  O O   . GLN B 1 273 ? -26.301 -9.579  -14.191  1.00 101.04 ? 1069 GLN B O   1 
ATOM   5465  C CB  . GLN B 1 273 ? -23.229 -9.302  -15.586  1.00 94.90  ? 1069 GLN B CB  1 
ATOM   5466  C CG  . GLN B 1 273 ? -23.372 -10.809 -15.436  1.00 100.25 ? 1069 GLN B CG  1 
ATOM   5467  C CD  . GLN B 1 273 ? -22.046 -11.540 -15.574  1.00 114.74 ? 1069 GLN B CD  1 
ATOM   5468  O OE1 . GLN B 1 273 ? -21.885 -12.656 -15.078  1.00 126.78 ? 1069 GLN B OE1 1 
ATOM   5469  N NE2 . GLN B 1 273 ? -21.089 -10.913 -16.254  1.00 107.04 ? 1069 GLN B NE2 1 
ATOM   5470  N N   . ASP B 1 274 ? -24.680 -8.537  -13.030  1.00 88.06  ? 1070 ASP B N   1 
ATOM   5471  C CA  . ASP B 1 274 ? -25.251 -8.867  -11.732  1.00 92.11  ? 1070 ASP B CA  1 
ATOM   5472  C C   . ASP B 1 274 ? -26.646 -8.272  -11.572  1.00 92.62  ? 1070 ASP B C   1 
ATOM   5473  O O   . ASP B 1 274 ? -27.519 -8.869  -10.937  1.00 92.64  ? 1070 ASP B O   1 
ATOM   5474  C CB  . ASP B 1 274 ? -24.327 -8.383  -10.614  1.00 98.30  ? 1070 ASP B CB  1 
ATOM   5475  C CG  . ASP B 1 274 ? -22.919 -8.934  -10.745  1.00 99.50  ? 1070 ASP B CG  1 
ATOM   5476  O OD1 . ASP B 1 274 ? -21.950 -8.220  -10.403  1.00 91.23  ? 1070 ASP B OD1 1 
ATOM   5477  O OD2 . ASP B 1 274 ? -22.785 -10.087 -11.204  1.00 106.00 ? 1070 ASP B OD2 1 
ATOM   5478  N N   . VAL B 1 275 ? -26.850 -7.097  -12.159  1.00 91.00  ? 1071 VAL B N   1 
ATOM   5479  C CA  . VAL B 1 275 ? -28.141 -6.423  -12.095  1.00 94.64  ? 1071 VAL B CA  1 
ATOM   5480  C C   . VAL B 1 275 ? -29.219 -7.220  -12.823  1.00 102.20 ? 1071 VAL B C   1 
ATOM   5481  O O   . VAL B 1 275 ? -30.262 -7.544  -12.248  1.00 103.49 ? 1071 VAL B O   1 
ATOM   5482  C CB  . VAL B 1 275 ? -28.072 -5.013  -12.695  1.00 85.37  ? 1071 VAL B CB  1 
ATOM   5483  C CG1 . VAL B 1 275 ? -29.453 -4.382  -12.706  1.00 90.72  ? 1071 VAL B CG1 1 
ATOM   5484  C CG2 . VAL B 1 275 ? -27.101 -4.153  -11.913  1.00 80.60  ? 1071 VAL B CG2 1 
ATOM   5485  N N   . ASP B 1 276 ? -28.966 -7.536  -14.089  1.00 103.81 ? 1072 ASP B N   1 
ATOM   5486  C CA  . ASP B 1 276 ? -29.903 -8.345  -14.861  1.00 107.80 ? 1072 ASP B CA  1 
ATOM   5487  C C   . ASP B 1 276 ? -30.160 -9.686  -14.188  1.00 109.96 ? 1072 ASP B C   1 
ATOM   5488  O O   . ASP B 1 276 ? -31.301 -10.137 -14.106  1.00 109.58 ? 1072 ASP B O   1 
ATOM   5489  C CB  . ASP B 1 276 ? -29.388 -8.569  -16.282  1.00 111.92 ? 1072 ASP B CB  1 
ATOM   5490  C CG  . ASP B 1 276 ? -29.439 -7.314  -17.123  1.00 122.54 ? 1072 ASP B CG  1 
ATOM   5491  O OD1 . ASP B 1 276 ? -28.554 -7.146  -17.988  1.00 131.42 ? 1072 ASP B OD1 1 
ATOM   5492  O OD2 . ASP B 1 276 ? -30.362 -6.497  -16.916  1.00 119.87 ? 1072 ASP B OD2 1 
ATOM   5493  N N   . ALA B 1 277 ? -29.091 -10.321 -13.717  1.00 106.81 ? 1073 ALA B N   1 
ATOM   5494  C CA  . ALA B 1 277 ? -29.205 -11.614 -13.052  1.00 109.45 ? 1073 ALA B CA  1 
ATOM   5495  C C   . ALA B 1 277 ? -30.143 -11.525 -11.853  1.00 109.83 ? 1073 ALA B C   1 
ATOM   5496  O O   . ALA B 1 277 ? -31.029 -12.368 -11.667  1.00 118.04 ? 1073 ALA B O   1 
ATOM   5497  C CB  . ALA B 1 277 ? -27.836 -12.109 -12.623  1.00 107.74 ? 1073 ALA B CB  1 
ATOM   5498  N N   . ALA B 1 278 ? -29.939 -10.495 -11.040  1.00 102.68 ? 1074 ALA B N   1 
ATOM   5499  C CA  . ALA B 1 278 ? -30.780 -10.273 -9.874   1.00 107.18 ? 1074 ALA B CA  1 
ATOM   5500  C C   . ALA B 1 278 ? -32.236 -10.041 -10.279  1.00 108.49 ? 1074 ALA B C   1 
ATOM   5501  O O   . ALA B 1 278 ? -33.153 -10.536 -9.625   1.00 103.20 ? 1074 ALA B O   1 
ATOM   5502  C CB  . ALA B 1 278 ? -30.254 -9.109  -9.051   1.00 107.04 ? 1074 ALA B CB  1 
ATOM   5503  N N   . VAL B 1 279 ? -32.444 -9.288  -11.357  1.00 109.40 ? 1075 VAL B N   1 
ATOM   5504  C CA  . VAL B 1 279 ? -33.798 -9.022  -11.840  1.00 107.79 ? 1075 VAL B CA  1 
ATOM   5505  C C   . VAL B 1 279 ? -34.497 -10.315 -12.266  1.00 115.55 ? 1075 VAL B C   1 
ATOM   5506  O O   . VAL B 1 279 ? -35.637 -10.582 -11.866  1.00 120.64 ? 1075 VAL B O   1 
ATOM   5507  C CB  . VAL B 1 279 ? -33.803 -8.016  -13.010  1.00 103.66 ? 1075 VAL B CB  1 
ATOM   5508  C CG1 . VAL B 1 279 ? -35.221 -7.804  -13.518  1.00 100.87 ? 1075 VAL B CG1 1 
ATOM   5509  C CG2 . VAL B 1 279 ? -33.186 -6.693  -12.578  1.00 103.64 ? 1075 VAL B CG2 1 
ATOM   5510  N N   . ARG B 1 280 ? -33.809 -11.113 -13.077  1.00 113.63 ? 1076 ARG B N   1 
ATOM   5511  C CA  . ARG B 1 280 ? -34.311 -12.423 -13.471  1.00 114.20 ? 1076 ARG B CA  1 
ATOM   5512  C C   . ARG B 1 280 ? -34.670 -13.220 -12.224  1.00 120.31 ? 1076 ARG B C   1 
ATOM   5513  O O   . ARG B 1 280 ? -35.682 -13.920 -12.194  1.00 119.32 ? 1076 ARG B O   1 
ATOM   5514  C CB  . ARG B 1 280 ? -33.272 -13.177 -14.302  1.00 105.52 ? 1076 ARG B CB  1 
ATOM   5515  N N   . GLY B 1 281 ? -33.837 -13.104 -11.193  1.00 122.22 ? 1077 GLY B N   1 
ATOM   5516  C CA  . GLY B 1 281 ? -34.129 -13.727 -9.915   1.00 120.73 ? 1077 GLY B CA  1 
ATOM   5517  C C   . GLY B 1 281 ? -35.453 -13.260 -9.329   1.00 125.96 ? 1077 GLY B C   1 
ATOM   5518  O O   . GLY B 1 281 ? -36.267 -14.076 -8.891   1.00 128.88 ? 1077 GLY B O   1 
ATOM   5519  N N   . ILE B 1 282 ? -35.669 -11.946 -9.323   1.00 121.86 ? 1078 ILE B N   1 
ATOM   5520  C CA  . ILE B 1 282 ? -36.893 -11.365 -8.770   1.00 118.07 ? 1078 ILE B CA  1 
ATOM   5521  C C   . ILE B 1 282 ? -38.136 -11.857 -9.489   1.00 119.40 ? 1078 ILE B C   1 
ATOM   5522  O O   . ILE B 1 282 ? -39.075 -12.349 -8.863   1.00 122.85 ? 1078 ILE B O   1 
ATOM   5523  C CB  . ILE B 1 282 ? -36.888 -9.822  -8.839   1.00 112.40 ? 1078 ILE B CB  1 
ATOM   5524  C CG1 . ILE B 1 282 ? -35.910 -9.238  -7.818   1.00 109.30 ? 1078 ILE B CG1 1 
ATOM   5525  C CG2 . ILE B 1 282 ? -38.292 -9.275  -8.602   1.00 101.38 ? 1078 ILE B CG2 1 
ATOM   5526  C CD1 . ILE B 1 282 ? -35.998 -7.728  -7.681   1.00 96.43  ? 1078 ILE B CD1 1 
ATOM   5527  N N   . LEU B 1 283 ? -38.144 -11.712 -10.809  1.00 119.28 ? 1079 LEU B N   1 
ATOM   5528  C CA  . LEU B 1 283 ? -39.319 -12.077 -11.593  1.00 126.29 ? 1079 LEU B CA  1 
ATOM   5529  C C   . LEU B 1 283 ? -39.567 -13.588 -11.587  1.00 128.68 ? 1079 LEU B C   1 
ATOM   5530  O O   . LEU B 1 283 ? -40.716 -14.038 -11.583  1.00 121.43 ? 1079 LEU B O   1 
ATOM   5531  C CB  . LEU B 1 283 ? -39.186 -11.553 -13.025  1.00 122.33 ? 1079 LEU B CB  1 
ATOM   5532  C CG  . LEU B 1 283 ? -39.049 -10.035 -13.157  1.00 107.42 ? 1079 LEU B CG  1 
ATOM   5533  C CD1 . LEU B 1 283 ? -38.770 -9.651  -14.595  1.00 101.33 ? 1079 LEU B CD1 1 
ATOM   5534  C CD2 . LEU B 1 283 ? -40.295 -9.331  -12.642  1.00 108.19 ? 1079 LEU B CD2 1 
ATOM   5535  N N   . ARG B 1 284 ? -38.484 -14.362 -11.575  1.00 128.76 ? 1080 ARG B N   1 
ATOM   5536  C CA  . ARG B 1 284 ? -38.574 -15.819 -11.597  1.00 126.05 ? 1080 ARG B CA  1 
ATOM   5537  C C   . ARG B 1 284 ? -39.265 -16.368 -10.354  1.00 127.89 ? 1080 ARG B C   1 
ATOM   5538  O O   . ARG B 1 284 ? -39.823 -17.464 -10.378  1.00 123.29 ? 1080 ARG B O   1 
ATOM   5539  C CB  . ARG B 1 284 ? -37.184 -16.441 -11.743  1.00 123.24 ? 1080 ARG B CB  1 
ATOM   5540  N N   . ASN B 1 285 ? -39.221 -15.599 -9.270   1.00 132.59 ? 1081 ASN B N   1 
ATOM   5541  C CA  . ASN B 1 285 ? -39.837 -16.005 -8.010   1.00 134.52 ? 1081 ASN B CA  1 
ATOM   5542  C C   . ASN B 1 285 ? -41.304 -15.590 -7.937   1.00 137.73 ? 1081 ASN B C   1 
ATOM   5543  O O   . ASN B 1 285 ? -41.660 -14.465 -8.295   1.00 133.34 ? 1081 ASN B O   1 
ATOM   5544  C CB  . ASN B 1 285 ? -39.061 -15.428 -6.822   1.00 132.63 ? 1081 ASN B CB  1 
ATOM   5545  C CG  . ASN B 1 285 ? -39.414 -16.103 -5.506   1.00 130.03 ? 1081 ASN B CG  1 
ATOM   5546  O OD1 . ASN B 1 285 ? -40.310 -15.659 -4.787   1.00 127.69 ? 1081 ASN B OD1 1 
ATOM   5547  N ND2 . ASN B 1 285 ? -38.705 -17.179 -5.185   1.00 119.11 ? 1081 ASN B ND2 1 
ATOM   5548  N N   . ALA B 1 286 ? -42.149 -16.505 -7.471   1.00 141.51 ? 1082 ALA B N   1 
ATOM   5549  C CA  . ALA B 1 286 ? -43.588 -16.269 -7.412   1.00 137.82 ? 1082 ALA B CA  1 
ATOM   5550  C C   . ALA B 1 286 ? -43.964 -15.239 -6.351   1.00 131.83 ? 1082 ALA B C   1 
ATOM   5551  O O   . ALA B 1 286 ? -44.875 -14.435 -6.552   1.00 130.39 ? 1082 ALA B O   1 
ATOM   5552  C CB  . ALA B 1 286 ? -44.331 -17.578 -7.172   1.00 129.09 ? 1082 ALA B CB  1 
ATOM   5553  N N   . LYS B 1 287 ? -43.256 -15.259 -5.227   1.00 128.64 ? 1083 LYS B N   1 
ATOM   5554  C CA  . LYS B 1 287 ? -43.570 -14.371 -4.113   1.00 133.35 ? 1083 LYS B CA  1 
ATOM   5555  C C   . LYS B 1 287 ? -43.142 -12.925 -4.373   1.00 131.89 ? 1083 LYS B C   1 
ATOM   5556  O O   . LYS B 1 287 ? -43.791 -11.984 -3.917   1.00 129.85 ? 1083 LYS B O   1 
ATOM   5557  C CB  . LYS B 1 287 ? -42.917 -14.888 -2.827   1.00 133.70 ? 1083 LYS B CB  1 
ATOM   5558  N N   . LEU B 1 288 ? -42.044 -12.759 -5.100   1.00 130.11 ? 1084 LEU B N   1 
ATOM   5559  C CA  . LEU B 1 288 ? -41.470 -11.439 -5.345   1.00 132.13 ? 1084 LEU B CA  1 
ATOM   5560  C C   . LEU B 1 288 ? -42.136 -10.654 -6.478   1.00 130.51 ? 1084 LEU B C   1 
ATOM   5561  O O   . LEU B 1 288 ? -42.289 -9.434  -6.398   1.00 125.97 ? 1084 LEU B O   1 
ATOM   5562  C CB  . LEU B 1 288 ? -39.971 -11.573 -5.608   1.00 132.03 ? 1084 LEU B CB  1 
ATOM   5563  C CG  . LEU B 1 288 ? -39.209 -12.251 -4.470   1.00 127.53 ? 1084 LEU B CG  1 
ATOM   5564  C CD1 . LEU B 1 288 ? -37.767 -12.534 -4.858   1.00 130.83 ? 1084 LEU B CD1 1 
ATOM   5565  C CD2 . LEU B 1 288 ? -39.277 -11.396 -3.213   1.00 124.70 ? 1084 LEU B CD2 1 
ATOM   5566  N N   . LYS B 1 289 ? -42.535 -11.364 -7.528   1.00 131.47 ? 1085 LYS B N   1 
ATOM   5567  C CA  . LYS B 1 289 ? -43.003 -10.731 -8.759   1.00 131.39 ? 1085 LYS B CA  1 
ATOM   5568  C C   . LYS B 1 289 ? -44.073 -9.651  -8.549   1.00 134.07 ? 1085 LYS B C   1 
ATOM   5569  O O   . LYS B 1 289 ? -43.860 -8.491  -8.912   1.00 129.71 ? 1085 LYS B O   1 
ATOM   5570  C CB  . LYS B 1 289 ? -43.494 -11.797 -9.746   1.00 130.09 ? 1085 LYS B CB  1 
ATOM   5571  C CG  . LYS B 1 289 ? -44.191 -11.247 -10.971  1.00 128.39 ? 1085 LYS B CG  1 
ATOM   5572  C CD  . LYS B 1 289 ? -44.749 -12.373 -11.822  1.00 127.92 ? 1085 LYS B CD  1 
ATOM   5573  C CE  . LYS B 1 289 ? -45.510 -11.826 -13.012  1.00 133.25 ? 1085 LYS B CE  1 
ATOM   5574  N NZ  . LYS B 1 289 ? -46.562 -10.867 -12.581  1.00 136.24 ? 1085 LYS B NZ  1 
ATOM   5575  N N   . PRO B 1 290 ? -45.222 -10.020 -7.953   1.00 142.76 ? 1086 PRO B N   1 
ATOM   5576  C CA  . PRO B 1 290 ? -46.321 -9.055  -7.801   1.00 141.10 ? 1086 PRO B CA  1 
ATOM   5577  C C   . PRO B 1 290 ? -45.920 -7.833  -6.977   1.00 133.06 ? 1086 PRO B C   1 
ATOM   5578  O O   . PRO B 1 290 ? -46.229 -6.698  -7.356   1.00 129.64 ? 1086 PRO B O   1 
ATOM   5579  C CB  . PRO B 1 290 ? -47.392 -9.858  -7.055   1.00 140.89 ? 1086 PRO B CB  1 
ATOM   5580  C CG  . PRO B 1 290 ? -47.061 -11.287 -7.330   1.00 142.99 ? 1086 PRO B CG  1 
ATOM   5581  C CD  . PRO B 1 290 ? -45.567 -11.334 -7.385   1.00 140.48 ? 1086 PRO B CD  1 
ATOM   5582  N N   . VAL B 1 291 ? -45.246 -8.073  -5.856   1.00 126.22 ? 1087 VAL B N   1 
ATOM   5583  C CA  . VAL B 1 291 ? -44.777 -6.992  -5.003   1.00 118.48 ? 1087 VAL B CA  1 
ATOM   5584  C C   . VAL B 1 291 ? -43.918 -6.040  -5.815   1.00 117.70 ? 1087 VAL B C   1 
ATOM   5585  O O   . VAL B 1 291 ? -44.104 -4.823  -5.774   1.00 115.11 ? 1087 VAL B O   1 
ATOM   5586  C CB  . VAL B 1 291 ? -43.947 -7.529  -3.835   1.00 115.11 ? 1087 VAL B CB  1 
ATOM   5587  C CG1 . VAL B 1 291 ? -43.452 -6.380  -2.972   1.00 118.25 ? 1087 VAL B CG1 1 
ATOM   5588  C CG2 . VAL B 1 291 ? -44.772 -8.506  -3.015   1.00 122.91 ? 1087 VAL B CG2 1 
ATOM   5589  N N   . TYR B 1 292 ? -42.981 -6.610  -6.563   1.00 120.78 ? 1088 TYR B N   1 
ATOM   5590  C CA  . TYR B 1 292 ? -42.108 -5.826  -7.424   1.00 120.46 ? 1088 TYR B CA  1 
ATOM   5591  C C   . TYR B 1 292 ? -42.917 -4.974  -8.394   1.00 113.26 ? 1088 TYR B C   1 
ATOM   5592  O O   . TYR B 1 292 ? -42.627 -3.795  -8.585   1.00 110.15 ? 1088 TYR B O   1 
ATOM   5593  C CB  . TYR B 1 292 ? -41.152 -6.738  -8.194   1.00 118.09 ? 1088 TYR B CB  1 
ATOM   5594  C CG  . TYR B 1 292 ? -40.426 -6.039  -9.316   1.00 115.36 ? 1088 TYR B CG  1 
ATOM   5595  C CD1 . TYR B 1 292 ? -39.276 -5.300  -9.073   1.00 112.23 ? 1088 TYR B CD1 1 
ATOM   5596  C CD2 . TYR B 1 292 ? -40.896 -6.113  -10.622  1.00 116.68 ? 1088 TYR B CD2 1 
ATOM   5597  C CE1 . TYR B 1 292 ? -38.612 -4.657  -10.100  1.00 110.51 ? 1088 TYR B CE1 1 
ATOM   5598  C CE2 . TYR B 1 292 ? -40.241 -5.475  -11.653  1.00 114.02 ? 1088 TYR B CE2 1 
ATOM   5599  C CZ  . TYR B 1 292 ? -39.100 -4.749  -11.388  1.00 114.06 ? 1088 TYR B CZ  1 
ATOM   5600  O OH  . TYR B 1 292 ? -38.450 -4.112  -12.420  1.00 118.17 ? 1088 TYR B OH  1 
ATOM   5601  N N   . ASP B 1 293 ? -43.934 -5.575  -9.001   1.00 113.77 ? 1089 ASP B N   1 
ATOM   5602  C CA  . ASP B 1 293 ? -44.779 -4.850  -9.940   1.00 116.20 ? 1089 ASP B CA  1 
ATOM   5603  C C   . ASP B 1 293 ? -45.465 -3.654  -9.278   1.00 111.07 ? 1089 ASP B C   1 
ATOM   5604  O O   . ASP B 1 293 ? -45.414 -2.538  -9.794   1.00 112.08 ? 1089 ASP B O   1 
ATOM   5605  C CB  . ASP B 1 293 ? -45.821 -5.785  -10.567  1.00 121.77 ? 1089 ASP B CB  1 
ATOM   5606  C CG  . ASP B 1 293 ? -45.263 -6.589  -11.733  1.00 122.28 ? 1089 ASP B CG  1 
ATOM   5607  O OD1 . ASP B 1 293 ? -44.024 -6.703  -11.845  1.00 120.80 ? 1089 ASP B OD1 1 
ATOM   5608  O OD2 . ASP B 1 293 ? -46.066 -7.108  -12.539  1.00 120.27 ? 1089 ASP B OD2 1 
ATOM   5609  N N   . SER B 1 294 ? -46.081 -3.885  -8.124   1.00 105.13 ? 1090 SER B N   1 
ATOM   5610  C CA  . SER B 1 294 ? -46.916 -2.873  -7.480   1.00 102.26 ? 1090 SER B CA  1 
ATOM   5611  C C   . SER B 1 294 ? -46.163 -1.633  -6.995   1.00 105.27 ? 1090 SER B C   1 
ATOM   5612  O O   . SER B 1 294 ? -46.784 -0.667  -6.550   1.00 112.05 ? 1090 SER B O   1 
ATOM   5613  C CB  . SER B 1 294 ? -47.688 -3.488  -6.317   1.00 104.51 ? 1090 SER B CB  1 
ATOM   5614  O OG  . SER B 1 294 ? -46.798 -3.903  -5.300   1.00 109.35 ? 1090 SER B OG  1 
ATOM   5615  N N   . LEU B 1 295 ? -44.838 -1.655  -7.078   1.00 105.00 ? 1091 LEU B N   1 
ATOM   5616  C CA  . LEU B 1 295 ? -44.025 -0.563  -6.545   1.00 104.44 ? 1091 LEU B CA  1 
ATOM   5617  C C   . LEU B 1 295 ? -43.511 0.379   -7.637   1.00 100.62 ? 1091 LEU B C   1 
ATOM   5618  O O   . LEU B 1 295 ? -43.235 -0.047  -8.761   1.00 101.51 ? 1091 LEU B O   1 
ATOM   5619  C CB  . LEU B 1 295 ? -42.846 -1.126  -5.748   1.00 103.53 ? 1091 LEU B CB  1 
ATOM   5620  C CG  . LEU B 1 295 ? -43.209 -2.142  -4.665   1.00 108.71 ? 1091 LEU B CG  1 
ATOM   5621  C CD1 . LEU B 1 295 ? -41.955 -2.662  -3.981   1.00 101.53 ? 1091 LEU B CD1 1 
ATOM   5622  C CD2 . LEU B 1 295 ? -44.175 -1.534  -3.654   1.00 110.18 ? 1091 LEU B CD2 1 
ATOM   5623  N N   . ASP B 1 296 ? -43.390 1.661   -7.296   1.00 94.25  ? 1092 ASP B N   1 
ATOM   5624  C CA  . ASP B 1 296 ? -42.818 2.665   -8.200   1.00 94.72  ? 1092 ASP B CA  1 
ATOM   5625  C C   . ASP B 1 296 ? -41.308 2.479   -8.400   1.00 92.94  ? 1092 ASP B C   1 
ATOM   5626  O O   . ASP B 1 296 ? -40.652 1.782   -7.624   1.00 98.90  ? 1092 ASP B O   1 
ATOM   5627  C CB  . ASP B 1 296 ? -43.141 4.091   -7.730   1.00 94.41  ? 1092 ASP B CB  1 
ATOM   5628  C CG  . ASP B 1 296 ? -42.710 4.350   -6.299   1.00 91.18  ? 1092 ASP B CG  1 
ATOM   5629  O OD1 . ASP B 1 296 ? -41.755 5.133   -6.090   1.00 82.47  ? 1092 ASP B OD1 1 
ATOM   5630  O OD2 . ASP B 1 296 ? -43.332 3.769   -5.385   1.00 88.37  ? 1092 ASP B OD2 1 
ATOM   5631  N N   . ALA B 1 297 ? -40.771 3.099   -9.447   1.00 83.01  ? 1093 ALA B N   1 
ATOM   5632  C CA  . ALA B 1 297 ? -39.389 2.880   -9.879   1.00 81.40  ? 1093 ALA B CA  1 
ATOM   5633  C C   . ALA B 1 297 ? -38.351 2.925   -8.754   1.00 77.17  ? 1093 ALA B C   1 
ATOM   5634  O O   . ALA B 1 297 ? -37.485 2.051   -8.659   1.00 70.00  ? 1093 ALA B O   1 
ATOM   5635  C CB  . ALA B 1 297 ? -39.025 3.885   -10.970  1.00 79.68  ? 1093 ALA B CB  1 
ATOM   5636  N N   . VAL B 1 298 ? -38.433 3.951   -7.916   1.00 80.52  ? 1094 VAL B N   1 
ATOM   5637  C CA  . VAL B 1 298 ? -37.517 4.099   -6.795   1.00 75.70  ? 1094 VAL B CA  1 
ATOM   5638  C C   . VAL B 1 298 ? -37.497 2.835   -5.946   1.00 79.10  ? 1094 VAL B C   1 
ATOM   5639  O O   . VAL B 1 298 ? -36.478 2.137   -5.861   1.00 83.79  ? 1094 VAL B O   1 
ATOM   5640  C CB  . VAL B 1 298 ? -37.913 5.294   -5.913   1.00 80.23  ? 1094 VAL B CB  1 
ATOM   5641  C CG1 . VAL B 1 298 ? -37.057 5.332   -4.661   1.00 80.35  ? 1094 VAL B CG1 1 
ATOM   5642  C CG2 . VAL B 1 298 ? -37.798 6.600   -6.698   1.00 79.47  ? 1094 VAL B CG2 1 
ATOM   5643  N N   . ARG B 1 299 ? -38.636 2.545   -5.324   1.00 80.00  ? 1095 ARG B N   1 
ATOM   5644  C CA  . ARG B 1 299 ? -38.769 1.381   -4.450   1.00 86.03  ? 1095 ARG B CA  1 
ATOM   5645  C C   . ARG B 1 299 ? -38.370 0.079   -5.151   1.00 82.74  ? 1095 ARG B C   1 
ATOM   5646  O O   . ARG B 1 299 ? -37.784 -0.821  -4.540   1.00 80.48  ? 1095 ARG B O   1 
ATOM   5647  C CB  . ARG B 1 299 ? -40.186 1.299   -3.873   1.00 82.72  ? 1095 ARG B CB  1 
ATOM   5648  C CG  . ARG B 1 299 ? -40.549 2.505   -3.015   1.00 85.10  ? 1095 ARG B CG  1 
ATOM   5649  C CD  . ARG B 1 299 ? -41.860 2.311   -2.275   1.00 89.66  ? 1095 ARG B CD  1 
ATOM   5650  N NE  . ARG B 1 299 ? -42.134 3.418   -1.361   1.00 87.86  ? 1095 ARG B NE  1 
ATOM   5651  C CZ  . ARG B 1 299 ? -42.926 4.446   -1.644   1.00 85.22  ? 1095 ARG B CZ  1 
ATOM   5652  N NH1 . ARG B 1 299 ? -43.536 4.517   -2.817   1.00 88.47  ? 1095 ARG B NH1 1 
ATOM   5653  N NH2 . ARG B 1 299 ? -43.115 5.402   -0.750   1.00 84.86  ? 1095 ARG B NH2 1 
ATOM   5654  N N   . ARG B 1 300 ? -38.675 -0.013  -6.439   1.00 83.65  ? 1096 ARG B N   1 
ATOM   5655  C CA  . ARG B 1 300 ? -38.189 -1.127  -7.234   1.00 85.07  ? 1096 ARG B CA  1 
ATOM   5656  C C   . ARG B 1 300 ? -36.670 -1.215  -7.105   1.00 80.15  ? 1096 ARG B C   1 
ATOM   5657  O O   . ARG B 1 300 ? -36.130 -2.259  -6.743   1.00 78.49  ? 1096 ARG B O   1 
ATOM   5658  C CB  . ARG B 1 300 ? -38.603 -0.970  -8.700   1.00 88.66  ? 1096 ARG B CB  1 
ATOM   5659  C CG  . ARG B 1 300 ? -40.071 -1.279  -8.967   1.00 92.16  ? 1096 ARG B CG  1 
ATOM   5660  C CD  . ARG B 1 300 ? -40.381 -1.257  -10.455  1.00 94.94  ? 1096 ARG B CD  1 
ATOM   5661  N NE  . ARG B 1 300 ? -41.703 -1.801  -10.753  1.00 101.46 ? 1096 ARG B NE  1 
ATOM   5662  C CZ  . ARG B 1 300 ? -42.162 -2.008  -11.983  1.00 104.48 ? 1096 ARG B CZ  1 
ATOM   5663  N NH1 . ARG B 1 300 ? -41.404 -1.716  -13.030  1.00 107.24 ? 1096 ARG B NH1 1 
ATOM   5664  N NH2 . ARG B 1 300 ? -43.375 -2.509  -12.169  1.00 105.36 ? 1096 ARG B NH2 1 
ATOM   5665  N N   . ALA B 1 301 ? -35.990 -0.105  -7.380   1.00 80.95  ? 1097 ALA B N   1 
ATOM   5666  C CA  . ALA B 1 301 ? -34.532 -0.048  -7.284   1.00 78.18  ? 1097 ALA B CA  1 
ATOM   5667  C C   . ALA B 1 301 ? -34.051 -0.499  -5.917   1.00 74.72  ? 1097 ALA B C   1 
ATOM   5668  O O   . ALA B 1 301 ? -33.054 -1.211  -5.803   1.00 71.41  ? 1097 ALA B O   1 
ATOM   5669  C CB  . ALA B 1 301 ? -34.035 1.357   -7.568   1.00 82.22  ? 1097 ALA B CB  1 
ATOM   5670  N N   . ALA B 1 302 ? -34.755 -0.069  -4.876   1.00 81.50  ? 1098 ALA B N   1 
ATOM   5671  C CA  . ALA B 1 302 ? -34.429 -0.519  -3.527   1.00 83.86  ? 1098 ALA B CA  1 
ATOM   5672  C C   . ALA B 1 302 ? -34.453 -2.046  -3.463   1.00 86.22  ? 1098 ALA B C   1 
ATOM   5673  O O   . ALA B 1 302 ? -33.491 -2.677  -3.006   1.00 84.23  ? 1098 ALA B O   1 
ATOM   5674  C CB  . ALA B 1 302 ? -35.395 0.079   -2.512   1.00 76.59  ? 1098 ALA B CB  1 
ATOM   5675  N N   . LEU B 1 303 ? -35.551 -2.637  -3.933   1.00 91.46  ? 1099 LEU B N   1 
ATOM   5676  C CA  . LEU B 1 303 ? -35.697 -4.093  -3.905   1.00 89.45  ? 1099 LEU B CA  1 
ATOM   5677  C C   . LEU B 1 303 ? -34.564 -4.775  -4.664   1.00 88.74  ? 1099 LEU B C   1 
ATOM   5678  O O   . LEU B 1 303 ? -34.035 -5.801  -4.228   1.00 88.30  ? 1099 LEU B O   1 
ATOM   5679  C CB  . LEU B 1 303 ? -37.046 -4.526  -4.474   1.00 78.22  ? 1099 LEU B CB  1 
ATOM   5680  C CG  . LEU B 1 303 ? -37.442 -5.951  -4.086   1.00 77.46  ? 1099 LEU B CG  1 
ATOM   5681  C CD1 . LEU B 1 303 ? -37.437 -6.113  -2.572   1.00 72.29  ? 1099 LEU B CD1 1 
ATOM   5682  C CD2 . LEU B 1 303 ? -38.797 -6.305  -4.659   1.00 89.98  ? 1099 LEU B CD2 1 
ATOM   5683  N N   . ILE B 1 304 ? -34.197 -4.196  -5.801   1.00 86.63  ? 1100 ILE B N   1 
ATOM   5684  C CA  . ILE B 1 304 ? -33.053 -4.674  -6.562   1.00 87.24  ? 1100 ILE B CA  1 
ATOM   5685  C C   . ILE B 1 304 ? -31.798 -4.633  -5.692   1.00 90.37  ? 1100 ILE B C   1 
ATOM   5686  O O   . ILE B 1 304 ? -30.952 -5.519  -5.774   1.00 96.43  ? 1100 ILE B O   1 
ATOM   5687  C CB  . ILE B 1 304 ? -32.826 -3.830  -7.830   1.00 89.82  ? 1100 ILE B CB  1 
ATOM   5688  C CG1 . ILE B 1 304 ? -34.110 -3.755  -8.661   1.00 88.64  ? 1100 ILE B CG1 1 
ATOM   5689  C CG2 . ILE B 1 304 ? -31.682 -4.399  -8.655   1.00 84.99  ? 1100 ILE B CG2 1 
ATOM   5690  C CD1 . ILE B 1 304 ? -33.962 -2.965  -9.945   1.00 81.23  ? 1100 ILE B CD1 1 
ATOM   5691  N N   . ASN B 1 305 ? -31.692 -3.603  -4.856   1.00 83.36  ? 1101 ASN B N   1 
ATOM   5692  C CA  . ASN B 1 305 ? -30.578 -3.464  -3.921   1.00 80.52  ? 1101 ASN B CA  1 
ATOM   5693  C C   . ASN B 1 305 ? -30.521 -4.624  -2.925   1.00 83.09  ? 1101 ASN B C   1 
ATOM   5694  O O   . ASN B 1 305 ? -29.491 -5.303  -2.785   1.00 82.59  ? 1101 ASN B O   1 
ATOM   5695  C CB  . ASN B 1 305 ? -30.692 -2.129  -3.177   1.00 73.62  ? 1101 ASN B CB  1 
ATOM   5696  C CG  . ASN B 1 305 ? -29.471 -1.815  -2.337   1.00 70.17  ? 1101 ASN B CG  1 
ATOM   5697  O OD1 . ASN B 1 305 ? -28.828 -2.707  -1.786   1.00 67.66  ? 1101 ASN B OD1 1 
ATOM   5698  N ND2 . ASN B 1 305 ? -29.148 -0.535  -2.232   1.00 68.89  ? 1101 ASN B ND2 1 
ATOM   5699  N N   . MET B 1 306 ? -31.636 -4.851  -2.234   1.00 89.07  ? 1102 MET B N   1 
ATOM   5700  C CA  . MET B 1 306 ? -31.715 -5.949  -1.271   1.00 91.11  ? 1102 MET B CA  1 
ATOM   5701  C C   . MET B 1 306 ? -31.392 -7.288  -1.927   1.00 94.77  ? 1102 MET B C   1 
ATOM   5702  O O   . MET B 1 306 ? -30.543 -8.039  -1.444   1.00 93.85  ? 1102 MET B O   1 
ATOM   5703  C CB  . MET B 1 306 ? -33.095 -6.007  -0.606   1.00 90.49  ? 1102 MET B CB  1 
ATOM   5704  C CG  . MET B 1 306 ? -33.280 -5.015  0.527    1.00 86.32  ? 1102 MET B CG  1 
ATOM   5705  S SD  . MET B 1 306 ? -34.899 -5.144  1.302    1.00 82.04  ? 1102 MET B SD  1 
ATOM   5706  C CE  . MET B 1 306 ? -34.759 -6.715  2.144    1.00 96.68  ? 1102 MET B CE  1 
ATOM   5707  N N   . VAL B 1 307 ? -32.072 -7.583  -3.029   1.00 94.15  ? 1103 VAL B N   1 
ATOM   5708  C CA  . VAL B 1 307 ? -31.831 -8.821  -3.761   1.00 98.25  ? 1103 VAL B CA  1 
ATOM   5709  C C   . VAL B 1 307 ? -30.387 -8.883  -4.253   1.00 97.92  ? 1103 VAL B C   1 
ATOM   5710  O O   . VAL B 1 307 ? -29.860 -9.959  -4.545   1.00 91.47  ? 1103 VAL B O   1 
ATOM   5711  C CB  . VAL B 1 307 ? -32.786 -8.958  -4.956   1.00 99.43  ? 1103 VAL B CB  1 
ATOM   5712  C CG1 . VAL B 1 307 ? -32.462 -10.211 -5.751   1.00 104.73 ? 1103 VAL B CG1 1 
ATOM   5713  C CG2 . VAL B 1 307 ? -34.231 -8.980  -4.477   1.00 100.13 ? 1103 VAL B CG2 1 
ATOM   5714  N N   . PHE B 1 308 ? -29.758 -7.715  -4.337   1.00 103.58 ? 1104 PHE B N   1 
ATOM   5715  C CA  . PHE B 1 308 ? -28.392 -7.589  -4.840   1.00 105.72 ? 1104 PHE B CA  1 
ATOM   5716  C C   . PHE B 1 308 ? -27.365 -7.976  -3.777   1.00 97.22  ? 1104 PHE B C   1 
ATOM   5717  O O   . PHE B 1 308 ? -26.333 -8.576  -4.089   1.00 94.72  ? 1104 PHE B O   1 
ATOM   5718  C CB  . PHE B 1 308 ? -28.134 -6.158  -5.332   1.00 101.14 ? 1104 PHE B CB  1 
ATOM   5719  C CG  . PHE B 1 308 ? -26.967 -6.034  -6.271   1.00 87.90  ? 1104 PHE B CG  1 
ATOM   5720  C CD1 . PHE B 1 308 ? -27.160 -6.054  -7.640   1.00 84.93  ? 1104 PHE B CD1 1 
ATOM   5721  C CD2 . PHE B 1 308 ? -25.679 -5.894  -5.785   1.00 91.86  ? 1104 PHE B CD2 1 
ATOM   5722  C CE1 . PHE B 1 308 ? -26.093 -5.940  -8.506   1.00 90.52  ? 1104 PHE B CE1 1 
ATOM   5723  C CE2 . PHE B 1 308 ? -24.607 -5.780  -6.647   1.00 93.09  ? 1104 PHE B CE2 1 
ATOM   5724  C CZ  . PHE B 1 308 ? -24.814 -5.803  -8.009   1.00 90.52  ? 1104 PHE B CZ  1 
ATOM   5725  N N   . GLN B 1 309 ? -27.640 -7.632  -2.523   1.00 90.55  ? 1105 GLN B N   1 
ATOM   5726  C CA  . GLN B 1 309 ? -26.749 -8.065  -1.447   1.00 91.52  ? 1105 GLN B CA  1 
ATOM   5727  C C   . GLN B 1 309 ? -27.055 -9.485  -0.951   1.00 100.78 ? 1105 GLN B C   1 
ATOM   5728  O O   . GLN B 1 309 ? -26.216 -10.382 -1.061   1.00 99.20  ? 1105 GLN B O   1 
ATOM   5729  C CB  . GLN B 1 309 ? -26.748 -7.079  -0.279   1.00 87.95  ? 1105 GLN B CB  1 
ATOM   5730  C CG  . GLN B 1 309 ? -25.650 -7.359  0.735    1.00 86.91  ? 1105 GLN B CG  1 
ATOM   5731  C CD  . GLN B 1 309 ? -25.638 -6.367  1.875    1.00 93.49  ? 1105 GLN B CD  1 
ATOM   5732  O OE1 . GLN B 1 309 ? -26.557 -5.560  2.019    1.00 89.23  ? 1105 GLN B OE1 1 
ATOM   5733  N NE2 . GLN B 1 309 ? -24.590 -6.417  2.696    1.00 95.81  ? 1105 GLN B NE2 1 
ATOM   5734  N N   . MET B 1 310 ? -28.252 -9.676  -0.396   1.00 105.70 ? 1106 MET B N   1 
ATOM   5735  C CA  . MET B 1 310 ? -28.644 -10.949 0.217    1.00 103.95 ? 1106 MET B CA  1 
ATOM   5736  C C   . MET B 1 310 ? -28.894 -12.082 -0.780   1.00 108.08 ? 1106 MET B C   1 
ATOM   5737  O O   . MET B 1 310 ? -28.591 -13.245 -0.500   1.00 99.70  ? 1106 MET B O   1 
ATOM   5738  C CB  . MET B 1 310 ? -29.891 -10.754 1.080    1.00 96.36  ? 1106 MET B CB  1 
ATOM   5739  C CG  . MET B 1 310 ? -29.659 -9.950  2.341    1.00 98.73  ? 1106 MET B CG  1 
ATOM   5740  S SD  . MET B 1 310 ? -31.203 -9.539  3.174    1.00 114.70 ? 1106 MET B SD  1 
ATOM   5741  C CE  . MET B 1 310 ? -31.823 -8.257  2.092    1.00 100.69 ? 1106 MET B CE  1 
ATOM   5742  N N   . GLY B 1 311 ? -29.459 -11.743 -1.935   1.00 113.91 ? 1107 GLY B N   1 
ATOM   5743  C CA  . GLY B 1 311 ? -29.820 -12.741 -2.926   1.00 115.06 ? 1107 GLY B CA  1 
ATOM   5744  C C   . GLY B 1 311 ? -31.311 -13.025 -2.921   1.00 116.49 ? 1107 GLY B C   1 
ATOM   5745  O O   . GLY B 1 311 ? -32.074 -12.344 -2.236   1.00 113.75 ? 1107 GLY B O   1 
ATOM   5746  N N   . GLU B 1 312 ? -31.726 -14.033 -3.682   1.00 118.54 ? 1108 GLU B N   1 
ATOM   5747  C CA  . GLU B 1 312 ? -33.145 -14.360 -3.823   1.00 123.23 ? 1108 GLU B CA  1 
ATOM   5748  C C   . GLU B 1 312 ? -33.787 -14.878 -2.530   1.00 130.63 ? 1108 GLU B C   1 
ATOM   5749  O O   . GLU B 1 312 ? -34.790 -14.331 -2.061   1.00 135.11 ? 1108 GLU B O   1 
ATOM   5750  C CB  . GLU B 1 312 ? -33.352 -15.368 -4.957   1.00 112.58 ? 1108 GLU B CB  1 
ATOM   5751  N N   . THR B 1 313 ? -33.208 -15.931 -1.958   1.00 129.57 ? 1109 THR B N   1 
ATOM   5752  C CA  . THR B 1 313 ? -33.746 -16.531 -0.741   1.00 125.76 ? 1109 THR B CA  1 
ATOM   5753  C C   . THR B 1 313 ? -33.764 -15.511 0.396    1.00 122.50 ? 1109 THR B C   1 
ATOM   5754  O O   . THR B 1 313 ? -34.786 -15.323 1.068    1.00 119.93 ? 1109 THR B O   1 
ATOM   5755  C CB  . THR B 1 313 ? -32.928 -17.772 -0.306   1.00 126.75 ? 1109 THR B CB  1 
ATOM   5756  O OG1 . THR B 1 313 ? -32.878 -18.723 -1.378   1.00 124.41 ? 1109 THR B OG1 1 
ATOM   5757  C CG2 . THR B 1 313 ? -33.554 -18.428 0.913    1.00 125.88 ? 1109 THR B CG2 1 
ATOM   5758  N N   . GLY B 1 314 ? -32.630 -14.843 0.589    1.00 120.19 ? 1110 GLY B N   1 
ATOM   5759  C CA  . GLY B 1 314 ? -32.467 -13.899 1.679    1.00 120.99 ? 1110 GLY B CA  1 
ATOM   5760  C C   . GLY B 1 314 ? -33.582 -12.877 1.762    1.00 122.36 ? 1110 GLY B C   1 
ATOM   5761  O O   . GLY B 1 314 ? -34.198 -12.706 2.813    1.00 129.24 ? 1110 GLY B O   1 
ATOM   5762  N N   . VAL B 1 315 ? -33.849 -12.197 0.653    1.00 116.28 ? 1111 VAL B N   1 
ATOM   5763  C CA  . VAL B 1 315 ? -34.916 -11.206 0.612    1.00 113.00 ? 1111 VAL B CA  1 
ATOM   5764  C C   . VAL B 1 315 ? -36.275 -11.899 0.540    1.00 118.59 ? 1111 VAL B C   1 
ATOM   5765  O O   . VAL B 1 315 ? -37.311 -11.286 0.800    1.00 117.79 ? 1111 VAL B O   1 
ATOM   5766  C CB  . VAL B 1 315 ? -34.747 -10.247 -0.578   1.00 106.69 ? 1111 VAL B CB  1 
ATOM   5767  C CG1 . VAL B 1 315 ? -35.745 -9.107  -0.489   1.00 106.21 ? 1111 VAL B CG1 1 
ATOM   5768  C CG2 . VAL B 1 315 ? -33.331 -9.707  -0.613   1.00 108.12 ? 1111 VAL B CG2 1 
ATOM   5769  N N   . ALA B 1 316 ? -36.262 -13.183 0.191    1.00 116.81 ? 1112 ALA B N   1 
ATOM   5770  C CA  . ALA B 1 316 ? -37.488 -13.971 0.139    1.00 109.77 ? 1112 ALA B CA  1 
ATOM   5771  C C   . ALA B 1 316 ? -37.876 -14.466 1.528    1.00 111.38 ? 1112 ALA B C   1 
ATOM   5772  O O   . ALA B 1 316 ? -38.898 -15.130 1.698    1.00 109.45 ? 1112 ALA B O   1 
ATOM   5773  C CB  . ALA B 1 316 ? -37.322 -15.144 -0.814   1.00 109.78 ? 1112 ALA B CB  1 
ATOM   5774  N N   . GLY B 1 317 ? -37.051 -14.134 2.516    1.00 117.45 ? 1113 GLY B N   1 
ATOM   5775  C CA  . GLY B 1 317 ? -37.255 -14.586 3.882    1.00 120.16 ? 1113 GLY B CA  1 
ATOM   5776  C C   . GLY B 1 317 ? -38.174 -13.752 4.762    1.00 121.18 ? 1113 GLY B C   1 
ATOM   5777  O O   . GLY B 1 317 ? -38.627 -14.232 5.804    1.00 120.17 ? 1113 GLY B O   1 
ATOM   5778  N N   . PHE B 1 318 ? -38.451 -12.510 4.369    1.00 121.54 ? 1114 PHE B N   1 
ATOM   5779  C CA  . PHE B 1 318 ? -39.346 -11.662 5.158    1.00 125.88 ? 1114 PHE B CA  1 
ATOM   5780  C C   . PHE B 1 318 ? -40.731 -11.596 4.533    1.00 124.30 ? 1114 PHE B C   1 
ATOM   5781  O O   . PHE B 1 318 ? -40.922 -10.967 3.495    1.00 130.73 ? 1114 PHE B O   1 
ATOM   5782  C CB  . PHE B 1 318 ? -38.804 -10.235 5.291    1.00 127.97 ? 1114 PHE B CB  1 
ATOM   5783  C CG  . PHE B 1 318 ? -37.305 -10.139 5.290    1.00 135.02 ? 1114 PHE B CG  1 
ATOM   5784  C CD1 . PHE B 1 318 ? -36.587 -10.230 6.472    1.00 140.09 ? 1114 PHE B CD1 1 
ATOM   5785  C CD2 . PHE B 1 318 ? -36.615 -9.927  4.106    1.00 129.44 ? 1114 PHE B CD2 1 
ATOM   5786  C CE1 . PHE B 1 318 ? -35.205 -10.130 6.469    1.00 139.61 ? 1114 PHE B CE1 1 
ATOM   5787  C CE2 . PHE B 1 318 ? -35.234 -9.825  4.096    1.00 128.01 ? 1114 PHE B CE2 1 
ATOM   5788  C CZ  . PHE B 1 318 ? -34.528 -9.927  5.279    1.00 130.68 ? 1114 PHE B CZ  1 
ATOM   5789  N N   . THR B 1 319 ? -41.701 -12.235 5.173    1.00 114.73 ? 1115 THR B N   1 
ATOM   5790  C CA  . THR B 1 319 ? -43.057 -12.227 4.649    1.00 122.21 ? 1115 THR B CA  1 
ATOM   5791  C C   . THR B 1 319 ? -43.772 -10.911 4.973    1.00 132.21 ? 1115 THR B C   1 
ATOM   5792  O O   . THR B 1 319 ? -44.383 -10.291 4.096    1.00 134.43 ? 1115 THR B O   1 
ATOM   5793  C CB  . THR B 1 319 ? -43.867 -13.437 5.161    1.00 121.41 ? 1115 THR B CB  1 
ATOM   5794  O OG1 . THR B 1 319 ? -43.181 -14.648 4.820    1.00 103.93 ? 1115 THR B OG1 1 
ATOM   5795  C CG2 . THR B 1 319 ? -45.249 -13.461 4.534    1.00 125.16 ? 1115 THR B CG2 1 
ATOM   5796  N N   . ASN B 1 320 ? -43.669 -10.476 6.226    1.00 132.33 ? 1116 ASN B N   1 
ATOM   5797  C CA  . ASN B 1 320 ? -44.389 -9.291  6.693    1.00 139.83 ? 1116 ASN B CA  1 
ATOM   5798  C C   . ASN B 1 320 ? -44.044 -8.014  5.925    1.00 138.18 ? 1116 ASN B C   1 
ATOM   5799  O O   . ASN B 1 320 ? -44.929 -7.348  5.372    1.00 134.67 ? 1116 ASN B O   1 
ATOM   5800  C CB  . ASN B 1 320 ? -44.155 -9.079  8.190    1.00 142.61 ? 1116 ASN B CB  1 
ATOM   5801  N N   . SER B 1 321 ? -42.758 -7.673  5.901    1.00 135.41 ? 1117 SER B N   1 
ATOM   5802  C CA  . SER B 1 321 ? -42.293 -6.477  5.208    1.00 127.61 ? 1117 SER B CA  1 
ATOM   5803  C C   . SER B 1 321 ? -42.810 -6.425  3.771    1.00 127.56 ? 1117 SER B C   1 
ATOM   5804  O O   . SER B 1 321 ? -43.265 -5.380  3.297    1.00 125.08 ? 1117 SER B O   1 
ATOM   5805  C CB  . SER B 1 321 ? -40.765 -6.414  5.234    1.00 112.91 ? 1117 SER B CB  1 
ATOM   5806  O OG  . SER B 1 321 ? -40.288 -6.401  6.570    1.00 111.92 ? 1117 SER B OG  1 
ATOM   5807  N N   . LEU B 1 322 ? -42.751 -7.564  3.089    1.00 124.18 ? 1118 LEU B N   1 
ATOM   5808  C CA  . LEU B 1 322 ? -43.247 -7.665  1.723    1.00 118.12 ? 1118 LEU B CA  1 
ATOM   5809  C C   . LEU B 1 322 ? -44.743 -7.399  1.654    1.00 119.19 ? 1118 LEU B C   1 
ATOM   5810  O O   . LEU B 1 322 ? -45.206 -6.589  0.846    1.00 114.76 ? 1118 LEU B O   1 
ATOM   5811  C CB  . LEU B 1 322 ? -42.953 -9.054  1.151    1.00 118.01 ? 1118 LEU B CB  1 
ATOM   5812  C CG  . LEU B 1 322 ? -41.477 -9.457  1.172    1.00 115.34 ? 1118 LEU B CG  1 
ATOM   5813  C CD1 . LEU B 1 322 ? -41.243 -10.726 0.366    1.00 116.41 ? 1118 LEU B CD1 1 
ATOM   5814  C CD2 . LEU B 1 322 ? -40.635 -8.323  0.641    1.00 113.78 ? 1118 LEU B CD2 1 
ATOM   5815  N N   . ARG B 1 323 ? -45.502 -8.086  2.503    1.00 125.17 ? 1119 ARG B N   1 
ATOM   5816  C CA  . ARG B 1 323 ? -46.953 -7.938  2.484    1.00 126.53 ? 1119 ARG B CA  1 
ATOM   5817  C C   . ARG B 1 323 ? -47.366 -6.481  2.680    1.00 120.21 ? 1119 ARG B C   1 
ATOM   5818  O O   . ARG B 1 323 ? -48.218 -5.968  1.950    1.00 115.90 ? 1119 ARG B O   1 
ATOM   5819  C CB  . ARG B 1 323 ? -47.611 -8.837  3.530    1.00 117.96 ? 1119 ARG B CB  1 
ATOM   5820  C CG  . ARG B 1 323 ? -47.602 -10.306 3.138    1.00 119.26 ? 1119 ARG B CG  1 
ATOM   5821  C CD  . ARG B 1 323 ? -48.434 -11.130 4.104    1.00 120.63 ? 1119 ARG B CD  1 
ATOM   5822  N NE  . ARG B 1 323 ? -47.978 -10.962 5.478    1.00 121.41 ? 1119 ARG B NE  1 
ATOM   5823  C CZ  . ARG B 1 323 ? -48.548 -10.125 6.346    1.00 125.35 ? 1119 ARG B CZ  1 
ATOM   5824  N NH1 . ARG B 1 323 ? -49.595 -9.366  5.990    1.00 127.32 ? 1119 ARG B NH1 1 
ATOM   5825  N NH2 . ARG B 1 323 ? -48.079 -10.042 7.584    1.00 123.96 ? 1119 ARG B NH2 1 
ATOM   5826  N N   . MET B 1 324 ? -46.757 -5.818  3.661    1.00 126.08 ? 1120 MET B N   1 
ATOM   5827  C CA  . MET B 1 324 ? -47.072 -4.420  3.956    1.00 128.28 ? 1120 MET B CA  1 
ATOM   5828  C C   . MET B 1 324 ? -46.616 -3.449  2.865    1.00 123.55 ? 1120 MET B C   1 
ATOM   5829  O O   . MET B 1 324 ? -47.317 -2.484  2.551    1.00 113.99 ? 1120 MET B O   1 
ATOM   5830  C CB  . MET B 1 324 ? -46.495 -4.015  5.313    1.00 127.44 ? 1120 MET B CB  1 
ATOM   5831  C CG  . MET B 1 324 ? -47.266 -4.571  6.494    1.00 135.82 ? 1120 MET B CG  1 
ATOM   5832  S SD  . MET B 1 324 ? -46.444 -4.282  8.069    1.00 149.08 ? 1120 MET B SD  1 
ATOM   5833  C CE  . MET B 1 324 ? -44.878 -5.093  7.765    1.00 237.60 ? 1120 MET B CE  1 
ATOM   5834  N N   . LEU B 1 325 ? -45.438 -3.696  2.300    1.00 124.89 ? 1121 LEU B N   1 
ATOM   5835  C CA  . LEU B 1 325 ? -44.954 -2.874  1.196    1.00 114.27 ? 1121 LEU B CA  1 
ATOM   5836  C C   . LEU B 1 325 ? -45.913 -2.947  0.020    1.00 109.71 ? 1121 LEU B C   1 
ATOM   5837  O O   . LEU B 1 325 ? -46.172 -1.941  -0.643   1.00 110.04 ? 1121 LEU B O   1 
ATOM   5838  C CB  . LEU B 1 325 ? -43.560 -3.314  0.749    1.00 115.30 ? 1121 LEU B CB  1 
ATOM   5839  C CG  . LEU B 1 325 ? -42.349 -2.678  1.432    1.00 111.07 ? 1121 LEU B CG  1 
ATOM   5840  C CD1 . LEU B 1 325 ? -41.083 -3.417  1.038    1.00 104.09 ? 1121 LEU B CD1 1 
ATOM   5841  C CD2 . LEU B 1 325 ? -42.243 -1.204  1.081    1.00 99.29  ? 1121 LEU B CD2 1 
ATOM   5842  N N   . GLN B 1 326 ? -46.427 -4.148  -0.234   1.00 112.11 ? 1122 GLN B N   1 
ATOM   5843  C CA  . GLN B 1 326 ? -47.355 -4.374  -1.336   1.00 114.59 ? 1122 GLN B CA  1 
ATOM   5844  C C   . GLN B 1 326 ? -48.718 -3.740  -1.052   1.00 118.44 ? 1122 GLN B C   1 
ATOM   5845  O O   . GLN B 1 326 ? -49.538 -3.578  -1.959   1.00 107.37 ? 1122 GLN B O   1 
ATOM   5846  C CB  . GLN B 1 326 ? -47.513 -5.874  -1.592   1.00 110.62 ? 1122 GLN B CB  1 
ATOM   5847  C CG  . GLN B 1 326 ? -48.231 -6.215  -2.878   1.00 109.77 ? 1122 GLN B CG  1 
ATOM   5848  C CD  . GLN B 1 326 ? -48.391 -7.708  -3.065   1.00 112.80 ? 1122 GLN B CD  1 
ATOM   5849  O OE1 . GLN B 1 326 ? -48.211 -8.482  -2.126   1.00 114.61 ? 1122 GLN B OE1 1 
ATOM   5850  N NE2 . GLN B 1 326 ? -48.726 -8.122  -4.281   1.00 114.97 ? 1122 GLN B NE2 1 
ATOM   5851  N N   . GLN B 1 327 ? -48.954 -3.399  0.212    1.00 119.28 ? 1123 GLN B N   1 
ATOM   5852  C CA  . GLN B 1 327 ? -50.193 -2.743  0.621    1.00 115.24 ? 1123 GLN B CA  1 
ATOM   5853  C C   . GLN B 1 327 ? -50.056 -1.217  0.681    1.00 111.90 ? 1123 GLN B C   1 
ATOM   5854  O O   . GLN B 1 327 ? -50.973 -0.520  1.108    1.00 110.25 ? 1123 GLN B O   1 
ATOM   5855  C CB  . GLN B 1 327 ? -50.701 -3.317  1.950    1.00 119.54 ? 1123 GLN B CB  1 
ATOM   5856  C CG  . GLN B 1 327 ? -51.391 -4.666  1.820    1.00 120.78 ? 1123 GLN B CG  1 
ATOM   5857  C CD  . GLN B 1 327 ? -51.976 -5.143  3.132    1.00 121.75 ? 1123 GLN B CD  1 
ATOM   5858  O OE1 . GLN B 1 327 ? -51.738 -4.545  4.180    1.00 123.41 ? 1123 GLN B OE1 1 
ATOM   5859  N NE2 . GLN B 1 327 ? -52.750 -6.221  3.081    1.00 112.79 ? 1123 GLN B NE2 1 
ATOM   5860  N N   . LYS B 1 328 ? -48.888 -0.731  0.269    1.00 109.91 ? 1124 LYS B N   1 
ATOM   5861  C CA  . LYS B 1 328 ? -48.596 0.689   0.181    1.00 102.01 ? 1124 LYS B CA  1 
ATOM   5862  C C   . LYS B 1 328 ? -48.350 1.285   1.580    1.00 105.84 ? 1124 LYS B C   1 
ATOM   5863  O O   . LYS B 1 328 ? -48.073 2.493   1.727    1.00 105.75 ? 1124 LYS B O   1 
ATOM   5864  C CB  . LYS B 1 328 ? -49.710 1.445   -0.517   1.00 91.85  ? 1124 LYS B CB  1 
ATOM   5865  N N   . ARG B 1 329 ? -48.441 0.437   2.605    1.00 106.13 ? 1125 ARG B N   1 
ATOM   5866  C CA  . ARG B 1 329 ? -48.106 0.856   3.956    1.00 105.69 ? 1125 ARG B CA  1 
ATOM   5867  C C   . ARG B 1 329 ? -46.619 0.732   4.158    1.00 99.35  ? 1125 ARG B C   1 
ATOM   5868  O O   . ARG B 1 329 ? -46.082 -0.369  4.198    1.00 98.55  ? 1125 ARG B O   1 
ATOM   5869  C CB  . ARG B 1 329 ? -48.762 -0.049  4.987    1.00 109.95 ? 1125 ARG B CB  1 
ATOM   5870  C CG  . ARG B 1 329 ? -50.256 -0.123  4.922    1.00 112.25 ? 1125 ARG B CG  1 
ATOM   5871  C CD  . ARG B 1 329 ? -50.733 -1.479  5.390    1.00 116.49 ? 1125 ARG B CD  1 
ATOM   5872  N NE  . ARG B 1 329 ? -50.674 -1.627  6.839    1.00 123.33 ? 1125 ARG B NE  1 
ATOM   5873  C CZ  . ARG B 1 329 ? -51.105 -2.707  7.483    1.00 127.72 ? 1125 ARG B CZ  1 
ATOM   5874  N NH1 . ARG B 1 329 ? -51.617 -3.721  6.797    1.00 127.20 ? 1125 ARG B NH1 1 
ATOM   5875  N NH2 . ARG B 1 329 ? -51.029 -2.782  8.807    1.00 123.81 ? 1125 ARG B NH2 1 
ATOM   5876  N N   . TRP B 1 330 ? -45.981 1.874   4.368    1.00 97.83  ? 1126 TRP B N   1 
ATOM   5877  C CA  . TRP B 1 330 ? -44.537 1.990   4.259    1.00 101.10 ? 1126 TRP B CA  1 
ATOM   5878  C C   . TRP B 1 330 ? -43.851 1.911   5.613    1.00 97.87  ? 1126 TRP B C   1 
ATOM   5879  O O   . TRP B 1 330 ? -43.018 1.040   5.843    1.00 96.73  ? 1126 TRP B O   1 
ATOM   5880  C CB  . TRP B 1 330 ? -44.150 3.295   3.568    1.00 99.54  ? 1126 TRP B CB  1 
ATOM   5881  C CG  . TRP B 1 330 ? -44.796 3.503   2.228    1.00 97.00  ? 1126 TRP B CG  1 
ATOM   5882  C CD1 . TRP B 1 330 ? -45.509 4.595   1.827    1.00 95.82  ? 1126 TRP B CD1 1 
ATOM   5883  C CD2 . TRP B 1 330 ? -44.778 2.602   1.112    1.00 95.52  ? 1126 TRP B CD2 1 
ATOM   5884  N NE1 . TRP B 1 330 ? -45.935 4.432   0.531    1.00 97.80  ? 1126 TRP B NE1 1 
ATOM   5885  C CE2 . TRP B 1 330 ? -45.502 3.217   0.071    1.00 99.31  ? 1126 TRP B CE2 1 
ATOM   5886  C CE3 . TRP B 1 330 ? -44.224 1.337   0.896    1.00 91.50  ? 1126 TRP B CE3 1 
ATOM   5887  C CZ2 . TRP B 1 330 ? -45.685 2.607   -1.168   1.00 96.98  ? 1126 TRP B CZ2 1 
ATOM   5888  C CZ3 . TRP B 1 330 ? -44.410 0.736   -0.335   1.00 90.70  ? 1126 TRP B CZ3 1 
ATOM   5889  C CH2 . TRP B 1 330 ? -45.133 1.370   -1.349   1.00 91.63  ? 1126 TRP B CH2 1 
ATOM   5890  N N   . ASP B 1 331 ? -44.168 2.863   6.485    1.00 95.27  ? 1127 ASP B N   1 
ATOM   5891  C CA  . ASP B 1 331 ? -43.569 2.928   7.810    1.00 97.12  ? 1127 ASP B CA  1 
ATOM   5892  C C   . ASP B 1 331 ? -43.662 1.564   8.472    1.00 97.83  ? 1127 ASP B C   1 
ATOM   5893  O O   . ASP B 1 331 ? -42.670 1.010   8.965    1.00 100.72 ? 1127 ASP B O   1 
ATOM   5894  C CB  . ASP B 1 331 ? -44.300 3.956   8.676    1.00 96.69  ? 1127 ASP B CB  1 
ATOM   5895  C CG  . ASP B 1 331 ? -44.663 5.220   7.914    1.00 91.46  ? 1127 ASP B CG  1 
ATOM   5896  O OD1 . ASP B 1 331 ? -45.764 5.271   7.321    1.00 89.53  ? 1127 ASP B OD1 1 
ATOM   5897  O OD2 . ASP B 1 331 ? -43.860 6.176   7.929    1.00 87.30  ? 1127 ASP B OD2 1 
ATOM   5898  N N   . GLU B 1 332 ? -44.877 1.031   8.471    1.00 95.75  ? 1128 GLU B N   1 
ATOM   5899  C CA  . GLU B 1 332 ? -45.171 -0.235  9.116    1.00 96.92  ? 1128 GLU B CA  1 
ATOM   5900  C C   . GLU B 1 332 ? -44.231 -1.315  8.600    1.00 101.64 ? 1128 GLU B C   1 
ATOM   5901  O O   . GLU B 1 332 ? -43.840 -2.217  9.339    1.00 99.09  ? 1128 GLU B O   1 
ATOM   5902  C CB  . GLU B 1 332 ? -46.641 -0.614  8.884    1.00 105.08 ? 1128 GLU B CB  1 
ATOM   5903  C CG  . GLU B 1 332 ? -47.610 0.573   9.012    1.00 108.58 ? 1128 GLU B CG  1 
ATOM   5904  C CD  . GLU B 1 332 ? -49.054 0.152   9.262    1.00 110.32 ? 1128 GLU B CD  1 
ATOM   5905  O OE1 . GLU B 1 332 ? -49.271 -0.982  9.739    1.00 112.44 ? 1128 GLU B OE1 1 
ATOM   5906  O OE2 . GLU B 1 332 ? -49.973 0.957   8.990    1.00 103.36 ? 1128 GLU B OE2 1 
ATOM   5907  N N   . ALA B 1 333 ? -43.859 -1.210  7.328    1.00 107.03 ? 1129 ALA B N   1 
ATOM   5908  C CA  . ALA B 1 333 ? -42.966 -2.181  6.703    1.00 108.56 ? 1129 ALA B CA  1 
ATOM   5909  C C   . ALA B 1 333 ? -41.498 -1.929  7.038    1.00 107.41 ? 1129 ALA B C   1 
ATOM   5910  O O   . ALA B 1 333 ? -40.720 -2.869  7.189    1.00 110.76 ? 1129 ALA B O   1 
ATOM   5911  C CB  . ALA B 1 333 ? -43.174 -2.200  5.199    1.00 102.86 ? 1129 ALA B CB  1 
ATOM   5912  N N   . ALA B 1 334 ? -41.126 -0.657  7.144    1.00 106.75 ? 1130 ALA B N   1 
ATOM   5913  C CA  . ALA B 1 334 ? -39.761 -0.275  7.489    1.00 106.26 ? 1130 ALA B CA  1 
ATOM   5914  C C   . ALA B 1 334 ? -39.435 -0.727  8.903    1.00 101.89 ? 1130 ALA B C   1 
ATOM   5915  O O   . ALA B 1 334 ? -38.276 -0.990  9.240    1.00 95.58  ? 1130 ALA B O   1 
ATOM   5916  C CB  . ALA B 1 334 ? -39.589 1.220   7.364    1.00 99.43  ? 1130 ALA B CB  1 
ATOM   5917  N N   . VAL B 1 335 ? -40.471 -0.810  9.729    1.00 103.40 ? 1131 VAL B N   1 
ATOM   5918  C CA  . VAL B 1 335 ? -40.307 -1.330  11.078   1.00 107.35 ? 1131 VAL B CA  1 
ATOM   5919  C C   . VAL B 1 335 ? -39.924 -2.809  11.032   1.00 113.61 ? 1131 VAL B C   1 
ATOM   5920  O O   . VAL B 1 335 ? -38.912 -3.213  11.605   1.00 118.81 ? 1131 VAL B O   1 
ATOM   5921  C CB  . VAL B 1 335 ? -41.584 -1.154  11.912   1.00 103.03 ? 1131 VAL B CB  1 
ATOM   5922  C CG1 . VAL B 1 335 ? -41.363 -1.673  13.323   1.00 101.75 ? 1131 VAL B CG1 1 
ATOM   5923  C CG2 . VAL B 1 335 ? -42.003 0.307   11.937   1.00 97.69  ? 1131 VAL B CG2 1 
ATOM   5924  N N   . ASN B 1 336 ? -40.732 -3.613  10.344   1.00 107.56 ? 1132 ASN B N   1 
ATOM   5925  C CA  . ASN B 1 336 ? -40.432 -5.032  10.183   1.00 102.58 ? 1132 ASN B CA  1 
ATOM   5926  C C   . ASN B 1 336 ? -39.067 -5.248  9.548    1.00 105.63 ? 1132 ASN B C   1 
ATOM   5927  O O   . ASN B 1 336 ? -38.373 -6.209  9.869    1.00 106.53 ? 1132 ASN B O   1 
ATOM   5928  C CB  . ASN B 1 336 ? -41.511 -5.730  9.359    1.00 114.20 ? 1132 ASN B CB  1 
ATOM   5929  C CG  . ASN B 1 336 ? -42.762 -6.017  10.164   1.00 127.29 ? 1132 ASN B CG  1 
ATOM   5930  O OD1 . ASN B 1 336 ? -43.039 -7.165  10.509   1.00 135.91 ? 1132 ASN B OD1 1 
ATOM   5931  N ND2 . ASN B 1 336 ? -43.521 -4.974  10.474   1.00 126.48 ? 1132 ASN B ND2 1 
ATOM   5932  N N   . LEU B 1 337 ? -38.687 -4.348  8.646    1.00 113.89 ? 1133 LEU B N   1 
ATOM   5933  C CA  . LEU B 1 337 ? -37.371 -4.403  8.017    1.00 116.32 ? 1133 LEU B CA  1 
ATOM   5934  C C   . LEU B 1 337 ? -36.261 -4.208  9.040    1.00 114.04 ? 1133 LEU B C   1 
ATOM   5935  O O   . LEU B 1 337 ? -35.329 -5.005  9.120    1.00 113.74 ? 1133 LEU B O   1 
ATOM   5936  C CB  . LEU B 1 337 ? -37.244 -3.339  6.923    1.00 108.69 ? 1133 LEU B CB  1 
ATOM   5937  C CG  . LEU B 1 337 ? -38.012 -3.572  5.623    1.00 107.29 ? 1133 LEU B CG  1 
ATOM   5938  C CD1 . LEU B 1 337 ? -37.786 -2.414  4.664    1.00 101.76 ? 1133 LEU B CD1 1 
ATOM   5939  C CD2 . LEU B 1 337 ? -37.594 -4.890  4.990    1.00 112.91 ? 1133 LEU B CD2 1 
ATOM   5940  N N   . ALA B 1 338 ? -36.367 -3.140  9.823    1.00 110.02 ? 1134 ALA B N   1 
ATOM   5941  C CA  . ALA B 1 338 ? -35.319 -2.788  10.772   1.00 112.05 ? 1134 ALA B CA  1 
ATOM   5942  C C   . ALA B 1 338 ? -34.995 -3.911  11.759   1.00 115.93 ? 1134 ALA B C   1 
ATOM   5943  O O   . ALA B 1 338 ? -33.888 -3.972  12.295   1.00 114.04 ? 1134 ALA B O   1 
ATOM   5944  C CB  . ALA B 1 338 ? -35.692 -1.513  11.515   1.00 122.90 ? 1134 ALA B CB  1 
ATOM   5945  N N   . LYS B 1 339 ? -35.954 -4.804  11.987   1.00 120.40 ? 1135 LYS B N   1 
ATOM   5946  C CA  . LYS B 1 339 ? -35.796 -5.846  13.001   1.00 125.82 ? 1135 LYS B CA  1 
ATOM   5947  C C   . LYS B 1 339 ? -35.145 -7.127  12.476   1.00 129.73 ? 1135 LYS B C   1 
ATOM   5948  O O   . LYS B 1 339 ? -35.004 -8.104  13.211   1.00 119.53 ? 1135 LYS B O   1 
ATOM   5949  C CB  . LYS B 1 339 ? -37.141 -6.173  13.658   1.00 127.00 ? 1135 LYS B CB  1 
ATOM   5950  C CG  . LYS B 1 339 ? -37.745 -5.022  14.453   1.00 130.39 ? 1135 LYS B CG  1 
ATOM   5951  C CD  . LYS B 1 339 ? -38.924 -5.487  15.303   1.00 126.40 ? 1135 LYS B CD  1 
ATOM   5952  C CE  . LYS B 1 339 ? -39.455 -4.357  16.178   1.00 131.72 ? 1135 LYS B CE  1 
ATOM   5953  N NZ  . LYS B 1 339 ? -40.494 -4.818  17.145   1.00 122.22 ? 1135 LYS B NZ  1 
ATOM   5954  N N   . SER B 1 340 ? -34.744 -7.120  11.209   1.00 132.27 ? 1136 SER B N   1 
ATOM   5955  C CA  . SER B 1 340 ? -34.156 -8.306  10.592   1.00 129.52 ? 1136 SER B CA  1 
ATOM   5956  C C   . SER B 1 340 ? -32.690 -8.499  10.969   1.00 119.72 ? 1136 SER B C   1 
ATOM   5957  O O   . SER B 1 340 ? -32.106 -7.680  11.678   1.00 119.59 ? 1136 SER B O   1 
ATOM   5958  C CB  . SER B 1 340 ? -34.289 -8.228  9.070    1.00 129.60 ? 1136 SER B CB  1 
ATOM   5959  O OG  . SER B 1 340 ? -33.586 -7.110  8.559    1.00 117.39 ? 1136 SER B OG  1 
ATOM   5960  N N   . ARG B 1 341 ? -32.104 -9.588  10.479   1.00 122.50 ? 1137 ARG B N   1 
ATOM   5961  C CA  . ARG B 1 341 ? -30.693 -9.884  10.698   1.00 114.54 ? 1137 ARG B CA  1 
ATOM   5962  C C   . ARG B 1 341 ? -29.848 -9.053  9.746    1.00 112.33 ? 1137 ARG B C   1 
ATOM   5963  O O   . ARG B 1 341 ? -28.747 -8.607  10.087   1.00 109.17 ? 1137 ARG B O   1 
ATOM   5964  C CB  . ARG B 1 341 ? -30.426 -11.372 10.465   1.00 98.77  ? 1137 ARG B CB  1 
ATOM   5965  N N   . TRP B 1 342 ? -30.389 -8.844  8.551    1.00 107.35 ? 1138 TRP B N   1 
ATOM   5966  C CA  . TRP B 1 342 ? -29.749 -8.036  7.525    1.00 110.66 ? 1138 TRP B CA  1 
ATOM   5967  C C   . TRP B 1 342 ? -29.516 -6.604  7.999    1.00 115.33 ? 1138 TRP B C   1 
ATOM   5968  O O   . TRP B 1 342 ? -28.508 -5.983  7.655    1.00 114.65 ? 1138 TRP B O   1 
ATOM   5969  C CB  . TRP B 1 342 ? -30.611 -8.038  6.263    1.00 106.26 ? 1138 TRP B CB  1 
ATOM   5970  C CG  . TRP B 1 342 ? -30.267 -6.967  5.282    1.00 100.55 ? 1138 TRP B CG  1 
ATOM   5971  C CD1 . TRP B 1 342 ? -29.201 -6.945  4.436    1.00 98.70  ? 1138 TRP B CD1 1 
ATOM   5972  C CD2 . TRP B 1 342 ? -31.003 -5.768  5.030    1.00 94.37  ? 1138 TRP B CD2 1 
ATOM   5973  N NE1 . TRP B 1 342 ? -29.222 -5.804  3.677    1.00 88.46  ? 1138 TRP B NE1 1 
ATOM   5974  C CE2 . TRP B 1 342 ? -30.322 -5.064  4.023    1.00 90.05  ? 1138 TRP B CE2 1 
ATOM   5975  C CE3 . TRP B 1 342 ? -32.173 -5.218  5.561    1.00 100.53 ? 1138 TRP B CE3 1 
ATOM   5976  C CZ2 . TRP B 1 342 ? -30.768 -3.841  3.536    1.00 95.76  ? 1138 TRP B CZ2 1 
ATOM   5977  C CZ3 . TRP B 1 342 ? -32.615 -4.002  5.076    1.00 96.12  ? 1138 TRP B CZ3 1 
ATOM   5978  C CH2 . TRP B 1 342 ? -31.915 -3.328  4.075    1.00 93.30  ? 1138 TRP B CH2 1 
ATOM   5979  N N   . TYR B 1 343 ? -30.447 -6.083  8.789    1.00 113.75 ? 1139 TYR B N   1 
ATOM   5980  C CA  . TYR B 1 343 ? -30.304 -4.738  9.323    1.00 108.66 ? 1139 TYR B CA  1 
ATOM   5981  C C   . TYR B 1 343 ? -29.132 -4.694  10.285   1.00 104.56 ? 1139 TYR B C   1 
ATOM   5982  O O   . TYR B 1 343 ? -28.266 -3.827  10.190   1.00 98.07  ? 1139 TYR B O   1 
ATOM   5983  C CB  . TYR B 1 343 ? -31.576 -4.305  10.045   1.00 111.09 ? 1139 TYR B CB  1 
ATOM   5984  C CG  . TYR B 1 343 ? -31.514 -2.884  10.551   1.00 116.31 ? 1139 TYR B CG  1 
ATOM   5985  C CD1 . TYR B 1 343 ? -32.079 -1.842  9.825    1.00 118.34 ? 1139 TYR B CD1 1 
ATOM   5986  C CD2 . TYR B 1 343 ? -30.878 -2.579  11.746   1.00 116.51 ? 1139 TYR B CD2 1 
ATOM   5987  C CE1 . TYR B 1 343 ? -32.020 -0.538  10.280   1.00 113.59 ? 1139 TYR B CE1 1 
ATOM   5988  C CE2 . TYR B 1 343 ? -30.814 -1.279  12.209   1.00 117.99 ? 1139 TYR B CE2 1 
ATOM   5989  C CZ  . TYR B 1 343 ? -31.386 -0.262  11.473   1.00 113.93 ? 1139 TYR B CZ  1 
ATOM   5990  O OH  . TYR B 1 343 ? -31.323 1.034   11.932   1.00 105.26 ? 1139 TYR B OH  1 
ATOM   5991  N N   . ASN B 1 344 ? -29.117 -5.644  11.211   1.00 113.92 ? 1140 ASN B N   1 
ATOM   5992  C CA  . ASN B 1 344 ? -28.054 -5.733  12.202   1.00 121.53 ? 1140 ASN B CA  1 
ATOM   5993  C C   . ASN B 1 344 ? -26.675 -5.840  11.563   1.00 119.00 ? 1140 ASN B C   1 
ATOM   5994  O O   . ASN B 1 344 ? -25.779 -5.054  11.872   1.00 114.65 ? 1140 ASN B O   1 
ATOM   5995  C CB  . ASN B 1 344 ? -28.301 -6.911  13.150   1.00 125.26 ? 1140 ASN B CB  1 
ATOM   5996  C CG  . ASN B 1 344 ? -29.413 -6.634  14.148   1.00 118.97 ? 1140 ASN B CG  1 
ATOM   5997  O OD1 . ASN B 1 344 ? -29.397 -5.620  14.848   1.00 112.59 ? 1140 ASN B OD1 1 
ATOM   5998  N ND2 . ASN B 1 344 ? -30.391 -7.532  14.211   1.00 117.43 ? 1140 ASN B ND2 1 
ATOM   5999  N N   . GLN B 1 345 ? -26.506 -6.810  10.670   1.00 121.20 ? 1141 GLN B N   1 
ATOM   6000  C CA  . GLN B 1 345 ? -25.215 -7.005  10.011   1.00 125.62 ? 1141 GLN B CA  1 
ATOM   6001  C C   . GLN B 1 345 ? -24.744 -5.754  9.267    1.00 123.03 ? 1141 GLN B C   1 
ATOM   6002  O O   . GLN B 1 345 ? -23.563 -5.416  9.299    1.00 124.19 ? 1141 GLN B O   1 
ATOM   6003  C CB  . GLN B 1 345 ? -25.258 -8.197  9.051    1.00 124.22 ? 1141 GLN B CB  1 
ATOM   6004  C CG  . GLN B 1 345 ? -25.245 -9.556  9.732    1.00 117.22 ? 1141 GLN B CG  1 
ATOM   6005  C CD  . GLN B 1 345 ? -25.094 -10.692 8.738    1.00 110.77 ? 1141 GLN B CD  1 
ATOM   6006  O OE1 . GLN B 1 345 ? -25.231 -11.864 9.090    1.00 108.68 ? 1141 GLN B OE1 1 
ATOM   6007  N NE2 . GLN B 1 345 ? -24.808 -10.350 7.487    1.00 104.58 ? 1141 GLN B NE2 1 
ATOM   6008  N N   . THR B 1 346 ? -25.668 -5.076  8.594    1.00 119.96 ? 1142 THR B N   1 
ATOM   6009  C CA  . THR B 1 346 ? -25.328 -3.886  7.822    1.00 113.73 ? 1142 THR B CA  1 
ATOM   6010  C C   . THR B 1 346 ? -26.321 -2.753  8.078    1.00 109.59 ? 1142 THR B C   1 
ATOM   6011  O O   . THR B 1 346 ? -27.296 -2.598  7.345    1.00 107.21 ? 1142 THR B O   1 
ATOM   6012  C CB  . THR B 1 346 ? -25.261 -4.196  6.314    1.00 113.53 ? 1142 THR B CB  1 
ATOM   6013  O OG1 . THR B 1 346 ? -26.486 -4.808  5.892    1.00 108.36 ? 1142 THR B OG1 1 
ATOM   6014  C CG2 . THR B 1 346 ? -24.103 -5.140  6.012    1.00 109.44 ? 1142 THR B CG2 1 
ATOM   6015  N N   . PRO B 1 347 ? -26.069 -1.965  9.133    1.00 105.14 ? 1143 PRO B N   1 
ATOM   6016  C CA  . PRO B 1 347 ? -26.926 -0.870  9.607    1.00 99.78  ? 1143 PRO B CA  1 
ATOM   6017  C C   . PRO B 1 347 ? -27.021 0.319   8.652    1.00 96.14  ? 1143 PRO B C   1 
ATOM   6018  O O   . PRO B 1 347 ? -28.112 0.861   8.465    1.00 101.64 ? 1143 PRO B O   1 
ATOM   6019  C CB  . PRO B 1 347 ? -26.238 -0.435  10.900   1.00 104.59 ? 1143 PRO B CB  1 
ATOM   6020  C CG  . PRO B 1 347 ? -24.810 -0.774  10.683   1.00 108.54 ? 1143 PRO B CG  1 
ATOM   6021  C CD  . PRO B 1 347 ? -24.823 -2.059  9.910    1.00 104.96 ? 1143 PRO B CD  1 
ATOM   6022  N N   . ASN B 1 348 ? -25.899 0.726   8.067    1.00 95.35  ? 1144 ASN B N   1 
ATOM   6023  C CA  . ASN B 1 348 ? -25.883 1.881   7.172    1.00 98.04  ? 1144 ASN B CA  1 
ATOM   6024  C C   . ASN B 1 348 ? -26.727 1.658   5.923    1.00 90.10  ? 1144 ASN B C   1 
ATOM   6025  O O   . ASN B 1 348 ? -27.665 2.418   5.633    1.00 86.93  ? 1144 ASN B O   1 
ATOM   6026  C CB  . ASN B 1 348 ? -24.449 2.218   6.755    1.00 108.14 ? 1144 ASN B CB  1 
ATOM   6027  C CG  . ASN B 1 348 ? -23.515 2.372   7.937    1.00 107.19 ? 1144 ASN B CG  1 
ATOM   6028  O OD1 . ASN B 1 348 ? -22.513 1.665   8.044    1.00 113.28 ? 1144 ASN B OD1 1 
ATOM   6029  N ND2 . ASN B 1 348 ? -23.835 3.303   8.828    1.00 100.87 ? 1144 ASN B ND2 1 
ATOM   6030  N N   . ARG B 1 349 ? -26.382 0.606   5.186    1.00 86.63  ? 1145 ARG B N   1 
ATOM   6031  C CA  . ARG B 1 349 ? -27.057 0.286   3.939    1.00 85.60  ? 1145 ARG B CA  1 
ATOM   6032  C C   . ARG B 1 349 ? -28.526 -0.012  4.208    1.00 90.28  ? 1145 ARG B C   1 
ATOM   6033  O O   . ARG B 1 349 ? -29.408 0.424   3.461    1.00 90.39  ? 1145 ARG B O   1 
ATOM   6034  C CB  . ARG B 1 349 ? -26.376 -0.900  3.251    1.00 76.44  ? 1145 ARG B CB  1 
ATOM   6035  C CG  . ARG B 1 349 ? -26.651 -0.998  1.760    1.00 72.81  ? 1145 ARG B CG  1 
ATOM   6036  C CD  . ARG B 1 349 ? -25.857 -2.118  1.123    1.00 74.07  ? 1145 ARG B CD  1 
ATOM   6037  N NE  . ARG B 1 349 ? -26.193 -2.300  -0.287   1.00 76.89  ? 1145 ARG B NE  1 
ATOM   6038  C CZ  . ARG B 1 349 ? -25.762 -3.310  -1.036   1.00 83.27  ? 1145 ARG B CZ  1 
ATOM   6039  N NH1 . ARG B 1 349 ? -24.976 -4.240  -0.514   1.00 85.71  ? 1145 ARG B NH1 1 
ATOM   6040  N NH2 . ARG B 1 349 ? -26.122 -3.395  -2.309   1.00 86.29  ? 1145 ARG B NH2 1 
ATOM   6041  N N   . ALA B 1 350 ? -28.787 -0.743  5.287    1.00 88.10  ? 1146 ALA B N   1 
ATOM   6042  C CA  . ALA B 1 350 ? -30.154 -1.031  5.694    1.00 87.40  ? 1146 ALA B CA  1 
ATOM   6043  C C   . ALA B 1 350 ? -30.935 0.264   5.888    1.00 88.88  ? 1146 ALA B C   1 
ATOM   6044  O O   . ALA B 1 350 ? -32.052 0.399   5.391    1.00 84.95  ? 1146 ALA B O   1 
ATOM   6045  C CB  . ALA B 1 350 ? -30.166 -1.861  6.964    1.00 91.72  ? 1146 ALA B CB  1 
ATOM   6046  N N   . LYS B 1 351 ? -30.337 1.223   6.592    1.00 91.98  ? 1147 LYS B N   1 
ATOM   6047  C CA  . LYS B 1 351 ? -30.991 2.511   6.811    1.00 87.94  ? 1147 LYS B CA  1 
ATOM   6048  C C   . LYS B 1 351 ? -31.298 3.226   5.498    1.00 82.42  ? 1147 LYS B C   1 
ATOM   6049  O O   . LYS B 1 351 ? -32.456 3.537   5.214    1.00 80.12  ? 1147 LYS B O   1 
ATOM   6050  C CB  . LYS B 1 351 ? -30.146 3.408   7.721    1.00 85.36  ? 1147 LYS B CB  1 
ATOM   6051  C CG  . LYS B 1 351 ? -30.169 2.992   9.180    1.00 86.30  ? 1147 LYS B CG  1 
ATOM   6052  C CD  . LYS B 1 351 ? -29.423 3.980   10.069   1.00 92.11  ? 1147 LYS B CD  1 
ATOM   6053  C CE  . LYS B 1 351 ? -30.150 5.315   10.188   1.00 89.32  ? 1147 LYS B CE  1 
ATOM   6054  N NZ  . LYS B 1 351 ? -29.511 6.231   11.185   1.00 80.81  ? 1147 LYS B NZ  1 
ATOM   6055  N N   . ARG B 1 352 ? -30.268 3.480   4.695    1.00 83.11  ? 1148 ARG B N   1 
ATOM   6056  C CA  . ARG B 1 352 ? -30.479 4.170   3.423    1.00 86.26  ? 1148 ARG B CA  1 
ATOM   6057  C C   . ARG B 1 352 ? -31.599 3.507   2.618    1.00 85.19  ? 1148 ARG B C   1 
ATOM   6058  O O   . ARG B 1 352 ? -32.545 4.170   2.161    1.00 83.48  ? 1148 ARG B O   1 
ATOM   6059  C CB  . ARG B 1 352 ? -29.187 4.216   2.604    1.00 78.85  ? 1148 ARG B CB  1 
ATOM   6060  C CG  . ARG B 1 352 ? -28.180 5.238   3.096    1.00 71.10  ? 1148 ARG B CG  1 
ATOM   6061  C CD  . ARG B 1 352 ? -26.931 5.223   2.249    1.00 69.64  ? 1148 ARG B CD  1 
ATOM   6062  N NE  . ARG B 1 352 ? -26.127 4.026   2.472    1.00 75.12  ? 1148 ARG B NE  1 
ATOM   6063  C CZ  . ARG B 1 352 ? -25.085 3.970   3.298    1.00 79.89  ? 1148 ARG B CZ  1 
ATOM   6064  N NH1 . ARG B 1 352 ? -24.720 5.045   3.981    1.00 89.87  ? 1148 ARG B NH1 1 
ATOM   6065  N NH2 . ARG B 1 352 ? -24.402 2.843   3.440    1.00 73.31  ? 1148 ARG B NH2 1 
ATOM   6066  N N   . VAL B 1 353 ? -31.499 2.191   2.466    1.00 86.70  ? 1149 VAL B N   1 
ATOM   6067  C CA  . VAL B 1 353 ? -32.492 1.442   1.708    1.00 86.86  ? 1149 VAL B CA  1 
ATOM   6068  C C   . VAL B 1 353 ? -33.890 1.624   2.285    1.00 89.91  ? 1149 VAL B C   1 
ATOM   6069  O O   . VAL B 1 353 ? -34.850 1.805   1.541    1.00 87.91  ? 1149 VAL B O   1 
ATOM   6070  C CB  . VAL B 1 353 ? -32.150 -0.062  1.640    1.00 82.36  ? 1149 VAL B CB  1 
ATOM   6071  C CG1 . VAL B 1 353 ? -33.335 -0.856  1.104    1.00 78.06  ? 1149 VAL B CG1 1 
ATOM   6072  C CG2 . VAL B 1 353 ? -30.915 -0.286  0.782    1.00 78.60  ? 1149 VAL B CG2 1 
ATOM   6073  N N   . ILE B 1 354 ? -33.999 1.581   3.611    1.00 92.96  ? 1150 ILE B N   1 
ATOM   6074  C CA  . ILE B 1 354 ? -35.295 1.697   4.275    1.00 87.73  ? 1150 ILE B CA  1 
ATOM   6075  C C   . ILE B 1 354 ? -35.934 3.063   4.047    1.00 86.69  ? 1150 ILE B C   1 
ATOM   6076  O O   . ILE B 1 354 ? -37.109 3.148   3.693    1.00 88.74  ? 1150 ILE B O   1 
ATOM   6077  C CB  . ILE B 1 354 ? -35.197 1.395   5.780    1.00 81.70  ? 1150 ILE B CB  1 
ATOM   6078  C CG1 . ILE B 1 354 ? -35.016 -0.109  5.998    1.00 85.77  ? 1150 ILE B CG1 1 
ATOM   6079  C CG2 . ILE B 1 354 ? -36.438 1.878   6.500    1.00 86.49  ? 1150 ILE B CG2 1 
ATOM   6080  C CD1 . ILE B 1 354 ? -34.948 -0.517  7.448    1.00 98.18  ? 1150 ILE B CD1 1 
ATOM   6081  N N   . THR B 1 355 ? -35.158 4.126   4.245    1.00 83.47  ? 1151 THR B N   1 
ATOM   6082  C CA  . THR B 1 355 ? -35.634 5.474   3.954    1.00 78.82  ? 1151 THR B CA  1 
ATOM   6083  C C   . THR B 1 355 ? -36.108 5.551   2.513    1.00 84.74  ? 1151 THR B C   1 
ATOM   6084  O O   . THR B 1 355 ? -37.151 6.140   2.220    1.00 87.49  ? 1151 THR B O   1 
ATOM   6085  C CB  . THR B 1 355 ? -34.541 6.524   4.169    1.00 73.48  ? 1151 THR B CB  1 
ATOM   6086  O OG1 . THR B 1 355 ? -34.264 6.639   5.569    1.00 75.84  ? 1151 THR B OG1 1 
ATOM   6087  C CG2 . THR B 1 355 ? -34.992 7.874   3.636    1.00 72.51  ? 1151 THR B CG2 1 
ATOM   6088  N N   . THR B 1 356 ? -35.338 4.949   1.612    1.00 85.54  ? 1152 THR B N   1 
ATOM   6089  C CA  . THR B 1 356 ? -35.741 4.889   0.213    1.00 88.06  ? 1152 THR B CA  1 
ATOM   6090  C C   . THR B 1 356 ? -37.048 4.108   0.062    1.00 84.38  ? 1152 THR B C   1 
ATOM   6091  O O   . THR B 1 356 ? -37.832 4.357   -0.854   1.00 89.66  ? 1152 THR B O   1 
ATOM   6092  C CB  . THR B 1 356 ? -34.626 4.283   -0.677   1.00 85.17  ? 1152 THR B CB  1 
ATOM   6093  O OG1 . THR B 1 356 ? -33.589 5.254   -0.866   1.00 79.80  ? 1152 THR B OG1 1 
ATOM   6094  C CG2 . THR B 1 356 ? -35.175 3.883   -2.037   1.00 83.90  ? 1152 THR B CG2 1 
ATOM   6095  N N   . PHE B 1 357 ? -37.292 3.181   0.979    1.00 76.16  ? 1153 PHE B N   1 
ATOM   6096  C CA  . PHE B 1 357 ? -38.491 2.358   0.917    1.00 83.18  ? 1153 PHE B CA  1 
ATOM   6097  C C   . PHE B 1 357 ? -39.729 3.123   1.363    1.00 87.66  ? 1153 PHE B C   1 
ATOM   6098  O O   . PHE B 1 357 ? -40.791 3.010   0.753    1.00 93.78  ? 1153 PHE B O   1 
ATOM   6099  C CB  . PHE B 1 357 ? -38.323 1.078   1.737    1.00 88.30  ? 1153 PHE B CB  1 
ATOM   6100  C CG  . PHE B 1 357 ? -38.060 -0.140  0.901    1.00 91.16  ? 1153 PHE B CG  1 
ATOM   6101  C CD1 . PHE B 1 357 ? -39.089 -0.746  0.200    1.00 81.20  ? 1153 PHE B CD1 1 
ATOM   6102  C CD2 . PHE B 1 357 ? -36.783 -0.672  0.804    1.00 94.61  ? 1153 PHE B CD2 1 
ATOM   6103  C CE1 . PHE B 1 357 ? -38.851 -1.861  -0.579   1.00 85.41  ? 1153 PHE B CE1 1 
ATOM   6104  C CE2 . PHE B 1 357 ? -36.537 -1.791  0.026    1.00 91.56  ? 1153 PHE B CE2 1 
ATOM   6105  C CZ  . PHE B 1 357 ? -37.575 -2.387  -0.666   1.00 91.98  ? 1153 PHE B CZ  1 
ATOM   6106  N N   . ARG B 1 358 ? -39.589 3.912   2.421    1.00 82.72  ? 1154 ARG B N   1 
ATOM   6107  C CA  . ARG B 1 358 ? -40.706 4.701   2.922    1.00 87.08  ? 1154 ARG B CA  1 
ATOM   6108  C C   . ARG B 1 358 ? -40.953 5.945   2.069    1.00 92.95  ? 1154 ARG B C   1 
ATOM   6109  O O   . ARG B 1 358 ? -42.021 6.084   1.474    1.00 99.70  ? 1154 ARG B O   1 
ATOM   6110  C CB  . ARG B 1 358 ? -40.509 5.066   4.394    1.00 89.61  ? 1154 ARG B CB  1 
ATOM   6111  C CG  . ARG B 1 358 ? -40.659 3.879   5.329    1.00 90.05  ? 1154 ARG B CG  1 
ATOM   6112  C CD  . ARG B 1 358 ? -40.800 4.312   6.776    1.00 90.28  ? 1154 ARG B CD  1 
ATOM   6113  N NE  . ARG B 1 358 ? -39.618 5.013   7.262    1.00 99.50  ? 1154 ARG B NE  1 
ATOM   6114  C CZ  . ARG B 1 358 ? -39.382 5.278   8.544    1.00 105.94 ? 1154 ARG B CZ  1 
ATOM   6115  N NH1 . ARG B 1 358 ? -40.246 4.893   9.474    1.00 93.73  ? 1154 ARG B NH1 1 
ATOM   6116  N NH2 . ARG B 1 358 ? -38.277 5.925   8.896    1.00 113.45 ? 1154 ARG B NH2 1 
ATOM   6117  N N   . THR B 1 359 ? -39.974 6.845   2.012    1.00 92.05  ? 1155 THR B N   1 
ATOM   6118  C CA  . THR B 1 359 ? -40.124 8.104   1.279    1.00 88.54  ? 1155 THR B CA  1 
ATOM   6119  C C   . THR B 1 359 ? -40.423 7.910   -0.204   1.00 90.96  ? 1155 THR B C   1 
ATOM   6120  O O   . THR B 1 359 ? -40.894 8.833   -0.872   1.00 87.16  ? 1155 THR B O   1 
ATOM   6121  C CB  . THR B 1 359 ? -38.862 8.970   1.393    1.00 92.31  ? 1155 THR B CB  1 
ATOM   6122  O OG1 . THR B 1 359 ? -37.745 8.261   0.838    1.00 91.64  ? 1155 THR B OG1 1 
ATOM   6123  C CG2 . THR B 1 359 ? -38.581 9.309   2.848    1.00 95.36  ? 1155 THR B CG2 1 
ATOM   6124  N N   . GLY B 1 360 ? -40.145 6.714   -0.716   1.00 86.19  ? 1156 GLY B N   1 
ATOM   6125  C CA  . GLY B 1 360 ? -40.321 6.437   -2.127   1.00 81.73  ? 1156 GLY B CA  1 
ATOM   6126  C C   . GLY B 1 360 ? -39.530 7.426   -2.956   1.00 86.69  ? 1156 GLY B C   1 
ATOM   6127  O O   . GLY B 1 360 ? -39.894 7.738   -4.090   1.00 86.56  ? 1156 GLY B O   1 
ATOM   6128  N N   . THR B 1 361 ? -38.441 7.926   -2.377   1.00 88.32  ? 1157 THR B N   1 
ATOM   6129  C CA  . THR B 1 361 ? -37.595 8.918   -3.033   1.00 91.12  ? 1157 THR B CA  1 
ATOM   6130  C C   . THR B 1 361 ? -36.104 8.685   -2.785   1.00 88.20  ? 1157 THR B C   1 
ATOM   6131  O O   . THR B 1 361 ? -35.713 7.876   -1.941   1.00 80.45  ? 1157 THR B O   1 
ATOM   6132  C CB  . THR B 1 361 ? -37.966 10.360  -2.626   1.00 96.83  ? 1157 THR B CB  1 
ATOM   6133  O OG1 . THR B 1 361 ? -37.755 10.535  -1.222   1.00 104.44 ? 1157 THR B OG1 1 
ATOM   6134  C CG2 . THR B 1 361 ? -39.421 10.655  -2.958   1.00 96.58  ? 1157 THR B CG2 1 
ATOM   6135  N N   . TRP B 1 362 ? -35.281 9.425   -3.516   1.00 90.07  ? 1158 TRP B N   1 
ATOM   6136  C CA  . TRP B 1 362 ? -33.839 9.228   -3.501   1.00 90.17  ? 1158 TRP B CA  1 
ATOM   6137  C C   . TRP B 1 362 ? -33.192 10.016  -2.377   1.00 90.91  ? 1158 TRP B C   1 
ATOM   6138  O O   . TRP B 1 362 ? -31.969 10.092  -2.294   1.00 94.68  ? 1158 TRP B O   1 
ATOM   6139  C CB  . TRP B 1 362 ? -33.225 9.600   -4.857   1.00 86.16  ? 1158 TRP B CB  1 
ATOM   6140  C CG  . TRP B 1 362 ? -33.745 8.737   -5.965   1.00 84.27  ? 1158 TRP B CG  1 
ATOM   6141  C CD1 . TRP B 1 362 ? -34.652 9.087   -6.922   1.00 88.17  ? 1158 TRP B CD1 1 
ATOM   6142  C CD2 . TRP B 1 362 ? -33.422 7.362   -6.203   1.00 80.45  ? 1158 TRP B CD2 1 
ATOM   6143  N NE1 . TRP B 1 362 ? -34.902 8.019   -7.749   1.00 86.07  ? 1158 TRP B NE1 1 
ATOM   6144  C CE2 . TRP B 1 362 ? -34.159 6.948   -7.327   1.00 82.57  ? 1158 TRP B CE2 1 
ATOM   6145  C CE3 . TRP B 1 362 ? -32.579 6.442   -5.575   1.00 81.02  ? 1158 TRP B CE3 1 
ATOM   6146  C CZ2 . TRP B 1 362 ? -34.075 5.655   -7.838   1.00 85.15  ? 1158 TRP B CZ2 1 
ATOM   6147  C CZ3 . TRP B 1 362 ? -32.497 5.160   -6.083   1.00 74.42  ? 1158 TRP B CZ3 1 
ATOM   6148  C CH2 . TRP B 1 362 ? -33.239 4.778   -7.202   1.00 78.95  ? 1158 TRP B CH2 1 
ATOM   6149  N N   . ASP B 1 363 ? -34.017 10.600  -1.513   1.00 93.68  ? 1159 ASP B N   1 
ATOM   6150  C CA  . ASP B 1 363 ? -33.524 11.501  -0.476   1.00 98.29  ? 1159 ASP B CA  1 
ATOM   6151  C C   . ASP B 1 363 ? -32.290 10.952  0.237    1.00 99.09  ? 1159 ASP B C   1 
ATOM   6152  O O   . ASP B 1 363 ? -31.343 11.693  0.498    1.00 99.15  ? 1159 ASP B O   1 
ATOM   6153  C CB  . ASP B 1 363 ? -34.626 11.801  0.547    1.00 95.37  ? 1159 ASP B CB  1 
ATOM   6154  C CG  . ASP B 1 363 ? -35.826 12.495  -0.069   1.00 105.36 ? 1159 ASP B CG  1 
ATOM   6155  O OD1 . ASP B 1 363 ? -35.718 12.968  -1.222   1.00 111.78 ? 1159 ASP B OD1 1 
ATOM   6156  O OD2 . ASP B 1 363 ? -36.876 12.573  0.607    1.00 102.69 ? 1159 ASP B OD2 1 
ATOM   6157  N N   . ALA B 1 364 ? -32.293 9.656   0.536    1.00 98.34  ? 1160 ALA B N   1 
ATOM   6158  C CA  . ALA B 1 364 ? -31.145 9.027   1.188    1.00 92.76  ? 1160 ALA B CA  1 
ATOM   6159  C C   . ALA B 1 364 ? -29.897 9.116   0.313    1.00 95.45  ? 1160 ALA B C   1 
ATOM   6160  O O   . ALA B 1 364 ? -28.802 9.394   0.800    1.00 98.95  ? 1160 ALA B O   1 
ATOM   6161  C CB  . ALA B 1 364 ? -31.446 7.577   1.532    1.00 81.74  ? 1160 ALA B CB  1 
ATOM   6162  N N   . TYR B 1 365 ? -30.072 8.864   -0.981   1.00 92.94  ? 1161 TYR B N   1 
ATOM   6163  C CA  . TYR B 1 365 ? -28.957 8.798   -1.922   1.00 81.25  ? 1161 TYR B CA  1 
ATOM   6164  C C   . TYR B 1 365 ? -28.651 10.102  -2.656   1.00 85.02  ? 1161 TYR B C   1 
ATOM   6165  O O   . TYR B 1 365 ? -27.631 10.210  -3.333   1.00 86.83  ? 1161 TYR B O   1 
ATOM   6166  C CB  . TYR B 1 365 ? -29.203 7.663   -2.915   1.00 70.74  ? 1161 TYR B CB  1 
ATOM   6167  C CG  . TYR B 1 365 ? -29.411 6.351   -2.211   1.00 69.06  ? 1161 TYR B CG  1 
ATOM   6168  C CD1 . TYR B 1 365 ? -28.348 5.495   -1.984   1.00 77.93  ? 1161 TYR B CD1 1 
ATOM   6169  C CD2 . TYR B 1 365 ? -30.660 5.985   -1.733   1.00 76.29  ? 1161 TYR B CD2 1 
ATOM   6170  C CE1 . TYR B 1 365 ? -28.524 4.298   -1.323   1.00 79.06  ? 1161 TYR B CE1 1 
ATOM   6171  C CE2 . TYR B 1 365 ? -30.846 4.787   -1.070   1.00 80.83  ? 1161 TYR B CE2 1 
ATOM   6172  C CZ  . TYR B 1 365 ? -29.772 3.947   -0.868   1.00 81.56  ? 1161 TYR B CZ  1 
ATOM   6173  O OH  . TYR B 1 365 ? -29.938 2.750   -0.212   1.00 85.63  ? 1161 TYR B OH  1 
ATOM   6174  N N   . LEU B 1 366 ? -29.526 11.091  -2.509   1.00 91.85  ? 482  LEU B N   1 
ATOM   6175  C CA  . LEU B 1 366 ? -29.378 12.355  -3.225   1.00 100.37 ? 482  LEU B CA  1 
ATOM   6176  C C   . LEU B 1 366 ? -29.159 12.125  -4.722   1.00 96.56  ? 482  LEU B C   1 
ATOM   6177  O O   . LEU B 1 366 ? -28.104 12.460  -5.262   1.00 101.40 ? 482  LEU B O   1 
ATOM   6178  C CB  . LEU B 1 366 ? -28.222 13.170  -2.639   1.00 99.08  ? 482  LEU B CB  1 
ATOM   6179  C CG  . LEU B 1 366 ? -28.417 13.642  -1.196   1.00 101.09 ? 482  LEU B CG  1 
ATOM   6180  C CD1 . LEU B 1 366 ? -27.210 14.436  -0.725   1.00 102.53 ? 482  LEU B CD1 1 
ATOM   6181  C CD2 . LEU B 1 366 ? -29.689 14.469  -1.074   1.00 96.22  ? 482  LEU B CD2 1 
ATOM   6182  N N   . ILE B 1 367 ? -30.166 11.562  -5.385   1.00 88.51  ? 483  ILE B N   1 
ATOM   6183  C CA  . ILE B 1 367 ? -30.053 11.185  -6.792   1.00 83.60  ? 483  ILE B CA  1 
ATOM   6184  C C   . ILE B 1 367 ? -30.966 12.010  -7.699   1.00 90.73  ? 483  ILE B C   1 
ATOM   6185  O O   . ILE B 1 367 ? -32.174 12.074  -7.479   1.00 89.53  ? 483  ILE B O   1 
ATOM   6186  C CB  . ILE B 1 367 ? -30.362 9.693   -6.989   1.00 75.73  ? 483  ILE B CB  1 
ATOM   6187  C CG1 . ILE B 1 367 ? -29.292 8.842   -6.302   1.00 76.41  ? 483  ILE B CG1 1 
ATOM   6188  C CG2 . ILE B 1 367 ? -30.449 9.363   -8.466   1.00 78.39  ? 483  ILE B CG2 1 
ATOM   6189  C CD1 . ILE B 1 367 ? -29.465 7.359   -6.505   1.00 76.03  ? 483  ILE B CD1 1 
ATOM   6190  N N   . LYS B 1 368 ? -30.380 12.624  -8.726   1.00 94.20  ? 484  LYS B N   1 
ATOM   6191  C CA  . LYS B 1 368 ? -31.103 13.549  -9.601   1.00 87.51  ? 484  LYS B CA  1 
ATOM   6192  C C   . LYS B 1 368 ? -32.331 12.923  -10.242  1.00 89.43  ? 484  LYS B C   1 
ATOM   6193  O O   . LYS B 1 368 ? -33.341 13.597  -10.436  1.00 97.40  ? 484  LYS B O   1 
ATOM   6194  C CB  . LYS B 1 368 ? -30.192 14.108  -10.700  1.00 86.51  ? 484  LYS B CB  1 
ATOM   6195  C CG  . LYS B 1 368 ? -28.764 13.593  -10.667  1.00 90.75  ? 484  LYS B CG  1 
ATOM   6196  C CD  . LYS B 1 368 ? -27.979 14.215  -9.524   1.00 91.34  ? 484  LYS B CD  1 
ATOM   6197  C CE  . LYS B 1 368 ? -26.593 13.616  -9.434   1.00 88.46  ? 484  LYS B CE  1 
ATOM   6198  N NZ  . LYS B 1 368 ? -26.650 12.132  -9.348   1.00 89.39  ? 484  LYS B NZ  1 
ATOM   6199  N N   . GLU B 1 369 ? -32.235 11.642  -10.583  1.00 87.37  ? 485  GLU B N   1 
ATOM   6200  C CA  . GLU B 1 369 ? -33.344 10.928  -11.216  1.00 94.38  ? 485  GLU B CA  1 
ATOM   6201  C C   . GLU B 1 369 ? -33.643 11.458  -12.618  1.00 92.48  ? 485  GLU B C   1 
ATOM   6202  O O   . GLU B 1 369 ? -33.539 10.728  -13.607  1.00 89.43  ? 485  GLU B O   1 
ATOM   6203  C CB  . GLU B 1 369 ? -34.600 10.998  -10.338  1.00 97.42  ? 485  GLU B CB  1 
ATOM   6204  C CG  . GLU B 1 369 ? -35.859 10.405  -10.968  1.00 101.26 ? 485  GLU B CG  1 
ATOM   6205  C CD  . GLU B 1 369 ? -35.865 8.882   -10.987  1.00 101.15 ? 485  GLU B CD  1 
ATOM   6206  O OE1 . GLU B 1 369 ? -34.810 8.268   -10.718  1.00 95.38  ? 485  GLU B OE1 1 
ATOM   6207  O OE2 . GLU B 1 369 ? -36.933 8.298   -11.270  1.00 106.97 ? 485  GLU B OE2 1 
ATOM   6208  N N   . ALA B 1 373 ? -35.894 7.960   -22.506  1.00 89.29  ? 489  ALA B N   1 
ATOM   6209  C CA  . ALA B 1 373 ? -36.807 8.150   -23.630  1.00 88.12  ? 489  ALA B CA  1 
ATOM   6210  C C   . ALA B 1 373 ? -37.368 9.569   -23.664  1.00 95.94  ? 489  ALA B C   1 
ATOM   6211  O O   . ALA B 1 373 ? -38.383 9.832   -24.317  1.00 90.47  ? 489  ALA B O   1 
ATOM   6212  C CB  . ALA B 1 373 ? -37.932 7.127   -23.587  1.00 85.45  ? 489  ALA B CB  1 
ATOM   6213  N N   . GLN B 1 374 ? -36.690 10.479  -22.966  1.00 104.93 ? 490  GLN B N   1 
ATOM   6214  C CA  . GLN B 1 374 ? -37.103 11.883  -22.895  1.00 105.00 ? 490  GLN B CA  1 
ATOM   6215  C C   . GLN B 1 374 ? -36.697 12.714  -24.105  1.00 103.54 ? 490  GLN B C   1 
ATOM   6216  O O   . GLN B 1 374 ? -35.520 12.735  -24.492  1.00 101.65 ? 490  GLN B O   1 
ATOM   6217  C CB  . GLN B 1 374 ? -36.540 12.545  -21.632  1.00 102.21 ? 490  GLN B CB  1 
ATOM   6218  C CG  . GLN B 1 374 ? -36.403 14.066  -21.733  1.00 93.76  ? 490  GLN B CG  1 
ATOM   6219  C CD  . GLN B 1 374 ? -35.106 14.590  -21.128  1.00 96.44  ? 490  GLN B CD  1 
ATOM   6220  O OE1 . GLN B 1 374 ? -34.613 14.060  -20.138  1.00 115.55 ? 490  GLN B OE1 1 
ATOM   6221  N NE2 . GLN B 1 374 ? -34.543 15.627  -21.734  1.00 88.46  ? 490  GLN B NE2 1 
ATOM   6222  N N   . THR B 1 375 ? -37.683 13.372  -24.709  1.00 99.31  ? 491  THR B N   1 
ATOM   6223  C CA  . THR B 1 375 ? -37.444 14.389  -25.729  1.00 95.06  ? 491  THR B CA  1 
ATOM   6224  C C   . THR B 1 375 ? -36.979 13.830  -27.083  1.00 87.73  ? 491  THR B C   1 
ATOM   6225  O O   . THR B 1 375 ? -37.292 14.408  -28.118  1.00 93.06  ? 491  THR B O   1 
ATOM   6226  C CB  . THR B 1 375 ? -36.449 15.460  -25.195  1.00 96.81  ? 491  THR B CB  1 
ATOM   6227  O OG1 . THR B 1 375 ? -37.033 16.188  -24.105  1.00 107.75 ? 491  THR B OG1 1 
ATOM   6228  C CG2 . THR B 1 375 ? -36.040 16.470  -26.277  1.00 75.49  ? 491  THR B CG2 1 
ATOM   6229  N N   . LEU B 1 376 ? -36.372 12.645  -27.097  1.00 87.41  ? 492  LEU B N   1 
ATOM   6230  C CA  . LEU B 1 376 ? -35.902 12.075  -28.367  1.00 83.72  ? 492  LEU B CA  1 
ATOM   6231  C C   . LEU B 1 376 ? -36.986 11.286  -29.109  1.00 68.86  ? 492  LEU B C   1 
ATOM   6232  O O   . LEU B 1 376 ? -37.001 11.281  -30.331  1.00 65.53  ? 492  LEU B O   1 
ATOM   6233  C CB  . LEU B 1 376 ? -34.633 11.230  -28.234  1.00 78.64  ? 492  LEU B CB  1 
ATOM   6234  C CG  . LEU B 1 376 ? -34.694 9.778   -27.752  1.00 70.30  ? 492  LEU B CG  1 
ATOM   6235  C CD1 . LEU B 1 376 ? -33.374 9.038   -28.003  1.00 63.91  ? 492  LEU B CD1 1 
ATOM   6236  C CD2 . LEU B 1 376 ? -35.091 9.725   -26.280  1.00 73.66  ? 492  LEU B CD2 1 
ATOM   6237  N N   . SER B 1 377 ? -37.892 10.623  -28.388  1.00 66.05  ? 493  SER B N   1 
ATOM   6238  C CA  . SER B 1 377 ? -38.972 9.897   -29.048  1.00 65.76  ? 493  SER B CA  1 
ATOM   6239  C C   . SER B 1 377 ? -39.525 10.845  -30.092  1.00 68.26  ? 493  SER B C   1 
ATOM   6240  O O   . SER B 1 377 ? -39.660 10.498  -31.271  1.00 71.79  ? 493  SER B O   1 
ATOM   6241  C CB  . SER B 1 377 ? -40.055 9.536   -28.040  1.00 70.05  ? 493  SER B CB  1 
ATOM   6242  O OG  . SER B 1 377 ? -39.509 8.893   -26.899  1.00 69.83  ? 493  SER B OG  1 
ATOM   6243  N N   . ALA B 1 378 ? -39.790 12.066  -29.640  1.00 67.26  ? 494  ALA B N   1 
ATOM   6244  C CA  . ALA B 1 378 ? -40.400 13.099  -30.457  1.00 69.73  ? 494  ALA B CA  1 
ATOM   6245  C C   . ALA B 1 378 ? -39.514 13.478  -31.639  1.00 73.62  ? 494  ALA B C   1 
ATOM   6246  O O   . ALA B 1 378 ? -39.953 13.470  -32.792  1.00 73.21  ? 494  ALA B O   1 
ATOM   6247  C CB  . ALA B 1 378 ? -40.704 14.307  -29.604  1.00 65.41  ? 494  ALA B CB  1 
ATOM   6248  N N   . ILE B 1 379 ? -38.265 13.814  -31.337  1.00 73.42  ? 495  ILE B N   1 
ATOM   6249  C CA  . ILE B 1 379 ? -37.309 14.260  -32.344  1.00 75.64  ? 495  ILE B CA  1 
ATOM   6250  C C   . ILE B 1 379 ? -37.003 13.202  -33.409  1.00 76.47  ? 495  ILE B C   1 
ATOM   6251  O O   . ILE B 1 379 ? -37.120 13.457  -34.612  1.00 71.82  ? 495  ILE B O   1 
ATOM   6252  C CB  . ILE B 1 379 ? -35.996 14.709  -31.687  1.00 69.83  ? 495  ILE B CB  1 
ATOM   6253  C CG1 . ILE B 1 379 ? -36.237 15.933  -30.803  1.00 77.36  ? 495  ILE B CG1 1 
ATOM   6254  C CG2 . ILE B 1 379 ? -34.956 15.010  -32.743  1.00 71.34  ? 495  ILE B CG2 1 
ATOM   6255  C CD1 . ILE B 1 379 ? -36.894 17.083  -31.532  1.00 83.48  ? 495  ILE B CD1 1 
ATOM   6256  N N   . LEU B 1 380 ? -36.589 12.026  -32.950  1.00 70.67  ? 496  LEU B N   1 
ATOM   6257  C CA  . LEU B 1 380 ? -36.283 10.882  -33.802  1.00 61.56  ? 496  LEU B CA  1 
ATOM   6258  C C   . LEU B 1 380 ? -37.479 10.522  -34.671  1.00 65.52  ? 496  LEU B C   1 
ATOM   6259  O O   . LEU B 1 380 ? -37.386 10.503  -35.908  1.00 65.84  ? 496  LEU B O   1 
ATOM   6260  C CB  . LEU B 1 380 ? -35.871 9.681   -32.944  1.00 58.06  ? 496  LEU B CB  1 
ATOM   6261  C CG  . LEU B 1 380 ? -35.383 8.412   -33.649  1.00 63.19  ? 496  LEU B CG  1 
ATOM   6262  C CD1 . LEU B 1 380 ? -34.113 8.694   -34.436  1.00 66.38  ? 496  LEU B CD1 1 
ATOM   6263  C CD2 . LEU B 1 380 ? -35.144 7.270   -32.664  1.00 66.73  ? 496  LEU B CD2 1 
ATOM   6264  N N   . LEU B 1 381 ? -38.612 10.267  -34.018  1.00 66.93  ? 497  LEU B N   1 
ATOM   6265  C CA  . LEU B 1 381 ? -39.852 9.943   -34.723  1.00 68.32  ? 497  LEU B CA  1 
ATOM   6266  C C   . LEU B 1 381 ? -40.156 10.989  -35.795  1.00 64.53  ? 497  LEU B C   1 
ATOM   6267  O O   . LEU B 1 381 ? -40.501 10.650  -36.936  1.00 63.57  ? 497  LEU B O   1 
ATOM   6268  C CB  . LEU B 1 381 ? -41.017 9.833   -33.737  1.00 69.37  ? 497  LEU B CB  1 
ATOM   6269  C CG  . LEU B 1 381 ? -42.309 9.164   -34.215  1.00 60.63  ? 497  LEU B CG  1 
ATOM   6270  C CD1 . LEU B 1 381 ? -43.031 8.537   -33.029  1.00 56.31  ? 497  LEU B CD1 1 
ATOM   6271  C CD2 . LEU B 1 381 ? -43.228 10.123  -34.965  1.00 65.91  ? 497  LEU B CD2 1 
ATOM   6272  N N   . ALA B 1 382 ? -40.014 12.258  -35.422  1.00 58.46  ? 498  ALA B N   1 
ATOM   6273  C CA  . ALA B 1 382 ? -40.197 13.368  -36.350  1.00 61.23  ? 498  ALA B CA  1 
ATOM   6274  C C   . ALA B 1 382 ? -39.308 13.215  -37.594  1.00 68.92  ? 498  ALA B C   1 
ATOM   6275  O O   . ALA B 1 382 ? -39.796 13.116  -38.724  1.00 68.59  ? 498  ALA B O   1 
ATOM   6276  C CB  . ALA B 1 382 ? -39.920 14.684  -35.650  1.00 67.17  ? 498  ALA B CB  1 
ATOM   6277  N N   . PHE B 1 383 ? -37.997 13.210  -37.372  1.00 67.08  ? 499  PHE B N   1 
ATOM   6278  C CA  . PHE B 1 383 ? -37.025 13.033  -38.446  1.00 61.65  ? 499  PHE B CA  1 
ATOM   6279  C C   . PHE B 1 383 ? -37.442 11.909  -39.383  1.00 58.64  ? 499  PHE B C   1 
ATOM   6280  O O   . PHE B 1 383 ? -37.770 12.153  -40.550  1.00 59.86  ? 499  PHE B O   1 
ATOM   6281  C CB  . PHE B 1 383 ? -35.648 12.745  -37.838  1.00 64.14  ? 499  PHE B CB  1 
ATOM   6282  C CG  . PHE B 1 383 ? -34.675 12.088  -38.782  1.00 62.65  ? 499  PHE B CG  1 
ATOM   6283  C CD1 . PHE B 1 383 ? -34.381 10.740  -38.659  1.00 54.39  ? 499  PHE B CD1 1 
ATOM   6284  C CD2 . PHE B 1 383 ? -34.038 12.822  -39.775  1.00 65.70  ? 499  PHE B CD2 1 
ATOM   6285  C CE1 . PHE B 1 383 ? -33.480 10.129  -39.513  1.00 57.69  ? 499  PHE B CE1 1 
ATOM   6286  C CE2 . PHE B 1 383 ? -33.136 12.218  -40.636  1.00 61.81  ? 499  PHE B CE2 1 
ATOM   6287  C CZ  . PHE B 1 383 ? -32.858 10.867  -40.504  1.00 64.59  ? 499  PHE B CZ  1 
ATOM   6288  N N   . ILE B 1 384 ? -37.454 10.684  -38.867  1.00 55.63  ? 500  ILE B N   1 
ATOM   6289  C CA  . ILE B 1 384 ? -37.768 9.527   -39.695  1.00 59.38  ? 500  ILE B CA  1 
ATOM   6290  C C   . ILE B 1 384 ? -39.057 9.687   -40.499  1.00 60.25  ? 500  ILE B C   1 
ATOM   6291  O O   . ILE B 1 384 ? -39.089 9.366   -41.686  1.00 62.66  ? 500  ILE B O   1 
ATOM   6292  C CB  . ILE B 1 384 ? -37.848 8.238   -38.857  1.00 58.52  ? 500  ILE B CB  1 
ATOM   6293  C CG1 . ILE B 1 384 ? -38.343 7.072   -39.711  1.00 62.39  ? 500  ILE B CG1 1 
ATOM   6294  C CG2 . ILE B 1 384 ? -38.739 8.433   -37.649  1.00 59.54  ? 500  ILE B CG2 1 
ATOM   6295  C CD1 . ILE B 1 384 ? -38.673 5.837   -38.902  1.00 65.91  ? 500  ILE B CD1 1 
ATOM   6296  N N   . ILE B 1 385 ? -40.110 10.193  -39.860  1.00 64.26  ? 501  ILE B N   1 
ATOM   6297  C CA  . ILE B 1 385 ? -41.383 10.386  -40.551  1.00 65.90  ? 501  ILE B CA  1 
ATOM   6298  C C   . ILE B 1 385 ? -41.325 11.416  -41.688  1.00 61.33  ? 501  ILE B C   1 
ATOM   6299  O O   . ILE B 1 385 ? -41.919 11.224  -42.749  1.00 51.79  ? 501  ILE B O   1 
ATOM   6300  C CB  . ILE B 1 385 ? -42.472 10.786  -39.553  1.00 56.02  ? 501  ILE B CB  1 
ATOM   6301  C CG1 . ILE B 1 385 ? -42.894 9.575   -38.715  1.00 57.73  ? 501  ILE B CG1 1 
ATOM   6302  C CG2 . ILE B 1 385 ? -43.654 11.394  -40.268  1.00 58.28  ? 501  ILE B CG2 1 
ATOM   6303  C CD1 . ILE B 1 385 ? -44.190 9.772   -37.974  1.00 53.86  ? 501  ILE B CD1 1 
ATOM   6304  N N   . THR B 1 386 ? -40.604 12.507  -41.458  1.00 65.24  ? 502  THR B N   1 
ATOM   6305  C CA  . THR B 1 386 ? -40.484 13.573  -42.455  1.00 66.51  ? 502  THR B CA  1 
ATOM   6306  C C   . THR B 1 386 ? -39.575 13.214  -43.634  1.00 71.74  ? 502  THR B C   1 
ATOM   6307  O O   . THR B 1 386 ? -39.832 13.629  -44.767  1.00 76.04  ? 502  THR B O   1 
ATOM   6308  C CB  . THR B 1 386 ? -39.932 14.861  -41.840  1.00 70.35  ? 502  THR B CB  1 
ATOM   6309  O OG1 . THR B 1 386 ? -38.706 14.572  -41.151  1.00 70.98  ? 502  THR B OG1 1 
ATOM   6310  C CG2 . THR B 1 386 ? -40.939 15.442  -40.858  1.00 68.65  ? 502  THR B CG2 1 
ATOM   6311  N N   . TRP B 1 387 ? -38.502 12.466  -43.372  1.00 70.53  ? 503  TRP B N   1 
ATOM   6312  C CA  . TRP B 1 387 ? -37.604 12.031  -44.446  1.00 66.45  ? 503  TRP B CA  1 
ATOM   6313  C C   . TRP B 1 387 ? -38.073 10.777  -45.200  1.00 68.14  ? 503  TRP B C   1 
ATOM   6314  O O   . TRP B 1 387 ? -37.963 10.723  -46.430  1.00 71.92  ? 503  TRP B O   1 
ATOM   6315  C CB  . TRP B 1 387 ? -36.179 11.835  -43.937  1.00 60.91  ? 503  TRP B CB  1 
ATOM   6316  C CG  . TRP B 1 387 ? -35.507 13.124  -43.575  1.00 67.44  ? 503  TRP B CG  1 
ATOM   6317  C CD1 . TRP B 1 387 ? -36.114 14.272  -43.160  1.00 74.80  ? 503  TRP B CD1 1 
ATOM   6318  C CD2 . TRP B 1 387 ? -34.101 13.405  -43.605  1.00 67.51  ? 503  TRP B CD2 1 
ATOM   6319  N NE1 . TRP B 1 387 ? -35.177 15.248  -42.921  1.00 81.92  ? 503  TRP B NE1 1 
ATOM   6320  C CE2 . TRP B 1 387 ? -33.934 14.740  -43.187  1.00 75.54  ? 503  TRP B CE2 1 
ATOM   6321  C CE3 . TRP B 1 387 ? -32.971 12.658  -43.939  1.00 68.78  ? 503  TRP B CE3 1 
ATOM   6322  C CZ2 . TRP B 1 387 ? -32.679 15.342  -43.099  1.00 72.68  ? 503  TRP B CZ2 1 
ATOM   6323  C CZ3 . TRP B 1 387 ? -31.725 13.261  -43.850  1.00 67.36  ? 503  TRP B CZ3 1 
ATOM   6324  C CH2 . TRP B 1 387 ? -31.591 14.587  -43.433  1.00 68.12  ? 503  TRP B CH2 1 
ATOM   6325  N N   . THR B 1 388 ? -38.599 9.785   -44.476  1.00 64.20  ? 504  THR B N   1 
ATOM   6326  C CA  . THR B 1 388 ? -38.888 8.474   -45.057  1.00 64.07  ? 504  THR B CA  1 
ATOM   6327  C C   . THR B 1 388 ? -39.537 8.520   -46.433  1.00 64.49  ? 504  THR B C   1 
ATOM   6328  O O   . THR B 1 388 ? -39.202 7.707   -47.283  1.00 71.16  ? 504  THR B O   1 
ATOM   6329  C CB  . THR B 1 388 ? -39.735 7.591   -44.129  1.00 69.53  ? 504  THR B CB  1 
ATOM   6330  O OG1 . THR B 1 388 ? -40.647 8.401   -43.376  1.00 80.23  ? 504  THR B OG1 1 
ATOM   6331  C CG2 . THR B 1 388 ? -38.846 6.791   -43.176  1.00 65.75  ? 504  THR B CG2 1 
ATOM   6332  N N   . PRO B 1 389 ? -40.482 9.445   -46.655  1.00 62.17  ? 505  PRO B N   1 
ATOM   6333  C CA  . PRO B 1 389 ? -41.078 9.484   -47.995  1.00 66.13  ? 505  PRO B CA  1 
ATOM   6334  C C   . PRO B 1 389 ? -40.026 9.572   -49.101  1.00 71.93  ? 505  PRO B C   1 
ATOM   6335  O O   . PRO B 1 389 ? -40.067 8.806   -50.071  1.00 64.43  ? 505  PRO B O   1 
ATOM   6336  C CB  . PRO B 1 389 ? -41.895 10.775  -47.963  1.00 58.45  ? 505  PRO B CB  1 
ATOM   6337  C CG  . PRO B 1 389 ? -42.274 10.929  -46.543  1.00 61.28  ? 505  PRO B CG  1 
ATOM   6338  C CD  . PRO B 1 389 ? -41.115 10.411  -45.741  1.00 62.90  ? 505  PRO B CD  1 
ATOM   6339  N N   . TYR B 1 390 ? -39.078 10.488  -48.936  1.00 75.11  ? 506  TYR B N   1 
ATOM   6340  C CA  . TYR B 1 390 ? -38.059 10.720  -49.946  1.00 72.14  ? 506  TYR B CA  1 
ATOM   6341  C C   . TYR B 1 390 ? -37.314 9.432   -50.257  1.00 68.78  ? 506  TYR B C   1 
ATOM   6342  O O   . TYR B 1 390 ? -37.405 8.903   -51.360  1.00 70.07  ? 506  TYR B O   1 
ATOM   6343  C CB  . TYR B 1 390 ? -37.077 11.789  -49.474  1.00 77.76  ? 506  TYR B CB  1 
ATOM   6344  C CG  . TYR B 1 390 ? -36.197 12.319  -50.576  1.00 75.36  ? 506  TYR B CG  1 
ATOM   6345  C CD1 . TYR B 1 390 ? -36.508 13.501  -51.230  1.00 79.55  ? 506  TYR B CD1 1 
ATOM   6346  C CD2 . TYR B 1 390 ? -35.062 11.630  -50.972  1.00 75.78  ? 506  TYR B CD2 1 
ATOM   6347  C CE1 . TYR B 1 390 ? -35.707 13.989  -52.246  1.00 82.50  ? 506  TYR B CE1 1 
ATOM   6348  C CE2 . TYR B 1 390 ? -34.255 12.108  -51.986  1.00 82.62  ? 506  TYR B CE2 1 
ATOM   6349  C CZ  . TYR B 1 390 ? -34.580 13.289  -52.622  1.00 83.63  ? 506  TYR B CZ  1 
ATOM   6350  O OH  . TYR B 1 390 ? -33.775 13.773  -53.634  1.00 78.97  ? 506  TYR B OH  1 
ATOM   6351  N N   . ASN B 1 391 ? -36.581 8.934   -49.268  1.00 69.54  ? 507  ASN B N   1 
ATOM   6352  C CA  . ASN B 1 391 ? -35.824 7.697   -49.414  1.00 69.38  ? 507  ASN B CA  1 
ATOM   6353  C C   . ASN B 1 391 ? -36.656 6.561   -49.986  1.00 66.68  ? 507  ASN B C   1 
ATOM   6354  O O   . ASN B 1 391 ? -36.244 5.914   -50.939  1.00 63.34  ? 507  ASN B O   1 
ATOM   6355  C CB  . ASN B 1 391 ? -35.218 7.281   -48.074  1.00 68.18  ? 507  ASN B CB  1 
ATOM   6356  C CG  . ASN B 1 391 ? -34.043 8.148   -47.677  1.00 66.75  ? 507  ASN B CG  1 
ATOM   6357  O OD1 . ASN B 1 391 ? -32.899 7.858   -48.031  1.00 62.64  ? 507  ASN B OD1 1 
ATOM   6358  N ND2 . ASN B 1 391 ? -34.317 9.224   -46.946  1.00 66.87  ? 507  ASN B ND2 1 
ATOM   6359  N N   . ILE B 1 392 ? -37.830 6.332   -49.408  1.00 68.15  ? 508  ILE B N   1 
ATOM   6360  C CA  . ILE B 1 392 ? -38.755 5.324   -49.904  1.00 63.43  ? 508  ILE B CA  1 
ATOM   6361  C C   . ILE B 1 392 ? -38.931 5.510   -51.402  1.00 66.25  ? 508  ILE B C   1 
ATOM   6362  O O   . ILE B 1 392 ? -39.040 4.546   -52.161  1.00 67.15  ? 508  ILE B O   1 
ATOM   6363  C CB  . ILE B 1 392 ? -40.132 5.455   -49.219  1.00 65.42  ? 508  ILE B CB  1 
ATOM   6364  C CG1 . ILE B 1 392 ? -40.064 4.984   -47.762  1.00 64.48  ? 508  ILE B CG1 1 
ATOM   6365  C CG2 . ILE B 1 392 ? -41.179 4.672   -49.981  1.00 71.06  ? 508  ILE B CG2 1 
ATOM   6366  C CD1 . ILE B 1 392 ? -41.353 5.168   -46.987  1.00 52.74  ? 508  ILE B CD1 1 
ATOM   6367  N N   . MET B 1 393 ? -38.925 6.770   -51.819  1.00 69.92  ? 509  MET B N   1 
ATOM   6368  C CA  . MET B 1 393 ? -39.129 7.140   -53.215  1.00 76.82  ? 509  MET B CA  1 
ATOM   6369  C C   . MET B 1 393 ? -37.861 6.981   -54.057  1.00 76.15  ? 509  MET B C   1 
ATOM   6370  O O   . MET B 1 393 ? -37.925 6.909   -55.286  1.00 71.58  ? 509  MET B O   1 
ATOM   6371  C CB  . MET B 1 393 ? -39.651 8.571   -53.284  1.00 82.56  ? 509  MET B CB  1 
ATOM   6372  C CG  . MET B 1 393 ? -39.842 9.115   -54.672  1.00 91.37  ? 509  MET B CG  1 
ATOM   6373  S SD  . MET B 1 393 ? -40.571 10.755  -54.575  1.00 107.07 ? 509  MET B SD  1 
ATOM   6374  C CE  . MET B 1 393 ? -39.587 11.479  -53.264  1.00 329.30 ? 509  MET B CE  1 
ATOM   6375  N N   . VAL B 1 394 ? -36.712 6.939   -53.392  1.00 74.41  ? 510  VAL B N   1 
ATOM   6376  C CA  . VAL B 1 394 ? -35.458 6.616   -54.061  1.00 69.29  ? 510  VAL B CA  1 
ATOM   6377  C C   . VAL B 1 394 ? -35.375 5.111   -54.294  1.00 72.98  ? 510  VAL B C   1 
ATOM   6378  O O   . VAL B 1 394 ? -35.129 4.663   -55.406  1.00 70.61  ? 510  VAL B O   1 
ATOM   6379  C CB  . VAL B 1 394 ? -34.263 7.051   -53.210  1.00 57.76  ? 510  VAL B CB  1 
ATOM   6380  C CG1 . VAL B 1 394 ? -32.957 6.665   -53.881  1.00 50.88  ? 510  VAL B CG1 1 
ATOM   6381  C CG2 . VAL B 1 394 ? -34.323 8.545   -52.954  1.00 58.34  ? 510  VAL B CG2 1 
ATOM   6382  N N   . LEU B 1 395 ? -35.638 4.344   -53.236  1.00 71.74  ? 511  LEU B N   1 
ATOM   6383  C CA  . LEU B 1 395 ? -35.750 2.889   -53.289  1.00 63.82  ? 511  LEU B CA  1 
ATOM   6384  C C   . LEU B 1 395 ? -36.734 2.465   -54.367  1.00 72.62  ? 511  LEU B C   1 
ATOM   6385  O O   . LEU B 1 395 ? -36.510 1.482   -55.070  1.00 74.42  ? 511  LEU B O   1 
ATOM   6386  C CB  . LEU B 1 395 ? -36.220 2.354   -51.938  1.00 53.31  ? 511  LEU B CB  1 
ATOM   6387  C CG  . LEU B 1 395 ? -36.753 0.923   -51.953  1.00 54.13  ? 511  LEU B CG  1 
ATOM   6388  C CD1 . LEU B 1 395 ? -35.678 -0.019  -52.454  1.00 69.83  ? 511  LEU B CD1 1 
ATOM   6389  C CD2 . LEU B 1 395 ? -37.233 0.501   -50.576  1.00 52.68  ? 511  LEU B CD2 1 
ATOM   6390  N N   . VAL B 1 396 ? -37.837 3.202   -54.473  1.00 74.71  ? 512  VAL B N   1 
ATOM   6391  C CA  . VAL B 1 396 ? -38.773 3.008   -55.569  1.00 74.57  ? 512  VAL B CA  1 
ATOM   6392  C C   . VAL B 1 396 ? -38.144 3.451   -56.891  1.00 79.53  ? 512  VAL B C   1 
ATOM   6393  O O   . VAL B 1 396 ? -38.227 2.742   -57.894  1.00 87.27  ? 512  VAL B O   1 
ATOM   6394  C CB  . VAL B 1 396 ? -40.093 3.768   -55.329  1.00 71.58  ? 512  VAL B CB  1 
ATOM   6395  C CG1 . VAL B 1 396 ? -40.979 3.691   -56.559  1.00 68.50  ? 512  VAL B CG1 1 
ATOM   6396  C CG2 . VAL B 1 396 ? -40.823 3.227   -54.104  1.00 65.60  ? 512  VAL B CG2 1 
ATOM   6397  N N   . ASN B 1 397 ? -37.492 4.611   -56.875  1.00 73.91  ? 513  ASN B N   1 
ATOM   6398  C CA  . ASN B 1 397 ? -36.984 5.253   -58.089  1.00 74.85  ? 513  ASN B CA  1 
ATOM   6399  C C   . ASN B 1 397 ? -35.960 4.442   -58.849  1.00 87.57  ? 513  ASN B C   1 
ATOM   6400  O O   . ASN B 1 397 ? -35.862 4.518   -60.060  1.00 92.52  ? 513  ASN B O   1 
ATOM   6401  C CB  . ASN B 1 397 ? -36.330 6.590   -57.763  1.00 76.12  ? 513  ASN B CB  1 
ATOM   6402  C CG  . ASN B 1 397 ? -35.392 7.051   -58.872  1.00 81.72  ? 513  ASN B CG  1 
ATOM   6403  O OD1 . ASN B 1 397 ? -34.210 7.309   -58.646  1.00 82.87  ? 513  ASN B OD1 1 
ATOM   6404  N ND2 . ASN B 1 397 ? -35.918 7.127   -60.090  1.00 72.86  ? 513  ASN B ND2 1 
ATOM   6405  N N   . THR B 1 398 ? -35.166 3.692   -58.098  1.00 85.30  ? 514  THR B N   1 
ATOM   6406  C CA  . THR B 1 398 ? -34.053 2.930   -58.652  1.00 81.88  ? 514  THR B CA  1 
ATOM   6407  C C   . THR B 1 398 ? -34.548 1.861   -59.640  1.00 89.69  ? 514  THR B C   1 
ATOM   6408  O O   . THR B 1 398 ? -33.876 1.592   -60.645  1.00 86.85  ? 514  THR B O   1 
ATOM   6409  C CB  . THR B 1 398 ? -33.191 2.316   -57.569  1.00 74.84  ? 514  THR B CB  1 
ATOM   6410  O OG1 . THR B 1 398 ? -32.522 3.373   -56.882  1.00 79.65  ? 514  THR B OG1 1 
ATOM   6411  C CG2 . THR B 1 398 ? -32.173 1.388   -58.180  1.00 75.87  ? 514  THR B CG2 1 
ATOM   6412  N N   . PHE B 1 399 ? -35.705 1.259   -59.385  1.00 92.82  ? 515  PHE B N   1 
ATOM   6413  C CA  . PHE B 1 399 ? -36.088 0.114   -60.183  1.00 93.09  ? 515  PHE B CA  1 
ATOM   6414  C C   . PHE B 1 399 ? -36.786 0.415   -61.528  1.00 105.64 ? 515  PHE B C   1 
ATOM   6415  O O   . PHE B 1 399 ? -37.104 -0.516  -62.298  1.00 113.75 ? 515  PHE B O   1 
ATOM   6416  C CB  . PHE B 1 399 ? -36.812 -0.917  -59.304  1.00 91.81  ? 515  PHE B CB  1 
ATOM   6417  C CG  . PHE B 1 399 ? -35.955 -1.465  -58.172  1.00 91.90  ? 515  PHE B CG  1 
ATOM   6418  C CD1 . PHE B 1 399 ? -35.401 -0.611  -57.234  1.00 82.24  ? 515  PHE B CD1 1 
ATOM   6419  C CD2 . PHE B 1 399 ? -35.669 -2.822  -58.082  1.00 87.56  ? 515  PHE B CD2 1 
ATOM   6420  C CE1 . PHE B 1 399 ? -34.596 -1.095  -56.207  1.00 76.17  ? 515  PHE B CE1 1 
ATOM   6421  C CE2 . PHE B 1 399 ? -34.872 -3.311  -57.064  1.00 66.33  ? 515  PHE B CE2 1 
ATOM   6422  C CZ  . PHE B 1 399 ? -34.337 -2.463  -56.136  1.00 70.31  ? 515  PHE B CZ  1 
ATOM   6423  N N   . CYS B 1 400 ? -36.816 1.711   -61.863  1.00 107.66 ? 516  CYS B N   1 
ATOM   6424  C CA  . CYS B 1 400 ? -37.695 2.231   -62.915  1.00 113.62 ? 516  CYS B CA  1 
ATOM   6425  C C   . CYS B 1 400 ? -37.036 3.433   -63.526  1.00 111.16 ? 516  CYS B C   1 
ATOM   6426  O O   . CYS B 1 400 ? -35.972 3.871   -63.097  1.00 111.35 ? 516  CYS B O   1 
ATOM   6427  C CB  . CYS B 1 400 ? -39.149 2.225   -62.479  1.00 117.41 ? 516  CYS B CB  1 
ATOM   6428  S SG  . CYS B 1 400 ? -39.225 3.025   -60.856  1.00 138.60 ? 516  CYS B SG  1 
ATOM   6429  N N   . ASP B 1 401 ? -37.721 4.015   -64.504  1.00 113.91 ? 517  ASP B N   1 
ATOM   6430  C CA  . ASP B 1 401 ? -37.416 5.336   -65.033  1.00 110.89 ? 517  ASP B CA  1 
ATOM   6431  C C   . ASP B 1 401 ? -38.590 6.253   -64.744  1.00 111.50 ? 517  ASP B C   1 
ATOM   6432  O O   . ASP B 1 401 ? -38.451 7.302   -64.131  1.00 104.84 ? 517  ASP B O   1 
ATOM   6433  C CB  . ASP B 1 401 ? -37.082 5.295   -66.538  1.00 111.37 ? 517  ASP B CB  1 
ATOM   6434  C CG  . ASP B 1 401 ? -37.653 4.079   -67.247  1.00 115.24 ? 517  ASP B CG  1 
ATOM   6435  O OD1 . ASP B 1 401 ? -38.788 3.674   -66.937  1.00 123.86 ? 517  ASP B OD1 1 
ATOM   6436  O OD2 . ASP B 1 401 ? -36.954 3.529   -68.122  1.00 110.48 ? 517  ASP B OD2 1 
ATOM   6437  N N   . SER B 1 402 ? -39.743 5.850   -65.253  1.00 122.97 ? 518  SER B N   1 
ATOM   6438  C CA  . SER B 1 402 ? -40.949 6.669   -65.222  1.00 127.14 ? 518  SER B CA  1 
ATOM   6439  C C   . SER B 1 402 ? -41.809 6.617   -63.953  1.00 127.66 ? 518  SER B C   1 
ATOM   6440  O O   . SER B 1 402 ? -42.834 7.292   -63.895  1.00 131.52 ? 518  SER B O   1 
ATOM   6441  C CB  . SER B 1 402 ? -41.836 6.342   -66.439  1.00 128.45 ? 518  SER B CB  1 
ATOM   6442  O OG  . SER B 1 402 ? -42.180 4.959   -66.470  1.00 128.77 ? 518  SER B OG  1 
ATOM   6443  N N   . CYS B 1 403 ? -41.426 5.843   -62.942  1.00 123.37 ? 519  CYS B N   1 
ATOM   6444  C CA  . CYS B 1 403 ? -42.295 5.718   -61.795  1.00 114.94 ? 519  CYS B CA  1 
ATOM   6445  C C   . CYS B 1 403 ? -42.787 6.957   -61.049  1.00 119.38 ? 519  CYS B C   1 
ATOM   6446  O O   . CYS B 1 403 ? -43.938 6.976   -60.614  1.00 133.62 ? 519  CYS B O   1 
ATOM   6447  C CB  . CYS B 1 403 ? -41.622 4.783   -60.848  1.00 125.48 ? 519  CYS B CB  1 
ATOM   6448  S SG  . CYS B 1 403 ? -39.849 4.920   -61.169  1.00 150.24 ? 519  CYS B SG  1 
ATOM   6449  N N   . ILE B 1 404 ? -41.939 7.976   -60.919  1.00 112.17 ? 520  ILE B N   1 
ATOM   6450  C CA  . ILE B 1 404 ? -42.283 9.124   -60.085  1.00 107.15 ? 520  ILE B CA  1 
ATOM   6451  C C   . ILE B 1 404 ? -42.141 10.497  -60.742  1.00 107.57 ? 520  ILE B C   1 
ATOM   6452  O O   . ILE B 1 404 ? -41.187 10.748  -61.482  1.00 107.37 ? 520  ILE B O   1 
ATOM   6453  C CB  . ILE B 1 404 ? -41.471 9.119   -58.792  1.00 98.63  ? 520  ILE B CB  1 
ATOM   6454  C CG1 . ILE B 1 404 ? -42.048 8.081   -57.832  1.00 106.96 ? 520  ILE B CG1 1 
ATOM   6455  C CG2 . ILE B 1 404 ? -41.487 10.494  -58.159  1.00 102.00 ? 520  ILE B CG2 1 
ATOM   6456  C CD1 . ILE B 1 404 ? -43.544 8.227   -57.597  1.00 116.52 ? 520  ILE B CD1 1 
ATOM   6457  N N   . PRO B 1 405 ? -43.104 11.391  -60.458  1.00 108.52 ? 521  PRO B N   1 
ATOM   6458  C CA  . PRO B 1 405 ? -43.180 12.771  -60.950  1.00 100.90 ? 521  PRO B CA  1 
ATOM   6459  C C   . PRO B 1 405 ? -42.280 13.735  -60.184  1.00 91.93  ? 521  PRO B C   1 
ATOM   6460  O O   . PRO B 1 405 ? -42.017 13.509  -59.006  1.00 99.43  ? 521  PRO B O   1 
ATOM   6461  C CB  . PRO B 1 405 ? -44.652 13.139  -60.713  1.00 100.64 ? 521  PRO B CB  1 
ATOM   6462  C CG  . PRO B 1 405 ? -45.362 11.819  -60.504  1.00 98.81  ? 521  PRO B CG  1 
ATOM   6463  C CD  . PRO B 1 405 ? -44.355 10.993  -59.794  1.00 105.23 ? 521  PRO B CD  1 
ATOM   6464  N N   . LYS B 1 406 ? -41.825 14.799  -60.839  1.00 80.70  ? 522  LYS B N   1 
ATOM   6465  C CA  . LYS B 1 406 ? -40.992 15.790  -60.167  1.00 87.51  ? 522  LYS B CA  1 
ATOM   6466  C C   . LYS B 1 406 ? -41.759 16.358  -58.980  1.00 97.46  ? 522  LYS B C   1 
ATOM   6467  O O   . LYS B 1 406 ? -41.170 16.768  -57.971  1.00 101.44 ? 522  LYS B O   1 
ATOM   6468  C CB  . LYS B 1 406 ? -40.578 16.905  -61.127  1.00 81.26  ? 522  LYS B CB  1 
ATOM   6469  C CG  . LYS B 1 406 ? -39.363 17.692  -60.659  1.00 77.40  ? 522  LYS B CG  1 
ATOM   6470  C CD  . LYS B 1 406 ? -38.662 18.364  -61.828  1.00 94.66  ? 522  LYS B CD  1 
ATOM   6471  C CE  . LYS B 1 406 ? -37.188 18.589  -61.526  1.00 103.03 ? 522  LYS B CE  1 
ATOM   6472  N NZ  . LYS B 1 406 ? -36.424 19.044  -62.723  1.00 96.61  ? 522  LYS B NZ  1 
ATOM   6473  N N   . THR B 1 407 ? -43.082 16.364  -59.110  1.00 94.69  ? 523  THR B N   1 
ATOM   6474  C CA  . THR B 1 407 ? -43.963 16.770  -58.024  1.00 94.28  ? 523  THR B CA  1 
ATOM   6475  C C   . THR B 1 407 ? -43.611 16.019  -56.740  1.00 98.45  ? 523  THR B C   1 
ATOM   6476  O O   . THR B 1 407 ? -43.149 16.616  -55.758  1.00 101.00 ? 523  THR B O   1 
ATOM   6477  C CB  . THR B 1 407 ? -45.438 16.501  -58.370  1.00 87.18  ? 523  THR B CB  1 
ATOM   6478  O OG1 . THR B 1 407 ? -45.782 17.191  -59.576  1.00 83.07  ? 523  THR B OG1 1 
ATOM   6479  C CG2 . THR B 1 407 ? -46.348 16.968  -57.246  1.00 81.35  ? 523  THR B CG2 1 
ATOM   6480  N N   . TYR B 1 408 ? -43.818 14.706  -56.760  1.00 94.80  ? 524  TYR B N   1 
ATOM   6481  C CA  . TYR B 1 408 ? -43.624 13.880  -55.572  1.00 98.97  ? 524  TYR B CA  1 
ATOM   6482  C C   . TYR B 1 408 ? -42.229 14.038  -54.966  1.00 95.57  ? 524  TYR B C   1 
ATOM   6483  O O   . TYR B 1 408 ? -42.076 14.086  -53.740  1.00 97.61  ? 524  TYR B O   1 
ATOM   6484  C CB  . TYR B 1 408 ? -43.934 12.412  -55.884  1.00 105.69 ? 524  TYR B CB  1 
ATOM   6485  C CG  . TYR B 1 408 ? -45.366 12.178  -56.327  1.00 106.20 ? 524  TYR B CG  1 
ATOM   6486  C CD1 . TYR B 1 408 ? -46.289 13.218  -56.339  1.00 108.19 ? 524  TYR B CD1 1 
ATOM   6487  C CD2 . TYR B 1 408 ? -45.796 10.919  -56.723  1.00 108.63 ? 524  TYR B CD2 1 
ATOM   6488  C CE1 . TYR B 1 408 ? -47.598 13.012  -56.740  1.00 108.55 ? 524  TYR B CE1 1 
ATOM   6489  C CE2 . TYR B 1 408 ? -47.102 10.703  -57.125  1.00 110.89 ? 524  TYR B CE2 1 
ATOM   6490  C CZ  . TYR B 1 408 ? -48.000 11.752  -57.131  1.00 109.95 ? 524  TYR B CZ  1 
ATOM   6491  O OH  . TYR B 1 408 ? -49.303 11.540  -57.531  1.00 107.75 ? 524  TYR B OH  1 
ATOM   6492  N N   . TRP B 1 409 ? -41.217 14.116  -55.825  1.00 89.36  ? 525  TRP B N   1 
ATOM   6493  C CA  . TRP B 1 409 ? -39.862 14.412  -55.381  1.00 95.12  ? 525  TRP B CA  1 
ATOM   6494  C C   . TRP B 1 409 ? -39.846 15.683  -54.540  1.00 102.85 ? 525  TRP B C   1 
ATOM   6495  O O   . TRP B 1 409 ? -39.526 15.665  -53.341  1.00 106.43 ? 525  TRP B O   1 
ATOM   6496  C CB  . TRP B 1 409 ? -38.920 14.600  -56.575  1.00 99.09  ? 525  TRP B CB  1 
ATOM   6497  C CG  . TRP B 1 409 ? -38.653 13.361  -57.376  1.00 103.25 ? 525  TRP B CG  1 
ATOM   6498  C CD1 . TRP B 1 409 ? -39.046 13.118  -58.659  1.00 101.55 ? 525  TRP B CD1 1 
ATOM   6499  C CD2 . TRP B 1 409 ? -37.921 12.201  -56.953  1.00 105.63 ? 525  TRP B CD2 1 
ATOM   6500  N NE1 . TRP B 1 409 ? -38.608 11.878  -59.061  1.00 99.94  ? 525  TRP B NE1 1 
ATOM   6501  C CE2 . TRP B 1 409 ? -37.920 11.296  -58.034  1.00 100.23 ? 525  TRP B CE2 1 
ATOM   6502  C CE3 . TRP B 1 409 ? -37.275 11.841  -55.767  1.00 103.72 ? 525  TRP B CE3 1 
ATOM   6503  C CZ2 . TRP B 1 409 ? -37.292 10.052  -57.960  1.00 94.97  ? 525  TRP B CZ2 1 
ATOM   6504  C CZ3 . TRP B 1 409 ? -36.654 10.604  -55.698  1.00 92.82  ? 525  TRP B CZ3 1 
ATOM   6505  C CH2 . TRP B 1 409 ? -36.668 9.726   -56.787  1.00 88.89  ? 525  TRP B CH2 1 
ATOM   6506  N N   . ASN B 1 410 ? -40.187 16.795  -55.183  1.00 92.65  ? 526  ASN B N   1 
ATOM   6507  C CA  . ASN B 1 410 ? -40.160 18.083  -54.506  1.00 85.67  ? 526  ASN B CA  1 
ATOM   6508  C C   . ASN B 1 410 ? -40.879 18.037  -53.160  1.00 83.05  ? 526  ASN B C   1 
ATOM   6509  O O   . ASN B 1 410 ? -40.325 18.447  -52.136  1.00 79.04  ? 526  ASN B O   1 
ATOM   6510  C CB  . ASN B 1 410 ? -40.756 19.154  -55.407  1.00 82.87  ? 526  ASN B CB  1 
ATOM   6511  C CG  . ASN B 1 410 ? -40.083 19.202  -56.764  1.00 91.76  ? 526  ASN B CG  1 
ATOM   6512  O OD1 . ASN B 1 410 ? -38.861 19.099  -56.861  1.00 93.49  ? 526  ASN B OD1 1 
ATOM   6513  N ND2 . ASN B 1 410 ? -40.877 19.345  -57.820  1.00 92.95  ? 526  ASN B ND2 1 
ATOM   6514  N N   . LEU B 1 411 ? -42.103 17.518  -53.158  1.00 84.35  ? 527  LEU B N   1 
ATOM   6515  C CA  . LEU B 1 411 ? -42.852 17.370  -51.911  1.00 84.17  ? 527  LEU B CA  1 
ATOM   6516  C C   . LEU B 1 411 ? -42.056 16.586  -50.865  1.00 88.38  ? 527  LEU B C   1 
ATOM   6517  O O   . LEU B 1 411 ? -42.075 16.928  -49.680  1.00 93.02  ? 527  LEU B O   1 
ATOM   6518  C CB  . LEU B 1 411 ? -44.217 16.715  -52.154  1.00 90.53  ? 527  LEU B CB  1 
ATOM   6519  C CG  . LEU B 1 411 ? -45.379 17.643  -52.531  1.00 82.18  ? 527  LEU B CG  1 
ATOM   6520  C CD1 . LEU B 1 411 ? -45.100 18.379  -53.833  1.00 77.69  ? 527  LEU B CD1 1 
ATOM   6521  C CD2 . LEU B 1 411 ? -46.697 16.879  -52.612  1.00 69.36  ? 527  LEU B CD2 1 
ATOM   6522  N N   . GLY B 1 412 ? -41.361 15.536  -51.303  1.00 90.39  ? 528  GLY B N   1 
ATOM   6523  C CA  . GLY B 1 412 ? -40.490 14.778  -50.419  1.00 88.71  ? 528  GLY B CA  1 
ATOM   6524  C C   . GLY B 1 412 ? -39.448 15.677  -49.775  1.00 90.74  ? 528  GLY B C   1 
ATOM   6525  O O   . GLY B 1 412 ? -39.263 15.665  -48.542  1.00 95.34  ? 528  GLY B O   1 
ATOM   6526  N N   . TYR B 1 413 ? -38.775 16.464  -50.614  1.00 80.40  ? 529  TYR B N   1 
ATOM   6527  C CA  . TYR B 1 413 ? -37.795 17.443  -50.144  1.00 82.81  ? 529  TYR B CA  1 
ATOM   6528  C C   . TYR B 1 413 ? -38.395 18.308  -49.042  1.00 87.40  ? 529  TYR B C   1 
ATOM   6529  O O   . TYR B 1 413 ? -37.827 18.453  -47.947  1.00 83.02  ? 529  TYR B O   1 
ATOM   6530  C CB  . TYR B 1 413 ? -37.370 18.347  -51.298  1.00 73.90  ? 529  TYR B CB  1 
ATOM   6531  C CG  . TYR B 1 413 ? -35.893 18.328  -51.609  1.00 76.75  ? 529  TYR B CG  1 
ATOM   6532  C CD1 . TYR B 1 413 ? -35.019 19.224  -51.004  1.00 79.82  ? 529  TYR B CD1 1 
ATOM   6533  C CD2 . TYR B 1 413 ? -35.370 17.422  -52.523  1.00 84.34  ? 529  TYR B CD2 1 
ATOM   6534  C CE1 . TYR B 1 413 ? -33.658 19.210  -51.299  1.00 78.87  ? 529  TYR B CE1 1 
ATOM   6535  C CE2 . TYR B 1 413 ? -34.015 17.401  -52.822  1.00 81.59  ? 529  TYR B CE2 1 
ATOM   6536  C CZ  . TYR B 1 413 ? -33.166 18.296  -52.209  1.00 77.69  ? 529  TYR B CZ  1 
ATOM   6537  O OH  . TYR B 1 413 ? -31.822 18.271  -52.507  1.00 76.91  ? 529  TYR B OH  1 
ATOM   6538  N N   . TRP B 1 414 ? -39.554 18.882  -49.342  1.00 86.45  ? 530  TRP B N   1 
ATOM   6539  C CA  . TRP B 1 414 ? -40.217 19.774  -48.403  1.00 88.26  ? 530  TRP B CA  1 
ATOM   6540  C C   . TRP B 1 414 ? -40.616 19.097  -47.091  1.00 88.22  ? 530  TRP B C   1 
ATOM   6541  O O   . TRP B 1 414 ? -40.599 19.734  -46.048  1.00 92.58  ? 530  TRP B O   1 
ATOM   6542  C CB  . TRP B 1 414 ? -41.416 20.476  -49.050  1.00 94.94  ? 530  TRP B CB  1 
ATOM   6543  C CG  . TRP B 1 414 ? -41.058 21.786  -49.691  1.00 91.11  ? 530  TRP B CG  1 
ATOM   6544  C CD1 . TRP B 1 414 ? -41.069 22.080  -51.022  1.00 85.16  ? 530  TRP B CD1 1 
ATOM   6545  C CD2 . TRP B 1 414 ? -40.620 22.974  -49.021  1.00 92.95  ? 530  TRP B CD2 1 
ATOM   6546  N NE1 . TRP B 1 414 ? -40.673 23.381  -51.223  1.00 84.08  ? 530  TRP B NE1 1 
ATOM   6547  C CE2 . TRP B 1 414 ? -40.390 23.952  -50.007  1.00 96.21  ? 530  TRP B CE2 1 
ATOM   6548  C CE3 . TRP B 1 414 ? -40.403 23.308  -47.679  1.00 89.11  ? 530  TRP B CE3 1 
ATOM   6549  C CZ2 . TRP B 1 414 ? -39.954 25.239  -49.699  1.00 98.38  ? 530  TRP B CZ2 1 
ATOM   6550  C CZ3 . TRP B 1 414 ? -39.969 24.587  -47.374  1.00 92.79  ? 530  TRP B CZ3 1 
ATOM   6551  C CH2 . TRP B 1 414 ? -39.749 25.536  -48.379  1.00 89.85  ? 530  TRP B CH2 1 
ATOM   6552  N N   . LEU B 1 415 ? -40.974 17.819  -47.133  1.00 81.84  ? 531  LEU B N   1 
ATOM   6553  C CA  . LEU B 1 415 ? -41.248 17.099  -45.895  1.00 82.95  ? 531  LEU B CA  1 
ATOM   6554  C C   . LEU B 1 415 ? -39.962 17.022  -45.077  1.00 85.44  ? 531  LEU B C   1 
ATOM   6555  O O   . LEU B 1 415 ? -39.943 17.296  -43.861  1.00 86.49  ? 531  LEU B O   1 
ATOM   6556  C CB  . LEU B 1 415 ? -41.784 15.702  -46.194  1.00 84.35  ? 531  LEU B CB  1 
ATOM   6557  C CG  . LEU B 1 415 ? -43.094 15.689  -46.985  1.00 85.77  ? 531  LEU B CG  1 
ATOM   6558  C CD1 . LEU B 1 415 ? -43.469 14.276  -47.397  1.00 81.70  ? 531  LEU B CD1 1 
ATOM   6559  C CD2 . LEU B 1 415 ? -44.213 16.337  -46.184  1.00 90.60  ? 531  LEU B CD2 1 
ATOM   6560  N N   . CYS B 1 416 ? -38.879 16.664  -45.761  1.00 85.73  ? 532  CYS B N   1 
ATOM   6561  C CA  . CYS B 1 416 ? -37.566 16.677  -45.134  1.00 85.25  ? 532  CYS B CA  1 
ATOM   6562  C C   . CYS B 1 416 ? -37.259 18.036  -44.507  1.00 91.17  ? 532  CYS B C   1 
ATOM   6563  O O   . CYS B 1 416 ? -36.514 18.118  -43.528  1.00 95.12  ? 532  CYS B O   1 
ATOM   6564  C CB  . CYS B 1 416 ? -36.495 16.294  -46.148  1.00 81.75  ? 532  CYS B CB  1 
ATOM   6565  S SG  . CYS B 1 416 ? -36.721 14.633  -46.789  1.00 96.49  ? 532  CYS B SG  1 
ATOM   6566  N N   . TYR B 1 417 ? -37.833 19.097  -45.068  1.00 85.99  ? 533  TYR B N   1 
ATOM   6567  C CA  . TYR B 1 417 ? -37.678 20.434  -44.487  1.00 90.62  ? 533  TYR B CA  1 
ATOM   6568  C C   . TYR B 1 417 ? -38.571 20.673  -43.256  1.00 94.36  ? 533  TYR B C   1 
ATOM   6569  O O   . TYR B 1 417 ? -38.140 21.264  -42.252  1.00 90.77  ? 533  TYR B O   1 
ATOM   6570  C CB  . TYR B 1 417 ? -37.951 21.508  -45.539  1.00 95.96  ? 533  TYR B CB  1 
ATOM   6571  C CG  . TYR B 1 417 ? -36.878 21.631  -46.597  1.00 95.42  ? 533  TYR B CG  1 
ATOM   6572  C CD1 . TYR B 1 417 ? -35.617 21.080  -46.409  1.00 91.62  ? 533  TYR B CD1 1 
ATOM   6573  C CD2 . TYR B 1 417 ? -37.123 22.314  -47.782  1.00 90.05  ? 533  TYR B CD2 1 
ATOM   6574  C CE1 . TYR B 1 417 ? -34.631 21.202  -47.378  1.00 85.72  ? 533  TYR B CE1 1 
ATOM   6575  C CE2 . TYR B 1 417 ? -36.146 22.441  -48.753  1.00 84.56  ? 533  TYR B CE2 1 
ATOM   6576  C CZ  . TYR B 1 417 ? -34.903 21.885  -48.546  1.00 77.88  ? 533  TYR B CZ  1 
ATOM   6577  O OH  . TYR B 1 417 ? -33.927 22.009  -49.505  1.00 67.15  ? 533  TYR B OH  1 
ATOM   6578  N N   . ILE B 1 418 ? -39.819 20.220  -43.337  1.00 95.81  ? 534  ILE B N   1 
ATOM   6579  C CA  . ILE B 1 418 ? -40.755 20.387  -42.232  1.00 92.37  ? 534  ILE B CA  1 
ATOM   6580  C C   . ILE B 1 418 ? -40.296 19.569  -41.039  1.00 91.45  ? 534  ILE B C   1 
ATOM   6581  O O   . ILE B 1 418 ? -40.809 19.739  -39.936  1.00 98.28  ? 534  ILE B O   1 
ATOM   6582  C CB  . ILE B 1 418 ? -42.198 19.978  -42.596  1.00 94.55  ? 534  ILE B CB  1 
ATOM   6583  C CG1 . ILE B 1 418 ? -42.357 18.456  -42.535  1.00 100.81 ? 534  ILE B CG1 1 
ATOM   6584  C CG2 . ILE B 1 418 ? -42.598 20.549  -43.953  1.00 98.10  ? 534  ILE B CG2 1 
ATOM   6585  C CD1 . ILE B 1 418 ? -43.766 17.975  -42.837  1.00 104.04 ? 534  ILE B CD1 1 
ATOM   6586  N N   . ASN B 1 419 ? -39.342 18.667  -41.253  1.00 88.05  ? 535  ASN B N   1 
ATOM   6587  C CA  . ASN B 1 419 ? -38.667 18.061  -40.108  1.00 88.64  ? 535  ASN B CA  1 
ATOM   6588  C C   . ASN B 1 419 ? -37.917 19.108  -39.284  1.00 90.63  ? 535  ASN B C   1 
ATOM   6589  O O   . ASN B 1 419 ? -38.034 19.162  -38.045  1.00 86.59  ? 535  ASN B O   1 
ATOM   6590  C CB  . ASN B 1 419 ? -37.688 16.981  -40.547  1.00 82.41  ? 535  ASN B CB  1 
ATOM   6591  C CG  . ASN B 1 419 ? -36.849 16.467  -39.396  1.00 82.57  ? 535  ASN B CG  1 
ATOM   6592  O OD1 . ASN B 1 419 ? -35.621 16.445  -39.471  1.00 88.94  ? 535  ASN B OD1 1 
ATOM   6593  N ND2 . ASN B 1 419 ? -37.509 16.078  -38.309  1.00 70.76  ? 535  ASN B ND2 1 
ATOM   6594  N N   . SER B 1 420 ? -37.145 19.933  -39.993  1.00 89.99  ? 536  SER B N   1 
ATOM   6595  C CA  . SER B 1 420 ? -36.359 21.005  -39.387  1.00 92.99  ? 536  SER B CA  1 
ATOM   6596  C C   . SER B 1 420 ? -37.259 22.112  -38.861  1.00 95.37  ? 536  SER B C   1 
ATOM   6597  O O   . SER B 1 420 ? -36.888 22.845  -37.941  1.00 94.35  ? 536  SER B O   1 
ATOM   6598  C CB  . SER B 1 420 ? -35.370 21.586  -40.398  1.00 91.13  ? 536  SER B CB  1 
ATOM   6599  O OG  . SER B 1 420 ? -34.385 20.637  -40.757  1.00 93.11  ? 536  SER B OG  1 
ATOM   6600  N N   . THR B 1 421 ? -38.438 22.236  -39.461  1.00 95.78  ? 537  THR B N   1 
ATOM   6601  C CA  . THR B 1 421 ? -39.444 23.164  -38.951  1.00 93.86  ? 537  THR B CA  1 
ATOM   6602  C C   . THR B 1 421 ? -40.072 22.635  -37.654  1.00 95.52  ? 537  THR B C   1 
ATOM   6603  O O   . THR B 1 421 ? -40.410 23.409  -36.759  1.00 94.08  ? 537  THR B O   1 
ATOM   6604  C CB  . THR B 1 421 ? -40.562 23.409  -39.983  1.00 96.50  ? 537  THR B CB  1 
ATOM   6605  O OG1 . THR B 1 421 ? -39.983 23.698  -41.262  1.00 103.77 ? 537  THR B OG1 1 
ATOM   6606  C CG2 . THR B 1 421 ? -41.446 24.567  -39.547  1.00 92.48  ? 537  THR B CG2 1 
ATOM   6607  N N   . VAL B 1 422 ? -40.216 21.312  -37.564  1.00 97.47  ? 538  VAL B N   1 
ATOM   6608  C CA  . VAL B 1 422 ? -40.887 20.656  -36.436  1.00 90.40  ? 538  VAL B CA  1 
ATOM   6609  C C   . VAL B 1 422 ? -40.031 20.489  -35.178  1.00 87.04  ? 538  VAL B C   1 
ATOM   6610  O O   . VAL B 1 422 ? -40.542 20.574  -34.056  1.00 87.06  ? 538  VAL B O   1 
ATOM   6611  C CB  . VAL B 1 422 ? -41.453 19.275  -36.838  1.00 87.81  ? 538  VAL B CB  1 
ATOM   6612  C CG1 . VAL B 1 422 ? -41.750 18.437  -35.606  1.00 86.22  ? 538  VAL B CG1 1 
ATOM   6613  C CG2 . VAL B 1 422 ? -42.703 19.440  -37.691  1.00 84.78  ? 538  VAL B CG2 1 
ATOM   6614  N N   . ASN B 1 423 ? -38.738 20.240  -35.355  1.00 91.01  ? 539  ASN B N   1 
ATOM   6615  C CA  . ASN B 1 423 ? -37.865 20.047  -34.193  1.00 94.98  ? 539  ASN B CA  1 
ATOM   6616  C C   . ASN B 1 423 ? -37.978 21.135  -33.105  1.00 91.46  ? 539  ASN B C   1 
ATOM   6617  O O   . ASN B 1 423 ? -38.209 20.817  -31.931  1.00 87.65  ? 539  ASN B O   1 
ATOM   6618  C CB  . ASN B 1 423 ? -36.409 19.830  -34.625  1.00 92.87  ? 539  ASN B CB  1 
ATOM   6619  C CG  . ASN B 1 423 ? -36.201 18.495  -35.319  1.00 89.41  ? 539  ASN B CG  1 
ATOM   6620  O OD1 . ASN B 1 423 ? -36.921 17.530  -35.062  1.00 85.16  ? 539  ASN B OD1 1 
ATOM   6621  N ND2 . ASN B 1 423 ? -35.215 18.436  -36.204  1.00 91.43  ? 539  ASN B ND2 1 
ATOM   6622  N N   . PRO B 1 424 ? -37.828 22.417  -33.489  1.00 90.67  ? 540  PRO B N   1 
ATOM   6623  C CA  . PRO B 1 424 ? -37.975 23.506  -32.514  1.00 87.75  ? 540  PRO B CA  1 
ATOM   6624  C C   . PRO B 1 424 ? -39.307 23.451  -31.768  1.00 87.07  ? 540  PRO B C   1 
ATOM   6625  O O   . PRO B 1 424 ? -39.420 24.007  -30.680  1.00 85.05  ? 540  PRO B O   1 
ATOM   6626  C CB  . PRO B 1 424 ? -37.916 24.762  -33.385  1.00 84.86  ? 540  PRO B CB  1 
ATOM   6627  C CG  . PRO B 1 424 ? -37.113 24.358  -34.558  1.00 85.88  ? 540  PRO B CG  1 
ATOM   6628  C CD  . PRO B 1 424 ? -37.451 22.923  -34.821  1.00 85.14  ? 540  PRO B CD  1 
ATOM   6629  N N   . VAL B 1 425 ? -40.308 22.814  -32.364  1.00 88.72  ? 541  VAL B N   1 
ATOM   6630  C CA  . VAL B 1 425 ? -41.592 22.605  -31.703  1.00 85.93  ? 541  VAL B CA  1 
ATOM   6631  C C   . VAL B 1 425 ? -41.533 21.446  -30.712  1.00 90.27  ? 541  VAL B C   1 
ATOM   6632  O O   . VAL B 1 425 ? -41.996 21.562  -29.573  1.00 88.81  ? 541  VAL B O   1 
ATOM   6633  C CB  . VAL B 1 425 ? -42.706 22.335  -32.729  1.00 91.21  ? 541  VAL B CB  1 
ATOM   6634  C CG1 . VAL B 1 425 ? -43.985 21.918  -32.027  1.00 95.30  ? 541  VAL B CG1 1 
ATOM   6635  C CG2 . VAL B 1 425 ? -42.935 23.562  -33.595  1.00 90.35  ? 541  VAL B CG2 1 
ATOM   6636  N N   . CYS B 1 426 ? -40.962 20.328  -31.154  1.00 96.81  ? 542  CYS B N   1 
ATOM   6637  C CA  . CYS B 1 426 ? -40.794 19.168  -30.284  1.00 93.92  ? 542  CYS B CA  1 
ATOM   6638  C C   . CYS B 1 426 ? -40.080 19.580  -29.008  1.00 95.24  ? 542  CYS B C   1 
ATOM   6639  O O   . CYS B 1 426 ? -40.420 19.116  -27.921  1.00 96.96  ? 542  CYS B O   1 
ATOM   6640  C CB  . CYS B 1 426 ? -39.996 18.066  -30.980  1.00 84.74  ? 542  CYS B CB  1 
ATOM   6641  S SG  . CYS B 1 426 ? -40.737 17.448  -32.500  1.00 92.69  ? 542  CYS B SG  1 
ATOM   6642  N N   . TYR B 1 427 ? -39.088 20.456  -29.143  1.00 93.77  ? 543  TYR B N   1 
ATOM   6643  C CA  . TYR B 1 427 ? -38.369 20.958  -27.976  1.00 99.33  ? 543  TYR B CA  1 
ATOM   6644  C C   . TYR B 1 427 ? -39.339 21.472  -26.919  1.00 105.98 ? 543  TYR B C   1 
ATOM   6645  O O   . TYR B 1 427 ? -39.446 20.908  -25.831  1.00 107.29 ? 543  TYR B O   1 
ATOM   6646  C CB  . TYR B 1 427 ? -37.422 22.088  -28.366  1.00 98.56  ? 543  TYR B CB  1 
ATOM   6647  C CG  . TYR B 1 427 ? -36.323 21.688  -29.316  1.00 98.05  ? 543  TYR B CG  1 
ATOM   6648  C CD1 . TYR B 1 427 ? -35.931 20.363  -29.443  1.00 93.37  ? 543  TYR B CD1 1 
ATOM   6649  C CD2 . TYR B 1 427 ? -35.672 22.644  -30.086  1.00 101.10 ? 543  TYR B CD2 1 
ATOM   6650  C CE1 . TYR B 1 427 ? -34.920 20.002  -30.315  1.00 95.95  ? 543  TYR B CE1 1 
ATOM   6651  C CE2 . TYR B 1 427 ? -34.666 22.296  -30.958  1.00 100.47 ? 543  TYR B CE2 1 
ATOM   6652  C CZ  . TYR B 1 427 ? -34.292 20.976  -31.071  1.00 101.15 ? 543  TYR B CZ  1 
ATOM   6653  O OH  . TYR B 1 427 ? -33.285 20.646  -31.948  1.00 106.25 ? 543  TYR B OH  1 
ATOM   6654  N N   . ALA B 1 428 ? -40.042 22.550  -27.253  1.00 105.86 ? 544  ALA B N   1 
ATOM   6655  C CA  . ALA B 1 428 ? -41.025 23.142  -26.356  1.00 105.38 ? 544  ALA B CA  1 
ATOM   6656  C C   . ALA B 1 428 ? -41.965 22.074  -25.817  1.00 109.71 ? 544  ALA B C   1 
ATOM   6657  O O   . ALA B 1 428 ? -42.328 22.092  -24.642  1.00 111.54 ? 544  ALA B O   1 
ATOM   6658  C CB  . ALA B 1 428 ? -41.810 24.226  -27.072  1.00 107.37 ? 544  ALA B CB  1 
ATOM   6659  N N   . LEU B 1 429 ? -42.357 21.147  -26.687  1.00 112.83 ? 545  LEU B N   1 
ATOM   6660  C CA  . LEU B 1 429 ? -43.261 20.062  -26.303  1.00 113.69 ? 545  LEU B CA  1 
ATOM   6661  C C   . LEU B 1 429 ? -42.737 19.221  -25.133  1.00 111.59 ? 545  LEU B C   1 
ATOM   6662  O O   . LEU B 1 429 ? -43.318 19.220  -24.047  1.00 105.69 ? 545  LEU B O   1 
ATOM   6663  C CB  . LEU B 1 429 ? -43.566 19.163  -27.505  1.00 108.87 ? 545  LEU B CB  1 
ATOM   6664  C CG  . LEU B 1 429 ? -44.351 19.810  -28.649  1.00 107.36 ? 545  LEU B CG  1 
ATOM   6665  C CD1 . LEU B 1 429 ? -44.514 18.834  -29.804  1.00 111.83 ? 545  LEU B CD1 1 
ATOM   6666  C CD2 . LEU B 1 429 ? -45.706 20.306  -28.164  1.00 103.29 ? 545  LEU B CD2 1 
ATOM   6667  N N   . CYS B 1 430 ? -41.639 18.507  -25.361  1.00 113.97 ? 546  CYS B N   1 
ATOM   6668  C CA  . CYS B 1 430 ? -41.092 17.602  -24.350  1.00 117.46 ? 546  CYS B CA  1 
ATOM   6669  C C   . CYS B 1 430 ? -40.474 18.321  -23.142  1.00 113.18 ? 546  CYS B C   1 
ATOM   6670  O O   . CYS B 1 430 ? -40.177 17.691  -22.125  1.00 103.73 ? 546  CYS B O   1 
ATOM   6671  C CB  . CYS B 1 430 ? -40.077 16.635  -24.981  1.00 115.62 ? 546  CYS B CB  1 
ATOM   6672  S SG  . CYS B 1 430 ? -40.794 15.190  -25.836  1.00 89.91  ? 546  CYS B SG  1 
ATOM   6673  N N   . ASN B 1 431 ? -40.286 19.634  -23.254  1.00 119.11 ? 547  ASN B N   1 
ATOM   6674  C CA  . ASN B 1 431 ? -39.681 20.410  -22.169  1.00 121.96 ? 547  ASN B CA  1 
ATOM   6675  C C   . ASN B 1 431 ? -40.382 21.723  -21.836  1.00 123.35 ? 547  ASN B C   1 
ATOM   6676  O O   . ASN B 1 431 ? -40.449 22.632  -22.662  1.00 119.50 ? 547  ASN B O   1 
ATOM   6677  C CB  . ASN B 1 431 ? -38.208 20.685  -22.463  1.00 113.89 ? 547  ASN B CB  1 
ATOM   6678  C CG  . ASN B 1 431 ? -37.354 19.458  -22.301  1.00 104.75 ? 547  ASN B CG  1 
ATOM   6679  O OD1 . ASN B 1 431 ? -36.762 19.238  -21.247  1.00 101.94 ? 547  ASN B OD1 1 
ATOM   6680  N ND2 . ASN B 1 431 ? -37.294 18.640  -23.341  1.00 100.38 ? 547  ASN B ND2 1 
ATOM   6681  N N   . LYS B 1 432 ? -40.876 21.821  -20.606  1.00 129.80 ? 548  LYS B N   1 
ATOM   6682  C CA  . LYS B 1 432 ? -41.519 23.041  -20.139  1.00 131.66 ? 548  LYS B CA  1 
ATOM   6683  C C   . LYS B 1 432 ? -40.479 24.140  -19.993  1.00 127.46 ? 548  LYS B C   1 
ATOM   6684  O O   . LYS B 1 432 ? -40.805 25.326  -20.026  1.00 121.02 ? 548  LYS B O   1 
ATOM   6685  C CB  . LYS B 1 432 ? -42.227 22.802  -18.803  1.00 129.61 ? 548  LYS B CB  1 
ATOM   6686  N N   . THR B 1 433 ? -39.224 23.735  -19.829  1.00 129.32 ? 549  THR B N   1 
ATOM   6687  C CA  . THR B 1 433 ? -38.123 24.682  -19.750  1.00 128.72 ? 549  THR B CA  1 
ATOM   6688  C C   . THR B 1 433 ? -38.133 25.538  -21.003  1.00 128.67 ? 549  THR B C   1 
ATOM   6689  O O   . THR B 1 433 ? -38.077 26.768  -20.936  1.00 128.30 ? 549  THR B O   1 
ATOM   6690  C CB  . THR B 1 433 ? -36.768 23.967  -19.655  1.00 122.63 ? 549  THR B CB  1 
ATOM   6691  O OG1 . THR B 1 433 ? -36.854 22.893  -18.711  1.00 115.51 ? 549  THR B OG1 1 
ATOM   6692  C CG2 . THR B 1 433 ? -35.685 24.942  -19.221  1.00 121.66 ? 549  THR B CG2 1 
ATOM   6693  N N   . PHE B 1 434 ? -38.222 24.872  -22.148  1.00 130.19 ? 550  PHE B N   1 
ATOM   6694  C CA  . PHE B 1 434 ? -38.289 25.557  -23.429  1.00 135.28 ? 550  PHE B CA  1 
ATOM   6695  C C   . PHE B 1 434 ? -39.524 26.452  -23.519  1.00 135.85 ? 550  PHE B C   1 
ATOM   6696  O O   . PHE B 1 434 ? -39.485 27.505  -24.152  1.00 138.10 ? 550  PHE B O   1 
ATOM   6697  C CB  . PHE B 1 434 ? -38.280 24.544  -24.578  1.00 127.66 ? 550  PHE B CB  1 
ATOM   6698  N N   . ARG B 1 435 ? -40.618 26.029  -22.889  1.00 132.76 ? 551  ARG B N   1 
ATOM   6699  C CA  . ARG B 1 435 ? -41.866 26.790  -22.922  1.00 130.19 ? 551  ARG B CA  1 
ATOM   6700  C C   . ARG B 1 435 ? -41.751 28.112  -22.166  1.00 128.48 ? 551  ARG B C   1 
ATOM   6701  O O   . ARG B 1 435 ? -42.026 29.188  -22.710  1.00 124.42 ? 551  ARG B O   1 
ATOM   6702  C CB  . ARG B 1 435 ? -43.016 25.955  -22.353  1.00 121.99 ? 551  ARG B CB  1 
ATOM   6703  N N   . THR B 1 436 ? -41.338 28.016  -20.908  1.00 128.64 ? 552  THR B N   1 
ATOM   6704  C CA  . THR B 1 436 ? -41.182 29.181  -20.047  1.00 130.23 ? 552  THR B CA  1 
ATOM   6705  C C   . THR B 1 436 ? -40.083 30.118  -20.545  1.00 129.05 ? 552  THR B C   1 
ATOM   6706  O O   . THR B 1 436 ? -40.243 31.338  -20.528  1.00 127.56 ? 552  THR B O   1 
ATOM   6707  C CB  . THR B 1 436 ? -40.872 28.768  -18.598  1.00 124.76 ? 552  THR B CB  1 
ATOM   6708  N N   . THR B 1 437 ? -38.965 29.547  -20.980  1.00 127.47 ? 553  THR B N   1 
ATOM   6709  C CA  . THR B 1 437 ? -37.844 30.352  -21.453  1.00 124.90 ? 553  THR B CA  1 
ATOM   6710  C C   . THR B 1 437 ? -38.156 31.000  -22.801  1.00 118.12 ? 553  THR B C   1 
ATOM   6711  O O   . THR B 1 437 ? -37.736 32.123  -23.076  1.00 114.56 ? 553  THR B O   1 
ATOM   6712  C CB  . THR B 1 437 ? -36.549 29.520  -21.559  1.00 128.98 ? 553  THR B CB  1 
ATOM   6713  O OG1 . THR B 1 437 ? -36.304 28.847  -20.317  1.00 125.77 ? 553  THR B OG1 1 
ATOM   6714  C CG2 . THR B 1 437 ? -35.359 30.413  -21.887  1.00 124.45 ? 553  THR B CG2 1 
ATOM   6715  N N   . PHE B 1 438 ? -38.904 30.289  -23.636  1.00 115.78 ? 554  PHE B N   1 
ATOM   6716  C CA  . PHE B 1 438 ? -39.264 30.798  -24.951  1.00 120.62 ? 554  PHE B CA  1 
ATOM   6717  C C   . PHE B 1 438 ? -40.286 31.921  -24.848  1.00 125.41 ? 554  PHE B C   1 
ATOM   6718  O O   . PHE B 1 438 ? -40.102 32.990  -25.429  1.00 128.96 ? 554  PHE B O   1 
ATOM   6719  C CB  . PHE B 1 438 ? -39.811 29.675  -25.830  1.00 129.18 ? 554  PHE B CB  1 
ATOM   6720  N N   . LYS B 1 439 ? -41.357 31.682  -24.097  1.00 127.11 ? 555  LYS B N   1 
ATOM   6721  C CA  . LYS B 1 439 ? -42.433 32.664  -23.997  1.00 132.30 ? 555  LYS B CA  1 
ATOM   6722  C C   . LYS B 1 439 ? -41.902 34.062  -23.661  1.00 131.73 ? 555  LYS B C   1 
ATOM   6723  O O   . LYS B 1 439 ? -42.420 35.067  -24.152  1.00 132.40 ? 555  LYS B O   1 
ATOM   6724  C CB  . LYS B 1 439 ? -43.483 32.220  -22.971  1.00 128.81 ? 555  LYS B CB  1 
ATOM   6725  C CG  . LYS B 1 439 ? -42.987 32.166  -21.535  1.00 118.33 ? 555  LYS B CG  1 
ATOM   6726  C CD  . LYS B 1 439 ? -44.125 31.830  -20.587  1.00 114.81 ? 555  LYS B CD  1 
ATOM   6727  C CE  . LYS B 1 439 ? -43.705 31.984  -19.136  1.00 112.33 ? 555  LYS B CE  1 
ATOM   6728  N NZ  . LYS B 1 439 ? -44.844 31.737  -18.210  1.00 97.79  ? 555  LYS B NZ  1 
ATOM   6729  N N   . THR B 1 440 ? -40.856 34.116  -22.842  1.00 125.72 ? 556  THR B N   1 
ATOM   6730  C CA  . THR B 1 440 ? -40.281 35.385  -22.409  1.00 118.60 ? 556  THR B CA  1 
ATOM   6731  C C   . THR B 1 440 ? -39.437 36.030  -23.503  1.00 115.49 ? 556  THR B C   1 
ATOM   6732  O O   . THR B 1 440 ? -39.321 35.500  -24.606  1.00 112.01 ? 556  THR B O   1 
ATOM   6733  C CB  . THR B 1 440 ? -39.413 35.204  -21.155  1.00 116.36 ? 556  THR B CB  1 
ATOM   6734  O OG1 . THR B 1 440 ? -38.243 34.451  -21.491  1.00 121.26 ? 556  THR B OG1 1 
ATOM   6735  C CG2 . THR B 1 440 ? -40.190 34.469  -20.074  1.00 115.82 ? 556  THR B CG2 1 
ATOM   6736  N N   . THR C 1 8   ? -25.115 -16.443 61.112   1.00 143.09 ? 63   THR C N   1 
ATOM   6737  C CA  . THR C 1 8   ? -24.015 -15.578 60.703   1.00 151.12 ? 63   THR C CA  1 
ATOM   6738  C C   . THR C 1 8   ? -22.968 -16.349 59.910   1.00 155.05 ? 63   THR C C   1 
ATOM   6739  O O   . THR C 1 8   ? -22.728 -16.062 58.739   1.00 157.48 ? 63   THR C O   1 
ATOM   6740  C CB  . THR C 1 8   ? -23.334 -14.914 61.915   1.00 141.72 ? 63   THR C CB  1 
ATOM   6741  N N   . ILE C 1 9   ? -22.345 -17.328 60.558   1.00 150.57 ? 64   ILE C N   1 
ATOM   6742  C CA  . ILE C 1 9   ? -21.304 -18.131 59.924   1.00 153.86 ? 64   ILE C CA  1 
ATOM   6743  C C   . ILE C 1 9   ? -21.823 -18.862 58.679   1.00 162.93 ? 64   ILE C C   1 
ATOM   6744  O O   . ILE C 1 9   ? -21.075 -19.108 57.729   1.00 164.72 ? 64   ILE C O   1 
ATOM   6745  C CB  . ILE C 1 9   ? -20.676 -19.125 60.932   1.00 135.38 ? 64   ILE C CB  1 
ATOM   6746  C CG1 . ILE C 1 9   ? -19.909 -18.363 62.015   1.00 117.63 ? 64   ILE C CG1 1 
ATOM   6747  C CG2 . ILE C 1 9   ? -19.756 -20.105 60.230   1.00 133.32 ? 64   ILE C CG2 1 
ATOM   6748  C CD1 . ILE C 1 9   ? -19.059 -19.242 62.907   1.00 91.86  ? 64   ILE C CD1 1 
ATOM   6749  N N   . TRP C 1 10  ? -23.113 -19.182 58.685   1.00 162.98 ? 65   TRP C N   1 
ATOM   6750  C CA  . TRP C 1 10  ? -23.762 -19.887 57.582   1.00 164.59 ? 65   TRP C CA  1 
ATOM   6751  C C   . TRP C 1 10  ? -23.693 -19.085 56.277   1.00 167.69 ? 65   TRP C C   1 
ATOM   6752  O O   . TRP C 1 10  ? -23.105 -19.522 55.271   1.00 166.98 ? 65   TRP C O   1 
ATOM   6753  C CB  . TRP C 1 10  ? -25.227 -20.122 57.962   1.00 164.60 ? 65   TRP C CB  1 
ATOM   6754  C CG  . TRP C 1 10  ? -25.893 -21.267 57.276   1.00 163.46 ? 65   TRP C CG  1 
ATOM   6755  C CD1 . TRP C 1 10  ? -26.923 -21.203 56.383   1.00 158.27 ? 65   TRP C CD1 1 
ATOM   6756  C CD2 . TRP C 1 10  ? -25.588 -22.655 57.440   1.00 162.46 ? 65   TRP C CD2 1 
ATOM   6757  N NE1 . TRP C 1 10  ? -27.275 -22.466 55.977   1.00 154.31 ? 65   TRP C NE1 1 
ATOM   6758  C CE2 . TRP C 1 10  ? -26.470 -23.375 56.609   1.00 162.25 ? 65   TRP C CE2 1 
ATOM   6759  C CE3 . TRP C 1 10  ? -24.651 -23.358 58.204   1.00 153.02 ? 65   TRP C CE3 1 
ATOM   6760  C CZ2 . TRP C 1 10  ? -26.442 -24.765 56.522   1.00 164.51 ? 65   TRP C CZ2 1 
ATOM   6761  C CZ3 . TRP C 1 10  ? -24.625 -24.737 58.117   1.00 155.15 ? 65   TRP C CZ3 1 
ATOM   6762  C CH2 . TRP C 1 10  ? -25.515 -25.426 57.282   1.00 165.30 ? 65   TRP C CH2 1 
ATOM   6763  N N   . GLN C 1 11  ? -24.280 -17.892 56.312   1.00 167.50 ? 66   GLN C N   1 
ATOM   6764  C CA  . GLN C 1 11  ? -24.328 -17.026 55.144   1.00 162.75 ? 66   GLN C CA  1 
ATOM   6765  C C   . GLN C 1 11  ? -22.923 -16.610 54.731   1.00 164.72 ? 66   GLN C C   1 
ATOM   6766  O O   . GLN C 1 11  ? -22.648 -16.420 53.547   1.00 164.21 ? 66   GLN C O   1 
ATOM   6767  C CB  . GLN C 1 11  ? -25.180 -15.789 55.430   1.00 155.42 ? 66   GLN C CB  1 
ATOM   6768  C CG  . GLN C 1 11  ? -24.680 -14.951 56.589   1.00 154.10 ? 66   GLN C CG  1 
ATOM   6769  C CD  . GLN C 1 11  ? -25.514 -13.707 56.804   1.00 160.83 ? 66   GLN C CD  1 
ATOM   6770  O OE1 . GLN C 1 11  ? -26.671 -13.644 56.391   1.00 157.29 ? 66   GLN C OE1 1 
ATOM   6771  N NE2 . GLN C 1 11  ? -24.926 -12.704 57.448   1.00 165.75 ? 66   GLN C NE2 1 
ATOM   6772  N N   . VAL C 1 12  ? -22.036 -16.472 55.712   1.00 164.90 ? 67   VAL C N   1 
ATOM   6773  C CA  . VAL C 1 12  ? -20.649 -16.122 55.434   1.00 164.56 ? 67   VAL C CA  1 
ATOM   6774  C C   . VAL C 1 12  ? -19.958 -17.251 54.667   1.00 164.17 ? 67   VAL C C   1 
ATOM   6775  O O   . VAL C 1 12  ? -19.114 -16.997 53.805   1.00 163.99 ? 67   VAL C O   1 
ATOM   6776  C CB  . VAL C 1 12  ? -19.868 -15.772 56.721   1.00 159.57 ? 67   VAL C CB  1 
ATOM   6777  C CG1 . VAL C 1 12  ? -18.388 -15.606 56.419   1.00 159.05 ? 67   VAL C CG1 1 
ATOM   6778  C CG2 . VAL C 1 12  ? -20.428 -14.505 57.356   1.00 143.15 ? 67   VAL C CG2 1 
ATOM   6779  N N   . VAL C 1 13  ? -20.322 -18.495 54.972   1.00 161.26 ? 68   VAL C N   1 
ATOM   6780  C CA  . VAL C 1 13  ? -19.813 -19.629 54.205   1.00 158.15 ? 68   VAL C CA  1 
ATOM   6781  C C   . VAL C 1 13  ? -20.364 -19.607 52.782   1.00 159.39 ? 68   VAL C C   1 
ATOM   6782  O O   . VAL C 1 13  ? -19.619 -19.805 51.817   1.00 157.54 ? 68   VAL C O   1 
ATOM   6783  C CB  . VAL C 1 13  ? -20.150 -20.981 54.862   1.00 155.90 ? 68   VAL C CB  1 
ATOM   6784  C CG1 . VAL C 1 13  ? -19.875 -22.120 53.893   1.00 144.43 ? 68   VAL C CG1 1 
ATOM   6785  C CG2 . VAL C 1 13  ? -19.352 -21.160 56.145   1.00 154.48 ? 68   VAL C CG2 1 
ATOM   6786  N N   . PHE C 1 14  ? -21.665 -19.354 52.653   1.00 162.42 ? 69   PHE C N   1 
ATOM   6787  C CA  . PHE C 1 14  ? -22.279 -19.255 51.327   1.00 159.42 ? 69   PHE C CA  1 
ATOM   6788  C C   . PHE C 1 14  ? -21.572 -18.215 50.451   1.00 154.15 ? 69   PHE C C   1 
ATOM   6789  O O   . PHE C 1 14  ? -21.097 -18.522 49.350   1.00 153.24 ? 69   PHE C O   1 
ATOM   6790  C CB  . PHE C 1 14  ? -23.766 -18.916 51.443   1.00 155.92 ? 69   PHE C CB  1 
ATOM   6791  N N   . ILE C 1 15  ? -21.500 -16.987 50.956   1.00 151.92 ? 70   ILE C N   1 
ATOM   6792  C CA  . ILE C 1 15  ? -20.837 -15.893 50.252   1.00 152.07 ? 70   ILE C CA  1 
ATOM   6793  C C   . ILE C 1 15  ? -19.360 -16.197 50.006   1.00 155.39 ? 70   ILE C C   1 
ATOM   6794  O O   . ILE C 1 15  ? -18.787 -15.772 49.003   1.00 153.67 ? 70   ILE C O   1 
ATOM   6795  C CB  . ILE C 1 15  ? -20.958 -14.569 51.032   1.00 144.74 ? 70   ILE C CB  1 
ATOM   6796  N N   . ALA C 1 16  ? -18.749 -16.935 50.927   1.00 154.99 ? 71   ALA C N   1 
ATOM   6797  C CA  . ALA C 1 16  ? -17.357 -17.340 50.780   1.00 148.59 ? 71   ALA C CA  1 
ATOM   6798  C C   . ALA C 1 16  ? -17.188 -18.225 49.549   1.00 154.00 ? 71   ALA C C   1 
ATOM   6799  O O   . ALA C 1 16  ? -16.301 -17.998 48.719   1.00 152.47 ? 71   ALA C O   1 
ATOM   6800  C CB  . ALA C 1 16  ? -16.879 -18.062 52.025   1.00 142.22 ? 71   ALA C CB  1 
ATOM   6801  N N   . PHE C 1 17  ? -18.042 -19.237 49.425   1.00 156.92 ? 72   PHE C N   1 
ATOM   6802  C CA  . PHE C 1 17  ? -17.984 -20.092 48.250   1.00 155.58 ? 72   PHE C CA  1 
ATOM   6803  C C   . PHE C 1 17  ? -18.384 -19.308 47.004   1.00 153.28 ? 72   PHE C C   1 
ATOM   6804  O O   . PHE C 1 17  ? -18.043 -19.692 45.885   1.00 155.05 ? 72   PHE C O   1 
ATOM   6805  C CB  . PHE C 1 17  ? -18.849 -21.342 48.407   1.00 154.73 ? 72   PHE C CB  1 
ATOM   6806  C CG  . PHE C 1 17  ? -18.474 -22.445 47.461   1.00 160.45 ? 72   PHE C CG  1 
ATOM   6807  C CD1 . PHE C 1 17  ? -17.498 -23.366 47.804   1.00 156.46 ? 72   PHE C CD1 1 
ATOM   6808  C CD2 . PHE C 1 17  ? -19.076 -22.546 46.218   1.00 161.99 ? 72   PHE C CD2 1 
ATOM   6809  C CE1 . PHE C 1 17  ? -17.140 -24.377 46.933   1.00 156.23 ? 72   PHE C CE1 1 
ATOM   6810  C CE2 . PHE C 1 17  ? -18.722 -23.556 45.340   1.00 160.01 ? 72   PHE C CE2 1 
ATOM   6811  C CZ  . PHE C 1 17  ? -17.753 -24.473 45.699   1.00 157.80 ? 72   PHE C CZ  1 
ATOM   6812  N N   . LEU C 1 18  ? -19.110 -18.210 47.201   1.00 149.07 ? 73   LEU C N   1 
ATOM   6813  C CA  . LEU C 1 18  ? -19.348 -17.268 46.111   1.00 150.30 ? 73   LEU C CA  1 
ATOM   6814  C C   . LEU C 1 18  ? -18.014 -16.673 45.658   1.00 154.30 ? 73   LEU C C   1 
ATOM   6815  O O   . LEU C 1 18  ? -17.732 -16.581 44.457   1.00 159.69 ? 73   LEU C O   1 
ATOM   6816  C CB  . LEU C 1 18  ? -20.314 -16.162 46.545   1.00 148.59 ? 73   LEU C CB  1 
ATOM   6817  C CG  . LEU C 1 18  ? -20.710 -15.117 45.499   1.00 138.09 ? 73   LEU C CG  1 
ATOM   6818  C CD1 . LEU C 1 18  ? -21.362 -15.777 44.294   1.00 141.78 ? 73   LEU C CD1 1 
ATOM   6819  C CD2 . LEU C 1 18  ? -21.637 -14.072 46.102   1.00 125.25 ? 73   LEU C CD2 1 
ATOM   6820  N N   . THR C 1 19  ? -17.192 -16.277 46.627   1.00 150.81 ? 74   THR C N   1 
ATOM   6821  C CA  . THR C 1 19  ? -15.847 -15.799 46.331   1.00 151.08 ? 74   THR C CA  1 
ATOM   6822  C C   . THR C 1 19  ? -15.091 -16.871 45.556   1.00 153.77 ? 74   THR C C   1 
ATOM   6823  O O   . THR C 1 19  ? -14.383 -16.573 44.591   1.00 155.20 ? 74   THR C O   1 
ATOM   6824  C CB  . THR C 1 19  ? -15.064 -15.445 47.607   1.00 146.01 ? 74   THR C CB  1 
ATOM   6825  N N   . GLY C 1 20  ? -15.247 -18.121 45.983   1.00 151.36 ? 75   GLY C N   1 
ATOM   6826  C CA  . GLY C 1 20  ? -14.687 -19.242 45.249   1.00 155.33 ? 75   GLY C CA  1 
ATOM   6827  C C   . GLY C 1 20  ? -15.108 -19.210 43.790   1.00 156.18 ? 75   GLY C C   1 
ATOM   6828  O O   . GLY C 1 20  ? -14.275 -19.307 42.887   1.00 152.99 ? 75   GLY C O   1 
ATOM   6829  N N   . PHE C 1 21  ? -16.410 -19.071 43.562   1.00 155.67 ? 76   PHE C N   1 
ATOM   6830  C CA  . PHE C 1 21  ? -16.949 -18.919 42.216   1.00 151.17 ? 76   PHE C CA  1 
ATOM   6831  C C   . PHE C 1 21  ? -16.171 -17.863 41.437   1.00 148.68 ? 76   PHE C C   1 
ATOM   6832  O O   . PHE C 1 21  ? -15.553 -18.164 40.411   1.00 146.69 ? 76   PHE C O   1 
ATOM   6833  C CB  . PHE C 1 21  ? -18.435 -18.556 42.276   1.00 152.96 ? 76   PHE C CB  1 
ATOM   6834  C CG  . PHE C 1 21  ? -19.030 -18.194 40.945   1.00 150.73 ? 76   PHE C CG  1 
ATOM   6835  C CD1 . PHE C 1 21  ? -19.390 -19.177 40.040   1.00 152.68 ? 76   PHE C CD1 1 
ATOM   6836  C CD2 . PHE C 1 21  ? -19.241 -16.869 40.606   1.00 150.09 ? 76   PHE C CD2 1 
ATOM   6837  C CE1 . PHE C 1 21  ? -19.942 -18.846 38.817   1.00 150.19 ? 76   PHE C CE1 1 
ATOM   6838  C CE2 . PHE C 1 21  ? -19.793 -16.532 39.386   1.00 153.77 ? 76   PHE C CE2 1 
ATOM   6839  C CZ  . PHE C 1 21  ? -20.144 -17.522 38.490   1.00 148.87 ? 76   PHE C CZ  1 
ATOM   6840  N N   . LEU C 1 22  ? -16.210 -16.627 41.928   1.00 148.99 ? 77   LEU C N   1 
ATOM   6841  C CA  . LEU C 1 22  ? -15.527 -15.517 41.265   1.00 147.73 ? 77   LEU C CA  1 
ATOM   6842  C C   . LEU C 1 22  ? -14.078 -15.861 40.905   1.00 145.85 ? 77   LEU C C   1 
ATOM   6843  O O   . LEU C 1 22  ? -13.624 -15.604 39.781   1.00 144.20 ? 77   LEU C O   1 
ATOM   6844  C CB  . LEU C 1 22  ? -15.568 -14.265 42.147   1.00 146.81 ? 77   LEU C CB  1 
ATOM   6845  C CG  . LEU C 1 22  ? -15.161 -12.949 41.483   1.00 143.35 ? 77   LEU C CG  1 
ATOM   6846  C CD1 . LEU C 1 22  ? -16.178 -12.554 40.427   1.00 142.83 ? 77   LEU C CD1 1 
ATOM   6847  C CD2 . LEU C 1 22  ? -15.014 -11.846 42.517   1.00 143.32 ? 77   LEU C CD2 1 
ATOM   6848  N N   . ALA C 1 23  ? -13.359 -16.438 41.864   1.00 149.56 ? 78   ALA C N   1 
ATOM   6849  C CA  . ALA C 1 23  ? -11.967 -16.832 41.654   1.00 150.99 ? 78   ALA C CA  1 
ATOM   6850  C C   . ALA C 1 23  ? -11.834 -17.846 40.521   1.00 147.90 ? 78   ALA C C   1 
ATOM   6851  O O   . ALA C 1 23  ? -10.884 -17.800 39.731   1.00 131.52 ? 78   ALA C O   1 
ATOM   6852  C CB  . ALA C 1 23  ? -11.372 -17.392 42.940   1.00 151.34 ? 78   ALA C CB  1 
ATOM   6853  N N   . LEU C 1 24  ? -12.795 -18.763 40.455   1.00 143.01 ? 79   LEU C N   1 
ATOM   6854  C CA  . LEU C 1 24  ? -12.834 -19.770 39.404   1.00 135.80 ? 79   LEU C CA  1 
ATOM   6855  C C   . LEU C 1 24  ? -13.007 -19.116 38.034   1.00 133.20 ? 79   LEU C C   1 
ATOM   6856  O O   . LEU C 1 24  ? -12.283 -19.432 37.083   1.00 133.01 ? 79   LEU C O   1 
ATOM   6857  C CB  . LEU C 1 24  ? -13.968 -20.758 39.667   1.00 131.43 ? 79   LEU C CB  1 
ATOM   6858  C CG  . LEU C 1 24  ? -14.004 -21.980 38.754   1.00 135.95 ? 79   LEU C CG  1 
ATOM   6859  C CD1 . LEU C 1 24  ? -12.683 -22.728 38.825   1.00 128.84 ? 79   LEU C CD1 1 
ATOM   6860  C CD2 . LEU C 1 24  ? -15.160 -22.886 39.134   1.00 141.19 ? 79   LEU C CD2 1 
ATOM   6861  N N   . VAL C 1 25  ? -13.969 -18.200 37.945   1.00 131.60 ? 80   VAL C N   1 
ATOM   6862  C CA  . VAL C 1 25  ? -14.195 -17.429 36.726   1.00 126.26 ? 80   VAL C CA  1 
ATOM   6863  C C   . VAL C 1 25  ? -12.913 -16.735 36.272   1.00 126.76 ? 80   VAL C C   1 
ATOM   6864  O O   . VAL C 1 25  ? -12.519 -16.826 35.102   1.00 126.28 ? 80   VAL C O   1 
ATOM   6865  C CB  . VAL C 1 25  ? -15.286 -16.364 36.933   1.00 123.64 ? 80   VAL C CB  1 
ATOM   6866  C CG1 . VAL C 1 25  ? -15.422 -15.490 35.696   1.00 120.28 ? 80   VAL C CG1 1 
ATOM   6867  C CG2 . VAL C 1 25  ? -16.609 -17.028 37.278   1.00 134.74 ? 80   VAL C CG2 1 
ATOM   6868  N N   . THR C 1 26  ? -12.264 -16.047 37.208   1.00 125.95 ? 81   THR C N   1 
ATOM   6869  C CA  . THR C 1 26  ? -11.005 -15.363 36.926   1.00 125.33 ? 81   THR C CA  1 
ATOM   6870  C C   . THR C 1 26  ? -9.936  -16.306 36.373   1.00 122.64 ? 81   THR C C   1 
ATOM   6871  O O   . THR C 1 26  ? -9.365  -16.065 35.300   1.00 125.03 ? 81   THR C O   1 
ATOM   6872  C CB  . THR C 1 26  ? -10.447 -14.689 38.188   1.00 124.76 ? 81   THR C CB  1 
ATOM   6873  O OG1 . THR C 1 26  ? -11.414 -13.767 38.707   1.00 128.61 ? 81   THR C OG1 1 
ATOM   6874  C CG2 . THR C 1 26  ? -9.156  -13.948 37.870   1.00 121.93 ? 81   THR C CG2 1 
ATOM   6875  N N   . ILE C 1 27  ? -9.667  -17.379 37.110   1.00 114.85 ? 82   ILE C N   1 
ATOM   6876  C CA  . ILE C 1 27  ? -8.610  -18.310 36.732   1.00 108.34 ? 82   ILE C CA  1 
ATOM   6877  C C   . ILE C 1 27  ? -8.854  -18.978 35.372   1.00 110.56 ? 82   ILE C C   1 
ATOM   6878  O O   . ILE C 1 27  ? -7.950  -19.032 34.527   1.00 110.59 ? 82   ILE C O   1 
ATOM   6879  C CB  . ILE C 1 27  ? -8.360  -19.363 37.831   1.00 107.46 ? 82   ILE C CB  1 
ATOM   6880  C CG1 . ILE C 1 27  ? -9.634  -20.147 38.133   1.00 106.33 ? 82   ILE C CG1 1 
ATOM   6881  C CG2 . ILE C 1 27  ? -7.865  -18.691 39.097   1.00 108.96 ? 82   ILE C CG2 1 
ATOM   6882  C CD1 . ILE C 1 27  ? -9.541  -20.981 39.388   1.00 107.88 ? 82   ILE C CD1 1 
ATOM   6883  N N   . ILE C 1 28  ? -10.069 -19.471 35.146   1.00 110.91 ? 83   ILE C N   1 
ATOM   6884  C CA  . ILE C 1 28  ? -10.374 -20.077 33.852   1.00 109.09 ? 83   ILE C CA  1 
ATOM   6885  C C   . ILE C 1 28  ? -10.265 -19.052 32.719   1.00 112.69 ? 83   ILE C C   1 
ATOM   6886  O O   . ILE C 1 28  ? -9.669  -19.339 31.680   1.00 110.59 ? 83   ILE C O   1 
ATOM   6887  C CB  . ILE C 1 28  ? -11.757 -20.790 33.820   1.00 111.05 ? 83   ILE C CB  1 
ATOM   6888  C CG1 . ILE C 1 28  ? -12.909 -19.785 33.891   1.00 112.46 ? 83   ILE C CG1 1 
ATOM   6889  C CG2 . ILE C 1 28  ? -11.860 -21.819 34.936   1.00 114.87 ? 83   ILE C CG2 1 
ATOM   6890  C CD1 . ILE C 1 28  ? -14.282 -20.425 33.822   1.00 96.33  ? 83   ILE C CD1 1 
ATOM   6891  N N   . GLY C 1 29  ? -10.821 -17.858 32.929   1.00 115.95 ? 84   GLY C N   1 
ATOM   6892  C CA  . GLY C 1 29  ? -10.777 -16.804 31.925   1.00 110.44 ? 84   GLY C CA  1 
ATOM   6893  C C   . GLY C 1 29  ? -9.362  -16.456 31.496   1.00 109.67 ? 84   GLY C C   1 
ATOM   6894  O O   . GLY C 1 29  ? -9.055  -16.361 30.299   1.00 108.34 ? 84   GLY C O   1 
ATOM   6895  N N   . ASN C 1 30  ? -8.492  -16.264 32.482   1.00 111.15 ? 85   ASN C N   1 
ATOM   6896  C CA  . ASN C 1 30  ? -7.089  -15.986 32.204   1.00 108.27 ? 85   ASN C CA  1 
ATOM   6897  C C   . ASN C 1 30  ? -6.395  -17.152 31.504   1.00 112.64 ? 85   ASN C C   1 
ATOM   6898  O O   . ASN C 1 30  ? -5.576  -16.946 30.603   1.00 112.29 ? 85   ASN C O   1 
ATOM   6899  C CB  . ASN C 1 30  ? -6.363  -15.613 33.493   1.00 109.26 ? 85   ASN C CB  1 
ATOM   6900  C CG  . ASN C 1 30  ? -7.025  -14.456 34.211   1.00 109.89 ? 85   ASN C CG  1 
ATOM   6901  O OD1 . ASN C 1 30  ? -7.515  -13.521 33.577   1.00 109.23 ? 85   ASN C OD1 1 
ATOM   6902  N ND2 . ASN C 1 30  ? -7.057  -14.518 35.537   1.00 109.89 ? 85   ASN C ND2 1 
ATOM   6903  N N   . ILE C 1 31  ? -6.722  -18.375 31.918   1.00 112.52 ? 86   ILE C N   1 
ATOM   6904  C CA  . ILE C 1 31  ? -6.189  -19.557 31.245   1.00 112.12 ? 86   ILE C CA  1 
ATOM   6905  C C   . ILE C 1 31  ? -6.553  -19.568 29.760   1.00 110.46 ? 86   ILE C C   1 
ATOM   6906  O O   . ILE C 1 31  ? -5.705  -19.836 28.906   1.00 109.44 ? 86   ILE C O   1 
ATOM   6907  C CB  . ILE C 1 31  ? -6.662  -20.856 31.909   1.00 113.27 ? 86   ILE C CB  1 
ATOM   6908  C CG1 . ILE C 1 31  ? -5.835  -21.128 33.166   1.00 108.65 ? 86   ILE C CG1 1 
ATOM   6909  C CG2 . ILE C 1 31  ? -6.525  -22.022 30.944   1.00 114.47 ? 86   ILE C CG2 1 
ATOM   6910  C CD1 . ILE C 1 31  ? -4.360  -21.345 32.887   1.00 96.26  ? 86   ILE C CD1 1 
ATOM   6911  N N   . LEU C 1 32  ? -7.814  -19.276 29.459   1.00 107.37 ? 87   LEU C N   1 
ATOM   6912  C CA  . LEU C 1 32  ? -8.252  -19.148 28.075   1.00 105.95 ? 87   LEU C CA  1 
ATOM   6913  C C   . LEU C 1 32  ? -7.445  -18.081 27.363   1.00 107.41 ? 87   LEU C C   1 
ATOM   6914  O O   . LEU C 1 32  ? -7.039  -18.260 26.220   1.00 106.91 ? 87   LEU C O   1 
ATOM   6915  C CB  . LEU C 1 32  ? -9.729  -18.772 27.995   1.00 101.15 ? 87   LEU C CB  1 
ATOM   6916  C CG  . LEU C 1 32  ? -10.768 -19.789 28.449   1.00 100.29 ? 87   LEU C CG  1 
ATOM   6917  C CD1 . LEU C 1 32  ? -12.136 -19.326 27.977   1.00 90.29  ? 87   LEU C CD1 1 
ATOM   6918  C CD2 . LEU C 1 32  ? -10.436 -21.174 27.910   1.00 88.80  ? 87   LEU C CD2 1 
ATOM   6919  N N   . VAL C 1 33  ? -7.225  -16.959 28.038   1.00 111.46 ? 88   VAL C N   1 
ATOM   6920  C CA  . VAL C 1 33  ? -6.459  -15.877 27.429   1.00 114.28 ? 88   VAL C CA  1 
ATOM   6921  C C   . VAL C 1 33  ? -5.053  -16.335 27.028   1.00 115.14 ? 88   VAL C C   1 
ATOM   6922  O O   . VAL C 1 33  ? -4.677  -16.250 25.854   1.00 116.05 ? 88   VAL C O   1 
ATOM   6923  C CB  . VAL C 1 33  ? -6.386  -14.641 28.347   1.00 113.13 ? 88   VAL C CB  1 
ATOM   6924  C CG1 . VAL C 1 33  ? -5.520  -13.564 27.717   1.00 111.91 ? 88   VAL C CG1 1 
ATOM   6925  C CG2 . VAL C 1 33  ? -7.786  -14.105 28.621   1.00 108.47 ? 88   VAL C CG2 1 
ATOM   6926  N N   . ILE C 1 34  ? -4.287  -16.840 27.994   1.00 114.24 ? 89   ILE C N   1 
ATOM   6927  C CA  . ILE C 1 34  ? -2.915  -17.280 27.721   1.00 121.27 ? 89   ILE C CA  1 
ATOM   6928  C C   . ILE C 1 34  ? -2.850  -18.410 26.695   1.00 128.87 ? 89   ILE C C   1 
ATOM   6929  O O   . ILE C 1 34  ? -2.144  -18.305 25.689   1.00 130.72 ? 89   ILE C O   1 
ATOM   6930  C CB  . ILE C 1 34  ? -2.182  -17.740 28.991   1.00 114.82 ? 89   ILE C CB  1 
ATOM   6931  C CG1 . ILE C 1 34  ? -2.104  -16.601 30.004   1.00 120.59 ? 89   ILE C CG1 1 
ATOM   6932  C CG2 . ILE C 1 34  ? -0.783  -18.232 28.642   1.00 108.71 ? 89   ILE C CG2 1 
ATOM   6933  C CD1 . ILE C 1 34  ? -1.293  -16.945 31.234   1.00 129.19 ? 89   ILE C CD1 1 
ATOM   6934  N N   . VAL C 1 35  ? -3.573  -19.494 26.963   1.00 125.99 ? 90   VAL C N   1 
ATOM   6935  C CA  . VAL C 1 35  ? -3.646  -20.611 26.028   1.00 123.74 ? 90   VAL C CA  1 
ATOM   6936  C C   . VAL C 1 35  ? -3.934  -20.088 24.629   1.00 124.79 ? 90   VAL C C   1 
ATOM   6937  O O   . VAL C 1 35  ? -3.129  -20.247 23.713   1.00 122.65 ? 90   VAL C O   1 
ATOM   6938  C CB  . VAL C 1 35  ? -4.741  -21.618 26.423   1.00 120.55 ? 90   VAL C CB  1 
ATOM   6939  C CG1 . VAL C 1 35  ? -4.903  -22.677 25.342   1.00 118.62 ? 90   VAL C CG1 1 
ATOM   6940  C CG2 . VAL C 1 35  ? -4.413  -22.262 27.760   1.00 124.30 ? 90   VAL C CG2 1 
ATOM   6941  N N   . ALA C 1 36  ? -5.094  -19.455 24.484   1.00 123.89 ? 91   ALA C N   1 
ATOM   6942  C CA  . ALA C 1 36  ? -5.551  -18.919 23.208   1.00 126.59 ? 91   ALA C CA  1 
ATOM   6943  C C   . ALA C 1 36  ? -4.479  -18.105 22.494   1.00 125.72 ? 91   ALA C C   1 
ATOM   6944  O O   . ALA C 1 36  ? -4.219  -18.322 21.312   1.00 127.09 ? 91   ALA C O   1 
ATOM   6945  C CB  . ALA C 1 36  ? -6.803  -18.079 23.410   1.00 119.98 ? 91   ALA C CB  1 
ATOM   6946  N N   . PHE C 1 37  ? -3.855  -17.171 23.205   1.00 120.60 ? 92   PHE C N   1 
ATOM   6947  C CA  . PHE C 1 37  ? -2.815  -16.356 22.590   1.00 123.45 ? 92   PHE C CA  1 
ATOM   6948  C C   . PHE C 1 37  ? -1.655  -17.213 22.096   1.00 127.97 ? 92   PHE C C   1 
ATOM   6949  O O   . PHE C 1 37  ? -1.231  -17.097 20.946   1.00 133.04 ? 92   PHE C O   1 
ATOM   6950  C CB  . PHE C 1 37  ? -2.289  -15.301 23.562   1.00 122.53 ? 92   PHE C CB  1 
ATOM   6951  C CG  . PHE C 1 37  ? -1.139  -14.500 23.014   1.00 117.02 ? 92   PHE C CG  1 
ATOM   6952  C CD1 . PHE C 1 37  ? 0.140   -15.032 22.974   1.00 114.84 ? 92   PHE C CD1 1 
ATOM   6953  C CD2 . PHE C 1 37  ? -1.338  -13.220 22.532   1.00 116.97 ? 92   PHE C CD2 1 
ATOM   6954  C CE1 . PHE C 1 37  ? 1.195   -14.304 22.467   1.00 113.43 ? 92   PHE C CE1 1 
ATOM   6955  C CE2 . PHE C 1 37  ? -0.285  -12.486 22.025   1.00 117.42 ? 92   PHE C CE2 1 
ATOM   6956  C CZ  . PHE C 1 37  ? 0.983   -13.029 21.991   1.00 114.84 ? 92   PHE C CZ  1 
ATOM   6957  N N   . LYS C 1 38  ? -1.142  -18.068 22.976   1.00 126.97 ? 93   LYS C N   1 
ATOM   6958  C CA  . LYS C 1 38  ? 0.048   -18.861 22.684   1.00 130.19 ? 93   LYS C CA  1 
ATOM   6959  C C   . LYS C 1 38  ? -0.174  -19.811 21.515   1.00 128.59 ? 93   LYS C C   1 
ATOM   6960  O O   . LYS C 1 38  ? 0.736   -20.070 20.727   1.00 124.60 ? 93   LYS C O   1 
ATOM   6961  C CB  . LYS C 1 38  ? 0.477   -19.652 23.922   1.00 123.42 ? 93   LYS C CB  1 
ATOM   6962  N N   . VAL C 1 39  ? -1.394  -20.324 21.414   1.00 130.01 ? 94   VAL C N   1 
ATOM   6963  C CA  . VAL C 1 39  ? -1.730  -21.341 20.428   1.00 136.70 ? 94   VAL C CA  1 
ATOM   6964  C C   . VAL C 1 39  ? -2.328  -20.727 19.158   1.00 139.23 ? 94   VAL C C   1 
ATOM   6965  O O   . VAL C 1 39  ? -2.672  -21.440 18.215   1.00 140.67 ? 94   VAL C O   1 
ATOM   6966  C CB  . VAL C 1 39  ? -2.707  -22.380 21.028   1.00 135.54 ? 94   VAL C CB  1 
ATOM   6967  C CG1 . VAL C 1 39  ? -4.127  -21.829 21.048   1.00 134.09 ? 94   VAL C CG1 1 
ATOM   6968  C CG2 . VAL C 1 39  ? -2.642  -23.691 20.257   1.00 133.72 ? 94   VAL C CG2 1 
ATOM   6969  N N   . ASN C 1 40  ? -2.446  -19.402 19.138   1.00 135.64 ? 95   ASN C N   1 
ATOM   6970  C CA  . ASN C 1 40  ? -2.996  -18.697 17.983   1.00 130.32 ? 95   ASN C CA  1 
ATOM   6971  C C   . ASN C 1 40  ? -2.014  -17.677 17.407   1.00 127.90 ? 95   ASN C C   1 
ATOM   6972  O O   . ASN C 1 40  ? -1.590  -16.751 18.096   1.00 131.69 ? 95   ASN C O   1 
ATOM   6973  C CB  . ASN C 1 40  ? -4.318  -18.017 18.353   1.00 130.06 ? 95   ASN C CB  1 
ATOM   6974  C CG  . ASN C 1 40  ? -5.042  -17.447 17.148   1.00 131.58 ? 95   ASN C CG  1 
ATOM   6975  O OD1 . ASN C 1 40  ? -4.420  -16.974 16.197   1.00 128.82 ? 95   ASN C OD1 1 
ATOM   6976  N ND2 . ASN C 1 40  ? -6.369  -17.489 17.184   1.00 132.49 ? 95   ASN C ND2 1 
ATOM   6977  N N   . LYS C 1 41  ? -1.662  -17.851 16.137   1.00 125.20 ? 96   LYS C N   1 
ATOM   6978  C CA  . LYS C 1 41  ? -0.696  -16.977 15.476   1.00 123.89 ? 96   LYS C CA  1 
ATOM   6979  C C   . LYS C 1 41  ? -1.240  -15.565 15.280   1.00 125.09 ? 96   LYS C C   1 
ATOM   6980  O O   . LYS C 1 41  ? -0.565  -14.580 15.589   1.00 123.65 ? 96   LYS C O   1 
ATOM   6981  C CB  . LYS C 1 41  ? -0.285  -17.564 14.123   1.00 112.76 ? 96   LYS C CB  1 
ATOM   6982  N N   . GLN C 1 42  ? -2.460  -15.475 14.759   1.00 126.47 ? 97   GLN C N   1 
ATOM   6983  C CA  . GLN C 1 42  ? -3.099  -14.189 14.499   1.00 126.32 ? 97   GLN C CA  1 
ATOM   6984  C C   . GLN C 1 42  ? -3.124  -13.321 15.751   1.00 133.05 ? 97   GLN C C   1 
ATOM   6985  O O   . GLN C 1 42  ? -2.951  -12.105 15.678   1.00 138.94 ? 97   GLN C O   1 
ATOM   6986  C CB  . GLN C 1 42  ? -4.522  -14.396 13.970   1.00 119.27 ? 97   GLN C CB  1 
ATOM   6987  N N   . LEU C 1 43  ? -3.332  -13.953 16.900   1.00 131.94 ? 98   LEU C N   1 
ATOM   6988  C CA  . LEU C 1 43  ? -3.422  -13.224 18.158   1.00 124.99 ? 98   LEU C CA  1 
ATOM   6989  C C   . LEU C 1 43  ? -2.118  -12.557 18.561   1.00 121.48 ? 98   LEU C C   1 
ATOM   6990  O O   . LEU C 1 43  ? -2.127  -11.471 19.131   1.00 125.48 ? 98   LEU C O   1 
ATOM   6991  C CB  . LEU C 1 43  ? -3.924  -14.133 19.279   1.00 125.38 ? 98   LEU C CB  1 
ATOM   6992  C CG  . LEU C 1 43  ? -5.422  -14.421 19.215   1.00 127.33 ? 98   LEU C CG  1 
ATOM   6993  C CD1 . LEU C 1 43  ? -5.824  -15.334 20.352   1.00 133.56 ? 98   LEU C CD1 1 
ATOM   6994  C CD2 . LEU C 1 43  ? -6.213  -13.123 19.257   1.00 122.35 ? 98   LEU C CD2 1 
ATOM   6995  N N   . LYS C 1 44  ? -0.995  -13.199 18.272   1.00 119.79 ? 99   LYS C N   1 
ATOM   6996  C CA  . LYS C 1 44  ? 0.289   -12.629 18.655   1.00 118.84 ? 99   LYS C CA  1 
ATOM   6997  C C   . LYS C 1 44  ? 0.472   -11.257 18.021   1.00 120.97 ? 99   LYS C C   1 
ATOM   6998  O O   . LYS C 1 44  ? 0.349   -11.097 16.808   1.00 121.23 ? 99   LYS C O   1 
ATOM   6999  C CB  . LYS C 1 44  ? 1.430   -13.549 18.248   1.00 119.21 ? 99   LYS C CB  1 
ATOM   7000  C CG  . LYS C 1 44  ? 1.219   -14.994 18.664   1.00 124.25 ? 99   LYS C CG  1 
ATOM   7001  C CD  . LYS C 1 44  ? 2.283   -15.895 18.062   1.00 129.39 ? 99   LYS C CD  1 
ATOM   7002  C CE  . LYS C 1 44  ? 2.008   -17.359 18.361   1.00 124.55 ? 99   LYS C CE  1 
ATOM   7003  N NZ  . LYS C 1 44  ? 2.072   -17.645 19.820   1.00 120.22 ? 99   LYS C NZ  1 
ATOM   7004  N N   . THR C 1 45  ? 0.803   -10.278 18.855   1.00 117.38 ? 100  THR C N   1 
ATOM   7005  C CA  . THR C 1 45  ? 0.916   -8.883  18.446   1.00 113.51 ? 100  THR C CA  1 
ATOM   7006  C C   . THR C 1 45  ? 1.466   -8.123  19.635   1.00 111.72 ? 100  THR C C   1 
ATOM   7007  O O   . THR C 1 45  ? 1.426   -8.618  20.758   1.00 119.24 ? 100  THR C O   1 
ATOM   7008  C CB  . THR C 1 45  ? -0.455  -8.271  18.088   1.00 115.19 ? 100  THR C CB  1 
ATOM   7009  O OG1 . THR C 1 45  ? -1.079  -9.035  17.049   1.00 125.39 ? 100  THR C OG1 1 
ATOM   7010  C CG2 . THR C 1 45  ? -0.310  -6.826  17.630   1.00 106.36 ? 100  THR C CG2 1 
ATOM   7011  N N   . VAL C 1 46  ? 1.982   -6.924  19.396   1.00 100.64 ? 101  VAL C N   1 
ATOM   7012  C CA  . VAL C 1 46  ? 2.479   -6.101  20.484   1.00 102.79 ? 101  VAL C CA  1 
ATOM   7013  C C   . VAL C 1 46  ? 1.369   -5.868  21.514   1.00 103.87 ? 101  VAL C C   1 
ATOM   7014  O O   . VAL C 1 46  ? 1.463   -6.293  22.676   1.00 104.77 ? 101  VAL C O   1 
ATOM   7015  C CB  . VAL C 1 46  ? 3.006   -4.760  19.969   1.00 100.36 ? 101  VAL C CB  1 
ATOM   7016  C CG1 . VAL C 1 46  ? 3.706   -4.011  21.090   1.00 104.32 ? 101  VAL C CG1 1 
ATOM   7017  C CG2 . VAL C 1 46  ? 3.957   -4.981  18.808   1.00 91.32  ? 101  VAL C CG2 1 
ATOM   7018  N N   . ASN C 1 47  ? 0.316   -5.190  21.071   1.00 96.76  ? 102  ASN C N   1 
ATOM   7019  C CA  . ASN C 1 47  ? -0.820  -4.883  21.924   1.00 95.59  ? 102  ASN C CA  1 
ATOM   7020  C C   . ASN C 1 47  ? -1.315  -6.128  22.663   1.00 102.88 ? 102  ASN C C   1 
ATOM   7021  O O   . ASN C 1 47  ? -1.519  -6.115  23.888   1.00 109.28 ? 102  ASN C O   1 
ATOM   7022  C CB  . ASN C 1 47  ? -1.953  -4.295  21.079   1.00 101.47 ? 102  ASN C CB  1 
ATOM   7023  C CG  . ASN C 1 47  ? -1.448  -3.406  19.946   1.00 98.25  ? 102  ASN C CG  1 
ATOM   7024  O OD1 . ASN C 1 47  ? -1.288  -2.194  20.109   1.00 91.48  ? 102  ASN C OD1 1 
ATOM   7025  N ND2 . ASN C 1 47  ? -1.209  -4.009  18.785   1.00 95.04  ? 102  ASN C ND2 1 
ATOM   7026  N N   . ASN C 1 48  ? -1.495  -7.208  21.908   1.00 103.50 ? 103  ASN C N   1 
ATOM   7027  C CA  . ASN C 1 48  ? -2.006  -8.462  22.452   1.00 103.49 ? 103  ASN C CA  1 
ATOM   7028  C C   . ASN C 1 48  ? -1.014  -9.143  23.396   1.00 102.27 ? 103  ASN C C   1 
ATOM   7029  O O   . ASN C 1 48  ? -1.400  -9.941  24.249   1.00 102.96 ? 103  ASN C O   1 
ATOM   7030  C CB  . ASN C 1 48  ? -2.405  -9.401  21.314   1.00 105.78 ? 103  ASN C CB  1 
ATOM   7031  C CG  . ASN C 1 48  ? -3.430  -8.781  20.385   1.00 112.75 ? 103  ASN C CG  1 
ATOM   7032  O OD1 . ASN C 1 48  ? -4.350  -8.095  20.831   1.00 124.79 ? 103  ASN C OD1 1 
ATOM   7033  N ND2 . ASN C 1 48  ? -3.274  -9.012  19.086   1.00 109.07 ? 103  ASN C ND2 1 
ATOM   7034  N N   . TYR C 1 49  ? 0.265   -8.819  23.231   1.00 99.40  ? 104  TYR C N   1 
ATOM   7035  C CA  . TYR C 1 49  ? 1.318   -9.288  24.123   1.00 97.54  ? 104  TYR C CA  1 
ATOM   7036  C C   . TYR C 1 49  ? 1.090   -8.617  25.470   1.00 93.48  ? 104  TYR C C   1 
ATOM   7037  O O   . TYR C 1 49  ? 1.078   -9.266  26.525   1.00 93.32  ? 104  TYR C O   1 
ATOM   7038  C CB  . TYR C 1 49  ? 2.684   -8.883  23.557   1.00 105.51 ? 104  TYR C CB  1 
ATOM   7039  C CG  . TYR C 1 49  ? 3.845   -9.820  23.853   1.00 110.62 ? 104  TYR C CG  1 
ATOM   7040  C CD1 . TYR C 1 49  ? 4.711   -9.576  24.915   1.00 105.30 ? 104  TYR C CD1 1 
ATOM   7041  C CD2 . TYR C 1 49  ? 4.097   -10.924 23.045   1.00 105.35 ? 104  TYR C CD2 1 
ATOM   7042  C CE1 . TYR C 1 49  ? 5.782   -10.418 25.177   1.00 101.75 ? 104  TYR C CE1 1 
ATOM   7043  C CE2 . TYR C 1 49  ? 5.164   -11.771 23.299   1.00 102.36 ? 104  TYR C CE2 1 
ATOM   7044  C CZ  . TYR C 1 49  ? 6.003   -11.514 24.367   1.00 103.83 ? 104  TYR C CZ  1 
ATOM   7045  O OH  . TYR C 1 49  ? 7.065   -12.351 24.626   1.00 98.49  ? 104  TYR C OH  1 
ATOM   7046  N N   . PHE C 1 50  ? 0.896   -7.302  25.425   1.00 94.63  ? 105  PHE C N   1 
ATOM   7047  C CA  . PHE C 1 50  ? 0.575   -6.546  26.633   1.00 91.58  ? 105  PHE C CA  1 
ATOM   7048  C C   . PHE C 1 50  ? -0.624  -7.167  27.346   1.00 93.12  ? 105  PHE C C   1 
ATOM   7049  O O   . PHE C 1 50  ? -0.565  -7.488  28.540   1.00 95.19  ? 105  PHE C O   1 
ATOM   7050  C CB  . PHE C 1 50  ? 0.293   -5.081  26.290   1.00 86.81  ? 105  PHE C CB  1 
ATOM   7051  C CG  . PHE C 1 50  ? 1.463   -4.370  25.673   1.00 87.84  ? 105  PHE C CG  1 
ATOM   7052  C CD1 . PHE C 1 50  ? 2.757   -4.687  26.053   1.00 84.36  ? 105  PHE C CD1 1 
ATOM   7053  C CD2 . PHE C 1 50  ? 1.274   -3.393  24.710   1.00 87.91  ? 105  PHE C CD2 1 
ATOM   7054  C CE1 . PHE C 1 50  ? 3.842   -4.041  25.490   1.00 75.63  ? 105  PHE C CE1 1 
ATOM   7055  C CE2 . PHE C 1 50  ? 2.361   -2.742  24.142   1.00 86.57  ? 105  PHE C CE2 1 
ATOM   7056  C CZ  . PHE C 1 50  ? 3.645   -3.069  24.535   1.00 73.24  ? 105  PHE C CZ  1 
ATOM   7057  N N   . LEU C 1 51  ? -1.713  -7.348  26.607   1.00 91.98  ? 106  LEU C N   1 
ATOM   7058  C CA  . LEU C 1 51  ? -2.913  -7.944  27.188   1.00 90.27  ? 106  LEU C CA  1 
ATOM   7059  C C   . LEU C 1 51  ? -2.631  -9.326  27.786   1.00 95.12  ? 106  LEU C C   1 
ATOM   7060  O O   . LEU C 1 51  ? -3.187  -9.698  28.822   1.00 96.61  ? 106  LEU C O   1 
ATOM   7061  C CB  . LEU C 1 51  ? -4.022  -8.011  26.141   1.00 95.86  ? 106  LEU C CB  1 
ATOM   7062  C CG  . LEU C 1 51  ? -4.249  -6.658  25.465   1.00 97.22  ? 106  LEU C CG  1 
ATOM   7063  C CD1 . LEU C 1 51  ? -5.262  -6.759  24.334   1.00 99.05  ? 106  LEU C CD1 1 
ATOM   7064  C CD2 . LEU C 1 51  ? -4.669  -5.621  26.496   1.00 96.19  ? 106  LEU C CD2 1 
ATOM   7065  N N   . LEU C 1 52  ? -1.760  -10.085 27.130   1.00 99.14  ? 107  LEU C N   1 
ATOM   7066  C CA  . LEU C 1 52  ? -1.344  -11.380 27.652   1.00 98.53  ? 107  LEU C CA  1 
ATOM   7067  C C   . LEU C 1 52  ? -0.761  -11.189 29.043   1.00 98.23  ? 107  LEU C C   1 
ATOM   7068  O O   . LEU C 1 52  ? -1.169  -11.861 29.986   1.00 97.04  ? 107  LEU C O   1 
ATOM   7069  C CB  . LEU C 1 52  ? -0.301  -12.024 26.734   1.00 106.44 ? 107  LEU C CB  1 
ATOM   7070  C CG  . LEU C 1 52  ? -0.004  -13.524 26.869   1.00 106.06 ? 107  LEU C CG  1 
ATOM   7071  C CD1 . LEU C 1 52  ? 1.097   -13.918 25.900   1.00 108.77 ? 107  LEU C CD1 1 
ATOM   7072  C CD2 . LEU C 1 52  ? 0.381   -13.918 28.285   1.00 96.73  ? 107  LEU C CD2 1 
ATOM   7073  N N   . SER C 1 53  ? 0.191   -10.267 29.170   1.00 102.19 ? 108  SER C N   1 
ATOM   7074  C CA  . SER C 1 53  ? 0.804   -10.011 30.474   1.00 98.19  ? 108  SER C CA  1 
ATOM   7075  C C   . SER C 1 53  ? -0.234  -9.623  31.526   1.00 93.49  ? 108  SER C C   1 
ATOM   7076  O O   . SER C 1 53  ? -0.175  -10.087 32.671   1.00 95.87  ? 108  SER C O   1 
ATOM   7077  C CB  . SER C 1 53  ? 1.879   -8.930  30.379   1.00 89.01  ? 108  SER C CB  1 
ATOM   7078  O OG  . SER C 1 53  ? 2.389   -8.622  31.665   1.00 88.03  ? 108  SER C OG  1 
ATOM   7079  N N   . LEU C 1 54  ? -1.177  -8.767  31.144   1.00 89.99  ? 109  LEU C N   1 
ATOM   7080  C CA  . LEU C 1 54  ? -2.263  -8.422  32.055   1.00 92.87  ? 109  LEU C CA  1 
ATOM   7081  C C   . LEU C 1 54  ? -2.967  -9.691  32.523   1.00 100.34 ? 109  LEU C C   1 
ATOM   7082  O O   . LEU C 1 54  ? -3.319  -9.827  33.697   1.00 99.66  ? 109  LEU C O   1 
ATOM   7083  C CB  . LEU C 1 54  ? -3.267  -7.487  31.383   1.00 96.41  ? 109  LEU C CB  1 
ATOM   7084  C CG  . LEU C 1 54  ? -2.880  -6.018  31.210   1.00 94.96  ? 109  LEU C CG  1 
ATOM   7085  C CD1 . LEU C 1 54  ? -3.928  -5.294  30.386   1.00 97.08  ? 109  LEU C CD1 1 
ATOM   7086  C CD2 . LEU C 1 54  ? -2.697  -5.340  32.557   1.00 90.42  ? 109  LEU C CD2 1 
ATOM   7087  N N   . ALA C 1 55  ? -3.162  -10.618 31.589   1.00 102.02 ? 110  ALA C N   1 
ATOM   7088  C CA  . ALA C 1 55  ? -3.782  -11.903 31.889   1.00 102.48 ? 110  ALA C CA  1 
ATOM   7089  C C   . ALA C 1 55  ? -2.919  -12.744 32.830   1.00 104.69 ? 110  ALA C C   1 
ATOM   7090  O O   . ALA C 1 55  ? -3.431  -13.573 33.581   1.00 104.11 ? 110  ALA C O   1 
ATOM   7091  C CB  . ALA C 1 55  ? -4.064  -12.659 30.608   1.00 107.29 ? 110  ALA C CB  1 
ATOM   7092  N N   . CYS C 1 56  ? -1.606  -12.539 32.771   1.00 107.79 ? 111  CYS C N   1 
ATOM   7093  C CA  . CYS C 1 56  ? -0.684  -13.239 33.662   1.00 112.01 ? 111  CYS C CA  1 
ATOM   7094  C C   . CYS C 1 56  ? -0.856  -12.734 35.090   1.00 113.18 ? 111  CYS C C   1 
ATOM   7095  O O   . CYS C 1 56  ? -1.074  -13.519 36.021   1.00 110.76 ? 111  CYS C O   1 
ATOM   7096  C CB  . CYS C 1 56  ? 0.770   -13.039 33.219   1.00 114.84 ? 111  CYS C CB  1 
ATOM   7097  S SG  . CYS C 1 56  ? 1.178   -13.695 31.581   1.00 162.27 ? 111  CYS C SG  1 
ATOM   7098  N N   . ALA C 1 57  ? -0.763  -11.417 35.259   1.00 113.58 ? 112  ALA C N   1 
ATOM   7099  C CA  . ALA C 1 57  ? -0.966  -10.816 36.573   1.00 108.64 ? 112  ALA C CA  1 
ATOM   7100  C C   . ALA C 1 57  ? -2.313  -11.248 37.141   1.00 104.52 ? 112  ALA C C   1 
ATOM   7101  O O   . ALA C 1 57  ? -2.403  -11.702 38.284   1.00 105.69 ? 112  ALA C O   1 
ATOM   7102  C CB  . ALA C 1 57  ? -0.885  -9.299  36.488   1.00 105.32 ? 112  ALA C CB  1 
ATOM   7103  N N   . ASP C 1 58  ? -3.359  -11.115 36.331   1.00 101.95 ? 113  ASP C N   1 
ATOM   7104  C CA  . ASP C 1 58  ? -4.696  -11.500 36.759   1.00 104.02 ? 113  ASP C CA  1 
ATOM   7105  C C   . ASP C 1 58  ? -4.758  -12.984 37.135   1.00 105.91 ? 113  ASP C C   1 
ATOM   7106  O O   . ASP C 1 58  ? -5.484  -13.374 38.055   1.00 110.19 ? 113  ASP C O   1 
ATOM   7107  C CB  . ASP C 1 58  ? -5.723  -11.162 35.675   1.00 110.03 ? 113  ASP C CB  1 
ATOM   7108  C CG  . ASP C 1 58  ? -5.673  -9.701  35.258   1.00 109.34 ? 113  ASP C CG  1 
ATOM   7109  O OD1 . ASP C 1 58  ? -5.367  -8.843  36.116   1.00 103.39 ? 113  ASP C OD1 1 
ATOM   7110  O OD2 . ASP C 1 58  ? -5.934  -9.414  34.070   1.00 110.52 ? 113  ASP C OD2 1 
ATOM   7111  N N   . LEU C 1 59  ? -3.982  -13.806 36.432   1.00 107.94 ? 114  LEU C N   1 
ATOM   7112  C CA  . LEU C 1 59  ? -3.945  -15.237 36.721   1.00 106.55 ? 114  LEU C CA  1 
ATOM   7113  C C   . LEU C 1 59  ? -3.328  -15.508 38.087   1.00 107.22 ? 114  LEU C C   1 
ATOM   7114  O O   . LEU C 1 59  ? -3.888  -16.268 38.880   1.00 108.99 ? 114  LEU C O   1 
ATOM   7115  C CB  . LEU C 1 59  ? -3.195  -16.021 35.635   1.00 101.83 ? 114  LEU C CB  1 
ATOM   7116  C CG  . LEU C 1 59  ? -3.268  -17.552 35.752   1.00 91.43  ? 114  LEU C CG  1 
ATOM   7117  C CD1 . LEU C 1 59  ? -3.014  -18.221 34.411   1.00 104.94 ? 114  LEU C CD1 1 
ATOM   7118  C CD2 . LEU C 1 59  ? -2.320  -18.097 36.813   1.00 80.02  ? 114  LEU C CD2 1 
ATOM   7119  N N   . ILE C 1 60  ? -2.180  -14.893 38.365   1.00 106.13 ? 115  ILE C N   1 
ATOM   7120  C CA  . ILE C 1 60  ? -1.516  -15.128 39.648   1.00 102.43 ? 115  ILE C CA  1 
ATOM   7121  C C   . ILE C 1 60  ? -2.299  -14.549 40.824   1.00 105.88 ? 115  ILE C C   1 
ATOM   7122  O O   . ILE C 1 60  ? -2.331  -15.147 41.900   1.00 108.57 ? 115  ILE C O   1 
ATOM   7123  C CB  . ILE C 1 60  ? -0.062  -14.614 39.691   1.00 96.49  ? 115  ILE C CB  1 
ATOM   7124  C CG1 . ILE C 1 60  ? 0.552   -14.921 41.060   1.00 83.37  ? 115  ILE C CG1 1 
ATOM   7125  C CG2 . ILE C 1 60  ? -0.004  -13.125 39.390   1.00 104.88 ? 115  ILE C CG2 1 
ATOM   7126  C CD1 . ILE C 1 60  ? 1.952   -14.397 41.249   1.00 82.82  ? 115  ILE C CD1 1 
ATOM   7127  N N   . ILE C 1 61  ? -2.930  -13.393 40.629   1.00 109.14 ? 116  ILE C N   1 
ATOM   7128  C CA  . ILE C 1 61  ? -3.759  -12.825 41.689   1.00 103.62 ? 116  ILE C CA  1 
ATOM   7129  C C   . ILE C 1 61  ? -4.963  -13.724 41.929   1.00 101.99 ? 116  ILE C C   1 
ATOM   7130  O O   . ILE C 1 61  ? -5.405  -13.897 43.063   1.00 104.15 ? 116  ILE C O   1 
ATOM   7131  C CB  . ILE C 1 61  ? -4.232  -11.385 41.369   1.00 101.74 ? 116  ILE C CB  1 
ATOM   7132  C CG1 . ILE C 1 61  ? -4.904  -10.759 42.590   1.00 102.49 ? 116  ILE C CG1 1 
ATOM   7133  C CG2 . ILE C 1 61  ? -5.187  -11.375 40.196   1.00 102.62 ? 116  ILE C CG2 1 
ATOM   7134  C CD1 . ILE C 1 61  ? -5.450  -9.367  42.335   1.00 104.61 ? 116  ILE C CD1 1 
ATOM   7135  N N   . GLY C 1 62  ? -5.479  -14.310 40.855   1.00 105.29 ? 117  GLY C N   1 
ATOM   7136  C CA  . GLY C 1 62  ? -6.618  -15.200 40.958   1.00 107.75 ? 117  GLY C CA  1 
ATOM   7137  C C   . GLY C 1 62  ? -6.305  -16.493 41.682   1.00 103.42 ? 117  GLY C C   1 
ATOM   7138  O O   . GLY C 1 62  ? -7.068  -16.929 42.538   1.00 107.53 ? 117  GLY C O   1 
ATOM   7139  N N   . VAL C 1 63  ? -5.172  -17.101 41.346   1.00 101.41 ? 118  VAL C N   1 
ATOM   7140  C CA  . VAL C 1 63  ? -4.836  -18.422 41.871   1.00 106.10 ? 118  VAL C CA  1 
ATOM   7141  C C   . VAL C 1 63  ? -4.451  -18.414 43.351   1.00 110.52 ? 118  VAL C C   1 
ATOM   7142  O O   . VAL C 1 63  ? -4.802  -19.334 44.089   1.00 112.91 ? 118  VAL C O   1 
ATOM   7143  C CB  . VAL C 1 63  ? -3.717  -19.108 41.050   1.00 101.00 ? 118  VAL C CB  1 
ATOM   7144  C CG1 . VAL C 1 63  ? -2.439  -18.285 41.082   1.00 103.06 ? 118  VAL C CG1 1 
ATOM   7145  C CG2 . VAL C 1 63  ? -3.458  -20.508 41.573   1.00 94.64  ? 118  VAL C CG2 1 
ATOM   7146  N N   . ILE C 1 64  ? -3.737  -17.381 43.786   1.00 109.23 ? 119  ILE C N   1 
ATOM   7147  C CA  . ILE C 1 64  ? -3.244  -17.341 45.159   1.00 110.30 ? 119  ILE C CA  1 
ATOM   7148  C C   . ILE C 1 64  ? -3.996  -16.343 46.035   1.00 105.77 ? 119  ILE C C   1 
ATOM   7149  O O   . ILE C 1 64  ? -4.683  -16.731 46.977   1.00 113.00 ? 119  ILE C O   1 
ATOM   7150  C CB  . ILE C 1 64  ? -1.727  -17.045 45.217   1.00 104.39 ? 119  ILE C CB  1 
ATOM   7151  C CG1 . ILE C 1 64  ? -0.933  -18.212 44.622   1.00 101.94 ? 119  ILE C CG1 1 
ATOM   7152  C CG2 . ILE C 1 64  ? -1.288  -16.790 46.647   1.00 97.76  ? 119  ILE C CG2 1 
ATOM   7153  C CD1 . ILE C 1 64  ? 0.570   -18.039 44.700   1.00 96.79  ? 119  ILE C CD1 1 
ATOM   7154  N N   . SER C 1 65  ? -3.869  -15.062 45.711   1.00 106.10 ? 120  SER C N   1 
ATOM   7155  C CA  . SER C 1 65  ? -4.387  -13.995 46.566   1.00 120.68 ? 120  SER C CA  1 
ATOM   7156  C C   . SER C 1 65  ? -5.853  -14.169 46.989   1.00 117.80 ? 120  SER C C   1 
ATOM   7157  O O   . SER C 1 65  ? -6.166  -14.134 48.182   1.00 113.58 ? 120  SER C O   1 
ATOM   7158  C CB  . SER C 1 65  ? -4.168  -12.630 45.903   1.00 114.74 ? 120  SER C CB  1 
ATOM   7159  O OG  . SER C 1 65  ? -2.786  -12.382 45.703   1.00 115.29 ? 120  SER C OG  1 
ATOM   7160  N N   . MET C 1 66  ? -6.744  -14.355 46.020   1.00 130.63 ? 121  MET C N   1 
ATOM   7161  C CA  . MET C 1 66  ? -8.166  -14.513 46.313   1.00 127.20 ? 121  MET C CA  1 
ATOM   7162  C C   . MET C 1 66  ? -8.396  -15.607 47.348   1.00 120.70 ? 121  MET C C   1 
ATOM   7163  O O   . MET C 1 66  ? -9.249  -15.480 48.227   1.00 119.76 ? 121  MET C O   1 
ATOM   7164  C CB  . MET C 1 66  ? -8.951  -14.853 45.044   1.00 127.17 ? 121  MET C CB  1 
ATOM   7165  C CG  . MET C 1 66  ? -8.559  -14.049 43.823   1.00 120.86 ? 121  MET C CG  1 
ATOM   7166  S SD  . MET C 1 66  ? -9.620  -14.420 42.416   1.00 116.31 ? 121  MET C SD  1 
ATOM   7167  C CE  . MET C 1 66  ? -11.182 -13.754 42.992   1.00 190.02 ? 121  MET C CE  1 
ATOM   7168  N N   . ASN C 1 67  ? -7.617  -16.678 47.245   1.00 115.61 ? 122  ASN C N   1 
ATOM   7169  C CA  . ASN C 1 67  ? -7.803  -17.837 48.104   1.00 113.13 ? 122  ASN C CA  1 
ATOM   7170  C C   . ASN C 1 67  ? -7.352  -17.550 49.522   1.00 116.16 ? 122  ASN C C   1 
ATOM   7171  O O   . ASN C 1 67  ? -8.162  -17.543 50.446   1.00 118.77 ? 122  ASN C O   1 
ATOM   7172  C CB  . ASN C 1 67  ? -7.050  -19.048 47.555   1.00 112.11 ? 122  ASN C CB  1 
ATOM   7173  C CG  . ASN C 1 67  ? -7.743  -19.670 46.365   1.00 112.27 ? 122  ASN C CG  1 
ATOM   7174  O OD1 . ASN C 1 67  ? -8.972  -19.691 46.287   1.00 109.69 ? 122  ASN C OD1 1 
ATOM   7175  N ND2 . ASN C 1 67  ? -6.958  -20.184 45.428   1.00 112.16 ? 122  ASN C ND2 1 
ATOM   7176  N N   . LEU C 1 68  ? -6.059  -17.310 49.692   1.00 115.32 ? 123  LEU C N   1 
ATOM   7177  C CA  . LEU C 1 68  ? -5.519  -17.021 51.010   1.00 110.40 ? 123  LEU C CA  1 
ATOM   7178  C C   . LEU C 1 68  ? -6.356  -15.940 51.684   1.00 115.02 ? 123  LEU C C   1 
ATOM   7179  O O   . LEU C 1 68  ? -6.600  -15.999 52.890   1.00 122.80 ? 123  LEU C O   1 
ATOM   7180  C CB  . LEU C 1 68  ? -4.055  -16.585 50.914   1.00 108.60 ? 123  LEU C CB  1 
ATOM   7181  C CG  . LEU C 1 68  ? -3.019  -17.668 50.591   1.00 105.83 ? 123  LEU C CG  1 
ATOM   7182  C CD1 . LEU C 1 68  ? -3.267  -18.281 49.223   1.00 109.28 ? 123  LEU C CD1 1 
ATOM   7183  C CD2 . LEU C 1 68  ? -1.598  -17.128 50.679   1.00 98.29  ? 123  LEU C CD2 1 
ATOM   7184  N N   . PHE C 1 69  ? -6.813  -14.970 50.897   1.00 114.12 ? 124  PHE C N   1 
ATOM   7185  C CA  . PHE C 1 69  ? -7.614  -13.868 51.429   1.00 120.81 ? 124  PHE C CA  1 
ATOM   7186  C C   . PHE C 1 69  ? -8.988  -14.320 51.916   1.00 121.18 ? 124  PHE C C   1 
ATOM   7187  O O   . PHE C 1 69  ? -9.386  -14.022 53.045   1.00 121.34 ? 124  PHE C O   1 
ATOM   7188  C CB  . PHE C 1 69  ? -7.771  -12.753 50.394   1.00 120.73 ? 124  PHE C CB  1 
ATOM   7189  C CG  . PHE C 1 69  ? -8.539  -11.563 50.901   1.00 116.21 ? 124  PHE C CG  1 
ATOM   7190  C CD1 . PHE C 1 69  ? -7.967  -10.690 51.813   1.00 105.11 ? 124  PHE C CD1 1 
ATOM   7191  C CD2 . PHE C 1 69  ? -9.828  -11.314 50.462   1.00 115.27 ? 124  PHE C CD2 1 
ATOM   7192  C CE1 . PHE C 1 69  ? -8.668  -9.595  52.277   1.00 100.70 ? 124  PHE C CE1 1 
ATOM   7193  C CE2 . PHE C 1 69  ? -10.534 -10.219 50.923   1.00 111.21 ? 124  PHE C CE2 1 
ATOM   7194  C CZ  . PHE C 1 69  ? -9.953  -9.359  51.833   1.00 103.49 ? 124  PHE C CZ  1 
ATOM   7195  N N   . THR C 1 70  ? -9.717  -15.026 51.059   1.00 116.96 ? 125  THR C N   1 
ATOM   7196  C CA  . THR C 1 70  ? -11.014 -15.567 51.444   1.00 119.79 ? 125  THR C CA  1 
ATOM   7197  C C   . THR C 1 70  ? -10.874 -16.399 52.720   1.00 124.37 ? 125  THR C C   1 
ATOM   7198  O O   . THR C 1 70  ? -11.742 -16.367 53.592   1.00 125.44 ? 125  THR C O   1 
ATOM   7199  C CB  . THR C 1 70  ? -11.626 -16.426 50.320   1.00 124.34 ? 125  THR C CB  1 
ATOM   7200  O OG1 . THR C 1 70  ? -11.814 -15.622 49.149   1.00 122.89 ? 125  THR C OG1 1 
ATOM   7201  C CG2 . THR C 1 70  ? -12.965 -16.997 50.752   1.00 126.24 ? 125  THR C CG2 1 
ATOM   7202  N N   . THR C 1 71  ? -9.769  -17.135 52.824   1.00 123.53 ? 126  THR C N   1 
ATOM   7203  C CA  . THR C 1 71  ? -9.479  -17.940 54.009   1.00 120.64 ? 126  THR C CA  1 
ATOM   7204  C C   . THR C 1 71  ? -9.321  -17.068 55.246   1.00 122.30 ? 126  THR C C   1 
ATOM   7205  O O   . THR C 1 71  ? -10.017 -17.260 56.241   1.00 123.30 ? 126  THR C O   1 
ATOM   7206  C CB  . THR C 1 71  ? -8.192  -18.765 53.835   1.00 118.08 ? 126  THR C CB  1 
ATOM   7207  O OG1 . THR C 1 71  ? -8.370  -19.717 52.780   1.00 121.87 ? 126  THR C OG1 1 
ATOM   7208  C CG2 . THR C 1 71  ? -7.860  -19.504 55.120   1.00 119.03 ? 126  THR C CG2 1 
ATOM   7209  N N   . TYR C 1 72  ? -8.396  -16.116 55.178   1.00 122.45 ? 127  TYR C N   1 
ATOM   7210  C CA  . TYR C 1 72  ? -8.172  -15.181 56.276   1.00 125.09 ? 127  TYR C CA  1 
ATOM   7211  C C   . TYR C 1 72  ? -9.484  -14.525 56.710   1.00 128.91 ? 127  TYR C C   1 
ATOM   7212  O O   . TYR C 1 72  ? -9.671  -14.208 57.885   1.00 128.14 ? 127  TYR C O   1 
ATOM   7213  C CB  . TYR C 1 72  ? -7.142  -14.120 55.873   1.00 122.27 ? 127  TYR C CB  1 
ATOM   7214  C CG  . TYR C 1 72  ? -7.008  -12.969 56.846   1.00 119.25 ? 127  TYR C CG  1 
ATOM   7215  C CD1 . TYR C 1 72  ? -5.936  -12.897 57.725   1.00 118.10 ? 127  TYR C CD1 1 
ATOM   7216  C CD2 . TYR C 1 72  ? -7.950  -11.948 56.876   1.00 115.27 ? 127  TYR C CD2 1 
ATOM   7217  C CE1 . TYR C 1 72  ? -5.811  -11.843 58.612   1.00 125.05 ? 127  TYR C CE1 1 
ATOM   7218  C CE2 . TYR C 1 72  ? -7.835  -10.893 57.757   1.00 117.16 ? 127  TYR C CE2 1 
ATOM   7219  C CZ  . TYR C 1 72  ? -6.763  -10.843 58.623   1.00 128.51 ? 127  TYR C CZ  1 
ATOM   7220  O OH  . TYR C 1 72  ? -6.646  -9.791  59.503   1.00 133.32 ? 127  TYR C OH  1 
ATOM   7221  N N   . ILE C 1 73  ? -10.386 -14.323 55.753   1.00 125.27 ? 128  ILE C N   1 
ATOM   7222  C CA  . ILE C 1 73  ? -11.703 -13.763 56.043   1.00 123.11 ? 128  ILE C CA  1 
ATOM   7223  C C   . ILE C 1 73  ? -12.599 -14.776 56.756   1.00 130.00 ? 128  ILE C C   1 
ATOM   7224  O O   . ILE C 1 73  ? -13.397 -14.415 57.622   1.00 129.90 ? 128  ILE C O   1 
ATOM   7225  C CB  . ILE C 1 73  ? -12.408 -13.288 54.763   1.00 111.06 ? 128  ILE C CB  1 
ATOM   7226  N N   . ILE C 1 74  ? -12.468 -16.043 56.377   1.00 128.44 ? 129  ILE C N   1 
ATOM   7227  C CA  . ILE C 1 74  ? -13.285 -17.112 56.947   1.00 131.27 ? 129  ILE C CA  1 
ATOM   7228  C C   . ILE C 1 74  ? -12.900 -17.441 58.389   1.00 135.86 ? 129  ILE C C   1 
ATOM   7229  O O   . ILE C 1 74  ? -13.752 -17.473 59.280   1.00 133.63 ? 129  ILE C O   1 
ATOM   7230  C CB  . ILE C 1 74  ? -13.198 -18.393 56.101   1.00 126.09 ? 129  ILE C CB  1 
ATOM   7231  N N   . MET C 1 75  ? -11.614 -17.692 58.610   1.00 132.63 ? 130  MET C N   1 
ATOM   7232  C CA  . MET C 1 75  ? -11.118 -18.061 59.931   1.00 132.22 ? 130  MET C CA  1 
ATOM   7233  C C   . MET C 1 75  ? -11.172 -16.887 60.896   1.00 131.22 ? 130  MET C C   1 
ATOM   7234  O O   . MET C 1 75  ? -10.977 -17.054 62.101   1.00 129.61 ? 130  MET C O   1 
ATOM   7235  C CB  . MET C 1 75  ? -9.681  -18.570 59.837   1.00 124.21 ? 130  MET C CB  1 
ATOM   7236  C CG  . MET C 1 75  ? -9.498  -19.755 58.909   1.00 116.98 ? 130  MET C CG  1 
ATOM   7237  S SD  . MET C 1 75  ? -7.846  -20.455 59.050   1.00 117.87 ? 130  MET C SD  1 
ATOM   7238  C CE  . MET C 1 75  ? -7.786  -20.799 60.806   1.00 131.28 ? 130  MET C CE  1 
ATOM   7239  N N   . ASN C 1 76  ? -11.417 -15.696 60.359   1.00 131.31 ? 131  ASN C N   1 
ATOM   7240  C CA  . ASN C 1 76  ? -11.428 -14.483 61.164   1.00 134.37 ? 131  ASN C CA  1 
ATOM   7241  C C   . ASN C 1 76  ? -10.031 -14.223 61.717   1.00 127.36 ? 131  ASN C C   1 
ATOM   7242  O O   . ASN C 1 76  ? -9.770  -13.188 62.330   1.00 124.36 ? 131  ASN C O   1 
ATOM   7243  C CB  . ASN C 1 76  ? -12.456 -14.585 62.297   1.00 145.80 ? 131  ASN C CB  1 
ATOM   7244  C CG  . ASN C 1 76  ? -13.871 -14.839 61.789   1.00 147.88 ? 131  ASN C CG  1 
ATOM   7245  O OD1 . ASN C 1 76  ? -14.454 -15.896 62.040   1.00 142.13 ? 131  ASN C OD1 1 
ATOM   7246  N ND2 . ASN C 1 76  ? -14.431 -13.863 61.080   1.00 147.07 ? 131  ASN C ND2 1 
ATOM   7247  N N   . ARG C 1 77  ? -9.138  -15.181 61.487   1.00 123.37 ? 132  ARG C N   1 
ATOM   7248  C CA  . ARG C 1 77  ? -7.770  -15.108 61.976   1.00 125.73 ? 132  ARG C CA  1 
ATOM   7249  C C   . ARG C 1 77  ? -6.800  -15.638 60.928   1.00 116.97 ? 132  ARG C C   1 
ATOM   7250  O O   . ARG C 1 77  ? -7.200  -16.337 59.997   1.00 112.65 ? 132  ARG C O   1 
ATOM   7251  C CB  . ARG C 1 77  ? -7.628  -15.912 63.269   1.00 125.75 ? 132  ARG C CB  1 
ATOM   7252  N N   . TRP C 1 78  ? -5.524  -15.306 61.088   1.00 116.70 ? 133  TRP C N   1 
ATOM   7253  C CA  . TRP C 1 78  ? -4.500  -15.745 60.149   1.00 114.64 ? 133  TRP C CA  1 
ATOM   7254  C C   . TRP C 1 78  ? -3.726  -16.924 60.709   1.00 113.02 ? 133  TRP C C   1 
ATOM   7255  O O   . TRP C 1 78  ? -2.943  -16.775 61.644   1.00 117.60 ? 133  TRP C O   1 
ATOM   7256  C CB  . TRP C 1 78  ? -3.532  -14.610 59.829   1.00 118.67 ? 133  TRP C CB  1 
ATOM   7257  C CG  . TRP C 1 78  ? -2.436  -15.041 58.921   1.00 111.05 ? 133  TRP C CG  1 
ATOM   7258  C CD1 . TRP C 1 78  ? -1.160  -15.366 59.274   1.00 104.26 ? 133  TRP C CD1 1 
ATOM   7259  C CD2 . TRP C 1 78  ? -2.521  -15.224 57.504   1.00 110.69 ? 133  TRP C CD2 1 
ATOM   7260  N NE1 . TRP C 1 78  ? -0.440  -15.728 58.162   1.00 105.35 ? 133  TRP C NE1 1 
ATOM   7261  C CE2 . TRP C 1 78  ? -1.253  -15.649 57.061   1.00 106.71 ? 133  TRP C CE2 1 
ATOM   7262  C CE3 . TRP C 1 78  ? -3.545  -15.062 56.565   1.00 106.21 ? 133  TRP C CE3 1 
ATOM   7263  C CZ2 . TRP C 1 78  ? -0.980  -15.917 55.722   1.00 100.27 ? 133  TRP C CZ2 1 
ATOM   7264  C CZ3 . TRP C 1 78  ? -3.272  -15.328 55.238   1.00 104.16 ? 133  TRP C CZ3 1 
ATOM   7265  C CH2 . TRP C 1 78  ? -2.000  -15.751 54.828   1.00 97.24  ? 133  TRP C CH2 1 
ATOM   7266  N N   . ALA C 1 79  ? -3.933  -18.093 60.114   1.00 111.98 ? 134  ALA C N   1 
ATOM   7267  C CA  . ALA C 1 79  ? -3.400  -19.334 60.662   1.00 113.54 ? 134  ALA C CA  1 
ATOM   7268  C C   . ALA C 1 79  ? -2.065  -19.778 60.061   1.00 111.73 ? 134  ALA C C   1 
ATOM   7269  O O   . ALA C 1 79  ? -1.486  -20.769 60.504   1.00 119.64 ? 134  ALA C O   1 
ATOM   7270  C CB  . ALA C 1 79  ? -4.433  -20.445 60.523   1.00 109.98 ? 134  ALA C CB  1 
ATOM   7271  N N   . LEU C 1 80  ? -1.565  -19.049 59.072   1.00 105.55 ? 135  LEU C N   1 
ATOM   7272  C CA  . LEU C 1 80  ? -0.393  -19.514 58.334   1.00 100.32 ? 135  LEU C CA  1 
ATOM   7273  C C   . LEU C 1 80  ? 0.944   -19.086 58.932   1.00 94.42  ? 135  LEU C C   1 
ATOM   7274  O O   . LEU C 1 80  ? 2.002   -19.504 58.461   1.00 84.41  ? 135  LEU C O   1 
ATOM   7275  C CB  . LEU C 1 80  ? -0.480  -19.095 56.867   1.00 105.92 ? 135  LEU C CB  1 
ATOM   7276  C CG  . LEU C 1 80  ? -0.978  -20.179 55.910   1.00 104.83 ? 135  LEU C CG  1 
ATOM   7277  C CD1 . LEU C 1 80  ? -1.128  -19.626 54.504   1.00 109.83 ? 135  LEU C CD1 1 
ATOM   7278  C CD2 . LEU C 1 80  ? -0.029  -21.364 55.921   1.00 104.55 ? 135  LEU C CD2 1 
ATOM   7279  N N   . GLY C 1 81  ? 0.895   -18.263 59.974   1.00 105.77 ? 136  GLY C N   1 
ATOM   7280  C CA  . GLY C 1 81  ? 2.107   -17.766 60.602   1.00 113.75 ? 136  GLY C CA  1 
ATOM   7281  C C   . GLY C 1 81  ? 2.589   -16.473 59.972   1.00 117.66 ? 136  GLY C C   1 
ATOM   7282  O O   . GLY C 1 81  ? 1.830   -15.788 59.287   1.00 120.20 ? 136  GLY C O   1 
ATOM   7283  N N   . ASN C 1 82  ? 3.850   -16.128 60.208   1.00 113.20 ? 137  ASN C N   1 
ATOM   7284  C CA  . ASN C 1 82  ? 4.415   -14.909 59.637   1.00 118.89 ? 137  ASN C CA  1 
ATOM   7285  C C   . ASN C 1 82  ? 4.791   -15.028 58.156   1.00 121.67 ? 137  ASN C C   1 
ATOM   7286  O O   . ASN C 1 82  ? 4.412   -14.183 57.333   1.00 124.30 ? 137  ASN C O   1 
ATOM   7287  C CB  . ASN C 1 82  ? 5.622   -14.432 60.458   1.00 118.27 ? 137  ASN C CB  1 
ATOM   7288  C CG  . ASN C 1 82  ? 6.634   -15.537 60.717   1.00 120.79 ? 137  ASN C CG  1 
ATOM   7289  O OD1 . ASN C 1 82  ? 6.557   -16.618 60.134   1.00 124.63 ? 137  ASN C OD1 1 
ATOM   7290  N ND2 . ASN C 1 82  ? 7.594   -15.264 61.595   1.00 112.47 ? 137  ASN C ND2 1 
ATOM   7291  N N   . LEU C 1 83  ? 5.513   -16.092 57.816   1.00 116.96 ? 138  LEU C N   1 
ATOM   7292  C CA  . LEU C 1 83  ? 6.088   -16.229 56.483   1.00 116.23 ? 138  LEU C CA  1 
ATOM   7293  C C   . LEU C 1 83  ? 5.036   -16.244 55.373   1.00 115.65 ? 138  LEU C C   1 
ATOM   7294  O O   . LEU C 1 83  ? 5.147   -15.493 54.406   1.00 114.86 ? 138  LEU C O   1 
ATOM   7295  C CB  . LEU C 1 83  ? 6.990   -17.463 56.405   1.00 111.97 ? 138  LEU C CB  1 
ATOM   7296  C CG  . LEU C 1 83  ? 7.904   -17.558 55.182   1.00 108.55 ? 138  LEU C CG  1 
ATOM   7297  C CD1 . LEU C 1 83  ? 9.217   -18.231 55.544   1.00 118.73 ? 138  LEU C CD1 1 
ATOM   7298  C CD2 . LEU C 1 83  ? 7.216   -18.283 54.030   1.00 107.44 ? 138  LEU C CD2 1 
ATOM   7299  N N   . ALA C 1 84  ? 4.021   -17.090 55.508   1.00 112.16 ? 139  ALA C N   1 
ATOM   7300  C CA  . ALA C 1 84  ? 2.978   -17.181 54.488   1.00 109.29 ? 139  ALA C CA  1 
ATOM   7301  C C   . ALA C 1 84  ? 2.270   -15.839 54.312   1.00 110.44 ? 139  ALA C C   1 
ATOM   7302  O O   . ALA C 1 84  ? 1.810   -15.498 53.222   1.00 115.69 ? 139  ALA C O   1 
ATOM   7303  C CB  . ALA C 1 84  ? 1.985   -18.263 54.846   1.00 101.93 ? 139  ALA C CB  1 
ATOM   7304  N N   . CYS C 1 85  ? 2.197   -15.087 55.403   1.00 101.67 ? 140  CYS C N   1 
ATOM   7305  C CA  . CYS C 1 85  ? 1.630   -13.746 55.418   1.00 99.68  ? 140  CYS C CA  1 
ATOM   7306  C C   . CYS C 1 85  ? 2.488   -12.811 54.552   1.00 103.24 ? 140  CYS C C   1 
ATOM   7307  O O   . CYS C 1 85  ? 1.941   -12.049 53.753   1.00 104.15 ? 140  CYS C O   1 
ATOM   7308  C CB  . CYS C 1 85  ? 1.547   -13.236 56.855   1.00 99.08  ? 140  CYS C CB  1 
ATOM   7309  S SG  . CYS C 1 85  ? 1.288   -11.444 57.017   1.00 98.78  ? 140  CYS C SG  1 
ATOM   7310  N N   . ASP C 1 86  ? 3.807   -12.894 54.752   1.00 110.90 ? 141  ASP C N   1 
ATOM   7311  C CA  . ASP C 1 86  ? 4.790   -12.115 53.995   1.00 116.79 ? 141  ASP C CA  1 
ATOM   7312  C C   . ASP C 1 86  ? 4.738   -12.424 52.492   1.00 113.84 ? 141  ASP C C   1 
ATOM   7313  O O   . ASP C 1 86  ? 4.648   -11.510 51.667   1.00 110.60 ? 141  ASP C O   1 
ATOM   7314  C CB  . ASP C 1 86  ? 6.212   -12.358 54.531   1.00 118.55 ? 141  ASP C CB  1 
ATOM   7315  C CG  . ASP C 1 86  ? 6.368   -11.972 55.997   1.00 114.72 ? 141  ASP C CG  1 
ATOM   7316  O OD1 . ASP C 1 86  ? 7.271   -12.523 56.667   1.00 112.43 ? 141  ASP C OD1 1 
ATOM   7317  O OD2 . ASP C 1 86  ? 5.593   -11.117 56.477   1.00 109.29 ? 141  ASP C OD2 1 
ATOM   7318  N N   . LEU C 1 87  ? 4.801   -13.710 52.144   1.00 111.43 ? 142  LEU C N   1 
ATOM   7319  C CA  . LEU C 1 87  ? 4.756   -14.137 50.744   1.00 101.79 ? 142  LEU C CA  1 
ATOM   7320  C C   . LEU C 1 87  ? 3.435   -13.767 50.081   1.00 97.54  ? 142  LEU C C   1 
ATOM   7321  O O   . LEU C 1 87  ? 3.409   -13.297 48.943   1.00 94.31  ? 142  LEU C O   1 
ATOM   7322  C CB  . LEU C 1 87  ? 4.982   -15.648 50.616   1.00 100.09 ? 142  LEU C CB  1 
ATOM   7323  C CG  . LEU C 1 87  ? 6.365   -16.218 50.936   1.00 102.19 ? 142  LEU C CG  1 
ATOM   7324  C CD1 . LEU C 1 87  ? 6.447   -17.667 50.484   1.00 99.97  ? 142  LEU C CD1 1 
ATOM   7325  C CD2 . LEU C 1 87  ? 7.452   -15.395 50.274   1.00 96.97  ? 142  LEU C CD2 1 
ATOM   7326  N N   . TRP C 1 88  ? 2.339   -13.993 50.797   1.00 98.37  ? 143  TRP C N   1 
ATOM   7327  C CA  . TRP C 1 88  ? 1.014   -13.652 50.299   1.00 101.33 ? 143  TRP C CA  1 
ATOM   7328  C C   . TRP C 1 88  ? 0.923   -12.164 49.961   1.00 105.90 ? 143  TRP C C   1 
ATOM   7329  O O   . TRP C 1 88  ? 0.520   -11.787 48.851   1.00 105.78 ? 143  TRP C O   1 
ATOM   7330  C CB  . TRP C 1 88  ? -0.048  -14.033 51.329   1.00 100.18 ? 143  TRP C CB  1 
ATOM   7331  C CG  . TRP C 1 88  ? -1.430  -13.697 50.898   1.00 96.06  ? 143  TRP C CG  1 
ATOM   7332  C CD1 . TRP C 1 88  ? -2.091  -14.196 49.818   1.00 101.89 ? 143  TRP C CD1 1 
ATOM   7333  C CD2 . TRP C 1 88  ? -2.330  -12.788 51.536   1.00 91.05  ? 143  TRP C CD2 1 
ATOM   7334  N NE1 . TRP C 1 88  ? -3.350  -13.654 49.741   1.00 103.45 ? 143  TRP C NE1 1 
ATOM   7335  C CE2 . TRP C 1 88  ? -3.521  -12.786 50.785   1.00 96.60  ? 143  TRP C CE2 1 
ATOM   7336  C CE3 . TRP C 1 88  ? -2.246  -11.977 52.667   1.00 92.70  ? 143  TRP C CE3 1 
ATOM   7337  C CZ2 . TRP C 1 88  ? -4.617  -12.005 51.128   1.00 92.62  ? 143  TRP C CZ2 1 
ATOM   7338  C CZ3 . TRP C 1 88  ? -3.337  -11.202 53.006   1.00 94.21  ? 143  TRP C CZ3 1 
ATOM   7339  C CH2 . TRP C 1 88  ? -4.506  -11.222 52.240   1.00 89.15  ? 143  TRP C CH2 1 
ATOM   7340  N N   . LEU C 1 89  ? 1.314   -11.323 50.916   1.00 108.90 ? 144  LEU C N   1 
ATOM   7341  C CA  . LEU C 1 89  ? 1.289   -9.877  50.700   1.00 102.91 ? 144  LEU C CA  1 
ATOM   7342  C C   . LEU C 1 89  ? 2.209   -9.417  49.565   1.00 99.00  ? 144  LEU C C   1 
ATOM   7343  O O   . LEU C 1 89  ? 1.752   -8.784  48.613   1.00 95.89  ? 144  LEU C O   1 
ATOM   7344  C CB  . LEU C 1 89  ? 1.622   -9.136  51.991   1.00 94.90  ? 144  LEU C CB  1 
ATOM   7345  C CG  . LEU C 1 89  ? 0.528   -9.227  53.050   1.00 90.71  ? 144  LEU C CG  1 
ATOM   7346  C CD1 . LEU C 1 89  ? 0.967   -8.538  54.330   1.00 99.95  ? 144  LEU C CD1 1 
ATOM   7347  C CD2 . LEU C 1 89  ? -0.766  -8.626  52.524   1.00 84.52  ? 144  LEU C CD2 1 
ATOM   7348  N N   . SER C 1 90  ? 3.499   -9.731  49.665   1.00 97.23  ? 145  SER C N   1 
ATOM   7349  C CA  . SER C 1 90  ? 4.448   -9.344  48.622   1.00 97.95  ? 145  SER C CA  1 
ATOM   7350  C C   . SER C 1 90  ? 3.955   -9.777  47.240   1.00 99.03  ? 145  SER C C   1 
ATOM   7351  O O   . SER C 1 90  ? 3.943   -8.979  46.298   1.00 100.22 ? 145  SER C O   1 
ATOM   7352  C CB  . SER C 1 90  ? 5.836   -9.921  48.902   1.00 97.59  ? 145  SER C CB  1 
ATOM   7353  O OG  . SER C 1 90  ? 5.793   -11.332 48.969   1.00 106.54 ? 145  SER C OG  1 
ATOM   7354  N N   . ILE C 1 91  ? 3.552   -11.040 47.125   1.00 98.30  ? 146  ILE C N   1 
ATOM   7355  C CA  . ILE C 1 91  ? 2.975   -11.559 45.885   1.00 101.24 ? 146  ILE C CA  1 
ATOM   7356  C C   . ILE C 1 91  ? 1.825   -10.678 45.380   1.00 99.90  ? 146  ILE C C   1 
ATOM   7357  O O   . ILE C 1 91  ? 1.891   -10.106 44.282   1.00 96.30  ? 146  ILE C O   1 
ATOM   7358  C CB  . ILE C 1 91  ? 2.495   -13.023 46.038   1.00 96.90  ? 146  ILE C CB  1 
ATOM   7359  C CG1 . ILE C 1 91  ? 3.686   -13.982 46.067   1.00 89.80  ? 146  ILE C CG1 1 
ATOM   7360  C CG2 . ILE C 1 91  ? 1.580   -13.408 44.894   1.00 97.42  ? 146  ILE C CG2 1 
ATOM   7361  C CD1 . ILE C 1 91  ? 3.291   -15.441 45.943   1.00 89.10  ? 146  ILE C CD1 1 
ATOM   7362  N N   . ASP C 1 92  ? 0.770   -10.579 46.185   1.00 94.75  ? 147  ASP C N   1 
ATOM   7363  C CA  . ASP C 1 92  ? -0.407  -9.801  45.816   1.00 96.34  ? 147  ASP C CA  1 
ATOM   7364  C C   . ASP C 1 92  ? -0.055  -8.384  45.332   1.00 97.92  ? 147  ASP C C   1 
ATOM   7365  O O   . ASP C 1 92  ? -0.478  -7.965  44.251   1.00 90.77  ? 147  ASP C O   1 
ATOM   7366  C CB  . ASP C 1 92  ? -1.376  -9.727  46.998   1.00 99.28  ? 147  ASP C CB  1 
ATOM   7367  C CG  . ASP C 1 92  ? -2.783  -9.347  46.577   1.00 110.00 ? 147  ASP C CG  1 
ATOM   7368  O OD1 . ASP C 1 92  ? -3.741  -9.756  47.265   1.00 105.06 ? 147  ASP C OD1 1 
ATOM   7369  O OD2 . ASP C 1 92  ? -2.935  -8.645  45.554   1.00 112.82 ? 147  ASP C OD2 1 
ATOM   7370  N N   . TYR C 1 93  ? 0.721   -7.654  46.131   1.00 103.49 ? 148  TYR C N   1 
ATOM   7371  C CA  . TYR C 1 93  ? 1.075   -6.266  45.812   1.00 94.48  ? 148  TYR C CA  1 
ATOM   7372  C C   . TYR C 1 93  ? 1.944   -6.105  44.568   1.00 82.10  ? 148  TYR C C   1 
ATOM   7373  O O   . TYR C 1 93  ? 1.638   -5.284  43.695   1.00 80.24  ? 148  TYR C O   1 
ATOM   7374  C CB  . TYR C 1 93  ? 1.722   -5.577  47.018   1.00 93.23  ? 148  TYR C CB  1 
ATOM   7375  C CG  . TYR C 1 93  ? 0.699   -5.022  47.978   1.00 89.84  ? 148  TYR C CG  1 
ATOM   7376  C CD1 . TYR C 1 93  ? 0.021   -5.856  48.854   1.00 96.22  ? 148  TYR C CD1 1 
ATOM   7377  C CD2 . TYR C 1 93  ? 0.390   -3.669  47.987   1.00 91.01  ? 148  TYR C CD2 1 
ATOM   7378  C CE1 . TYR C 1 93  ? -0.928  -5.358  49.724   1.00 103.77 ? 148  TYR C CE1 1 
ATOM   7379  C CE2 . TYR C 1 93  ? -0.556  -3.159  48.854   1.00 98.17  ? 148  TYR C CE2 1 
ATOM   7380  C CZ  . TYR C 1 93  ? -1.215  -4.009  49.721   1.00 105.68 ? 148  TYR C CZ  1 
ATOM   7381  O OH  . TYR C 1 93  ? -2.164  -3.513  50.591   1.00 102.65 ? 148  TYR C OH  1 
ATOM   7382  N N   . VAL C 1 94  ? 3.022   -6.879  44.488   1.00 77.39  ? 149  VAL C N   1 
ATOM   7383  C CA  . VAL C 1 94  ? 3.872   -6.858  43.303   1.00 82.37  ? 149  VAL C CA  1 
ATOM   7384  C C   . VAL C 1 94  ? 3.052   -7.152  42.047   1.00 85.84  ? 149  VAL C C   1 
ATOM   7385  O O   . VAL C 1 94  ? 3.261   -6.537  40.998   1.00 89.42  ? 149  VAL C O   1 
ATOM   7386  C CB  . VAL C 1 94  ? 5.031   -7.867  43.414   1.00 82.40  ? 149  VAL C CB  1 
ATOM   7387  C CG1 . VAL C 1 94  ? 5.806   -7.938  42.103   1.00 72.58  ? 149  VAL C CG1 1 
ATOM   7388  C CG2 . VAL C 1 94  ? 5.952   -7.479  44.559   1.00 91.70  ? 149  VAL C CG2 1 
ATOM   7389  N N   . ALA C 1 95  ? 2.107   -8.081  42.165   1.00 80.43  ? 150  ALA C N   1 
ATOM   7390  C CA  . ALA C 1 95  ? 1.238   -8.430  41.043   1.00 82.80  ? 150  ALA C CA  1 
ATOM   7391  C C   . ALA C 1 95  ? 0.312   -7.279  40.630   1.00 82.57  ? 150  ALA C C   1 
ATOM   7392  O O   . ALA C 1 95  ? 0.282   -6.871  39.466   1.00 80.67  ? 150  ALA C O   1 
ATOM   7393  C CB  . ALA C 1 95  ? 0.430   -9.669  41.370   1.00 85.58  ? 150  ALA C CB  1 
ATOM   7394  N N   . SER C 1 96  ? -0.447  -6.766  41.591   1.00 79.34  ? 151  SER C N   1 
ATOM   7395  C CA  . SER C 1 96  ? -1.384  -5.680  41.332   1.00 75.17  ? 151  SER C CA  1 
ATOM   7396  C C   . SER C 1 96  ? -0.698  -4.465  40.717   1.00 73.02  ? 151  SER C C   1 
ATOM   7397  O O   . SER C 1 96  ? -1.111  -3.964  39.665   1.00 73.15  ? 151  SER C O   1 
ATOM   7398  C CB  . SER C 1 96  ? -2.087  -5.281  42.627   1.00 79.01  ? 151  SER C CB  1 
ATOM   7399  O OG  . SER C 1 96  ? -1.192  -5.329  43.725   1.00 78.14  ? 151  SER C OG  1 
ATOM   7400  N N   . ASN C 1 97  ? 0.349   -3.983  41.379   1.00 76.29  ? 152  ASN C N   1 
ATOM   7401  C CA  . ASN C 1 97  ? 1.066   -2.826  40.861   1.00 79.17  ? 152  ASN C CA  1 
ATOM   7402  C C   . ASN C 1 97  ? 1.697   -3.129  39.509   1.00 84.47  ? 152  ASN C C   1 
ATOM   7403  O O   . ASN C 1 97  ? 1.677   -2.291  38.602   1.00 89.49  ? 152  ASN C O   1 
ATOM   7404  C CB  . ASN C 1 97  ? 2.122   -2.328  41.846   1.00 78.06  ? 152  ASN C CB  1 
ATOM   7405  C CG  . ASN C 1 97  ? 2.738   -1.014  41.412   1.00 78.35  ? 152  ASN C CG  1 
ATOM   7406  O OD1 . ASN C 1 97  ? 2.225   0.063   41.725   1.00 76.57  ? 152  ASN C OD1 1 
ATOM   7407  N ND2 . ASN C 1 97  ? 3.838   -1.095  40.675   1.00 68.93  ? 152  ASN C ND2 1 
ATOM   7408  N N   . ALA C 1 98  ? 2.251   -4.328  39.368   1.00 79.14  ? 153  ALA C N   1 
ATOM   7409  C CA  . ALA C 1 98  ? 2.752   -4.751  38.068   1.00 77.65  ? 153  ALA C CA  1 
ATOM   7410  C C   . ALA C 1 98  ? 1.652   -4.550  37.025   1.00 78.28  ? 153  ALA C C   1 
ATOM   7411  O O   . ALA C 1 98  ? 1.922   -4.156  35.891   1.00 77.14  ? 153  ALA C O   1 
ATOM   7412  C CB  . ALA C 1 98  ? 3.195   -6.202  38.112   1.00 77.73  ? 153  ALA C CB  1 
ATOM   7413  N N   . SER C 1 99  ? 0.409   -4.805  37.427   1.00 78.21  ? 154  SER C N   1 
ATOM   7414  C CA  . SER C 1 99  ? -0.740  -4.664  36.533   1.00 78.51  ? 154  SER C CA  1 
ATOM   7415  C C   . SER C 1 99  ? -1.034  -3.201  36.179   1.00 77.39  ? 154  SER C C   1 
ATOM   7416  O O   . SER C 1 99  ? -1.244  -2.864  35.004   1.00 79.39  ? 154  SER C O   1 
ATOM   7417  C CB  . SER C 1 99  ? -1.974  -5.344  37.135   1.00 76.86  ? 154  SER C CB  1 
ATOM   7418  O OG  . SER C 1 99  ? -3.059  -5.345  36.228   1.00 71.88  ? 154  SER C OG  1 
ATOM   7419  N N   . VAL C 1 100 ? -1.054  -2.327  37.181   1.00 73.84  ? 155  VAL C N   1 
ATOM   7420  C CA  . VAL C 1 100 ? -1.268  -0.912  36.884   1.00 67.97  ? 155  VAL C CA  1 
ATOM   7421  C C   . VAL C 1 100 ? -0.196  -0.412  35.912   1.00 69.74  ? 155  VAL C C   1 
ATOM   7422  O O   . VAL C 1 100 ? -0.509  0.187   34.873   1.00 73.03  ? 155  VAL C O   1 
ATOM   7423  C CB  . VAL C 1 100 ? -1.315  -0.025  38.155   1.00 66.60  ? 155  VAL C CB  1 
ATOM   7424  C CG1 . VAL C 1 100 ? -2.325  -0.567  39.144   1.00 74.75  ? 155  VAL C CG1 1 
ATOM   7425  C CG2 . VAL C 1 100 ? 0.046   0.074   38.809   1.00 77.76  ? 155  VAL C CG2 1 
ATOM   7426  N N   . MET C 1 101 ? 1.066   -0.682  36.240   1.00 72.46  ? 156  MET C N   1 
ATOM   7427  C CA  . MET C 1 101 ? 2.178   -0.305  35.373   1.00 72.33  ? 156  MET C CA  1 
ATOM   7428  C C   . MET C 1 101 ? 1.952   -0.863  33.981   1.00 73.68  ? 156  MET C C   1 
ATOM   7429  O O   . MET C 1 101 ? 2.244   -0.211  32.981   1.00 71.24  ? 156  MET C O   1 
ATOM   7430  C CB  . MET C 1 101 ? 3.511   -0.819  35.923   1.00 69.21  ? 156  MET C CB  1 
ATOM   7431  C CG  . MET C 1 101 ? 4.028   -0.068  37.137   1.00 77.59  ? 156  MET C CG  1 
ATOM   7432  S SD  . MET C 1 101 ? 5.691   -0.586  37.602   1.00 101.25 ? 156  MET C SD  1 
ATOM   7433  C CE  . MET C 1 101 ? 6.608   -0.154  36.127   1.00 74.36  ? 156  MET C CE  1 
ATOM   7434  N N   . ASN C 1 102 ? 1.430   -2.081  33.926   1.00 78.77  ? 157  ASN C N   1 
ATOM   7435  C CA  . ASN C 1 102 ? 1.126   -2.727  32.659   1.00 78.53  ? 157  ASN C CA  1 
ATOM   7436  C C   . ASN C 1 102 ? 0.183   -1.863  31.823   1.00 81.15  ? 157  ASN C C   1 
ATOM   7437  O O   . ASN C 1 102 ? 0.418   -1.631  30.626   1.00 83.19  ? 157  ASN C O   1 
ATOM   7438  C CB  . ASN C 1 102 ? 0.508   -4.096  32.916   1.00 78.34  ? 157  ASN C CB  1 
ATOM   7439  C CG  . ASN C 1 102 ? 0.694   -5.039  31.761   1.00 83.11  ? 157  ASN C CG  1 
ATOM   7440  O OD1 . ASN C 1 102 ? 0.108   -4.852  30.694   1.00 86.26  ? 157  ASN C OD1 1 
ATOM   7441  N ND2 . ASN C 1 102 ? 1.508   -6.070  31.965   1.00 83.75  ? 157  ASN C ND2 1 
ATOM   7442  N N   . LEU C 1 103 ? -0.877  -1.373  32.465   1.00 81.68  ? 158  LEU C N   1 
ATOM   7443  C CA  . LEU C 1 103 ? -1.808  -0.452  31.809   1.00 80.43  ? 158  LEU C CA  1 
ATOM   7444  C C   . LEU C 1 103 ? -1.087  0.800   31.308   1.00 75.29  ? 158  LEU C C   1 
ATOM   7445  O O   . LEU C 1 103 ? -1.325  1.273   30.182   1.00 72.14  ? 158  LEU C O   1 
ATOM   7446  C CB  . LEU C 1 103 ? -2.930  -0.062  32.765   1.00 72.89  ? 158  LEU C CB  1 
ATOM   7447  C CG  . LEU C 1 103 ? -3.665  -1.275  33.321   1.00 78.01  ? 158  LEU C CG  1 
ATOM   7448  C CD1 . LEU C 1 103 ? -4.880  -0.853  34.126   1.00 81.61  ? 158  LEU C CD1 1 
ATOM   7449  C CD2 . LEU C 1 103 ? -4.067  -2.186  32.177   1.00 73.21  ? 158  LEU C CD2 1 
ATOM   7450  N N   . LEU C 1 104 ? -0.199  1.325   32.148   1.00 70.50  ? 159  LEU C N   1 
ATOM   7451  C CA  . LEU C 1 104 ? 0.645   2.450   31.758   1.00 67.11  ? 159  LEU C CA  1 
ATOM   7452  C C   . LEU C 1 104 ? 1.382   2.172   30.445   1.00 67.05  ? 159  LEU C C   1 
ATOM   7453  O O   . LEU C 1 104 ? 1.353   2.985   29.514   1.00 70.19  ? 159  LEU C O   1 
ATOM   7454  C CB  . LEU C 1 104 ? 1.644   2.770   32.875   1.00 67.39  ? 159  LEU C CB  1 
ATOM   7455  C CG  . LEU C 1 104 ? 1.031   3.296   34.176   1.00 70.31  ? 159  LEU C CG  1 
ATOM   7456  C CD1 . LEU C 1 104 ? 2.054   3.319   35.313   1.00 62.82  ? 159  LEU C CD1 1 
ATOM   7457  C CD2 . LEU C 1 104 ? 0.425   4.674   33.947   1.00 68.52  ? 159  LEU C CD2 1 
ATOM   7458  N N   . VAL C 1 105 ? 2.035   1.016   30.379   1.00 63.54  ? 160  VAL C N   1 
ATOM   7459  C CA  . VAL C 1 105 ? 2.786   0.619   29.194   1.00 65.82  ? 160  VAL C CA  1 
ATOM   7460  C C   . VAL C 1 105 ? 1.882   0.550   27.975   1.00 63.96  ? 160  VAL C C   1 
ATOM   7461  O O   . VAL C 1 105 ? 2.245   1.006   26.898   1.00 62.36  ? 160  VAL C O   1 
ATOM   7462  C CB  . VAL C 1 105 ? 3.463   -0.749  29.380   1.00 72.60  ? 160  VAL C CB  1 
ATOM   7463  C CG1 . VAL C 1 105 ? 4.259   -1.125  28.134   1.00 77.86  ? 160  VAL C CG1 1 
ATOM   7464  C CG2 . VAL C 1 105 ? 4.359   -0.728  30.605   1.00 75.15  ? 160  VAL C CG2 1 
ATOM   7465  N N   . ILE C 1 106 ? 0.702   -0.032  28.139   1.00 63.22  ? 161  ILE C N   1 
ATOM   7466  C CA  . ILE C 1 106 ? -0.246  -0.072  27.035   1.00 64.59  ? 161  ILE C CA  1 
ATOM   7467  C C   . ILE C 1 106 ? -0.534  1.338   26.504   1.00 63.10  ? 161  ILE C C   1 
ATOM   7468  O O   . ILE C 1 106 ? -0.209  1.664   25.349   1.00 59.51  ? 161  ILE C O   1 
ATOM   7469  C CB  . ILE C 1 106 ? -1.541  -0.792  27.445   1.00 66.32  ? 161  ILE C CB  1 
ATOM   7470  C CG1 . ILE C 1 106 ? -1.220  -2.226  27.872   1.00 64.33  ? 161  ILE C CG1 1 
ATOM   7471  C CG2 . ILE C 1 106 ? -2.539  -0.793  26.303   1.00 70.91  ? 161  ILE C CG2 1 
ATOM   7472  C CD1 . ILE C 1 106 ? -2.436  -3.069  28.126   1.00 76.33  ? 161  ILE C CD1 1 
ATOM   7473  N N   . SER C 1 107 ? -1.130  2.173   27.356   1.00 63.67  ? 162  SER C N   1 
ATOM   7474  C CA  . SER C 1 107 ? -1.521  3.527   26.956   1.00 62.11  ? 162  SER C CA  1 
ATOM   7475  C C   . SER C 1 107 ? -0.381  4.303   26.306   1.00 72.20  ? 162  SER C C   1 
ATOM   7476  O O   . SER C 1 107 ? -0.507  4.793   25.174   1.00 74.72  ? 162  SER C O   1 
ATOM   7477  C CB  . SER C 1 107 ? -2.023  4.312   28.164   1.00 62.53  ? 162  SER C CB  1 
ATOM   7478  O OG  . SER C 1 107 ? -3.037  3.595   28.841   1.00 70.78  ? 162  SER C OG  1 
ATOM   7479  N N   . PHE C 1 108 ? 0.731   4.417   27.030   1.00 76.92  ? 163  PHE C N   1 
ATOM   7480  C CA  . PHE C 1 108 ? 1.905   5.117   26.518   1.00 74.84  ? 163  PHE C CA  1 
ATOM   7481  C C   . PHE C 1 108 ? 2.326   4.542   25.170   1.00 76.40  ? 163  PHE C C   1 
ATOM   7482  O O   . PHE C 1 108 ? 2.663   5.281   24.245   1.00 72.23  ? 163  PHE C O   1 
ATOM   7483  C CB  . PHE C 1 108 ? 3.064   5.028   27.512   1.00 62.25  ? 163  PHE C CB  1 
ATOM   7484  C CG  . PHE C 1 108 ? 3.295   6.290   28.284   1.00 58.70  ? 163  PHE C CG  1 
ATOM   7485  C CD1 . PHE C 1 108 ? 2.960   6.369   29.619   1.00 62.39  ? 163  PHE C CD1 1 
ATOM   7486  C CD2 . PHE C 1 108 ? 3.847   7.399   27.671   1.00 64.54  ? 163  PHE C CD2 1 
ATOM   7487  C CE1 . PHE C 1 108 ? 3.179   7.530   30.337   1.00 65.10  ? 163  PHE C CE1 1 
ATOM   7488  C CE2 . PHE C 1 108 ? 4.064   8.565   28.382   1.00 70.80  ? 163  PHE C CE2 1 
ATOM   7489  C CZ  . PHE C 1 108 ? 3.731   8.629   29.717   1.00 67.30  ? 163  PHE C CZ  1 
ATOM   7490  N N   . ASP C 1 109 ? 2.310   3.215   25.084   1.00 77.38  ? 164  ASP C N   1 
ATOM   7491  C CA  . ASP C 1 109 ? 2.614   2.499   23.853   1.00 76.00  ? 164  ASP C CA  1 
ATOM   7492  C C   . ASP C 1 109 ? 1.829   3.099   22.700   1.00 78.61  ? 164  ASP C C   1 
ATOM   7493  O O   . ASP C 1 109 ? 2.401   3.713   21.788   1.00 74.98  ? 164  ASP C O   1 
ATOM   7494  C CB  . ASP C 1 109 ? 2.279   1.011   24.001   1.00 72.45  ? 164  ASP C CB  1 
ATOM   7495  C CG  . ASP C 1 109 ? 2.025   0.331   22.664   1.00 76.79  ? 164  ASP C CG  1 
ATOM   7496  O OD1 . ASP C 1 109 ? 3.010   -0.013  21.977   1.00 74.65  ? 164  ASP C OD1 1 
ATOM   7497  O OD2 . ASP C 1 109 ? 0.841   0.129   22.307   1.00 75.60  ? 164  ASP C OD2 1 
ATOM   7498  N N   . ARG C 1 110 ? 0.511   2.941   22.747   1.00 75.13  ? 165  ARG C N   1 
ATOM   7499  C CA  . ARG C 1 110 ? -0.298  3.419   21.636   1.00 68.96  ? 165  ARG C CA  1 
ATOM   7500  C C   . ARG C 1 110 ? -0.113  4.912   21.363   1.00 72.90  ? 165  ARG C C   1 
ATOM   7501  O O   . ARG C 1 110 ? -0.049  5.328   20.200   1.00 79.66  ? 165  ARG C O   1 
ATOM   7502  C CB  . ARG C 1 110 ? -1.764  3.059   21.830   1.00 68.73  ? 165  ARG C CB  1 
ATOM   7503  C CG  . ARG C 1 110 ? -2.056  1.613   21.478   1.00 78.08  ? 165  ARG C CG  1 
ATOM   7504  C CD  . ARG C 1 110 ? -3.541  1.325   21.559   1.00 91.23  ? 165  ARG C CD  1 
ATOM   7505  N NE  . ARG C 1 110 ? -3.866  -0.030  21.128   1.00 95.51  ? 165  ARG C NE  1 
ATOM   7506  C CZ  . ARG C 1 110 ? -3.728  -1.110  21.888   1.00 94.47  ? 165  ARG C CZ  1 
ATOM   7507  N NH1 . ARG C 1 110 ? -3.257  -1.002  23.123   1.00 87.27  ? 165  ARG C NH1 1 
ATOM   7508  N NH2 . ARG C 1 110 ? -4.057  -2.301  21.411   1.00 104.74 ? 165  ARG C NH2 1 
ATOM   7509  N N   . TYR C 1 111 ? -0.001  5.711   22.422   1.00 72.14  ? 166  TYR C N   1 
ATOM   7510  C CA  . TYR C 1 111 ? 0.207   7.150   22.254   1.00 70.16  ? 166  TYR C CA  1 
ATOM   7511  C C   . TYR C 1 111 ? 1.489   7.454   21.478   1.00 73.59  ? 166  TYR C C   1 
ATOM   7512  O O   . TYR C 1 111 ? 1.525   8.379   20.661   1.00 76.68  ? 166  TYR C O   1 
ATOM   7513  C CB  . TYR C 1 111 ? 0.225   7.866   23.601   1.00 70.66  ? 166  TYR C CB  1 
ATOM   7514  C CG  . TYR C 1 111 ? 0.565   9.339   23.507   1.00 77.21  ? 166  TYR C CG  1 
ATOM   7515  C CD1 . TYR C 1 111 ? -0.418  10.287  23.243   1.00 78.12  ? 166  TYR C CD1 1 
ATOM   7516  C CD2 . TYR C 1 111 ? 1.870   9.783   23.693   1.00 77.89  ? 166  TYR C CD2 1 
ATOM   7517  C CE1 . TYR C 1 111 ? -0.110  11.639  23.163   1.00 76.74  ? 166  TYR C CE1 1 
ATOM   7518  C CE2 . TYR C 1 111 ? 2.188   11.130  23.615   1.00 76.27  ? 166  TYR C CE2 1 
ATOM   7519  C CZ  . TYR C 1 111 ? 1.195   12.052  23.350   1.00 79.70  ? 166  TYR C CZ  1 
ATOM   7520  O OH  . TYR C 1 111 ? 1.508   13.390  23.274   1.00 73.45  ? 166  TYR C OH  1 
ATOM   7521  N N   . PHE C 1 112 ? 2.536   6.675   21.732   1.00 68.46  ? 167  PHE C N   1 
ATOM   7522  C CA  . PHE C 1 112 ? 3.796   6.842   21.017   1.00 70.10  ? 167  PHE C CA  1 
ATOM   7523  C C   . PHE C 1 112 ? 3.684   6.354   19.588   1.00 69.03  ? 167  PHE C C   1 
ATOM   7524  O O   . PHE C 1 112 ? 4.314   6.903   18.685   1.00 68.09  ? 167  PHE C O   1 
ATOM   7525  C CB  . PHE C 1 112 ? 4.920   6.105   21.727   1.00 74.79  ? 167  PHE C CB  1 
ATOM   7526  C CG  . PHE C 1 112 ? 5.476   6.854   22.885   1.00 75.75  ? 167  PHE C CG  1 
ATOM   7527  C CD1 . PHE C 1 112 ? 5.332   8.224   22.958   1.00 82.11  ? 167  PHE C CD1 1 
ATOM   7528  C CD2 . PHE C 1 112 ? 6.137   6.195   23.905   1.00 73.82  ? 167  PHE C CD2 1 
ATOM   7529  C CE1 . PHE C 1 112 ? 5.838   8.927   24.025   1.00 87.09  ? 167  PHE C CE1 1 
ATOM   7530  C CE2 . PHE C 1 112 ? 6.646   6.892   24.976   1.00 68.11  ? 167  PHE C CE2 1 
ATOM   7531  C CZ  . PHE C 1 112 ? 6.497   8.261   25.037   1.00 76.23  ? 167  PHE C CZ  1 
ATOM   7532  N N   . SER C 1 113 ? 2.891   5.306   19.392   1.00 66.20  ? 168  SER C N   1 
ATOM   7533  C CA  . SER C 1 113 ? 2.597   4.832   18.051   1.00 66.53  ? 168  SER C CA  1 
ATOM   7534  C C   . SER C 1 113 ? 2.033   5.989   17.229   1.00 65.83  ? 168  SER C C   1 
ATOM   7535  O O   . SER C 1 113 ? 2.511   6.272   16.130   1.00 60.93  ? 168  SER C O   1 
ATOM   7536  C CB  . SER C 1 113 ? 1.604   3.672   18.106   1.00 66.84  ? 168  SER C CB  1 
ATOM   7537  O OG  . SER C 1 113 ? 2.026   2.698   19.046   1.00 64.75  ? 168  SER C OG  1 
ATOM   7538  N N   . ILE C 1 114 ? 1.016   6.662   17.765   1.00 70.73  ? 169  ILE C N   1 
ATOM   7539  C CA  . ILE C 1 114 ? 0.484   7.860   17.108   1.00 65.06  ? 169  ILE C CA  1 
ATOM   7540  C C   . ILE C 1 114 ? 1.544   8.958   16.920   1.00 64.60  ? 169  ILE C C   1 
ATOM   7541  O O   . ILE C 1 114 ? 1.915   9.276   15.790   1.00 70.93  ? 169  ILE C O   1 
ATOM   7542  C CB  . ILE C 1 114 ? -0.765  8.438   17.827   1.00 60.06  ? 169  ILE C CB  1 
ATOM   7543  C CG1 . ILE C 1 114 ? -2.026  7.641   17.471   1.00 59.95  ? 169  ILE C CG1 1 
ATOM   7544  C CG2 . ILE C 1 114 ? -0.975  9.895   17.440   1.00 55.04  ? 169  ILE C CG2 1 
ATOM   7545  C CD1 . ILE C 1 114 ? -2.120  6.278   18.115   1.00 55.61  ? 169  ILE C CD1 1 
ATOM   7546  N N   . THR C 1 115 ? 2.038   9.523   18.019   1.00 61.83  ? 170  THR C N   1 
ATOM   7547  C CA  . THR C 1 115 ? 2.899   10.709  17.949   1.00 63.21  ? 170  THR C CA  1 
ATOM   7548  C C   . THR C 1 115 ? 4.291   10.506  17.336   1.00 70.29  ? 170  THR C C   1 
ATOM   7549  O O   . THR C 1 115 ? 4.885   11.457  16.826   1.00 66.71  ? 170  THR C O   1 
ATOM   7550  C CB  . THR C 1 115 ? 3.068   11.364  19.331   1.00 61.84  ? 170  THR C CB  1 
ATOM   7551  O OG1 . THR C 1 115 ? 3.716   10.447  20.221   1.00 67.77  ? 170  THR C OG1 1 
ATOM   7552  C CG2 . THR C 1 115 ? 1.719   11.755  19.899   1.00 62.10  ? 170  THR C CG2 1 
ATOM   7553  N N   . ARG C 1 116 ? 4.812   9.283   17.395   1.00 76.16  ? 171  ARG C N   1 
ATOM   7554  C CA  . ARG C 1 116 ? 6.157   8.996   16.889   1.00 76.31  ? 171  ARG C CA  1 
ATOM   7555  C C   . ARG C 1 116 ? 6.176   7.806   15.926   1.00 74.23  ? 171  ARG C C   1 
ATOM   7556  O O   . ARG C 1 116 ? 6.627   6.719   16.289   1.00 76.74  ? 171  ARG C O   1 
ATOM   7557  C CB  . ARG C 1 116 ? 7.120   8.748   18.056   1.00 75.07  ? 171  ARG C CB  1 
ATOM   7558  C CG  . ARG C 1 116 ? 7.035   9.801   19.146   1.00 80.08  ? 171  ARG C CG  1 
ATOM   7559  C CD  . ARG C 1 116 ? 8.112   9.618   20.205   1.00 91.70  ? 171  ARG C CD  1 
ATOM   7560  N NE  . ARG C 1 116 ? 8.198   10.777  21.095   1.00 103.80 ? 171  ARG C NE  1 
ATOM   7561  C CZ  . ARG C 1 116 ? 9.162   10.967  21.994   1.00 101.43 ? 171  ARG C CZ  1 
ATOM   7562  N NH1 . ARG C 1 116 ? 10.136  10.074  22.129   1.00 103.74 ? 171  ARG C NH1 1 
ATOM   7563  N NH2 . ARG C 1 116 ? 9.156   12.054  22.756   1.00 85.93  ? 171  ARG C NH2 1 
ATOM   7564  N N   . PRO C 1 117 ? 5.702   8.017   14.687   1.00 69.15  ? 172  PRO C N   1 
ATOM   7565  C CA  . PRO C 1 117 ? 5.519   6.936   13.711   1.00 71.45  ? 172  PRO C CA  1 
ATOM   7566  C C   . PRO C 1 117 ? 6.842   6.325   13.271   1.00 69.39  ? 172  PRO C C   1 
ATOM   7567  O O   . PRO C 1 117 ? 6.950   5.113   13.069   1.00 63.90  ? 172  PRO C O   1 
ATOM   7568  C CB  . PRO C 1 117 ? 4.866   7.647   12.522   1.00 75.45  ? 172  PRO C CB  1 
ATOM   7569  C CG  . PRO C 1 117 ? 4.423   8.989   13.035   1.00 68.94  ? 172  PRO C CG  1 
ATOM   7570  C CD  . PRO C 1 117 ? 5.376   9.333   14.117   1.00 67.13  ? 172  PRO C CD  1 
ATOM   7571  N N   . LEU C 1 118 ? 7.842   7.184   13.129   1.00 76.42  ? 173  LEU C N   1 
ATOM   7572  C CA  . LEU C 1 118 ? 9.169   6.788   12.688   1.00 75.31  ? 173  LEU C CA  1 
ATOM   7573  C C   . LEU C 1 118 ? 9.936   6.095   13.801   1.00 72.81  ? 173  LEU C C   1 
ATOM   7574  O O   . LEU C 1 118 ? 10.237  4.905   13.723   1.00 65.83  ? 173  LEU C O   1 
ATOM   7575  C CB  . LEU C 1 118 ? 9.957   8.026   12.262   1.00 70.55  ? 173  LEU C CB  1 
ATOM   7576  C CG  . LEU C 1 118 ? 10.224  8.258   10.778   1.00 72.62  ? 173  LEU C CG  1 
ATOM   7577  C CD1 . LEU C 1 118 ? 8.936   8.266   9.974    1.00 70.51  ? 173  LEU C CD1 1 
ATOM   7578  C CD2 . LEU C 1 118 ? 10.978  9.563   10.616   1.00 76.78  ? 173  LEU C CD2 1 
ATOM   7579  N N   . THR C 1 119 ? 10.245  6.862   14.840   1.00 77.76  ? 174  THR C N   1 
ATOM   7580  C CA  . THR C 1 119 ? 11.144  6.417   15.897   1.00 83.17  ? 174  THR C CA  1 
ATOM   7581  C C   . THR C 1 119 ? 10.522  5.371   16.827   1.00 78.94  ? 174  THR C C   1 
ATOM   7582  O O   . THR C 1 119 ? 11.211  4.807   17.673   1.00 83.62  ? 174  THR C O   1 
ATOM   7583  C CB  . THR C 1 119 ? 11.654  7.616   16.734   1.00 83.27  ? 174  THR C CB  1 
ATOM   7584  O OG1 . THR C 1 119 ? 11.811  8.760   15.886   1.00 70.42  ? 174  THR C OG1 1 
ATOM   7585  C CG2 . THR C 1 119 ? 12.992  7.286   17.389   1.00 81.95  ? 174  THR C CG2 1 
ATOM   7586  N N   . TYR C 1 120 ? 9.226   5.115   16.683   1.00 71.98  ? 175  TYR C N   1 
ATOM   7587  C CA  . TYR C 1 120 ? 8.580   4.117   17.526   1.00 67.85  ? 175  TYR C CA  1 
ATOM   7588  C C   . TYR C 1 120 ? 7.745   3.086   16.772   1.00 75.29  ? 175  TYR C C   1 
ATOM   7589  O O   . TYR C 1 120 ? 8.053   1.897   16.806   1.00 80.75  ? 175  TYR C O   1 
ATOM   7590  C CB  . TYR C 1 120 ? 7.743   4.773   18.619   1.00 74.53  ? 175  TYR C CB  1 
ATOM   7591  C CG  . TYR C 1 120 ? 7.155   3.771   19.585   1.00 78.93  ? 175  TYR C CG  1 
ATOM   7592  C CD1 . TYR C 1 120 ? 7.898   3.298   20.662   1.00 79.11  ? 175  TYR C CD1 1 
ATOM   7593  C CD2 . TYR C 1 120 ? 5.861   3.292   19.418   1.00 72.71  ? 175  TYR C CD2 1 
ATOM   7594  C CE1 . TYR C 1 120 ? 7.368   2.379   21.548   1.00 66.75  ? 175  TYR C CE1 1 
ATOM   7595  C CE2 . TYR C 1 120 ? 5.323   2.374   20.300   1.00 72.98  ? 175  TYR C CE2 1 
ATOM   7596  C CZ  . TYR C 1 120 ? 6.082   1.922   21.362   1.00 71.42  ? 175  TYR C CZ  1 
ATOM   7597  O OH  . TYR C 1 120 ? 5.547   1.011   22.240   1.00 69.82  ? 175  TYR C OH  1 
ATOM   7598  N N   . ARG C 1 121 ? 6.680   3.540   16.114   1.00 76.65  ? 176  ARG C N   1 
ATOM   7599  C CA  . ARG C 1 121 ? 5.740   2.626   15.464   1.00 79.12  ? 176  ARG C CA  1 
ATOM   7600  C C   . ARG C 1 121 ? 6.472   1.588   14.625   1.00 81.63  ? 176  ARG C C   1 
ATOM   7601  O O   . ARG C 1 121 ? 6.146   0.403   14.669   1.00 85.01  ? 176  ARG C O   1 
ATOM   7602  C CB  . ARG C 1 121 ? 4.733   3.386   14.595   1.00 81.18  ? 176  ARG C CB  1 
ATOM   7603  C CG  . ARG C 1 121 ? 3.326   2.789   14.613   1.00 85.56  ? 176  ARG C CG  1 
ATOM   7604  C CD  . ARG C 1 121 ? 2.433   3.365   13.519   1.00 84.91  ? 176  ARG C CD  1 
ATOM   7605  N NE  . ARG C 1 121 ? 2.598   2.661   12.249   1.00 94.02  ? 176  ARG C NE  1 
ATOM   7606  C CZ  . ARG C 1 121 ? 1.847   1.635   11.855   1.00 91.00  ? 176  ARG C CZ  1 
ATOM   7607  N NH1 . ARG C 1 121 ? 2.077   1.057   10.683   1.00 92.02  ? 176  ARG C NH1 1 
ATOM   7608  N NH2 . ARG C 1 121 ? 0.868   1.185   12.629   1.00 85.00  ? 176  ARG C NH2 1 
ATOM   7609  N N   . ALA C 1 122 ? 7.475   2.038   13.876   1.00 83.74  ? 177  ALA C N   1 
ATOM   7610  C CA  . ALA C 1 122 ? 8.308   1.147   13.074   1.00 88.40  ? 177  ALA C CA  1 
ATOM   7611  C C   . ALA C 1 122 ? 9.149   0.187   13.929   1.00 86.40  ? 177  ALA C C   1 
ATOM   7612  O O   . ALA C 1 122 ? 9.190   -1.018  13.667   1.00 76.41  ? 177  ALA C O   1 
ATOM   7613  C CB  . ALA C 1 122 ? 9.211   1.966   12.153   1.00 85.94  ? 177  ALA C CB  1 
ATOM   7614  N N   . LYS C 1 123 ? 9.810   0.729   14.950   1.00 90.58  ? 178  LYS C N   1 
ATOM   7615  C CA  . LYS C 1 123 ? 10.740  -0.039  15.780   1.00 86.23  ? 178  LYS C CA  1 
ATOM   7616  C C   . LYS C 1 123 ? 10.075  -1.022  16.747   1.00 94.96  ? 178  LYS C C   1 
ATOM   7617  O O   . LYS C 1 123 ? 10.761  -1.831  17.375   1.00 101.54 ? 178  LYS C O   1 
ATOM   7618  C CB  . LYS C 1 123 ? 11.657  0.902   16.567   1.00 79.03  ? 178  LYS C CB  1 
ATOM   7619  C CG  . LYS C 1 123 ? 12.664  1.650   15.717   1.00 81.01  ? 178  LYS C CG  1 
ATOM   7620  C CD  . LYS C 1 123 ? 13.558  2.518   16.584   1.00 85.99  ? 178  LYS C CD  1 
ATOM   7621  C CE  . LYS C 1 123 ? 14.537  3.326   15.748   1.00 93.68  ? 178  LYS C CE  1 
ATOM   7622  N NZ  . LYS C 1 123 ? 15.340  4.251   16.597   1.00 94.15  ? 178  LYS C NZ  1 
ATOM   7623  N N   . ARG C 1 124 ? 8.752   -0.956  16.870   1.00 94.50  ? 179  ARG C N   1 
ATOM   7624  C CA  . ARG C 1 124 ? 8.043   -1.800  17.831   1.00 92.29  ? 179  ARG C CA  1 
ATOM   7625  C C   . ARG C 1 124 ? 8.015   -3.266  17.406   1.00 86.22  ? 179  ARG C C   1 
ATOM   7626  O O   . ARG C 1 124 ? 7.659   -3.590  16.274   1.00 84.57  ? 179  ARG C O   1 
ATOM   7627  C CB  . ARG C 1 124 ? 6.625   -1.278  18.089   1.00 85.36  ? 179  ARG C CB  1 
ATOM   7628  C CG  . ARG C 1 124 ? 5.654   -1.477  16.942   1.00 87.00  ? 179  ARG C CG  1 
ATOM   7629  C CD  . ARG C 1 124 ? 4.297   -0.854  17.249   1.00 88.41  ? 179  ARG C CD  1 
ATOM   7630  N NE  . ARG C 1 124 ? 3.687   -1.401  18.460   1.00 83.32  ? 179  ARG C NE  1 
ATOM   7631  C CZ  . ARG C 1 124 ? 2.471   -1.080  18.891   1.00 83.83  ? 179  ARG C CZ  1 
ATOM   7632  N NH1 . ARG C 1 124 ? 1.733   -0.215  18.210   1.00 92.31  ? 179  ARG C NH1 1 
ATOM   7633  N NH2 . ARG C 1 124 ? 1.988   -1.621  20.000   1.00 83.98  ? 179  ARG C NH2 1 
ATOM   7634  N N   . THR C 1 125 ? 8.404   -4.144  18.325   1.00 87.13  ? 180  THR C N   1 
ATOM   7635  C CA  . THR C 1 125 ? 8.449   -5.576  18.064   1.00 90.07  ? 180  THR C CA  1 
ATOM   7636  C C   . THR C 1 125 ? 7.926   -6.342  19.269   1.00 95.80  ? 180  THR C C   1 
ATOM   7637  O O   . THR C 1 125 ? 7.709   -5.763  20.332   1.00 98.36  ? 180  THR C O   1 
ATOM   7638  C CB  . THR C 1 125 ? 9.879   -6.052  17.757   1.00 85.56  ? 180  THR C CB  1 
ATOM   7639  O OG1 . THR C 1 125 ? 10.705  -5.879  18.914   1.00 86.00  ? 180  THR C OG1 1 
ATOM   7640  C CG2 . THR C 1 125 ? 10.465  -5.264  16.601   1.00 87.68  ? 180  THR C CG2 1 
ATOM   7641  N N   . THR C 1 126 ? 7.703   -7.640  19.098   1.00 94.99  ? 181  THR C N   1 
ATOM   7642  C CA  . THR C 1 126 ? 7.305   -8.486  20.217   1.00 103.55 ? 181  THR C CA  1 
ATOM   7643  C C   . THR C 1 126 ? 8.435   -8.540  21.248   1.00 102.61 ? 181  THR C C   1 
ATOM   7644  O O   . THR C 1 126 ? 8.197   -8.693  22.452   1.00 97.57  ? 181  THR C O   1 
ATOM   7645  C CB  . THR C 1 126 ? 6.939   -9.909  19.752   1.00 107.20 ? 181  THR C CB  1 
ATOM   7646  O OG1 . THR C 1 126 ? 7.983   -10.427 18.917   1.00 105.61 ? 181  THR C OG1 1 
ATOM   7647  C CG2 . THR C 1 126 ? 5.642   -9.892  18.963   1.00 106.07 ? 181  THR C CG2 1 
ATOM   7648  N N   . LYS C 1 127 ? 9.665   -8.400  20.759   1.00 103.09 ? 182  LYS C N   1 
ATOM   7649  C CA  . LYS C 1 127 ? 10.845  -8.370  21.617   1.00 101.04 ? 182  LYS C CA  1 
ATOM   7650  C C   . LYS C 1 127 ? 10.758  -7.212  22.602   1.00 101.67 ? 182  LYS C C   1 
ATOM   7651  O O   . LYS C 1 127 ? 10.829  -7.403  23.819   1.00 102.25 ? 182  LYS C O   1 
ATOM   7652  C CB  . LYS C 1 127 ? 12.113  -8.239  20.769   1.00 88.76  ? 182  LYS C CB  1 
ATOM   7653  N N   . ARG C 1 128 ? 10.596  -6.009  22.059   1.00 105.33 ? 183  ARG C N   1 
ATOM   7654  C CA  . ARG C 1 128 ? 10.436  -4.806  22.865   1.00 105.73 ? 183  ARG C CA  1 
ATOM   7655  C C   . ARG C 1 128 ? 9.378   -5.027  23.940   1.00 100.63 ? 183  ARG C C   1 
ATOM   7656  O O   . ARG C 1 128 ? 9.528   -4.566  25.070   1.00 101.19 ? 183  ARG C O   1 
ATOM   7657  C CB  . ARG C 1 128 ? 10.047  -3.618  21.977   1.00 104.77 ? 183  ARG C CB  1 
ATOM   7658  C CG  . ARG C 1 128 ? 11.035  -3.332  20.855   1.00 102.89 ? 183  ARG C CG  1 
ATOM   7659  C CD  . ARG C 1 128 ? 12.274  -2.627  21.378   1.00 105.27 ? 183  ARG C CD  1 
ATOM   7660  N NE  . ARG C 1 128 ? 13.279  -2.433  20.337   1.00 100.93 ? 183  ARG C NE  1 
ATOM   7661  C CZ  . ARG C 1 128 ? 14.291  -1.577  20.431   1.00 105.51 ? 183  ARG C CZ  1 
ATOM   7662  N NH1 . ARG C 1 128 ? 14.428  -0.828  21.517   1.00 113.86 ? 183  ARG C NH1 1 
ATOM   7663  N NH2 . ARG C 1 128 ? 15.162  -1.464  19.439   1.00 100.59 ? 183  ARG C NH2 1 
ATOM   7664  N N   . ALA C 1 129 ? 8.309   -5.732  23.575   1.00 97.79  ? 184  ALA C N   1 
ATOM   7665  C CA  . ALA C 1 129 ? 7.204   -5.997  24.491   1.00 92.50  ? 184  ALA C CA  1 
ATOM   7666  C C   . ALA C 1 129 ? 7.609   -6.911  25.646   1.00 89.59  ? 184  ALA C C   1 
ATOM   7667  O O   . ALA C 1 129 ? 7.462   -6.553  26.821   1.00 88.77  ? 184  ALA C O   1 
ATOM   7668  C CB  . ALA C 1 129 ? 6.023   -6.583  23.734   1.00 91.50  ? 184  ALA C CB  1 
ATOM   7669  N N   . GLY C 1 130 ? 8.126   -8.088  25.316   1.00 90.84  ? 185  GLY C N   1 
ATOM   7670  C CA  . GLY C 1 130 ? 8.600   -8.995  26.343   1.00 90.97  ? 185  GLY C CA  1 
ATOM   7671  C C   . GLY C 1 130 ? 9.542   -8.286  27.297   1.00 89.38  ? 185  GLY C C   1 
ATOM   7672  O O   . GLY C 1 130 ? 9.434   -8.425  28.520   1.00 82.19  ? 185  GLY C O   1 
ATOM   7673  N N   . VAL C 1 131 ? 10.456  -7.506  26.727   1.00 94.46  ? 186  VAL C N   1 
ATOM   7674  C CA  . VAL C 1 131 ? 11.484  -6.812  27.500   1.00 94.45  ? 186  VAL C CA  1 
ATOM   7675  C C   . VAL C 1 131 ? 10.921  -5.759  28.451   1.00 90.65  ? 186  VAL C C   1 
ATOM   7676  O O   . VAL C 1 131 ? 11.193  -5.786  29.652   1.00 86.71  ? 186  VAL C O   1 
ATOM   7677  C CB  . VAL C 1 131 ? 12.510  -6.128  26.579   1.00 94.82  ? 186  VAL C CB  1 
ATOM   7678  C CG1 . VAL C 1 131 ? 13.424  -5.224  27.389   1.00 91.80  ? 186  VAL C CG1 1 
ATOM   7679  C CG2 . VAL C 1 131 ? 13.311  -7.173  25.819   1.00 100.70 ? 186  VAL C CG2 1 
ATOM   7680  N N   . MET C 1 132 ? 10.147  -4.825  27.911   1.00 93.70  ? 187  MET C N   1 
ATOM   7681  C CA  . MET C 1 132 ? 9.562   -3.778  28.738   1.00 90.61  ? 187  MET C CA  1 
ATOM   7682  C C   . MET C 1 132 ? 8.707   -4.389  29.836   1.00 86.62  ? 187  MET C C   1 
ATOM   7683  O O   . MET C 1 132 ? 8.697   -3.893  30.961   1.00 90.46  ? 187  MET C O   1 
ATOM   7684  C CB  . MET C 1 132 ? 8.756   -2.789  27.894   1.00 94.67  ? 187  MET C CB  1 
ATOM   7685  C CG  . MET C 1 132 ? 9.613   -1.996  26.918   1.00 117.17 ? 187  MET C CG  1 
ATOM   7686  S SD  . MET C 1 132 ? 8.676   -0.881  25.856   1.00 148.13 ? 187  MET C SD  1 
ATOM   7687  C CE  . MET C 1 132 ? 8.026   0.268   27.067   1.00 140.45 ? 187  MET C CE  1 
ATOM   7688  N N   . ILE C 1 133 ? 8.004   -5.475  29.521   1.00 88.85  ? 188  ILE C N   1 
ATOM   7689  C CA  . ILE C 1 133 ? 7.187   -6.147  30.533   1.00 87.79  ? 188  ILE C CA  1 
ATOM   7690  C C   . ILE C 1 133 ? 8.039   -6.744  31.659   1.00 90.14  ? 188  ILE C C   1 
ATOM   7691  O O   . ILE C 1 133 ? 7.783   -6.494  32.846   1.00 85.35  ? 188  ILE C O   1 
ATOM   7692  C CB  . ILE C 1 133 ? 6.288   -7.234  29.920   1.00 77.44  ? 188  ILE C CB  1 
ATOM   7693  C CG1 . ILE C 1 133 ? 5.178   -6.588  29.095   1.00 73.95  ? 188  ILE C CG1 1 
ATOM   7694  C CG2 . ILE C 1 133 ? 5.681   -8.094  31.009   1.00 71.90  ? 188  ILE C CG2 1 
ATOM   7695  C CD1 . ILE C 1 133 ? 4.351   -7.574  28.299   1.00 86.92  ? 188  ILE C CD1 1 
ATOM   7696  N N   . GLY C 1 134 ? 9.053   -7.524  31.287   1.00 94.21  ? 189  GLY C N   1 
ATOM   7697  C CA  . GLY C 1 134 ? 9.987   -8.060  32.262   1.00 85.25  ? 189  GLY C CA  1 
ATOM   7698  C C   . GLY C 1 134 ? 10.503  -6.952  33.160   1.00 83.58  ? 189  GLY C C   1 
ATOM   7699  O O   . GLY C 1 134 ? 10.524  -7.085  34.387   1.00 91.11  ? 189  GLY C O   1 
ATOM   7700  N N   . LEU C 1 135 ? 10.901  -5.844  32.540   1.00 82.29  ? 190  LEU C N   1 
ATOM   7701  C CA  . LEU C 1 135 ? 11.395  -4.673  33.259   1.00 85.19  ? 190  LEU C CA  1 
ATOM   7702  C C   . LEU C 1 135 ? 10.356  -4.115  34.243   1.00 86.09  ? 190  LEU C C   1 
ATOM   7703  O O   . LEU C 1 135 ? 10.699  -3.682  35.352   1.00 77.22  ? 190  LEU C O   1 
ATOM   7704  C CB  . LEU C 1 135 ? 11.824  -3.595  32.257   1.00 85.40  ? 190  LEU C CB  1 
ATOM   7705  C CG  . LEU C 1 135 ? 12.499  -2.323  32.782   1.00 86.94  ? 190  LEU C CG  1 
ATOM   7706  C CD1 . LEU C 1 135 ? 11.480  -1.289  33.257   1.00 82.82  ? 190  LEU C CD1 1 
ATOM   7707  C CD2 . LEU C 1 135 ? 13.505  -2.656  33.880   1.00 81.48  ? 190  LEU C CD2 1 
ATOM   7708  N N   . ALA C 1 136 ? 9.090   -4.131  33.828   1.00 85.09  ? 191  ALA C N   1 
ATOM   7709  C CA  . ALA C 1 136 ? 7.990   -3.658  34.666   1.00 75.23  ? 191  ALA C CA  1 
ATOM   7710  C C   . ALA C 1 136 ? 7.823   -4.528  35.914   1.00 79.65  ? 191  ALA C C   1 
ATOM   7711  O O   . ALA C 1 136 ? 7.752   -4.015  37.037   1.00 77.83  ? 191  ALA C O   1 
ATOM   7712  C CB  . ALA C 1 136 ? 6.705   -3.614  33.873   1.00 66.64  ? 191  ALA C CB  1 
ATOM   7713  N N   . TRP C 1 137 ? 7.762   -5.843  35.720   1.00 79.55  ? 192  TRP C N   1 
ATOM   7714  C CA  . TRP C 1 137 ? 7.718   -6.753  36.862   1.00 74.83  ? 192  TRP C CA  1 
ATOM   7715  C C   . TRP C 1 137 ? 8.902   -6.502  37.790   1.00 75.15  ? 192  TRP C C   1 
ATOM   7716  O O   . TRP C 1 137 ? 8.731   -6.375  39.002   1.00 73.72  ? 192  TRP C O   1 
ATOM   7717  C CB  . TRP C 1 137 ? 7.699   -8.210  36.413   1.00 73.23  ? 192  TRP C CB  1 
ATOM   7718  C CG  . TRP C 1 137 ? 6.381   -8.646  35.866   1.00 83.55  ? 192  TRP C CG  1 
ATOM   7719  C CD1 . TRP C 1 137 ? 5.853   -8.324  34.650   1.00 91.55  ? 192  TRP C CD1 1 
ATOM   7720  C CD2 . TRP C 1 137 ? 5.423   -9.500  36.506   1.00 83.03  ? 192  TRP C CD2 1 
ATOM   7721  N NE1 . TRP C 1 137 ? 4.624   -8.919  34.494   1.00 94.17  ? 192  TRP C NE1 1 
ATOM   7722  C CE2 . TRP C 1 137 ? 4.339   -9.646  35.615   1.00 90.45  ? 192  TRP C CE2 1 
ATOM   7723  C CE3 . TRP C 1 137 ? 5.377   -10.150 37.738   1.00 83.23  ? 192  TRP C CE3 1 
ATOM   7724  C CZ2 . TRP C 1 137 ? 3.219   -10.418 35.928   1.00 90.88  ? 192  TRP C CZ2 1 
ATOM   7725  C CZ3 . TRP C 1 137 ? 4.264   -10.916 38.043   1.00 89.69  ? 192  TRP C CZ3 1 
ATOM   7726  C CH2 . TRP C 1 137 ? 3.201   -11.043 37.142   1.00 90.82  ? 192  TRP C CH2 1 
ATOM   7727  N N   . VAL C 1 138 ? 10.104  -6.433  37.224   1.00 75.17  ? 193  VAL C N   1 
ATOM   7728  C CA  . VAL C 1 138 ? 11.281  -6.119  38.024   1.00 68.65  ? 193  VAL C CA  1 
ATOM   7729  C C   . VAL C 1 138 ? 11.028  -4.891  38.894   1.00 72.69  ? 193  VAL C C   1 
ATOM   7730  O O   . VAL C 1 138 ? 11.043  -4.989  40.117   1.00 73.47  ? 193  VAL C O   1 
ATOM   7731  C CB  . VAL C 1 138 ? 12.541  -5.927  37.174   1.00 66.60  ? 193  VAL C CB  1 
ATOM   7732  C CG1 . VAL C 1 138 ? 13.663  -5.349  38.022   1.00 62.03  ? 193  VAL C CG1 1 
ATOM   7733  C CG2 . VAL C 1 138 ? 12.967  -7.250  36.565   1.00 73.50  ? 193  VAL C CG2 1 
ATOM   7734  N N   . ILE C 1 139 ? 10.783  -3.743  38.264   1.00 71.55  ? 194  ILE C N   1 
ATOM   7735  C CA  . ILE C 1 139 ? 10.520  -2.511  39.008   1.00 69.24  ? 194  ILE C CA  1 
ATOM   7736  C C   . ILE C 1 139 ? 9.509   -2.736  40.128   1.00 67.46  ? 194  ILE C C   1 
ATOM   7737  O O   . ILE C 1 139 ? 9.701   -2.261  41.248   1.00 69.72  ? 194  ILE C O   1 
ATOM   7738  C CB  . ILE C 1 139 ? 9.972   -1.390  38.099   1.00 72.62  ? 194  ILE C CB  1 
ATOM   7739  C CG1 . ILE C 1 139 ? 10.970  -1.042  36.995   1.00 71.71  ? 194  ILE C CG1 1 
ATOM   7740  C CG2 . ILE C 1 139 ? 9.637   -0.153  38.918   1.00 65.71  ? 194  ILE C CG2 1 
ATOM   7741  C CD1 . ILE C 1 139 ? 10.604  0.207   36.230   1.00 65.22  ? 194  ILE C CD1 1 
ATOM   7742  N N   . SER C 1 140 ? 8.439   -3.466  39.823   1.00 63.87  ? 195  SER C N   1 
ATOM   7743  C CA  . SER C 1 140 ? 7.414   -3.784  40.820   1.00 71.32  ? 195  SER C CA  1 
ATOM   7744  C C   . SER C 1 140 ? 8.013   -4.469  42.049   1.00 73.47  ? 195  SER C C   1 
ATOM   7745  O O   . SER C 1 140 ? 7.959   -3.948  43.171   1.00 68.29  ? 195  SER C O   1 
ATOM   7746  C CB  . SER C 1 140 ? 6.339   -4.687  40.210   1.00 71.37  ? 195  SER C CB  1 
ATOM   7747  O OG  . SER C 1 140 ? 5.679   -4.044  39.132   1.00 75.60  ? 195  SER C OG  1 
ATOM   7748  N N   . PHE C 1 141 ? 8.569   -5.653  41.817   1.00 77.78  ? 196  PHE C N   1 
ATOM   7749  C CA  . PHE C 1 141 ? 9.209   -6.445  42.857   1.00 73.22  ? 196  PHE C CA  1 
ATOM   7750  C C   . PHE C 1 141 ? 10.170  -5.592  43.674   1.00 71.83  ? 196  PHE C C   1 
ATOM   7751  O O   . PHE C 1 141 ? 10.169  -5.655  44.897   1.00 76.01  ? 196  PHE C O   1 
ATOM   7752  C CB  . PHE C 1 141 ? 9.950   -7.618  42.218   1.00 69.36  ? 196  PHE C CB  1 
ATOM   7753  C CG  . PHE C 1 141 ? 10.958  -8.266  43.120   1.00 75.27  ? 196  PHE C CG  1 
ATOM   7754  C CD1 . PHE C 1 141 ? 10.610  -9.357  43.902   1.00 78.43  ? 196  PHE C CD1 1 
ATOM   7755  C CD2 . PHE C 1 141 ? 12.259  -7.796  43.175   1.00 76.01  ? 196  PHE C CD2 1 
ATOM   7756  C CE1 . PHE C 1 141 ? 11.543  -9.962  44.730   1.00 80.85  ? 196  PHE C CE1 1 
ATOM   7757  C CE2 . PHE C 1 141 ? 13.197  -8.394  44.002   1.00 79.03  ? 196  PHE C CE2 1 
ATOM   7758  C CZ  . PHE C 1 141 ? 12.839  -9.477  44.781   1.00 80.38  ? 196  PHE C CZ  1 
ATOM   7759  N N   . VAL C 1 142 ? 10.973  -4.790  42.980   1.00 69.79  ? 197  VAL C N   1 
ATOM   7760  C CA  . VAL C 1 142 ? 11.947  -3.890  43.596   1.00 68.89  ? 197  VAL C CA  1 
ATOM   7761  C C   . VAL C 1 142 ? 11.312  -2.871  44.537   1.00 78.62  ? 197  VAL C C   1 
ATOM   7762  O O   . VAL C 1 142 ? 11.832  -2.597  45.623   1.00 76.51  ? 197  VAL C O   1 
ATOM   7763  C CB  . VAL C 1 142 ? 12.727  -3.115  42.522   1.00 62.26  ? 197  VAL C CB  1 
ATOM   7764  C CG1 . VAL C 1 142 ? 13.517  -1.978  43.150   1.00 57.24  ? 197  VAL C CG1 1 
ATOM   7765  C CG2 . VAL C 1 142 ? 13.633  -4.047  41.753   1.00 73.88  ? 197  VAL C CG2 1 
ATOM   7766  N N   . LEU C 1 143 ? 10.195  -2.296  44.109   1.00 79.28  ? 198  LEU C N   1 
ATOM   7767  C CA  . LEU C 1 143 ? 9.510   -1.293  44.913   1.00 78.94  ? 198  LEU C CA  1 
ATOM   7768  C C   . LEU C 1 143 ? 8.828   -1.898  46.138   1.00 80.86  ? 198  LEU C C   1 
ATOM   7769  O O   . LEU C 1 143 ? 8.885   -1.332  47.228   1.00 79.13  ? 198  LEU C O   1 
ATOM   7770  C CB  . LEU C 1 143 ? 8.483   -0.529  44.073   1.00 71.93  ? 198  LEU C CB  1 
ATOM   7771  C CG  . LEU C 1 143 ? 9.013   0.339   42.933   1.00 65.30  ? 198  LEU C CG  1 
ATOM   7772  C CD1 . LEU C 1 143 ? 7.910   1.260   42.437   1.00 57.35  ? 198  LEU C CD1 1 
ATOM   7773  C CD2 . LEU C 1 143 ? 10.222  1.142   43.385   1.00 66.33  ? 198  LEU C CD2 1 
ATOM   7774  N N   . TRP C 1 144 ? 8.189   -3.049  45.958   1.00 77.48  ? 199  TRP C N   1 
ATOM   7775  C CA  . TRP C 1 144 ? 7.364   -3.624  47.017   1.00 75.16  ? 199  TRP C CA  1 
ATOM   7776  C C   . TRP C 1 144 ? 8.051   -4.692  47.858   1.00 82.54  ? 199  TRP C C   1 
ATOM   7777  O O   . TRP C 1 144 ? 8.228   -4.526  49.067   1.00 90.24  ? 199  TRP C O   1 
ATOM   7778  C CB  . TRP C 1 144 ? 6.064   -4.171  46.435   1.00 80.72  ? 199  TRP C CB  1 
ATOM   7779  C CG  . TRP C 1 144 ? 5.181   -3.097  45.895   1.00 89.32  ? 199  TRP C CG  1 
ATOM   7780  C CD1 . TRP C 1 144 ? 5.009   -2.757  44.585   1.00 89.88  ? 199  TRP C CD1 1 
ATOM   7781  C CD2 . TRP C 1 144 ? 4.353   -2.206  46.651   1.00 86.33  ? 199  TRP C CD2 1 
ATOM   7782  N NE1 . TRP C 1 144 ? 4.119   -1.716  44.479   1.00 86.01  ? 199  TRP C NE1 1 
ATOM   7783  C CE2 . TRP C 1 144 ? 3.702   -1.359  45.737   1.00 86.09  ? 199  TRP C CE2 1 
ATOM   7784  C CE3 . TRP C 1 144 ? 4.094   -2.048  48.015   1.00 86.38  ? 199  TRP C CE3 1 
ATOM   7785  C CZ2 . TRP C 1 144 ? 2.811   -0.367  46.137   1.00 88.90  ? 199  TRP C CZ2 1 
ATOM   7786  C CZ3 . TRP C 1 144 ? 3.208   -1.064  48.411   1.00 87.13  ? 199  TRP C CZ3 1 
ATOM   7787  C CH2 . TRP C 1 144 ? 2.577   -0.237  47.476   1.00 85.89  ? 199  TRP C CH2 1 
ATOM   7788  N N   . ALA C 1 145 ? 8.423   -5.790  47.211   1.00 79.95  ? 200  ALA C N   1 
ATOM   7789  C CA  . ALA C 1 145 ? 8.957   -6.961  47.905   1.00 88.64  ? 200  ALA C CA  1 
ATOM   7790  C C   . ALA C 1 145 ? 9.965   -6.633  49.017   1.00 93.28  ? 200  ALA C C   1 
ATOM   7791  O O   . ALA C 1 145 ? 9.805   -7.083  50.157   1.00 95.51  ? 200  ALA C O   1 
ATOM   7792  C CB  . ALA C 1 145 ? 9.563   -7.940  46.902   1.00 87.34  ? 200  ALA C CB  1 
ATOM   7793  N N   . PRO C 1 146 ? 11.004  -5.844  48.699   1.00 88.48  ? 201  PRO C N   1 
ATOM   7794  C CA  . PRO C 1 146 ? 11.994  -5.538  49.733   1.00 87.47  ? 201  PRO C CA  1 
ATOM   7795  C C   . PRO C 1 146 ? 11.326  -4.875  50.925   1.00 94.12  ? 201  PRO C C   1 
ATOM   7796  O O   . PRO C 1 146 ? 11.621  -5.220  52.069   1.00 102.07 ? 201  PRO C O   1 
ATOM   7797  C CB  . PRO C 1 146 ? 12.927  -4.540  49.041   1.00 83.29  ? 201  PRO C CB  1 
ATOM   7798  C CG  . PRO C 1 146 ? 12.738  -4.780  47.591   1.00 85.30  ? 201  PRO C CG  1 
ATOM   7799  C CD  . PRO C 1 146 ? 11.297  -5.139  47.441   1.00 88.23  ? 201  PRO C CD  1 
ATOM   7800  N N   . ALA C 1 147 ? 10.427  -3.936  50.651   1.00 90.27  ? 202  ALA C N   1 
ATOM   7801  C CA  . ALA C 1 147 ? 9.755   -3.201  51.711   1.00 92.00  ? 202  ALA C CA  1 
ATOM   7802  C C   . ALA C 1 147 ? 8.961   -4.152  52.592   1.00 92.90  ? 202  ALA C C   1 
ATOM   7803  O O   . ALA C 1 147 ? 9.240   -4.288  53.789   1.00 100.39 ? 202  ALA C O   1 
ATOM   7804  C CB  . ALA C 1 147 ? 8.837   -2.152  51.114   1.00 95.98  ? 202  ALA C CB  1 
ATOM   7805  N N   . ILE C 1 148 ? 8.002   -4.841  51.983   1.00 91.12  ? 203  ILE C N   1 
ATOM   7806  C CA  . ILE C 1 148 ? 7.129   -5.750  52.719   1.00 93.02  ? 203  ILE C CA  1 
ATOM   7807  C C   . ILE C 1 148 ? 7.923   -6.757  53.545   1.00 97.10  ? 203  ILE C C   1 
ATOM   7808  O O   . ILE C 1 148 ? 7.689   -6.910  54.744   1.00 97.45  ? 203  ILE C O   1 
ATOM   7809  C CB  . ILE C 1 148 ? 6.179   -6.516  51.773   1.00 97.90  ? 203  ILE C CB  1 
ATOM   7810  C CG1 . ILE C 1 148 ? 5.173   -5.556  51.134   1.00 99.42  ? 203  ILE C CG1 1 
ATOM   7811  C CG2 . ILE C 1 148 ? 5.456   -7.631  52.520   1.00 95.69  ? 203  ILE C CG2 1 
ATOM   7812  C CD1 . ILE C 1 148 ? 4.277   -6.203  50.096   1.00 100.08 ? 203  ILE C CD1 1 
ATOM   7813  N N   . LEU C 1 149 ? 8.867   -7.435  52.901   1.00 98.14  ? 204  LEU C N   1 
ATOM   7814  C CA  . LEU C 1 149 ? 9.593   -8.528  53.540   1.00 104.74 ? 204  LEU C CA  1 
ATOM   7815  C C   . LEU C 1 149 ? 10.604  -8.086  54.600   1.00 110.95 ? 204  LEU C C   1 
ATOM   7816  O O   . LEU C 1 149 ? 10.587  -8.583  55.727   1.00 109.32 ? 204  LEU C O   1 
ATOM   7817  C CB  . LEU C 1 149 ? 10.286  -9.392  52.483   1.00 96.85  ? 204  LEU C CB  1 
ATOM   7818  C CG  . LEU C 1 149 ? 9.350   -9.974  51.426   1.00 93.91  ? 204  LEU C CG  1 
ATOM   7819  C CD1 . LEU C 1 149 ? 10.140  -10.761 50.401   1.00 101.29 ? 204  LEU C CD1 1 
ATOM   7820  C CD2 . LEU C 1 149 ? 8.277   -10.842 52.069   1.00 92.64  ? 204  LEU C CD2 1 
ATOM   7821  N N   . PHE C 1 150 ? 11.480  -7.154  54.237   1.00 112.98 ? 205  PHE C N   1 
ATOM   7822  C CA  . PHE C 1 150 ? 12.604  -6.790  55.101   1.00 109.68 ? 205  PHE C CA  1 
ATOM   7823  C C   . PHE C 1 150 ? 12.372  -5.571  55.998   1.00 110.00 ? 205  PHE C C   1 
ATOM   7824  O O   . PHE C 1 150 ? 13.250  -5.214  56.783   1.00 113.36 ? 205  PHE C O   1 
ATOM   7825  C CB  . PHE C 1 150 ? 13.889  -6.599  54.278   1.00 108.77 ? 205  PHE C CB  1 
ATOM   7826  C CG  . PHE C 1 150 ? 14.429  -7.877  53.680   1.00 119.91 ? 205  PHE C CG  1 
ATOM   7827  C CD1 . PHE C 1 150 ? 13.896  -9.110  54.033   1.00 117.31 ? 205  PHE C CD1 1 
ATOM   7828  C CD2 . PHE C 1 150 ? 15.477  -7.843  52.771   1.00 117.93 ? 205  PHE C CD2 1 
ATOM   7829  C CE1 . PHE C 1 150 ? 14.394  -10.283 53.485   1.00 105.97 ? 205  PHE C CE1 1 
ATOM   7830  C CE2 . PHE C 1 150 ? 15.981  -9.011  52.222   1.00 108.25 ? 205  PHE C CE2 1 
ATOM   7831  C CZ  . PHE C 1 150 ? 15.439  -10.233 52.580   1.00 100.91 ? 205  PHE C CZ  1 
ATOM   7832  N N   . TRP C 1 151 ? 11.208  -4.931  55.888   1.00 107.95 ? 206  TRP C N   1 
ATOM   7833  C CA  . TRP C 1 151 ? 10.915  -3.776  56.739   1.00 104.46 ? 206  TRP C CA  1 
ATOM   7834  C C   . TRP C 1 151 ? 10.911  -4.156  58.220   1.00 106.25 ? 206  TRP C C   1 
ATOM   7835  O O   . TRP C 1 151 ? 11.417  -3.410  59.062   1.00 108.81 ? 206  TRP C O   1 
ATOM   7836  C CB  . TRP C 1 151 ? 9.593   -3.114  56.341   1.00 99.39  ? 206  TRP C CB  1 
ATOM   7837  C CG  . TRP C 1 151 ? 9.155   -1.994  57.252   1.00 100.11 ? 206  TRP C CG  1 
ATOM   7838  C CD1 . TRP C 1 151 ? 8.137   -2.033  58.160   1.00 107.86 ? 206  TRP C CD1 1 
ATOM   7839  C CD2 . TRP C 1 151 ? 9.713   -0.674  57.335   1.00 95.48  ? 206  TRP C CD2 1 
ATOM   7840  N NE1 . TRP C 1 151 ? 8.027   -0.823  58.803   1.00 107.50 ? 206  TRP C NE1 1 
ATOM   7841  C CE2 . TRP C 1 151 ? 8.984   0.030   58.314   1.00 100.19 ? 206  TRP C CE2 1 
ATOM   7842  C CE3 . TRP C 1 151 ? 10.758  -0.019  56.679   1.00 94.81  ? 206  TRP C CE3 1 
ATOM   7843  C CZ2 . TRP C 1 151 ? 9.262   1.353   58.654   1.00 97.90  ? 206  TRP C CZ2 1 
ATOM   7844  C CZ3 . TRP C 1 151 ? 11.036  1.296   57.018   1.00 93.51  ? 206  TRP C CZ3 1 
ATOM   7845  C CH2 . TRP C 1 151 ? 10.290  1.967   57.995   1.00 95.96  ? 206  TRP C CH2 1 
ATOM   7846  N N   . GLN C 1 152 ? 10.350  -5.321  58.534   1.00 104.87 ? 207  GLN C N   1 
ATOM   7847  C CA  . GLN C 1 152 ? 10.358  -5.804  59.910   1.00 103.59 ? 207  GLN C CA  1 
ATOM   7848  C C   . GLN C 1 152 ? 11.785  -5.907  60.456   1.00 106.17 ? 207  GLN C C   1 
ATOM   7849  O O   . GLN C 1 152 ? 12.106  -5.313  61.487   1.00 103.04 ? 207  GLN C O   1 
ATOM   7850  C CB  . GLN C 1 152 ? 9.606   -7.138  60.042   1.00 102.19 ? 207  GLN C CB  1 
ATOM   7851  C CG  . GLN C 1 152 ? 10.123  -8.275  59.169   1.00 110.66 ? 207  GLN C CG  1 
ATOM   7852  C CD  . GLN C 1 152 ? 9.342   -9.564  59.374   1.00 112.70 ? 207  GLN C CD  1 
ATOM   7853  O OE1 . GLN C 1 152 ? 8.492   -9.654  60.261   1.00 103.06 ? 207  GLN C OE1 1 
ATOM   7854  N NE2 . GLN C 1 152 ? 9.624   -10.568 58.549   1.00 118.12 ? 207  GLN C NE2 1 
ATOM   7855  N N   . TYR C 1 153 ? 12.638  -6.645  59.750   1.00 107.32 ? 208  TYR C N   1 
ATOM   7856  C CA  . TYR C 1 153 ? 14.032  -6.830  60.157   1.00 105.30 ? 208  TYR C CA  1 
ATOM   7857  C C   . TYR C 1 153 ? 14.821  -5.526  60.130   1.00 101.32 ? 208  TYR C C   1 
ATOM   7858  O O   . TYR C 1 153 ? 15.880  -5.422  60.747   1.00 93.79  ? 208  TYR C O   1 
ATOM   7859  C CB  . TYR C 1 153 ? 14.724  -7.864  59.266   1.00 104.08 ? 208  TYR C CB  1 
ATOM   7860  C CG  . TYR C 1 153 ? 14.113  -9.243  59.339   1.00 111.17 ? 208  TYR C CG  1 
ATOM   7861  C CD1 . TYR C 1 153 ? 14.578  -10.183 60.248   1.00 118.91 ? 208  TYR C CD1 1 
ATOM   7862  C CD2 . TYR C 1 153 ? 13.076  -9.609  58.492   1.00 118.52 ? 208  TYR C CD2 1 
ATOM   7863  C CE1 . TYR C 1 153 ? 14.023  -11.451 60.315   1.00 132.17 ? 208  TYR C CE1 1 
ATOM   7864  C CE2 . TYR C 1 153 ? 12.514  -10.873 58.551   1.00 125.73 ? 208  TYR C CE2 1 
ATOM   7865  C CZ  . TYR C 1 153 ? 12.990  -11.791 59.464   1.00 131.11 ? 208  TYR C CZ  1 
ATOM   7866  O OH  . TYR C 1 153 ? 12.433  -13.050 59.525   1.00 126.96 ? 208  TYR C OH  1 
ATOM   7867  N N   . PHE C 1 154 ? 14.316  -4.541  59.396   1.00 103.13 ? 209  PHE C N   1 
ATOM   7868  C CA  . PHE C 1 154 ? 14.961  -3.235  59.340   1.00 102.29 ? 209  PHE C CA  1 
ATOM   7869  C C   . PHE C 1 154 ? 14.617  -2.377  60.552   1.00 108.72 ? 209  PHE C C   1 
ATOM   7870  O O   . PHE C 1 154 ? 15.454  -1.618  61.044   1.00 107.12 ? 209  PHE C O   1 
ATOM   7871  C CB  . PHE C 1 154 ? 14.598  -2.488  58.057   1.00 99.70  ? 209  PHE C CB  1 
ATOM   7872  C CG  . PHE C 1 154 ? 15.199  -1.124  57.979   1.00 98.39  ? 209  PHE C CG  1 
ATOM   7873  C CD1 . PHE C 1 154 ? 16.542  -0.963  57.679   1.00 101.39 ? 209  PHE C CD1 1 
ATOM   7874  C CD2 . PHE C 1 154 ? 14.431  -0.002  58.229   1.00 102.01 ? 209  PHE C CD2 1 
ATOM   7875  C CE1 . PHE C 1 154 ? 17.109  0.295   57.617   1.00 102.69 ? 209  PHE C CE1 1 
ATOM   7876  C CE2 . PHE C 1 154 ? 14.989  1.261   58.169   1.00 112.87 ? 209  PHE C CE2 1 
ATOM   7877  C CZ  . PHE C 1 154 ? 16.333  1.410   57.861   1.00 107.17 ? 209  PHE C CZ  1 
ATOM   7878  N N   . VAL C 1 155 ? 13.374  -2.484  61.013   1.00 107.27 ? 210  VAL C N   1 
ATOM   7879  C CA  . VAL C 1 155 ? 12.946  -1.775  62.213   1.00 102.20 ? 210  VAL C CA  1 
ATOM   7880  C C   . VAL C 1 155 ? 13.466  -2.501  63.449   1.00 104.30 ? 210  VAL C C   1 
ATOM   7881  O O   . VAL C 1 155 ? 13.756  -1.880  64.472   1.00 109.18 ? 210  VAL C O   1 
ATOM   7882  C CB  . VAL C 1 155 ? 11.412  -1.636  62.282   1.00 99.70  ? 210  VAL C CB  1 
ATOM   7883  C CG1 . VAL C 1 155 ? 10.991  -1.036  63.611   1.00 98.44  ? 210  VAL C CG1 1 
ATOM   7884  C CG2 . VAL C 1 155 ? 10.907  -0.780  61.135   1.00 101.83 ? 210  VAL C CG2 1 
ATOM   7885  N N   . GLY C 1 156 ? 13.596  -3.820  63.343   1.00 97.67  ? 211  GLY C N   1 
ATOM   7886  C CA  . GLY C 1 156 ? 14.161  -4.617  64.415   1.00 96.21  ? 211  GLY C CA  1 
ATOM   7887  C C   . GLY C 1 156 ? 13.114  -5.404  65.172   1.00 92.16  ? 211  GLY C C   1 
ATOM   7888  O O   . GLY C 1 156 ? 13.440  -6.273  65.978   1.00 95.34  ? 211  GLY C O   1 
ATOM   7889  N N   . LYS C 1 157 ? 11.849  -5.098  64.914   1.00 87.85  ? 212  LYS C N   1 
ATOM   7890  C CA  . LYS C 1 157 ? 10.751  -5.797  65.568   1.00 94.17  ? 212  LYS C CA  1 
ATOM   7891  C C   . LYS C 1 157 ? 9.567   -5.954  64.625   1.00 96.14  ? 212  LYS C C   1 
ATOM   7892  O O   . LYS C 1 157 ? 9.508   -5.306  63.582   1.00 98.56  ? 212  LYS C O   1 
ATOM   7893  C CB  . LYS C 1 157 ? 10.324  -5.063  66.841   1.00 97.57  ? 212  LYS C CB  1 
ATOM   7894  N N   . ARG C 1 158 ? 8.632   -6.822  64.998   1.00 102.39 ? 213  ARG C N   1 
ATOM   7895  C CA  . ARG C 1 158 ? 7.433   -7.064  64.200   1.00 107.44 ? 213  ARG C CA  1 
ATOM   7896  C C   . ARG C 1 158 ? 6.219   -6.332  64.771   1.00 114.82 ? 213  ARG C C   1 
ATOM   7897  O O   . ARG C 1 158 ? 5.766   -6.627  65.873   1.00 122.40 ? 213  ARG C O   1 
ATOM   7898  C CB  . ARG C 1 158 ? 7.148   -8.564  64.109   1.00 103.24 ? 213  ARG C CB  1 
ATOM   7899  C CG  . ARG C 1 158 ? 5.722   -8.899  63.722   1.00 111.67 ? 213  ARG C CG  1 
ATOM   7900  C CD  . ARG C 1 158 ? 5.556   -10.385 63.452   1.00 118.42 ? 213  ARG C CD  1 
ATOM   7901  N NE  . ARG C 1 158 ? 5.840   -10.728 62.060   1.00 128.36 ? 213  ARG C NE  1 
ATOM   7902  C CZ  . ARG C 1 158 ? 4.907   -10.985 61.146   1.00 124.73 ? 213  ARG C CZ  1 
ATOM   7903  N NH1 . ARG C 1 158 ? 3.620   -10.947 61.473   1.00 116.99 ? 213  ARG C NH1 1 
ATOM   7904  N NH2 . ARG C 1 158 ? 5.262   -11.286 59.903   1.00 117.68 ? 213  ARG C NH2 1 
ATOM   7905  N N   . THR C 1 159 ? 5.696   -5.375  64.011   1.00 114.34 ? 214  THR C N   1 
ATOM   7906  C CA  . THR C 1 159 ? 4.571   -4.557  64.460   1.00 115.75 ? 214  THR C CA  1 
ATOM   7907  C C   . THR C 1 159 ? 3.245   -5.267  64.190   1.00 111.64 ? 214  THR C C   1 
ATOM   7908  O O   . THR C 1 159 ? 2.187   -4.849  64.670   1.00 107.73 ? 214  THR C O   1 
ATOM   7909  C CB  . THR C 1 159 ? 4.593   -3.158  63.786   1.00 119.32 ? 214  THR C CB  1 
ATOM   7910  O OG1 . THR C 1 159 ? 5.835   -2.508  64.085   1.00 113.69 ? 214  THR C OG1 1 
ATOM   7911  C CG2 . THR C 1 159 ? 3.439   -2.290  64.266   1.00 115.55 ? 214  THR C CG2 1 
ATOM   7912  N N   . VAL C 1 160 ? 3.313   -6.351  63.424   1.00 113.74 ? 215  VAL C N   1 
ATOM   7913  C CA  . VAL C 1 160 ? 2.127   -7.133  63.122   1.00 122.03 ? 215  VAL C CA  1 
ATOM   7914  C C   . VAL C 1 160 ? 1.980   -8.272  64.117   1.00 132.46 ? 215  VAL C C   1 
ATOM   7915  O O   . VAL C 1 160 ? 2.757   -9.227  64.101   1.00 138.68 ? 215  VAL C O   1 
ATOM   7916  C CB  . VAL C 1 160 ? 2.180   -7.712  61.702   1.00 117.83 ? 215  VAL C CB  1 
ATOM   7917  C CG1 . VAL C 1 160 ? 0.934   -8.538  61.430   1.00 127.63 ? 215  VAL C CG1 1 
ATOM   7918  C CG2 . VAL C 1 160 ? 2.309   -6.589  60.688   1.00 107.67 ? 215  VAL C CG2 1 
ATOM   7919  N N   . PRO C 1 161 ? 0.987   -8.168  65.004   1.00 135.72 ? 216  PRO C N   1 
ATOM   7920  C CA  . PRO C 1 161 ? 0.753   -9.218  65.992   1.00 148.29 ? 216  PRO C CA  1 
ATOM   7921  C C   . PRO C 1 161 ? 0.052   -10.404 65.349   1.00 160.37 ? 216  PRO C C   1 
ATOM   7922  O O   . PRO C 1 161 ? -0.625  -10.245 64.341   1.00 156.97 ? 216  PRO C O   1 
ATOM   7923  C CB  . PRO C 1 161 ? -0.179  -8.543  66.994   1.00 152.97 ? 216  PRO C CB  1 
ATOM   7924  C CG  . PRO C 1 161 ? -0.923  -7.546  66.188   1.00 146.14 ? 216  PRO C CG  1 
ATOM   7925  C CD  . PRO C 1 161 ? 0.020   -7.067  65.124   1.00 134.84 ? 216  PRO C CD  1 
ATOM   7926  N N   . PRO C 1 162 ? 0.224   -11.599 65.926   1.00 166.50 ? 217  PRO C N   1 
ATOM   7927  C CA  . PRO C 1 162 ? -0.507  -12.777 65.458   1.00 170.94 ? 217  PRO C CA  1 
ATOM   7928  C C   . PRO C 1 162 ? -2.011  -12.538 65.606   1.00 175.04 ? 217  PRO C C   1 
ATOM   7929  O O   . PRO C 1 162 ? -2.448  -11.903 66.591   1.00 178.00 ? 217  PRO C O   1 
ATOM   7930  C CB  . PRO C 1 162 ? -0.065  -13.857 66.446   1.00 170.76 ? 217  PRO C CB  1 
ATOM   7931  C CG  . PRO C 1 162 ? 0.303   -13.100 67.681   1.00 174.24 ? 217  PRO C CG  1 
ATOM   7932  C CD  . PRO C 1 162 ? 0.986   -11.884 67.153   1.00 164.66 ? 217  PRO C CD  1 
ATOM   7933  N N   . GLY C 1 163 ? -2.800  -13.070 64.674   1.00 177.92 ? 218  GLY C N   1 
ATOM   7934  C CA  . GLY C 1 163 ? -4.240  -12.854 64.668   1.00 179.33 ? 218  GLY C CA  1 
ATOM   7935  C C   . GLY C 1 163 ? -4.738  -12.026 63.499   1.00 171.69 ? 218  GLY C C   1 
ATOM   7936  O O   . GLY C 1 163 ? -5.915  -12.052 63.154   1.00 162.25 ? 218  GLY C O   1 
ATOM   7937  N N   . GLU C 1 164 ? -3.818  -11.326 62.856   1.00 167.37 ? 219  GLU C N   1 
ATOM   7938  C CA  . GLU C 1 164 ? -4.135  -10.527 61.698   1.00 156.39 ? 219  GLU C CA  1 
ATOM   7939  C C   . GLU C 1 164 ? -2.881  -10.409 60.864   1.00 148.33 ? 219  GLU C C   1 
ATOM   7940  O O   . GLU C 1 164 ? -1.777  -10.550 61.379   1.00 142.85 ? 219  GLU C O   1 
ATOM   7941  C CB  . GLU C 1 164 ? -4.623  -9.157  62.159   1.00 156.49 ? 219  GLU C CB  1 
ATOM   7942  C CG  . GLU C 1 164 ? -3.543  -8.297  62.813   1.00 154.31 ? 219  GLU C CG  1 
ATOM   7943  C CD  . GLU C 1 164 ? -3.724  -8.181  64.315   1.00 160.63 ? 219  GLU C CD  1 
ATOM   7944  O OE1 . GLU C 1 164 ? -3.396  -7.113  64.869   1.00 156.42 ? 219  GLU C OE1 1 
ATOM   7945  O OE2 . GLU C 1 164 ? -4.183  -9.158  64.945   1.00 164.54 ? 219  GLU C OE2 1 
ATOM   7946  N N   . CYS C 1 165 ? -3.060  -10.110 59.587   1.00 130.83 ? 220  CYS C N   1 
ATOM   7947  C CA  . CYS C 1 165 ? -1.925  -9.967  58.658   1.00 117.58 ? 220  CYS C CA  1 
ATOM   7948  C C   . CYS C 1 165 ? -2.123  -8.799  57.698   1.00 107.09 ? 220  CYS C C   1 
ATOM   7949  O O   . CYS C 1 165 ? -3.160  -8.670  57.050   1.00 104.40 ? 220  CYS C O   1 
ATOM   7950  C CB  . CYS C 1 165 ? -1.669  -11.271 57.862   1.00 109.95 ? 220  CYS C CB  1 
ATOM   7951  S SG  . CYS C 1 165 ? -0.609  -11.135 56.371   1.00 85.12  ? 220  CYS C SG  1 
ATOM   7952  N N   . PHE C 1 166 ? -1.094  -7.965  57.622   1.00 104.16 ? 221  PHE C N   1 
ATOM   7953  C CA  . PHE C 1 166 ? -1.086  -6.789  56.772   1.00 98.13  ? 221  PHE C CA  1 
ATOM   7954  C C   . PHE C 1 166 ? 0.328   -6.217  56.659   1.00 91.16  ? 221  PHE C C   1 
ATOM   7955  O O   . PHE C 1 166 ? 1.268   -6.723  57.275   1.00 81.20  ? 221  PHE C O   1 
ATOM   7956  C CB  . PHE C 1 166 ? -2.041  -5.736  57.324   1.00 97.90  ? 221  PHE C CB  1 
ATOM   7957  C CG  . PHE C 1 166 ? -1.695  -5.277  58.707   1.00 102.31 ? 221  PHE C CG  1 
ATOM   7958  C CD1 . PHE C 1 166 ? -0.786  -4.251  58.900   1.00 108.23 ? 221  PHE C CD1 1 
ATOM   7959  C CD2 . PHE C 1 166 ? -2.270  -5.873  59.816   1.00 106.06 ? 221  PHE C CD2 1 
ATOM   7960  C CE1 . PHE C 1 166 ? -0.460  -3.823  60.174   1.00 108.43 ? 221  PHE C CE1 1 
ATOM   7961  C CE2 . PHE C 1 166 ? -1.948  -5.449  61.093   1.00 112.08 ? 221  PHE C CE2 1 
ATOM   7962  C CZ  . PHE C 1 166 ? -1.042  -4.421  61.272   1.00 110.31 ? 221  PHE C CZ  1 
ATOM   7963  N N   . ILE C 1 167 ? 0.468   -5.154  55.874   1.00 88.00  ? 222  ILE C N   1 
ATOM   7964  C CA  . ILE C 1 167 ? 1.772   -4.558  55.629   1.00 79.28  ? 222  ILE C CA  1 
ATOM   7965  C C   . ILE C 1 167 ? 2.195   -3.707  56.814   1.00 79.36  ? 222  ILE C C   1 
ATOM   7966  O O   . ILE C 1 167 ? 1.424   -2.889  57.303   1.00 81.36  ? 222  ILE C O   1 
ATOM   7967  C CB  . ILE C 1 167 ? 1.774   -3.722  54.341   1.00 76.06  ? 222  ILE C CB  1 
ATOM   7968  C CG1 . ILE C 1 167 ? 1.569   -4.632  53.127   1.00 77.17  ? 222  ILE C CG1 1 
ATOM   7969  C CG2 . ILE C 1 167 ? 3.073   -2.968  54.210   1.00 83.76  ? 222  ILE C CG2 1 
ATOM   7970  C CD1 . ILE C 1 167 ? 1.630   -3.916  51.796   1.00 77.41  ? 222  ILE C CD1 1 
ATOM   7971  N N   . GLN C 1 168 ? 3.427   -3.909  57.270   1.00 81.24  ? 223  GLN C N   1 
ATOM   7972  C CA  . GLN C 1 168 ? 3.905   -3.280  58.496   1.00 86.76  ? 223  GLN C CA  1 
ATOM   7973  C C   . GLN C 1 168 ? 3.991   -1.765  58.388   1.00 81.92  ? 223  GLN C C   1 
ATOM   7974  O O   . GLN C 1 168 ? 3.414   -1.043  59.199   1.00 80.86  ? 223  GLN C O   1 
ATOM   7975  C CB  . GLN C 1 168 ? 5.265   -3.856  58.897   1.00 86.71  ? 223  GLN C CB  1 
ATOM   7976  C CG  . GLN C 1 168 ? 5.782   -3.362  60.240   1.00 91.11  ? 223  GLN C CG  1 
ATOM   7977  C CD  . GLN C 1 168 ? 7.024   -4.106  60.693   1.00 103.45 ? 223  GLN C CD  1 
ATOM   7978  O OE1 . GLN C 1 168 ? 7.368   -5.152  60.142   1.00 106.49 ? 223  GLN C OE1 1 
ATOM   7979  N NE2 . GLN C 1 168 ? 7.706   -3.567  61.700   1.00 110.20 ? 223  GLN C NE2 1 
ATOM   7980  N N   . PHE C 1 169 ? 4.700   -1.288  57.373   1.00 78.98  ? 224  PHE C N   1 
ATOM   7981  C CA  . PHE C 1 169 ? 4.960   0.139   57.229   1.00 87.48  ? 224  PHE C CA  1 
ATOM   7982  C C   . PHE C 1 169 ? 3.714   0.940   56.848   1.00 91.09  ? 224  PHE C C   1 
ATOM   7983  O O   . PHE C 1 169 ? 3.765   2.164   56.743   1.00 95.89  ? 224  PHE C O   1 
ATOM   7984  C CB  . PHE C 1 169 ? 6.071   0.380   56.211   1.00 87.25  ? 224  PHE C CB  1 
ATOM   7985  C CG  . PHE C 1 169 ? 5.765   -0.158  54.851   1.00 89.46  ? 224  PHE C CG  1 
ATOM   7986  C CD1 . PHE C 1 169 ? 6.282   -1.374  54.443   1.00 94.00  ? 224  PHE C CD1 1 
ATOM   7987  C CD2 . PHE C 1 169 ? 4.951   0.546   53.979   1.00 91.78  ? 224  PHE C CD2 1 
ATOM   7988  C CE1 . PHE C 1 169 ? 6.001   -1.879  53.183   1.00 94.22  ? 224  PHE C CE1 1 
ATOM   7989  C CE2 . PHE C 1 169 ? 4.663   0.048   52.721   1.00 90.53  ? 224  PHE C CE2 1 
ATOM   7990  C CZ  . PHE C 1 169 ? 5.189   -1.166  52.323   1.00 90.24  ? 224  PHE C CZ  1 
ATOM   7991  N N   . LEU C 1 170 ? 2.605   0.247   56.618   1.00 89.47  ? 225  LEU C N   1 
ATOM   7992  C CA  . LEU C 1 170 ? 1.342   0.906   56.284   1.00 86.36  ? 225  LEU C CA  1 
ATOM   7993  C C   . LEU C 1 170 ? 0.513   1.239   57.526   1.00 82.11  ? 225  LEU C C   1 
ATOM   7994  O O   . LEU C 1 170 ? -0.633  1.680   57.420   1.00 80.46  ? 225  LEU C O   1 
ATOM   7995  C CB  . LEU C 1 170 ? 0.539   0.087   55.272   1.00 83.29  ? 225  LEU C CB  1 
ATOM   7996  C CG  . LEU C 1 170 ? 1.221   -0.020  53.906   1.00 82.32  ? 225  LEU C CG  1 
ATOM   7997  C CD1 . LEU C 1 170 ? 0.297   -0.652  52.879   1.00 74.76  ? 225  LEU C CD1 1 
ATOM   7998  C CD2 . LEU C 1 170 ? 1.692   1.349   53.438   1.00 73.60  ? 225  LEU C CD2 1 
ATOM   7999  N N   . SER C 1 171 ? 1.103   1.041   58.697   1.00 77.90  ? 226  SER C N   1 
ATOM   8000  C CA  . SER C 1 171 ? 0.395   1.235   59.956   1.00 84.81  ? 226  SER C CA  1 
ATOM   8001  C C   . SER C 1 171 ? -0.116  2.669   60.131   1.00 84.25  ? 226  SER C C   1 
ATOM   8002  O O   . SER C 1 171 ? -0.941  2.933   61.003   1.00 85.09  ? 226  SER C O   1 
ATOM   8003  C CB  . SER C 1 171 ? 1.312   0.886   61.131   1.00 97.57  ? 226  SER C CB  1 
ATOM   8004  O OG  . SER C 1 171 ? 1.665   -0.487  61.141   1.00 99.70  ? 226  SER C OG  1 
ATOM   8005  N N   . GLU C 1 172 ? 0.318   3.585   59.268   1.00 79.86  ? 227  GLU C N   1 
ATOM   8006  C CA  . GLU C 1 172 ? -0.090  4.980   59.396   1.00 75.24  ? 227  GLU C CA  1 
ATOM   8007  C C   . GLU C 1 172 ? -0.888  5.400   58.171   1.00 69.75  ? 227  GLU C C   1 
ATOM   8008  O O   . GLU C 1 172 ? -0.564  5.001   57.056   1.00 72.71  ? 227  GLU C O   1 
ATOM   8009  C CB  . GLU C 1 172 ? 1.145   5.873   59.552   1.00 76.71  ? 227  GLU C CB  1 
ATOM   8010  C CG  . GLU C 1 172 ? 0.848   7.355   59.733   1.00 79.23  ? 227  GLU C CG  1 
ATOM   8011  C CD  . GLU C 1 172 ? 0.428   7.709   61.151   1.00 85.75  ? 227  GLU C CD  1 
ATOM   8012  O OE1 . GLU C 1 172 ? 0.588   6.855   62.049   1.00 89.22  ? 227  GLU C OE1 1 
ATOM   8013  O OE2 . GLU C 1 172 ? -0.058  8.843   61.367   1.00 77.96  ? 227  GLU C OE2 1 
ATOM   8014  N N   . PRO C 1 173 ? -1.933  6.216   58.377   1.00 68.49  ? 228  PRO C N   1 
ATOM   8015  C CA  . PRO C 1 173 ? -2.840  6.652   57.303   1.00 77.14  ? 228  PRO C CA  1 
ATOM   8016  C C   . PRO C 1 173 ? -2.183  7.554   56.254   1.00 72.85  ? 228  PRO C C   1 
ATOM   8017  O O   . PRO C 1 173 ? -2.527  7.472   55.068   1.00 70.29  ? 228  PRO C O   1 
ATOM   8018  C CB  . PRO C 1 173 ? -3.943  7.416   58.055   1.00 74.57  ? 228  PRO C CB  1 
ATOM   8019  C CG  . PRO C 1 173 ? -3.337  7.777   59.372   1.00 74.45  ? 228  PRO C CG  1 
ATOM   8020  C CD  . PRO C 1 173 ? -2.400  6.654   59.702   1.00 66.03  ? 228  PRO C CD  1 
ATOM   8021  N N   . THR C 1 174 ? -1.256  8.404   56.686   1.00 62.37  ? 229  THR C N   1 
ATOM   8022  C CA  . THR C 1 174 ? -0.601  9.334   55.777   1.00 59.87  ? 229  THR C CA  1 
ATOM   8023  C C   . THR C 1 174 ? 0.245   8.614   54.728   1.00 63.10  ? 229  THR C C   1 
ATOM   8024  O O   . THR C 1 174 ? 0.102   8.852   53.524   1.00 57.68  ? 229  THR C O   1 
ATOM   8025  C CB  . THR C 1 174 ? 0.270   10.343  56.540   1.00 60.20  ? 229  THR C CB  1 
ATOM   8026  O OG1 . THR C 1 174 ? 1.006   9.658   57.557   1.00 65.96  ? 229  THR C OG1 1 
ATOM   8027  C CG2 . THR C 1 174 ? -0.595  11.415  57.188   1.00 58.14  ? 229  THR C CG2 1 
ATOM   8028  N N   . ILE C 1 175 ? 1.126   7.733   55.195   1.00 68.67  ? 230  ILE C N   1 
ATOM   8029  C CA  . ILE C 1 175 ? 2.010   6.977   54.310   1.00 69.63  ? 230  ILE C CA  1 
ATOM   8030  C C   . ILE C 1 175 ? 1.191   6.209   53.264   1.00 62.50  ? 230  ILE C C   1 
ATOM   8031  O O   . ILE C 1 175 ? 1.424   6.328   52.049   1.00 57.78  ? 230  ILE C O   1 
ATOM   8032  C CB  . ILE C 1 175 ? 2.955   6.041   55.119   1.00 64.27  ? 230  ILE C CB  1 
ATOM   8033  C CG1 . ILE C 1 175 ? 3.868   5.241   54.192   1.00 63.66  ? 230  ILE C CG1 1 
ATOM   8034  C CG2 . ILE C 1 175 ? 2.174   5.114   56.029   1.00 69.01  ? 230  ILE C CG2 1 
ATOM   8035  C CD1 . ILE C 1 175 ? 4.862   4.377   54.933   1.00 72.75  ? 230  ILE C CD1 1 
ATOM   8036  N N   . THR C 1 176 ? 0.212   5.451   53.746   1.00 62.53  ? 231  THR C N   1 
ATOM   8037  C CA  . THR C 1 176 ? -0.739  4.766   52.879   1.00 64.52  ? 231  THR C CA  1 
ATOM   8038  C C   . THR C 1 176 ? -1.341  5.725   51.850   1.00 63.01  ? 231  THR C C   1 
ATOM   8039  O O   . THR C 1 176 ? -1.427  5.394   50.662   1.00 62.75  ? 231  THR C O   1 
ATOM   8040  C CB  . THR C 1 176 ? -1.866  4.106   53.702   1.00 61.83  ? 231  THR C CB  1 
ATOM   8041  O OG1 . THR C 1 176 ? -1.296  3.207   54.662   1.00 62.37  ? 231  THR C OG1 1 
ATOM   8042  C CG2 . THR C 1 176 ? -2.812  3.336   52.798   1.00 59.44  ? 231  THR C CG2 1 
ATOM   8043  N N   . PHE C 1 177 ? -1.755  6.908   52.305   1.00 61.18  ? 232  PHE C N   1 
ATOM   8044  C CA  . PHE C 1 177 ? -2.300  7.924   51.403   1.00 57.72  ? 232  PHE C CA  1 
ATOM   8045  C C   . PHE C 1 177 ? -1.338  8.303   50.282   1.00 58.43  ? 232  PHE C C   1 
ATOM   8046  O O   . PHE C 1 177 ? -1.640  8.099   49.106   1.00 64.83  ? 232  PHE C O   1 
ATOM   8047  C CB  . PHE C 1 177 ? -2.714  9.183   52.160   1.00 57.43  ? 232  PHE C CB  1 
ATOM   8048  C CG  . PHE C 1 177 ? -3.165  10.302  51.263   1.00 59.80  ? 232  PHE C CG  1 
ATOM   8049  C CD1 . PHE C 1 177 ? -4.338  10.187  50.532   1.00 64.64  ? 232  PHE C CD1 1 
ATOM   8050  C CD2 . PHE C 1 177 ? -2.416  11.466  51.144   1.00 60.81  ? 232  PHE C CD2 1 
ATOM   8051  C CE1 . PHE C 1 177 ? -4.763  11.213  49.694   1.00 63.03  ? 232  PHE C CE1 1 
ATOM   8052  C CE2 . PHE C 1 177 ? -2.836  12.499  50.309   1.00 61.37  ? 232  PHE C CE2 1 
ATOM   8053  C CZ  . PHE C 1 177 ? -4.012  12.370  49.582   1.00 57.07  ? 232  PHE C CZ  1 
ATOM   8054  N N   . GLY C 1 178 ? -0.194  8.875   50.643   1.00 47.48  ? 233  GLY C N   1 
ATOM   8055  C CA  . GLY C 1 178 ? 0.780   9.275   49.645   1.00 49.51  ? 233  GLY C CA  1 
ATOM   8056  C C   . GLY C 1 178 ? 1.063   8.166   48.648   1.00 54.34  ? 233  GLY C C   1 
ATOM   8057  O O   . GLY C 1 178 ? 1.154   8.399   47.431   1.00 55.13  ? 233  GLY C O   1 
ATOM   8058  N N   . THR C 1 179 ? 1.202   6.947   49.160   1.00 53.72  ? 234  THR C N   1 
ATOM   8059  C CA  . THR C 1 179 ? 1.445   5.801   48.290   1.00 51.94  ? 234  THR C CA  1 
ATOM   8060  C C   . THR C 1 179 ? 0.246   5.528   47.385   1.00 54.60  ? 234  THR C C   1 
ATOM   8061  O O   . THR C 1 179 ? 0.394   4.984   46.293   1.00 55.83  ? 234  THR C O   1 
ATOM   8062  C CB  . THR C 1 179 ? 1.798   4.547   49.094   1.00 50.93  ? 234  THR C CB  1 
ATOM   8063  O OG1 . THR C 1 179 ? 2.964   4.818   49.880   1.00 57.99  ? 234  THR C OG1 1 
ATOM   8064  C CG2 . THR C 1 179 ? 2.073   3.379   48.160   1.00 45.98  ? 234  THR C CG2 1 
ATOM   8065  N N   . ALA C 1 180 ? -0.943  5.910   47.837   1.00 53.25  ? 235  ALA C N   1 
ATOM   8066  C CA  . ALA C 1 180 ? -2.125  5.835   46.992   1.00 51.80  ? 235  ALA C CA  1 
ATOM   8067  C C   . ALA C 1 180 ? -1.979  6.835   45.855   1.00 53.93  ? 235  ALA C C   1 
ATOM   8068  O O   . ALA C 1 180 ? -2.268  6.527   44.701   1.00 59.17  ? 235  ALA C O   1 
ATOM   8069  C CB  . ALA C 1 180 ? -3.368  6.125   47.796   1.00 50.57  ? 235  ALA C CB  1 
ATOM   8070  N N   . ILE C 1 181 ? -1.519  8.034   46.194   1.00 53.81  ? 236  ILE C N   1 
ATOM   8071  C CA  . ILE C 1 181 ? -1.265  9.073   45.201   1.00 53.37  ? 236  ILE C CA  1 
ATOM   8072  C C   . ILE C 1 181 ? -0.342  8.562   44.103   1.00 52.27  ? 236  ILE C C   1 
ATOM   8073  O O   . ILE C 1 181 ? -0.750  8.431   42.947   1.00 51.00  ? 236  ILE C O   1 
ATOM   8074  C CB  . ILE C 1 181 ? -0.631  10.325  45.837   1.00 52.26  ? 236  ILE C CB  1 
ATOM   8075  C CG1 . ILE C 1 181 ? -1.620  11.007  46.775   1.00 51.73  ? 236  ILE C CG1 1 
ATOM   8076  C CG2 . ILE C 1 181 ? -0.169  11.301  44.770   1.00 48.89  ? 236  ILE C CG2 1 
ATOM   8077  C CD1 . ILE C 1 181 ? -1.137  12.336  47.288   1.00 48.56  ? 236  ILE C CD1 1 
ATOM   8078  N N   . ALA C 1 182 ? 0.900   8.269   44.474   1.00 51.95  ? 237  ALA C N   1 
ATOM   8079  C CA  . ALA C 1 182 ? 1.912   7.897   43.490   1.00 51.76  ? 237  ALA C CA  1 
ATOM   8080  C C   . ALA C 1 182 ? 1.684   6.532   42.835   1.00 58.33  ? 237  ALA C C   1 
ATOM   8081  O O   . ALA C 1 182 ? 2.018   6.339   41.664   1.00 59.75  ? 237  ALA C O   1 
ATOM   8082  C CB  . ALA C 1 182 ? 3.302   7.963   44.108   1.00 47.53  ? 237  ALA C CB  1 
ATOM   8083  N N   . ALA C 1 183 ? 1.129   5.582   43.583   1.00 60.46  ? 238  ALA C N   1 
ATOM   8084  C CA  . ALA C 1 183 ? 0.928   4.225   43.067   1.00 54.38  ? 238  ALA C CA  1 
ATOM   8085  C C   . ALA C 1 183 ? -0.446  4.009   42.446   1.00 50.68  ? 238  ALA C C   1 
ATOM   8086  O O   . ALA C 1 183 ? -0.669  3.005   41.781   1.00 53.75  ? 238  ALA C O   1 
ATOM   8087  C CB  . ALA C 1 183 ? 1.177   3.193   44.159   1.00 56.45  ? 238  ALA C CB  1 
ATOM   8088  N N   . PHE C 1 184 ? -1.362  4.952   42.644   1.00 53.37  ? 239  PHE C N   1 
ATOM   8089  C CA  . PHE C 1 184 ? -2.678  4.854   42.017   1.00 56.33  ? 239  PHE C CA  1 
ATOM   8090  C C   . PHE C 1 184 ? -3.114  6.122   41.289   1.00 58.98  ? 239  PHE C C   1 
ATOM   8091  O O   . PHE C 1 184 ? -3.150  6.154   40.061   1.00 61.06  ? 239  PHE C O   1 
ATOM   8092  C CB  . PHE C 1 184 ? -3.743  4.469   43.038   1.00 57.35  ? 239  PHE C CB  1 
ATOM   8093  C CG  . PHE C 1 184 ? -5.112  4.328   42.450   1.00 62.13  ? 239  PHE C CG  1 
ATOM   8094  C CD1 . PHE C 1 184 ? -5.519  3.126   41.893   1.00 64.82  ? 239  PHE C CD1 1 
ATOM   8095  C CD2 . PHE C 1 184 ? -5.996  5.396   42.450   1.00 67.00  ? 239  PHE C CD2 1 
ATOM   8096  C CE1 . PHE C 1 184 ? -6.783  2.987   41.352   1.00 67.70  ? 239  PHE C CE1 1 
ATOM   8097  C CE2 . PHE C 1 184 ? -7.266  5.266   41.908   1.00 67.12  ? 239  PHE C CE2 1 
ATOM   8098  C CZ  . PHE C 1 184 ? -7.658  4.058   41.359   1.00 67.95  ? 239  PHE C CZ  1 
ATOM   8099  N N   . TYR C 1 185 ? -3.437  7.165   42.048   1.00 56.74  ? 240  TYR C N   1 
ATOM   8100  C CA  . TYR C 1 185 ? -4.008  8.381   41.473   1.00 56.27  ? 240  TYR C CA  1 
ATOM   8101  C C   . TYR C 1 185 ? -3.225  8.899   40.282   1.00 58.59  ? 240  TYR C C   1 
ATOM   8102  O O   . TYR C 1 185 ? -3.805  9.214   39.246   1.00 59.51  ? 240  TYR C O   1 
ATOM   8103  C CB  . TYR C 1 185 ? -4.106  9.482   42.523   1.00 55.28  ? 240  TYR C CB  1 
ATOM   8104  C CG  . TYR C 1 185 ? -4.976  9.105   43.683   1.00 58.77  ? 240  TYR C CG  1 
ATOM   8105  C CD1 . TYR C 1 185 ? -6.315  9.459   43.712   1.00 57.67  ? 240  TYR C CD1 1 
ATOM   8106  C CD2 . TYR C 1 185 ? -4.461  8.382   44.748   1.00 59.03  ? 240  TYR C CD2 1 
ATOM   8107  C CE1 . TYR C 1 185 ? -7.116  9.107   44.778   1.00 62.85  ? 240  TYR C CE1 1 
ATOM   8108  C CE2 . TYR C 1 185 ? -5.249  8.028   45.815   1.00 61.06  ? 240  TYR C CE2 1 
ATOM   8109  C CZ  . TYR C 1 185 ? -6.576  8.390   45.826   1.00 68.20  ? 240  TYR C CZ  1 
ATOM   8110  O OH  . TYR C 1 185 ? -7.364  8.032   46.892   1.00 73.19  ? 240  TYR C OH  1 
ATOM   8111  N N   . MET C 1 186 ? -1.910  8.994   40.436   1.00 57.19  ? 241  MET C N   1 
ATOM   8112  C CA  . MET C 1 186 ? -1.067  9.550   39.386   1.00 56.29  ? 241  MET C CA  1 
ATOM   8113  C C   . MET C 1 186 ? -1.088  8.720   38.098   1.00 60.32  ? 241  MET C C   1 
ATOM   8114  O O   . MET C 1 186 ? -1.334  9.264   37.017   1.00 65.48  ? 241  MET C O   1 
ATOM   8115  C CB  . MET C 1 186 ? 0.364   9.771   39.887   1.00 54.57  ? 241  MET C CB  1 
ATOM   8116  C CG  . MET C 1 186 ? 1.265   10.450  38.877   1.00 59.41  ? 241  MET C CG  1 
ATOM   8117  S SD  . MET C 1 186 ? 2.077   9.295   37.752   1.00 56.98  ? 241  MET C SD  1 
ATOM   8118  C CE  . MET C 1 186 ? 3.419   8.703   38.799   1.00 49.63  ? 241  MET C CE  1 
ATOM   8119  N N   . PRO C 1 187 ? -0.830  7.403   38.200   1.00 57.24  ? 242  PRO C N   1 
ATOM   8120  C CA  . PRO C 1 187 ? -0.901  6.588   36.983   1.00 56.88  ? 242  PRO C CA  1 
ATOM   8121  C C   . PRO C 1 187 ? -2.291  6.650   36.350   1.00 61.49  ? 242  PRO C C   1 
ATOM   8122  O O   . PRO C 1 187 ? -2.415  6.634   35.122   1.00 64.24  ? 242  PRO C O   1 
ATOM   8123  C CB  . PRO C 1 187 ? -0.583  5.176   37.488   1.00 48.95  ? 242  PRO C CB  1 
ATOM   8124  C CG  . PRO C 1 187 ? 0.250   5.406   38.712   1.00 55.54  ? 242  PRO C CG  1 
ATOM   8125  C CD  . PRO C 1 187 ? -0.357  6.621   39.356   1.00 58.52  ? 242  PRO C CD  1 
ATOM   8126  N N   . VAL C 1 188 ? -3.323  6.743   37.182   1.00 59.60  ? 243  VAL C N   1 
ATOM   8127  C CA  . VAL C 1 188 ? -4.691  6.860   36.686   1.00 61.98  ? 243  VAL C CA  1 
ATOM   8128  C C   . VAL C 1 188 ? -4.880  8.127   35.857   1.00 65.04  ? 243  VAL C C   1 
ATOM   8129  O O   . VAL C 1 188 ? -5.297  8.066   34.693   1.00 70.45  ? 243  VAL C O   1 
ATOM   8130  C CB  . VAL C 1 188 ? -5.718  6.861   37.832   1.00 63.71  ? 243  VAL C CB  1 
ATOM   8131  C CG1 . VAL C 1 188 ? -7.077  7.311   37.325   1.00 64.81  ? 243  VAL C CG1 1 
ATOM   8132  C CG2 . VAL C 1 188 ? -5.812  5.483   38.466   1.00 63.30  ? 243  VAL C CG2 1 
ATOM   8133  N N   . THR C 1 189 ? -4.575  9.273   36.460   1.00 62.69  ? 244  THR C N   1 
ATOM   8134  C CA  . THR C 1 189 ? -4.728  10.554  35.783   1.00 63.48  ? 244  THR C CA  1 
ATOM   8135  C C   . THR C 1 189 ? -3.915  10.611  34.491   1.00 68.49  ? 244  THR C C   1 
ATOM   8136  O O   . THR C 1 189 ? -4.437  10.997  33.443   1.00 70.50  ? 244  THR C O   1 
ATOM   8137  C CB  . THR C 1 189 ? -4.344  11.731  36.695   1.00 58.85  ? 244  THR C CB  1 
ATOM   8138  O OG1 . THR C 1 189 ? -2.934  11.701  36.948   1.00 48.29  ? 244  THR C OG1 1 
ATOM   8139  C CG2 . THR C 1 189 ? -5.115  11.650  38.005   1.00 62.22  ? 244  THR C CG2 1 
ATOM   8140  N N   . ILE C 1 190 ? -2.644  10.220  34.556   1.00 68.43  ? 245  ILE C N   1 
ATOM   8141  C CA  . ILE C 1 190 ? -1.839  10.173  33.339   1.00 63.39  ? 245  ILE C CA  1 
ATOM   8142  C C   . ILE C 1 190 ? -2.534  9.338   32.276   1.00 61.51  ? 245  ILE C C   1 
ATOM   8143  O O   . ILE C 1 190 ? -2.752  9.807   31.160   1.00 59.48  ? 245  ILE C O   1 
ATOM   8144  C CB  . ILE C 1 190 ? -0.428  9.616   33.584   1.00 55.00  ? 245  ILE C CB  1 
ATOM   8145  C CG1 . ILE C 1 190 ? 0.523   10.750  33.966   1.00 62.36  ? 245  ILE C CG1 1 
ATOM   8146  C CG2 . ILE C 1 190 ? 0.085   8.910   32.347   1.00 50.08  ? 245  ILE C CG2 1 
ATOM   8147  C CD1 . ILE C 1 190 ? 1.974   10.331  34.066   1.00 64.23  ? 245  ILE C CD1 1 
ATOM   8148  N N   . MET C 1 191 ? -2.903  8.110   32.628   1.00 64.02  ? 246  MET C N   1 
ATOM   8149  C CA  . MET C 1 191 ? -3.571  7.233   31.669   1.00 70.13  ? 246  MET C CA  1 
ATOM   8150  C C   . MET C 1 191 ? -4.856  7.827   31.073   1.00 68.92  ? 246  MET C C   1 
ATOM   8151  O O   . MET C 1 191 ? -5.239  7.487   29.956   1.00 66.12  ? 246  MET C O   1 
ATOM   8152  C CB  . MET C 1 191 ? -3.847  5.862   32.287   1.00 65.40  ? 246  MET C CB  1 
ATOM   8153  C CG  . MET C 1 191 ? -2.600  5.023   32.469   1.00 65.11  ? 246  MET C CG  1 
ATOM   8154  S SD  . MET C 1 191 ? -2.979  3.342   32.989   1.00 86.19  ? 246  MET C SD  1 
ATOM   8155  C CE  . MET C 1 191 ? -3.889  3.662   34.500   1.00 128.32 ? 246  MET C CE  1 
ATOM   8156  N N   . THR C 1 192 ? -5.532  8.684   31.835   1.00 66.45  ? 247  THR C N   1 
ATOM   8157  C CA  . THR C 1 192 ? -6.722  9.370   31.332   1.00 65.60  ? 247  THR C CA  1 
ATOM   8158  C C   . THR C 1 192 ? -6.355  10.458  30.333   1.00 72.46  ? 247  THR C C   1 
ATOM   8159  O O   . THR C 1 192 ? -6.878  10.505  29.210   1.00 81.36  ? 247  THR C O   1 
ATOM   8160  C CB  . THR C 1 192 ? -7.553  9.982   32.468   1.00 63.11  ? 247  THR C CB  1 
ATOM   8161  O OG1 . THR C 1 192 ? -8.394  8.977   33.050   1.00 57.16  ? 247  THR C OG1 1 
ATOM   8162  C CG2 . THR C 1 192 ? -8.429  11.113  31.945   1.00 60.26  ? 247  THR C CG2 1 
ATOM   8163  N N   . ILE C 1 193 ? -5.457  11.335  30.758   1.00 65.24  ? 248  ILE C N   1 
ATOM   8164  C CA  . ILE C 1 193 ? -5.038  12.457  29.936   1.00 68.85  ? 248  ILE C CA  1 
ATOM   8165  C C   . ILE C 1 193 ? -4.398  11.966  28.635   1.00 75.60  ? 248  ILE C C   1 
ATOM   8166  O O   . ILE C 1 193 ? -4.439  12.661  27.617   1.00 79.30  ? 248  ILE C O   1 
ATOM   8167  C CB  . ILE C 1 193 ? -4.100  13.400  30.705   1.00 60.57  ? 248  ILE C CB  1 
ATOM   8168  C CG1 . ILE C 1 193 ? -4.832  13.991  31.908   1.00 59.74  ? 248  ILE C CG1 1 
ATOM   8169  C CG2 . ILE C 1 193 ? -3.612  14.515  29.808   1.00 70.84  ? 248  ILE C CG2 1 
ATOM   8170  C CD1 . ILE C 1 193 ? -3.996  14.948  32.721   1.00 62.21  ? 248  ILE C CD1 1 
ATOM   8171  N N   . LEU C 1 194 ? -3.806  10.773  28.675   1.00 71.30  ? 249  LEU C N   1 
ATOM   8172  C CA  . LEU C 1 194 ? -3.342  10.096  27.464   1.00 70.26  ? 249  LEU C CA  1 
ATOM   8173  C C   . LEU C 1 194 ? -4.492  9.495   26.670   1.00 71.75  ? 249  LEU C C   1 
ATOM   8174  O O   . LEU C 1 194 ? -4.633  9.736   25.475   1.00 78.16  ? 249  LEU C O   1 
ATOM   8175  C CB  . LEU C 1 194 ? -2.349  8.986   27.802   1.00 61.01  ? 249  LEU C CB  1 
ATOM   8176  C CG  . LEU C 1 194 ? -0.945  9.408   28.214   1.00 64.17  ? 249  LEU C CG  1 
ATOM   8177  C CD1 . LEU C 1 194 ? 0.000   8.230   28.047   1.00 65.87  ? 249  LEU C CD1 1 
ATOM   8178  C CD2 . LEU C 1 194 ? -0.485  10.596  27.387   1.00 67.89  ? 249  LEU C CD2 1 
ATOM   8179  N N   . TYR C 1 195 ? -5.316  8.709   27.348   1.00 69.61  ? 250  TYR C N   1 
ATOM   8180  C CA  . TYR C 1 195 ? -6.404  7.995   26.691   1.00 79.44  ? 250  TYR C CA  1 
ATOM   8181  C C   . TYR C 1 195 ? -7.281  8.921   25.870   1.00 80.28  ? 250  TYR C C   1 
ATOM   8182  O O   . TYR C 1 195 ? -7.766  8.535   24.809   1.00 85.44  ? 250  TYR C O   1 
ATOM   8183  C CB  . TYR C 1 195 ? -7.252  7.226   27.707   1.00 81.19  ? 250  TYR C CB  1 
ATOM   8184  C CG  . TYR C 1 195 ? -8.645  6.874   27.225   1.00 75.42  ? 250  TYR C CG  1 
ATOM   8185  C CD1 . TYR C 1 195 ? -8.853  5.865   26.293   1.00 71.58  ? 250  TYR C CD1 1 
ATOM   8186  C CD2 . TYR C 1 195 ? -9.753  7.546   27.719   1.00 81.71  ? 250  TYR C CD2 1 
ATOM   8187  C CE1 . TYR C 1 195 ? -10.131 5.544   25.863   1.00 79.06  ? 250  TYR C CE1 1 
ATOM   8188  C CE2 . TYR C 1 195 ? -11.029 7.232   27.299   1.00 82.79  ? 250  TYR C CE2 1 
ATOM   8189  C CZ  . TYR C 1 195 ? -11.215 6.233   26.373   1.00 81.80  ? 250  TYR C CZ  1 
ATOM   8190  O OH  . TYR C 1 195 ? -12.495 5.932   25.965   1.00 76.34  ? 250  TYR C OH  1 
ATOM   8191  N N   . TRP C 1 196 ? -7.486  10.143  26.350   1.00 78.03  ? 251  TRP C N   1 
ATOM   8192  C CA  . TRP C 1 196 ? -8.325  11.079  25.604   1.00 87.00  ? 251  TRP C CA  1 
ATOM   8193  C C   . TRP C 1 196 ? -7.607  11.695  24.389   1.00 89.87  ? 251  TRP C C   1 
ATOM   8194  O O   . TRP C 1 196 ? -8.255  12.179  23.455   1.00 87.72  ? 251  TRP C O   1 
ATOM   8195  C CB  . TRP C 1 196 ? -8.929  12.142  26.527   1.00 82.24  ? 251  TRP C CB  1 
ATOM   8196  C CG  . TRP C 1 196 ? -9.940  11.576  27.494   1.00 77.82  ? 251  TRP C CG  1 
ATOM   8197  C CD1 . TRP C 1 196 ? -9.795  11.442  28.844   1.00 79.49  ? 251  TRP C CD1 1 
ATOM   8198  C CD2 . TRP C 1 196 ? -11.245 11.057  27.179   1.00 83.57  ? 251  TRP C CD2 1 
ATOM   8199  N NE1 . TRP C 1 196 ? -10.927 10.882  29.391   1.00 85.51  ? 251  TRP C NE1 1 
ATOM   8200  C CE2 . TRP C 1 196 ? -11.830 10.635  28.393   1.00 87.21  ? 251  TRP C CE2 1 
ATOM   8201  C CE3 . TRP C 1 196 ? -11.974 10.914  25.994   1.00 81.33  ? 251  TRP C CE3 1 
ATOM   8202  C CZ2 . TRP C 1 196 ? -13.114 10.078  28.453   1.00 78.99  ? 251  TRP C CZ2 1 
ATOM   8203  C CZ3 . TRP C 1 196 ? -13.249 10.361  26.057   1.00 76.82  ? 251  TRP C CZ3 1 
ATOM   8204  C CH2 . TRP C 1 196 ? -13.804 9.952   27.278   1.00 72.41  ? 251  TRP C CH2 1 
ATOM   8205  N N   . ARG C 1 197 ? -6.274  11.662  24.400   1.00 87.09  ? 252  ARG C N   1 
ATOM   8206  C CA  . ARG C 1 197 ? -5.481  12.051  23.230   1.00 83.16  ? 252  ARG C CA  1 
ATOM   8207  C C   . ARG C 1 197 ? -5.408  10.926  22.190   1.00 87.19  ? 252  ARG C C   1 
ATOM   8208  O O   . ARG C 1 197 ? -5.411  11.187  20.989   1.00 93.23  ? 252  ARG C O   1 
ATOM   8209  C CB  . ARG C 1 197 ? -4.072  12.502  23.631   1.00 76.68  ? 252  ARG C CB  1 
ATOM   8210  C CG  . ARG C 1 197 ? -4.031  13.825  24.384   1.00 83.08  ? 252  ARG C CG  1 
ATOM   8211  C CD  . ARG C 1 197 ? -2.604  14.220  24.754   1.00 89.50  ? 252  ARG C CD  1 
ATOM   8212  N NE  . ARG C 1 197 ? -2.550  15.519  25.422   1.00 93.44  ? 252  ARG C NE  1 
ATOM   8213  C CZ  . ARG C 1 197 ? -1.427  16.148  25.761   1.00 97.81  ? 252  ARG C CZ  1 
ATOM   8214  N NH1 . ARG C 1 197 ? -0.249  15.603  25.496   1.00 101.11 ? 252  ARG C NH1 1 
ATOM   8215  N NH2 . ARG C 1 197 ? -1.485  17.327  26.365   1.00 104.58 ? 252  ARG C NH2 1 
ATOM   8216  N N   . ILE C 1 198 ? -5.337  9.680   22.654   1.00 87.50  ? 253  ILE C N   1 
ATOM   8217  C CA  . ILE C 1 198 ? -5.361  8.526   21.753   1.00 84.44  ? 253  ILE C CA  1 
ATOM   8218  C C   . ILE C 1 198 ? -6.744  8.354   21.136   1.00 86.19  ? 253  ILE C C   1 
ATOM   8219  O O   . ILE C 1 198 ? -6.880  7.915   19.993   1.00 81.74  ? 253  ILE C O   1 
ATOM   8220  C CB  . ILE C 1 198 ? -4.968  7.223   22.476   1.00 84.87  ? 253  ILE C CB  1 
ATOM   8221  C CG1 . ILE C 1 198 ? -3.502  7.283   22.917   1.00 93.92  ? 253  ILE C CG1 1 
ATOM   8222  C CG2 . ILE C 1 198 ? -5.216  6.015   21.576   1.00 84.73  ? 253  ILE C CG2 1 
ATOM   8223  C CD1 . ILE C 1 198 ? -3.009  6.023   23.606   1.00 92.44  ? 253  ILE C CD1 1 
ATOM   8224  N N   . TYR C 1 199 ? -7.768  8.701   21.906   1.00 95.13  ? 254  TYR C N   1 
ATOM   8225  C CA  . TYR C 1 199 ? -9.139  8.685   21.418   1.00 96.07  ? 254  TYR C CA  1 
ATOM   8226  C C   . TYR C 1 199 ? -9.338  9.863   20.475   1.00 95.06  ? 254  TYR C C   1 
ATOM   8227  O O   . TYR C 1 199 ? -9.978  9.732   19.432   1.00 92.46  ? 254  TYR C O   1 
ATOM   8228  C CB  . TYR C 1 199 ? -10.121 8.751   22.591   1.00 95.50  ? 254  TYR C CB  1 
ATOM   8229  C CG  . TYR C 1 199 ? -11.588 8.773   22.207   1.00 99.60  ? 254  TYR C CG  1 
ATOM   8230  C CD1 . TYR C 1 199 ? -12.294 7.592   22.003   1.00 99.73  ? 254  TYR C CD1 1 
ATOM   8231  C CD2 . TYR C 1 199 ? -12.273 9.976   22.077   1.00 101.72 ? 254  TYR C CD2 1 
ATOM   8232  C CE1 . TYR C 1 199 ? -13.640 7.612   21.663   1.00 104.76 ? 254  TYR C CE1 1 
ATOM   8233  C CE2 . TYR C 1 199 ? -13.614 10.007  21.740   1.00 102.58 ? 254  TYR C CE2 1 
ATOM   8234  C CZ  . TYR C 1 199 ? -14.293 8.824   21.533   1.00 107.28 ? 254  TYR C CZ  1 
ATOM   8235  O OH  . TYR C 1 199 ? -15.629 8.857   21.197   1.00 106.49 ? 254  TYR C OH  1 
ATOM   8236  N N   . LYS C 1 200 ? -8.774  11.013  20.835   1.00 92.24  ? 255  LYS C N   1 
ATOM   8237  C CA  . LYS C 1 200 ? -8.891  12.191  19.989   1.00 90.00  ? 255  LYS C CA  1 
ATOM   8238  C C   . LYS C 1 200 ? -8.398  11.888  18.578   1.00 88.03  ? 255  LYS C C   1 
ATOM   8239  O O   . LYS C 1 200 ? -9.203  11.780  17.658   1.00 93.98  ? 255  LYS C O   1 
ATOM   8240  C CB  . LYS C 1 200 ? -8.139  13.387  20.581   1.00 95.43  ? 255  LYS C CB  1 
ATOM   8241  C CG  . LYS C 1 200 ? -8.369  14.684  19.818   1.00 97.56  ? 255  LYS C CG  1 
ATOM   8242  C CD  . LYS C 1 200 ? -7.681  15.863  20.487   1.00 102.83 ? 255  LYS C CD  1 
ATOM   8243  C CE  . LYS C 1 200 ? -7.855  17.130  19.667   1.00 101.75 ? 255  LYS C CE  1 
ATOM   8244  N NZ  . LYS C 1 200 ? -9.294  17.459  19.470   1.00 102.97 ? 255  LYS C NZ  1 
ATOM   8245  N N   . GLU C 1 201 ? -7.091  11.716  18.402   1.00 85.81  ? 256  GLU C N   1 
ATOM   8246  C CA  . GLU C 1 201 ? -6.569  11.504  17.057   1.00 87.42  ? 256  GLU C CA  1 
ATOM   8247  C C   . GLU C 1 201 ? -6.011  10.103  16.842   1.00 86.72  ? 256  GLU C C   1 
ATOM   8248  O O   . GLU C 1 201 ? -4.898  9.800   17.269   1.00 78.41  ? 256  GLU C O   1 
ATOM   8249  C CB  . GLU C 1 201 ? -5.471  12.532  16.767   1.00 86.77  ? 256  GLU C CB  1 
ATOM   8250  N N   . THR C 1 202 ? -6.784  9.269   16.146   1.00 95.34  ? 257  THR C N   1 
ATOM   8251  C CA  . THR C 1 202 ? -6.313  7.978   15.648   1.00 98.19  ? 257  THR C CA  1 
ATOM   8252  C C   . THR C 1 202 ? -5.974  8.137   14.170   1.00 99.16  ? 257  THR C C   1 
ATOM   8253  O O   . THR C 1 202 ? -5.511  7.206   13.511   1.00 91.40  ? 257  THR C O   1 
ATOM   8254  C CB  . THR C 1 202 ? -7.378  6.873   15.827   1.00 96.57  ? 257  THR C CB  1 
ATOM   8255  O OG1 . THR C 1 202 ? -7.889  6.906   17.165   1.00 95.88  ? 257  THR C OG1 1 
ATOM   8256  C CG2 . THR C 1 202 ? -6.789  5.495   15.549   1.00 94.30  ? 257  THR C CG2 1 
ATOM   8257  N N   . GLU C 1 203 ? -6.220  9.340   13.663   1.00 105.87 ? 258  GLU C N   1 
ATOM   8258  C CA  . GLU C 1 203 ? -6.054  9.658   12.250   1.00 107.81 ? 258  GLU C CA  1 
ATOM   8259  C C   . GLU C 1 203 ? -4.594  9.614   11.797   1.00 108.23 ? 258  GLU C C   1 
ATOM   8260  O O   . GLU C 1 203 ? -4.259  8.971   10.791   1.00 106.11 ? 258  GLU C O   1 
ATOM   8261  C CB  . GLU C 1 203 ? -6.636  11.048  11.965   1.00 118.24 ? 258  GLU C CB  1 
ATOM   8262  C CG  . GLU C 1 203 ? -6.015  12.157  12.820   1.00 125.90 ? 258  GLU C CG  1 
ATOM   8263  C CD  . GLU C 1 203 ? -6.378  13.559  12.353   1.00 135.74 ? 258  GLU C CD  1 
ATOM   8264  O OE1 . GLU C 1 203 ? -5.594  14.496  12.626   1.00 132.45 ? 258  GLU C OE1 1 
ATOM   8265  O OE2 . GLU C 1 203 ? -7.444  13.728  11.722   1.00 137.87 ? 258  GLU C OE2 1 
ATOM   8266  N N   . LYS C 1 204 ? -3.735  10.316  12.534   1.00 98.98  ? 259  LYS C N   1 
ATOM   8267  C CA  . LYS C 1 204 ? -2.337  10.469  12.152   1.00 94.18  ? 259  LYS C CA  1 
ATOM   8268  C C   . LYS C 1 204 ? -1.670  9.115   11.959   1.00 95.25  ? 259  LYS C C   1 
ATOM   8269  O O   . LYS C 1 204 ? -0.701  8.984   11.204   1.00 92.45  ? 259  LYS C O   1 
ATOM   8270  C CB  . LYS C 1 204 ? -1.590  11.310  13.187   1.00 92.98  ? 259  LYS C CB  1 
ATOM   8271  C CG  . LYS C 1 204 ? -2.198  12.690  13.391   1.00 91.90  ? 259  LYS C CG  1 
ATOM   8272  C CD  . LYS C 1 204 ? -1.266  13.599  14.173   1.00 91.22  ? 259  LYS C CD  1 
ATOM   8273  C CE  . LYS C 1 204 ? -1.840  15.004  14.295   1.00 91.47  ? 259  LYS C CE  1 
ATOM   8274  N NZ  . LYS C 1 204 ? -0.947  15.908  15.075   1.00 90.06  ? 259  LYS C NZ  1 
ATOM   8275  N N   . MET C 1 205 ? -2.216  8.111   12.639   1.00 93.50  ? 1001 MET C N   1 
ATOM   8276  C CA  . MET C 1 205 ? -1.781  6.731   12.492   1.00 94.83  ? 1001 MET C CA  1 
ATOM   8277  C C   . MET C 1 205 ? -1.661  6.358   11.012   1.00 97.25  ? 1001 MET C C   1 
ATOM   8278  O O   . MET C 1 205 ? -0.565  6.097   10.512   1.00 92.87  ? 1001 MET C O   1 
ATOM   8279  C CB  . MET C 1 205 ? -2.785  5.809   13.184   1.00 89.26  ? 1001 MET C CB  1 
ATOM   8280  C CG  . MET C 1 205 ? -2.322  4.377   13.362   1.00 100.49 ? 1001 MET C CG  1 
ATOM   8281  S SD  . MET C 1 205 ? -1.153  4.181   14.717   1.00 133.45 ? 1001 MET C SD  1 
ATOM   8282  C CE  . MET C 1 205 ? -1.286  2.426   15.025   1.00 76.24  ? 1001 MET C CE  1 
ATOM   8283  N N   . ASN C 1 206 ? -2.796  6.326   10.319   1.00 94.05  ? 1002 ASN C N   1 
ATOM   8284  C CA  . ASN C 1 206 ? -2.833  5.985   8.898    1.00 84.59  ? 1002 ASN C CA  1 
ATOM   8285  C C   . ASN C 1 206 ? -2.431  7.124   7.959    1.00 86.68  ? 1002 ASN C C   1 
ATOM   8286  O O   . ASN C 1 206 ? -1.656  6.917   7.010    1.00 88.95  ? 1002 ASN C O   1 
ATOM   8287  C CB  . ASN C 1 206 ? -4.216  5.459   8.512    1.00 84.64  ? 1002 ASN C CB  1 
ATOM   8288  C CG  . ASN C 1 206 ? -4.537  4.125   9.163    1.00 89.76  ? 1002 ASN C CG  1 
ATOM   8289  O OD1 . ASN C 1 206 ? -5.606  3.949   9.748    1.00 90.77  ? 1002 ASN C OD1 1 
ATOM   8290  N ND2 . ASN C 1 206 ? -3.610  3.177   9.062    1.00 86.42  ? 1002 ASN C ND2 1 
ATOM   8291  N N   . ILE C 1 207 ? -2.963  8.321   8.207    1.00 89.43  ? 1003 ILE C N   1 
ATOM   8292  C CA  . ILE C 1 207 ? -2.655  9.445   7.325    1.00 83.38  ? 1003 ILE C CA  1 
ATOM   8293  C C   . ILE C 1 207 ? -1.145  9.621   7.237    1.00 80.93  ? 1003 ILE C C   1 
ATOM   8294  O O   . ILE C 1 207 ? -0.626  10.055  6.209    1.00 77.87  ? 1003 ILE C O   1 
ATOM   8295  C CB  . ILE C 1 207 ? -3.317  10.770  7.761    1.00 77.10  ? 1003 ILE C CB  1 
ATOM   8296  C CG1 . ILE C 1 207 ? -2.450  11.505  8.786    1.00 79.90  ? 1003 ILE C CG1 1 
ATOM   8297  C CG2 . ILE C 1 207 ? -4.735  10.525  8.260    1.00 78.94  ? 1003 ILE C CG2 1 
ATOM   8298  C CD1 . ILE C 1 207 ? -2.936  12.897  9.110    1.00 85.87  ? 1003 ILE C CD1 1 
ATOM   8299  N N   . PHE C 1 208 ? -0.442  9.269   8.311    1.00 80.31  ? 1004 PHE C N   1 
ATOM   8300  C CA  . PHE C 1 208 ? 1.009   9.249   8.265    1.00 76.75  ? 1004 PHE C CA  1 
ATOM   8301  C C   . PHE C 1 208 ? 1.476   8.360   7.121    1.00 78.36  ? 1004 PHE C C   1 
ATOM   8302  O O   . PHE C 1 208 ? 2.081   8.842   6.171    1.00 79.11  ? 1004 PHE C O   1 
ATOM   8303  C CB  . PHE C 1 208 ? 1.611   8.762   9.578    1.00 76.06  ? 1004 PHE C CB  1 
ATOM   8304  C CG  . PHE C 1 208 ? 3.043   8.329   9.449    1.00 74.95  ? 1004 PHE C CG  1 
ATOM   8305  C CD1 . PHE C 1 208 ? 4.055   9.265   9.326    1.00 72.67  ? 1004 PHE C CD1 1 
ATOM   8306  C CD2 . PHE C 1 208 ? 3.376   6.984   9.433    1.00 80.05  ? 1004 PHE C CD2 1 
ATOM   8307  C CE1 . PHE C 1 208 ? 5.376   8.869   9.196    1.00 76.09  ? 1004 PHE C CE1 1 
ATOM   8308  C CE2 . PHE C 1 208 ? 4.693   6.578   9.304    1.00 76.93  ? 1004 PHE C CE2 1 
ATOM   8309  C CZ  . PHE C 1 208 ? 5.696   7.523   9.185    1.00 76.55  ? 1004 PHE C CZ  1 
ATOM   8310  N N   . GLU C 1 209 ? 1.179   7.066   7.210    1.00 81.31  ? 1005 GLU C N   1 
ATOM   8311  C CA  . GLU C 1 209 ? 1.610   6.108   6.195    1.00 82.99  ? 1005 GLU C CA  1 
ATOM   8312  C C   . GLU C 1 209 ? 1.308   6.638   4.800    1.00 79.69  ? 1005 GLU C C   1 
ATOM   8313  O O   . GLU C 1 209 ? 2.109   6.474   3.874    1.00 80.36  ? 1005 GLU C O   1 
ATOM   8314  C CB  . GLU C 1 209 ? 0.906   4.763   6.382    1.00 90.53  ? 1005 GLU C CB  1 
ATOM   8315  C CG  . GLU C 1 209 ? 0.823   4.277   7.822    1.00 92.50  ? 1005 GLU C CG  1 
ATOM   8316  C CD  . GLU C 1 209 ? 0.151   2.917   7.938    1.00 97.17  ? 1005 GLU C CD  1 
ATOM   8317  O OE1 . GLU C 1 209 ? -0.472  2.641   8.988    1.00 93.03  ? 1005 GLU C OE1 1 
ATOM   8318  O OE2 . GLU C 1 209 ? 0.250   2.124   6.976    1.00 99.82  ? 1005 GLU C OE2 1 
ATOM   8319  N N   . MET C 1 210 ? 0.150   7.276   4.653    1.00 75.86  ? 1006 MET C N   1 
ATOM   8320  C CA  . MET C 1 210 ? -0.230  7.833   3.361    1.00 67.72  ? 1006 MET C CA  1 
ATOM   8321  C C   . MET C 1 210 ? 0.702   8.952   2.901    1.00 71.00  ? 1006 MET C C   1 
ATOM   8322  O O   . MET C 1 210 ? 1.233   8.903   1.793    1.00 74.23  ? 1006 MET C O   1 
ATOM   8323  C CB  . MET C 1 210 ? -1.669  8.333   3.388    1.00 69.90  ? 1006 MET C CB  1 
ATOM   8324  C CG  . MET C 1 210 ? -2.071  9.061   2.124    1.00 74.85  ? 1006 MET C CG  1 
ATOM   8325  S SD  . MET C 1 210 ? -3.809  9.525   2.118    1.00 89.20  ? 1006 MET C SD  1 
ATOM   8326  C CE  . MET C 1 210 ? -3.917  10.415  0.570    1.00 87.09  ? 1006 MET C CE  1 
ATOM   8327  N N   . LEU C 1 211 ? 0.895   9.959   3.750    1.00 68.74  ? 1007 LEU C N   1 
ATOM   8328  C CA  . LEU C 1 211 ? 1.749   11.096  3.412    1.00 68.53  ? 1007 LEU C CA  1 
ATOM   8329  C C   . LEU C 1 211 ? 3.212   10.716  3.263    1.00 71.25  ? 1007 LEU C C   1 
ATOM   8330  O O   . LEU C 1 211 ? 3.979   11.427  2.624    1.00 74.70  ? 1007 LEU C O   1 
ATOM   8331  C CB  . LEU C 1 211 ? 1.615   12.208  4.449    1.00 64.96  ? 1007 LEU C CB  1 
ATOM   8332  C CG  . LEU C 1 211 ? 0.372   13.085  4.298    1.00 67.72  ? 1007 LEU C CG  1 
ATOM   8333  C CD1 . LEU C 1 211 ? 0.385   14.205  5.317    1.00 73.25  ? 1007 LEU C CD1 1 
ATOM   8334  C CD2 . LEU C 1 211 ? 0.293   13.641  2.893    1.00 66.92  ? 1007 LEU C CD2 1 
ATOM   8335  N N   . ARG C 1 212 ? 3.605   9.611   3.878    1.00 73.80  ? 1008 ARG C N   1 
ATOM   8336  C CA  . ARG C 1 212 ? 4.957   9.108   3.712    1.00 76.63  ? 1008 ARG C CA  1 
ATOM   8337  C C   . ARG C 1 212 ? 5.091   8.438   2.357    1.00 80.36  ? 1008 ARG C C   1 
ATOM   8338  O O   . ARG C 1 212 ? 6.026   8.714   1.609    1.00 77.40  ? 1008 ARG C O   1 
ATOM   8339  C CB  . ARG C 1 212 ? 5.325   8.119   4.819    1.00 79.88  ? 1008 ARG C CB  1 
ATOM   8340  C CG  . ARG C 1 212 ? 6.632   7.385   4.546    1.00 87.88  ? 1008 ARG C CG  1 
ATOM   8341  C CD  . ARG C 1 212 ? 7.714   8.357   4.077    1.00 84.47  ? 1008 ARG C CD  1 
ATOM   8342  N NE  . ARG C 1 212 ? 8.848   7.686   3.449    1.00 75.12  ? 1008 ARG C NE  1 
ATOM   8343  C CZ  . ARG C 1 212 ? 9.876   7.182   4.121    1.00 77.27  ? 1008 ARG C CZ  1 
ATOM   8344  N NH1 . ARG C 1 212 ? 9.909   7.267   5.443    1.00 79.91  ? 1008 ARG C NH1 1 
ATOM   8345  N NH2 . ARG C 1 212 ? 10.869  6.591   3.476    1.00 81.14  ? 1008 ARG C NH2 1 
ATOM   8346  N N   . ILE C 1 213 ? 4.145   7.556   2.047    1.00 89.49  ? 1009 ILE C N   1 
ATOM   8347  C CA  . ILE C 1 213 ? 4.177   6.830   0.783    1.00 91.63  ? 1009 ILE C CA  1 
ATOM   8348  C C   . ILE C 1 213 ? 4.105   7.787   -0.407   1.00 91.10  ? 1009 ILE C C   1 
ATOM   8349  O O   . ILE C 1 213 ? 4.823   7.616   -1.395   1.00 89.08  ? 1009 ILE C O   1 
ATOM   8350  C CB  . ILE C 1 213 ? 3.056   5.776   0.706    1.00 80.62  ? 1009 ILE C CB  1 
ATOM   8351  C CG1 . ILE C 1 213 ? 3.271   4.718   1.791    1.00 80.52  ? 1009 ILE C CG1 1 
ATOM   8352  C CG2 . ILE C 1 213 ? 3.022   5.132   -0.671   1.00 76.83  ? 1009 ILE C CG2 1 
ATOM   8353  C CD1 . ILE C 1 213 ? 2.216   3.643   1.821    1.00 85.82  ? 1009 ILE C CD1 1 
ATOM   8354  N N   . ASP C 1 214 ? 3.243   8.794   -0.307   1.00 88.20  ? 1010 ASP C N   1 
ATOM   8355  C CA  . ASP C 1 214 ? 3.152   9.815   -1.345   1.00 90.62  ? 1010 ASP C CA  1 
ATOM   8356  C C   . ASP C 1 214 ? 4.362   10.741  -1.342   1.00 92.78  ? 1010 ASP C C   1 
ATOM   8357  O O   . ASP C 1 214 ? 5.031   10.917  -2.363   1.00 92.74  ? 1010 ASP C O   1 
ATOM   8358  C CB  . ASP C 1 214 ? 1.884   10.650  -1.160   1.00 88.68  ? 1010 ASP C CB  1 
ATOM   8359  C CG  . ASP C 1 214 ? 0.658   9.982   -1.732   1.00 89.96  ? 1010 ASP C CG  1 
ATOM   8360  O OD1 . ASP C 1 214 ? 0.810   9.174   -2.672   1.00 93.64  ? 1010 ASP C OD1 1 
ATOM   8361  O OD2 . ASP C 1 214 ? -0.456  10.269  -1.248   1.00 88.68  ? 1010 ASP C OD2 1 
ATOM   8362  N N   . GLU C 1 215 ? 4.632   11.322  -0.178   1.00 89.93  ? 1011 GLU C N   1 
ATOM   8363  C CA  . GLU C 1 215 ? 5.606   12.398  -0.044   1.00 91.80  ? 1011 GLU C CA  1 
ATOM   8364  C C   . GLU C 1 215 ? 7.058   11.934  0.035    1.00 87.47  ? 1011 GLU C C   1 
ATOM   8365  O O   . GLU C 1 215 ? 7.974   12.663  -0.343   1.00 85.79  ? 1011 GLU C O   1 
ATOM   8366  C CB  . GLU C 1 215 ? 5.275   13.242  1.191    1.00 93.41  ? 1011 GLU C CB  1 
ATOM   8367  C CG  . GLU C 1 215 ? 6.139   14.470  1.325    1.00 100.38 ? 1011 GLU C CG  1 
ATOM   8368  C CD  . GLU C 1 215 ? 5.898   15.464  0.208    1.00 101.50 ? 1011 GLU C CD  1 
ATOM   8369  O OE1 . GLU C 1 215 ? 4.731   15.870  0.021    1.00 93.91  ? 1011 GLU C OE1 1 
ATOM   8370  O OE2 . GLU C 1 215 ? 6.873   15.836  -0.480   1.00 105.26 ? 1011 GLU C OE2 1 
ATOM   8371  N N   . GLY C 1 216 ? 7.272   10.735  0.558    1.00 86.12  ? 1012 GLY C N   1 
ATOM   8372  C CA  . GLY C 1 216 ? 8.622   10.242  0.737    1.00 87.19  ? 1012 GLY C CA  1 
ATOM   8373  C C   . GLY C 1 216 ? 9.308   11.001  1.858    1.00 86.39  ? 1012 GLY C C   1 
ATOM   8374  O O   . GLY C 1 216 ? 8.821   12.038  2.308    1.00 83.96  ? 1012 GLY C O   1 
ATOM   8375  N N   . LEU C 1 217 ? 10.461  10.502  2.287    1.00 90.28  ? 1013 LEU C N   1 
ATOM   8376  C CA  . LEU C 1 217 ? 11.172  11.073  3.424    1.00 86.94  ? 1013 LEU C CA  1 
ATOM   8377  C C   . LEU C 1 217 ? 12.652  11.308  3.110    1.00 95.39  ? 1013 LEU C C   1 
ATOM   8378  O O   . LEU C 1 217 ? 13.331  10.431  2.574    1.00 88.49  ? 1013 LEU C O   1 
ATOM   8379  C CB  . LEU C 1 217 ? 11.000  10.152  4.636    1.00 77.47  ? 1013 LEU C CB  1 
ATOM   8380  C CG  . LEU C 1 217 ? 11.948  10.208  5.834    1.00 81.57  ? 1013 LEU C CG  1 
ATOM   8381  C CD1 . LEU C 1 217 ? 11.275  9.567   7.033    1.00 79.92  ? 1013 LEU C CD1 1 
ATOM   8382  C CD2 . LEU C 1 217 ? 13.269  9.514   5.533    1.00 82.48  ? 1013 LEU C CD2 1 
ATOM   8383  N N   . ARG C 1 218 ? 13.136  12.505  3.431    1.00 96.86  ? 1014 ARG C N   1 
ATOM   8384  C CA  . ARG C 1 218 ? 14.548  12.840  3.266    1.00 95.76  ? 1014 ARG C CA  1 
ATOM   8385  C C   . ARG C 1 218 ? 15.057  13.601  4.483    1.00 99.32  ? 1014 ARG C C   1 
ATOM   8386  O O   . ARG C 1 218 ? 14.497  14.631  4.855    1.00 99.87  ? 1014 ARG C O   1 
ATOM   8387  C CB  . ARG C 1 218 ? 14.774  13.681  2.011    1.00 99.73  ? 1014 ARG C CB  1 
ATOM   8388  C CG  . ARG C 1 218 ? 14.315  13.035  0.720    1.00 102.82 ? 1014 ARG C CG  1 
ATOM   8389  C CD  . ARG C 1 218 ? 14.991  13.701  -0.461   1.00 107.41 ? 1014 ARG C CD  1 
ATOM   8390  N NE  . ARG C 1 218 ? 14.232  13.561  -1.698   1.00 113.08 ? 1014 ARG C NE  1 
ATOM   8391  C CZ  . ARG C 1 218 ? 14.681  13.936  -2.891   1.00 113.27 ? 1014 ARG C CZ  1 
ATOM   8392  N NH1 . ARG C 1 218 ? 15.892  14.466  -3.008   1.00 111.11 ? 1014 ARG C NH1 1 
ATOM   8393  N NH2 . ARG C 1 218 ? 13.925  13.776  -3.969   1.00 118.85 ? 1014 ARG C NH2 1 
ATOM   8394  N N   . LEU C 1 219 ? 16.125  13.094  5.092    1.00 103.51 ? 1015 LEU C N   1 
ATOM   8395  C CA  . LEU C 1 219 ? 16.663  13.669  6.323    1.00 103.67 ? 1015 LEU C CA  1 
ATOM   8396  C C   . LEU C 1 219 ? 17.340  15.014  6.077    1.00 99.71  ? 1015 LEU C C   1 
ATOM   8397  O O   . LEU C 1 219 ? 17.537  15.805  7.000    1.00 100.18 ? 1015 LEU C O   1 
ATOM   8398  C CB  . LEU C 1 219 ? 17.639  12.690  6.981    1.00 105.29 ? 1015 LEU C CB  1 
ATOM   8399  C CG  . LEU C 1 219 ? 17.040  11.328  7.346    1.00 105.03 ? 1015 LEU C CG  1 
ATOM   8400  C CD1 . LEU C 1 219 ? 18.080  10.416  7.987    1.00 101.67 ? 1015 LEU C CD1 1 
ATOM   8401  C CD2 . LEU C 1 219 ? 15.840  11.509  8.264    1.00 104.48 ? 1015 LEU C CD2 1 
ATOM   8402  N N   . LYS C 1 220 ? 17.687  15.269  4.824    1.00 97.91  ? 1016 LYS C N   1 
ATOM   8403  C CA  . LYS C 1 220 ? 18.337  16.513  4.453    1.00 100.48 ? 1016 LYS C CA  1 
ATOM   8404  C C   . LYS C 1 220 ? 17.455  17.270  3.477    1.00 106.63 ? 1016 LYS C C   1 
ATOM   8405  O O   . LYS C 1 220 ? 16.575  16.690  2.845    1.00 110.18 ? 1016 LYS C O   1 
ATOM   8406  C CB  . LYS C 1 220 ? 19.705  16.239  3.826    1.00 96.66  ? 1016 LYS C CB  1 
ATOM   8407  N N   . ILE C 1 221 ? 17.691  18.571  3.366    1.00 111.55 ? 1017 ILE C N   1 
ATOM   8408  C CA  . ILE C 1 221 ? 16.922  19.411  2.461    1.00 114.08 ? 1017 ILE C CA  1 
ATOM   8409  C C   . ILE C 1 221 ? 16.965  18.846  1.044    1.00 116.95 ? 1017 ILE C C   1 
ATOM   8410  O O   . ILE C 1 221 ? 17.970  18.273  0.627    1.00 114.48 ? 1017 ILE C O   1 
ATOM   8411  C CB  . ILE C 1 221 ? 17.458  20.853  2.455    1.00 113.46 ? 1017 ILE C CB  1 
ATOM   8412  C CG1 . ILE C 1 221 ? 17.622  21.361  3.891    1.00 114.60 ? 1017 ILE C CG1 1 
ATOM   8413  C CG2 . ILE C 1 221 ? 16.542  21.758  1.646    1.00 116.25 ? 1017 ILE C CG2 1 
ATOM   8414  C CD1 . ILE C 1 221 ? 18.180  22.764  3.989    1.00 117.67 ? 1017 ILE C CD1 1 
ATOM   8415  N N   . TYR C 1 222 ? 15.858  18.977  0.322    1.00 119.16 ? 1018 TYR C N   1 
ATOM   8416  C CA  . TYR C 1 222 ? 15.778  18.499  -1.053   1.00 121.30 ? 1018 TYR C CA  1 
ATOM   8417  C C   . TYR C 1 222 ? 14.872  19.394  -1.890   1.00 124.14 ? 1018 TYR C C   1 
ATOM   8418  O O   . TYR C 1 222 ? 13.949  20.023  -1.372   1.00 116.30 ? 1018 TYR C O   1 
ATOM   8419  C CB  . TYR C 1 222 ? 15.286  17.048  -1.102   1.00 120.87 ? 1018 TYR C CB  1 
ATOM   8420  C CG  . TYR C 1 222 ? 13.811  16.877  -0.800   1.00 120.98 ? 1018 TYR C CG  1 
ATOM   8421  C CD1 . TYR C 1 222 ? 12.862  16.925  -1.816   1.00 123.53 ? 1018 TYR C CD1 1 
ATOM   8422  C CD2 . TYR C 1 222 ? 13.366  16.662  0.498    1.00 116.96 ? 1018 TYR C CD2 1 
ATOM   8423  C CE1 . TYR C 1 222 ? 11.514  16.769  -1.545   1.00 119.56 ? 1018 TYR C CE1 1 
ATOM   8424  C CE2 . TYR C 1 222 ? 12.019  16.505  0.777    1.00 113.56 ? 1018 TYR C CE2 1 
ATOM   8425  C CZ  . TYR C 1 222 ? 11.099  16.559  -0.248   1.00 113.08 ? 1018 TYR C CZ  1 
ATOM   8426  O OH  . TYR C 1 222 ? 9.760   16.403  0.027    1.00 101.20 ? 1018 TYR C OH  1 
ATOM   8427  N N   . LYS C 1 223 ? 15.142  19.442  -3.190   1.00 131.68 ? 1019 LYS C N   1 
ATOM   8428  C CA  . LYS C 1 223 ? 14.363  20.267  -4.101   1.00 129.67 ? 1019 LYS C CA  1 
ATOM   8429  C C   . LYS C 1 223 ? 12.994  19.653  -4.369   1.00 122.89 ? 1019 LYS C C   1 
ATOM   8430  O O   . LYS C 1 223 ? 12.856  18.437  -4.504   1.00 112.89 ? 1019 LYS C O   1 
ATOM   8431  C CB  . LYS C 1 223 ? 15.112  20.465  -5.419   1.00 130.56 ? 1019 LYS C CB  1 
ATOM   8432  C CG  . LYS C 1 223 ? 14.887  21.824  -6.052   1.00 124.74 ? 1019 LYS C CG  1 
ATOM   8433  C CD  . LYS C 1 223 ? 15.349  22.924  -5.115   1.00 125.80 ? 1019 LYS C CD  1 
ATOM   8434  C CE  . LYS C 1 223 ? 15.327  24.280  -5.792   1.00 133.61 ? 1019 LYS C CE  1 
ATOM   8435  N NZ  . LYS C 1 223 ? 15.696  25.360  -4.836   1.00 143.77 ? 1019 LYS C NZ  1 
ATOM   8436  N N   . ASP C 1 224 ? 11.984  20.510  -4.448   1.00 125.58 ? 1020 ASP C N   1 
ATOM   8437  C CA  . ASP C 1 224 ? 10.621  20.080  -4.723   1.00 128.08 ? 1020 ASP C CA  1 
ATOM   8438  C C   . ASP C 1 224 ? 10.439  19.854  -6.221   1.00 130.67 ? 1020 ASP C C   1 
ATOM   8439  O O   . ASP C 1 224 ? 11.357  20.086  -7.011   1.00 132.19 ? 1020 ASP C O   1 
ATOM   8440  C CB  . ASP C 1 224 ? 9.637   21.148  -4.235   1.00 123.91 ? 1020 ASP C CB  1 
ATOM   8441  C CG  . ASP C 1 224 ? 8.206   20.650  -4.172   1.00 117.80 ? 1020 ASP C CG  1 
ATOM   8442  O OD1 . ASP C 1 224 ? 7.950   19.491  -4.555   1.00 116.33 ? 1020 ASP C OD1 1 
ATOM   8443  O OD2 . ASP C 1 224 ? 7.330   21.427  -3.744   1.00 116.91 ? 1020 ASP C OD2 1 
ATOM   8444  N N   . THR C 1 225 ? 9.247   19.408  -6.605   1.00 127.04 ? 1021 THR C N   1 
ATOM   8445  C CA  . THR C 1 225 ? 8.895   19.241  -8.007   1.00 124.74 ? 1021 THR C CA  1 
ATOM   8446  C C   . THR C 1 225 ? 8.613   20.602  -8.631   1.00 129.64 ? 1021 THR C C   1 
ATOM   8447  O O   . THR C 1 225 ? 8.684   20.768  -9.848   1.00 128.89 ? 1021 THR C O   1 
ATOM   8448  C CB  . THR C 1 225 ? 7.653   18.350  -8.171   1.00 114.75 ? 1021 THR C CB  1 
ATOM   8449  O OG1 . THR C 1 225 ? 6.645   18.767  -7.242   1.00 111.56 ? 1021 THR C OG1 1 
ATOM   8450  C CG2 . THR C 1 225 ? 7.999   16.896  -7.906   1.00 107.81 ? 1021 THR C CG2 1 
ATOM   8451  N N   . GLU C 1 226 ? 8.274   21.572  -7.788   1.00 126.38 ? 1022 GLU C N   1 
ATOM   8452  C CA  . GLU C 1 226 ? 8.045   22.934  -8.246   1.00 120.73 ? 1022 GLU C CA  1 
ATOM   8453  C C   . GLU C 1 226 ? 9.287   23.803  -8.066   1.00 123.99 ? 1022 GLU C C   1 
ATOM   8454  O O   . GLU C 1 226 ? 9.277   24.987  -8.395   1.00 133.06 ? 1022 GLU C O   1 
ATOM   8455  C CB  . GLU C 1 226 ? 6.846   23.548  -7.525   1.00 120.74 ? 1022 GLU C CB  1 
ATOM   8456  C CG  . GLU C 1 226 ? 5.534   22.845  -7.821   1.00 125.65 ? 1022 GLU C CG  1 
ATOM   8457  C CD  . GLU C 1 226 ? 4.358   23.488  -7.113   1.00 142.96 ? 1022 GLU C CD  1 
ATOM   8458  O OE1 . GLU C 1 226 ? 4.591   24.373  -6.263   1.00 150.06 ? 1022 GLU C OE1 1 
ATOM   8459  O OE2 . GLU C 1 226 ? 3.202   23.111  -7.409   1.00 140.11 ? 1022 GLU C OE2 1 
ATOM   8460  N N   . GLY C 1 227 ? 10.352  23.212  -7.534   1.00 119.86 ? 1023 GLY C N   1 
ATOM   8461  C CA  . GLY C 1 227 ? 11.615  23.913  -7.394   1.00 123.27 ? 1023 GLY C CA  1 
ATOM   8462  C C   . GLY C 1 227 ? 11.793  24.639  -6.074   1.00 129.74 ? 1023 GLY C C   1 
ATOM   8463  O O   . GLY C 1 227 ? 12.662  25.500  -5.945   1.00 131.19 ? 1023 GLY C O   1 
ATOM   8464  N N   . TYR C 1 228 ? 10.961  24.305  -5.094   1.00 132.32 ? 1024 TYR C N   1 
ATOM   8465  C CA  . TYR C 1 228 ? 11.087  24.873  -3.756   1.00 135.54 ? 1024 TYR C CA  1 
ATOM   8466  C C   . TYR C 1 228 ? 11.915  23.946  -2.879   1.00 136.49 ? 1024 TYR C C   1 
ATOM   8467  O O   . TYR C 1 228 ? 11.845  22.727  -3.022   1.00 135.42 ? 1024 TYR C O   1 
ATOM   8468  C CB  . TYR C 1 228 ? 9.713   25.091  -3.126   1.00 134.75 ? 1024 TYR C CB  1 
ATOM   8469  C CG  . TYR C 1 228 ? 8.775   25.909  -3.978   1.00 141.86 ? 1024 TYR C CG  1 
ATOM   8470  C CD1 . TYR C 1 228 ? 7.404   25.701  -3.925   1.00 143.94 ? 1024 TYR C CD1 1 
ATOM   8471  C CD2 . TYR C 1 228 ? 9.258   26.888  -4.836   1.00 146.27 ? 1024 TYR C CD2 1 
ATOM   8472  C CE1 . TYR C 1 228 ? 6.537   26.445  -4.705   1.00 145.17 ? 1024 TYR C CE1 1 
ATOM   8473  C CE2 . TYR C 1 228 ? 8.400   27.637  -5.620   1.00 147.12 ? 1024 TYR C CE2 1 
ATOM   8474  C CZ  . TYR C 1 228 ? 7.041   27.411  -5.551   1.00 144.58 ? 1024 TYR C CZ  1 
ATOM   8475  O OH  . TYR C 1 228 ? 6.184   28.152  -6.329   1.00 130.72 ? 1024 TYR C OH  1 
ATOM   8476  N N   . TYR C 1 229 ? 12.700  24.515  -1.972   1.00 134.94 ? 1025 TYR C N   1 
ATOM   8477  C CA  . TYR C 1 229 ? 13.501  23.689  -1.081   1.00 137.17 ? 1025 TYR C CA  1 
ATOM   8478  C C   . TYR C 1 229 ? 12.614  23.113  0.021    1.00 134.77 ? 1025 TYR C C   1 
ATOM   8479  O O   . TYR C 1 229 ? 11.997  23.850  0.792    1.00 129.26 ? 1025 TYR C O   1 
ATOM   8480  C CB  . TYR C 1 229 ? 14.656  24.495  -0.482   1.00 137.02 ? 1025 TYR C CB  1 
ATOM   8481  N N   . THR C 1 230 ? 12.557  21.786  0.083    1.00 133.47 ? 1026 THR C N   1 
ATOM   8482  C CA  . THR C 1 230 ? 11.697  21.085  1.028    1.00 129.12 ? 1026 THR C CA  1 
ATOM   8483  C C   . THR C 1 230 ? 12.509  20.126  1.890    1.00 128.85 ? 1026 THR C C   1 
ATOM   8484  O O   . THR C 1 230 ? 13.482  19.536  1.423    1.00 129.60 ? 1026 THR C O   1 
ATOM   8485  C CB  . THR C 1 230 ? 10.600  20.286  0.291    1.00 127.72 ? 1026 THR C CB  1 
ATOM   8486  O OG1 . THR C 1 230 ? 9.678   21.192  -0.327   1.00 125.20 ? 1026 THR C OG1 1 
ATOM   8487  C CG2 . THR C 1 230 ? 9.843   19.384  1.259    1.00 126.77 ? 1026 THR C CG2 1 
ATOM   8488  N N   . ILE C 1 231 ? 12.110  19.978  3.151    1.00 125.15 ? 1027 ILE C N   1 
ATOM   8489  C CA  . ILE C 1 231 ? 12.763  19.028  4.044    1.00 117.22 ? 1027 ILE C CA  1 
ATOM   8490  C C   . ILE C 1 231 ? 11.747  18.143  4.758    1.00 109.52 ? 1027 ILE C C   1 
ATOM   8491  O O   . ILE C 1 231 ? 10.579  18.508  4.897    1.00 104.76 ? 1027 ILE C O   1 
ATOM   8492  C CB  . ILE C 1 231 ? 13.643  19.737  5.090    1.00 117.07 ? 1027 ILE C CB  1 
ATOM   8493  C CG1 . ILE C 1 231 ? 14.500  18.712  5.842    1.00 114.91 ? 1027 ILE C CG1 1 
ATOM   8494  C CG2 . ILE C 1 231 ? 12.782  20.552  6.046    1.00 116.45 ? 1027 ILE C CG2 1 
ATOM   8495  C CD1 . ILE C 1 231 ? 15.476  19.319  6.824    1.00 122.45 ? 1027 ILE C CD1 1 
ATOM   8496  N N   . GLY C 1 232 ? 12.203  16.976  5.204    1.00 107.98 ? 1028 GLY C N   1 
ATOM   8497  C CA  . GLY C 1 232 ? 11.365  16.046  5.937    1.00 102.38 ? 1028 GLY C CA  1 
ATOM   8498  C C   . GLY C 1 232 ? 10.252  15.471  5.090    1.00 103.24 ? 1028 GLY C C   1 
ATOM   8499  O O   . GLY C 1 232 ? 10.496  14.910  4.021    1.00 102.60 ? 1028 GLY C O   1 
ATOM   8500  N N   . ILE C 1 233 ? 9.022   15.593  5.577    1.00 106.09 ? 1029 ILE C N   1 
ATOM   8501  C CA  . ILE C 1 233 ? 7.867   15.164  4.804    1.00 102.59 ? 1029 ILE C CA  1 
ATOM   8502  C C   . ILE C 1 233 ? 6.968   16.345  4.444    1.00 102.57 ? 1029 ILE C C   1 
ATOM   8503  O O   . ILE C 1 233 ? 6.281   16.904  5.301    1.00 96.45  ? 1029 ILE C O   1 
ATOM   8504  C CB  . ILE C 1 233 ? 7.052   14.098  5.555    1.00 94.83  ? 1029 ILE C CB  1 
ATOM   8505  C CG1 . ILE C 1 233 ? 7.967   12.964  6.023    1.00 91.25  ? 1029 ILE C CG1 1 
ATOM   8506  C CG2 . ILE C 1 233 ? 5.937   13.563  4.672    1.00 93.53  ? 1029 ILE C CG2 1 
ATOM   8507  C CD1 . ILE C 1 233 ? 7.265   11.910  6.858    1.00 84.45  ? 1029 ILE C CD1 1 
ATOM   8508  N N   . GLY C 1 234 ? 6.983   16.713  3.167    1.00 108.47 ? 1030 GLY C N   1 
ATOM   8509  C CA  . GLY C 1 234 ? 6.080   17.713  2.624    1.00 108.47 ? 1030 GLY C CA  1 
ATOM   8510  C C   . GLY C 1 234 ? 6.215   19.115  3.180    1.00 111.16 ? 1030 GLY C C   1 
ATOM   8511  O O   . GLY C 1 234 ? 5.369   19.969  2.916    1.00 114.67 ? 1030 GLY C O   1 
ATOM   8512  N N   . HIS C 1 235 ? 7.277   19.371  3.937    1.00 110.36 ? 1031 HIS C N   1 
ATOM   8513  C CA  . HIS C 1 235 ? 7.412   20.665  4.592    1.00 112.68 ? 1031 HIS C CA  1 
ATOM   8514  C C   . HIS C 1 235 ? 8.051   21.700  3.673    1.00 113.75 ? 1031 HIS C C   1 
ATOM   8515  O O   . HIS C 1 235 ? 9.208   21.567  3.281    1.00 112.88 ? 1031 HIS C O   1 
ATOM   8516  C CB  . HIS C 1 235 ? 8.219   20.533  5.883    1.00 111.17 ? 1031 HIS C CB  1 
ATOM   8517  C CG  . HIS C 1 235 ? 8.087   21.705  6.794    1.00 114.88 ? 1031 HIS C CG  1 
ATOM   8518  N ND1 . HIS C 1 235 ? 6.872   22.135  7.298    1.00 109.95 ? 1031 HIS C ND1 1 
ATOM   8519  C CD2 . HIS C 1 235 ? 9.011   22.559  7.304    1.00 117.95 ? 1031 HIS C CD2 1 
ATOM   8520  C CE1 . HIS C 1 235 ? 7.053   23.183  8.067    1.00 110.79 ? 1031 HIS C CE1 1 
ATOM   8521  N NE2 . HIS C 1 235 ? 8.352   23.465  8.087    1.00 118.81 ? 1031 HIS C NE2 1 
ATOM   8522  N N   . LEU C 1 236 ? 7.291   22.743  3.352    1.00 116.65 ? 1032 LEU C N   1 
ATOM   8523  C CA  . LEU C 1 236 ? 7.771   23.792  2.462    1.00 123.06 ? 1032 LEU C CA  1 
ATOM   8524  C C   . LEU C 1 236 ? 8.352   24.949  3.259    1.00 128.41 ? 1032 LEU C C   1 
ATOM   8525  O O   . LEU C 1 236 ? 7.626   25.678  3.935    1.00 125.18 ? 1032 LEU C O   1 
ATOM   8526  C CB  . LEU C 1 236 ? 6.640   24.293  1.563    1.00 122.09 ? 1032 LEU C CB  1 
ATOM   8527  C CG  . LEU C 1 236 ? 6.930   25.561  0.758    1.00 131.20 ? 1032 LEU C CG  1 
ATOM   8528  C CD1 . LEU C 1 236 ? 8.242   25.442  -0.001   1.00 139.22 ? 1032 LEU C CD1 1 
ATOM   8529  C CD2 . LEU C 1 236 ? 5.786   25.864  -0.194   1.00 141.59 ? 1032 LEU C CD2 1 
ATOM   8530  N N   . LEU C 1 237 ? 9.669   25.106  3.174    1.00 134.26 ? 1033 LEU C N   1 
ATOM   8531  C CA  . LEU C 1 237 ? 10.373  26.158  3.897    1.00 142.54 ? 1033 LEU C CA  1 
ATOM   8532  C C   . LEU C 1 237 ? 10.198  27.543  3.268    1.00 145.88 ? 1033 LEU C C   1 
ATOM   8533  O O   . LEU C 1 237 ? 9.812   28.499  3.942    1.00 140.72 ? 1033 LEU C O   1 
ATOM   8534  C CB  . LEU C 1 237 ? 11.862  25.812  3.997    1.00 142.65 ? 1033 LEU C CB  1 
ATOM   8535  C CG  . LEU C 1 237 ? 12.202  24.400  4.484    1.00 134.32 ? 1033 LEU C CG  1 
ATOM   8536  C CD1 . LEU C 1 237 ? 13.704  24.175  4.479    1.00 133.90 ? 1033 LEU C CD1 1 
ATOM   8537  C CD2 . LEU C 1 237 ? 11.630  24.151  5.871    1.00 137.53 ? 1033 LEU C CD2 1 
ATOM   8538  N N   . THR C 1 238 ? 10.501  27.644  1.977    1.00 152.92 ? 1034 THR C N   1 
ATOM   8539  C CA  . THR C 1 238 ? 10.398  28.907  1.248    1.00 152.62 ? 1034 THR C CA  1 
ATOM   8540  C C   . THR C 1 238 ? 10.328  28.686  -0.261   1.00 158.44 ? 1034 THR C C   1 
ATOM   8541  O O   . THR C 1 238 ? 10.644  27.604  -0.757   1.00 158.96 ? 1034 THR C O   1 
ATOM   8542  C CB  . THR C 1 238 ? 11.578  29.850  1.562    1.00 151.14 ? 1034 THR C CB  1 
ATOM   8543  O OG1 . THR C 1 238 ? 11.406  31.085  0.856    1.00 146.09 ? 1034 THR C OG1 1 
ATOM   8544  C CG2 . THR C 1 238 ? 12.896  29.215  1.147    1.00 160.09 ? 1034 THR C CG2 1 
ATOM   8545  N N   . LYS C 1 239 ? 9.905   29.715  -0.986   1.00 156.99 ? 1035 LYS C N   1 
ATOM   8546  C CA  . LYS C 1 239 ? 9.925   29.676  -2.442   1.00 158.74 ? 1035 LYS C CA  1 
ATOM   8547  C C   . LYS C 1 239 ? 11.219  30.283  -2.987   1.00 166.77 ? 1035 LYS C C   1 
ATOM   8548  O O   . LYS C 1 239 ? 11.394  30.404  -4.199   1.00 168.26 ? 1035 LYS C O   1 
ATOM   8549  C CB  . LYS C 1 239 ? 8.711   30.406  -3.017   1.00 151.51 ? 1035 LYS C CB  1 
ATOM   8550  N N   . SER C 1 240 ? 12.120  30.665  -2.086   1.00 166.92 ? 1036 SER C N   1 
ATOM   8551  C CA  . SER C 1 240 ? 13.388  31.284  -2.473   1.00 171.86 ? 1036 SER C CA  1 
ATOM   8552  C C   . SER C 1 240 ? 14.437  30.273  -2.933   1.00 177.87 ? 1036 SER C C   1 
ATOM   8553  O O   . SER C 1 240 ? 14.669  29.262  -2.268   1.00 176.99 ? 1036 SER C O   1 
ATOM   8554  C CB  . SER C 1 240 ? 13.953  32.120  -1.322   1.00 170.20 ? 1036 SER C CB  1 
ATOM   8555  O OG  . SER C 1 240 ? 15.289  32.510  -1.589   1.00 165.82 ? 1036 SER C OG  1 
ATOM   8556  N N   . PRO C 1 241 ? 15.084  30.557  -4.074   1.00 180.83 ? 1037 PRO C N   1 
ATOM   8557  C CA  . PRO C 1 241 ? 16.139  29.705  -4.633   1.00 183.07 ? 1037 PRO C CA  1 
ATOM   8558  C C   . PRO C 1 241 ? 17.409  29.750  -3.788   1.00 182.93 ? 1037 PRO C C   1 
ATOM   8559  O O   . PRO C 1 241 ? 18.260  28.865  -3.905   1.00 182.04 ? 1037 PRO C O   1 
ATOM   8560  C CB  . PRO C 1 241 ? 16.402  30.337  -6.002   1.00 186.35 ? 1037 PRO C CB  1 
ATOM   8561  C CG  . PRO C 1 241 ? 16.036  31.768  -5.825   1.00 185.57 ? 1037 PRO C CG  1 
ATOM   8562  C CD  . PRO C 1 241 ? 14.860  31.764  -4.889   1.00 180.85 ? 1037 PRO C CD  1 
ATOM   8563  N N   . SER C 1 242 ? 17.530  30.773  -2.947   1.00 177.32 ? 1038 SER C N   1 
ATOM   8564  C CA  . SER C 1 242 ? 18.729  30.967  -2.140   1.00 168.42 ? 1038 SER C CA  1 
ATOM   8565  C C   . SER C 1 242 ? 18.821  29.925  -1.030   1.00 160.60 ? 1038 SER C C   1 
ATOM   8566  O O   . SER C 1 242 ? 17.880  29.741  -0.259   1.00 156.88 ? 1038 SER C O   1 
ATOM   8567  C CB  . SER C 1 242 ? 18.757  32.380  -1.552   1.00 158.76 ? 1038 SER C CB  1 
ATOM   8568  O OG  . SER C 1 242 ? 20.067  32.737  -1.141   1.00 158.35 ? 1038 SER C OG  1 
ATOM   8569  N N   . LEU C 1 243 ? 19.964  29.249  -0.959   1.00 155.12 ? 1039 LEU C N   1 
ATOM   8570  C CA  . LEU C 1 243 ? 20.175  28.172  0.002    1.00 155.59 ? 1039 LEU C CA  1 
ATOM   8571  C C   . LEU C 1 243 ? 20.241  28.673  1.443    1.00 155.28 ? 1039 LEU C C   1 
ATOM   8572  O O   . LEU C 1 243 ? 19.684  28.051  2.352    1.00 159.05 ? 1039 LEU C O   1 
ATOM   8573  C CB  . LEU C 1 243 ? 21.452  27.399  -0.337   1.00 150.36 ? 1039 LEU C CB  1 
ATOM   8574  N N   . ASN C 1 244 ? 20.927  29.791  1.651    1.00 154.50 ? 1040 ASN C N   1 
ATOM   8575  C CA  . ASN C 1 244 ? 21.043  30.364  2.986    1.00 154.93 ? 1040 ASN C CA  1 
ATOM   8576  C C   . ASN C 1 244 ? 19.692  30.833  3.522    1.00 152.03 ? 1040 ASN C C   1 
ATOM   8577  O O   . ASN C 1 244 ? 19.497  30.945  4.735    1.00 148.10 ? 1040 ASN C O   1 
ATOM   8578  C CB  . ASN C 1 244 ? 22.078  31.497  3.012    1.00 158.86 ? 1040 ASN C CB  1 
ATOM   8579  C CG  . ASN C 1 244 ? 21.715  32.650  2.092    1.00 154.36 ? 1040 ASN C CG  1 
ATOM   8580  O OD1 . ASN C 1 244 ? 20.799  32.547  1.278    1.00 158.76 ? 1040 ASN C OD1 1 
ATOM   8581  N ND2 . ASN C 1 244 ? 22.445  33.752  2.211    1.00 140.01 ? 1040 ASN C ND2 1 
ATOM   8582  N N   . ALA C 1 245 ? 18.763  31.099  2.609    1.00 152.15 ? 1041 ALA C N   1 
ATOM   8583  C CA  . ALA C 1 245 ? 17.412  31.506  2.980    1.00 152.48 ? 1041 ALA C CA  1 
ATOM   8584  C C   . ALA C 1 245 ? 16.605  30.331  3.528    1.00 147.43 ? 1041 ALA C C   1 
ATOM   8585  O O   . ALA C 1 245 ? 16.015  30.418  4.609    1.00 143.09 ? 1041 ALA C O   1 
ATOM   8586  C CB  . ALA C 1 245 ? 16.703  32.118  1.782    1.00 162.31 ? 1041 ALA C CB  1 
ATOM   8587  N N   . ALA C 1 246 ? 16.585  29.231  2.780    1.00 150.03 ? 1042 ALA C N   1 
ATOM   8588  C CA  . ALA C 1 246 ? 15.929  28.013  3.236    1.00 145.68 ? 1042 ALA C CA  1 
ATOM   8589  C C   . ALA C 1 246 ? 16.567  27.556  4.542    1.00 144.43 ? 1042 ALA C C   1 
ATOM   8590  O O   . ALA C 1 246 ? 15.879  27.091  5.450    1.00 138.35 ? 1042 ALA C O   1 
ATOM   8591  C CB  . ALA C 1 246 ? 16.020  26.923  2.178    1.00 143.82 ? 1042 ALA C CB  1 
ATOM   8592  N N   . LYS C 1 247 ? 17.888  27.693  4.626    1.00 148.88 ? 1043 LYS C N   1 
ATOM   8593  C CA  . LYS C 1 247 ? 18.612  27.383  5.853    1.00 141.63 ? 1043 LYS C CA  1 
ATOM   8594  C C   . LYS C 1 247 ? 18.142  28.259  7.011    1.00 140.98 ? 1043 LYS C C   1 
ATOM   8595  O O   . LYS C 1 247 ? 17.977  27.778  8.133    1.00 139.81 ? 1043 LYS C O   1 
ATOM   8596  C CB  . LYS C 1 247 ? 20.119  27.549  5.650    1.00 137.87 ? 1043 LYS C CB  1 
ATOM   8597  N N   . SER C 1 248 ? 17.928  29.543  6.739    1.00 143.31 ? 1044 SER C N   1 
ATOM   8598  C CA  . SER C 1 248 ? 17.458  30.470  7.765    1.00 138.89 ? 1044 SER C CA  1 
ATOM   8599  C C   . SER C 1 248 ? 16.063  30.091  8.259    1.00 132.44 ? 1044 SER C C   1 
ATOM   8600  O O   . SER C 1 248 ? 15.788  30.126  9.460    1.00 127.48 ? 1044 SER C O   1 
ATOM   8601  C CB  . SER C 1 248 ? 17.461  31.908  7.237    1.00 139.52 ? 1044 SER C CB  1 
ATOM   8602  N N   . GLU C 1 249 ? 15.185  29.727  7.328    1.00 136.67 ? 1045 GLU C N   1 
ATOM   8603  C CA  . GLU C 1 249 ? 13.827  29.317  7.678    1.00 135.45 ? 1045 GLU C CA  1 
ATOM   8604  C C   . GLU C 1 249 ? 13.811  28.015  8.482    1.00 134.02 ? 1045 GLU C C   1 
ATOM   8605  O O   . GLU C 1 249 ? 13.068  27.886  9.460    1.00 129.41 ? 1045 GLU C O   1 
ATOM   8606  C CB  . GLU C 1 249 ? 12.970  29.172  6.418    1.00 133.27 ? 1045 GLU C CB  1 
ATOM   8607  N N   . LEU C 1 250 ? 14.629  27.053  8.062    1.00 133.11 ? 1046 LEU C N   1 
ATOM   8608  C CA  . LEU C 1 250 ? 14.718  25.765  8.744    1.00 127.69 ? 1046 LEU C CA  1 
ATOM   8609  C C   . LEU C 1 250 ? 15.261  25.926  10.156   1.00 127.44 ? 1046 LEU C C   1 
ATOM   8610  O O   . LEU C 1 250 ? 14.658  25.456  11.121   1.00 122.87 ? 1046 LEU C O   1 
ATOM   8611  C CB  . LEU C 1 250 ? 15.601  24.798  7.956    1.00 125.55 ? 1046 LEU C CB  1 
ATOM   8612  C CG  . LEU C 1 250 ? 15.936  23.482  8.656    1.00 122.31 ? 1046 LEU C CG  1 
ATOM   8613  C CD1 . LEU C 1 250 ? 14.673  22.733  9.052    1.00 119.65 ? 1046 LEU C CD1 1 
ATOM   8614  C CD2 . LEU C 1 250 ? 16.819  22.621  7.769    1.00 119.83 ? 1046 LEU C CD2 1 
ATOM   8615  N N   . ASP C 1 251 ? 16.409  26.586  10.268   1.00 134.17 ? 1047 ASP C N   1 
ATOM   8616  C CA  . ASP C 1 251 ? 16.990  26.885  11.570   1.00 136.03 ? 1047 ASP C CA  1 
ATOM   8617  C C   . ASP C 1 251 ? 15.972  27.618  12.441   1.00 136.46 ? 1047 ASP C C   1 
ATOM   8618  O O   . ASP C 1 251 ? 15.890  27.383  13.647   1.00 135.00 ? 1047 ASP C O   1 
ATOM   8619  C CB  . ASP C 1 251 ? 18.266  27.723  11.420   1.00 140.14 ? 1047 ASP C CB  1 
ATOM   8620  C CG  . ASP C 1 251 ? 19.365  26.992  10.664   1.00 138.71 ? 1047 ASP C CG  1 
ATOM   8621  O OD1 . ASP C 1 251 ? 19.414  25.745  10.731   1.00 134.92 ? 1047 ASP C OD1 1 
ATOM   8622  O OD2 . ASP C 1 251 ? 20.182  27.668  10.003   1.00 143.29 ? 1047 ASP C OD2 1 
ATOM   8623  N N   . LYS C 1 252 ? 15.194  28.502  11.820   1.00 139.89 ? 1048 LYS C N   1 
ATOM   8624  C CA  . LYS C 1 252 ? 14.152  29.239  12.532   1.00 131.52 ? 1048 LYS C CA  1 
ATOM   8625  C C   . LYS C 1 252 ? 13.074  28.304  13.083   1.00 130.03 ? 1048 LYS C C   1 
ATOM   8626  O O   . LYS C 1 252 ? 12.608  28.476  14.209   1.00 126.14 ? 1048 LYS C O   1 
ATOM   8627  C CB  . LYS C 1 252 ? 13.514  30.288  11.616   1.00 123.09 ? 1048 LYS C CB  1 
ATOM   8628  N N   . ALA C 1 253 ? 12.689  27.312  12.285   1.00 131.30 ? 1049 ALA C N   1 
ATOM   8629  C CA  . ALA C 1 253 ? 11.608  26.400  12.654   1.00 128.42 ? 1049 ALA C CA  1 
ATOM   8630  C C   . ALA C 1 253 ? 12.021  25.382  13.715   1.00 124.21 ? 1049 ALA C C   1 
ATOM   8631  O O   . ALA C 1 253 ? 11.291  25.144  14.677   1.00 115.56 ? 1049 ALA C O   1 
ATOM   8632  C CB  . ALA C 1 253 ? 11.063  25.697  11.421   1.00 126.42 ? 1049 ALA C CB  1 
ATOM   8633  N N   . ILE C 1 254 ? 13.186  24.772  13.527   1.00 127.02 ? 1050 ILE C N   1 
ATOM   8634  C CA  . ILE C 1 254 ? 13.687  23.785  14.477   1.00 126.90 ? 1050 ILE C CA  1 
ATOM   8635  C C   . ILE C 1 254 ? 14.013  24.429  15.822   1.00 132.01 ? 1050 ILE C C   1 
ATOM   8636  O O   . ILE C 1 254 ? 13.756  23.846  16.877   1.00 133.40 ? 1050 ILE C O   1 
ATOM   8637  C CB  . ILE C 1 254 ? 14.929  23.048  13.937   1.00 126.23 ? 1050 ILE C CB  1 
ATOM   8638  C CG1 . ILE C 1 254 ? 14.515  22.027  12.876   1.00 119.70 ? 1050 ILE C CG1 1 
ATOM   8639  C CG2 . ILE C 1 254 ? 15.670  22.356  15.066   1.00 125.06 ? 1050 ILE C CG2 1 
ATOM   8640  C CD1 . ILE C 1 254 ? 13.638  20.916  13.409   1.00 106.94 ? 1050 ILE C CD1 1 
ATOM   8641  N N   . GLY C 1 255 ? 14.569  25.636  15.778   1.00 133.74 ? 1051 GLY C N   1 
ATOM   8642  C CA  . GLY C 1 255 ? 14.942  26.351  16.985   1.00 132.16 ? 1051 GLY C CA  1 
ATOM   8643  C C   . GLY C 1 255 ? 16.424  26.225  17.267   1.00 125.07 ? 1051 GLY C C   1 
ATOM   8644  O O   . GLY C 1 255 ? 16.934  26.784  18.237   1.00 116.63 ? 1051 GLY C O   1 
ATOM   8645  N N   . ARG C 1 256 ? 17.112  25.474  16.413   1.00 133.22 ? 1052 ARG C N   1 
ATOM   8646  C CA  . ARG C 1 256 ? 18.549  25.264  16.539   1.00 139.91 ? 1052 ARG C CA  1 
ATOM   8647  C C   . ARG C 1 256 ? 19.218  25.461  15.182   1.00 138.51 ? 1052 ARG C C   1 
ATOM   8648  O O   . ARG C 1 256 ? 18.544  25.728  14.187   1.00 143.92 ? 1052 ARG C O   1 
ATOM   8649  C CB  . ARG C 1 256 ? 18.824  23.850  17.052   1.00 134.40 ? 1052 ARG C CB  1 
ATOM   8650  C CG  . ARG C 1 256 ? 20.291  23.529  17.293   1.00 126.84 ? 1052 ARG C CG  1 
ATOM   8651  C CD  . ARG C 1 256 ? 20.529  22.042  17.163   1.00 125.29 ? 1052 ARG C CD  1 
ATOM   8652  N NE  . ARG C 1 256 ? 19.981  21.534  15.909   1.00 134.15 ? 1052 ARG C NE  1 
ATOM   8653  C CZ  . ARG C 1 256 ? 19.893  20.245  15.597   1.00 137.28 ? 1052 ARG C CZ  1 
ATOM   8654  N NH1 . ARG C 1 256 ? 20.318  19.324  16.451   1.00 137.72 ? 1052 ARG C NH1 1 
ATOM   8655  N NH2 . ARG C 1 256 ? 19.378  19.876  14.432   1.00 131.97 ? 1052 ARG C NH2 1 
ATOM   8656  N N   . ASN C 1 257 ? 20.538  25.318  15.136   1.00 133.16 ? 1053 ASN C N   1 
ATOM   8657  C CA  . ASN C 1 257 ? 21.236  25.333  13.863   1.00 133.91 ? 1053 ASN C CA  1 
ATOM   8658  C C   . ASN C 1 257 ? 21.342  23.907  13.352   1.00 136.98 ? 1053 ASN C C   1 
ATOM   8659  O O   . ASN C 1 257 ? 22.075  23.087  13.907   1.00 138.04 ? 1053 ASN C O   1 
ATOM   8660  C CB  . ASN C 1 257 ? 22.633  25.940  14.009   1.00 132.01 ? 1053 ASN C CB  1 
ATOM   8661  C CG  . ASN C 1 257 ? 22.597  27.429  14.272   1.00 130.02 ? 1053 ASN C CG  1 
ATOM   8662  O OD1 . ASN C 1 257 ? 23.262  27.925  15.179   1.00 130.13 ? 1053 ASN C OD1 1 
ATOM   8663  N ND2 . ASN C 1 257 ? 21.819  28.152  13.476   1.00 130.37 ? 1053 ASN C ND2 1 
ATOM   8664  N N   . THR C 1 258 ? 20.601  23.618  12.290   1.00 135.96 ? 1054 THR C N   1 
ATOM   8665  C CA  . THR C 1 258 ? 20.625  22.299  11.684   1.00 131.64 ? 1054 THR C CA  1 
ATOM   8666  C C   . THR C 1 258 ? 21.847  22.190  10.796   1.00 130.30 ? 1054 THR C C   1 
ATOM   8667  O O   . THR C 1 258 ? 22.457  21.126  10.683   1.00 125.36 ? 1054 THR C O   1 
ATOM   8668  C CB  . THR C 1 258 ? 19.379  22.064  10.818   1.00 128.19 ? 1054 THR C CB  1 
ATOM   8669  O OG1 . THR C 1 258 ? 19.431  22.914  9.664    1.00 120.59 ? 1054 THR C OG1 1 
ATOM   8670  C CG2 . THR C 1 258 ? 18.116  22.359  11.615   1.00 131.99 ? 1054 THR C CG2 1 
ATOM   8671  N N   . ASN C 1 259 ? 22.207  23.313  10.185   1.00 134.21 ? 1055 ASN C N   1 
ATOM   8672  C CA  . ASN C 1 259 ? 23.246  23.338  9.174    1.00 132.79 ? 1055 ASN C CA  1 
ATOM   8673  C C   . ASN C 1 259 ? 22.788  22.514  7.978    1.00 133.20 ? 1055 ASN C C   1 
ATOM   8674  O O   . ASN C 1 259 ? 23.598  22.053  7.175    1.00 135.17 ? 1055 ASN C O   1 
ATOM   8675  C CB  . ASN C 1 259 ? 24.552  22.792  9.754    1.00 133.57 ? 1055 ASN C CB  1 
ATOM   8676  C CG  . ASN C 1 259 ? 25.719  22.937  8.805    1.00 131.19 ? 1055 ASN C CG  1 
ATOM   8677  O OD1 . ASN C 1 259 ? 25.680  23.735  7.871    1.00 125.80 ? 1055 ASN C OD1 1 
ATOM   8678  N ND2 . ASN C 1 259 ? 26.771  22.164  9.042    1.00 137.05 ? 1055 ASN C ND2 1 
ATOM   8679  N N   . GLY C 1 260 ? 21.471  22.351  7.861    1.00 129.24 ? 1056 GLY C N   1 
ATOM   8680  C CA  . GLY C 1 260 ? 20.879  21.613  6.760    1.00 133.50 ? 1056 GLY C CA  1 
ATOM   8681  C C   . GLY C 1 260 ? 20.439  20.193  7.083    1.00 135.11 ? 1056 GLY C C   1 
ATOM   8682  O O   . GLY C 1 260 ? 19.804  19.534  6.257    1.00 133.63 ? 1056 GLY C O   1 
ATOM   8683  N N   . VAL C 1 261 ? 20.770  19.711  8.277    1.00 132.82 ? 1057 VAL C N   1 
ATOM   8684  C CA  . VAL C 1 261 ? 20.430  18.340  8.654    1.00 124.23 ? 1057 VAL C CA  1 
ATOM   8685  C C   . VAL C 1 261 ? 19.639  18.262  9.958    1.00 122.97 ? 1057 VAL C C   1 
ATOM   8686  O O   . VAL C 1 261 ? 20.079  18.754  10.997   1.00 126.84 ? 1057 VAL C O   1 
ATOM   8687  C CB  . VAL C 1 261 ? 21.687  17.448  8.757    1.00 122.59 ? 1057 VAL C CB  1 
ATOM   8688  C CG1 . VAL C 1 261 ? 21.343  16.109  9.396    1.00 124.31 ? 1057 VAL C CG1 1 
ATOM   8689  C CG2 . VAL C 1 261 ? 22.311  17.249  7.382    1.00 116.78 ? 1057 VAL C CG2 1 
ATOM   8690  N N   . ILE C 1 262 ? 18.467  17.636  9.893    1.00 115.95 ? 1058 ILE C N   1 
ATOM   8691  C CA  . ILE C 1 262 ? 17.631  17.448  11.070   1.00 114.92 ? 1058 ILE C CA  1 
ATOM   8692  C C   . ILE C 1 262 ? 17.448  15.966  11.365   1.00 115.55 ? 1058 ILE C C   1 
ATOM   8693  O O   . ILE C 1 262 ? 17.409  15.143  10.451   1.00 108.63 ? 1058 ILE C O   1 
ATOM   8694  C CB  . ILE C 1 262 ? 16.241  18.083  10.894   1.00 112.91 ? 1058 ILE C CB  1 
ATOM   8695  C CG1 . ILE C 1 262 ? 15.450  17.340  9.817    1.00 109.87 ? 1058 ILE C CG1 1 
ATOM   8696  C CG2 . ILE C 1 262 ? 16.362  19.561  10.562   1.00 111.78 ? 1058 ILE C CG2 1 
ATOM   8697  C CD1 . ILE C 1 262 ? 14.023  17.819  9.671    1.00 108.88 ? 1058 ILE C CD1 1 
ATOM   8698  N N   . THR C 1 263 ? 17.335  15.633  12.646   1.00 118.13 ? 1059 THR C N   1 
ATOM   8699  C CA  . THR C 1 263 ? 17.142  14.249  13.062   1.00 111.87 ? 1059 THR C CA  1 
ATOM   8700  C C   . THR C 1 263 ? 15.732  13.766  12.743   1.00 109.54 ? 1059 THR C C   1 
ATOM   8701  O O   . THR C 1 263 ? 14.821  14.569  12.533   1.00 106.31 ? 1059 THR C O   1 
ATOM   8702  C CB  . THR C 1 263 ? 17.414  14.066  14.564   1.00 104.85 ? 1059 THR C CB  1 
ATOM   8703  O OG1 . THR C 1 263 ? 16.470  14.835  15.319   1.00 99.81  ? 1059 THR C OG1 1 
ATOM   8704  C CG2 . THR C 1 263 ? 18.826  14.517  14.903   1.00 108.80 ? 1059 THR C CG2 1 
ATOM   8705  N N   . LYS C 1 264 ? 15.564  12.448  12.701   1.00 106.43 ? 1060 LYS C N   1 
ATOM   8706  C CA  . LYS C 1 264 ? 14.272  11.838  12.411   1.00 97.12  ? 1060 LYS C CA  1 
ATOM   8707  C C   . LYS C 1 264 ? 13.179  12.337  13.359   1.00 102.35 ? 1060 LYS C C   1 
ATOM   8708  O O   . LYS C 1 264 ? 12.036  12.531  12.944   1.00 104.29 ? 1060 LYS C O   1 
ATOM   8709  C CB  . LYS C 1 264 ? 14.384  10.317  12.486   1.00 93.64  ? 1060 LYS C CB  1 
ATOM   8710  C CG  . LYS C 1 264 ? 15.518  9.741   11.655   1.00 97.46  ? 1060 LYS C CG  1 
ATOM   8711  C CD  . LYS C 1 264 ? 15.724  8.272   11.956   1.00 101.80 ? 1060 LYS C CD  1 
ATOM   8712  C CE  . LYS C 1 264 ? 14.420  7.492   11.869   1.00 99.35  ? 1060 LYS C CE  1 
ATOM   8713  N NZ  . LYS C 1 264 ? 14.580  6.056   12.246   1.00 89.82  ? 1060 LYS C NZ  1 
ATOM   8714  N N   . ASP C 1 265 ? 13.538  12.548  14.626   1.00 103.19 ? 1061 ASP C N   1 
ATOM   8715  C CA  . ASP C 1 265 ? 12.592  13.019  15.640   1.00 95.83  ? 1061 ASP C CA  1 
ATOM   8716  C C   . ASP C 1 265 ? 12.031  14.395  15.301   1.00 99.03  ? 1061 ASP C C   1 
ATOM   8717  O O   . ASP C 1 265 ? 10.812  14.602  15.298   1.00 94.36  ? 1061 ASP C O   1 
ATOM   8718  C CB  . ASP C 1 265 ? 13.258  13.079  17.016   1.00 94.85  ? 1061 ASP C CB  1 
ATOM   8719  C CG  . ASP C 1 265 ? 13.786  11.737  17.470   1.00 96.85  ? 1061 ASP C CG  1 
ATOM   8720  O OD1 . ASP C 1 265 ? 13.402  10.706  16.879   1.00 101.77 ? 1061 ASP C OD1 1 
ATOM   8721  O OD2 . ASP C 1 265 ? 14.581  11.716  18.431   1.00 90.01  ? 1061 ASP C OD2 1 
ATOM   8722  N N   . GLU C 1 266 ? 12.932  15.336  15.032   1.00 107.45 ? 1062 GLU C N   1 
ATOM   8723  C CA  . GLU C 1 266 ? 12.541  16.691  14.662   1.00 110.68 ? 1062 GLU C CA  1 
ATOM   8724  C C   . GLU C 1 266 ? 11.669  16.655  13.411   1.00 104.10 ? 1062 GLU C C   1 
ATOM   8725  O O   . GLU C 1 266 ? 10.707  17.420  13.285   1.00 103.35 ? 1062 GLU C O   1 
ATOM   8726  C CB  . GLU C 1 266 ? 13.777  17.555  14.415   1.00 112.18 ? 1062 GLU C CB  1 
ATOM   8727  C CG  . GLU C 1 266 ? 14.779  17.555  15.558   1.00 115.81 ? 1062 GLU C CG  1 
ATOM   8728  C CD  . GLU C 1 266 ? 16.032  18.336  15.219   1.00 121.90 ? 1062 GLU C CD  1 
ATOM   8729  O OE1 . GLU C 1 266 ? 16.024  19.042  14.189   1.00 126.14 ? 1062 GLU C OE1 1 
ATOM   8730  O OE2 . GLU C 1 266 ? 17.024  18.241  15.974   1.00 116.54 ? 1062 GLU C OE2 1 
ATOM   8731  N N   . ALA C 1 267 ? 12.010  15.753  12.494   1.00 98.38  ? 1063 ALA C N   1 
ATOM   8732  C CA  . ALA C 1 267 ? 11.227  15.544  11.283   1.00 90.39  ? 1063 ALA C CA  1 
ATOM   8733  C C   . ALA C 1 267 ? 9.791   15.142  11.624   1.00 94.36  ? 1063 ALA C C   1 
ATOM   8734  O O   . ALA C 1 267 ? 8.836   15.731  11.113   1.00 90.53  ? 1063 ALA C O   1 
ATOM   8735  C CB  . ALA C 1 267 ? 11.881  14.495  10.414   1.00 83.24  ? 1063 ALA C CB  1 
ATOM   8736  N N   . GLU C 1 268 ? 9.645   14.142  12.492   1.00 95.21  ? 1064 GLU C N   1 
ATOM   8737  C CA  . GLU C 1 268 ? 8.328   13.723  12.963   1.00 89.05  ? 1064 GLU C CA  1 
ATOM   8738  C C   . GLU C 1 268 ? 7.563   14.911  13.527   1.00 93.63  ? 1064 GLU C C   1 
ATOM   8739  O O   . GLU C 1 268 ? 6.441   15.194  13.106   1.00 92.37  ? 1064 GLU C O   1 
ATOM   8740  C CB  . GLU C 1 268 ? 8.449   12.641  14.038   1.00 86.38  ? 1064 GLU C CB  1 
ATOM   8741  C CG  . GLU C 1 268 ? 9.043   11.333  13.553   1.00 95.64  ? 1064 GLU C CG  1 
ATOM   8742  C CD  . GLU C 1 268 ? 9.056   10.263  14.630   1.00 96.45  ? 1064 GLU C CD  1 
ATOM   8743  O OE1 . GLU C 1 268 ? 9.983   10.257  15.470   1.00 92.11  ? 1064 GLU C OE1 1 
ATOM   8744  O OE2 . GLU C 1 268 ? 8.131   9.429   14.637   1.00 92.94  ? 1064 GLU C OE2 1 
ATOM   8745  N N   . LYS C 1 269 ? 8.178   15.606  14.481   1.00 100.42 ? 1065 LYS C N   1 
ATOM   8746  C CA  . LYS C 1 269 ? 7.547   16.764  15.109   1.00 94.34  ? 1065 LYS C CA  1 
ATOM   8747  C C   . LYS C 1 269 ? 7.010   17.714  14.046   1.00 96.97  ? 1065 LYS C C   1 
ATOM   8748  O O   . LYS C 1 269 ? 5.839   18.105  14.079   1.00 99.03  ? 1065 LYS C O   1 
ATOM   8749  C CB  . LYS C 1 269 ? 8.542   17.490  16.016   1.00 85.87  ? 1065 LYS C CB  1 
ATOM   8750  C CG  . LYS C 1 269 ? 9.161   16.589  17.072   1.00 96.14  ? 1065 LYS C CG  1 
ATOM   8751  C CD  . LYS C 1 269 ? 10.119  17.347  17.975   1.00 99.58  ? 1065 LYS C CD  1 
ATOM   8752  C CE  . LYS C 1 269 ? 10.652  16.446  19.084   1.00 99.73  ? 1065 LYS C CE  1 
ATOM   8753  N NZ  . LYS C 1 269 ? 11.575  17.159  20.013   1.00 88.84  ? 1065 LYS C NZ  1 
ATOM   8754  N N   . LEU C 1 270 ? 7.871   18.062  13.094   1.00 97.00  ? 1066 LEU C N   1 
ATOM   8755  C CA  . LEU C 1 270 ? 7.494   18.947  12.000   1.00 92.65  ? 1066 LEU C CA  1 
ATOM   8756  C C   . LEU C 1 270 ? 6.282   18.418  11.243   1.00 96.13  ? 1066 LEU C C   1 
ATOM   8757  O O   . LEU C 1 270 ? 5.334   19.159  10.978   1.00 100.07 ? 1066 LEU C O   1 
ATOM   8758  C CB  . LEU C 1 270 ? 8.673   19.158  11.052   1.00 85.10  ? 1066 LEU C CB  1 
ATOM   8759  C CG  . LEU C 1 270 ? 9.702   20.146  11.596   1.00 82.34  ? 1066 LEU C CG  1 
ATOM   8760  C CD1 . LEU C 1 270 ? 10.964  20.147  10.757   1.00 92.58  ? 1066 LEU C CD1 1 
ATOM   8761  C CD2 . LEU C 1 270 ? 9.095   21.538  11.671   1.00 88.96  ? 1066 LEU C CD2 1 
ATOM   8762  N N   . PHE C 1 271 ? 6.318   17.134  10.906   1.00 88.85  ? 1067 PHE C N   1 
ATOM   8763  C CA  . PHE C 1 271 ? 5.195   16.483  10.242   1.00 91.95  ? 1067 PHE C CA  1 
ATOM   8764  C C   . PHE C 1 271 ? 3.895   16.695  11.016   1.00 96.47  ? 1067 PHE C C   1 
ATOM   8765  O O   . PHE C 1 271 ? 2.909   17.170  10.457   1.00 98.93  ? 1067 PHE C O   1 
ATOM   8766  C CB  . PHE C 1 271 ? 5.473   14.987  10.057   1.00 94.19  ? 1067 PHE C CB  1 
ATOM   8767  C CG  . PHE C 1 271 ? 4.263   14.183  9.640    1.00 94.32  ? 1067 PHE C CG  1 
ATOM   8768  C CD1 . PHE C 1 271 ? 3.753   14.284  8.355    1.00 89.76  ? 1067 PHE C CD1 1 
ATOM   8769  C CD2 . PHE C 1 271 ? 3.650   13.312  10.530   1.00 92.82  ? 1067 PHE C CD2 1 
ATOM   8770  C CE1 . PHE C 1 271 ? 2.646   13.543  7.973    1.00 85.52  ? 1067 PHE C CE1 1 
ATOM   8771  C CE2 . PHE C 1 271 ? 2.545   12.569  10.153   1.00 84.62  ? 1067 PHE C CE2 1 
ATOM   8772  C CZ  . PHE C 1 271 ? 2.043   12.685  8.873    1.00 80.98  ? 1067 PHE C CZ  1 
ATOM   8773  N N   . ASN C 1 272 ? 3.899   16.349  12.301   1.00 93.05  ? 1068 ASN C N   1 
ATOM   8774  C CA  . ASN C 1 272 ? 2.711   16.505  13.136   1.00 91.04  ? 1068 ASN C CA  1 
ATOM   8775  C C   . ASN C 1 272 ? 2.194   17.943  13.157   1.00 98.28  ? 1068 ASN C C   1 
ATOM   8776  O O   . ASN C 1 272 ? 1.001   18.187  12.945   1.00 103.19 ? 1068 ASN C O   1 
ATOM   8777  C CB  . ASN C 1 272 ? 2.971   16.006  14.562   1.00 87.01  ? 1068 ASN C CB  1 
ATOM   8778  C CG  . ASN C 1 272 ? 2.965   14.490  14.662   1.00 88.53  ? 1068 ASN C CG  1 
ATOM   8779  O OD1 . ASN C 1 272 ? 1.905   13.860  14.674   1.00 85.75  ? 1068 ASN C OD1 1 
ATOM   8780  N ND2 . ASN C 1 272 ? 4.150   13.898  14.747   1.00 85.37  ? 1068 ASN C ND2 1 
ATOM   8781  N N   . GLN C 1 273 ? 3.095   18.892  13.402   1.00 102.08 ? 1069 GLN C N   1 
ATOM   8782  C CA  . GLN C 1 273 ? 2.719   20.307  13.430   1.00 106.05 ? 1069 GLN C CA  1 
ATOM   8783  C C   . GLN C 1 273 ? 2.115   20.755  12.097   1.00 108.01 ? 1069 GLN C C   1 
ATOM   8784  O O   . GLN C 1 273 ? 1.224   21.608  12.059   1.00 111.01 ? 1069 GLN C O   1 
ATOM   8785  C CB  . GLN C 1 273 ? 3.920   21.181  13.799   1.00 103.52 ? 1069 GLN C CB  1 
ATOM   8786  C CG  . GLN C 1 273 ? 3.580   22.646  14.014   1.00 112.79 ? 1069 GLN C CG  1 
ATOM   8787  C CD  . GLN C 1 273 ? 4.765   23.452  14.516   1.00 125.73 ? 1069 GLN C CD  1 
ATOM   8788  O OE1 . GLN C 1 273 ? 5.842   22.906  14.762   1.00 121.14 ? 1069 GLN C OE1 1 
ATOM   8789  N NE2 . GLN C 1 273 ? 4.572   24.760  14.670   1.00 131.64 ? 1069 GLN C NE2 1 
ATOM   8790  N N   . ASP C 1 274 ? 2.601   20.171  11.005   1.00 105.44 ? 1070 ASP C N   1 
ATOM   8791  C CA  . ASP C 1 274 ? 2.061   20.461  9.679    1.00 102.66 ? 1070 ASP C CA  1 
ATOM   8792  C C   . ASP C 1 274 ? 0.696   19.810  9.461    1.00 99.14  ? 1070 ASP C C   1 
ATOM   8793  O O   . ASP C 1 274 ? -0.131  20.330  8.716    1.00 95.42  ? 1070 ASP C O   1 
ATOM   8794  C CB  . ASP C 1 274 ? 3.034   20.013  8.589    1.00 102.64 ? 1070 ASP C CB  1 
ATOM   8795  C CG  . ASP C 1 274 ? 4.317   20.817  8.592    1.00 107.89 ? 1070 ASP C CG  1 
ATOM   8796  O OD1 . ASP C 1 274 ? 4.260   22.030  8.883    1.00 110.47 ? 1070 ASP C OD1 1 
ATOM   8797  O OD2 . ASP C 1 274 ? 5.383   20.236  8.304    1.00 111.99 ? 1070 ASP C OD2 1 
ATOM   8798  N N   . VAL C 1 275 ? 0.471   18.668  10.104   1.00 97.15  ? 1071 VAL C N   1 
ATOM   8799  C CA  . VAL C 1 275 ? -0.821  17.997  10.036   1.00 95.03  ? 1071 VAL C CA  1 
ATOM   8800  C C   . VAL C 1 275 ? -1.862  18.829  10.760   1.00 97.71  ? 1071 VAL C C   1 
ATOM   8801  O O   . VAL C 1 275 ? -2.992  18.977  10.293   1.00 99.67  ? 1071 VAL C O   1 
ATOM   8802  C CB  . VAL C 1 275 ? -0.778  16.598  10.672   1.00 91.22  ? 1071 VAL C CB  1 
ATOM   8803  C CG1 . VAL C 1 275 ? -2.188  16.033  10.805   1.00 85.72  ? 1071 VAL C CG1 1 
ATOM   8804  C CG2 . VAL C 1 275 ? 0.103   15.671  9.852    1.00 90.05  ? 1071 VAL C CG2 1 
ATOM   8805  N N   . ASP C 1 276 ? -1.476  19.375  11.907   1.00 99.29  ? 1072 ASP C N   1 
ATOM   8806  C CA  . ASP C 1 276 ? -2.368  20.255  12.652   1.00 107.34 ? 1072 ASP C CA  1 
ATOM   8807  C C   . ASP C 1 276 ? -2.575  21.570  11.896   1.00 105.77 ? 1072 ASP C C   1 
ATOM   8808  O O   . ASP C 1 276 ? -3.655  22.165  11.945   1.00 108.34 ? 1072 ASP C O   1 
ATOM   8809  C CB  . ASP C 1 276 ? -1.829  20.506  14.065   1.00 117.35 ? 1072 ASP C CB  1 
ATOM   8810  C CG  . ASP C 1 276 ? -2.037  19.315  14.997   1.00 114.67 ? 1072 ASP C CG  1 
ATOM   8811  O OD1 . ASP C 1 276 ? -2.283  18.198  14.496   1.00 112.74 ? 1072 ASP C OD1 1 
ATOM   8812  O OD2 . ASP C 1 276 ? -1.954  19.499  16.233   1.00 105.96 ? 1072 ASP C OD2 1 
ATOM   8813  N N   . ALA C 1 277 ? -1.541  22.005  11.180   1.00 104.11 ? 1073 ALA C N   1 
ATOM   8814  C CA  . ALA C 1 277 ? -1.621  23.224  10.381   1.00 104.21 ? 1073 ALA C CA  1 
ATOM   8815  C C   . ALA C 1 277 ? -2.561  23.059  9.187    1.00 102.48 ? 1073 ALA C C   1 
ATOM   8816  O O   . ALA C 1 277 ? -3.257  23.996  8.793    1.00 104.47 ? 1073 ALA C O   1 
ATOM   8817  C CB  . ALA C 1 277 ? -0.235  23.642  9.911    1.00 102.16 ? 1073 ALA C CB  1 
ATOM   8818  N N   . ALA C 1 278 ? -2.569  21.862  8.610    1.00 98.32  ? 1074 ALA C N   1 
ATOM   8819  C CA  . ALA C 1 278 ? -3.410  21.564  7.456    1.00 99.44  ? 1074 ALA C CA  1 
ATOM   8820  C C   . ALA C 1 278 ? -4.857  21.256  7.843    1.00 105.28 ? 1074 ALA C C   1 
ATOM   8821  O O   . ALA C 1 278 ? -5.785  21.660  7.146    1.00 105.02 ? 1074 ALA C O   1 
ATOM   8822  C CB  . ALA C 1 278 ? -2.819  20.417  6.656    1.00 100.54 ? 1074 ALA C CB  1 
ATOM   8823  N N   . VAL C 1 279 ? -5.047  20.539  8.949    1.00 107.56 ? 1075 VAL C N   1 
ATOM   8824  C CA  . VAL C 1 279 ? -6.394  20.210  9.422    1.00 102.64 ? 1075 VAL C CA  1 
ATOM   8825  C C   . VAL C 1 279 ? -7.085  21.450  9.993    1.00 104.99 ? 1075 VAL C C   1 
ATOM   8826  O O   . VAL C 1 279 ? -8.244  21.740  9.669    1.00 106.69 ? 1075 VAL C O   1 
ATOM   8827  C CB  . VAL C 1 279 ? -6.379  19.086  10.477   1.00 92.42  ? 1075 VAL C CB  1 
ATOM   8828  C CG1 . VAL C 1 279 ? -7.783  18.825  10.990   1.00 90.42  ? 1075 VAL C CG1 1 
ATOM   8829  C CG2 . VAL C 1 279 ? -5.785  17.816  9.893    1.00 91.98  ? 1075 VAL C CG2 1 
ATOM   8830  N N   . ARG C 1 280 ? -6.370  22.184  10.841   1.00 107.38 ? 1076 ARG C N   1 
ATOM   8831  C CA  . ARG C 1 280 ? -6.872  23.461  11.331   1.00 111.36 ? 1076 ARG C CA  1 
ATOM   8832  C C   . ARG C 1 280 ? -7.033  24.421  10.155   1.00 111.04 ? 1076 ARG C C   1 
ATOM   8833  O O   . ARG C 1 280 ? -7.978  25.207  10.105   1.00 112.70 ? 1076 ARG C O   1 
ATOM   8834  C CB  . ARG C 1 280 ? -5.931  24.051  12.384   1.00 112.91 ? 1076 ARG C CB  1 
ATOM   8835  N N   . GLY C 1 281 ? -6.104  24.349  9.208    1.00 108.07 ? 1077 GLY C N   1 
ATOM   8836  C CA  . GLY C 1 281 ? -6.212  25.121  7.987    1.00 108.15 ? 1077 GLY C CA  1 
ATOM   8837  C C   . GLY C 1 281 ? -7.513  24.810  7.272    1.00 115.75 ? 1077 GLY C C   1 
ATOM   8838  O O   . GLY C 1 281 ? -8.109  25.685  6.645    1.00 121.75 ? 1077 GLY C O   1 
ATOM   8839  N N   . ILE C 1 282 ? -7.954  23.558  7.372    1.00 114.84 ? 1078 ILE C N   1 
ATOM   8840  C CA  . ILE C 1 282 ? -9.191  23.113  6.730    1.00 112.55 ? 1078 ILE C CA  1 
ATOM   8841  C C   . ILE C 1 282 ? -10.439 23.605  7.456    1.00 112.86 ? 1078 ILE C C   1 
ATOM   8842  O O   . ILE C 1 282 ? -11.371 24.109  6.828    1.00 116.32 ? 1078 ILE C O   1 
ATOM   8843  C CB  . ILE C 1 282 ? -9.261  21.575  6.604    1.00 105.43 ? 1078 ILE C CB  1 
ATOM   8844  C CG1 . ILE C 1 282 ? -8.323  21.086  5.504    1.00 97.02  ? 1078 ILE C CG1 1 
ATOM   8845  C CG2 . ILE C 1 282 ? -10.680 21.125  6.296    1.00 102.18 ? 1078 ILE C CG2 1 
ATOM   8846  C CD1 . ILE C 1 282 ? -8.479  19.617  5.198    1.00 96.55  ? 1078 ILE C CD1 1 
ATOM   8847  N N   . LEU C 1 283 ? -10.467 23.457  8.775    1.00 106.95 ? 1079 LEU C N   1 
ATOM   8848  C CA  . LEU C 1 283 ? -11.633 23.899  9.533    1.00 105.66 ? 1079 LEU C CA  1 
ATOM   8849  C C   . LEU C 1 283 ? -11.810 25.416  9.478    1.00 104.21 ? 1079 LEU C C   1 
ATOM   8850  O O   . LEU C 1 283 ? -12.931 25.919  9.540    1.00 98.23  ? 1079 LEU C O   1 
ATOM   8851  C CB  . LEU C 1 283 ? -11.550 23.417  10.978   1.00 103.56 ? 1079 LEU C CB  1 
ATOM   8852  C CG  . LEU C 1 283 ? -11.686 21.905  11.143   1.00 94.92  ? 1079 LEU C CG  1 
ATOM   8853  C CD1 . LEU C 1 283 ? -11.534 21.519  12.602   1.00 87.82  ? 1079 LEU C CD1 1 
ATOM   8854  C CD2 . LEU C 1 283 ? -13.022 21.436  10.587   1.00 92.70  ? 1079 LEU C CD2 1 
ATOM   8855  N N   . ARG C 1 284 ? -10.698 26.135  9.344    1.00 105.13 ? 1080 ARG C N   1 
ATOM   8856  C CA  . ARG C 1 284 ? -10.714 27.596  9.308    1.00 107.00 ? 1080 ARG C CA  1 
ATOM   8857  C C   . ARG C 1 284 ? -11.203 28.147  7.971    1.00 112.73 ? 1080 ARG C C   1 
ATOM   8858  O O   . ARG C 1 284 ? -11.354 29.356  7.807    1.00 116.98 ? 1080 ARG C O   1 
ATOM   8859  C CB  . ARG C 1 284 ? -9.332  28.165  9.639    1.00 109.15 ? 1080 ARG C CB  1 
ATOM   8860  C CG  . ARG C 1 284 ? -8.846  27.833  11.043   1.00 115.32 ? 1080 ARG C CG  1 
ATOM   8861  C CD  . ARG C 1 284 ? -7.676  28.709  11.465   1.00 114.47 ? 1080 ARG C CD  1 
ATOM   8862  N NE  . ARG C 1 284 ? -6.558  28.635  10.528   1.00 118.83 ? 1080 ARG C NE  1 
ATOM   8863  C CZ  . ARG C 1 284 ? -6.347  29.504  9.544    1.00 119.49 ? 1080 ARG C CZ  1 
ATOM   8864  N NH1 . ARG C 1 284 ? -7.178  30.522  9.362    1.00 112.66 ? 1080 ARG C NH1 1 
ATOM   8865  N NH2 . ARG C 1 284 ? -5.302  29.356  8.742    1.00 118.88 ? 1080 ARG C NH2 1 
ATOM   8866  N N   . ASN C 1 285 ? -11.435 27.254  7.015    1.00 118.00 ? 1081 ASN C N   1 
ATOM   8867  C CA  . ASN C 1 285 ? -11.901 27.644  5.687    1.00 117.28 ? 1081 ASN C CA  1 
ATOM   8868  C C   . ASN C 1 285 ? -13.416 27.487  5.526    1.00 116.76 ? 1081 ASN C C   1 
ATOM   8869  O O   . ASN C 1 285 ? -13.987 26.464  5.909    1.00 115.74 ? 1081 ASN C O   1 
ATOM   8870  C CB  . ASN C 1 285 ? -11.172 26.830  4.618    1.00 115.79 ? 1081 ASN C CB  1 
ATOM   8871  C CG  . ASN C 1 285 ? -11.471 27.311  3.215    1.00 115.27 ? 1081 ASN C CG  1 
ATOM   8872  O OD1 . ASN C 1 285 ? -12.458 26.902  2.603    1.00 113.71 ? 1081 ASN C OD1 1 
ATOM   8873  N ND2 . ASN C 1 285 ? -10.613 28.181  2.693    1.00 116.06 ? 1081 ASN C ND2 1 
ATOM   8874  N N   . ALA C 1 286 ? -14.059 28.499  4.950    1.00 112.65 ? 1082 ALA C N   1 
ATOM   8875  C CA  . ALA C 1 286 ? -15.514 28.502  4.812    1.00 104.98 ? 1082 ALA C CA  1 
ATOM   8876  C C   . ALA C 1 286 ? -16.014 27.459  3.823    1.00 100.58 ? 1082 ALA C C   1 
ATOM   8877  O O   . ALA C 1 286 ? -17.040 26.824  4.051    1.00 104.48 ? 1082 ALA C O   1 
ATOM   8878  C CB  . ALA C 1 286 ? -16.012 29.883  4.423    1.00 103.20 ? 1082 ALA C CB  1 
ATOM   8879  N N   . LYS C 1 287 ? -15.292 27.296  2.719    1.00 101.82 ? 1083 LYS C N   1 
ATOM   8880  C CA  . LYS C 1 287 ? -15.701 26.375  1.661    1.00 104.72 ? 1083 LYS C CA  1 
ATOM   8881  C C   . LYS C 1 287 ? -15.359 24.911  1.946    1.00 103.28 ? 1083 LYS C C   1 
ATOM   8882  O O   . LYS C 1 287 ? -16.043 24.003  1.475    1.00 100.83 ? 1083 LYS C O   1 
ATOM   8883  C CB  . LYS C 1 287 ? -15.093 26.800  0.321    1.00 100.14 ? 1083 LYS C CB  1 
ATOM   8884  N N   . LEU C 1 288 ? -14.293 24.685  2.704    1.00 104.06 ? 1084 LEU C N   1 
ATOM   8885  C CA  . LEU C 1 288 ? -13.804 23.331  2.950    1.00 105.53 ? 1084 LEU C CA  1 
ATOM   8886  C C   . LEU C 1 288 ? -14.546 22.569  4.052    1.00 110.48 ? 1084 LEU C C   1 
ATOM   8887  O O   . LEU C 1 288 ? -14.867 21.392  3.889    1.00 107.98 ? 1084 LEU C O   1 
ATOM   8888  C CB  . LEU C 1 288 ? -12.307 23.370  3.261    1.00 104.83 ? 1084 LEU C CB  1 
ATOM   8889  C CG  . LEU C 1 288 ? -11.452 24.042  2.185    1.00 103.70 ? 1084 LEU C CG  1 
ATOM   8890  C CD1 . LEU C 1 288 ? -10.024 24.225  2.665    1.00 113.66 ? 1084 LEU C CD1 1 
ATOM   8891  C CD2 . LEU C 1 288 ? -11.494 23.249  0.891    1.00 110.21 ? 1084 LEU C CD2 1 
ATOM   8892  N N   . LYS C 1 289 ? -14.820 23.247  5.163    1.00 110.05 ? 1085 LYS C N   1 
ATOM   8893  C CA  . LYS C 1 289 ? -15.369 22.603  6.357    1.00 103.67 ? 1085 LYS C CA  1 
ATOM   8894  C C   . LYS C 1 289 ? -16.508 21.620  6.080    1.00 106.87 ? 1085 LYS C C   1 
ATOM   8895  O O   . LYS C 1 289 ? -16.466 20.481  6.543    1.00 109.65 ? 1085 LYS C O   1 
ATOM   8896  C CB  . LYS C 1 289 ? -15.807 23.654  7.377    1.00 103.60 ? 1085 LYS C CB  1 
ATOM   8897  C CG  . LYS C 1 289 ? -16.641 23.106  8.516    1.00 103.84 ? 1085 LYS C CG  1 
ATOM   8898  C CD  . LYS C 1 289 ? -17.115 24.229  9.419    1.00 105.23 ? 1085 LYS C CD  1 
ATOM   8899  C CE  . LYS C 1 289 ? -18.087 23.719  10.462   1.00 101.58 ? 1085 LYS C CE  1 
ATOM   8900  N NZ  . LYS C 1 289 ? -19.277 23.088  9.829    1.00 90.98  ? 1085 LYS C NZ  1 
ATOM   8901  N N   . PRO C 1 290 ? -17.532 22.053  5.325    1.00 111.02 ? 1086 PRO C N   1 
ATOM   8902  C CA  . PRO C 1 290 ? -18.656 21.167  4.998    1.00 113.81 ? 1086 PRO C CA  1 
ATOM   8903  C C   . PRO C 1 290 ? -18.216 19.938  4.206    1.00 111.42 ? 1086 PRO C C   1 
ATOM   8904  O O   . PRO C 1 290 ? -18.759 18.852  4.404    1.00 113.68 ? 1086 PRO C O   1 
ATOM   8905  C CB  . PRO C 1 290 ? -19.555 22.050  4.130    1.00 114.93 ? 1086 PRO C CB  1 
ATOM   8906  C CG  . PRO C 1 290 ? -19.220 23.443  4.537    1.00 116.89 ? 1086 PRO C CG  1 
ATOM   8907  C CD  . PRO C 1 290 ? -17.750 23.419  4.819    1.00 114.19 ? 1086 PRO C CD  1 
ATOM   8908  N N   . VAL C 1 291 ? -17.245 20.112  3.318    1.00 106.86 ? 1087 VAL C N   1 
ATOM   8909  C CA  . VAL C 1 291 ? -16.726 19.004  2.528    1.00 105.24 ? 1087 VAL C CA  1 
ATOM   8910  C C   . VAL C 1 291 ? -16.002 18.005  3.417    1.00 107.81 ? 1087 VAL C C   1 
ATOM   8911  O O   . VAL C 1 291 ? -16.206 16.796  3.314    1.00 103.34 ? 1087 VAL C O   1 
ATOM   8912  C CB  . VAL C 1 291 ? -15.739 19.496  1.462    1.00 103.14 ? 1087 VAL C CB  1 
ATOM   8913  C CG1 . VAL C 1 291 ? -15.171 18.318  0.691    1.00 103.20 ? 1087 VAL C CG1 1 
ATOM   8914  C CG2 . VAL C 1 291 ? -16.412 20.482  0.527    1.00 109.42 ? 1087 VAL C CG2 1 
ATOM   8915  N N   . TYR C 1 292 ? -15.153 18.534  4.293    1.00 116.36 ? 1088 TYR C N   1 
ATOM   8916  C CA  . TYR C 1 292 ? -14.327 17.733  5.190    1.00 116.92 ? 1088 TYR C CA  1 
ATOM   8917  C C   . TYR C 1 292 ? -15.173 16.943  6.181    1.00 117.19 ? 1088 TYR C C   1 
ATOM   8918  O O   . TYR C 1 292 ? -14.888 15.779  6.466    1.00 110.75 ? 1088 TYR C O   1 
ATOM   8919  C CB  . TYR C 1 292 ? -13.345 18.650  5.927    1.00 113.09 ? 1088 TYR C CB  1 
ATOM   8920  C CG  . TYR C 1 292 ? -12.490 17.973  6.970    1.00 111.49 ? 1088 TYR C CG  1 
ATOM   8921  C CD1 . TYR C 1 292 ? -11.243 17.461  6.647    1.00 111.11 ? 1088 TYR C CD1 1 
ATOM   8922  C CD2 . TYR C 1 292 ? -12.923 17.865  8.285    1.00 122.01 ? 1088 TYR C CD2 1 
ATOM   8923  C CE1 . TYR C 1 292 ? -10.453 16.846  7.603    1.00 123.12 ? 1088 TYR C CE1 1 
ATOM   8924  C CE2 . TYR C 1 292 ? -12.144 17.254  9.249    1.00 128.03 ? 1088 TYR C CE2 1 
ATOM   8925  C CZ  . TYR C 1 292 ? -10.909 16.746  8.904    1.00 131.80 ? 1088 TYR C CZ  1 
ATOM   8926  O OH  . TYR C 1 292 ? -10.130 16.137  9.864    1.00 129.01 ? 1088 TYR C OH  1 
ATOM   8927  N N   . ASP C 1 293 ? -16.219 17.582  6.697    1.00 125.43 ? 1089 ASP C N   1 
ATOM   8928  C CA  . ASP C 1 293 ? -17.091 16.963  7.691    1.00 128.55 ? 1089 ASP C CA  1 
ATOM   8929  C C   . ASP C 1 293 ? -17.978 15.870  7.096    1.00 127.91 ? 1089 ASP C C   1 
ATOM   8930  O O   . ASP C 1 293 ? -18.384 14.943  7.797    1.00 129.46 ? 1089 ASP C O   1 
ATOM   8931  C CB  . ASP C 1 293 ? -17.960 18.023  8.374    1.00 121.76 ? 1089 ASP C CB  1 
ATOM   8932  N N   . SER C 1 294 ? -18.265 15.973  5.802    1.00 119.33 ? 1090 SER C N   1 
ATOM   8933  C CA  . SER C 1 294 ? -19.184 15.047  5.150    1.00 114.77 ? 1090 SER C CA  1 
ATOM   8934  C C   . SER C 1 294 ? -18.476 13.814  4.598    1.00 115.68 ? 1090 SER C C   1 
ATOM   8935  O O   . SER C 1 294 ? -19.104 12.960  3.970    1.00 115.87 ? 1090 SER C O   1 
ATOM   8936  C CB  . SER C 1 294 ? -19.932 15.752  4.021    1.00 116.49 ? 1090 SER C CB  1 
ATOM   8937  O OG  . SER C 1 294 ? -19.033 16.169  3.008    1.00 116.70 ? 1090 SER C OG  1 
ATOM   8938  N N   . LEU C 1 295 ? -17.171 13.722  4.833    1.00 114.20 ? 1091 LEU C N   1 
ATOM   8939  C CA  . LEU C 1 295 ? -16.378 12.635  4.266    1.00 114.99 ? 1091 LEU C CA  1 
ATOM   8940  C C   . LEU C 1 295 ? -15.879 11.636  5.308    1.00 120.06 ? 1091 LEU C C   1 
ATOM   8941  O O   . LEU C 1 295 ? -15.624 11.994  6.458    1.00 119.66 ? 1091 LEU C O   1 
ATOM   8942  C CB  . LEU C 1 295 ? -15.202 13.200  3.470    1.00 111.05 ? 1091 LEU C CB  1 
ATOM   8943  C CG  . LEU C 1 295 ? -15.583 14.013  2.233    1.00 110.62 ? 1091 LEU C CG  1 
ATOM   8944  C CD1 . LEU C 1 295 ? -14.348 14.657  1.629    1.00 104.04 ? 1091 LEU C CD1 1 
ATOM   8945  C CD2 . LEU C 1 295 ? -16.305 13.137  1.216    1.00 113.74 ? 1091 LEU C CD2 1 
ATOM   8946  N N   . ASP C 1 296 ? -15.753 10.378  4.889    1.00 121.97 ? 1092 ASP C N   1 
ATOM   8947  C CA  . ASP C 1 296 ? -15.258 9.297   5.746    1.00 122.10 ? 1092 ASP C CA  1 
ATOM   8948  C C   . ASP C 1 296 ? -13.741 9.351   5.966    1.00 118.08 ? 1092 ASP C C   1 
ATOM   8949  O O   . ASP C 1 296 ? -13.017 9.991   5.204    1.00 112.18 ? 1092 ASP C O   1 
ATOM   8950  C CB  . ASP C 1 296 ? -15.680 7.929   5.201    1.00 119.79 ? 1092 ASP C CB  1 
ATOM   8951  C CG  . ASP C 1 296 ? -15.248 7.716   3.767    1.00 118.35 ? 1092 ASP C CG  1 
ATOM   8952  O OD1 . ASP C 1 296 ? -14.197 7.076   3.551    1.00 112.74 ? 1092 ASP C OD1 1 
ATOM   8953  O OD2 . ASP C 1 296 ? -15.958 8.190   2.857    1.00 120.74 ? 1092 ASP C OD2 1 
ATOM   8954  N N   . ALA C 1 297 ? -13.272 8.662   7.003    1.00 114.30 ? 1093 ALA C N   1 
ATOM   8955  C CA  . ALA C 1 297 ? -11.893 8.795   7.474    1.00 109.29 ? 1093 ALA C CA  1 
ATOM   8956  C C   . ALA C 1 297 ? -10.863 8.754   6.349    1.00 100.81 ? 1093 ALA C C   1 
ATOM   8957  O O   . ALA C 1 297 ? -9.983  9.613   6.267    1.00 99.84  ? 1093 ALA C O   1 
ATOM   8958  C CB  . ALA C 1 297 ? -11.585 7.719   8.510    1.00 113.86 ? 1093 ALA C CB  1 
ATOM   8959  N N   . VAL C 1 298 ? -10.976 7.753   5.486    1.00 99.27  ? 1094 VAL C N   1 
ATOM   8960  C CA  . VAL C 1 298 ? -10.057 7.603   4.365    1.00 94.48  ? 1094 VAL C CA  1 
ATOM   8961  C C   . VAL C 1 298 ? -10.039 8.854   3.480    1.00 91.59  ? 1094 VAL C C   1 
ATOM   8962  O O   . VAL C 1 298 ? -9.012  9.533   3.354    1.00 91.82  ? 1094 VAL C O   1 
ATOM   8963  C CB  . VAL C 1 298 ? -10.415 6.361   3.523    1.00 92.11  ? 1094 VAL C CB  1 
ATOM   8964  C CG1 . VAL C 1 298 ? -9.369  6.125   2.455    1.00 90.96  ? 1094 VAL C CG1 1 
ATOM   8965  C CG2 . VAL C 1 298 ? -10.548 5.135   4.418    1.00 91.67  ? 1094 VAL C CG2 1 
ATOM   8966  N N   . ARG C 1 299 ? -11.183 9.149   2.869    1.00 89.83  ? 1095 ARG C N   1 
ATOM   8967  C CA  . ARG C 1 299 ? -11.307 10.284  1.959    1.00 90.16  ? 1095 ARG C CA  1 
ATOM   8968  C C   . ARG C 1 299 ? -10.926 11.599  2.637    1.00 91.93  ? 1095 ARG C C   1 
ATOM   8969  O O   . ARG C 1 299 ? -10.311 12.472  2.021    1.00 92.97  ? 1095 ARG C O   1 
ATOM   8970  C CB  . ARG C 1 299 ? -12.723 10.357  1.378    1.00 96.98  ? 1095 ARG C CB  1 
ATOM   8971  C CG  . ARG C 1 299 ? -13.127 9.120   0.570    1.00 98.02  ? 1095 ARG C CG  1 
ATOM   8972  C CD  . ARG C 1 299 ? -14.476 9.306   -0.112   1.00 94.53  ? 1095 ARG C CD  1 
ATOM   8973  N NE  . ARG C 1 299 ? -14.808 8.204   -1.012   1.00 85.51  ? 1095 ARG C NE  1 
ATOM   8974  C CZ  . ARG C 1 299 ? -15.712 7.268   -0.750   1.00 85.43  ? 1095 ARG C CZ  1 
ATOM   8975  N NH1 . ARG C 1 299 ? -16.386 7.297   0.386    1.00 90.48  ? 1095 ARG C NH1 1 
ATOM   8976  N NH2 . ARG C 1 299 ? -15.951 6.307   -1.629   1.00 88.11  ? 1095 ARG C NH2 1 
ATOM   8977  N N   . ARG C 1 300 ? -11.298 11.738  3.904    1.00 95.95  ? 1096 ARG C N   1 
ATOM   8978  C CA  . ARG C 1 300 ? -10.808 12.844  4.717    1.00 94.58  ? 1096 ARG C CA  1 
ATOM   8979  C C   . ARG C 1 300 ? -9.297  12.921  4.565    1.00 92.71  ? 1096 ARG C C   1 
ATOM   8980  O O   . ARG C 1 300 ? -8.756  13.916  4.087    1.00 84.27  ? 1096 ARG C O   1 
ATOM   8981  C CB  . ARG C 1 300 ? -11.161 12.641  6.190    1.00 96.23  ? 1096 ARG C CB  1 
ATOM   8982  C CG  . ARG C 1 300 ? -12.571 13.042  6.565    1.00 100.23 ? 1096 ARG C CG  1 
ATOM   8983  C CD  . ARG C 1 300 ? -12.796 12.846  8.050    1.00 110.15 ? 1096 ARG C CD  1 
ATOM   8984  N NE  . ARG C 1 300 ? -14.109 13.323  8.469    1.00 125.44 ? 1096 ARG C NE  1 
ATOM   8985  C CZ  . ARG C 1 300 ? -14.569 13.238  9.713    1.00 135.34 ? 1096 ARG C CZ  1 
ATOM   8986  N NH1 . ARG C 1 300 ? -13.822 12.690  10.662   1.00 132.91 ? 1096 ARG C NH1 1 
ATOM   8987  N NH2 . ARG C 1 300 ? -15.778 13.699  10.009   1.00 136.02 ? 1096 ARG C NH2 1 
ATOM   8988  N N   . ALA C 1 301 ? -8.626  11.852  4.984    1.00 96.28  ? 1097 ALA C N   1 
ATOM   8989  C CA  . ALA C 1 301 ? -7.174  11.777  4.941    1.00 89.34  ? 1097 ALA C CA  1 
ATOM   8990  C C   . ALA C 1 301 ? -6.635  12.230  3.590    1.00 88.25  ? 1097 ALA C C   1 
ATOM   8991  O O   . ALA C 1 301 ? -5.681  13.005  3.527    1.00 87.57  ? 1097 ALA C O   1 
ATOM   8992  C CB  . ALA C 1 301 ? -6.717  10.364  5.250    1.00 93.36  ? 1097 ALA C CB  1 
ATOM   8993  N N   . ALA C 1 302 ? -7.239  11.742  2.512    1.00 89.62  ? 1098 ALA C N   1 
ATOM   8994  C CA  . ALA C 1 302 ? -6.850  12.181  1.173    1.00 88.05  ? 1098 ALA C CA  1 
ATOM   8995  C C   . ALA C 1 302 ? -6.964  13.701  1.026    1.00 88.87  ? 1098 ALA C C   1 
ATOM   8996  O O   . ALA C 1 302 ? -6.089  14.354  0.443    1.00 88.49  ? 1098 ALA C O   1 
ATOM   8997  C CB  . ALA C 1 302 ? -7.692  11.479  0.119    1.00 87.26  ? 1098 ALA C CB  1 
ATOM   8998  N N   . LEU C 1 303 ? -8.041  14.264  1.564    1.00 90.12  ? 1099 LEU C N   1 
ATOM   8999  C CA  . LEU C 1 303 ? -8.253  15.708  1.502    1.00 90.76  ? 1099 LEU C CA  1 
ATOM   9000  C C   . LEU C 1 303 ? -7.166  16.462  2.268    1.00 87.00  ? 1099 LEU C C   1 
ATOM   9001  O O   . LEU C 1 303 ? -6.648  17.484  1.805    1.00 84.01  ? 1099 LEU C O   1 
ATOM   9002  C CB  . LEU C 1 303 ? -9.641  16.071  2.035    1.00 88.96  ? 1099 LEU C CB  1 
ATOM   9003  C CG  . LEU C 1 303 ? -10.057 17.535  1.893    1.00 88.91  ? 1099 LEU C CG  1 
ATOM   9004  C CD1 . LEU C 1 303 ? -9.684  18.077  0.522    1.00 95.93  ? 1099 LEU C CD1 1 
ATOM   9005  C CD2 . LEU C 1 303 ? -11.546 17.698  2.146    1.00 92.23  ? 1099 LEU C CD2 1 
ATOM   9006  N N   . ILE C 1 304 ? -6.821  15.946  3.440    1.00 85.80  ? 1100 ILE C N   1 
ATOM   9007  C CA  . ILE C 1 304 ? -5.735  16.505  4.227    1.00 89.07  ? 1100 ILE C CA  1 
ATOM   9008  C C   . ILE C 1 304 ? -4.436  16.445  3.430    1.00 92.24  ? 1100 ILE C C   1 
ATOM   9009  O O   . ILE C 1 304 ? -3.597  17.339  3.521    1.00 95.75  ? 1100 ILE C O   1 
ATOM   9010  C CB  . ILE C 1 304 ? -5.561  15.740  5.544    1.00 86.37  ? 1100 ILE C CB  1 
ATOM   9011  C CG1 . ILE C 1 304 ? -6.920  15.556  6.224    1.00 90.86  ? 1100 ILE C CG1 1 
ATOM   9012  C CG2 . ILE C 1 304 ? -4.580  16.463  6.455    1.00 79.70  ? 1100 ILE C CG2 1 
ATOM   9013  C CD1 . ILE C 1 304 ? -6.853  14.820  7.539    1.00 103.95 ? 1100 ILE C CD1 1 
ATOM   9014  N N   . ASN C 1 305 ? -4.291  15.376  2.651    1.00 89.57  ? 1101 ASN C N   1 
ATOM   9015  C CA  . ASN C 1 305 ? -3.150  15.168  1.764    1.00 87.60  ? 1101 ASN C CA  1 
ATOM   9016  C C   . ASN C 1 305 ? -3.037  16.307  0.747    1.00 92.25  ? 1101 ASN C C   1 
ATOM   9017  O O   . ASN C 1 305 ? -1.981  16.956  0.608    1.00 92.23  ? 1101 ASN C O   1 
ATOM   9018  C CB  . ASN C 1 305 ? -3.315  13.815  1.060    1.00 78.83  ? 1101 ASN C CB  1 
ATOM   9019  C CG  . ASN C 1 305 ? -2.194  13.502  0.088    1.00 83.93  ? 1101 ASN C CG  1 
ATOM   9020  O OD1 . ASN C 1 305 ? -1.799  14.334  -0.725   1.00 89.12  ? 1101 ASN C OD1 1 
ATOM   9021  N ND2 . ASN C 1 305 ? -1.685  12.280  0.160    1.00 82.84  ? 1101 ASN C ND2 1 
ATOM   9022  N N   . MET C 1 306 ? -4.139  16.556  0.046    1.00 91.23  ? 1102 MET C N   1 
ATOM   9023  C CA  . MET C 1 306 ? -4.186  17.649  -0.915   1.00 89.23  ? 1102 MET C CA  1 
ATOM   9024  C C   . MET C 1 306 ? -3.838  18.969  -0.247   1.00 94.37  ? 1102 MET C C   1 
ATOM   9025  O O   . MET C 1 306 ? -2.917  19.667  -0.673   1.00 95.13  ? 1102 MET C O   1 
ATOM   9026  C CB  . MET C 1 306 ? -5.569  17.755  -1.548   1.00 91.51  ? 1102 MET C CB  1 
ATOM   9027  C CG  . MET C 1 306 ? -5.891  16.675  -2.552   1.00 86.07  ? 1102 MET C CG  1 
ATOM   9028  S SD  . MET C 1 306 ? -7.497  16.979  -3.293   1.00 73.48  ? 1102 MET C SD  1 
ATOM   9029  C CE  . MET C 1 306 ? -7.182  18.515  -4.148   1.00 88.68  ? 1102 MET C CE  1 
ATOM   9030  N N   . VAL C 1 307 ? -4.579  19.312  0.802    1.00 95.09  ? 1103 VAL C N   1 
ATOM   9031  C CA  . VAL C 1 307 ? -4.329  20.560  1.507    1.00 96.85  ? 1103 VAL C CA  1 
ATOM   9032  C C   . VAL C 1 307 ? -2.864  20.625  1.932    1.00 100.40 ? 1103 VAL C C   1 
ATOM   9033  O O   . VAL C 1 307 ? -2.299  21.706  2.105    1.00 97.12  ? 1103 VAL C O   1 
ATOM   9034  C CB  . VAL C 1 307 ? -5.221  20.687  2.753    1.00 91.51  ? 1103 VAL C CB  1 
ATOM   9035  C CG1 . VAL C 1 307 ? -5.014  22.042  3.409    1.00 98.70  ? 1103 VAL C CG1 1 
ATOM   9036  C CG2 . VAL C 1 307 ? -6.676  20.490  2.382    1.00 88.56  ? 1103 VAL C CG2 1 
ATOM   9037  N N   . PHE C 1 308 ? -2.257  19.452  2.075    1.00 102.97 ? 1104 PHE C N   1 
ATOM   9038  C CA  . PHE C 1 308 ? -0.888  19.322  2.558    1.00 101.55 ? 1104 PHE C CA  1 
ATOM   9039  C C   . PHE C 1 308 ? 0.126   19.667  1.474    1.00 102.05 ? 1104 PHE C C   1 
ATOM   9040  O O   . PHE C 1 308 ? 1.173   20.246  1.759    1.00 106.43 ? 1104 PHE C O   1 
ATOM   9041  C CB  . PHE C 1 308 ? -0.650  17.903  3.075    1.00 98.19  ? 1104 PHE C CB  1 
ATOM   9042  C CG  . PHE C 1 308 ? 0.609   17.745  3.874    1.00 98.58  ? 1104 PHE C CG  1 
ATOM   9043  C CD1 . PHE C 1 308 ? 0.612   17.976  5.240    1.00 98.30  ? 1104 PHE C CD1 1 
ATOM   9044  C CD2 . PHE C 1 308 ? 1.787   17.346  3.264    1.00 109.75 ? 1104 PHE C CD2 1 
ATOM   9045  C CE1 . PHE C 1 308 ? 1.771   17.824  5.984    1.00 104.95 ? 1104 PHE C CE1 1 
ATOM   9046  C CE2 . PHE C 1 308 ? 2.950   17.192  4.000    1.00 114.91 ? 1104 PHE C CE2 1 
ATOM   9047  C CZ  . PHE C 1 308 ? 2.943   17.431  5.362    1.00 110.95 ? 1104 PHE C CZ  1 
ATOM   9048  N N   . GLN C 1 309 ? -0.177  19.304  0.231    1.00 102.65 ? 1105 GLN C N   1 
ATOM   9049  C CA  . GLN C 1 309 ? 0.715   19.664  -0.875   1.00 105.92 ? 1105 GLN C CA  1 
ATOM   9050  C C   . GLN C 1 309 ? 0.512   21.100  -1.379   1.00 110.03 ? 1105 GLN C C   1 
ATOM   9051  O O   . GLN C 1 309 ? 1.419   21.931  -1.288   1.00 106.68 ? 1105 GLN C O   1 
ATOM   9052  C CB  . GLN C 1 309 ? 0.600   18.665  -2.033   1.00 96.17  ? 1105 GLN C CB  1 
ATOM   9053  N N   . MET C 1 310 ? -0.675  21.384  -1.909   1.00 115.33 ? 1106 MET C N   1 
ATOM   9054  C CA  . MET C 1 310 ? -0.969  22.686  -2.514   1.00 117.10 ? 1106 MET C CA  1 
ATOM   9055  C C   . MET C 1 310 ? -1.231  23.803  -1.502   1.00 122.98 ? 1106 MET C C   1 
ATOM   9056  O O   . MET C 1 310 ? -0.895  24.964  -1.753   1.00 120.64 ? 1106 MET C O   1 
ATOM   9057  C CB  . MET C 1 310 ? -2.150  22.575  -3.484   1.00 107.73 ? 1106 MET C CB  1 
ATOM   9058  C CG  . MET C 1 310 ? -1.815  21.865  -4.782   1.00 114.37 ? 1106 MET C CG  1 
ATOM   9059  S SD  . MET C 1 310 ? -3.219  21.770  -5.907   1.00 132.84 ? 1106 MET C SD  1 
ATOM   9060  C CE  . MET C 1 310 ? -4.397  20.891  -4.887   1.00 112.54 ? 1106 MET C CE  1 
ATOM   9061  N N   . GLY C 1 311 ? -1.825  23.451  -0.363   1.00 119.64 ? 1107 GLY C N   1 
ATOM   9062  C CA  . GLY C 1 311 ? -2.170  24.429  0.656    1.00 117.58 ? 1107 GLY C CA  1 
ATOM   9063  C C   . GLY C 1 311 ? -3.658  24.716  0.730    1.00 115.96 ? 1107 GLY C C   1 
ATOM   9064  O O   . GLY C 1 311 ? -4.450  24.117  0.004    1.00 115.78 ? 1107 GLY C O   1 
ATOM   9065  N N   . GLU C 1 312 ? -4.038  25.628  1.619    1.00 114.14 ? 1108 GLU C N   1 
ATOM   9066  C CA  . GLU C 1 312 ? -5.443  25.972  1.831    1.00 120.42 ? 1108 GLU C CA  1 
ATOM   9067  C C   . GLU C 1 312 ? -6.152  26.474  0.565    1.00 125.97 ? 1108 GLU C C   1 
ATOM   9068  O O   . GLU C 1 312 ? -7.028  25.792  0.020    1.00 127.36 ? 1108 GLU C O   1 
ATOM   9069  C CB  . GLU C 1 312 ? -5.567  27.004  2.955    1.00 125.76 ? 1108 GLU C CB  1 
ATOM   9070  C CG  . GLU C 1 312 ? -6.995  27.355  3.340    1.00 121.96 ? 1108 GLU C CG  1 
ATOM   9071  C CD  . GLU C 1 312 ? -7.060  28.308  4.520    1.00 126.77 ? 1108 GLU C CD  1 
ATOM   9072  O OE1 . GLU C 1 312 ? -8.036  29.083  4.611    1.00 126.43 ? 1108 GLU C OE1 1 
ATOM   9073  O OE2 . GLU C 1 312 ? -6.135  28.280  5.360    1.00 129.23 ? 1108 GLU C OE2 1 
ATOM   9074  N N   . THR C 1 313 ? -5.774  27.665  0.102    1.00 130.37 ? 1109 THR C N   1 
ATOM   9075  C CA  . THR C 1 313 ? -6.422  28.281  -1.059   1.00 122.33 ? 1109 THR C CA  1 
ATOM   9076  C C   . THR C 1 313 ? -6.349  27.368  -2.282   1.00 120.24 ? 1109 THR C C   1 
ATOM   9077  O O   . THR C 1 313 ? -7.293  27.296  -3.075   1.00 119.55 ? 1109 THR C O   1 
ATOM   9078  C CB  . THR C 1 313 ? -5.814  29.672  -1.403   1.00 106.72 ? 1109 THR C CB  1 
ATOM   9079  O OG1 . THR C 1 313 ? -5.958  30.562  -0.289   1.00 97.31  ? 1109 THR C OG1 1 
ATOM   9080  C CG2 . THR C 1 313 ? -6.514  30.280  -2.609   1.00 93.60  ? 1109 THR C CG2 1 
ATOM   9081  N N   . GLY C 1 314 ? -5.229  26.662  -2.415   1.00 117.97 ? 1110 GLY C N   1 
ATOM   9082  C CA  . GLY C 1 314 ? -5.001  25.771  -3.539   1.00 119.34 ? 1110 GLY C CA  1 
ATOM   9083  C C   . GLY C 1 314 ? -6.076  24.716  -3.722   1.00 123.59 ? 1110 GLY C C   1 
ATOM   9084  O O   . GLY C 1 314 ? -6.653  24.591  -4.803   1.00 127.71 ? 1110 GLY C O   1 
ATOM   9085  N N   . VAL C 1 315 ? -6.343  23.951  -2.669   1.00 121.30 ? 1111 VAL C N   1 
ATOM   9086  C CA  . VAL C 1 315 ? -7.381  22.926  -2.715   1.00 115.26 ? 1111 VAL C CA  1 
ATOM   9087  C C   . VAL C 1 315 ? -8.764  23.569  -2.634   1.00 117.94 ? 1111 VAL C C   1 
ATOM   9088  O O   . VAL C 1 315 ? -9.761  22.983  -3.059   1.00 116.59 ? 1111 VAL C O   1 
ATOM   9089  C CB  . VAL C 1 315 ? -7.206  21.891  -1.588   1.00 109.29 ? 1111 VAL C CB  1 
ATOM   9090  C CG1 . VAL C 1 315 ? -8.286  20.824  -1.665   1.00 98.99  ? 1111 VAL C CG1 1 
ATOM   9091  C CG2 . VAL C 1 315 ? -5.827  21.261  -1.673   1.00 111.25 ? 1111 VAL C CG2 1 
ATOM   9092  N N   . ALA C 1 316 ? -8.817  24.782  -2.090   1.00 120.93 ? 1112 ALA C N   1 
ATOM   9093  C CA  . ALA C 1 316 ? -10.061 25.543  -2.079   1.00 123.62 ? 1112 ALA C CA  1 
ATOM   9094  C C   . ALA C 1 316 ? -10.407 26.010  -3.491   1.00 127.09 ? 1112 ALA C C   1 
ATOM   9095  O O   . ALA C 1 316 ? -11.514 26.489  -3.745   1.00 122.95 ? 1112 ALA C O   1 
ATOM   9096  C CB  . ALA C 1 316 ? -9.949  26.732  -1.137   1.00 120.14 ? 1112 ALA C CB  1 
ATOM   9097  N N   . GLY C 1 317 ? -9.455  25.852  -4.408   1.00 130.15 ? 1113 GLY C N   1 
ATOM   9098  C CA  . GLY C 1 317 ? -9.608  26.323  -5.775   1.00 127.85 ? 1113 GLY C CA  1 
ATOM   9099  C C   . GLY C 1 317 ? -10.343 25.405  -6.739   1.00 123.65 ? 1113 GLY C C   1 
ATOM   9100  O O   . GLY C 1 317 ? -10.395 25.685  -7.937   1.00 115.28 ? 1113 GLY C O   1 
ATOM   9101  N N   . PHE C 1 318 ? -10.907 24.310  -6.233   1.00 127.27 ? 1114 PHE C N   1 
ATOM   9102  C CA  . PHE C 1 318 ? -11.715 23.425  -7.071   1.00 129.03 ? 1114 PHE C CA  1 
ATOM   9103  C C   . PHE C 1 318 ? -13.179 23.476  -6.649   1.00 126.65 ? 1114 PHE C C   1 
ATOM   9104  O O   . PHE C 1 318 ? -13.559 22.904  -5.630   1.00 125.02 ? 1114 PHE C O   1 
ATOM   9105  C CB  . PHE C 1 318 ? -11.213 21.984  -6.963   1.00 125.24 ? 1114 PHE C CB  1 
ATOM   9106  C CG  . PHE C 1 318 ? -9.747  21.826  -7.251   1.00 125.22 ? 1114 PHE C CG  1 
ATOM   9107  C CD1 . PHE C 1 318 ? -9.311  21.441  -8.507   1.00 123.12 ? 1114 PHE C CD1 1 
ATOM   9108  C CD2 . PHE C 1 318 ? -8.803  22.054  -6.263   1.00 123.21 ? 1114 PHE C CD2 1 
ATOM   9109  C CE1 . PHE C 1 318 ? -7.961  21.291  -8.772   1.00 115.59 ? 1114 PHE C CE1 1 
ATOM   9110  C CE2 . PHE C 1 318 ? -7.454  21.906  -6.524   1.00 117.18 ? 1114 PHE C CE2 1 
ATOM   9111  C CZ  . PHE C 1 318 ? -7.033  21.524  -7.780   1.00 109.52 ? 1114 PHE C CZ  1 
ATOM   9112  N N   . THR C 1 319 ? -14.007 24.133  -7.452   1.00 120.90 ? 1115 THR C N   1 
ATOM   9113  C CA  . THR C 1 319 ? -15.409 24.298  -7.098   1.00 120.60 ? 1115 THR C CA  1 
ATOM   9114  C C   . THR C 1 319 ? -16.235 23.065  -7.447   1.00 124.66 ? 1115 THR C C   1 
ATOM   9115  O O   . THR C 1 319 ? -17.077 22.627  -6.661   1.00 122.76 ? 1115 THR C O   1 
ATOM   9116  C CB  . THR C 1 319 ? -16.022 25.544  -7.766   1.00 124.17 ? 1115 THR C CB  1 
ATOM   9117  O OG1 . THR C 1 319 ? -15.259 26.703  -7.409   1.00 108.89 ? 1115 THR C OG1 1 
ATOM   9118  C CG2 . THR C 1 319 ? -17.463 25.735  -7.316   1.00 129.48 ? 1115 THR C CG2 1 
ATOM   9119  N N   . ASN C 1 320 ? -15.981 22.508  -8.626   1.00 127.45 ? 1116 ASN C N   1 
ATOM   9120  C CA  . ASN C 1 320 ? -16.777 21.396  -9.137   1.00 132.40 ? 1116 ASN C CA  1 
ATOM   9121  C C   . ASN C 1 320 ? -16.552 20.092  -8.378   1.00 128.21 ? 1116 ASN C C   1 
ATOM   9122  O O   . ASN C 1 320 ? -17.503 19.459  -7.900   1.00 125.49 ? 1116 ASN C O   1 
ATOM   9123  C CB  . ASN C 1 320 ? -16.497 21.185  -10.627  1.00 131.06 ? 1116 ASN C CB  1 
ATOM   9124  N N   . SER C 1 321 ? -15.286 19.704  -8.266   1.00 121.78 ? 1117 SER C N   1 
ATOM   9125  C CA  . SER C 1 321 ? -14.917 18.437  -7.650   1.00 113.74 ? 1117 SER C CA  1 
ATOM   9126  C C   . SER C 1 321 ? -15.466 18.302  -6.236   1.00 116.17 ? 1117 SER C C   1 
ATOM   9127  O O   . SER C 1 321 ? -15.955 17.239  -5.851   1.00 113.11 ? 1117 SER C O   1 
ATOM   9128  C CB  . SER C 1 321 ? -13.399 18.284  -7.637   1.00 103.28 ? 1117 SER C CB  1 
ATOM   9129  O OG  . SER C 1 321 ? -12.878 18.387  -8.947   1.00 105.81 ? 1117 SER C OG  1 
ATOM   9130  N N   . LEU C 1 322 ? -15.387 19.385  -5.469   1.00 120.15 ? 1118 LEU C N   1 
ATOM   9131  C CA  . LEU C 1 322 ? -15.833 19.380  -4.079   1.00 116.84 ? 1118 LEU C CA  1 
ATOM   9132  C C   . LEU C 1 322 ? -17.351 19.294  -3.987   1.00 111.39 ? 1118 LEU C C   1 
ATOM   9133  O O   . LEU C 1 322 ? -17.895 18.508  -3.207   1.00 99.89  ? 1118 LEU C O   1 
ATOM   9134  C CB  . LEU C 1 322 ? -15.328 20.630  -3.356   1.00 113.32 ? 1118 LEU C CB  1 
ATOM   9135  C CG  . LEU C 1 322 ? -13.807 20.791  -3.359   1.00 111.47 ? 1118 LEU C CG  1 
ATOM   9136  C CD1 . LEU C 1 322 ? -13.392 22.083  -2.677   1.00 121.09 ? 1118 LEU C CD1 1 
ATOM   9137  C CD2 . LEU C 1 322 ? -13.151 19.594  -2.695   1.00 103.88 ? 1118 LEU C CD2 1 
ATOM   9138  N N   . ARG C 1 323 ? -18.029 20.106  -4.790   1.00 116.23 ? 1119 ARG C N   1 
ATOM   9139  C CA  . ARG C 1 323 ? -19.483 20.081  -4.836   1.00 116.45 ? 1119 ARG C CA  1 
ATOM   9140  C C   . ARG C 1 323 ? -19.976 18.676  -5.135   1.00 111.37 ? 1119 ARG C C   1 
ATOM   9141  O O   . ARG C 1 323 ? -20.920 18.197  -4.510   1.00 104.76 ? 1119 ARG C O   1 
ATOM   9142  C CB  . ARG C 1 323 ? -20.014 21.036  -5.900   1.00 121.76 ? 1119 ARG C CB  1 
ATOM   9143  C CG  . ARG C 1 323 ? -21.516 20.931  -6.099   1.00 119.72 ? 1119 ARG C CG  1 
ATOM   9144  C CD  . ARG C 1 323 ? -21.907 21.382  -7.488   1.00 125.24 ? 1119 ARG C CD  1 
ATOM   9145  N NE  . ARG C 1 323 ? -21.238 22.628  -7.838   1.00 119.32 ? 1119 ARG C NE  1 
ATOM   9146  C CZ  . ARG C 1 323 ? -21.690 23.831  -7.508   1.00 116.84 ? 1119 ARG C CZ  1 
ATOM   9147  N NH1 . ARG C 1 323 ? -22.820 23.953  -6.824   1.00 115.64 ? 1119 ARG C NH1 1 
ATOM   9148  N NH2 . ARG C 1 323 ? -21.013 24.912  -7.864   1.00 114.42 ? 1119 ARG C NH2 1 
ATOM   9149  N N   . MET C 1 324 ? -19.338 18.023  -6.102   1.00 119.06 ? 1120 MET C N   1 
ATOM   9150  C CA  . MET C 1 324 ? -19.713 16.659  -6.464   1.00 117.97 ? 1120 MET C CA  1 
ATOM   9151  C C   . MET C 1 324 ? -19.235 15.665  -5.411   1.00 103.98 ? 1120 MET C C   1 
ATOM   9152  O O   . MET C 1 324 ? -19.713 14.533  -5.347   1.00 96.21  ? 1120 MET C O   1 
ATOM   9153  C CB  . MET C 1 324 ? -19.166 16.295  -7.846   1.00 119.53 ? 1120 MET C CB  1 
ATOM   9154  C CG  . MET C 1 324 ? -19.750 17.135  -8.972   1.00 125.00 ? 1120 MET C CG  1 
ATOM   9155  S SD  . MET C 1 324 ? -18.945 16.822  -10.551  1.00 137.31 ? 1120 MET C SD  1 
ATOM   9156  C CE  . MET C 1 324 ? -17.242 17.147  -10.110  1.00 243.68 ? 1120 MET C CE  1 
ATOM   9157  N N   . LEU C 1 325 ? -18.295 16.102  -4.581   1.00 100.56 ? 1121 LEU C N   1 
ATOM   9158  C CA  . LEU C 1 325 ? -17.794 15.279  -3.492   1.00 97.52  ? 1121 LEU C CA  1 
ATOM   9159  C C   . LEU C 1 325 ? -18.812 15.170  -2.373   1.00 106.44 ? 1121 LEU C C   1 
ATOM   9160  O O   . LEU C 1 325 ? -19.113 14.075  -1.899   1.00 109.53 ? 1121 LEU C O   1 
ATOM   9161  C CB  . LEU C 1 325 ? -16.502 15.862  -2.937   1.00 93.95  ? 1121 LEU C CB  1 
ATOM   9162  C CG  . LEU C 1 325 ? -15.222 15.282  -3.524   1.00 93.23  ? 1121 LEU C CG  1 
ATOM   9163  C CD1 . LEU C 1 325 ? -14.017 15.919  -2.858   1.00 91.14  ? 1121 LEU C CD1 1 
ATOM   9164  C CD2 . LEU C 1 325 ? -15.207 13.773  -3.347   1.00 89.22  ? 1121 LEU C CD2 1 
ATOM   9165  N N   . GLN C 1 326 ? -19.339 16.314  -1.951   1.00 107.88 ? 1122 GLN C N   1 
ATOM   9166  C CA  . GLN C 1 326 ? -20.300 16.347  -0.856   1.00 108.11 ? 1122 GLN C CA  1 
ATOM   9167  C C   . GLN C 1 326 ? -21.543 15.524  -1.191   1.00 108.70 ? 1122 GLN C C   1 
ATOM   9168  O O   . GLN C 1 326 ? -22.197 14.977  -0.301   1.00 108.73 ? 1122 GLN C O   1 
ATOM   9169  C CB  . GLN C 1 326 ? -20.679 17.792  -0.521   1.00 101.06 ? 1122 GLN C CB  1 
ATOM   9170  C CG  . GLN C 1 326 ? -19.488 18.673  -0.189   1.00 103.74 ? 1122 GLN C CG  1 
ATOM   9171  C CD  . GLN C 1 326 ? -19.873 20.121  0.039    1.00 107.52 ? 1122 GLN C CD  1 
ATOM   9172  O OE1 . GLN C 1 326 ? -19.986 20.572  1.178    1.00 109.27 ? 1122 GLN C OE1 1 
ATOM   9173  N NE2 . GLN C 1 326 ? -20.070 20.859  -1.048   1.00 109.35 ? 1122 GLN C NE2 1 
ATOM   9174  N N   . GLN C 1 327 ? -21.853 15.431  -2.482   1.00 105.19 ? 1123 GLN C N   1 
ATOM   9175  C CA  . GLN C 1 327 ? -23.028 14.699  -2.946   1.00 103.03 ? 1123 GLN C CA  1 
ATOM   9176  C C   . GLN C 1 327 ? -22.717 13.214  -3.075   1.00 99.80  ? 1123 GLN C C   1 
ATOM   9177  O O   . GLN C 1 327 ? -23.579 12.413  -3.441   1.00 96.22  ? 1123 GLN C O   1 
ATOM   9178  C CB  . GLN C 1 327 ? -23.515 15.267  -4.280   1.00 105.87 ? 1123 GLN C CB  1 
ATOM   9179  C CG  . GLN C 1 327 ? -23.848 16.754  -4.223   1.00 105.36 ? 1123 GLN C CG  1 
ATOM   9180  C CD  . GLN C 1 327 ? -24.195 17.330  -5.579   1.00 107.63 ? 1123 GLN C CD  1 
ATOM   9181  O OE1 . GLN C 1 327 ? -24.178 16.628  -6.590   1.00 109.61 ? 1123 GLN C OE1 1 
ATOM   9182  N NE2 . GLN C 1 327 ? -24.514 18.618  -5.608   1.00 107.89 ? 1123 GLN C NE2 1 
ATOM   9183  N N   . LYS C 1 328 ? -21.471 12.863  -2.774   1.00 100.97 ? 1124 LYS C N   1 
ATOM   9184  C CA  . LYS C 1 328 ? -21.016 11.475  -2.776   1.00 100.83 ? 1124 LYS C CA  1 
ATOM   9185  C C   . LYS C 1 328 ? -21.073 10.809  -4.156   1.00 97.83  ? 1124 LYS C C   1 
ATOM   9186  O O   . LYS C 1 328 ? -21.298 9.602   -4.266   1.00 90.07  ? 1124 LYS C O   1 
ATOM   9187  C CB  . LYS C 1 328 ? -21.775 10.655  -1.726   1.00 97.83  ? 1124 LYS C CB  1 
ATOM   9188  C CG  . LYS C 1 328 ? -21.500 11.096  -0.296   1.00 99.04  ? 1124 LYS C CG  1 
ATOM   9189  C CD  . LYS C 1 328 ? -22.267 10.258  0.712    1.00 104.06 ? 1124 LYS C CD  1 
ATOM   9190  C CE  . LYS C 1 328 ? -21.952 10.682  2.142    1.00 109.12 ? 1124 LYS C CE  1 
ATOM   9191  N NZ  . LYS C 1 328 ? -20.519 10.472  2.506    1.00 107.27 ? 1124 LYS C NZ  1 
ATOM   9192  N N   . ARG C 1 329 ? -20.842 11.602  -5.200   1.00 101.68 ? 1125 ARG C N   1 
ATOM   9193  C CA  . ARG C 1 329 ? -20.685 11.064  -6.545   1.00 99.28  ? 1125 ARG C CA  1 
ATOM   9194  C C   . ARG C 1 329 ? -19.190 11.015  -6.790   1.00 86.42  ? 1125 ARG C C   1 
ATOM   9195  O O   . ARG C 1 329 ? -18.558 12.044  -7.020   1.00 92.15  ? 1125 ARG C O   1 
ATOM   9196  C CB  . ARG C 1 329 ? -21.329 11.994  -7.578   1.00 106.15 ? 1125 ARG C CB  1 
ATOM   9197  C CG  . ARG C 1 329 ? -22.744 12.448  -7.242   1.00 105.95 ? 1125 ARG C CG  1 
ATOM   9198  C CD  . ARG C 1 329 ? -23.019 13.856  -7.773   1.00 101.36 ? 1125 ARG C CD  1 
ATOM   9199  N NE  . ARG C 1 329 ? -23.048 13.925  -9.232   1.00 94.10  ? 1125 ARG C NE  1 
ATOM   9200  C CZ  . ARG C 1 329 ? -23.237 15.049  -9.920   1.00 102.93 ? 1125 ARG C CZ  1 
ATOM   9201  N NH1 . ARG C 1 329 ? -23.407 16.200  -9.282   1.00 108.00 ? 1125 ARG C NH1 1 
ATOM   9202  N NH2 . ARG C 1 329 ? -23.257 15.029  -11.245  1.00 102.06 ? 1125 ARG C NH2 1 
ATOM   9203  N N   . TRP C 1 330 ? -18.630 9.814   -6.773   1.00 81.89  ? 1126 TRP C N   1 
ATOM   9204  C CA  . TRP C 1 330 ? -17.181 9.659   -6.699   1.00 86.27  ? 1126 TRP C CA  1 
ATOM   9205  C C   . TRP C 1 330 ? -16.499 9.750   -8.059   1.00 87.63  ? 1126 TRP C C   1 
ATOM   9206  O O   . TRP C 1 330 ? -15.673 10.635  -8.294   1.00 85.90  ? 1126 TRP C O   1 
ATOM   9207  C CB  . TRP C 1 330 ? -16.815 8.358   -5.981   1.00 83.27  ? 1126 TRP C CB  1 
ATOM   9208  C CG  . TRP C 1 330 ? -17.503 8.229   -4.654   1.00 89.23  ? 1126 TRP C CG  1 
ATOM   9209  C CD1 . TRP C 1 330 ? -18.408 7.275   -4.284   1.00 88.34  ? 1126 TRP C CD1 1 
ATOM   9210  C CD2 . TRP C 1 330 ? -17.364 9.108   -3.531   1.00 94.22  ? 1126 TRP C CD2 1 
ATOM   9211  N NE1 . TRP C 1 330 ? -18.829 7.498   -2.993   1.00 87.22  ? 1126 TRP C NE1 1 
ATOM   9212  C CE2 . TRP C 1 330 ? -18.204 8.619   -2.510   1.00 96.27  ? 1126 TRP C CE2 1 
ATOM   9213  C CE3 . TRP C 1 330 ? -16.605 10.259  -3.287   1.00 90.88  ? 1126 TRP C CE3 1 
ATOM   9214  C CZ2 . TRP C 1 330 ? -18.307 9.241   -1.267   1.00 99.35  ? 1126 TRP C CZ2 1 
ATOM   9215  C CZ3 . TRP C 1 330 ? -16.709 10.877  -2.052   1.00 88.04  ? 1126 TRP C CZ3 1 
ATOM   9216  C CH2 . TRP C 1 330 ? -17.553 10.366  -1.057   1.00 92.98  ? 1126 TRP C CH2 1 
ATOM   9217  N N   . ASP C 1 331 ? -16.846 8.825   -8.944   1.00 89.87  ? 1127 ASP C N   1 
ATOM   9218  C CA  . ASP C 1 331 ? -16.246 8.756   -10.268  1.00 88.00  ? 1127 ASP C CA  1 
ATOM   9219  C C   . ASP C 1 331 ? -16.211 10.123  -10.952  1.00 89.74  ? 1127 ASP C C   1 
ATOM   9220  O O   . ASP C 1 331 ? -15.164 10.560  -11.426  1.00 85.02  ? 1127 ASP C O   1 
ATOM   9221  C CB  . ASP C 1 331 ? -17.028 7.767   -11.131  1.00 88.92  ? 1127 ASP C CB  1 
ATOM   9222  C CG  . ASP C 1 331 ? -17.307 6.459   -10.412  1.00 91.14  ? 1127 ASP C CG  1 
ATOM   9223  O OD1 . ASP C 1 331 ? -18.323 6.370   -9.688   1.00 83.90  ? 1127 ASP C OD1 1 
ATOM   9224  O OD2 . ASP C 1 331 ? -16.505 5.517   -10.574  1.00 93.74  ? 1127 ASP C OD2 1 
ATOM   9225  N N   . GLU C 1 332 ? -17.357 10.796  -10.984  1.00 93.88  ? 1128 GLU C N   1 
ATOM   9226  C CA  . GLU C 1 332 ? -17.481 12.088  -11.650  1.00 90.91  ? 1128 GLU C CA  1 
ATOM   9227  C C   . GLU C 1 332 ? -16.514 13.106  -11.056  1.00 87.69  ? 1128 GLU C C   1 
ATOM   9228  O O   . GLU C 1 332 ? -15.821 13.825  -11.783  1.00 88.74  ? 1128 GLU C O   1 
ATOM   9229  C CB  . GLU C 1 332 ? -18.926 12.586  -11.556  1.00 99.84  ? 1128 GLU C CB  1 
ATOM   9230  C CG  . GLU C 1 332 ? -19.961 11.547  -12.004  1.00 102.11 ? 1128 GLU C CG  1 
ATOM   9231  C CD  . GLU C 1 332 ? -21.395 12.050  -11.924  1.00 109.52 ? 1128 GLU C CD  1 
ATOM   9232  O OE1 . GLU C 1 332 ? -21.587 13.258  -11.677  1.00 113.29 ? 1128 GLU C OE1 1 
ATOM   9233  O OE2 . GLU C 1 332 ? -22.328 11.235  -12.107  1.00 103.57 ? 1128 GLU C OE2 1 
ATOM   9234  N N   . ALA C 1 333 ? -16.467 13.151  -9.729   1.00 92.27  ? 1129 ALA C N   1 
ATOM   9235  C CA  . ALA C 1 333 ? -15.549 14.033  -9.016   1.00 100.13 ? 1129 ALA C CA  1 
ATOM   9236  C C   . ALA C 1 333 ? -14.094 13.738  -9.374   1.00 101.10 ? 1129 ALA C C   1 
ATOM   9237  O O   . ALA C 1 333 ? -13.291 14.660  -9.542   1.00 104.57 ? 1129 ALA C O   1 
ATOM   9238  C CB  . ALA C 1 333 ? -15.760 13.920  -7.517   1.00 97.77  ? 1129 ALA C CB  1 
ATOM   9239  N N   . ALA C 1 334 ? -13.760 12.453  -9.484   1.00 93.62  ? 1130 ALA C N   1 
ATOM   9240  C CA  . ALA C 1 334 ? -12.424 12.036  -9.904   1.00 92.47  ? 1130 ALA C CA  1 
ATOM   9241  C C   . ALA C 1 334 ? -12.122 12.540  -11.317  1.00 96.12  ? 1130 ALA C C   1 
ATOM   9242  O O   . ALA C 1 334 ? -10.989 12.944  -11.635  1.00 92.01  ? 1130 ALA C O   1 
ATOM   9243  C CB  . ALA C 1 334 ? -12.306 10.532  -9.845   1.00 82.89  ? 1130 ALA C CB  1 
ATOM   9244  N N   . VAL C 1 335 ? -13.149 12.511  -12.162  1.00 95.34  ? 1131 VAL C N   1 
ATOM   9245  C CA  . VAL C 1 335 ? -13.029 13.001  -13.526  1.00 95.19  ? 1131 VAL C CA  1 
ATOM   9246  C C   . VAL C 1 335 ? -12.690 14.485  -13.519  1.00 92.80  ? 1131 VAL C C   1 
ATOM   9247  O O   . VAL C 1 335 ? -11.742 14.909  -14.176  1.00 98.67  ? 1131 VAL C O   1 
ATOM   9248  C CB  . VAL C 1 335 ? -14.319 12.770  -14.339  1.00 98.08  ? 1131 VAL C CB  1 
ATOM   9249  C CG1 . VAL C 1 335 ? -14.143 13.283  -15.760  1.00 102.77 ? 1131 VAL C CG1 1 
ATOM   9250  C CG2 . VAL C 1 335 ? -14.687 11.293  -14.348  1.00 92.48  ? 1131 VAL C CG2 1 
ATOM   9251  N N   . ASN C 1 336 ? -13.460 15.273  -12.775  1.00 90.89  ? 1132 ASN C N   1 
ATOM   9252  C CA  . ASN C 1 336 ? -13.165 16.697  -12.657  1.00 88.32  ? 1132 ASN C CA  1 
ATOM   9253  C C   . ASN C 1 336 ? -11.787 16.938  -12.056  1.00 93.13  ? 1132 ASN C C   1 
ATOM   9254  O O   . ASN C 1 336 ? -11.147 17.950  -12.343  1.00 99.49  ? 1132 ASN C O   1 
ATOM   9255  C CB  . ASN C 1 336 ? -14.233 17.418  -11.836  1.00 94.46  ? 1132 ASN C CB  1 
ATOM   9256  C CG  . ASN C 1 336 ? -15.399 17.888  -12.682  1.00 101.93 ? 1132 ASN C CG  1 
ATOM   9257  O OD1 . ASN C 1 336 ? -15.523 19.074  -12.981  1.00 105.99 ? 1132 ASN C OD1 1 
ATOM   9258  N ND2 . ASN C 1 336 ? -16.261 16.959  -13.072  1.00 110.32 ? 1132 ASN C ND2 1 
ATOM   9259  N N   . LEU C 1 337 ? -11.328 16.001  -11.231  1.00 89.69  ? 1133 LEU C N   1 
ATOM   9260  C CA  . LEU C 1 337 ? -10.020 16.122  -10.595  1.00 85.97  ? 1133 LEU C CA  1 
ATOM   9261  C C   . LEU C 1 337 ? -8.888  16.005  -11.599  1.00 85.52  ? 1133 LEU C C   1 
ATOM   9262  O O   . LEU C 1 337 ? -8.042  16.892  -11.701  1.00 79.90  ? 1133 LEU C O   1 
ATOM   9263  C CB  . LEU C 1 337 ? -9.844  15.060  -9.512   1.00 82.42  ? 1133 LEU C CB  1 
ATOM   9264  C CG  . LEU C 1 337 ? -10.587 15.319  -8.206   1.00 82.53  ? 1133 LEU C CG  1 
ATOM   9265  C CD1 . LEU C 1 337 ? -10.377 14.172  -7.235   1.00 75.57  ? 1133 LEU C CD1 1 
ATOM   9266  C CD2 . LEU C 1 337 ? -10.136 16.640  -7.600   1.00 86.10  ? 1133 LEU C CD2 1 
ATOM   9267  N N   . ALA C 1 338 ? -8.893  14.918  -12.362  1.00 94.92  ? 1134 ALA C N   1 
ATOM   9268  C CA  . ALA C 1 338 ? -7.793  14.639  -13.284  1.00 97.90  ? 1134 ALA C CA  1 
ATOM   9269  C C   . ALA C 1 338 ? -7.569  15.777  -14.281  1.00 100.43 ? 1134 ALA C C   1 
ATOM   9270  O O   . ALA C 1 338 ? -6.528  15.844  -14.935  1.00 102.72 ? 1134 ALA C O   1 
ATOM   9271  C CB  . ALA C 1 338 ? -8.037  13.327  -14.019  1.00 98.00  ? 1134 ALA C CB  1 
ATOM   9272  N N   . LYS C 1 339 ? -8.552  16.667  -14.392  1.00 102.38 ? 1135 LYS C N   1 
ATOM   9273  C CA  . LYS C 1 339 ? -8.509  17.764  -15.355  1.00 100.41 ? 1135 LYS C CA  1 
ATOM   9274  C C   . LYS C 1 339 ? -7.665  18.947  -14.888  1.00 107.34 ? 1135 LYS C C   1 
ATOM   9275  O O   . LYS C 1 339 ? -7.337  19.829  -15.680  1.00 112.54 ? 1135 LYS C O   1 
ATOM   9276  C CB  . LYS C 1 339 ? -9.926  18.249  -15.672  1.00 91.45  ? 1135 LYS C CB  1 
ATOM   9277  N N   . SER C 1 340 ? -7.317  18.971  -13.606  1.00 107.77 ? 1136 SER C N   1 
ATOM   9278  C CA  . SER C 1 340 ? -6.627  20.127  -13.045  1.00 112.04 ? 1136 SER C CA  1 
ATOM   9279  C C   . SER C 1 340 ? -5.162  20.188  -13.449  1.00 115.53 ? 1136 SER C C   1 
ATOM   9280  O O   . SER C 1 340 ? -4.644  19.279  -14.096  1.00 118.05 ? 1136 SER C O   1 
ATOM   9281  C CB  . SER C 1 340 ? -6.725  20.115  -11.521  1.00 117.01 ? 1136 SER C CB  1 
ATOM   9282  O OG  . SER C 1 340 ? -6.033  19.004  -10.982  1.00 118.12 ? 1136 SER C OG  1 
ATOM   9283  N N   . ARG C 1 341 ? -4.498  21.265  -13.042  1.00 117.68 ? 1137 ARG C N   1 
ATOM   9284  C CA  . ARG C 1 341 ? -3.074  21.436  -13.284  1.00 118.79 ? 1137 ARG C CA  1 
ATOM   9285  C C   . ARG C 1 341 ? -2.302  20.631  -12.256  1.00 116.84 ? 1137 ARG C C   1 
ATOM   9286  O O   . ARG C 1 341 ? -1.173  20.208  -12.499  1.00 115.29 ? 1137 ARG C O   1 
ATOM   9287  C CB  . ARG C 1 341 ? -2.699  22.910  -13.181  1.00 116.89 ? 1137 ARG C CB  1 
ATOM   9288  C CG  . ARG C 1 341 ? -3.071  23.535  -11.851  1.00 126.54 ? 1137 ARG C CG  1 
ATOM   9289  C CD  . ARG C 1 341 ? -3.025  25.044  -11.937  1.00 131.61 ? 1137 ARG C CD  1 
ATOM   9290  N NE  . ARG C 1 341 ? -1.786  25.506  -12.553  1.00 128.93 ? 1137 ARG C NE  1 
ATOM   9291  C CZ  . ARG C 1 341 ? -1.494  26.783  -12.769  1.00 122.17 ? 1137 ARG C CZ  1 
ATOM   9292  N NH1 . ARG C 1 341 ? -2.356  27.728  -12.416  1.00 124.69 ? 1137 ARG C NH1 1 
ATOM   9293  N NH2 . ARG C 1 341 ? -0.340  27.114  -13.335  1.00 105.18 ? 1137 ARG C NH2 1 
ATOM   9294  N N   . TRP C 1 342 ? -2.928  20.430  -11.102  1.00 112.98 ? 1138 TRP C N   1 
ATOM   9295  C CA  . TRP C 1 342 ? -2.340  19.648  -10.026  1.00 112.94 ? 1138 TRP C CA  1 
ATOM   9296  C C   . TRP C 1 342 ? -2.051  18.222  -10.481  1.00 114.38 ? 1138 TRP C C   1 
ATOM   9297  O O   . TRP C 1 342 ? -0.928  17.739  -10.356  1.00 116.59 ? 1138 TRP C O   1 
ATOM   9298  C CB  . TRP C 1 342 ? -3.269  19.645  -8.814   1.00 106.49 ? 1138 TRP C CB  1 
ATOM   9299  C CG  . TRP C 1 342 ? -2.932  18.601  -7.806   1.00 106.87 ? 1138 TRP C CG  1 
ATOM   9300  C CD1 . TRP C 1 342 ? -1.966  18.669  -6.850   1.00 108.44 ? 1138 TRP C CD1 1 
ATOM   9301  C CD2 . TRP C 1 342 ? -3.567  17.325  -7.646   1.00 109.36 ? 1138 TRP C CD2 1 
ATOM   9302  N NE1 . TRP C 1 342 ? -1.955  17.515  -6.104   1.00 110.02 ? 1138 TRP C NE1 1 
ATOM   9303  C CE2 . TRP C 1 342 ? -2.929  16.675  -6.573   1.00 108.46 ? 1138 TRP C CE2 1 
ATOM   9304  C CE3 . TRP C 1 342 ? -4.611  16.671  -8.307   1.00 106.19 ? 1138 TRP C CE3 1 
ATOM   9305  C CZ2 . TRP C 1 342 ? -3.301  15.401  -6.146   1.00 104.02 ? 1138 TRP C CZ2 1 
ATOM   9306  C CZ3 . TRP C 1 342 ? -4.979  15.406  -7.880   1.00 100.51 ? 1138 TRP C CZ3 1 
ATOM   9307  C CH2 . TRP C 1 342 ? -4.327  14.786  -6.809   1.00 99.46  ? 1138 TRP C CH2 1 
ATOM   9308  N N   . TYR C 1 343 ? -3.071  17.554  -11.010  1.00 113.55 ? 1139 TYR C N   1 
ATOM   9309  C CA  . TYR C 1 343 ? -2.909  16.210  -11.549  1.00 111.00 ? 1139 TYR C CA  1 
ATOM   9310  C C   . TYR C 1 343 ? -1.801  16.205  -12.589  1.00 110.45 ? 1139 TYR C C   1 
ATOM   9311  O O   . TYR C 1 343 ? -0.948  15.317  -12.609  1.00 100.43 ? 1139 TYR C O   1 
ATOM   9312  C CB  . TYR C 1 343 ? -4.214  15.732  -12.185  1.00 107.07 ? 1139 TYR C CB  1 
ATOM   9313  C CG  . TYR C 1 343 ? -4.143  14.321  -12.719  1.00 111.00 ? 1139 TYR C CG  1 
ATOM   9314  C CD1 . TYR C 1 343 ? -4.675  13.258  -12.000  1.00 110.55 ? 1139 TYR C CD1 1 
ATOM   9315  C CD2 . TYR C 1 343 ? -3.538  14.049  -13.938  1.00 112.10 ? 1139 TYR C CD2 1 
ATOM   9316  C CE1 . TYR C 1 343 ? -4.610  11.963  -12.480  1.00 109.75 ? 1139 TYR C CE1 1 
ATOM   9317  C CE2 . TYR C 1 343 ? -3.468  12.758  -14.428  1.00 116.78 ? 1139 TYR C CE2 1 
ATOM   9318  C CZ  . TYR C 1 343 ? -4.005  11.718  -13.695  1.00 113.49 ? 1139 TYR C CZ  1 
ATOM   9319  O OH  . TYR C 1 343 ? -3.940  10.430  -14.176  1.00 105.38 ? 1139 TYR C OH  1 
ATOM   9320  N N   . ASN C 1 344 ? -1.825  17.215  -13.450  1.00 119.99 ? 1140 ASN C N   1 
ATOM   9321  C CA  . ASN C 1 344 ? -0.847  17.346  -14.519  1.00 128.14 ? 1140 ASN C CA  1 
ATOM   9322  C C   . ASN C 1 344 ? 0.576   17.340  -13.977  1.00 128.05 ? 1140 ASN C C   1 
ATOM   9323  O O   . ASN C 1 344 ? 1.429   16.589  -14.450  1.00 129.59 ? 1140 ASN C O   1 
ATOM   9324  C CB  . ASN C 1 344 ? -1.100  18.631  -15.313  1.00 129.38 ? 1140 ASN C CB  1 
ATOM   9325  C CG  . ASN C 1 344 ? -1.083  18.404  -16.815  1.00 135.77 ? 1140 ASN C CG  1 
ATOM   9326  O OD1 . ASN C 1 344 ? -2.051  18.712  -17.514  1.00 129.70 ? 1140 ASN C OD1 1 
ATOM   9327  N ND2 . ASN C 1 344 ? 0.021   17.863  -17.319  1.00 144.87 ? 1140 ASN C ND2 1 
ATOM   9328  N N   . GLN C 1 345 ? 0.820   18.171  -12.969  1.00 127.22 ? 1141 GLN C N   1 
ATOM   9329  C CA  . GLN C 1 345 ? 2.154   18.317  -12.395  1.00 129.25 ? 1141 GLN C CA  1 
ATOM   9330  C C   . GLN C 1 345 ? 2.665   17.030  -11.752  1.00 128.23 ? 1141 GLN C C   1 
ATOM   9331  O O   . GLN C 1 345 ? 3.771   16.583  -12.047  1.00 130.83 ? 1141 GLN C O   1 
ATOM   9332  C CB  . GLN C 1 345 ? 2.180   19.458  -11.377  1.00 129.81 ? 1141 GLN C CB  1 
ATOM   9333  C CG  . GLN C 1 345 ? 1.962   20.832  -11.991  1.00 139.92 ? 1141 GLN C CG  1 
ATOM   9334  C CD  . GLN C 1 345 ? 3.064   21.217  -12.958  1.00 145.59 ? 1141 GLN C CD  1 
ATOM   9335  O OE1 . GLN C 1 345 ? 2.916   22.154  -13.745  1.00 146.64 ? 1141 GLN C OE1 1 
ATOM   9336  N NE2 . GLN C 1 345 ? 4.182   20.498  -12.900  1.00 136.89 ? 1141 GLN C NE2 1 
ATOM   9337  N N   . THR C 1 346 ? 1.857   16.435  -10.880  1.00 123.19 ? 1142 THR C N   1 
ATOM   9338  C CA  . THR C 1 346 ? 2.266   15.222  -10.180  1.00 115.68 ? 1142 THR C CA  1 
ATOM   9339  C C   . THR C 1 346 ? 1.288   14.075  -10.413  1.00 114.84 ? 1142 THR C C   1 
ATOM   9340  O O   . THR C 1 346 ? 0.321   13.916  -9.671   1.00 112.36 ? 1142 THR C O   1 
ATOM   9341  C CB  . THR C 1 346 ? 2.448   15.467  -8.667   1.00 110.03 ? 1142 THR C CB  1 
ATOM   9342  O OG1 . THR C 1 346 ? 1.237   15.990  -8.110   1.00 100.78 ? 1142 THR C OG1 1 
ATOM   9343  C CG2 . THR C 1 346 ? 3.577   16.455  -8.419   1.00 115.63 ? 1142 THR C CG2 1 
ATOM   9344  N N   . PRO C 1 347 ? 1.548   13.271  -11.453  1.00 118.24 ? 1143 PRO C N   1 
ATOM   9345  C CA  . PRO C 1 347 ? 0.710   12.132  -11.845  1.00 116.21 ? 1143 PRO C CA  1 
ATOM   9346  C C   . PRO C 1 347 ? 0.657   11.030  -10.790  1.00 112.26 ? 1143 PRO C C   1 
ATOM   9347  O O   . PRO C 1 347 ? -0.398  10.429  -10.597  1.00 112.47 ? 1143 PRO C O   1 
ATOM   9348  C CB  . PRO C 1 347 ? 1.401   11.611  -13.109  1.00 117.07 ? 1143 PRO C CB  1 
ATOM   9349  C CG  . PRO C 1 347 ? 2.812   12.059  -12.978  1.00 120.37 ? 1143 PRO C CG  1 
ATOM   9350  C CD  . PRO C 1 347 ? 2.738   13.397  -12.312  1.00 119.56 ? 1143 PRO C CD  1 
ATOM   9351  N N   . ASN C 1 348 ? 1.779   10.766  -10.127  1.00 115.54 ? 1144 ASN C N   1 
ATOM   9352  C CA  . ASN C 1 348 ? 1.850   9.696   -9.137   1.00 116.82 ? 1144 ASN C CA  1 
ATOM   9353  C C   . ASN C 1 348 ? 0.885   9.934   -7.982   1.00 106.16 ? 1144 ASN C C   1 
ATOM   9354  O O   . ASN C 1 348 ? -0.034  9.140   -7.718   1.00 107.52 ? 1144 ASN C O   1 
ATOM   9355  C CB  . ASN C 1 348 ? 3.271   9.603   -8.565   1.00 125.42 ? 1144 ASN C CB  1 
ATOM   9356  C CG  . ASN C 1 348 ? 4.346   9.785   -9.621   1.00 124.45 ? 1144 ASN C CG  1 
ATOM   9357  O OD1 . ASN C 1 348 ? 4.188   9.361   -10.767  1.00 133.41 ? 1144 ASN C OD1 1 
ATOM   9358  N ND2 . ASN C 1 348 ? 5.451   10.416  -9.236   1.00 103.22 ? 1144 ASN C ND2 1 
ATOM   9359  N N   . ARG C 1 349 ? 1.100   11.056  -7.308   1.00 100.00 ? 1145 ARG C N   1 
ATOM   9360  C CA  . ARG C 1 349 ? 0.355   11.405  -6.111   1.00 102.70 ? 1145 ARG C CA  1 
ATOM   9361  C C   . ARG C 1 349 ? -1.111  11.650  -6.455   1.00 104.57 ? 1145 ARG C C   1 
ATOM   9362  O O   . ARG C 1 349 ? -2.002  11.382  -5.647   1.00 101.85 ? 1145 ARG C O   1 
ATOM   9363  C CB  . ARG C 1 349 ? 0.976   12.648  -5.475   1.00 95.02  ? 1145 ARG C CB  1 
ATOM   9364  C CG  . ARG C 1 349 ? 0.533   12.952  -4.061   1.00 90.12  ? 1145 ARG C CG  1 
ATOM   9365  C CD  . ARG C 1 349 ? 1.077   14.306  -3.656   1.00 88.31  ? 1145 ARG C CD  1 
ATOM   9366  N NE  . ARG C 1 349 ? 0.670   14.701  -2.315   1.00 76.40  ? 1145 ARG C NE  1 
ATOM   9367  C CZ  . ARG C 1 349 ? 1.381   14.455  -1.222   1.00 94.22  ? 1145 ARG C CZ  1 
ATOM   9368  N NH1 . ARG C 1 349 ? 2.535   13.808  -1.311   1.00 95.62  ? 1145 ARG C NH1 1 
ATOM   9369  N NH2 . ARG C 1 349 ? 0.939   14.856  -0.040   1.00 102.92 ? 1145 ARG C NH2 1 
ATOM   9370  N N   . ALA C 1 350 ? -1.352  12.150  -7.665   1.00 101.36 ? 1146 ALA C N   1 
ATOM   9371  C CA  . ALA C 1 350 ? -2.705  12.408  -8.142   1.00 95.56  ? 1146 ALA C CA  1 
ATOM   9372  C C   . ALA C 1 350 ? -3.471  11.108  -8.360   1.00 95.52  ? 1146 ALA C C   1 
ATOM   9373  O O   . ALA C 1 350 ? -4.609  10.965  -7.914   1.00 88.05  ? 1146 ALA C O   1 
ATOM   9374  C CB  . ALA C 1 350 ? -2.666  13.222  -9.414   1.00 98.90  ? 1146 ALA C CB  1 
ATOM   9375  N N   . LYS C 1 351 ? -2.847  10.165  -9.059   1.00 100.22 ? 1147 LYS C N   1 
ATOM   9376  C CA  . LYS C 1 351 ? -3.443  8.850   -9.243   1.00 91.46  ? 1147 LYS C CA  1 
ATOM   9377  C C   . LYS C 1 351 ? -3.759  8.242   -7.889   1.00 82.73  ? 1147 LYS C C   1 
ATOM   9378  O O   . LYS C 1 351 ? -4.901  7.886   -7.619   1.00 82.58  ? 1147 LYS C O   1 
ATOM   9379  C CB  . LYS C 1 351 ? -2.514  7.929   -10.037  1.00 92.26  ? 1147 LYS C CB  1 
ATOM   9380  C CG  . LYS C 1 351 ? -2.367  8.311   -11.501  1.00 101.52 ? 1147 LYS C CG  1 
ATOM   9381  C CD  . LYS C 1 351 ? -3.381  7.592   -12.387  1.00 111.23 ? 1147 LYS C CD  1 
ATOM   9382  C CE  . LYS C 1 351 ? -2.997  6.129   -12.590  1.00 113.95 ? 1147 LYS C CE  1 
ATOM   9383  N NZ  . LYS C 1 351 ? -3.873  5.419   -13.570  1.00 97.04  ? 1147 LYS C NZ  1 
ATOM   9384  N N   . ARG C 1 352 ? -2.754  8.137   -7.028   1.00 83.80  ? 1148 ARG C N   1 
ATOM   9385  C CA  . ARG C 1 352 ? -2.988  7.547   -5.714   1.00 84.23  ? 1148 ARG C CA  1 
ATOM   9386  C C   . ARG C 1 352 ? -4.136  8.220   -4.954   1.00 80.84  ? 1148 ARG C C   1 
ATOM   9387  O O   . ARG C 1 352 ? -5.024  7.546   -4.426   1.00 73.50  ? 1148 ARG C O   1 
ATOM   9388  C CB  . ARG C 1 352 ? -1.705  7.537   -4.882   1.00 83.47  ? 1148 ARG C CB  1 
ATOM   9389  C CG  . ARG C 1 352 ? -0.718  6.483   -5.343   1.00 83.69  ? 1148 ARG C CG  1 
ATOM   9390  C CD  . ARG C 1 352 ? 0.503   6.426   -4.453   1.00 91.00  ? 1148 ARG C CD  1 
ATOM   9391  N NE  . ARG C 1 352 ? 1.538   7.372   -4.862   1.00 93.95  ? 1148 ARG C NE  1 
ATOM   9392  C CZ  . ARG C 1 352 ? 2.544   7.072   -5.679   1.00 100.56 ? 1148 ARG C CZ  1 
ATOM   9393  N NH1 . ARG C 1 352 ? 2.651   5.850   -6.185   1.00 103.81 ? 1148 ARG C NH1 1 
ATOM   9394  N NH2 . ARG C 1 352 ? 3.446   7.991   -5.993   1.00 100.71 ? 1148 ARG C NH2 1 
ATOM   9395  N N   . VAL C 1 353 ? -4.127  9.549   -4.921   1.00 84.99  ? 1149 VAL C N   1 
ATOM   9396  C CA  . VAL C 1 353 ? -5.118  10.310  -4.158   1.00 83.15  ? 1149 VAL C CA  1 
ATOM   9397  C C   . VAL C 1 353 ? -6.536  10.161  -4.710   1.00 81.87  ? 1149 VAL C C   1 
ATOM   9398  O O   . VAL C 1 353 ? -7.492  10.029  -3.948   1.00 82.44  ? 1149 VAL C O   1 
ATOM   9399  C CB  . VAL C 1 353 ? -4.747  11.809  -4.075   1.00 83.67  ? 1149 VAL C CB  1 
ATOM   9400  C CG1 . VAL C 1 353 ? -5.941  12.634  -3.624   1.00 71.47  ? 1149 VAL C CG1 1 
ATOM   9401  C CG2 . VAL C 1 353 ? -3.555  12.013  -3.141   1.00 81.82  ? 1149 VAL C CG2 1 
ATOM   9402  N N   . ILE C 1 354 ? -6.665  10.180  -6.034   1.00 84.72  ? 1150 ILE C N   1 
ATOM   9403  C CA  . ILE C 1 354 ? -7.967  10.030  -6.683   1.00 78.46  ? 1150 ILE C CA  1 
ATOM   9404  C C   . ILE C 1 354 ? -8.507  8.610   -6.539   1.00 73.20  ? 1150 ILE C C   1 
ATOM   9405  O O   . ILE C 1 354 ? -9.709  8.406   -6.356   1.00 69.14  ? 1150 ILE C O   1 
ATOM   9406  C CB  . ILE C 1 354 ? -7.899  10.398  -8.169   1.00 73.58  ? 1150 ILE C CB  1 
ATOM   9407  C CG1 . ILE C 1 354 ? -7.542  11.875  -8.323   1.00 78.08  ? 1150 ILE C CG1 1 
ATOM   9408  C CG2 . ILE C 1 354 ? -9.219  10.094  -8.851   1.00 70.70  ? 1150 ILE C CG2 1 
ATOM   9409  C CD1 . ILE C 1 354 ? -7.468  12.337  -9.755   1.00 86.88  ? 1150 ILE C CD1 1 
ATOM   9410  N N   . THR C 1 355 ? -7.614  7.630   -6.621   1.00 73.04  ? 1151 THR C N   1 
ATOM   9411  C CA  . THR C 1 355 ? -7.996  6.249   -6.383   1.00 67.03  ? 1151 THR C CA  1 
ATOM   9412  C C   . THR C 1 355 ? -8.431  6.080   -4.930   1.00 74.13  ? 1151 THR C C   1 
ATOM   9413  O O   . THR C 1 355 ? -9.309  5.271   -4.632   1.00 78.69  ? 1151 THR C O   1 
ATOM   9414  C CB  . THR C 1 355 ? -6.860  5.270   -6.754   1.00 60.58  ? 1151 THR C CB  1 
ATOM   9415  O OG1 . THR C 1 355 ? -6.816  5.124   -8.177   1.00 56.56  ? 1151 THR C OG1 1 
ATOM   9416  C CG2 . THR C 1 355 ? -7.091  3.901   -6.135   1.00 61.52  ? 1151 THR C CG2 1 
ATOM   9417  N N   . THR C 1 356 ? -7.832  6.860   -4.032   1.00 75.40  ? 1152 THR C N   1 
ATOM   9418  C CA  . THR C 1 356 ? -8.253  6.883   -2.632   1.00 74.52  ? 1152 THR C CA  1 
ATOM   9419  C C   . THR C 1 356 ? -9.596  7.599   -2.487   1.00 78.96  ? 1152 THR C C   1 
ATOM   9420  O O   . THR C 1 356 ? -10.342 7.358   -1.538   1.00 84.68  ? 1152 THR C O   1 
ATOM   9421  C CB  . THR C 1 356 ? -7.206  7.579   -1.739   1.00 64.77  ? 1152 THR C CB  1 
ATOM   9422  O OG1 . THR C 1 356 ? -5.977  6.853   -1.798   1.00 61.17  ? 1152 THR C OG1 1 
ATOM   9423  C CG2 . THR C 1 356 ? -7.668  7.627   -0.298   1.00 62.05  ? 1152 THR C CG2 1 
ATOM   9424  N N   . PHE C 1 357 ? -9.897  8.482   -3.434   1.00 71.58  ? 1153 PHE C N   1 
ATOM   9425  C CA  . PHE C 1 357 ? -11.132 9.257   -3.396   1.00 71.26  ? 1153 PHE C CA  1 
ATOM   9426  C C   . PHE C 1 357 ? -12.350 8.482   -3.892   1.00 80.35  ? 1153 PHE C C   1 
ATOM   9427  O O   . PHE C 1 357 ? -13.429 8.568   -3.305   1.00 86.59  ? 1153 PHE C O   1 
ATOM   9428  C CB  . PHE C 1 357 ? -10.976 10.551  -4.196   1.00 75.04  ? 1153 PHE C CB  1 
ATOM   9429  C CG  . PHE C 1 357 ? -10.680 11.751  -3.349   1.00 77.46  ? 1153 PHE C CG  1 
ATOM   9430  C CD1 . PHE C 1 357 ? -11.687 12.364  -2.628   1.00 76.51  ? 1153 PHE C CD1 1 
ATOM   9431  C CD2 . PHE C 1 357 ? -9.397  12.268  -3.273   1.00 78.80  ? 1153 PHE C CD2 1 
ATOM   9432  C CE1 . PHE C 1 357 ? -11.423 13.467  -1.847   1.00 77.17  ? 1153 PHE C CE1 1 
ATOM   9433  C CE2 . PHE C 1 357 ? -9.126  13.373  -2.491   1.00 79.79  ? 1153 PHE C CE2 1 
ATOM   9434  C CZ  . PHE C 1 357 ? -10.142 13.973  -1.778   1.00 78.06  ? 1153 PHE C CZ  1 
ATOM   9435  N N   . ARG C 1 358 ? -12.176 7.730   -4.975   1.00 81.07  ? 1154 ARG C N   1 
ATOM   9436  C CA  . ARG C 1 358 ? -13.277 6.955   -5.542   1.00 84.20  ? 1154 ARG C CA  1 
ATOM   9437  C C   . ARG C 1 358 ? -13.579 5.724   -4.701   1.00 87.01  ? 1154 ARG C C   1 
ATOM   9438  O O   . ARG C 1 358 ? -14.663 5.597   -4.131   1.00 92.43  ? 1154 ARG C O   1 
ATOM   9439  C CB  . ARG C 1 358 ? -12.982 6.543   -6.990   1.00 82.39  ? 1154 ARG C CB  1 
ATOM   9440  C CG  . ARG C 1 358 ? -13.284 7.623   -8.014   1.00 89.92  ? 1154 ARG C CG  1 
ATOM   9441  C CD  . ARG C 1 358 ? -13.318 7.079   -9.433   1.00 83.78  ? 1154 ARG C CD  1 
ATOM   9442  N NE  . ARG C 1 358 ? -11.999 6.678   -9.913   1.00 92.88  ? 1154 ARG C NE  1 
ATOM   9443  C CZ  . ARG C 1 358 ? -11.700 6.475   -11.194  1.00 103.30 ? 1154 ARG C CZ  1 
ATOM   9444  N NH1 . ARG C 1 358 ? -12.628 6.641   -12.129  1.00 98.18  ? 1154 ARG C NH1 1 
ATOM   9445  N NH2 . ARG C 1 358 ? -10.472 6.111   -11.544  1.00 104.03 ? 1154 ARG C NH2 1 
ATOM   9446  N N   . THR C 1 359 ? -12.609 4.818   -4.639   1.00 83.03  ? 1155 THR C N   1 
ATOM   9447  C CA  . THR C 1 359 ? -12.739 3.578   -3.883   1.00 82.90  ? 1155 THR C CA  1 
ATOM   9448  C C   . THR C 1 359 ? -12.990 3.827   -2.397   1.00 88.06  ? 1155 THR C C   1 
ATOM   9449  O O   . THR C 1 359 ? -13.530 2.969   -1.699   1.00 89.46  ? 1155 THR C O   1 
ATOM   9450  C CB  . THR C 1 359 ? -11.477 2.715   -4.030   1.00 85.41  ? 1155 THR C CB  1 
ATOM   9451  O OG1 . THR C 1 359 ? -10.371 3.373   -3.395   1.00 86.01  ? 1155 THR C OG1 1 
ATOM   9452  C CG2 . THR C 1 359 ? -11.159 2.486   -5.503   1.00 74.89  ? 1155 THR C CG2 1 
ATOM   9453  N N   . GLY C 1 360 ? -12.592 5.003   -1.919   1.00 86.36  ? 1156 GLY C N   1 
ATOM   9454  C CA  . GLY C 1 360 ? -12.729 5.340   -0.515   1.00 78.40  ? 1156 GLY C CA  1 
ATOM   9455  C C   . GLY C 1 360 ? -12.002 4.334   0.355    1.00 87.15  ? 1156 GLY C C   1 
ATOM   9456  O O   . GLY C 1 360 ? -12.388 4.089   1.496    1.00 99.15  ? 1156 GLY C O   1 
ATOM   9457  N N   . THR C 1 361 ? -10.947 3.741   -0.196   1.00 84.17  ? 1157 THR C N   1 
ATOM   9458  C CA  . THR C 1 361 ? -10.142 2.764   0.527    1.00 88.71  ? 1157 THR C CA  1 
ATOM   9459  C C   . THR C 1 361 ? -8.661  2.980   0.234    1.00 91.66  ? 1157 THR C C   1 
ATOM   9460  O O   . THR C 1 361 ? -8.305  3.716   -0.690   1.00 87.05  ? 1157 THR C O   1 
ATOM   9461  C CB  . THR C 1 361 ? -10.544 1.323   0.175    1.00 89.14  ? 1157 THR C CB  1 
ATOM   9462  O OG1 . THR C 1 361 ? -10.225 1.062   -1.194   1.00 96.15  ? 1157 THR C OG1 1 
ATOM   9463  C CG2 . THR C 1 361 ? -12.035 1.108   0.392    1.00 84.69  ? 1157 THR C CG2 1 
ATOM   9464  N N   . TRP C 1 362 ? -7.808  2.316   1.007    1.00 87.39  ? 1158 TRP C N   1 
ATOM   9465  C CA  . TRP C 1 362 ? -6.370  2.566   0.970    1.00 87.57  ? 1158 TRP C CA  1 
ATOM   9466  C C   . TRP C 1 362 ? -5.653  1.743   -0.083   1.00 91.71  ? 1158 TRP C C   1 
ATOM   9467  O O   . TRP C 1 362 ? -4.428  1.781   -0.179   1.00 94.89  ? 1158 TRP C O   1 
ATOM   9468  C CB  . TRP C 1 362 ? -5.749  2.268   2.331    1.00 86.24  ? 1158 TRP C CB  1 
ATOM   9469  C CG  . TRP C 1 362 ? -6.313  3.102   3.399    1.00 86.63  ? 1158 TRP C CG  1 
ATOM   9470  C CD1 . TRP C 1 362 ? -7.236  2.729   4.327    1.00 91.87  ? 1158 TRP C CD1 1 
ATOM   9471  C CD2 . TRP C 1 362 ? -6.018  4.475   3.649    1.00 87.24  ? 1158 TRP C CD2 1 
ATOM   9472  N NE1 . TRP C 1 362 ? -7.529  3.787   5.150    1.00 95.17  ? 1158 TRP C NE1 1 
ATOM   9473  C CE2 . TRP C 1 362 ? -6.792  4.875   4.752    1.00 90.06  ? 1158 TRP C CE2 1 
ATOM   9474  C CE3 . TRP C 1 362 ? -5.171  5.410   3.048    1.00 88.27  ? 1158 TRP C CE3 1 
ATOM   9475  C CZ2 . TRP C 1 362 ? -6.746  6.165   5.269    1.00 92.28  ? 1158 TRP C CZ2 1 
ATOM   9476  C CZ3 . TRP C 1 362 ? -5.126  6.692   3.561    1.00 86.66  ? 1158 TRP C CZ3 1 
ATOM   9477  C CH2 . TRP C 1 362 ? -5.908  7.058   4.660    1.00 86.66  ? 1158 TRP C CH2 1 
ATOM   9478  N N   . ASP C 1 363 ? -6.419  1.006   -0.875   1.00 94.49  ? 1159 ASP C N   1 
ATOM   9479  C CA  . ASP C 1 363 ? -5.858  -0.006  -1.762   1.00 97.98  ? 1159 ASP C CA  1 
ATOM   9480  C C   . ASP C 1 363 ? -4.705  0.507   -2.623   1.00 95.05  ? 1159 ASP C C   1 
ATOM   9481  O O   . ASP C 1 363 ? -3.840  -0.267  -3.033   1.00 89.40  ? 1159 ASP C O   1 
ATOM   9482  C CB  . ASP C 1 363 ? -6.960  -0.606  -2.637   1.00 98.47  ? 1159 ASP C CB  1 
ATOM   9483  C CG  . ASP C 1 363 ? -8.128  -1.130  -1.822   1.00 100.37 ? 1159 ASP C CG  1 
ATOM   9484  O OD1 . ASP C 1 363 ? -9.231  -1.273  -2.391   1.00 97.22  ? 1159 ASP C OD1 1 
ATOM   9485  O OD2 . ASP C 1 363 ? -7.943  -1.389  -0.612   1.00 96.21  ? 1159 ASP C OD2 1 
ATOM   9486  N N   . ALA C 1 364 ? -4.698  1.808   -2.896   1.00 94.56  ? 1160 ALA C N   1 
ATOM   9487  C CA  . ALA C 1 364 ? -3.599  2.416   -3.635   1.00 91.91  ? 1160 ALA C CA  1 
ATOM   9488  C C   . ALA C 1 364 ? -2.330  2.401   -2.796   1.00 93.91  ? 1160 ALA C C   1 
ATOM   9489  O O   . ALA C 1 364 ? -1.242  2.145   -3.310   1.00 105.29 ? 1160 ALA C O   1 
ATOM   9490  C CB  . ALA C 1 364 ? -3.943  3.833   -4.048   1.00 89.24  ? 1160 ALA C CB  1 
ATOM   9491  N N   . TYR C 1 365 ? -2.473  2.694   -1.507   1.00 87.85  ? 1161 TYR C N   1 
ATOM   9492  C CA  . TYR C 1 365 ? -1.337  2.708   -0.591   1.00 82.94  ? 1161 TYR C CA  1 
ATOM   9493  C C   . TYR C 1 365 ? -1.102  1.364   0.088    1.00 82.27  ? 1161 TYR C C   1 
ATOM   9494  O O   . TYR C 1 365 ? -0.048  1.135   0.681    1.00 76.79  ? 1161 TYR C O   1 
ATOM   9495  C CB  . TYR C 1 365 ? -1.534  3.799   0.458    1.00 78.92  ? 1161 TYR C CB  1 
ATOM   9496  C CG  . TYR C 1 365 ? -1.788  5.139   -0.170   1.00 74.62  ? 1161 TYR C CG  1 
ATOM   9497  C CD1 . TYR C 1 365 ? -0.740  5.997   -0.457   1.00 81.93  ? 1161 TYR C CD1 1 
ATOM   9498  C CD2 . TYR C 1 365 ? -3.072  5.534   -0.505   1.00 76.53  ? 1161 TYR C CD2 1 
ATOM   9499  C CE1 . TYR C 1 365 ? -0.964  7.218   -1.044   1.00 86.24  ? 1161 TYR C CE1 1 
ATOM   9500  C CE2 . TYR C 1 365 ? -3.306  6.753   -1.092   1.00 83.11  ? 1161 TYR C CE2 1 
ATOM   9501  C CZ  . TYR C 1 365 ? -2.248  7.593   -1.361   1.00 86.82  ? 1161 TYR C CZ  1 
ATOM   9502  O OH  . TYR C 1 365 ? -2.476  8.816   -1.948   1.00 96.13  ? 1161 TYR C OH  1 
ATOM   9503  N N   . LEU C 1 366 ? -2.074  0.467   -0.023   1.00 88.77  ? 482  LEU C N   1 
ATOM   9504  C CA  . LEU C 1 366 ? -1.995  -0.811  0.667    1.00 94.55  ? 482  LEU C CA  1 
ATOM   9505  C C   . LEU C 1 366 ? -1.713  -0.567  2.147    1.00 100.10 ? 482  LEU C C   1 
ATOM   9506  O O   . LEU C 1 366 ? -0.611  -0.829  2.632    1.00 104.56 ? 482  LEU C O   1 
ATOM   9507  C CB  . LEU C 1 366 ? -0.909  -1.685  0.043    1.00 97.13  ? 482  LEU C CB  1 
ATOM   9508  C CG  . LEU C 1 366 ? -1.115  -1.961  -1.448   1.00 97.61  ? 482  LEU C CG  1 
ATOM   9509  C CD1 . LEU C 1 366 ? 0.109   -2.629  -2.054   1.00 101.72 ? 482  LEU C CD1 1 
ATOM   9510  C CD2 . LEU C 1 366 ? -2.367  -2.800  -1.672   1.00 90.61  ? 482  LEU C CD2 1 
ATOM   9511  N N   . ILE C 1 367 ? -2.712  -0.036  2.850    1.00 96.77  ? 483  ILE C N   1 
ATOM   9512  C CA  . ILE C 1 367 ? -2.592  0.262   4.273    1.00 92.36  ? 483  ILE C CA  1 
ATOM   9513  C C   . ILE C 1 367 ? -3.529  -0.628  5.098    1.00 91.66  ? 483  ILE C C   1 
ATOM   9514  O O   . ILE C 1 367 ? -4.605  -1.007  4.637    1.00 87.43  ? 483  ILE C O   1 
ATOM   9515  C CB  . ILE C 1 367 ? -2.875  1.756   4.558    1.00 82.45  ? 483  ILE C CB  1 
ATOM   9516  C CG1 . ILE C 1 367 ? -1.925  2.638   3.751    1.00 73.16  ? 483  ILE C CG1 1 
ATOM   9517  C CG2 . ILE C 1 367 ? -2.730  2.060   6.037    1.00 87.54  ? 483  ILE C CG2 1 
ATOM   9518  C CD1 . ILE C 1 367 ? -2.041  4.103   4.076    1.00 73.13  ? 483  ILE C CD1 1 
ATOM   9519  N N   . LYS C 1 368 ? -3.112  -0.953  6.318    1.00 93.48  ? 484  LYS C N   1 
ATOM   9520  C CA  . LYS C 1 368 ? -3.835  -1.898  7.165    1.00 88.95  ? 484  LYS C CA  1 
ATOM   9521  C C   . LYS C 1 368 ? -5.102  -1.301  7.767    1.00 92.00  ? 484  LYS C C   1 
ATOM   9522  O O   . LYS C 1 368 ? -6.203  -1.768  7.484    1.00 96.58  ? 484  LYS C O   1 
ATOM   9523  C CB  . LYS C 1 368 ? -2.925  -2.421  8.279    1.00 92.03  ? 484  LYS C CB  1 
ATOM   9524  N N   . GLU C 1 369 ? -4.936  -0.283  8.607    1.00 95.20  ? 485  GLU C N   1 
ATOM   9525  C CA  . GLU C 1 369 ? -6.056  0.372   9.286    1.00 107.66 ? 485  GLU C CA  1 
ATOM   9526  C C   . GLU C 1 369 ? -6.505  -0.405  10.523   1.00 111.08 ? 485  GLU C C   1 
ATOM   9527  O O   . GLU C 1 369 ? -6.543  0.136   11.631   1.00 111.36 ? 485  GLU C O   1 
ATOM   9528  C CB  . GLU C 1 369 ? -7.235  0.580   8.330    1.00 107.90 ? 485  GLU C CB  1 
ATOM   9529  C CG  . GLU C 1 369 ? -8.513  1.061   8.999    1.00 113.39 ? 485  GLU C CG  1 
ATOM   9530  C CD  . GLU C 1 369 ? -9.723  0.921   8.095    1.00 119.18 ? 485  GLU C CD  1 
ATOM   9531  O OE1 . GLU C 1 369 ? -9.540  0.538   6.920    1.00 123.00 ? 485  GLU C OE1 1 
ATOM   9532  O OE2 . GLU C 1 369 ? -10.853 1.186   8.559    1.00 120.26 ? 485  GLU C OE2 1 
ATOM   9533  N N   . ALA C 1 373 ? -7.920  3.509   20.386   1.00 88.77  ? 489  ALA C N   1 
ATOM   9534  C CA  . ALA C 1 373 ? -8.889  3.474   21.477   1.00 97.05  ? 489  ALA C CA  1 
ATOM   9535  C C   . ALA C 1 373 ? -9.627  2.138   21.548   1.00 94.51  ? 489  ALA C C   1 
ATOM   9536  O O   . ALA C 1 373 ? -10.688 2.039   22.166   1.00 91.20  ? 489  ALA C O   1 
ATOM   9537  C CB  . ALA C 1 373 ? -9.883  4.624   21.343   1.00 102.01 ? 489  ALA C CB  1 
ATOM   9538  N N   . GLN C 1 374 ? -9.065  1.114   20.915   1.00 96.01  ? 490  GLN C N   1 
ATOM   9539  C CA  . GLN C 1 374 ? -9.669  -0.214  20.934   1.00 96.79  ? 490  GLN C CA  1 
ATOM   9540  C C   . GLN C 1 374 ? -9.247  -0.988  22.181   1.00 98.67  ? 490  GLN C C   1 
ATOM   9541  O O   . GLN C 1 374 ? -8.059  -1.093  22.481   1.00 95.60  ? 490  GLN C O   1 
ATOM   9542  C CB  . GLN C 1 374 ? -9.304  -0.988  19.664   1.00 101.40 ? 490  GLN C CB  1 
ATOM   9543  C CG  . GLN C 1 374 ? -9.048  -2.471  19.884   1.00 104.33 ? 490  GLN C CG  1 
ATOM   9544  C CD  . GLN C 1 374 ? -7.604  -2.860  19.610   1.00 109.34 ? 490  GLN C CD  1 
ATOM   9545  O OE1 . GLN C 1 374 ? -6.797  -2.039  19.171   1.00 105.26 ? 490  GLN C OE1 1 
ATOM   9546  N NE2 . GLN C 1 374 ? -7.274  -4.120  19.866   1.00 114.66 ? 490  GLN C NE2 1 
ATOM   9547  N N   . THR C 1 375 ? -10.223 -1.514  22.914   1.00 100.86 ? 491  THR C N   1 
ATOM   9548  C CA  . THR C 1 375 ? -9.949  -2.281  24.132   1.00 100.08 ? 491  THR C CA  1 
ATOM   9549  C C   . THR C 1 375 ? -9.410  -1.408  25.252   1.00 98.08  ? 491  THR C C   1 
ATOM   9550  O O   . THR C 1 375 ? -9.376  -1.818  26.413   1.00 98.14  ? 491  THR C O   1 
ATOM   9551  C CB  . THR C 1 375 ? -8.949  -3.430  23.899   1.00 97.41  ? 491  THR C CB  1 
ATOM   9552  O OG1 . THR C 1 375 ? -9.427  -4.292  22.861   1.00 106.19 ? 491  THR C OG1 1 
ATOM   9553  C CG2 . THR C 1 375 ? -8.747  -4.239  25.181   1.00 85.25  ? 491  THR C CG2 1 
ATOM   9554  N N   . LEU C 1 376 ? -9.020  -0.188  24.912   1.00 96.59  ? 492  LEU C N   1 
ATOM   9555  C CA  . LEU C 1 376 ? -8.396  0.671   25.900   1.00 90.35  ? 492  LEU C CA  1 
ATOM   9556  C C   . LEU C 1 376 ? -9.458  1.289   26.790   1.00 87.81  ? 492  LEU C C   1 
ATOM   9557  O O   . LEU C 1 376 ? -9.353  1.256   28.010   1.00 89.39  ? 492  LEU C O   1 
ATOM   9558  C CB  . LEU C 1 376 ? -7.563  1.758   25.229   1.00 86.52  ? 492  LEU C CB  1 
ATOM   9559  C CG  . LEU C 1 376 ? -6.762  2.641   26.183   1.00 80.68  ? 492  LEU C CG  1 
ATOM   9560  C CD1 . LEU C 1 376 ? -5.869  1.793   27.072   1.00 76.29  ? 492  LEU C CD1 1 
ATOM   9561  C CD2 . LEU C 1 376 ? -5.948  3.656   25.404   1.00 83.83  ? 492  LEU C CD2 1 
ATOM   9562  N N   . SER C 1 377 ? -10.502 1.822   26.172   1.00 79.23  ? 493  SER C N   1 
ATOM   9563  C CA  . SER C 1 377 ? -11.601 2.393   26.921   1.00 75.79  ? 493  SER C CA  1 
ATOM   9564  C C   . SER C 1 377 ? -12.092 1.363   27.922   1.00 76.94  ? 493  SER C C   1 
ATOM   9565  O O   . SER C 1 377 ? -12.242 1.665   29.105   1.00 78.38  ? 493  SER C O   1 
ATOM   9566  C CB  . SER C 1 377 ? -12.724 2.812   25.975   1.00 87.92  ? 493  SER C CB  1 
ATOM   9567  O OG  . SER C 1 377 ? -12.220 3.643   24.946   1.00 92.22  ? 493  SER C OG  1 
ATOM   9568  N N   . ALA C 1 378 ? -12.312 0.141   27.442   1.00 82.73  ? 494  ALA C N   1 
ATOM   9569  C CA  . ALA C 1 378 ? -12.824 -0.953  28.275   1.00 89.95  ? 494  ALA C CA  1 
ATOM   9570  C C   . ALA C 1 378 ? -11.964 -1.234  29.509   1.00 88.04  ? 494  ALA C C   1 
ATOM   9571  O O   . ALA C 1 378 ? -12.401 -1.030  30.647   1.00 90.01  ? 494  ALA C O   1 
ATOM   9572  C CB  . ALA C 1 378 ? -12.987 -2.223  27.449   1.00 91.89  ? 494  ALA C CB  1 
ATOM   9573  N N   . ILE C 1 379 ? -10.745 -1.710  29.282   1.00 86.64  ? 495  ILE C N   1 
ATOM   9574  C CA  . ILE C 1 379 ? -9.844  -2.037  30.380   1.00 86.62  ? 495  ILE C CA  1 
ATOM   9575  C C   . ILE C 1 379 ? -9.625  -0.850  31.319   1.00 77.03  ? 495  ILE C C   1 
ATOM   9576  O O   . ILE C 1 379 ? -9.687  -1.001  32.539   1.00 83.01  ? 495  ILE C O   1 
ATOM   9577  C CB  . ILE C 1 379 ? -8.494  -2.560  29.864   1.00 86.91  ? 495  ILE C CB  1 
ATOM   9578  C CG1 . ILE C 1 379 ? -8.715  -3.768  28.952   1.00 89.03  ? 495  ILE C CG1 1 
ATOM   9579  C CG2 . ILE C 1 379 ? -7.588  -2.929  31.026   1.00 78.81  ? 495  ILE C CG2 1 
ATOM   9580  C CD1 . ILE C 1 379 ? -9.437  -4.903  29.627   1.00 92.24  ? 495  ILE C CD1 1 
ATOM   9581  N N   . LEU C 1 380 ? -9.380  0.328   30.754   1.00 69.45  ? 496  LEU C N   1 
ATOM   9582  C CA  . LEU C 1 380 ? -9.135  1.515   31.564   1.00 67.97  ? 496  LEU C CA  1 
ATOM   9583  C C   . LEU C 1 380 ? -10.313 1.827   32.488   1.00 71.98  ? 496  LEU C C   1 
ATOM   9584  O O   . LEU C 1 380 ? -10.159 1.882   33.719   1.00 76.89  ? 496  LEU C O   1 
ATOM   9585  C CB  . LEU C 1 380 ? -8.825  2.721   30.676   1.00 72.53  ? 496  LEU C CB  1 
ATOM   9586  C CG  . LEU C 1 380 ? -8.337  3.981   31.398   1.00 71.02  ? 496  LEU C CG  1 
ATOM   9587  C CD1 . LEU C 1 380 ? -7.101  3.679   32.230   1.00 65.64  ? 496  LEU C CD1 1 
ATOM   9588  C CD2 . LEU C 1 380 ? -8.051  5.104   30.413   1.00 72.99  ? 496  LEU C CD2 1 
ATOM   9589  N N   . LEU C 1 381 ? -11.491 2.017   31.901   1.00 68.12  ? 497  LEU C N   1 
ATOM   9590  C CA  . LEU C 1 381 ? -12.668 2.338   32.698   1.00 70.54  ? 497  LEU C CA  1 
ATOM   9591  C C   . LEU C 1 381 ? -12.957 1.262   33.744   1.00 75.28  ? 497  LEU C C   1 
ATOM   9592  O O   . LEU C 1 381 ? -13.291 1.583   34.888   1.00 77.49  ? 497  LEU C O   1 
ATOM   9593  C CB  . LEU C 1 381 ? -13.892 2.599   31.820   1.00 71.40  ? 497  LEU C CB  1 
ATOM   9594  C CG  . LEU C 1 381 ? -14.220 4.076   31.592   1.00 69.05  ? 497  LEU C CG  1 
ATOM   9595  C CD1 . LEU C 1 381 ? -15.372 4.229   30.611   1.00 77.28  ? 497  LEU C CD1 1 
ATOM   9596  C CD2 . LEU C 1 381 ? -14.543 4.768   32.903   1.00 49.39  ? 497  LEU C CD2 1 
ATOM   9597  N N   . ALA C 1 382 ? -12.825 -0.006  33.359   1.00 75.00  ? 498  ALA C N   1 
ATOM   9598  C CA  . ALA C 1 382 ? -13.024 -1.104  34.307   1.00 76.72  ? 498  ALA C CA  1 
ATOM   9599  C C   . ALA C 1 382 ? -12.078 -0.963  35.499   1.00 80.93  ? 498  ALA C C   1 
ATOM   9600  O O   . ALA C 1 382 ? -12.487 -1.094  36.661   1.00 80.76  ? 498  ALA C O   1 
ATOM   9601  C CB  . ALA C 1 382 ? -12.816 -2.443  33.623   1.00 70.77  ? 498  ALA C CB  1 
ATOM   9602  N N   . PHE C 1 383 ? -10.814 -0.684  35.198   1.00 78.58  ? 499  PHE C N   1 
ATOM   9603  C CA  . PHE C 1 383 ? -9.797  -0.470  36.220   1.00 70.51  ? 499  PHE C CA  1 
ATOM   9604  C C   . PHE C 1 383 ? -10.193 0.632   37.180   1.00 68.33  ? 499  PHE C C   1 
ATOM   9605  O O   . PHE C 1 383 ? -10.454 0.373   38.354   1.00 70.27  ? 499  PHE C O   1 
ATOM   9606  C CB  . PHE C 1 383 ? -8.468  -0.120  35.557   1.00 72.53  ? 499  PHE C CB  1 
ATOM   9607  C CG  . PHE C 1 383 ? -7.402  0.326   36.515   1.00 78.70  ? 499  PHE C CG  1 
ATOM   9608  C CD1 . PHE C 1 383 ? -7.122  1.675   36.676   1.00 78.23  ? 499  PHE C CD1 1 
ATOM   9609  C CD2 . PHE C 1 383 ? -6.674  -0.600  37.247   1.00 82.85  ? 499  PHE C CD2 1 
ATOM   9610  C CE1 . PHE C 1 383 ? -6.136  2.096   37.552   1.00 79.10  ? 499  PHE C CE1 1 
ATOM   9611  C CE2 . PHE C 1 383 ? -5.687  -0.190  38.129   1.00 83.24  ? 499  PHE C CE2 1 
ATOM   9612  C CZ  . PHE C 1 383 ? -5.418  1.163   38.282   1.00 84.63  ? 499  PHE C CZ  1 
ATOM   9613  N N   . ILE C 1 384 ? -10.253 1.860   36.676   1.00 66.42  ? 500  ILE C N   1 
ATOM   9614  C CA  . ILE C 1 384 ? -10.540 2.997   37.549   1.00 69.11  ? 500  ILE C CA  1 
ATOM   9615  C C   . ILE C 1 384 ? -11.850 2.855   38.334   1.00 70.00  ? 500  ILE C C   1 
ATOM   9616  O O   . ILE C 1 384 ? -11.888 3.140   39.530   1.00 69.34  ? 500  ILE C O   1 
ATOM   9617  C CB  . ILE C 1 384 ? -10.525 4.339   36.786   1.00 59.26  ? 500  ILE C CB  1 
ATOM   9618  C CG1 . ILE C 1 384 ? -11.135 5.434   37.658   1.00 59.58  ? 500  ILE C CG1 1 
ATOM   9619  C CG2 . ILE C 1 384 ? -11.275 4.220   35.480   1.00 69.11  ? 500  ILE C CG2 1 
ATOM   9620  C CD1 . ILE C 1 384 ? -11.402 6.736   36.935   1.00 51.49  ? 500  ILE C CD1 1 
ATOM   9621  N N   . ILE C 1 385 ? -12.909 2.397   37.670   1.00 71.43  ? 501  ILE C N   1 
ATOM   9622  C CA  . ILE C 1 385 ? -14.199 2.190   38.334   1.00 78.01  ? 501  ILE C CA  1 
ATOM   9623  C C   . ILE C 1 385 ? -14.176 1.125   39.442   1.00 78.51  ? 501  ILE C C   1 
ATOM   9624  O O   . ILE C 1 385 ? -14.766 1.315   40.509   1.00 76.14  ? 501  ILE C O   1 
ATOM   9625  C CB  . ILE C 1 385 ? -15.302 1.819   37.324   1.00 73.92  ? 501  ILE C CB  1 
ATOM   9626  C CG1 . ILE C 1 385 ? -15.823 3.073   36.634   1.00 75.17  ? 501  ILE C CG1 1 
ATOM   9627  C CG2 . ILE C 1 385 ? -16.433 1.090   38.020   1.00 74.41  ? 501  ILE C CG2 1 
ATOM   9628  C CD1 . ILE C 1 385 ? -17.063 2.825   35.841   1.00 79.48  ? 501  ILE C CD1 1 
ATOM   9629  N N   . THR C 1 386 ? -13.504 0.006   39.187   1.00 75.03  ? 502  THR C N   1 
ATOM   9630  C CA  . THR C 1 386 ? -13.493 -1.093  40.147   1.00 78.79  ? 502  THR C CA  1 
ATOM   9631  C C   . THR C 1 386 ? -12.516 -0.844  41.294   1.00 84.27  ? 502  THR C C   1 
ATOM   9632  O O   . THR C 1 386 ? -12.694 -1.359  42.397   1.00 88.66  ? 502  THR C O   1 
ATOM   9633  C CB  . THR C 1 386 ? -13.148 -2.422  39.483   1.00 83.95  ? 502  THR C CB  1 
ATOM   9634  O OG1 . THR C 1 386 ? -11.910 -2.297  38.772   1.00 74.48  ? 502  THR C OG1 1 
ATOM   9635  C CG2 . THR C 1 386 ? -14.253 -2.820  38.516   1.00 93.54  ? 502  THR C CG2 1 
ATOM   9636  N N   . TRP C 1 387 ? -11.474 -0.069  41.026   1.00 79.89  ? 503  TRP C N   1 
ATOM   9637  C CA  . TRP C 1 387 ? -10.474 0.239   42.040   1.00 76.16  ? 503  TRP C CA  1 
ATOM   9638  C C   . TRP C 1 387 ? -10.821 1.458   42.869   1.00 74.78  ? 503  TRP C C   1 
ATOM   9639  O O   . TRP C 1 387 ? -10.948 1.367   44.087   1.00 80.03  ? 503  TRP C O   1 
ATOM   9640  C CB  . TRP C 1 387 ? -9.092  0.421   41.423   1.00 76.36  ? 503  TRP C CB  1 
ATOM   9641  C CG  . TRP C 1 387 ? -8.387  -0.858  41.196   1.00 76.66  ? 503  TRP C CG  1 
ATOM   9642  C CD1 . TRP C 1 387 ? -8.950  -2.054  40.872   1.00 82.22  ? 503  TRP C CD1 1 
ATOM   9643  C CD2 . TRP C 1 387 ? -6.977  -1.087  41.291   1.00 73.66  ? 503  TRP C CD2 1 
ATOM   9644  N NE1 . TRP C 1 387 ? -7.977  -3.014  40.746   1.00 87.95  ? 503  TRP C NE1 1 
ATOM   9645  C CE2 . TRP C 1 387 ? -6.759  -2.445  40.998   1.00 81.04  ? 503  TRP C CE2 1 
ATOM   9646  C CE3 . TRP C 1 387 ? -5.883  -0.274  41.591   1.00 68.22  ? 503  TRP C CE3 1 
ATOM   9647  C CZ2 . TRP C 1 387 ? -5.485  -3.008  40.998   1.00 78.15  ? 503  TRP C CZ2 1 
ATOM   9648  C CZ3 . TRP C 1 387 ? -4.622  -0.838  41.589   1.00 68.91  ? 503  TRP C CZ3 1 
ATOM   9649  C CH2 . TRP C 1 387 ? -4.433  -2.189  41.296   1.00 67.31  ? 503  TRP C CH2 1 
ATOM   9650  N N   . THR C 1 388 ? -10.958 2.598   42.203   1.00 70.53  ? 504  THR C N   1 
ATOM   9651  C CA  . THR C 1 388 ? -10.964 3.884   42.885   1.00 72.09  ? 504  THR C CA  1 
ATOM   9652  C C   . THR C 1 388 ? -11.731 3.913   44.201   1.00 78.13  ? 504  THR C C   1 
ATOM   9653  O O   . THR C 1 388 ? -11.264 4.531   45.142   1.00 87.26  ? 504  THR C O   1 
ATOM   9654  C CB  . THR C 1 388 ? -11.454 5.042   41.983   1.00 78.69  ? 504  THR C CB  1 
ATOM   9655  O OG1 . THR C 1 388 ? -12.692 4.686   41.358   1.00 85.46  ? 504  THR C OG1 1 
ATOM   9656  C CG2 . THR C 1 388 ? -10.419 5.365   40.920   1.00 71.33  ? 504  THR C CG2 1 
ATOM   9657  N N   . PRO C 1 389 ? -12.900 3.252   44.285   1.00 80.06  ? 505  PRO C N   1 
ATOM   9658  C CA  . PRO C 1 389 ? -13.589 3.299   45.582   1.00 80.36  ? 505  PRO C CA  1 
ATOM   9659  C C   . PRO C 1 389 ? -12.649 3.022   46.762   1.00 79.01  ? 505  PRO C C   1 
ATOM   9660  O O   . PRO C 1 389 ? -12.728 3.696   47.795   1.00 81.46  ? 505  PRO C O   1 
ATOM   9661  C CB  . PRO C 1 389 ? -14.622 2.178   45.460   1.00 70.41  ? 505  PRO C CB  1 
ATOM   9662  C CG  . PRO C 1 389 ? -14.950 2.149   44.010   1.00 75.27  ? 505  PRO C CG  1 
ATOM   9663  C CD  . PRO C 1 389 ? -13.689 2.534   43.268   1.00 80.62  ? 505  PRO C CD  1 
ATOM   9664  N N   . TYR C 1 390 ? -11.759 2.050   46.598   1.00 76.92  ? 506  TYR C N   1 
ATOM   9665  C CA  . TYR C 1 390 ? -10.787 1.714   47.629   1.00 80.69  ? 506  TYR C CA  1 
ATOM   9666  C C   . TYR C 1 390 ? -9.924  2.915   48.008   1.00 81.29  ? 506  TYR C C   1 
ATOM   9667  O O   . TYR C 1 390 ? -9.817  3.269   49.180   1.00 90.20  ? 506  TYR C O   1 
ATOM   9668  C CB  . TYR C 1 390 ? -9.893  0.573   47.149   1.00 91.56  ? 506  TYR C CB  1 
ATOM   9669  C CG  . TYR C 1 390 ? -8.920  0.088   48.194   1.00 94.18  ? 506  TYR C CG  1 
ATOM   9670  C CD1 . TYR C 1 390 ? -9.222  -1.004  48.998   1.00 98.04  ? 506  TYR C CD1 1 
ATOM   9671  C CD2 . TYR C 1 390 ? -7.702  0.723   48.382   1.00 92.01  ? 506  TYR C CD2 1 
ATOM   9672  C CE1 . TYR C 1 390 ? -8.335  -1.452  49.958   1.00 96.97  ? 506  TYR C CE1 1 
ATOM   9673  C CE2 . TYR C 1 390 ? -6.809  0.283   49.342   1.00 100.20 ? 506  TYR C CE2 1 
ATOM   9674  C CZ  . TYR C 1 390 ? -7.130  -0.805  50.128   1.00 97.13  ? 506  TYR C CZ  1 
ATOM   9675  O OH  . TYR C 1 390 ? -6.243  -1.248  51.085   1.00 97.99  ? 506  TYR C OH  1 
ATOM   9676  N N   . ASN C 1 391 ? -9.304  3.534   47.010   1.00 79.68  ? 507  ASN C N   1 
ATOM   9677  C CA  . ASN C 1 391 ? -8.430  4.680   47.242   1.00 74.93  ? 507  ASN C CA  1 
ATOM   9678  C C   . ASN C 1 391 ? -9.165  5.894   47.789   1.00 71.21  ? 507  ASN C C   1 
ATOM   9679  O O   . ASN C 1 391 ? -8.619  6.645   48.583   1.00 72.68  ? 507  ASN C O   1 
ATOM   9680  C CB  . ASN C 1 391 ? -7.682  5.053   45.964   1.00 71.33  ? 507  ASN C CB  1 
ATOM   9681  C CG  . ASN C 1 391 ? -6.652  4.016   45.578   1.00 76.21  ? 507  ASN C CG  1 
ATOM   9682  O OD1 . ASN C 1 391 ? -5.522  4.035   46.066   1.00 71.55  ? 507  ASN C OD1 1 
ATOM   9683  N ND2 . ASN C 1 391 ? -7.039  3.094   44.706   1.00 82.00  ? 507  ASN C ND2 1 
ATOM   9684  N N   . ILE C 1 392 ? -10.399 6.089   47.342   1.00 69.77  ? 508  ILE C N   1 
ATOM   9685  C CA  . ILE C 1 392 ? -11.265 7.110   47.894   1.00 65.47  ? 508  ILE C CA  1 
ATOM   9686  C C   . ILE C 1 392 ? -11.385 6.820   49.372   1.00 73.73  ? 508  ILE C C   1 
ATOM   9687  O O   . ILE C 1 392 ? -11.384 7.724   50.202   1.00 75.87  ? 508  ILE C O   1 
ATOM   9688  C CB  . ILE C 1 392 ? -12.666 7.054   47.259   1.00 65.00  ? 508  ILE C CB  1 
ATOM   9689  C CG1 . ILE C 1 392 ? -12.584 7.317   45.753   1.00 66.74  ? 508  ILE C CG1 1 
ATOM   9690  C CG2 . ILE C 1 392 ? -13.596 8.052   47.930   1.00 73.79  ? 508  ILE C CG2 1 
ATOM   9691  C CD1 . ILE C 1 392 ? -13.903 7.165   45.027   1.00 60.36  ? 508  ILE C CD1 1 
ATOM   9692  N N   . MET C 1 393 ? -11.465 5.535   49.691   1.00 81.91  ? 509  MET C N   1 
ATOM   9693  C CA  . MET C 1 393 ? -11.569 5.086   51.075   1.00 90.91  ? 509  MET C CA  1 
ATOM   9694  C C   . MET C 1 393 ? -10.256 5.288   51.838   1.00 86.53  ? 509  MET C C   1 
ATOM   9695  O O   . MET C 1 393 ? -10.245 5.373   53.065   1.00 86.24  ? 509  MET C O   1 
ATOM   9696  C CB  . MET C 1 393 ? -11.997 3.619   51.111   1.00 98.05  ? 509  MET C CB  1 
ATOM   9697  C CG  . MET C 1 393 ? -12.266 3.072   52.488   1.00 107.70 ? 509  MET C CG  1 
ATOM   9698  S SD  . MET C 1 393 ? -13.098 1.485   52.362   1.00 130.12 ? 509  MET C SD  1 
ATOM   9699  C CE  . MET C 1 393 ? -12.057 0.671   51.151   1.00 338.34 ? 509  MET C CE  1 
ATOM   9700  N N   . VAL C 1 394 ? -9.150  5.367   51.105   1.00 83.78  ? 510  VAL C N   1 
ATOM   9701  C CA  . VAL C 1 394 ? -7.857  5.679   51.701   1.00 75.18  ? 510  VAL C CA  1 
ATOM   9702  C C   . VAL C 1 394 ? -7.781  7.166   52.018   1.00 80.10  ? 510  VAL C C   1 
ATOM   9703  O O   . VAL C 1 394 ? -7.645  7.553   53.174   1.00 82.01  ? 510  VAL C O   1 
ATOM   9704  C CB  . VAL C 1 394 ? -6.703  5.308   50.770   1.00 68.03  ? 510  VAL C CB  1 
ATOM   9705  C CG1 . VAL C 1 394 ? -5.411  5.924   51.269   1.00 66.42  ? 510  VAL C CG1 1 
ATOM   9706  C CG2 . VAL C 1 394 ? -6.583  3.801   50.659   1.00 71.02  ? 510  VAL C CG2 1 
ATOM   9707  N N   . LEU C 1 395 ? -7.868  7.987   50.974   1.00 79.81  ? 511  LEU C N   1 
ATOM   9708  C CA  . LEU C 1 395 ? -7.882  9.440   51.094   1.00 77.47  ? 511  LEU C CA  1 
ATOM   9709  C C   . LEU C 1 395 ? -8.873  9.869   52.166   1.00 81.90  ? 511  LEU C C   1 
ATOM   9710  O O   . LEU C 1 395 ? -8.676  10.882  52.840   1.00 80.21  ? 511  LEU C O   1 
ATOM   9711  C CB  . LEU C 1 395 ? -8.257  10.071  49.751   1.00 65.90  ? 511  LEU C CB  1 
ATOM   9712  C CG  . LEU C 1 395 ? -8.809  11.497  49.764   1.00 63.62  ? 511  LEU C CG  1 
ATOM   9713  C CD1 . LEU C 1 395 ? -7.763  12.486  50.246   1.00 65.37  ? 511  LEU C CD1 1 
ATOM   9714  C CD2 . LEU C 1 395 ? -9.318  11.883  48.384   1.00 67.22  ? 511  LEU C CD2 1 
ATOM   9715  N N   . VAL C 1 396 ? -9.943  9.094   52.312   1.00 83.91  ? 512  VAL C N   1 
ATOM   9716  C CA  . VAL C 1 396 ? -10.902 9.312   53.385   1.00 86.89  ? 512  VAL C CA  1 
ATOM   9717  C C   . VAL C 1 396 ? -10.329 8.855   54.723   1.00 89.84  ? 512  VAL C C   1 
ATOM   9718  O O   . VAL C 1 396 ? -10.405 9.577   55.716   1.00 98.28  ? 512  VAL C O   1 
ATOM   9719  C CB  . VAL C 1 396 ? -12.223 8.571   53.121   1.00 84.59  ? 512  VAL C CB  1 
ATOM   9720  C CG1 . VAL C 1 396 ? -13.023 8.437   54.402   1.00 83.10  ? 512  VAL C CG1 1 
ATOM   9721  C CG2 . VAL C 1 396 ? -13.029 9.296   52.051   1.00 94.08  ? 512  VAL C CG2 1 
ATOM   9722  N N   . ASN C 1 397 ? -9.743  7.662   54.738   1.00 84.91  ? 513  ASN C N   1 
ATOM   9723  C CA  . ASN C 1 397 ? -9.186  7.092   55.962   1.00 90.04  ? 513  ASN C CA  1 
ATOM   9724  C C   . ASN C 1 397 ? -8.139  7.980   56.620   1.00 91.28  ? 513  ASN C C   1 
ATOM   9725  O O   . ASN C 1 397 ? -8.012  8.011   57.843   1.00 88.03  ? 513  ASN C O   1 
ATOM   9726  C CB  . ASN C 1 397 ? -8.584  5.714   55.689   1.00 85.03  ? 513  ASN C CB  1 
ATOM   9727  C CG  . ASN C 1 397 ? -7.748  5.211   56.848   1.00 81.43  ? 513  ASN C CG  1 
ATOM   9728  O OD1 . ASN C 1 397 ? -6.629  4.738   56.669   1.00 75.73  ? 513  ASN C OD1 1 
ATOM   9729  N ND2 . ASN C 1 397 ? -8.281  5.338   58.052   1.00 82.92  ? 513  ASN C ND2 1 
ATOM   9730  N N   . THR C 1 398 ? -7.381  8.693   55.799   1.00 89.42  ? 514  THR C N   1 
ATOM   9731  C CA  . THR C 1 398 ? -6.323  9.562   56.286   1.00 79.47  ? 514  THR C CA  1 
ATOM   9732  C C   . THR C 1 398 ? -6.836  10.545  57.322   1.00 84.21  ? 514  THR C C   1 
ATOM   9733  O O   . THR C 1 398 ? -6.158  10.825  58.305   1.00 81.90  ? 514  THR C O   1 
ATOM   9734  C CB  . THR C 1 398 ? -5.690  10.353  55.127   1.00 76.43  ? 514  THR C CB  1 
ATOM   9735  O OG1 . THR C 1 398 ? -4.938  9.452   54.308   1.00 78.92  ? 514  THR C OG1 1 
ATOM   9736  C CG2 . THR C 1 398 ? -4.780  11.429  55.665   1.00 74.30  ? 514  THR C CG2 1 
ATOM   9737  N N   . PHE C 1 399 ? -8.043  11.055  57.093   1.00 89.98  ? 515  PHE C N   1 
ATOM   9738  C CA  . PHE C 1 399 ? -8.612  12.120  57.914   1.00 96.32  ? 515  PHE C CA  1 
ATOM   9739  C C   . PHE C 1 399 ? -9.521  11.696  59.088   1.00 107.76 ? 515  PHE C C   1 
ATOM   9740  O O   . PHE C 1 399 ? -9.857  12.527  59.940   1.00 104.91 ? 515  PHE C O   1 
ATOM   9741  C CB  . PHE C 1 399 ? -9.335  13.118  57.003   1.00 89.24  ? 515  PHE C CB  1 
ATOM   9742  C CG  . PHE C 1 399 ? -8.453  13.728  55.939   1.00 87.67  ? 515  PHE C CG  1 
ATOM   9743  C CD1 . PHE C 1 399 ? -8.253  15.097  55.901   1.00 92.40  ? 515  PHE C CD1 1 
ATOM   9744  C CD2 . PHE C 1 399 ? -7.829  12.940  54.981   1.00 78.95  ? 515  PHE C CD2 1 
ATOM   9745  C CE1 . PHE C 1 399 ? -7.453  15.677  54.926   1.00 75.55  ? 515  PHE C CE1 1 
ATOM   9746  C CE2 . PHE C 1 399 ? -7.022  13.516  54.002   1.00 72.23  ? 515  PHE C CE2 1 
ATOM   9747  C CZ  . PHE C 1 399 ? -6.837  14.886  53.979   1.00 64.20  ? 515  PHE C CZ  1 
ATOM   9748  N N   . CYS C 1 400 ? -9.901  10.419  59.143   1.00 109.09 ? 516  CYS C N   1 
ATOM   9749  C CA  . CYS C 1 400 ? -10.778 9.931   60.198   1.00 125.27 ? 516  CYS C CA  1 
ATOM   9750  C C   . CYS C 1 400 ? -10.388 8.504   60.531   1.00 126.37 ? 516  CYS C C   1 
ATOM   9751  O O   . CYS C 1 400 ? -10.096 7.707   59.642   1.00 114.30 ? 516  CYS C O   1 
ATOM   9752  C CB  . CYS C 1 400 ? -12.223 10.009  59.754   1.00 139.56 ? 516  CYS C CB  1 
ATOM   9753  S SG  . CYS C 1 400 ? -12.488 9.187   58.165   1.00 156.04 ? 516  CYS C SG  1 
ATOM   9754  N N   . ASP C 1 401 ? -10.350 8.213   61.827   1.00 132.43 ? 517  ASP C N   1 
ATOM   9755  C CA  . ASP C 1 401 ? -9.973  6.896   62.340   1.00 140.58 ? 517  ASP C CA  1 
ATOM   9756  C C   . ASP C 1 401 ? -11.089 5.851   62.430   1.00 140.75 ? 517  ASP C C   1 
ATOM   9757  O O   . ASP C 1 401 ? -10.874 4.680   62.130   1.00 131.14 ? 517  ASP C O   1 
ATOM   9758  C CB  . ASP C 1 401 ? -9.283  7.059   63.697   1.00 148.53 ? 517  ASP C CB  1 
ATOM   9759  C CG  . ASP C 1 401 ? -9.627  8.383   64.369   1.00 147.61 ? 517  ASP C CG  1 
ATOM   9760  O OD1 . ASP C 1 401 ? -10.766 8.867   64.192   1.00 143.30 ? 517  ASP C OD1 1 
ATOM   9761  O OD2 . ASP C 1 401 ? -8.762  8.941   65.076   1.00 148.78 ? 517  ASP C OD2 1 
ATOM   9762  N N   . SER C 1 402 ? -12.265 6.281   62.879   1.00 150.09 ? 518  SER C N   1 
ATOM   9763  C CA  . SER C 1 402 ? -13.387 5.375   63.120   1.00 154.43 ? 518  SER C CA  1 
ATOM   9764  C C   . SER C 1 402 ? -14.387 5.314   61.968   1.00 149.71 ? 518  SER C C   1 
ATOM   9765  O O   . SER C 1 402 ? -15.372 4.570   62.017   1.00 152.65 ? 518  SER C O   1 
ATOM   9766  C CB  . SER C 1 402 ? -14.143 5.802   64.377   1.00 161.35 ? 518  SER C CB  1 
ATOM   9767  O OG  . SER C 1 402 ? -14.860 6.995   64.148   1.00 166.96 ? 518  SER C OG  1 
ATOM   9768  N N   . CYS C 1 403 ? -14.152 6.109   60.939   1.00 144.10 ? 519  CYS C N   1 
ATOM   9769  C CA  . CYS C 1 403 ? -15.093 6.191   59.815   1.00 140.61 ? 519  CYS C CA  1 
ATOM   9770  C C   . CYS C 1 403 ? -15.262 5.000   58.885   1.00 138.56 ? 519  CYS C C   1 
ATOM   9771  O O   . CYS C 1 403 ? -16.342 4.791   58.316   1.00 132.37 ? 519  CYS C O   1 
ATOM   9772  C CB  . CYS C 1 403 ? -14.708 7.373   58.972   1.00 139.87 ? 519  CYS C CB  1 
ATOM   9773  S SG  . CYS C 1 403 ? -12.917 7.291   58.720   1.00 139.42 ? 519  CYS C SG  1 
ATOM   9774  N N   . ILE C 1 404 ? -14.210 4.199   58.745   1.00 134.11 ? 520  ILE C N   1 
ATOM   9775  C CA  . ILE C 1 404 ? -14.238 3.067   57.824   1.00 129.40 ? 520  ILE C CA  1 
ATOM   9776  C C   . ILE C 1 404 ? -14.178 1.710   58.526   1.00 121.86 ? 520  ILE C C   1 
ATOM   9777  O O   . ILE C 1 404 ? -13.148 1.348   59.099   1.00 118.91 ? 520  ILE C O   1 
ATOM   9778  C CB  . ILE C 1 404 ? -13.085 3.150   56.813   1.00 127.28 ? 520  ILE C CB  1 
ATOM   9779  C CG1 . ILE C 1 404 ? -13.028 4.546   56.188   1.00 124.45 ? 520  ILE C CG1 1 
ATOM   9780  C CG2 . ILE C 1 404 ? -13.252 2.090   55.744   1.00 130.47 ? 520  ILE C CG2 1 
ATOM   9781  C CD1 . ILE C 1 404 ? -14.245 4.894   55.357   1.00 121.03 ? 520  ILE C CD1 1 
ATOM   9782  N N   . PRO C 1 405 ? -15.288 0.954   58.473   1.00 117.64 ? 521  PRO C N   1 
ATOM   9783  C CA  . PRO C 1 405 ? -15.420 -0.391  59.047   1.00 114.55 ? 521  PRO C CA  1 
ATOM   9784  C C   . PRO C 1 405 ? -14.672 -1.448  58.239   1.00 111.40 ? 521  PRO C C   1 
ATOM   9785  O O   . PRO C 1 405 ? -14.427 -1.250  57.050   1.00 115.28 ? 521  PRO C O   1 
ATOM   9786  C CB  . PRO C 1 405 ? -16.929 -0.662  58.968   1.00 115.90 ? 521  PRO C CB  1 
ATOM   9787  C CG  . PRO C 1 405 ? -17.562 0.671   58.740   1.00 124.24 ? 521  PRO C CG  1 
ATOM   9788  C CD  . PRO C 1 405 ? -16.568 1.441   57.939   1.00 120.63 ? 521  PRO C CD  1 
ATOM   9789  N N   . LYS C 1 406 ? -14.320 -2.556  58.886   1.00 103.39 ? 522  LYS C N   1 
ATOM   9790  C CA  . LYS C 1 406 ? -13.611 -3.650  58.228   1.00 102.21 ? 522  LYS C CA  1 
ATOM   9791  C C   . LYS C 1 406 ? -14.377 -4.113  56.998   1.00 111.83 ? 522  LYS C C   1 
ATOM   9792  O O   . LYS C 1 406 ? -13.786 -4.478  55.973   1.00 122.99 ? 522  LYS C O   1 
ATOM   9793  C CB  . LYS C 1 406 ? -13.414 -4.816  59.195   1.00 90.39  ? 522  LYS C CB  1 
ATOM   9794  N N   . THR C 1 407 ? -15.700 -4.088  57.108   1.00 104.72 ? 523  THR C N   1 
ATOM   9795  C CA  . THR C 1 407 ? -16.573 -4.419  55.994   1.00 110.66 ? 523  THR C CA  1 
ATOM   9796  C C   . THR C 1 407 ? -16.128 -3.701  54.722   1.00 121.12 ? 523  THR C C   1 
ATOM   9797  O O   . THR C 1 407 ? -15.648 -4.329  53.768   1.00 118.38 ? 523  THR C O   1 
ATOM   9798  C CB  . THR C 1 407 ? -18.022 -4.007  56.303   1.00 109.30 ? 523  THR C CB  1 
ATOM   9799  O OG1 . THR C 1 407 ? -18.455 -4.646  57.509   1.00 111.82 ? 523  THR C OG1 1 
ATOM   9800  C CG2 . THR C 1 407 ? -18.948 -4.397  55.162   1.00 106.57 ? 523  THR C CG2 1 
ATOM   9801  N N   . TYR C 1 408 ? -16.282 -2.379  54.730   1.00 125.07 ? 524  TYR C N   1 
ATOM   9802  C CA  . TYR C 1 408 ? -16.013 -1.541  53.562   1.00 123.50 ? 524  TYR C CA  1 
ATOM   9803  C C   . TYR C 1 408 ? -14.614 -1.755  52.976   1.00 121.92 ? 524  TYR C C   1 
ATOM   9804  O O   . TYR C 1 408 ? -14.452 -1.823  51.754   1.00 127.42 ? 524  TYR C O   1 
ATOM   9805  C CB  . TYR C 1 408 ? -16.234 -0.063  53.901   1.00 123.61 ? 524  TYR C CB  1 
ATOM   9806  C CG  . TYR C 1 408 ? -17.660 0.279   54.290   1.00 129.81 ? 524  TYR C CG  1 
ATOM   9807  C CD1 . TYR C 1 408 ? -18.708 -0.589  54.008   1.00 131.62 ? 524  TYR C CD1 1 
ATOM   9808  C CD2 . TYR C 1 408 ? -17.958 1.475   54.934   1.00 137.84 ? 524  TYR C CD2 1 
ATOM   9809  C CE1 . TYR C 1 408 ? -20.013 -0.277  54.361   1.00 135.76 ? 524  TYR C CE1 1 
ATOM   9810  C CE2 . TYR C 1 408 ? -19.260 1.795   55.290   1.00 144.32 ? 524  TYR C CE2 1 
ATOM   9811  C CZ  . TYR C 1 408 ? -20.284 0.916   55.001   1.00 142.54 ? 524  TYR C CZ  1 
ATOM   9812  O OH  . TYR C 1 408 ? -21.581 1.226   55.351   1.00 141.79 ? 524  TYR C OH  1 
ATOM   9813  N N   . TRP C 1 409 ? -13.611 -1.856  53.845   1.00 115.71 ? 525  TRP C N   1 
ATOM   9814  C CA  . TRP C 1 409 ? -12.257 -2.177  53.407   1.00 115.18 ? 525  TRP C CA  1 
ATOM   9815  C C   . TRP C 1 409 ? -12.265 -3.466  52.594   1.00 115.24 ? 525  TRP C C   1 
ATOM   9816  O O   . TRP C 1 409 ? -11.939 -3.466  51.402   1.00 122.30 ? 525  TRP C O   1 
ATOM   9817  C CB  . TRP C 1 409 ? -11.303 -2.327  54.597   1.00 116.35 ? 525  TRP C CB  1 
ATOM   9818  C CG  . TRP C 1 409 ? -10.905 -1.034  55.255   1.00 120.98 ? 525  TRP C CG  1 
ATOM   9819  C CD1 . TRP C 1 409 ? -11.232 -0.621  56.514   1.00 122.38 ? 525  TRP C CD1 1 
ATOM   9820  C CD2 . TRP C 1 409 ? -10.102 0.011   54.689   1.00 124.22 ? 525  TRP C CD2 1 
ATOM   9821  N NE1 . TRP C 1 409 ? -10.685 0.616   56.766   1.00 123.11 ? 525  TRP C NE1 1 
ATOM   9822  C CE2 . TRP C 1 409 ? -9.988  1.027   55.660   1.00 121.62 ? 525  TRP C CE2 1 
ATOM   9823  C CE3 . TRP C 1 409 ? -9.471  0.189   53.453   1.00 123.57 ? 525  TRP C CE3 1 
ATOM   9824  C CZ2 . TRP C 1 409 ? -9.270  2.202   55.435   1.00 109.83 ? 525  TRP C CZ2 1 
ATOM   9825  C CZ3 . TRP C 1 409 ? -8.758  1.356   53.231   1.00 116.67 ? 525  TRP C CZ3 1 
ATOM   9826  C CH2 . TRP C 1 409 ? -8.664  2.346   54.217   1.00 111.45 ? 525  TRP C CH2 1 
ATOM   9827  N N   . ASN C 1 410 ? -12.637 -4.565  53.242   1.00 106.39 ? 526  ASN C N   1 
ATOM   9828  C CA  . ASN C 1 410 ? -12.624 -5.860  52.575   1.00 102.10 ? 526  ASN C CA  1 
ATOM   9829  C C   . ASN C 1 410 ? -13.353 -5.847  51.236   1.00 110.20 ? 526  ASN C C   1 
ATOM   9830  O O   . ASN C 1 410 ? -12.863 -6.396  50.245   1.00 110.48 ? 526  ASN C O   1 
ATOM   9831  C CB  . ASN C 1 410 ? -13.196 -6.936  53.489   1.00 103.42 ? 526  ASN C CB  1 
ATOM   9832  C CG  . ASN C 1 410 ? -12.342 -7.161  54.718   1.00 113.16 ? 526  ASN C CG  1 
ATOM   9833  O OD1 . ASN C 1 410 ? -11.196 -7.591  54.616   1.00 108.25 ? 526  ASN C OD1 1 
ATOM   9834  N ND2 . ASN C 1 410 ? -12.895 -6.871  55.890   1.00 116.38 ? 526  ASN C ND2 1 
ATOM   9835  N N   . LEU C 1 411 ? -14.516 -5.205  51.206   1.00 115.18 ? 527  LEU C N   1 
ATOM   9836  C CA  . LEU C 1 411 ? -15.277 -5.090  49.964   1.00 120.28 ? 527  LEU C CA  1 
ATOM   9837  C C   . LEU C 1 411 ? -14.492 -4.346  48.875   1.00 122.03 ? 527  LEU C C   1 
ATOM   9838  O O   . LEU C 1 411 ? -14.384 -4.832  47.749   1.00 124.07 ? 527  LEU C O   1 
ATOM   9839  C CB  . LEU C 1 411 ? -16.631 -4.418  50.207   1.00 120.17 ? 527  LEU C CB  1 
ATOM   9840  N N   . GLY C 1 412 ? -13.950 -3.174  49.208   1.00 119.76 ? 528  GLY C N   1 
ATOM   9841  C CA  . GLY C 1 412 ? -13.123 -2.427  48.271   1.00 106.30 ? 528  GLY C CA  1 
ATOM   9842  C C   . GLY C 1 412 ? -12.028 -3.312  47.705   1.00 103.30 ? 528  GLY C C   1 
ATOM   9843  O O   . GLY C 1 412 ? -11.743 -3.294  46.498   1.00 102.73 ? 528  GLY C O   1 
ATOM   9844  N N   . TYR C 1 413 ? -11.420 -4.097  48.590   1.00 100.39 ? 529  TYR C N   1 
ATOM   9845  C CA  . TYR C 1 413 ? -10.411 -5.075  48.199   1.00 102.00 ? 529  TYR C CA  1 
ATOM   9846  C C   . TYR C 1 413 ? -10.967 -6.013  47.131   1.00 114.58 ? 529  TYR C C   1 
ATOM   9847  O O   . TYR C 1 413 ? -10.343 -6.241  46.083   1.00 117.04 ? 529  TYR C O   1 
ATOM   9848  C CB  . TYR C 1 413 ? -9.975  -5.890  49.417   1.00 93.53  ? 529  TYR C CB  1 
ATOM   9849  C CG  . TYR C 1 413 ? -8.486  -6.099  49.519   1.00 87.46  ? 529  TYR C CG  1 
ATOM   9850  C CD1 . TYR C 1 413 ? -7.869  -7.166  48.885   1.00 93.28  ? 529  TYR C CD1 1 
ATOM   9851  C CD2 . TYR C 1 413 ? -7.695  -5.228  50.253   1.00 84.23  ? 529  TYR C CD2 1 
ATOM   9852  C CE1 . TYR C 1 413 ? -6.504  -7.358  48.981   1.00 94.71  ? 529  TYR C CE1 1 
ATOM   9853  C CE2 . TYR C 1 413 ? -6.332  -5.412  50.353   1.00 84.47  ? 529  TYR C CE2 1 
ATOM   9854  C CZ  . TYR C 1 413 ? -5.741  -6.477  49.716   1.00 87.87  ? 529  TYR C CZ  1 
ATOM   9855  O OH  . TYR C 1 413 ? -4.379  -6.660  49.814   1.00 94.60  ? 529  TYR C OH  1 
ATOM   9856  N N   . TRP C 1 414 ? -12.154 -6.551  47.401   1.00 117.64 ? 530  TRP C N   1 
ATOM   9857  C CA  . TRP C 1 414 ? -12.803 -7.457  46.459   1.00 118.68 ? 530  TRP C CA  1 
ATOM   9858  C C   . TRP C 1 414 ? -13.113 -6.820  45.105   1.00 117.25 ? 530  TRP C C   1 
ATOM   9859  O O   . TRP C 1 414 ? -13.028 -7.492  44.088   1.00 117.72 ? 530  TRP C O   1 
ATOM   9860  C CB  . TRP C 1 414 ? -14.070 -8.075  47.055   1.00 127.16 ? 530  TRP C CB  1 
ATOM   9861  C CG  . TRP C 1 414 ? -13.797 -9.286  47.892   1.00 134.43 ? 530  TRP C CG  1 
ATOM   9862  C CD1 . TRP C 1 414 ? -14.060 -9.439  49.222   1.00 135.45 ? 530  TRP C CD1 1 
ATOM   9863  C CD2 . TRP C 1 414 ? -13.195 -10.514 47.458   1.00 138.49 ? 530  TRP C CD2 1 
ATOM   9864  N NE1 . TRP C 1 414 ? -13.666 -10.688 49.642   1.00 133.64 ? 530  TRP C NE1 1 
ATOM   9865  C CE2 . TRP C 1 414 ? -13.131 -11.366 48.579   1.00 141.04 ? 530  TRP C CE2 1 
ATOM   9866  C CE3 . TRP C 1 414 ? -12.707 -10.975 46.230   1.00 136.12 ? 530  TRP C CE3 1 
ATOM   9867  C CZ2 . TRP C 1 414 ? -12.599 -12.655 48.510   1.00 141.80 ? 530  TRP C CZ2 1 
ATOM   9868  C CZ3 . TRP C 1 414 ? -12.180 -12.256 46.163   1.00 136.90 ? 530  TRP C CZ3 1 
ATOM   9869  C CH2 . TRP C 1 414 ? -12.130 -13.080 47.296   1.00 140.02 ? 530  TRP C CH2 1 
ATOM   9870  N N   . LEU C 1 415 ? -13.481 -5.541  45.091   1.00 116.33 ? 531  LEU C N   1 
ATOM   9871  C CA  . LEU C 1 415 ? -13.712 -4.831  43.833   1.00 112.05 ? 531  LEU C CA  1 
ATOM   9872  C C   . LEU C 1 415 ? -12.406 -4.729  43.058   1.00 109.68 ? 531  LEU C C   1 
ATOM   9873  O O   . LEU C 1 415 ? -12.354 -4.991  41.850   1.00 106.60 ? 531  LEU C O   1 
ATOM   9874  C CB  . LEU C 1 415 ? -14.274 -3.432  44.091   1.00 109.46 ? 531  LEU C CB  1 
ATOM   9875  C CG  . LEU C 1 415 ? -15.677 -3.338  44.692   1.00 112.31 ? 531  LEU C CG  1 
ATOM   9876  C CD1 . LEU C 1 415 ? -16.017 -1.898  45.048   1.00 107.98 ? 531  LEU C CD1 1 
ATOM   9877  C CD2 . LEU C 1 415 ? -16.713 -3.919  43.742   1.00 105.92 ? 531  LEU C CD2 1 
ATOM   9878  N N   . CYS C 1 416 ? -11.345 -4.349  43.763   1.00 110.71 ? 532  CYS C N   1 
ATOM   9879  C CA  . CYS C 1 416 ? -10.023 -4.333  43.158   1.00 105.66 ? 532  CYS C CA  1 
ATOM   9880  C C   . CYS C 1 416 ? -9.644  -5.725  42.654   1.00 109.79 ? 532  CYS C C   1 
ATOM   9881  O O   . CYS C 1 416 ? -8.750  -5.872  41.820   1.00 108.58 ? 532  CYS C O   1 
ATOM   9882  C CB  . CYS C 1 416 ? -8.991  -3.793  44.141   1.00 98.42  ? 532  CYS C CB  1 
ATOM   9883  S SG  . CYS C 1 416 ? -9.268  -2.059  44.543   1.00 96.96  ? 532  CYS C SG  1 
ATOM   9884  N N   . TYR C 1 417 ? -10.326 -6.745  43.166   1.00 108.88 ? 533  TYR C N   1 
ATOM   9885  C CA  . TYR C 1 417 ? -10.207 -8.090  42.604   1.00 107.88 ? 533  TYR C CA  1 
ATOM   9886  C C   . TYR C 1 417 ? -11.062 -8.303  41.340   1.00 114.52 ? 533  TYR C C   1 
ATOM   9887  O O   . TYR C 1 417 ? -10.613 -8.905  40.354   1.00 112.63 ? 533  TYR C O   1 
ATOM   9888  C CB  . TYR C 1 417 ? -10.558 -9.139  43.656   1.00 107.73 ? 533  TYR C CB  1 
ATOM   9889  C CG  . TYR C 1 417 ? -9.452  -9.400  44.646   1.00 112.05 ? 533  TYR C CG  1 
ATOM   9890  C CD1 . TYR C 1 417 ? -8.252  -8.706  44.576   1.00 113.01 ? 533  TYR C CD1 1 
ATOM   9891  C CD2 . TYR C 1 417 ? -9.597  -10.356 45.640   1.00 119.77 ? 533  TYR C CD2 1 
ATOM   9892  C CE1 . TYR C 1 417 ? -7.231  -8.952  45.480   1.00 115.15 ? 533  TYR C CE1 1 
ATOM   9893  C CE2 . TYR C 1 417 ? -8.584  -10.610 46.546   1.00 116.96 ? 533  TYR C CE2 1 
ATOM   9894  C CZ  . TYR C 1 417 ? -7.404  -9.907  46.462   1.00 112.85 ? 533  TYR C CZ  1 
ATOM   9895  O OH  . TYR C 1 417 ? -6.397  -10.162 47.363   1.00 100.24 ? 533  TYR C OH  1 
ATOM   9896  N N   . ILE C 1 418 ? -12.295 -7.805  41.372   1.00 117.43 ? 534  ILE C N   1 
ATOM   9897  C CA  . ILE C 1 418 ? -13.236 -8.013  40.277   1.00 121.27 ? 534  ILE C CA  1 
ATOM   9898  C C   . ILE C 1 418 ? -12.794 -7.227  39.057   1.00 118.93 ? 534  ILE C C   1 
ATOM   9899  O O   . ILE C 1 418 ? -13.296 -7.443  37.957   1.00 117.87 ? 534  ILE C O   1 
ATOM   9900  C CB  . ILE C 1 418 ? -14.681 -7.602  40.642   1.00 124.48 ? 534  ILE C CB  1 
ATOM   9901  C CG1 . ILE C 1 418 ? -14.817 -6.075  40.667   1.00 124.60 ? 534  ILE C CG1 1 
ATOM   9902  C CG2 . ILE C 1 418 ? -15.112 -8.245  41.957   1.00 116.11 ? 534  ILE C CG2 1 
ATOM   9903  C CD1 . ILE C 1 418 ? -16.247 -5.584  40.743   1.00 124.31 ? 534  ILE C CD1 1 
ATOM   9904  N N   . ASN C 1 419 ? -11.870 -6.296  39.258   1.00 114.28 ? 535  ASN C N   1 
ATOM   9905  C CA  . ASN C 1 419 ? -11.226 -5.651  38.127   1.00 110.16 ? 535  ASN C CA  1 
ATOM   9906  C C   . ASN C 1 419 ? -10.528 -6.703  37.273   1.00 110.26 ? 535  ASN C C   1 
ATOM   9907  O O   . ASN C 1 419 ? -10.799 -6.849  36.070   1.00 113.39 ? 535  ASN C O   1 
ATOM   9908  C CB  . ASN C 1 419 ? -10.212 -4.623  38.611   1.00 102.53 ? 535  ASN C CB  1 
ATOM   9909  C CG  . ASN C 1 419 ? -9.294  -4.161  37.507   1.00 100.51 ? 535  ASN C CG  1 
ATOM   9910  O OD1 . ASN C 1 419 ? -8.120  -4.529  37.465   1.00 104.44 ? 535  ASN C OD1 1 
ATOM   9911  N ND2 . ASN C 1 419 ? -9.831  -3.367  36.587   1.00 94.23  ? 535  ASN C ND2 1 
ATOM   9912  N N   . SER C 1 420 ? -9.636  -7.446  37.923   1.00 107.97 ? 536  SER C N   1 
ATOM   9913  C CA  . SER C 1 420 ? -8.879  -8.502  37.268   1.00 114.47 ? 536  SER C CA  1 
ATOM   9914  C C   . SER C 1 420 ? -9.773  -9.669  36.857   1.00 114.35 ? 536  SER C C   1 
ATOM   9915  O O   . SER C 1 420 ? -9.450  -10.412 35.928   1.00 113.99 ? 536  SER C O   1 
ATOM   9916  C CB  . SER C 1 420 ? -7.733  -8.976  38.165   1.00 112.68 ? 536  SER C CB  1 
ATOM   9917  O OG  . SER C 1 420 ? -6.752  -7.964  38.309   1.00 97.70  ? 536  SER C OG  1 
ATOM   9918  N N   . THR C 1 421 ? -10.895 -9.831  37.550   1.00 112.99 ? 537  THR C N   1 
ATOM   9919  C CA  . THR C 1 421 ? -11.891 -10.812 37.123   1.00 119.23 ? 537  THR C CA  1 
ATOM   9920  C C   . THR C 1 421 ? -12.538 -10.404 35.796   1.00 117.21 ? 537  THR C C   1 
ATOM   9921  O O   . THR C 1 421 ? -12.796 -11.242 34.929   1.00 108.84 ? 537  THR C O   1 
ATOM   9922  C CB  . THR C 1 421 ? -13.001 -10.982 38.170   1.00 125.56 ? 537  THR C CB  1 
ATOM   9923  O OG1 . THR C 1 421 ? -12.428 -11.379 39.422   1.00 126.31 ? 537  THR C OG1 1 
ATOM   9924  C CG2 . THR C 1 421 ? -14.005 -12.028 37.712   1.00 128.47 ? 537  THR C CG2 1 
ATOM   9925  N N   . VAL C 1 422 ? -12.798 -9.108  35.656   1.00 120.97 ? 538  VAL C N   1 
ATOM   9926  C CA  . VAL C 1 422 ? -13.505 -8.557  34.502   1.00 118.54 ? 538  VAL C CA  1 
ATOM   9927  C C   . VAL C 1 422 ? -12.614 -8.384  33.270   1.00 117.28 ? 538  VAL C C   1 
ATOM   9928  O O   . VAL C 1 422 ? -13.103 -8.397  32.139   1.00 117.33 ? 538  VAL C O   1 
ATOM   9929  C CB  . VAL C 1 422 ? -14.182 -7.208  34.853   1.00 120.30 ? 538  VAL C CB  1 
ATOM   9930  C CG1 . VAL C 1 422 ? -14.723 -6.528  33.605   1.00 120.06 ? 538  VAL C CG1 1 
ATOM   9931  C CG2 . VAL C 1 422 ? -15.296 -7.422  35.866   1.00 125.31 ? 538  VAL C CG2 1 
ATOM   9932  N N   . ASN C 1 423 ? -11.310 -8.227  33.484   1.00 116.21 ? 539  ASN C N   1 
ATOM   9933  C CA  . ASN C 1 423 ? -10.390 -8.048  32.357   1.00 114.14 ? 539  ASN C CA  1 
ATOM   9934  C C   . ASN C 1 423 ? -10.570 -9.021  31.176   1.00 114.00 ? 539  ASN C C   1 
ATOM   9935  O O   . ASN C 1 423 ? -10.741 -8.581  30.035   1.00 116.61 ? 539  ASN C O   1 
ATOM   9936  C CB  . ASN C 1 423 ? -8.933  -8.022  32.828   1.00 106.93 ? 539  ASN C CB  1 
ATOM   9937  C CG  . ASN C 1 423 ? -8.529  -6.671  33.379   1.00 101.73 ? 539  ASN C CG  1 
ATOM   9938  O OD1 . ASN C 1 423 ? -9.153  -5.654  33.076   1.00 96.79  ? 539  ASN C OD1 1 
ATOM   9939  N ND2 . ASN C 1 423 ? -7.479  -6.652  34.187   1.00 105.08 ? 539  ASN C ND2 1 
ATOM   9940  N N   . PRO C 1 424 ? -10.535 -10.340 31.439   1.00 107.42 ? 540  PRO C N   1 
ATOM   9941  C CA  . PRO C 1 424 ? -10.703 -11.297 30.337   1.00 108.37 ? 540  PRO C CA  1 
ATOM   9942  C C   . PRO C 1 424 ? -11.975 -11.015 29.538   1.00 113.67 ? 540  PRO C C   1 
ATOM   9943  O O   . PRO C 1 424 ? -11.973 -11.030 28.301   1.00 114.21 ? 540  PRO C O   1 
ATOM   9944  C CB  . PRO C 1 424 ? -10.828 -12.640 31.060   1.00 102.92 ? 540  PRO C CB  1 
ATOM   9945  C CG  . PRO C 1 424 ? -10.124 -12.437 32.353   1.00 104.53 ? 540  PRO C CG  1 
ATOM   9946  C CD  . PRO C 1 424 ? -10.380 -11.014 32.739   1.00 102.16 ? 540  PRO C CD  1 
ATOM   9947  N N   . VAL C 1 425 ? -13.057 -10.749 30.260   1.00 112.98 ? 541  VAL C N   1 
ATOM   9948  C CA  . VAL C 1 425 ? -14.345 -10.458 29.646   1.00 110.56 ? 541  VAL C CA  1 
ATOM   9949  C C   . VAL C 1 425 ? -14.277 -9.190  28.795   1.00 115.22 ? 541  VAL C C   1 
ATOM   9950  O O   . VAL C 1 425 ? -14.887 -9.117  27.727   1.00 119.27 ? 541  VAL C O   1 
ATOM   9951  C CB  . VAL C 1 425 ? -15.446 -10.313 30.711   1.00 110.74 ? 541  VAL C CB  1 
ATOM   9952  C CG1 . VAL C 1 425 ? -16.794 -10.076 30.055   1.00 109.35 ? 541  VAL C CG1 1 
ATOM   9953  C CG2 . VAL C 1 425 ? -15.488 -11.546 31.597   1.00 103.34 ? 541  VAL C CG2 1 
ATOM   9954  N N   . CYS C 1 426 ? -13.541 -8.191  29.274   1.00 114.84 ? 542  CYS C N   1 
ATOM   9955  C CA  . CYS C 1 426 ? -13.300 -6.986  28.489   1.00 117.37 ? 542  CYS C CA  1 
ATOM   9956  C C   . CYS C 1 426 ? -12.664 -7.388  27.172   1.00 118.91 ? 542  CYS C C   1 
ATOM   9957  O O   . CYS C 1 426 ? -13.116 -6.987  26.097   1.00 115.16 ? 542  CYS C O   1 
ATOM   9958  C CB  . CYS C 1 426 ? -12.364 -6.031  29.225   1.00 107.68 ? 542  CYS C CB  1 
ATOM   9959  S SG  . CYS C 1 426 ? -12.920 -5.520  30.851   1.00 113.18 ? 542  CYS C SG  1 
ATOM   9960  N N   . TYR C 1 427 ? -11.609 -8.192  27.272   1.00 117.79 ? 543  TYR C N   1 
ATOM   9961  C CA  . TYR C 1 427 ? -10.940 -8.719  26.095   1.00 118.79 ? 543  TYR C CA  1 
ATOM   9962  C C   . TYR C 1 427 ? -11.991 -9.218  25.123   1.00 129.07 ? 543  TYR C C   1 
ATOM   9963  O O   . TYR C 1 427 ? -12.111 -8.708  24.009   1.00 130.73 ? 543  TYR C O   1 
ATOM   9964  C CB  . TYR C 1 427 ? -10.003 -9.861  26.473   1.00 116.40 ? 543  TYR C CB  1 
ATOM   9965  C CG  . TYR C 1 427 ? -8.768  -9.419  27.212   1.00 110.35 ? 543  TYR C CG  1 
ATOM   9966  C CD1 . TYR C 1 427 ? -8.422  -8.077  27.278   1.00 109.01 ? 543  TYR C CD1 1 
ATOM   9967  C CD2 . TYR C 1 427 ? -7.941  -10.344 27.833   1.00 109.92 ? 543  TYR C CD2 1 
ATOM   9968  C CE1 . TYR C 1 427 ? -7.290  -7.668  27.948   1.00 112.97 ? 543  TYR C CE1 1 
ATOM   9969  C CE2 . TYR C 1 427 ? -6.807  -9.947  28.506   1.00 113.18 ? 543  TYR C CE2 1 
ATOM   9970  C CZ  . TYR C 1 427 ? -6.485  -8.607  28.561   1.00 117.92 ? 543  TYR C CZ  1 
ATOM   9971  O OH  . TYR C 1 427 ? -5.355  -8.201  29.233   1.00 124.70 ? 543  TYR C OH  1 
ATOM   9972  N N   . ALA C 1 428 ? -12.753 -10.217 25.555   1.00 137.98 ? 544  ALA C N   1 
ATOM   9973  C CA  . ALA C 1 428 ? -13.792 -10.804 24.711   1.00 140.78 ? 544  ALA C CA  1 
ATOM   9974  C C   . ALA C 1 428 ? -14.765 -9.771  24.130   1.00 137.82 ? 544  ALA C C   1 
ATOM   9975  O O   . ALA C 1 428 ? -15.298 -9.966  23.039   1.00 140.29 ? 544  ALA C O   1 
ATOM   9976  C CB  . ALA C 1 428 ? -14.546 -11.884 25.473   1.00 135.92 ? 544  ALA C CB  1 
ATOM   9977  N N   . LEU C 1 429 ? -14.998 -8.677  24.851   1.00 131.34 ? 545  LEU C N   1 
ATOM   9978  C CA  . LEU C 1 429 ? -15.943 -7.660  24.384   1.00 129.54 ? 545  LEU C CA  1 
ATOM   9979  C C   . LEU C 1 429 ? -15.371 -6.767  23.282   1.00 132.09 ? 545  LEU C C   1 
ATOM   9980  O O   . LEU C 1 429 ? -16.041 -6.497  22.286   1.00 134.05 ? 545  LEU C O   1 
ATOM   9981  C CB  . LEU C 1 429 ? -16.461 -6.801  25.544   1.00 132.12 ? 545  LEU C CB  1 
ATOM   9982  C CG  . LEU C 1 429 ? -17.474 -5.704  25.189   1.00 129.19 ? 545  LEU C CG  1 
ATOM   9983  C CD1 . LEU C 1 429 ? -18.746 -6.297  24.603   1.00 124.57 ? 545  LEU C CD1 1 
ATOM   9984  C CD2 . LEU C 1 429 ? -17.805 -4.843  26.398   1.00 122.79 ? 545  LEU C CD2 1 
ATOM   9985  N N   . CYS C 1 430 ? -14.138 -6.304  23.456   1.00 129.98 ? 546  CYS C N   1 
ATOM   9986  C CA  . CYS C 1 430 ? -13.566 -5.346  22.510   1.00 134.67 ? 546  CYS C CA  1 
ATOM   9987  C C   . CYS C 1 430 ? -13.096 -5.950  21.181   1.00 143.73 ? 546  CYS C C   1 
ATOM   9988  O O   . CYS C 1 430 ? -13.346 -5.380  20.117   1.00 146.25 ? 546  CYS C O   1 
ATOM   9989  C CB  . CYS C 1 430 ? -12.456 -4.520  23.164   1.00 127.57 ? 546  CYS C CB  1 
ATOM   9990  S SG  . CYS C 1 430 ? -13.040 -2.969  23.895   1.00 118.23 ? 546  CYS C SG  1 
ATOM   9991  N N   . ASN C 1 431 ? -12.427 -7.097  21.236   1.00 143.71 ? 547  ASN C N   1 
ATOM   9992  C CA  . ASN C 1 431 ? -11.935 -7.739  20.019   1.00 140.95 ? 547  ASN C CA  1 
ATOM   9993  C C   . ASN C 1 431 ? -12.617 -9.065  19.709   1.00 141.50 ? 547  ASN C C   1 
ATOM   9994  O O   . ASN C 1 431 ? -12.389 -10.066 20.386   1.00 140.94 ? 547  ASN C O   1 
ATOM   9995  C CB  . ASN C 1 431 ? -10.421 -7.927  20.083   1.00 132.13 ? 547  ASN C CB  1 
ATOM   9996  C CG  . ASN C 1 431 ? -9.669  -6.640  19.833   1.00 133.38 ? 547  ASN C CG  1 
ATOM   9997  O OD1 . ASN C 1 431 ? -10.254 -5.555  19.832   1.00 127.16 ? 547  ASN C OD1 1 
ATOM   9998  N ND2 . ASN C 1 431 ? -8.364  -6.752  19.614   1.00 132.19 ? 547  ASN C ND2 1 
ATOM   9999  N N   . LYS C 1 432 ? -13.437 -9.065  18.663   1.00 145.47 ? 548  LYS C N   1 
ATOM   10000 C CA  . LYS C 1 432 ? -14.187 -10.249 18.266   1.00 144.90 ? 548  LYS C CA  1 
ATOM   10001 C C   . LYS C 1 432 ? -13.254 -11.415 17.970   1.00 149.49 ? 548  LYS C C   1 
ATOM   10002 O O   . LYS C 1 432 ? -13.662 -12.572 18.014   1.00 148.29 ? 548  LYS C O   1 
ATOM   10003 C CB  . LYS C 1 432 ? -15.051 -9.948  17.041   1.00 142.91 ? 548  LYS C CB  1 
ATOM   10004 N N   . THR C 1 433 ? -11.998 -11.103 17.666   1.00 151.28 ? 549  THR C N   1 
ATOM   10005 C CA  . THR C 1 433 ? -10.998 -12.132 17.418   1.00 146.42 ? 549  THR C CA  1 
ATOM   10006 C C   . THR C 1 433 ? -10.936 -13.075 18.611   1.00 146.54 ? 549  THR C C   1 
ATOM   10007 O O   . THR C 1 433 ? -11.097 -14.286 18.469   1.00 144.16 ? 549  THR C O   1 
ATOM   10008 C CB  . THR C 1 433 ? -9.604  -11.525 17.195   1.00 145.40 ? 549  THR C CB  1 
ATOM   10009 O OG1 . THR C 1 433 ? -9.685  -10.458 16.242   1.00 135.83 ? 549  THR C OG1 1 
ATOM   10010 C CG2 . THR C 1 433 ? -8.638  -12.584 16.687   1.00 151.91 ? 549  THR C CG2 1 
ATOM   10011 N N   . PHE C 1 434 ? -10.715 -12.501 19.789   1.00 150.62 ? 550  PHE C N   1 
ATOM   10012 C CA  . PHE C 1 434 ? -10.661 -13.274 21.024   1.00 155.19 ? 550  PHE C CA  1 
ATOM   10013 C C   . PHE C 1 434 ? -11.984 -13.990 21.276   1.00 156.00 ? 550  PHE C C   1 
ATOM   10014 O O   . PHE C 1 434 ? -12.024 -15.015 21.955   1.00 153.15 ? 550  PHE C O   1 
ATOM   10015 C CB  . PHE C 1 434 ? -10.318 -12.370 22.210   1.00 145.60 ? 550  PHE C CB  1 
ATOM   10016 N N   . ARG C 1 435 ? -13.065 -13.442 20.731   1.00 155.61 ? 551  ARG C N   1 
ATOM   10017 C CA  . ARG C 1 435 ? -14.381 -14.056 20.859   1.00 155.53 ? 551  ARG C CA  1 
ATOM   10018 C C   . ARG C 1 435 ? -14.430 -15.374 20.094   1.00 162.53 ? 551  ARG C C   1 
ATOM   10019 O O   . ARG C 1 435 ? -14.761 -16.422 20.653   1.00 164.46 ? 551  ARG C O   1 
ATOM   10020 C CB  . ARG C 1 435 ? -15.465 -13.107 20.344   1.00 148.07 ? 551  ARG C CB  1 
ATOM   10021 N N   . THR C 1 436 ? -14.087 -15.310 18.812   1.00 161.97 ? 552  THR C N   1 
ATOM   10022 C CA  . THR C 1 436 ? -14.085 -16.483 17.949   1.00 161.34 ? 552  THR C CA  1 
ATOM   10023 C C   . THR C 1 436 ? -13.040 -17.494 18.404   1.00 162.54 ? 552  THR C C   1 
ATOM   10024 O O   . THR C 1 436 ? -13.195 -18.699 18.203   1.00 164.64 ? 552  THR C O   1 
ATOM   10025 C CB  . THR C 1 436 ? -13.802 -16.101 16.486   1.00 151.85 ? 552  THR C CB  1 
ATOM   10026 N N   . THR C 1 437 ? -11.974 -16.995 19.020   1.00 160.08 ? 553  THR C N   1 
ATOM   10027 C CA  . THR C 1 437 ? -10.897 -17.854 19.491   1.00 157.21 ? 553  THR C CA  1 
ATOM   10028 C C   . THR C 1 437 ? -11.305 -18.605 20.753   1.00 157.35 ? 553  THR C C   1 
ATOM   10029 O O   . THR C 1 437 ? -11.091 -19.811 20.866   1.00 158.47 ? 553  THR C O   1 
ATOM   10030 C CB  . THR C 1 437 ? -9.620  -17.043 19.774   1.00 156.67 ? 553  THR C CB  1 
ATOM   10031 O OG1 . THR C 1 437 ? -9.229  -16.336 18.590   1.00 160.13 ? 553  THR C OG1 1 
ATOM   10032 C CG2 . THR C 1 437 ? -8.489  -17.962 20.207   1.00 150.86 ? 553  THR C CG2 1 
ATOM   10033 N N   . PHE C 1 438 ? -11.899 -17.885 21.696   1.00 154.24 ? 554  PHE C N   1 
ATOM   10034 C CA  . PHE C 1 438 ? -12.315 -18.479 22.958   1.00 157.63 ? 554  PHE C CA  1 
ATOM   10035 C C   . PHE C 1 438 ? -13.493 -19.422 22.757   1.00 168.00 ? 554  PHE C C   1 
ATOM   10036 O O   . PHE C 1 438 ? -13.571 -20.473 23.394   1.00 176.86 ? 554  PHE C O   1 
ATOM   10037 C CB  . PHE C 1 438 ? -12.682 -17.390 23.967   1.00 158.30 ? 554  PHE C CB  1 
ATOM   10038 N N   . LYS C 1 439 ? -14.404 -19.048 21.864   1.00 166.35 ? 555  LYS C N   1 
ATOM   10039 C CA  . LYS C 1 439 ? -15.604 -19.842 21.617   1.00 170.72 ? 555  LYS C CA  1 
ATOM   10040 C C   . LYS C 1 439 ? -15.274 -21.312 21.347   1.00 175.65 ? 555  LYS C C   1 
ATOM   10041 O O   . LYS C 1 439 ? -15.998 -22.212 21.778   1.00 175.09 ? 555  LYS C O   1 
ATOM   10042 C CB  . LYS C 1 439 ? -16.400 -19.258 20.448   1.00 162.07 ? 555  LYS C CB  1 
ATOM   10043 N N   . THR C 1 440 ? -14.171 -21.546 20.642   1.00 172.38 ? 556  THR C N   1 
ATOM   10044 C CA  . THR C 1 440 ? -13.777 -22.896 20.255   1.00 165.16 ? 556  THR C CA  1 
ATOM   10045 C C   . THR C 1 440 ? -12.922 -23.579 21.320   1.00 160.57 ? 556  THR C C   1 
ATOM   10046 O O   . THR C 1 440 ? -12.559 -22.972 22.327   1.00 155.73 ? 556  THR C O   1 
ATOM   10047 C CB  . THR C 1 440 ? -13.012 -22.889 18.920   1.00 157.57 ? 556  THR C CB  1 
ATOM   10048 O OG1 . THR C 1 440 ? -11.841 -22.073 19.042   1.00 150.32 ? 556  THR C OG1 1 
ATOM   10049 C CG2 . THR C 1 440 ? -13.891 -22.332 17.811   1.00 159.94 ? 556  THR C CG2 1 
ATOM   10050 N N   . TRP D 1 10  ? 27.093  41.554  27.498   1.00 190.74 ? 65   TRP D N   1 
ATOM   10051 C CA  . TRP D 1 10  ? 27.712  42.230  28.631   1.00 188.73 ? 65   TRP D CA  1 
ATOM   10052 C C   . TRP D 1 10  ? 26.927  41.972  29.912   1.00 197.30 ? 65   TRP D C   1 
ATOM   10053 O O   . TRP D 1 10  ? 27.498  41.604  30.939   1.00 200.07 ? 65   TRP D O   1 
ATOM   10054 C CB  . TRP D 1 10  ? 27.814  43.733  28.366   1.00 182.04 ? 65   TRP D CB  1 
ATOM   10055 C CG  . TRP D 1 10  ? 28.728  44.441  29.312   1.00 183.74 ? 65   TRP D CG  1 
ATOM   10056 C CD1 . TRP D 1 10  ? 28.409  45.471  30.149   1.00 184.84 ? 65   TRP D CD1 1 
ATOM   10057 C CD2 . TRP D 1 10  ? 30.115  44.160  29.530   1.00 185.81 ? 65   TRP D CD2 1 
ATOM   10058 N NE1 . TRP D 1 10  ? 29.516  45.854  30.870   1.00 183.71 ? 65   TRP D NE1 1 
ATOM   10059 C CE2 . TRP D 1 10  ? 30.576  45.064  30.509   1.00 182.45 ? 65   TRP D CE2 1 
ATOM   10060 C CE3 . TRP D 1 10  ? 31.013  43.233  28.991   1.00 181.59 ? 65   TRP D CE3 1 
ATOM   10061 C CZ2 . TRP D 1 10  ? 31.895  45.068  30.959   1.00 173.14 ? 65   TRP D CZ2 1 
ATOM   10062 C CZ3 . TRP D 1 10  ? 32.321  43.238  29.439   1.00 175.50 ? 65   TRP D CZ3 1 
ATOM   10063 C CH2 . TRP D 1 10  ? 32.750  44.150  30.413   1.00 173.50 ? 65   TRP D CH2 1 
ATOM   10064 N N   . GLN D 1 11  ? 25.615  42.171  29.843   1.00 200.28 ? 66   GLN D N   1 
ATOM   10065 C CA  . GLN D 1 11  ? 24.737  41.912  30.977   1.00 205.93 ? 66   GLN D CA  1 
ATOM   10066 C C   . GLN D 1 11  ? 24.793  40.438  31.362   1.00 206.04 ? 66   GLN D C   1 
ATOM   10067 O O   . GLN D 1 11  ? 24.545  40.072  32.514   1.00 203.47 ? 66   GLN D O   1 
ATOM   10068 C CB  . GLN D 1 11  ? 23.299  42.319  30.645   1.00 208.16 ? 66   GLN D CB  1 
ATOM   10069 N N   . VAL D 1 12  ? 25.126  39.598  30.385   1.00 207.44 ? 67   VAL D N   1 
ATOM   10070 C CA  . VAL D 1 12  ? 25.231  38.160  30.600   1.00 207.62 ? 67   VAL D CA  1 
ATOM   10071 C C   . VAL D 1 12  ? 26.420  37.818  31.493   1.00 202.77 ? 67   VAL D C   1 
ATOM   10072 O O   . VAL D 1 12  ? 26.291  37.038  32.438   1.00 201.56 ? 67   VAL D O   1 
ATOM   10073 C CB  . VAL D 1 12  ? 25.364  37.400  29.267   1.00 213.22 ? 67   VAL D CB  1 
ATOM   10074 N N   . VAL D 1 13  ? 27.575  38.400  31.189   1.00 201.86 ? 68   VAL D N   1 
ATOM   10075 C CA  . VAL D 1 13  ? 28.762  38.218  32.015   1.00 200.70 ? 68   VAL D CA  1 
ATOM   10076 C C   . VAL D 1 13  ? 28.481  38.693  33.438   1.00 198.44 ? 68   VAL D C   1 
ATOM   10077 O O   . VAL D 1 13  ? 28.806  38.014  34.418   1.00 192.25 ? 68   VAL D O   1 
ATOM   10078 C CB  . VAL D 1 13  ? 29.955  39.013  31.454   1.00 199.62 ? 68   VAL D CB  1 
ATOM   10079 C CG1 . VAL D 1 13  ? 31.186  38.798  32.318   1.00 194.04 ? 68   VAL D CG1 1 
ATOM   10080 C CG2 . VAL D 1 13  ? 30.225  38.612  30.012   1.00 203.67 ? 68   VAL D CG2 1 
ATOM   10081 N N   . PHE D 1 14  ? 27.865  39.866  33.531   1.00 201.52 ? 69   PHE D N   1 
ATOM   10082 C CA  . PHE D 1 14  ? 27.473  40.463  34.804   1.00 197.00 ? 69   PHE D CA  1 
ATOM   10083 C C   . PHE D 1 14  ? 26.625  39.504  35.643   1.00 190.20 ? 69   PHE D C   1 
ATOM   10084 O O   . PHE D 1 14  ? 27.059  39.017  36.702   1.00 191.54 ? 69   PHE D O   1 
ATOM   10085 C CB  . PHE D 1 14  ? 26.704  41.761  34.532   1.00 194.76 ? 69   PHE D CB  1 
ATOM   10086 C CG  . PHE D 1 14  ? 26.218  42.454  35.768   1.00 193.89 ? 69   PHE D CG  1 
ATOM   10087 C CD1 . PHE D 1 14  ? 27.087  43.199  36.547   1.00 197.83 ? 69   PHE D CD1 1 
ATOM   10088 C CD2 . PHE D 1 14  ? 24.889  42.373  36.145   1.00 189.89 ? 69   PHE D CD2 1 
ATOM   10089 C CE1 . PHE D 1 14  ? 26.641  43.843  37.686   1.00 195.29 ? 69   PHE D CE1 1 
ATOM   10090 C CE2 . PHE D 1 14  ? 24.436  43.014  37.282   1.00 188.72 ? 69   PHE D CE2 1 
ATOM   10091 C CZ  . PHE D 1 14  ? 25.313  43.750  38.053   1.00 187.54 ? 69   PHE D CZ  1 
ATOM   10092 N N   . ILE D 1 15  ? 25.417  39.230  35.160   1.00 181.07 ? 70   ILE D N   1 
ATOM   10093 C CA  . ILE D 1 15  ? 24.504  38.329  35.850   1.00 175.90 ? 70   ILE D CA  1 
ATOM   10094 C C   . ILE D 1 15  ? 25.173  36.992  36.179   1.00 177.55 ? 70   ILE D C   1 
ATOM   10095 O O   . ILE D 1 15  ? 24.927  36.409  37.236   1.00 173.19 ? 70   ILE D O   1 
ATOM   10096 C CB  . ILE D 1 15  ? 23.232  38.078  35.020   1.00 173.51 ? 70   ILE D CB  1 
ATOM   10097 N N   . ALA D 1 16  ? 26.027  36.519  35.276   1.00 177.95 ? 71   ALA D N   1 
ATOM   10098 C CA  . ALA D 1 16  ? 26.743  35.261  35.479   1.00 171.96 ? 71   ALA D CA  1 
ATOM   10099 C C   . ALA D 1 16  ? 27.615  35.315  36.731   1.00 165.26 ? 71   ALA D C   1 
ATOM   10100 O O   . ALA D 1 16  ? 27.505  34.464  37.625   1.00 159.39 ? 71   ALA D O   1 
ATOM   10101 C CB  . ALA D 1 16  ? 27.585  34.928  34.257   1.00 175.44 ? 71   ALA D CB  1 
ATOM   10102 N N   . PHE D 1 17  ? 28.486  36.317  36.793   1.00 168.68 ? 72   PHE D N   1 
ATOM   10103 C CA  . PHE D 1 17  ? 29.300  36.508  37.985   1.00 168.53 ? 72   PHE D CA  1 
ATOM   10104 C C   . PHE D 1 17  ? 28.387  36.556  39.204   1.00 161.63 ? 72   PHE D C   1 
ATOM   10105 O O   . PHE D 1 17  ? 28.719  36.019  40.265   1.00 161.25 ? 72   PHE D O   1 
ATOM   10106 C CB  . PHE D 1 17  ? 30.134  37.785  37.885   1.00 174.39 ? 72   PHE D CB  1 
ATOM   10107 N N   . LEU D 1 18  ? 27.225  37.187  39.047   1.00 161.63 ? 73   LEU D N   1 
ATOM   10108 C CA  . LEU D 1 18  ? 26.245  37.224  40.132   1.00 154.21 ? 73   LEU D CA  1 
ATOM   10109 C C   . LEU D 1 18  ? 25.868  35.816  40.608   1.00 148.88 ? 73   LEU D C   1 
ATOM   10110 O O   . LEU D 1 18  ? 25.847  35.539  41.816   1.00 147.49 ? 73   LEU D O   1 
ATOM   10111 C CB  . LEU D 1 18  ? 24.996  38.000  39.712   1.00 156.38 ? 73   LEU D CB  1 
ATOM   10112 N N   . THR D 1 19  ? 25.575  34.927  39.661   1.00 150.50 ? 74   THR D N   1 
ATOM   10113 C CA  . THR D 1 19  ? 25.234  33.546  40.000   1.00 149.68 ? 74   THR D CA  1 
ATOM   10114 C C   . THR D 1 19  ? 26.400  32.861  40.705   1.00 147.63 ? 74   THR D C   1 
ATOM   10115 O O   . THR D 1 19  ? 26.201  32.022  41.591   1.00 141.63 ? 74   THR D O   1 
ATOM   10116 C CB  . THR D 1 19  ? 24.834  32.719  38.762   1.00 143.05 ? 74   THR D CB  1 
ATOM   10117 O OG1 . THR D 1 19  ? 26.008  32.333  38.036   1.00 146.06 ? 74   THR D OG1 1 
ATOM   10118 C CG2 . THR D 1 19  ? 23.913  33.521  37.858   1.00 152.47 ? 74   THR D CG2 1 
ATOM   10119 N N   . GLY D 1 20  ? 27.618  33.215  40.305   1.00 148.62 ? 75   GLY D N   1 
ATOM   10120 C CA  . GLY D 1 20  ? 28.792  32.742  41.017   1.00 143.12 ? 75   GLY D CA  1 
ATOM   10121 C C   . GLY D 1 20  ? 28.698  33.131  42.482   1.00 137.45 ? 75   GLY D C   1 
ATOM   10122 O O   . GLY D 1 20  ? 28.803  32.286  43.376   1.00 128.01 ? 75   GLY D O   1 
ATOM   10123 N N   . PHE D 1 21  ? 28.479  34.421  42.719   1.00 139.45 ? 76   PHE D N   1 
ATOM   10124 C CA  . PHE D 1 21  ? 28.288  34.951  44.069   1.00 131.36 ? 76   PHE D CA  1 
ATOM   10125 C C   . PHE D 1 21  ? 27.284  34.099  44.847   1.00 129.03 ? 76   PHE D C   1 
ATOM   10126 O O   . PHE D 1 21  ? 27.546  33.672  45.984   1.00 124.23 ? 76   PHE D O   1 
ATOM   10127 C CB  . PHE D 1 21  ? 27.824  36.408  43.976   1.00 130.41 ? 76   PHE D CB  1 
ATOM   10128 C CG  . PHE D 1 21  ? 27.052  36.888  45.168   1.00 132.53 ? 76   PHE D CG  1 
ATOM   10129 C CD1 . PHE D 1 21  ? 27.708  37.286  46.319   1.00 140.43 ? 76   PHE D CD1 1 
ATOM   10130 C CD2 . PHE D 1 21  ? 25.670  36.967  45.127   1.00 129.94 ? 76   PHE D CD2 1 
ATOM   10131 C CE1 . PHE D 1 21  ? 26.997  37.739  47.417   1.00 145.07 ? 76   PHE D CE1 1 
ATOM   10132 C CE2 . PHE D 1 21  ? 24.954  37.419  46.219   1.00 130.67 ? 76   PHE D CE2 1 
ATOM   10133 C CZ  . PHE D 1 21  ? 25.618  37.806  47.366   1.00 133.85 ? 76   PHE D CZ  1 
ATOM   10134 N N   . LEU D 1 22  ? 26.150  33.819  44.210   1.00 128.98 ? 77   LEU D N   1 
ATOM   10135 C CA  . LEU D 1 22  ? 25.125  32.979  44.820   1.00 120.56 ? 77   LEU D CA  1 
ATOM   10136 C C   . LEU D 1 22  ? 25.687  31.617  45.238   1.00 114.13 ? 77   LEU D C   1 
ATOM   10137 O O   . LEU D 1 22  ? 25.591  31.232  46.407   1.00 111.07 ? 77   LEU D O   1 
ATOM   10138 C CB  . LEU D 1 22  ? 23.957  32.784  43.854   1.00 119.99 ? 77   LEU D CB  1 
ATOM   10139 C CG  . LEU D 1 22  ? 22.770  31.971  44.368   1.00 114.19 ? 77   LEU D CG  1 
ATOM   10140 C CD1 . LEU D 1 22  ? 22.114  32.673  45.547   1.00 112.74 ? 77   LEU D CD1 1 
ATOM   10141 C CD2 . LEU D 1 22  ? 21.767  31.737  43.254   1.00 110.51 ? 77   LEU D CD2 1 
ATOM   10142 N N   . ALA D 1 23  ? 26.270  30.894  44.283   1.00 115.06 ? 78   ALA D N   1 
ATOM   10143 C CA  . ALA D 1 23  ? 26.803  29.556  44.545   1.00 112.41 ? 78   ALA D CA  1 
ATOM   10144 C C   . ALA D 1 23  ? 27.787  29.553  45.711   1.00 105.18 ? 78   ALA D C   1 
ATOM   10145 O O   . ALA D 1 23  ? 27.766  28.656  46.565   1.00 101.25 ? 78   ALA D O   1 
ATOM   10146 C CB  . ALA D 1 23  ? 27.460  28.996  43.294   1.00 112.56 ? 78   ALA D CB  1 
ATOM   10147 N N   . LEU D 1 24  ? 28.649  30.564  45.734   1.00 107.07 ? 79   LEU D N   1 
ATOM   10148 C CA  . LEU D 1 24  ? 29.593  30.740  46.829   1.00 109.78 ? 79   LEU D CA  1 
ATOM   10149 C C   . LEU D 1 24  ? 28.854  30.841  48.162   1.00 110.06 ? 79   LEU D C   1 
ATOM   10150 O O   . LEU D 1 24  ? 29.128  30.082  49.097   1.00 101.64 ? 79   LEU D O   1 
ATOM   10151 C CB  . LEU D 1 24  ? 30.448  31.990  46.598   1.00 110.87 ? 79   LEU D CB  1 
ATOM   10152 C CG  . LEU D 1 24  ? 31.519  32.320  47.641   1.00 105.74 ? 79   LEU D CG  1 
ATOM   10153 C CD1 . LEU D 1 24  ? 32.481  31.155  47.820   1.00 100.51 ? 79   LEU D CD1 1 
ATOM   10154 C CD2 . LEU D 1 24  ? 32.266  33.586  47.248   1.00 98.99  ? 79   LEU D CD2 1 
ATOM   10155 N N   . VAL D 1 25  ? 27.911  31.776  48.246   1.00 110.91 ? 80   VAL D N   1 
ATOM   10156 C CA  . VAL D 1 25  ? 27.136  31.930  49.475   1.00 102.44 ? 80   VAL D CA  1 
ATOM   10157 C C   . VAL D 1 25  ? 26.498  30.605  49.914   1.00 98.35  ? 80   VAL D C   1 
ATOM   10158 O O   . VAL D 1 25  ? 26.499  30.269  51.100   1.00 96.40  ? 80   VAL D O   1 
ATOM   10159 C CB  . VAL D 1 25  ? 26.064  33.027  49.338   1.00 102.22 ? 80   VAL D CB  1 
ATOM   10160 C CG1 . VAL D 1 25  ? 25.099  32.975  50.507   1.00 105.67 ? 80   VAL D CG1 1 
ATOM   10161 C CG2 . VAL D 1 25  ? 26.725  34.394  49.244   1.00 95.72  ? 80   VAL D CG2 1 
ATOM   10162 N N   . THR D 1 26  ? 25.972  29.848  48.954   1.00 101.11 ? 81   THR D N   1 
ATOM   10163 C CA  . THR D 1 26  ? 25.377  28.545  49.249   1.00 98.55  ? 81   THR D CA  1 
ATOM   10164 C C   . THR D 1 26  ? 26.382  27.590  49.893   1.00 95.22  ? 81   THR D C   1 
ATOM   10165 O O   . THR D 1 26  ? 26.172  27.114  51.016   1.00 96.02  ? 81   THR D O   1 
ATOM   10166 C CB  . THR D 1 26  ? 24.814  27.875  47.977   1.00 100.39 ? 81   THR D CB  1 
ATOM   10167 O OG1 . THR D 1 26  ? 23.805  28.711  47.397   1.00 105.83 ? 81   THR D OG1 1 
ATOM   10168 C CG2 . THR D 1 26  ? 24.210  26.517  48.306   1.00 90.03  ? 81   THR D CG2 1 
ATOM   10169 N N   . ILE D 1 27  ? 27.479  27.319  49.190   1.00 93.31  ? 82   ILE D N   1 
ATOM   10170 C CA  . ILE D 1 27  ? 28.483  26.394  49.713   1.00 89.85  ? 82   ILE D CA  1 
ATOM   10171 C C   . ILE D 1 27  ? 29.013  26.827  51.086   1.00 96.03  ? 82   ILE D C   1 
ATOM   10172 O O   . ILE D 1 27  ? 29.106  26.009  52.005   1.00 93.06  ? 82   ILE D O   1 
ATOM   10173 C CB  . ILE D 1 27  ? 29.660  26.186  48.735   1.00 84.19  ? 82   ILE D CB  1 
ATOM   10174 C CG1 . ILE D 1 27  ? 30.343  27.513  48.418   1.00 87.44  ? 82   ILE D CG1 1 
ATOM   10175 C CG2 . ILE D 1 27  ? 29.184  25.535  47.453   1.00 90.71  ? 82   ILE D CG2 1 
ATOM   10176 C CD1 . ILE D 1 27  ? 31.393  27.411  47.345   1.00 88.78  ? 82   ILE D CD1 1 
ATOM   10177 N N   . ILE D 1 28  ? 29.344  28.110  51.229   1.00 98.15  ? 83   ILE D N   1 
ATOM   10178 C CA  . ILE D 1 28  ? 29.897  28.612  52.489   1.00 89.18  ? 83   ILE D CA  1 
ATOM   10179 C C   . ILE D 1 28  ? 28.896  28.485  53.637   1.00 85.01  ? 83   ILE D C   1 
ATOM   10180 O O   . ILE D 1 28  ? 29.255  28.093  54.747   1.00 76.34  ? 83   ILE D O   1 
ATOM   10181 C CB  . ILE D 1 28  ? 30.403  30.077  52.381   1.00 93.87  ? 83   ILE D CB  1 
ATOM   10182 C CG1 . ILE D 1 28  ? 29.250  31.046  52.103   1.00 97.31  ? 83   ILE D CG1 1 
ATOM   10183 C CG2 . ILE D 1 28  ? 31.480  30.191  51.315   1.00 94.08  ? 83   ILE D CG2 1 
ATOM   10184 C CD1 . ILE D 1 28  ? 29.660  32.509  52.120   1.00 91.73  ? 83   ILE D CD1 1 
ATOM   10185 N N   . GLY D 1 29  ? 27.642  28.830  53.370   1.00 89.56  ? 84   GLY D N   1 
ATOM   10186 C CA  . GLY D 1 29  ? 26.597  28.656  54.357   1.00 87.00  ? 84   GLY D CA  1 
ATOM   10187 C C   . GLY D 1 29  ? 26.529  27.208  54.802   1.00 93.39  ? 84   GLY D C   1 
ATOM   10188 O O   . GLY D 1 29  ? 26.634  26.907  55.994   1.00 101.46 ? 84   GLY D O   1 
ATOM   10189 N N   . ASN D 1 30  ? 26.363  26.303  53.841   1.00 90.97  ? 85   ASN D N   1 
ATOM   10190 C CA  . ASN D 1 30  ? 26.246  24.880  54.158   1.00 89.47  ? 85   ASN D CA  1 
ATOM   10191 C C   . ASN D 1 30  ? 27.434  24.329  54.961   1.00 86.40  ? 85   ASN D C   1 
ATOM   10192 O O   . ASN D 1 30  ? 27.254  23.551  55.912   1.00 78.30  ? 85   ASN D O   1 
ATOM   10193 C CB  . ASN D 1 30  ? 26.017  24.066  52.882   1.00 85.82  ? 85   ASN D CB  1 
ATOM   10194 C CG  . ASN D 1 30  ? 24.683  24.375  52.228   1.00 77.67  ? 85   ASN D CG  1 
ATOM   10195 O OD1 . ASN D 1 30  ? 23.645  24.402  52.886   1.00 73.03  ? 85   ASN D OD1 1 
ATOM   10196 N ND2 . ASN D 1 30  ? 24.708  24.616  50.926   1.00 84.42  ? 85   ASN D ND2 1 
ATOM   10197 N N   . ILE D 1 31  ? 28.643  24.743  54.589   1.00 88.94  ? 86   ILE D N   1 
ATOM   10198 C CA  . ILE D 1 31  ? 29.835  24.341  55.332   1.00 92.02  ? 86   ILE D CA  1 
ATOM   10199 C C   . ILE D 1 31  ? 29.770  24.876  56.765   1.00 89.40  ? 86   ILE D C   1 
ATOM   10200 O O   . ILE D 1 31  ? 30.040  24.148  57.724   1.00 82.36  ? 86   ILE D O   1 
ATOM   10201 C CB  . ILE D 1 31  ? 31.154  24.770  54.624   1.00 92.44  ? 86   ILE D CB  1 
ATOM   10202 C CG1 . ILE D 1 31  ? 32.373  24.350  55.446   1.00 91.50  ? 86   ILE D CG1 1 
ATOM   10203 C CG2 . ILE D 1 31  ? 31.198  26.260  54.375   1.00 85.48  ? 86   ILE D CG2 1 
ATOM   10204 C CD1 . ILE D 1 31  ? 32.548  22.855  55.549   1.00 90.66  ? 86   ILE D CD1 1 
ATOM   10205 N N   . LEU D 1 32  ? 29.385  26.142  56.908   1.00 88.88  ? 87   LEU D N   1 
ATOM   10206 C CA  . LEU D 1 32  ? 29.153  26.706  58.229   1.00 87.15  ? 87   LEU D CA  1 
ATOM   10207 C C   . LEU D 1 32  ? 28.278  25.760  59.028   1.00 86.68  ? 87   LEU D C   1 
ATOM   10208 O O   . LEU D 1 32  ? 28.600  25.416  60.160   1.00 84.22  ? 87   LEU D O   1 
ATOM   10209 C CB  . LEU D 1 32  ? 28.440  28.050  58.119   1.00 85.26  ? 87   LEU D CB  1 
ATOM   10210 C CG  . LEU D 1 32  ? 29.291  29.313  58.130   1.00 85.88  ? 87   LEU D CG  1 
ATOM   10211 C CD1 . LEU D 1 32  ? 28.382  30.524  58.102   1.00 83.15  ? 87   LEU D CD1 1 
ATOM   10212 C CD2 . LEU D 1 32  ? 30.179  29.331  59.361   1.00 94.20  ? 87   LEU D CD2 1 
ATOM   10213 N N   . VAL D 1 33  ? 27.165  25.346  58.429   1.00 91.18  ? 88   VAL D N   1 
ATOM   10214 C CA  . VAL D 1 33  ? 26.218  24.462  59.100   1.00 83.60  ? 88   VAL D CA  1 
ATOM   10215 C C   . VAL D 1 33  ? 26.897  23.183  59.581   1.00 83.78  ? 88   VAL D C   1 
ATOM   10216 O O   . VAL D 1 33  ? 26.876  22.862  60.777   1.00 84.74  ? 88   VAL D O   1 
ATOM   10217 C CB  . VAL D 1 33  ? 25.046  24.086  58.172   1.00 79.52  ? 88   VAL D CB  1 
ATOM   10218 C CG1 . VAL D 1 33  ? 24.122  23.104  58.864   1.00 79.82  ? 88   VAL D CG1 1 
ATOM   10219 C CG2 . VAL D 1 33  ? 24.284  25.327  57.748   1.00 77.07  ? 88   VAL D CG2 1 
ATOM   10220 N N   . ILE D 1 34  ? 27.511  22.464  58.647   1.00 83.27  ? 89   ILE D N   1 
ATOM   10221 C CA  . ILE D 1 34  ? 28.150  21.192  58.974   1.00 85.50  ? 89   ILE D CA  1 
ATOM   10222 C C   . ILE D 1 34  ? 29.174  21.327  60.108   1.00 93.56  ? 89   ILE D C   1 
ATOM   10223 O O   . ILE D 1 34  ? 29.101  20.615  61.122   1.00 89.68  ? 89   ILE D O   1 
ATOM   10224 C CB  . ILE D 1 34  ? 28.836  20.579  57.742   1.00 85.21  ? 89   ILE D CB  1 
ATOM   10225 C CG1 . ILE D 1 34  ? 27.858  20.522  56.562   1.00 84.08  ? 89   ILE D CG1 1 
ATOM   10226 C CG2 . ILE D 1 34  ? 29.386  19.199  58.078   1.00 87.35  ? 89   ILE D CG2 1 
ATOM   10227 C CD1 . ILE D 1 34  ? 28.443  19.941  55.296   1.00 73.22  ? 89   ILE D CD1 1 
ATOM   10228 N N   . VAL D 1 35  ? 30.125  22.241  59.920   1.00 98.03  ? 90   VAL D N   1 
ATOM   10229 C CA  . VAL D 1 35  ? 31.150  22.546  60.922   1.00 91.60  ? 90   VAL D CA  1 
ATOM   10230 C C   . VAL D 1 35  ? 30.545  22.858  62.287   1.00 92.25  ? 90   VAL D C   1 
ATOM   10231 O O   . VAL D 1 35  ? 30.816  22.173  63.274   1.00 91.05  ? 90   VAL D O   1 
ATOM   10232 C CB  . VAL D 1 35  ? 32.023  23.740  60.493   1.00 85.46  ? 90   VAL D CB  1 
ATOM   10233 C CG1 . VAL D 1 35  ? 32.995  24.109  61.601   1.00 87.99  ? 90   VAL D CG1 1 
ATOM   10234 C CG2 . VAL D 1 35  ? 32.769  23.421  59.212   1.00 84.78  ? 90   VAL D CG2 1 
ATOM   10235 N N   . ALA D 1 36  ? 29.746  23.919  62.335   1.00 94.73  ? 91   ALA D N   1 
ATOM   10236 C CA  . ALA D 1 36  ? 29.105  24.362  63.566   1.00 95.37  ? 91   ALA D CA  1 
ATOM   10237 C C   . ALA D 1 36  ? 28.438  23.206  64.302   1.00 91.32  ? 91   ALA D C   1 
ATOM   10238 O O   . ALA D 1 36  ? 28.553  23.092  65.524   1.00 89.05  ? 91   ALA D O   1 
ATOM   10239 C CB  . ALA D 1 36  ? 28.091  25.462  63.266   1.00 90.23  ? 91   ALA D CB  1 
ATOM   10240 N N   . PHE D 1 37  ? 27.740  22.349  63.564   1.00 91.47  ? 92   PHE D N   1 
ATOM   10241 C CA  . PHE D 1 37  ? 27.133  21.185  64.198   1.00 95.95  ? 92   PHE D CA  1 
ATOM   10242 C C   . PHE D 1 37  ? 28.190  20.271  64.800   1.00 100.05 ? 92   PHE D C   1 
ATOM   10243 O O   . PHE D 1 37  ? 28.189  20.017  66.002   1.00 99.54  ? 92   PHE D O   1 
ATOM   10244 C CB  . PHE D 1 37  ? 26.293  20.380  63.206   1.00 97.24  ? 92   PHE D CB  1 
ATOM   10245 C CG  . PHE D 1 37  ? 25.714  19.114  63.792   1.00 94.36  ? 92   PHE D CG  1 
ATOM   10246 C CD1 . PHE D 1 37  ? 26.497  17.979  63.958   1.00 94.20  ? 92   PHE D CD1 1 
ATOM   10247 C CD2 . PHE D 1 37  ? 24.387  19.062  64.176   1.00 89.10  ? 92   PHE D CD2 1 
ATOM   10248 C CE1 . PHE D 1 37  ? 25.966  16.824  64.495   1.00 89.08  ? 92   PHE D CE1 1 
ATOM   10249 C CE2 . PHE D 1 37  ? 23.853  17.908  64.712   1.00 89.92  ? 92   PHE D CE2 1 
ATOM   10250 C CZ  . PHE D 1 37  ? 24.643  16.790  64.871   1.00 90.22  ? 92   PHE D CZ  1 
ATOM   10251 N N   . LYS D 1 38  ? 29.095  19.775  63.963   1.00 101.11 ? 93   LYS D N   1 
ATOM   10252 C CA  . LYS D 1 38  ? 30.029  18.757  64.426   1.00 99.91  ? 93   LYS D CA  1 
ATOM   10253 C C   . LYS D 1 38  ? 30.840  19.247  65.626   1.00 101.92 ? 93   LYS D C   1 
ATOM   10254 O O   . LYS D 1 38  ? 31.135  18.473  66.541   1.00 94.60  ? 93   LYS D O   1 
ATOM   10255 C CB  . LYS D 1 38  ? 30.946  18.290  63.289   1.00 86.95  ? 93   LYS D CB  1 
ATOM   10256 N N   . VAL D 1 39  ? 31.172  20.537  65.629   1.00 104.01 ? 94   VAL D N   1 
ATOM   10257 C CA  . VAL D 1 39  ? 32.096  21.100  66.613   1.00 104.61 ? 94   VAL D CA  1 
ATOM   10258 C C   . VAL D 1 39  ? 31.408  21.591  67.889   1.00 106.75 ? 94   VAL D C   1 
ATOM   10259 O O   . VAL D 1 39  ? 32.075  21.958  68.858   1.00 109.80 ? 94   VAL D O   1 
ATOM   10260 C CB  . VAL D 1 39  ? 32.920  22.259  66.007   1.00 102.18 ? 94   VAL D CB  1 
ATOM   10261 C CG1 . VAL D 1 39  ? 32.097  23.542  65.969   1.00 97.97  ? 94   VAL D CG1 1 
ATOM   10262 C CG2 . VAL D 1 39  ? 34.205  22.472  66.796   1.00 108.16 ? 94   VAL D CG2 1 
ATOM   10263 N N   . ASN D 1 40  ? 30.079  21.599  67.890   1.00 104.26 ? 95   ASN D N   1 
ATOM   10264 C CA  . ASN D 1 40  ? 29.329  22.026  69.065   1.00 96.19  ? 95   ASN D CA  1 
ATOM   10265 C C   . ASN D 1 40  ? 28.292  20.982  69.479   1.00 99.74  ? 95   ASN D C   1 
ATOM   10266 O O   . ASN D 1 40  ? 27.382  20.658  68.716   1.00 101.21 ? 95   ASN D O   1 
ATOM   10267 C CB  . ASN D 1 40  ? 28.661  23.376  68.810   1.00 88.70  ? 95   ASN D CB  1 
ATOM   10268 C CG  . ASN D 1 40  ? 28.139  24.012  70.077   1.00 86.85  ? 95   ASN D CG  1 
ATOM   10269 O OD1 . ASN D 1 40  ? 27.755  23.322  71.018   1.00 88.79  ? 95   ASN D OD1 1 
ATOM   10270 N ND2 . ASN D 1 40  ? 28.122  25.336  70.109   1.00 82.10  ? 95   ASN D ND2 1 
ATOM   10271 N N   . LYS D 1 41  ? 28.440  20.456  70.690   1.00 96.64  ? 96   LYS D N   1 
ATOM   10272 C CA  . LYS D 1 41  ? 27.568  19.397  71.182   1.00 94.17  ? 96   LYS D CA  1 
ATOM   10273 C C   . LYS D 1 41  ? 26.155  19.905  71.415   1.00 89.46  ? 96   LYS D C   1 
ATOM   10274 O O   . LYS D 1 41  ? 25.185  19.175  71.230   1.00 91.36  ? 96   LYS D O   1 
ATOM   10275 C CB  . LYS D 1 41  ? 28.129  18.800  72.473   1.00 98.65  ? 96   LYS D CB  1 
ATOM   10276 C CG  . LYS D 1 41  ? 27.302  17.654  73.034   1.00 100.53 ? 96   LYS D CG  1 
ATOM   10277 C CD  . LYS D 1 41  ? 27.243  16.492  72.056   1.00 97.36  ? 96   LYS D CD  1 
ATOM   10278 C CE  . LYS D 1 41  ? 26.329  15.388  72.561   1.00 94.88  ? 96   LYS D CE  1 
ATOM   10279 N NZ  . LYS D 1 41  ? 26.234  14.272  71.579   1.00 91.05  ? 96   LYS D NZ  1 
ATOM   10280 N N   . GLN D 1 42  ? 26.043  21.162  71.824   1.00 88.23  ? 97   GLN D N   1 
ATOM   10281 C CA  . GLN D 1 42  ? 24.737  21.768  72.018   1.00 93.80  ? 97   GLN D CA  1 
ATOM   10282 C C   . GLN D 1 42  ? 23.902  21.519  70.780   1.00 95.14  ? 97   GLN D C   1 
ATOM   10283 O O   . GLN D 1 42  ? 22.699  21.292  70.865   1.00 99.25  ? 97   GLN D O   1 
ATOM   10284 C CB  . GLN D 1 42  ? 24.863  23.277  72.238   1.00 104.06 ? 97   GLN D CB  1 
ATOM   10285 C CG  . GLN D 1 42  ? 25.371  23.686  73.611   1.00 111.45 ? 97   GLN D CG  1 
ATOM   10286 C CD  . GLN D 1 42  ? 25.228  25.180  73.858   1.00 111.87 ? 97   GLN D CD  1 
ATOM   10287 O OE1 . GLN D 1 42  ? 25.494  25.670  74.956   1.00 118.08 ? 97   GLN D OE1 1 
ATOM   10288 N NE2 . GLN D 1 42  ? 24.803  25.912  72.832   1.00 103.57 ? 97   GLN D NE2 1 
ATOM   10289 N N   . LEU D 1 43  ? 24.557  21.558  69.625   1.00 95.56  ? 98   LEU D N   1 
ATOM   10290 C CA  . LEU D 1 43  ? 23.866  21.487  68.347   1.00 95.02  ? 98   LEU D CA  1 
ATOM   10291 C C   . LEU D 1 43  ? 23.557  20.064  67.900   1.00 91.13  ? 98   LEU D C   1 
ATOM   10292 O O   . LEU D 1 43  ? 22.867  19.864  66.904   1.00 89.75  ? 98   LEU D O   1 
ATOM   10293 C CB  . LEU D 1 43  ? 24.687  22.194  67.268   1.00 100.17 ? 98   LEU D CB  1 
ATOM   10294 C CG  . LEU D 1 43  ? 24.930  23.685  67.492   1.00 98.76  ? 98   LEU D CG  1 
ATOM   10295 C CD1 . LEU D 1 43  ? 25.916  24.225  66.467   1.00 93.16  ? 98   LEU D CD1 1 
ATOM   10296 C CD2 . LEU D 1 43  ? 23.611  24.440  67.438   1.00 94.39  ? 98   LEU D CD2 1 
ATOM   10297 N N   . LYS D 1 44  ? 24.042  19.072  68.636   1.00 89.19  ? 99   LYS D N   1 
ATOM   10298 C CA  . LYS D 1 44  ? 23.846  17.702  68.194   1.00 88.93  ? 99   LYS D CA  1 
ATOM   10299 C C   . LYS D 1 44  ? 22.558  17.133  68.765   1.00 88.78  ? 99   LYS D C   1 
ATOM   10300 O O   . LYS D 1 44  ? 22.453  16.858  69.960   1.00 88.64  ? 99   LYS D O   1 
ATOM   10301 C CB  . LYS D 1 44  ? 25.036  16.828  68.592   1.00 89.57  ? 99   LYS D CB  1 
ATOM   10302 C CG  . LYS D 1 44  ? 26.328  17.198  67.894   1.00 92.03  ? 99   LYS D CG  1 
ATOM   10303 C CD  . LYS D 1 44  ? 27.444  16.250  68.279   1.00 95.49  ? 99   LYS D CD  1 
ATOM   10304 C CE  . LYS D 1 44  ? 28.705  16.551  67.496   1.00 95.35  ? 99   LYS D CE  1 
ATOM   10305 N NZ  . LYS D 1 44  ? 29.812  15.657  67.912   1.00 99.24  ? 99   LYS D NZ  1 
ATOM   10306 N N   . THR D 1 45  ? 21.586  16.945  67.877   1.00 88.42  ? 100  THR D N   1 
ATOM   10307 C CA  . THR D 1 45  ? 20.298  16.363  68.222   1.00 85.02  ? 100  THR D CA  1 
ATOM   10308 C C   . THR D 1 45  ? 19.771  15.659  66.993   1.00 82.31  ? 100  THR D C   1 
ATOM   10309 O O   . THR D 1 45  ? 20.204  15.945  65.877   1.00 87.31  ? 100  THR D O   1 
ATOM   10310 C CB  . THR D 1 45  ? 19.259  17.428  68.595   1.00 86.20  ? 100  THR D CB  1 
ATOM   10311 O OG1 . THR D 1 45  ? 19.910  18.566  69.170   1.00 87.48  ? 100  THR D OG1 1 
ATOM   10312 C CG2 . THR D 1 45  ? 18.244  16.855  69.576   1.00 92.65  ? 100  THR D CG2 1 
ATOM   10313 N N   . VAL D 1 46  ? 18.830  14.747  67.187   1.00 69.64  ? 101  VAL D N   1 
ATOM   10314 C CA  . VAL D 1 46  ? 18.227  14.080  66.052   1.00 76.81  ? 101  VAL D CA  1 
ATOM   10315 C C   . VAL D 1 46  ? 17.807  15.128  65.017   1.00 87.08  ? 101  VAL D C   1 
ATOM   10316 O O   . VAL D 1 46  ? 18.103  14.997  63.814   1.00 84.66  ? 101  VAL D O   1 
ATOM   10317 C CB  . VAL D 1 46  ? 17.017  13.252  66.483   1.00 71.06  ? 101  VAL D CB  1 
ATOM   10318 C CG1 . VAL D 1 46  ? 16.382  12.582  65.274   1.00 69.51  ? 101  VAL D CG1 1 
ATOM   10319 C CG2 . VAL D 1 46  ? 17.430  12.225  67.526   1.00 63.70  ? 101  VAL D CG2 1 
ATOM   10320 N N   . ASN D 1 47  ? 17.145  16.182  65.495   1.00 84.70  ? 102  ASN D N   1 
ATOM   10321 C CA  . ASN D 1 47  ? 16.654  17.238  64.614   1.00 82.05  ? 102  ASN D CA  1 
ATOM   10322 C C   . ASN D 1 47  ? 17.786  17.854  63.804   1.00 82.91  ? 102  ASN D C   1 
ATOM   10323 O O   . ASN D 1 47  ? 17.796  17.802  62.565   1.00 84.44  ? 102  ASN D O   1 
ATOM   10324 C CB  . ASN D 1 47  ? 15.971  18.349  65.419   1.00 79.97  ? 102  ASN D CB  1 
ATOM   10325 C CG  . ASN D 1 47  ? 15.387  17.860  66.730   1.00 75.80  ? 102  ASN D CG  1 
ATOM   10326 O OD1 . ASN D 1 47  ? 14.204  17.529  66.815   1.00 69.24  ? 102  ASN D OD1 1 
ATOM   10327 N ND2 . ASN D 1 47  ? 16.210  17.835  67.766   1.00 72.76  ? 102  ASN D ND2 1 
ATOM   10328 N N   . ASN D 1 48  ? 18.758  18.418  64.514   1.00 79.52  ? 103  ASN D N   1 
ATOM   10329 C CA  . ASN D 1 48  ? 19.870  19.082  63.857   1.00 74.67  ? 103  ASN D CA  1 
ATOM   10330 C C   . ASN D 1 48  ? 20.686  18.085  63.051   1.00 73.18  ? 103  ASN D C   1 
ATOM   10331 O O   . ASN D 1 48  ? 21.446  18.465  62.166   1.00 75.15  ? 103  ASN D O   1 
ATOM   10332 C CB  . ASN D 1 48  ? 20.736  19.821  64.874   1.00 74.01  ? 103  ASN D CB  1 
ATOM   10333 C CG  . ASN D 1 48  ? 19.961  20.886  65.629   1.00 81.46  ? 103  ASN D CG  1 
ATOM   10334 O OD1 . ASN D 1 48  ? 19.214  21.669  65.036   1.00 76.19  ? 103  ASN D OD1 1 
ATOM   10335 N ND2 . ASN D 1 48  ? 20.124  20.913  66.946   1.00 85.80  ? 103  ASN D ND2 1 
ATOM   10336 N N   . TYR D 1 49  ? 20.513  16.802  63.344   1.00 77.23  ? 104  TYR D N   1 
ATOM   10337 C CA  . TYR D 1 49  ? 21.158  15.772  62.546   1.00 83.68  ? 104  TYR D CA  1 
ATOM   10338 C C   . TYR D 1 49  ? 20.522  15.794  61.165   1.00 82.47  ? 104  TYR D C   1 
ATOM   10339 O O   . TYR D 1 49  ? 21.213  15.847  60.136   1.00 85.31  ? 104  TYR D O   1 
ATOM   10340 C CB  . TYR D 1 49  ? 21.001  14.392  63.185   1.00 80.88  ? 104  TYR D CB  1 
ATOM   10341 C CG  . TYR D 1 49  ? 22.106  13.440  62.803   1.00 77.68  ? 104  TYR D CG  1 
ATOM   10342 C CD1 . TYR D 1 49  ? 22.201  12.938  61.511   1.00 81.96  ? 104  TYR D CD1 1 
ATOM   10343 C CD2 . TYR D 1 49  ? 23.062  13.051  63.731   1.00 82.92  ? 104  TYR D CD2 1 
ATOM   10344 C CE1 . TYR D 1 49  ? 23.216  12.072  61.151   1.00 92.42  ? 104  TYR D CE1 1 
ATOM   10345 C CE2 . TYR D 1 49  ? 24.081  12.181  63.385   1.00 98.35  ? 104  TYR D CE2 1 
ATOM   10346 C CZ  . TYR D 1 49  ? 24.154  11.694  62.092   1.00 107.23 ? 104  TYR D CZ  1 
ATOM   10347 O OH  . TYR D 1 49  ? 25.169  10.827  61.741   1.00 109.76 ? 104  TYR D OH  1 
ATOM   10348 N N   . PHE D 1 50  ? 19.194  15.762  61.144   1.00 78.78  ? 105  PHE D N   1 
ATOM   10349 C CA  . PHE D 1 50  ? 18.477  15.855  59.878   1.00 78.94  ? 105  PHE D CA  1 
ATOM   10350 C C   . PHE D 1 50  ? 18.837  17.141  59.128   1.00 75.80  ? 105  PHE D C   1 
ATOM   10351 O O   . PHE D 1 50  ? 19.017  17.131  57.900   1.00 76.42  ? 105  PHE D O   1 
ATOM   10352 C CB  . PHE D 1 50  ? 16.970  15.736  60.108   1.00 80.69  ? 105  PHE D CB  1 
ATOM   10353 C CG  . PHE D 1 50  ? 16.547  14.388  60.628   1.00 77.70  ? 105  PHE D CG  1 
ATOM   10354 C CD1 . PHE D 1 50  ? 17.276  13.253  60.315   1.00 72.63  ? 105  PHE D CD1 1 
ATOM   10355 C CD2 . PHE D 1 50  ? 15.433  14.255  61.436   1.00 77.01  ? 105  PHE D CD2 1 
ATOM   10356 C CE1 . PHE D 1 50  ? 16.899  12.015  60.789   1.00 66.74  ? 105  PHE D CE1 1 
ATOM   10357 C CE2 . PHE D 1 50  ? 15.055  13.014  61.915   1.00 72.98  ? 105  PHE D CE2 1 
ATOM   10358 C CZ  . PHE D 1 50  ? 15.790  11.894  61.589   1.00 71.01  ? 105  PHE D CZ  1 
ATOM   10359 N N   . LEU D 1 51  ? 18.966  18.240  59.868   1.00 75.67  ? 106  LEU D N   1 
ATOM   10360 C CA  . LEU D 1 51  ? 19.355  19.512  59.254   1.00 76.25  ? 106  LEU D CA  1 
ATOM   10361 C C   . LEU D 1 51  ? 20.797  19.471  58.717   1.00 77.96  ? 106  LEU D C   1 
ATOM   10362 O O   . LEU D 1 51  ? 21.164  20.237  57.815   1.00 74.81  ? 106  LEU D O   1 
ATOM   10363 C CB  . LEU D 1 51  ? 19.151  20.677  60.231   1.00 66.53  ? 106  LEU D CB  1 
ATOM   10364 C CG  . LEU D 1 51  ? 17.713  20.824  60.740   1.00 65.78  ? 106  LEU D CG  1 
ATOM   10365 C CD1 . LEU D 1 51  ? 17.581  21.904  61.802   1.00 73.42  ? 106  LEU D CD1 1 
ATOM   10366 C CD2 . LEU D 1 51  ? 16.764  21.088  59.585   1.00 72.48  ? 106  LEU D CD2 1 
ATOM   10367 N N   . LEU D 1 52  ? 21.602  18.565  59.269   1.00 77.33  ? 107  LEU D N   1 
ATOM   10368 C CA  . LEU D 1 52  ? 22.959  18.328  58.786   1.00 72.43  ? 107  LEU D CA  1 
ATOM   10369 C C   . LEU D 1 52  ? 22.894  17.572  57.463   1.00 77.29  ? 107  LEU D C   1 
ATOM   10370 O O   . LEU D 1 52  ? 23.645  17.861  56.527   1.00 80.15  ? 107  LEU D O   1 
ATOM   10371 C CB  . LEU D 1 52  ? 23.763  17.532  59.818   1.00 75.89  ? 107  LEU D CB  1 
ATOM   10372 C CG  . LEU D 1 52  ? 25.284  17.407  59.649   1.00 80.22  ? 107  LEU D CG  1 
ATOM   10373 C CD1 . LEU D 1 52  ? 25.898  16.746  60.876   1.00 86.13  ? 107  LEU D CD1 1 
ATOM   10374 C CD2 . LEU D 1 52  ? 25.668  16.645  58.388   1.00 71.74  ? 107  LEU D CD2 1 
ATOM   10375 N N   . SER D 1 53  ? 21.993  16.599  57.388   1.00 77.08  ? 108  SER D N   1 
ATOM   10376 C CA  . SER D 1 53  ? 21.741  15.920  56.123   1.00 76.59  ? 108  SER D CA  1 
ATOM   10377 C C   . SER D 1 53  ? 21.371  16.931  55.042   1.00 76.85  ? 108  SER D C   1 
ATOM   10378 O O   . SER D 1 53  ? 21.978  16.957  53.963   1.00 80.30  ? 108  SER D O   1 
ATOM   10379 C CB  . SER D 1 53  ? 20.617  14.904  56.270   1.00 77.20  ? 108  SER D CB  1 
ATOM   10380 O OG  . SER D 1 53  ? 20.271  14.359  55.011   1.00 81.37  ? 108  SER D OG  1 
ATOM   10381 N N   . LEU D 1 54  ? 20.368  17.759  55.330   1.00 74.81  ? 109  LEU D N   1 
ATOM   10382 C CA  . LEU D 1 54  ? 19.980  18.807  54.385   1.00 78.67  ? 109  LEU D CA  1 
ATOM   10383 C C   . LEU D 1 54  ? 21.170  19.682  53.991   1.00 82.23  ? 109  LEU D C   1 
ATOM   10384 O O   . LEU D 1 54  ? 21.377  19.958  52.811   1.00 84.14  ? 109  LEU D O   1 
ATOM   10385 C CB  . LEU D 1 54  ? 18.839  19.673  54.931   1.00 81.56  ? 109  LEU D CB  1 
ATOM   10386 C CG  . LEU D 1 54  ? 17.413  19.217  54.614   1.00 82.82  ? 109  LEU D CG  1 
ATOM   10387 C CD1 . LEU D 1 54  ? 17.034  18.028  55.476   1.00 78.02  ? 109  LEU D CD1 1 
ATOM   10388 C CD2 . LEU D 1 54  ? 16.429  20.358  54.820   1.00 78.05  ? 109  LEU D CD2 1 
ATOM   10389 N N   . ALA D 1 55  ? 21.949  20.117  54.979   1.00 79.51  ? 110  ALA D N   1 
ATOM   10390 C CA  . ALA D 1 55  ? 23.159  20.883  54.697   1.00 75.55  ? 110  ALA D CA  1 
ATOM   10391 C C   . ALA D 1 55  ? 24.072  20.142  53.720   1.00 75.87  ? 110  ALA D C   1 
ATOM   10392 O O   . ALA D 1 55  ? 24.748  20.764  52.905   1.00 77.69  ? 110  ALA D O   1 
ATOM   10393 C CB  . ALA D 1 55  ? 23.900  21.203  55.980   1.00 76.58  ? 110  ALA D CB  1 
ATOM   10394 N N   . CYS D 1 56  ? 24.089  18.813  53.808   1.00 75.62  ? 111  CYS D N   1 
ATOM   10395 C CA  . CYS D 1 56  ? 24.870  17.981  52.891   1.00 80.96  ? 111  CYS D CA  1 
ATOM   10396 C C   . CYS D 1 56  ? 24.333  18.048  51.464   1.00 80.65  ? 111  CYS D C   1 
ATOM   10397 O O   . CYS D 1 56  ? 25.081  18.314  50.514   1.00 78.11  ? 111  CYS D O   1 
ATOM   10398 C CB  . CYS D 1 56  ? 24.876  16.522  53.355   1.00 78.66  ? 111  CYS D CB  1 
ATOM   10399 S SG  . CYS D 1 56  ? 25.870  16.198  54.813   1.00 76.30  ? 111  CYS D SG  1 
ATOM   10400 N N   . ALA D 1 57  ? 23.037  17.784  51.320   1.00 77.07  ? 112  ALA D N   1 
ATOM   10401 C CA  . ALA D 1 57  ? 22.388  17.837  50.016   1.00 72.66  ? 112  ALA D CA  1 
ATOM   10402 C C   . ALA D 1 57  ? 22.623  19.196  49.364   1.00 84.62  ? 112  ALA D C   1 
ATOM   10403 O O   . ALA D 1 57  ? 22.896  19.295  48.163   1.00 91.16  ? 112  ALA D O   1 
ATOM   10404 C CB  . ALA D 1 57  ? 20.903  17.575  50.166   1.00 66.50  ? 112  ALA D CB  1 
ATOM   10405 N N   . ASP D 1 58  ? 22.524  20.242  50.177   1.00 83.34  ? 113  ASP D N   1 
ATOM   10406 C CA  . ASP D 1 58  ? 22.671  21.615  49.715   1.00 81.74  ? 113  ASP D CA  1 
ATOM   10407 C C   . ASP D 1 58  ? 24.109  21.970  49.359   1.00 87.15  ? 113  ASP D C   1 
ATOM   10408 O O   . ASP D 1 58  ? 24.356  22.725  48.420   1.00 93.95  ? 113  ASP D O   1 
ATOM   10409 C CB  . ASP D 1 58  ? 22.140  22.580  50.770   1.00 84.10  ? 113  ASP D CB  1 
ATOM   10410 C CG  . ASP D 1 58  ? 20.633  22.586  50.838   1.00 94.36  ? 113  ASP D CG  1 
ATOM   10411 O OD1 . ASP D 1 58  ? 20.082  23.426  51.581   1.00 102.15 ? 113  ASP D OD1 1 
ATOM   10412 O OD2 . ASP D 1 58  ? 20.005  21.763  50.138   1.00 86.66  ? 113  ASP D OD2 1 
ATOM   10413 N N   . LEU D 1 59  ? 25.058  21.437  50.116   1.00 85.70  ? 114  LEU D N   1 
ATOM   10414 C CA  . LEU D 1 59  ? 26.462  21.670  49.816   1.00 86.04  ? 114  LEU D CA  1 
ATOM   10415 C C   . LEU D 1 59  ? 26.808  21.022  48.478   1.00 84.63  ? 114  LEU D C   1 
ATOM   10416 O O   . LEU D 1 59  ? 27.332  21.681  47.578   1.00 81.77  ? 114  LEU D O   1 
ATOM   10417 C CB  . LEU D 1 59  ? 27.359  21.135  50.940   1.00 86.18  ? 114  LEU D CB  1 
ATOM   10418 C CG  . LEU D 1 59  ? 28.808  21.633  50.984   1.00 79.75  ? 114  LEU D CG  1 
ATOM   10419 C CD1 . LEU D 1 59  ? 29.350  21.614  52.408   1.00 76.96  ? 114  LEU D CD1 1 
ATOM   10420 C CD2 . LEU D 1 59  ? 29.701  20.830  50.048   1.00 73.81  ? 114  LEU D CD2 1 
ATOM   10421 N N   . ILE D 1 60  ? 26.495  19.735  48.341   1.00 90.31  ? 115  ILE D N   1 
ATOM   10422 C CA  . ILE D 1 60  ? 26.784  19.031  47.091   1.00 88.53  ? 115  ILE D CA  1 
ATOM   10423 C C   . ILE D 1 60  ? 26.050  19.651  45.901   1.00 83.21  ? 115  ILE D C   1 
ATOM   10424 O O   . ILE D 1 60  ? 26.577  19.673  44.789   1.00 80.12  ? 115  ILE D O   1 
ATOM   10425 C CB  . ILE D 1 60  ? 26.508  17.497  47.176   1.00 90.19  ? 115  ILE D CB  1 
ATOM   10426 C CG1 . ILE D 1 60  ? 26.684  16.843  45.801   1.00 81.53  ? 115  ILE D CG1 1 
ATOM   10427 C CG2 . ILE D 1 60  ? 25.119  17.215  47.733   1.00 86.14  ? 115  ILE D CG2 1 
ATOM   10428 C CD1 . ILE D 1 60  ? 26.468  15.342  45.797   1.00 75.24  ? 115  ILE D CD1 1 
ATOM   10429 N N   . ILE D 1 61  ? 24.845  20.165  46.135   1.00 82.17  ? 116  ILE D N   1 
ATOM   10430 C CA  . ILE D 1 61  ? 24.088  20.809  45.064   1.00 79.15  ? 116  ILE D CA  1 
ATOM   10431 C C   . ILE D 1 61  ? 24.694  22.163  44.698   1.00 86.18  ? 116  ILE D C   1 
ATOM   10432 O O   . ILE D 1 61  ? 24.611  22.599  43.549   1.00 89.97  ? 116  ILE D O   1 
ATOM   10433 C CB  . ILE D 1 61  ? 22.599  20.994  45.435   1.00 78.21  ? 116  ILE D CB  1 
ATOM   10434 C CG1 . ILE D 1 61  ? 21.750  21.199  44.183   1.00 81.77  ? 116  ILE D CG1 1 
ATOM   10435 C CG2 . ILE D 1 61  ? 22.415  22.170  46.364   1.00 83.32  ? 116  ILE D CG2 1 
ATOM   10436 C CD1 . ILE D 1 61  ? 20.287  21.475  44.484   1.00 83.50  ? 116  ILE D CD1 1 
ATOM   10437 N N   . GLY D 1 62  ? 25.290  22.828  45.684   1.00 90.63  ? 117  GLY D N   1 
ATOM   10438 C CA  . GLY D 1 62  ? 25.882  24.141  45.488   1.00 95.23  ? 117  GLY D CA  1 
ATOM   10439 C C   . GLY D 1 62  ? 27.237  24.146  44.804   1.00 92.13  ? 117  GLY D C   1 
ATOM   10440 O O   . GLY D 1 62  ? 27.480  24.933  43.885   1.00 86.82  ? 117  GLY D O   1 
ATOM   10441 N N   . VAL D 1 63  ? 28.123  23.265  45.260   1.00 93.95  ? 118  VAL D N   1 
ATOM   10442 C CA  . VAL D 1 63  ? 29.487  23.196  44.740   1.00 96.16  ? 118  VAL D CA  1 
ATOM   10443 C C   . VAL D 1 63  ? 29.508  22.700  43.298   1.00 97.13  ? 118  VAL D C   1 
ATOM   10444 O O   . VAL D 1 63  ? 30.404  23.045  42.527   1.00 96.37  ? 118  VAL D O   1 
ATOM   10445 C CB  . VAL D 1 63  ? 30.382  22.268  45.599   1.00 86.57  ? 118  VAL D CB  1 
ATOM   10446 C CG1 . VAL D 1 63  ? 29.946  20.816  45.449   1.00 80.48  ? 118  VAL D CG1 1 
ATOM   10447 C CG2 . VAL D 1 63  ? 31.842  22.426  45.212   1.00 75.35  ? 118  VAL D CG2 1 
ATOM   10448 N N   . ILE D 1 64  ? 28.520  21.887  42.938   1.00 93.72  ? 119  ILE D N   1 
ATOM   10449 C CA  . ILE D 1 64  ? 28.498  21.259  41.623   1.00 86.54  ? 119  ILE D CA  1 
ATOM   10450 C C   . ILE D 1 64  ? 27.425  21.832  40.704   1.00 82.88  ? 119  ILE D C   1 
ATOM   10451 O O   . ILE D 1 64  ? 27.731  22.570  39.770   1.00 87.90  ? 119  ILE D O   1 
ATOM   10452 C CB  . ILE D 1 64  ? 28.304  19.738  41.734   1.00 82.97  ? 119  ILE D CB  1 
ATOM   10453 C CG1 . ILE D 1 64  ? 29.484  19.102  42.475   1.00 80.69  ? 119  ILE D CG1 1 
ATOM   10454 C CG2 . ILE D 1 64  ? 28.151  19.127  40.358   1.00 81.41  ? 119  ILE D CG2 1 
ATOM   10455 C CD1 . ILE D 1 64  ? 29.381  17.596  42.608   1.00 83.79  ? 119  ILE D CD1 1 
ATOM   10456 N N   . SER D 1 65  ? 26.170  21.498  40.978   1.00 75.65  ? 120  SER D N   1 
ATOM   10457 C CA  . SER D 1 65  ? 25.073  21.820  40.071   1.00 79.24  ? 120  SER D CA  1 
ATOM   10458 C C   . SER D 1 65  ? 24.951  23.305  39.690   1.00 88.44  ? 120  SER D C   1 
ATOM   10459 O O   . SER D 1 65  ? 24.906  23.639  38.505   1.00 97.30  ? 120  SER D O   1 
ATOM   10460 C CB  . SER D 1 65  ? 23.753  21.272  40.616   1.00 77.07  ? 120  SER D CB  1 
ATOM   10461 O OG  . SER D 1 65  ? 23.781  19.855  40.648   1.00 69.80  ? 120  SER D OG  1 
ATOM   10462 N N   . MET D 1 66  ? 24.904  24.190  40.682   1.00 87.55  ? 121  MET D N   1 
ATOM   10463 C CA  . MET D 1 66  ? 24.765  25.623  40.422   1.00 88.92  ? 121  MET D CA  1 
ATOM   10464 C C   . MET D 1 66  ? 25.766  26.097  39.374   1.00 87.64  ? 121  MET D C   1 
ATOM   10465 O O   . MET D 1 66  ? 25.425  26.811  38.429   1.00 93.09  ? 121  MET D O   1 
ATOM   10466 C CB  . MET D 1 66  ? 24.985  26.424  41.706   1.00 93.28  ? 121  MET D CB  1 
ATOM   10467 C CG  . MET D 1 66  ? 24.174  25.955  42.901   1.00 97.49  ? 121  MET D CG  1 
ATOM   10468 S SD  . MET D 1 66  ? 24.367  27.028  44.342   1.00 112.97 ? 121  MET D SD  1 
ATOM   10469 C CE  . MET D 1 66  ? 23.506  28.499  43.797   1.00 97.78  ? 121  MET D CE  1 
ATOM   10470 N N   . ASN D 1 67  ? 27.006  25.661  39.541   1.00 84.83  ? 122  ASN D N   1 
ATOM   10471 C CA  . ASN D 1 67  ? 28.120  26.155  38.749   1.00 89.57  ? 122  ASN D CA  1 
ATOM   10472 C C   . ASN D 1 67  ? 28.109  25.622  37.323   1.00 96.14  ? 122  ASN D C   1 
ATOM   10473 O O   . ASN D 1 67  ? 28.049  26.393  36.363   1.00 101.93 ? 122  ASN D O   1 
ATOM   10474 C CB  . ASN D 1 67  ? 29.433  25.804  39.440   1.00 97.39  ? 122  ASN D CB  1 
ATOM   10475 C CG  . ASN D 1 67  ? 29.437  26.204  40.899   1.00 92.22  ? 122  ASN D CG  1 
ATOM   10476 O OD1 . ASN D 1 67  ? 28.790  27.179  41.285   1.00 89.97  ? 122  ASN D OD1 1 
ATOM   10477 N ND2 . ASN D 1 67  ? 30.157  25.450  41.720   1.00 84.82  ? 122  ASN D ND2 1 
ATOM   10478 N N   . LEU D 1 68  ? 28.205  24.303  37.189   1.00 92.36  ? 123  LEU D N   1 
ATOM   10479 C CA  . LEU D 1 68  ? 28.140  23.667  35.879   1.00 98.16  ? 123  LEU D CA  1 
ATOM   10480 C C   . LEU D 1 68  ? 26.914  24.138  35.102   1.00 101.03 ? 123  LEU D C   1 
ATOM   10481 O O   . LEU D 1 68  ? 26.964  24.297  33.880   1.00 103.17 ? 123  LEU D O   1 
ATOM   10482 C CB  . LEU D 1 68  ? 28.125  22.144  36.014   1.00 94.79  ? 123  LEU D CB  1 
ATOM   10483 C CG  . LEU D 1 68  ? 29.468  21.489  36.347   1.00 97.00  ? 123  LEU D CG  1 
ATOM   10484 C CD1 . LEU D 1 68  ? 30.019  22.000  37.672   1.00 100.61 ? 123  LEU D CD1 1 
ATOM   10485 C CD2 . LEU D 1 68  ? 29.332  19.975  36.369   1.00 93.21  ? 123  LEU D CD2 1 
ATOM   10486 N N   . PHE D 1 69  ? 25.814  24.365  35.815   1.00 96.17  ? 124  PHE D N   1 
ATOM   10487 C CA  . PHE D 1 69  ? 24.621  24.920  35.194   1.00 95.10  ? 124  PHE D CA  1 
ATOM   10488 C C   . PHE D 1 69  ? 24.943  26.302  34.650   1.00 103.16 ? 124  PHE D C   1 
ATOM   10489 O O   . PHE D 1 69  ? 24.684  26.597  33.481   1.00 112.77 ? 124  PHE D O   1 
ATOM   10490 C CB  . PHE D 1 69  ? 23.480  25.007  36.204   1.00 99.33  ? 124  PHE D CB  1 
ATOM   10491 N N   . THR D 1 70  ? 25.521  27.142  35.506   1.00 102.37 ? 125  THR D N   1 
ATOM   10492 C CA  . THR D 1 70  ? 25.916  28.494  35.112   1.00 112.42 ? 125  THR D CA  1 
ATOM   10493 C C   . THR D 1 70  ? 26.743  28.518  33.822   1.00 121.23 ? 125  THR D C   1 
ATOM   10494 O O   . THR D 1 70  ? 26.522  29.358  32.942   1.00 120.16 ? 125  THR D O   1 
ATOM   10495 C CB  . THR D 1 70  ? 26.706  29.192  36.226   1.00 112.38 ? 125  THR D CB  1 
ATOM   10496 O OG1 . THR D 1 70  ? 25.858  29.376  37.366   1.00 120.27 ? 125  THR D OG1 1 
ATOM   10497 C CG2 . THR D 1 70  ? 27.209  30.544  35.750   1.00 116.18 ? 125  THR D CG2 1 
ATOM   10498 N N   . THR D 1 71  ? 27.698  27.597  33.715   1.00 122.61 ? 126  THR D N   1 
ATOM   10499 C CA  . THR D 1 71  ? 28.520  27.489  32.509   1.00 117.66 ? 126  THR D CA  1 
ATOM   10500 C C   . THR D 1 71  ? 27.705  27.023  31.295   1.00 114.07 ? 126  THR D C   1 
ATOM   10501 O O   . THR D 1 71  ? 27.775  27.629  30.221   1.00 114.07 ? 126  THR D O   1 
ATOM   10502 C CB  . THR D 1 71  ? 29.716  26.543  32.722   1.00 108.49 ? 126  THR D CB  1 
ATOM   10503 N N   . TYR D 1 72  ? 26.939  25.947  31.472   1.00 106.85 ? 127  TYR D N   1 
ATOM   10504 C CA  . TYR D 1 72  ? 26.082  25.424  30.409   1.00 102.77 ? 127  TYR D CA  1 
ATOM   10505 C C   . TYR D 1 72  ? 25.224  26.531  29.811   1.00 106.97 ? 127  TYR D C   1 
ATOM   10506 O O   . TYR D 1 72  ? 25.022  26.582  28.596   1.00 108.11 ? 127  TYR D O   1 
ATOM   10507 C CB  . TYR D 1 72  ? 25.195  24.294  30.937   1.00 102.76 ? 127  TYR D CB  1 
ATOM   10508 C CG  . TYR D 1 72  ? 24.079  23.879  29.999   1.00 104.94 ? 127  TYR D CG  1 
ATOM   10509 C CD1 . TYR D 1 72  ? 24.209  22.768  29.174   1.00 102.56 ? 127  TYR D CD1 1 
ATOM   10510 C CD2 . TYR D 1 72  ? 22.888  24.595  29.946   1.00 108.16 ? 127  TYR D CD2 1 
ATOM   10511 C CE1 . TYR D 1 72  ? 23.185  22.386  28.322   1.00 105.15 ? 127  TYR D CE1 1 
ATOM   10512 C CE2 . TYR D 1 72  ? 21.862  24.221  29.096   1.00 103.49 ? 127  TYR D CE2 1 
ATOM   10513 C CZ  . TYR D 1 72  ? 22.014  23.117  28.287   1.00 102.56 ? 127  TYR D CZ  1 
ATOM   10514 O OH  . TYR D 1 72  ? 20.991  22.744  27.443   1.00 92.58  ? 127  TYR D OH  1 
ATOM   10515 N N   . ILE D 1 73  ? 24.715  27.410  30.672   1.00 106.54 ? 128  ILE D N   1 
ATOM   10516 C CA  . ILE D 1 73  ? 23.980  28.586  30.217   1.00 109.16 ? 128  ILE D CA  1 
ATOM   10517 C C   . ILE D 1 73  ? 24.912  29.535  29.470   1.00 112.66 ? 128  ILE D C   1 
ATOM   10518 O O   . ILE D 1 73  ? 24.614  29.967  28.355   1.00 112.17 ? 128  ILE D O   1 
ATOM   10519 C CB  . ILE D 1 73  ? 23.333  29.350  31.389   1.00 105.59 ? 128  ILE D CB  1 
ATOM   10520 C CG1 . ILE D 1 73  ? 22.314  28.471  32.117   1.00 109.13 ? 128  ILE D CG1 1 
ATOM   10521 C CG2 . ILE D 1 73  ? 22.671  30.623  30.887   1.00 108.58 ? 128  ILE D CG2 1 
ATOM   10522 C CD1 . ILE D 1 73  ? 21.646  29.157  33.293   1.00 112.70 ? 128  ILE D CD1 1 
ATOM   10523 N N   . ILE D 1 74  ? 26.047  29.848  30.091   1.00 108.49 ? 129  ILE D N   1 
ATOM   10524 C CA  . ILE D 1 74  ? 27.025  30.752  29.495   1.00 107.71 ? 129  ILE D CA  1 
ATOM   10525 C C   . ILE D 1 74  ? 27.315  30.416  28.030   1.00 105.31 ? 129  ILE D C   1 
ATOM   10526 O O   . ILE D 1 74  ? 26.990  31.191  27.128   1.00 94.64  ? 129  ILE D O   1 
ATOM   10527 C CB  . ILE D 1 74  ? 28.345  30.744  30.288   1.00 102.58 ? 129  ILE D CB  1 
ATOM   10528 N N   . MET D 1 75  ? 27.922  29.256  27.800   1.00 108.10 ? 130  MET D N   1 
ATOM   10529 C CA  . MET D 1 75  ? 28.318  28.851  26.454   1.00 113.89 ? 130  MET D CA  1 
ATOM   10530 C C   . MET D 1 75  ? 27.137  28.714  25.502   1.00 115.72 ? 130  MET D C   1 
ATOM   10531 O O   . MET D 1 75  ? 27.319  28.675  24.284   1.00 118.18 ? 130  MET D O   1 
ATOM   10532 C CB  . MET D 1 75  ? 29.069  27.519  26.494   1.00 121.81 ? 130  MET D CB  1 
ATOM   10533 C CG  . MET D 1 75  ? 30.269  27.498  27.412   1.00 127.63 ? 130  MET D CG  1 
ATOM   10534 S SD  . MET D 1 75  ? 31.198  25.968  27.223   1.00 147.88 ? 130  MET D SD  1 
ATOM   10535 C CE  . MET D 1 75  ? 31.884  26.200  25.589   1.00 238.30 ? 130  MET D CE  1 
ATOM   10536 N N   . ASN D 1 76  ? 25.932  28.627  26.061   1.00 114.92 ? 131  ASN D N   1 
ATOM   10537 C CA  . ASN D 1 76  ? 24.734  28.359  25.270   1.00 110.28 ? 131  ASN D CA  1 
ATOM   10538 C C   . ASN D 1 76  ? 24.742  26.933  24.720   1.00 106.04 ? 131  ASN D C   1 
ATOM   10539 O O   . ASN D 1 76  ? 23.799  26.504  24.056   1.00 103.26 ? 131  ASN D O   1 
ATOM   10540 C CB  . ASN D 1 76  ? 24.571  29.392  24.152   1.00 110.74 ? 131  ASN D CB  1 
ATOM   10541 C CG  . ASN D 1 76  ? 24.411  30.805  24.686   1.00 111.52 ? 131  ASN D CG  1 
ATOM   10542 O OD1 . ASN D 1 76  ? 25.269  31.666  24.479   1.00 114.82 ? 131  ASN D OD1 1 
ATOM   10543 N ND2 . ASN D 1 76  ? 23.309  31.048  25.384   1.00 107.91 ? 131  ASN D ND2 1 
ATOM   10544 N N   . ARG D 1 77  ? 25.825  26.213  24.997   1.00 103.39 ? 132  ARG D N   1 
ATOM   10545 C CA  . ARG D 1 77  ? 25.955  24.812  24.618   1.00 110.06 ? 132  ARG D CA  1 
ATOM   10546 C C   . ARG D 1 77  ? 26.633  24.012  25.731   1.00 113.19 ? 132  ARG D C   1 
ATOM   10547 O O   . ARG D 1 77  ? 27.138  24.585  26.697   1.00 109.28 ? 132  ARG D O   1 
ATOM   10548 C CB  . ARG D 1 77  ? 26.749  24.679  23.319   1.00 117.43 ? 132  ARG D CB  1 
ATOM   10549 C CG  . ARG D 1 77  ? 28.247  24.875  23.489   1.00 122.20 ? 132  ARG D CG  1 
ATOM   10550 C CD  . ARG D 1 77  ? 28.983  24.678  22.172   1.00 122.38 ? 132  ARG D CD  1 
ATOM   10551 N NE  . ARG D 1 77  ? 30.406  24.430  22.376   1.00 116.57 ? 132  ARG D NE  1 
ATOM   10552 C CZ  . ARG D 1 77  ? 31.305  25.382  22.597   1.00 116.64 ? 132  ARG D CZ  1 
ATOM   10553 N NH1 . ARG D 1 77  ? 30.927  26.651  22.652   1.00 121.35 ? 132  ARG D NH1 1 
ATOM   10554 N NH2 . ARG D 1 77  ? 32.580  25.064  22.770   1.00 118.29 ? 132  ARG D NH2 1 
ATOM   10555 N N   . TRP D 1 78  ? 26.624  22.688  25.593   1.00 114.71 ? 133  TRP D N   1 
ATOM   10556 C CA  . TRP D 1 78  ? 27.313  21.799  26.529   1.00 117.52 ? 133  TRP D CA  1 
ATOM   10557 C C   . TRP D 1 78  ? 28.643  21.337  25.933   1.00 119.42 ? 133  TRP D C   1 
ATOM   10558 O O   . TRP D 1 78  ? 28.661  20.585  24.960   1.00 123.28 ? 133  TRP D O   1 
ATOM   10559 C CB  . TRP D 1 78  ? 26.429  20.589  26.846   1.00 117.57 ? 133  TRP D CB  1 
ATOM   10560 C CG  . TRP D 1 78  ? 27.011  19.623  27.846   1.00 113.23 ? 133  TRP D CG  1 
ATOM   10561 C CD1 . TRP D 1 78  ? 27.623  18.431  27.578   1.00 109.44 ? 133  TRP D CD1 1 
ATOM   10562 C CD2 . TRP D 1 78  ? 27.019  19.765  29.271   1.00 109.89 ? 133  TRP D CD2 1 
ATOM   10563 N NE1 . TRP D 1 78  ? 28.016  17.826  28.748   1.00 109.66 ? 133  TRP D NE1 1 
ATOM   10564 C CE2 . TRP D 1 78  ? 27.656  18.625  29.802   1.00 109.50 ? 133  TRP D CE2 1 
ATOM   10565 C CE3 . TRP D 1 78  ? 26.552  20.746  30.151   1.00 104.46 ? 133  TRP D CE3 1 
ATOM   10566 C CZ2 . TRP D 1 78  ? 27.840  18.443  31.169   1.00 102.34 ? 133  TRP D CZ2 1 
ATOM   10567 C CZ3 . TRP D 1 78  ? 26.735  20.562  31.507   1.00 97.63  ? 133  TRP D CZ3 1 
ATOM   10568 C CH2 . TRP D 1 78  ? 27.372  19.420  32.003   1.00 94.50  ? 133  TRP D CH2 1 
ATOM   10569 N N   . ALA D 1 79  ? 29.752  21.797  26.509   1.00 118.44 ? 134  ALA D N   1 
ATOM   10570 C CA  . ALA D 1 79  ? 31.082  21.512  25.961   1.00 124.87 ? 134  ALA D CA  1 
ATOM   10571 C C   . ALA D 1 79  ? 31.851  20.356  26.618   1.00 126.51 ? 134  ALA D C   1 
ATOM   10572 O O   . ALA D 1 79  ? 32.993  20.082  26.240   1.00 134.53 ? 134  ALA D O   1 
ATOM   10573 C CB  . ALA D 1 79  ? 31.937  22.777  25.954   1.00 129.09 ? 134  ALA D CB  1 
ATOM   10574 N N   . LEU D 1 80  ? 31.247  19.689  27.599   1.00 114.86 ? 135  LEU D N   1 
ATOM   10575 C CA  . LEU D 1 80  ? 31.962  18.648  28.342   1.00 110.51 ? 135  LEU D CA  1 
ATOM   10576 C C   . LEU D 1 80  ? 31.741  17.222  27.843   1.00 108.86 ? 135  LEU D C   1 
ATOM   10577 O O   . LEU D 1 80  ? 32.262  16.268  28.423   1.00 101.74 ? 135  LEU D O   1 
ATOM   10578 C CB  . LEU D 1 80  ? 31.668  18.741  29.838   1.00 107.85 ? 135  LEU D CB  1 
ATOM   10579 C CG  . LEU D 1 80  ? 32.747  19.490  30.622   1.00 118.07 ? 135  LEU D CG  1 
ATOM   10580 C CD1 . LEU D 1 80  ? 32.420  19.502  32.102   1.00 119.33 ? 135  LEU D CD1 1 
ATOM   10581 C CD2 . LEU D 1 80  ? 34.116  18.864  30.376   1.00 118.26 ? 135  LEU D CD2 1 
ATOM   10582 N N   . GLY D 1 81  ? 30.976  17.082  26.767   1.00 117.80 ? 136  GLY D N   1 
ATOM   10583 C CA  . GLY D 1 81  ? 30.742  15.778  26.172   1.00 124.10 ? 136  GLY D CA  1 
ATOM   10584 C C   . GLY D 1 81  ? 29.510  15.077  26.711   1.00 125.61 ? 136  GLY D C   1 
ATOM   10585 O O   . GLY D 1 81  ? 28.553  15.722  27.141   1.00 122.94 ? 136  GLY D O   1 
ATOM   10586 N N   . ASN D 1 82  ? 29.532  13.749  26.678   1.00 124.16 ? 137  ASN D N   1 
ATOM   10587 C CA  . ASN D 1 82  ? 28.384  12.955  27.100   1.00 119.53 ? 137  ASN D CA  1 
ATOM   10588 C C   . ASN D 1 82  ? 28.419  12.536  28.570   1.00 113.17 ? 137  ASN D C   1 
ATOM   10589 O O   . ASN D 1 82  ? 27.590  12.981  29.362   1.00 115.16 ? 137  ASN D O   1 
ATOM   10590 C CB  . ASN D 1 82  ? 28.215  11.730  26.197   1.00 122.07 ? 137  ASN D CB  1 
ATOM   10591 C CG  . ASN D 1 82  ? 27.965  12.102  24.745   1.00 123.00 ? 137  ASN D CG  1 
ATOM   10592 O OD1 . ASN D 1 82  ? 27.406  13.159  24.447   1.00 114.37 ? 137  ASN D OD1 1 
ATOM   10593 N ND2 . ASN D 1 82  ? 28.379  11.229  23.832   1.00 128.54 ? 137  ASN D ND2 1 
ATOM   10594 N N   . LEU D 1 83  ? 29.377  11.686  28.930   1.00 106.64 ? 138  LEU D N   1 
ATOM   10595 C CA  . LEU D 1 83  ? 29.446  11.137  30.285   1.00 104.20 ? 138  LEU D CA  1 
ATOM   10596 C C   . LEU D 1 83  ? 29.341  12.208  31.372   1.00 107.33 ? 138  LEU D C   1 
ATOM   10597 O O   . LEU D 1 83  ? 28.691  11.997  32.399   1.00 110.48 ? 138  LEU D O   1 
ATOM   10598 C CB  . LEU D 1 83  ? 30.719  10.303  30.469   1.00 105.08 ? 138  LEU D CB  1 
ATOM   10599 C CG  . LEU D 1 83  ? 30.913  9.568   31.800   1.00 95.26  ? 138  LEU D CG  1 
ATOM   10600 C CD1 . LEU D 1 83  ? 31.726  8.295   31.606   1.00 100.70 ? 138  LEU D CD1 1 
ATOM   10601 C CD2 . LEU D 1 83  ? 31.567  10.463  32.840   1.00 91.53  ? 138  LEU D CD2 1 
ATOM   10602 N N   . ALA D 1 84  ? 29.983  13.350  31.142   1.00 106.91 ? 139  ALA D N   1 
ATOM   10603 C CA  . ALA D 1 84  ? 29.985  14.452  32.106   1.00 105.68 ? 139  ALA D CA  1 
ATOM   10604 C C   . ALA D 1 84  ? 28.571  14.950  32.377   1.00 106.45 ? 139  ALA D C   1 
ATOM   10605 O O   . ALA D 1 84  ? 28.177  15.180  33.520   1.00 109.73 ? 139  ALA D O   1 
ATOM   10606 C CB  . ALA D 1 84  ? 30.848  15.590  31.598   1.00 106.83 ? 139  ALA D CB  1 
ATOM   10607 N N   . CYS D 1 85  ? 27.825  15.126  31.298   1.00 100.79 ? 140  CYS D N   1 
ATOM   10608 C CA  . CYS D 1 85  ? 26.433  15.521  31.338   1.00 101.39 ? 140  CYS D CA  1 
ATOM   10609 C C   . CYS D 1 85  ? 25.610  14.528  32.201   1.00 101.04 ? 140  CYS D C   1 
ATOM   10610 O O   . CYS D 1 85  ? 24.831  14.971  33.040   1.00 98.99  ? 140  CYS D O   1 
ATOM   10611 C CB  . CYS D 1 85  ? 25.926  15.663  29.892   1.00 99.94  ? 140  CYS D CB  1 
ATOM   10612 S SG  . CYS D 1 85  ? 24.125  15.585  29.620   1.00 103.69 ? 140  CYS D SG  1 
ATOM   10613 N N   . ASP D 1 86  ? 25.827  13.230  31.991   1.00 104.49 ? 141  ASP D N   1 
ATOM   10614 C CA  . ASP D 1 86  ? 25.151  12.171  32.737   1.00 104.15 ? 141  ASP D CA  1 
ATOM   10615 C C   . ASP D 1 86  ? 25.471  12.228  34.230   1.00 103.08 ? 141  ASP D C   1 
ATOM   10616 O O   . ASP D 1 86  ? 24.578  12.099  35.073   1.00 103.67 ? 141  ASP D O   1 
ATOM   10617 C CB  . ASP D 1 86  ? 25.527  10.800  32.163   1.00 112.48 ? 141  ASP D CB  1 
ATOM   10618 C CG  . ASP D 1 86  ? 25.286  10.711  30.667   1.00 111.43 ? 141  ASP D CG  1 
ATOM   10619 O OD1 . ASP D 1 86  ? 25.978  9.920   29.987   1.00 105.60 ? 141  ASP D OD1 1 
ATOM   10620 O OD2 . ASP D 1 86  ? 24.405  11.446  30.173   1.00 110.08 ? 141  ASP D OD2 1 
ATOM   10621 N N   . LEU D 1 87  ? 26.747  12.422  34.556   1.00 107.07 ? 142  LEU D N   1 
ATOM   10622 C CA  . LEU D 1 87  ? 27.158  12.564  35.953   1.00 103.66 ? 142  LEU D CA  1 
ATOM   10623 C C   . LEU D 1 87  ? 26.531  13.791  36.617   1.00 99.93  ? 142  LEU D C   1 
ATOM   10624 O O   . LEU D 1 87  ? 25.944  13.689  37.693   1.00 96.63  ? 142  LEU D O   1 
ATOM   10625 C CB  . LEU D 1 87  ? 28.684  12.626  36.083   1.00 95.55  ? 142  LEU D CB  1 
ATOM   10626 C CG  . LEU D 1 87  ? 29.465  11.333  35.833   1.00 94.02  ? 142  LEU D CG  1 
ATOM   10627 C CD1 . LEU D 1 87  ? 30.934  11.544  36.150   1.00 91.71  ? 142  LEU D CD1 1 
ATOM   10628 C CD2 . LEU D 1 87  ? 28.893  10.197  36.661   1.00 100.24 ? 142  LEU D CD2 1 
ATOM   10629 N N   . TRP D 1 88  ? 26.661  14.948  35.976   1.00 93.64  ? 143  TRP D N   1 
ATOM   10630 C CA  . TRP D 1 88  ? 26.115  16.174  36.535   1.00 87.17  ? 143  TRP D CA  1 
ATOM   10631 C C   . TRP D 1 88  ? 24.624  16.011  36.809   1.00 93.88  ? 143  TRP D C   1 
ATOM   10632 O O   . TRP D 1 88  ? 24.135  16.385  37.883   1.00 95.47  ? 143  TRP D O   1 
ATOM   10633 C CB  . TRP D 1 88  ? 26.361  17.360  35.604   1.00 87.02  ? 143  TRP D CB  1 
ATOM   10634 C CG  . TRP D 1 88  ? 25.787  18.647  36.128   1.00 95.09  ? 143  TRP D CG  1 
ATOM   10635 C CD1 . TRP D 1 88  ? 26.185  19.330  37.241   1.00 95.28  ? 143  TRP D CD1 1 
ATOM   10636 C CD2 . TRP D 1 88  ? 24.711  19.403  35.558   1.00 91.63  ? 143  TRP D CD2 1 
ATOM   10637 N NE1 . TRP D 1 88  ? 25.422  20.462  37.399   1.00 89.30  ? 143  TRP D NE1 1 
ATOM   10638 C CE2 . TRP D 1 88  ? 24.513  20.530  36.381   1.00 88.71  ? 143  TRP D CE2 1 
ATOM   10639 C CE3 . TRP D 1 88  ? 23.898  19.235  34.436   1.00 91.31  ? 143  TRP D CE3 1 
ATOM   10640 C CZ2 . TRP D 1 88  ? 23.534  21.484  36.112   1.00 93.56  ? 143  TRP D CZ2 1 
ATOM   10641 C CZ3 . TRP D 1 88  ? 22.930  20.183  34.171   1.00 92.27  ? 143  TRP D CZ3 1 
ATOM   10642 C CH2 . TRP D 1 88  ? 22.756  21.294  35.005   1.00 94.18  ? 143  TRP D CH2 1 
ATOM   10643 N N   . LEU D 1 89  ? 23.904  15.445  35.842   1.00 96.05  ? 144  LEU D N   1 
ATOM   10644 C CA  . LEU D 1 89  ? 22.471  15.218  36.027   1.00 100.82 ? 144  LEU D CA  1 
ATOM   10645 C C   . LEU D 1 89  ? 22.148  14.243  37.169   1.00 94.50  ? 144  LEU D C   1 
ATOM   10646 O O   . LEU D 1 89  ? 21.439  14.605  38.107   1.00 84.07  ? 144  LEU D O   1 
ATOM   10647 C CB  . LEU D 1 89  ? 21.809  14.764  34.722   1.00 100.87 ? 144  LEU D CB  1 
ATOM   10648 C CG  . LEU D 1 89  ? 21.778  15.774  33.573   1.00 96.65  ? 144  LEU D CG  1 
ATOM   10649 C CD1 . LEU D 1 89  ? 21.093  15.173  32.356   1.00 98.91  ? 144  LEU D CD1 1 
ATOM   10650 C CD2 . LEU D 1 89  ? 21.097  17.070  33.990   1.00 85.05  ? 144  LEU D CD2 1 
ATOM   10651 N N   . SER D 1 90  ? 22.668  13.018  37.095   1.00 95.49  ? 145  SER D N   1 
ATOM   10652 C CA  . SER D 1 90  ? 22.358  12.001  38.105   1.00 83.33  ? 145  SER D CA  1 
ATOM   10653 C C   . SER D 1 90  ? 22.713  12.477  39.513   1.00 82.23  ? 145  SER D C   1 
ATOM   10654 O O   . SER D 1 90  ? 21.961  12.249  40.465   1.00 78.73  ? 145  SER D O   1 
ATOM   10655 C CB  . SER D 1 90  ? 23.046  10.669  37.783   1.00 80.20  ? 145  SER D CB  1 
ATOM   10656 O OG  . SER D 1 90  ? 24.436  10.841  37.563   1.00 79.74  ? 145  SER D OG  1 
ATOM   10657 N N   . ILE D 1 91  ? 23.863  13.137  39.635   1.00 88.17  ? 146  ILE D N   1 
ATOM   10658 C CA  . ILE D 1 91  ? 24.229  13.842  40.861   1.00 82.49  ? 146  ILE D CA  1 
ATOM   10659 C C   . ILE D 1 91  ? 23.094  14.773  41.270   1.00 76.79  ? 146  ILE D C   1 
ATOM   10660 O O   . ILE D 1 91  ? 22.512  14.629  42.345   1.00 77.08  ? 146  ILE D O   1 
ATOM   10661 C CB  . ILE D 1 91  ? 25.546  14.648  40.704   1.00 79.43  ? 146  ILE D CB  1 
ATOM   10662 C CG1 . ILE D 1 91  ? 26.761  13.749  40.964   1.00 73.32  ? 146  ILE D CG1 1 
ATOM   10663 C CG2 . ILE D 1 91  ? 25.559  15.850  41.638   1.00 68.48  ? 146  ILE D CG2 1 
ATOM   10664 C CD1 . ILE D 1 91  ? 28.092  14.459  40.854   1.00 67.41  ? 146  ILE D CD1 1 
ATOM   10665 N N   . ASP D 1 92  ? 22.786  15.724  40.396   1.00 68.88  ? 147  ASP D N   1 
ATOM   10666 C CA  . ASP D 1 92  ? 21.778  16.736  40.673   1.00 66.58  ? 147  ASP D CA  1 
ATOM   10667 C C   . ASP D 1 92  ? 20.449  16.164  41.186   1.00 72.87  ? 147  ASP D C   1 
ATOM   10668 O O   . ASP D 1 92  ? 19.953  16.567  42.246   1.00 77.18  ? 147  ASP D O   1 
ATOM   10669 C CB  . ASP D 1 92  ? 21.525  17.550  39.411   1.00 73.65  ? 147  ASP D CB  1 
ATOM   10670 C CG  . ASP D 1 92  ? 21.163  18.983  39.711   1.00 83.10  ? 147  ASP D CG  1 
ATOM   10671 O OD1 . ASP D 1 92  ? 21.495  19.861  38.886   1.00 86.33  ? 147  ASP D OD1 1 
ATOM   10672 O OD2 . ASP D 1 92  ? 20.557  19.232  40.773   1.00 78.48  ? 147  ASP D OD2 1 
ATOM   10673 N N   . TYR D 1 93  ? 19.880  15.221  40.438   1.00 76.63  ? 148  TYR D N   1 
ATOM   10674 C CA  . TYR D 1 93  ? 18.560  14.668  40.741   1.00 64.61  ? 148  TYR D CA  1 
ATOM   10675 C C   . TYR D 1 93  ? 18.557  13.739  41.944   1.00 65.05  ? 148  TYR D C   1 
ATOM   10676 O O   . TYR D 1 93  ? 17.650  13.809  42.771   1.00 68.27  ? 148  TYR D O   1 
ATOM   10677 C CB  . TYR D 1 93  ? 17.979  13.953  39.525   1.00 64.70  ? 148  TYR D CB  1 
ATOM   10678 C CG  . TYR D 1 93  ? 17.229  14.871  38.590   1.00 71.05  ? 148  TYR D CG  1 
ATOM   10679 C CD1 . TYR D 1 93  ? 17.903  15.679  37.684   1.00 77.37  ? 148  TYR D CD1 1 
ATOM   10680 C CD2 . TYR D 1 93  ? 15.846  14.932  38.612   1.00 75.45  ? 148  TYR D CD2 1 
ATOM   10681 C CE1 . TYR D 1 93  ? 17.214  16.525  36.823   1.00 76.95  ? 148  TYR D CE1 1 
ATOM   10682 C CE2 . TYR D 1 93  ? 15.148  15.771  37.758   1.00 80.24  ? 148  TYR D CE2 1 
ATOM   10683 C CZ  . TYR D 1 93  ? 15.835  16.565  36.865   1.00 78.12  ? 148  TYR D CZ  1 
ATOM   10684 O OH  . TYR D 1 93  ? 15.139  17.401  36.016   1.00 73.42  ? 148  TYR D OH  1 
ATOM   10685 N N   . VAL D 1 94  ? 19.561  12.870  42.046   1.00 68.69  ? 149  VAL D N   1 
ATOM   10686 C CA  . VAL D 1 94  ? 19.683  12.024  43.231   1.00 67.18  ? 149  VAL D CA  1 
ATOM   10687 C C   . VAL D 1 94  ? 19.740  12.902  44.471   1.00 64.10  ? 149  VAL D C   1 
ATOM   10688 O O   . VAL D 1 94  ? 19.022  12.669  45.444   1.00 60.90  ? 149  VAL D O   1 
ATOM   10689 C CB  . VAL D 1 94  ? 20.938  11.141  43.197   1.00 65.06  ? 149  VAL D CB  1 
ATOM   10690 C CG1 . VAL D 1 94  ? 21.204  10.553  44.577   1.00 57.77  ? 149  VAL D CG1 1 
ATOM   10691 C CG2 . VAL D 1 94  ? 20.788  10.045  42.153   1.00 72.50  ? 149  VAL D CG2 1 
ATOM   10692 N N   . ALA D 1 95  ? 20.596  13.917  44.416   1.00 64.84  ? 150  ALA D N   1 
ATOM   10693 C CA  . ALA D 1 95  ? 20.732  14.872  45.507   1.00 64.57  ? 150  ALA D CA  1 
ATOM   10694 C C   . ALA D 1 95  ? 19.412  15.558  45.865   1.00 63.58  ? 150  ALA D C   1 
ATOM   10695 O O   . ALA D 1 95  ? 18.809  15.238  46.887   1.00 65.10  ? 150  ALA D O   1 
ATOM   10696 C CB  . ALA D 1 95  ? 21.801  15.909  45.175   1.00 60.27  ? 150  ALA D CB  1 
ATOM   10697 N N   . SER D 1 96  ? 18.943  16.470  45.017   1.00 59.32  ? 151  SER D N   1 
ATOM   10698 C CA  . SER D 1 96  ? 17.759  17.252  45.372   1.00 59.57  ? 151  SER D CA  1 
ATOM   10699 C C   . SER D 1 96  ? 16.578  16.342  45.733   1.00 65.82  ? 151  SER D C   1 
ATOM   10700 O O   . SER D 1 96  ? 15.756  16.669  46.606   1.00 73.26  ? 151  SER D O   1 
ATOM   10701 C CB  . SER D 1 96  ? 17.381  18.232  44.264   1.00 56.31  ? 151  SER D CB  1 
ATOM   10702 O OG  . SER D 1 96  ? 16.955  17.540  43.110   1.00 67.46  ? 151  SER D OG  1 
ATOM   10703 N N   . ASN D 1 97  ? 16.506  15.186  45.081   1.00 62.11  ? 152  ASN D N   1 
ATOM   10704 C CA  . ASN D 1 97  ? 15.500  14.199  45.443   1.00 60.43  ? 152  ASN D CA  1 
ATOM   10705 C C   . ASN D 1 97  ? 15.662  13.831  46.906   1.00 64.32  ? 152  ASN D C   1 
ATOM   10706 O O   . ASN D 1 97  ? 14.735  13.976  47.708   1.00 68.05  ? 152  ASN D O   1 
ATOM   10707 C CB  . ASN D 1 97  ? 15.623  12.950  44.573   1.00 64.96  ? 152  ASN D CB  1 
ATOM   10708 C CG  . ASN D 1 97  ? 14.405  12.058  44.664   1.00 68.18  ? 152  ASN D CG  1 
ATOM   10709 O OD1 . ASN D 1 97  ? 13.331  12.406  44.168   1.00 66.48  ? 152  ASN D OD1 1 
ATOM   10710 N ND2 . ASN D 1 97  ? 14.564  10.900  45.296   1.00 66.15  ? 152  ASN D ND2 1 
ATOM   10711 N N   . ALA D 1 98  ? 16.861  13.381  47.259   1.00 63.91  ? 153  ALA D N   1 
ATOM   10712 C CA  . ALA D 1 98  ? 17.161  13.038  48.645   1.00 68.65  ? 153  ALA D CA  1 
ATOM   10713 C C   . ALA D 1 98  ? 16.888  14.220  49.574   1.00 63.77  ? 153  ALA D C   1 
ATOM   10714 O O   . ALA D 1 98  ? 16.707  14.041  50.774   1.00 64.07  ? 153  ALA D O   1 
ATOM   10715 C CB  . ALA D 1 98  ? 18.603  12.570  48.782   1.00 67.98  ? 153  ALA D CB  1 
ATOM   10716 N N   . SER D 1 99  ? 16.866  15.426  49.020   1.00 61.16  ? 154  SER D N   1 
ATOM   10717 C CA  . SER D 1 99  ? 16.515  16.599  49.805   1.00 59.11  ? 154  SER D CA  1 
ATOM   10718 C C   . SER D 1 99  ? 15.035  16.542  50.135   1.00 59.19  ? 154  SER D C   1 
ATOM   10719 O O   . SER D 1 99  ? 14.645  16.685  51.296   1.00 66.11  ? 154  SER D O   1 
ATOM   10720 C CB  . SER D 1 99  ? 16.857  17.891  49.054   1.00 65.46  ? 154  SER D CB  1 
ATOM   10721 O OG  . SER D 1 99  ? 16.469  19.043  49.785   1.00 60.78  ? 154  SER D OG  1 
ATOM   10722 N N   . VAL D 1 100 ? 14.204  16.330  49.120   1.00 57.87  ? 155  VAL D N   1 
ATOM   10723 C CA  . VAL D 1 100 ? 12.771  16.244  49.384   1.00 61.13  ? 155  VAL D CA  1 
ATOM   10724 C C   . VAL D 1 100 ? 12.506  15.137  50.400   1.00 64.74  ? 155  VAL D C   1 
ATOM   10725 O O   . VAL D 1 100 ? 11.821  15.349  51.412   1.00 61.33  ? 155  VAL D O   1 
ATOM   10726 C CB  . VAL D 1 100 ? 11.924  16.032  48.102   1.00 57.75  ? 155  VAL D CB  1 
ATOM   10727 C CG1 . VAL D 1 100 ? 12.367  16.991  47.011   1.00 67.11  ? 155  VAL D CG1 1 
ATOM   10728 C CG2 . VAL D 1 100 ? 12.006  14.594  47.618   1.00 58.84  ? 155  VAL D CG2 1 
ATOM   10729 N N   . MET D 1 101 ? 13.082  13.964  50.143   1.00 64.79  ? 156  MET D N   1 
ATOM   10730 C CA  . MET D 1 101 ? 12.917  12.828  51.045   1.00 67.19  ? 156  MET D CA  1 
ATOM   10731 C C   . MET D 1 101 ? 13.430  13.162  52.445   1.00 73.29  ? 156  MET D C   1 
ATOM   10732 O O   . MET D 1 101 ? 12.951  12.614  53.438   1.00 75.69  ? 156  MET D O   1 
ATOM   10733 C CB  . MET D 1 101 ? 13.618  11.586  50.498   1.00 57.85  ? 156  MET D CB  1 
ATOM   10734 C CG  . MET D 1 101 ? 13.101  11.141  49.151   1.00 68.25  ? 156  MET D CG  1 
ATOM   10735 S SD  . MET D 1 101 ? 13.696  9.501   48.717   1.00 127.17 ? 156  MET D SD  1 
ATOM   10736 C CE  . MET D 1 101 ? 12.709  8.479   49.806   1.00 81.50  ? 156  MET D CE  1 
ATOM   10737 N N   . ASN D 1 102 ? 14.400  14.069  52.515   1.00 73.26  ? 157  ASN D N   1 
ATOM   10738 C CA  . ASN D 1 102 ? 14.928  14.547  53.789   1.00 67.29  ? 157  ASN D CA  1 
ATOM   10739 C C   . ASN D 1 102 ? 13.899  15.380  54.549   1.00 62.68  ? 157  ASN D C   1 
ATOM   10740 O O   . ASN D 1 102 ? 13.718  15.210  55.757   1.00 63.76  ? 157  ASN D O   1 
ATOM   10741 C CB  . ASN D 1 102 ? 16.194  15.369  53.561   1.00 65.82  ? 157  ASN D CB  1 
ATOM   10742 C CG  . ASN D 1 102 ? 17.412  14.756  54.213   1.00 64.44  ? 157  ASN D CG  1 
ATOM   10743 O OD1 . ASN D 1 102 ? 18.078  13.903  53.630   1.00 63.82  ? 157  ASN D OD1 1 
ATOM   10744 N ND2 . ASN D 1 102 ? 17.715  15.193  55.428   1.00 66.85  ? 157  ASN D ND2 1 
ATOM   10745 N N   . LEU D 1 103 ? 13.229  16.282  53.836   1.00 59.12  ? 158  LEU D N   1 
ATOM   10746 C CA  . LEU D 1 103 ? 12.172  17.090  54.436   1.00 60.17  ? 158  LEU D CA  1 
ATOM   10747 C C   . LEU D 1 103 ? 11.026  16.213  54.939   1.00 69.01  ? 158  LEU D C   1 
ATOM   10748 O O   . LEU D 1 103 ? 10.497  16.411  56.052   1.00 68.45  ? 158  LEU D O   1 
ATOM   10749 C CB  . LEU D 1 103 ? 11.669  18.125  53.434   1.00 55.74  ? 158  LEU D CB  1 
ATOM   10750 C CG  . LEU D 1 103 ? 12.446  19.435  53.532   1.00 59.20  ? 158  LEU D CG  1 
ATOM   10751 C CD1 . LEU D 1 103 ? 12.275  20.292  52.286   1.00 66.47  ? 158  LEU D CD1 1 
ATOM   10752 C CD2 . LEU D 1 103 ? 12.022  20.182  54.784   1.00 47.52  ? 158  LEU D CD2 1 
ATOM   10753 N N   . LEU D 1 104 ? 10.653  15.236  54.115   1.00 72.13  ? 159  LEU D N   1 
ATOM   10754 C CA  . LEU D 1 104 ? 9.681   14.227  54.527   1.00 69.97  ? 159  LEU D CA  1 
ATOM   10755 C C   . LEU D 1 104 ? 10.127  13.568  55.834   1.00 64.57  ? 159  LEU D C   1 
ATOM   10756 O O   . LEU D 1 104 ? 9.405   13.595  56.834   1.00 56.87  ? 159  LEU D O   1 
ATOM   10757 C CB  . LEU D 1 104 ? 9.496   13.172  53.431   1.00 67.54  ? 159  LEU D CB  1 
ATOM   10758 C CG  . LEU D 1 104 ? 8.524   13.525  52.306   1.00 55.91  ? 159  LEU D CG  1 
ATOM   10759 C CD1 . LEU D 1 104 ? 8.599   12.514  51.175   1.00 58.99  ? 159  LEU D CD1 1 
ATOM   10760 C CD2 . LEU D 1 104 ? 7.116   13.609  52.860   1.00 51.32  ? 159  LEU D CD2 1 
ATOM   10761 N N   . VAL D 1 105 ? 11.338  13.016  55.824   1.00 61.53  ? 160  VAL D N   1 
ATOM   10762 C CA  . VAL D 1 105 ? 11.889  12.353  56.995   1.00 54.63  ? 160  VAL D CA  1 
ATOM   10763 C C   . VAL D 1 105 ? 11.706  13.227  58.214   1.00 52.77  ? 160  VAL D C   1 
ATOM   10764 O O   . VAL D 1 105 ? 11.166  12.785  59.219   1.00 54.62  ? 160  VAL D O   1 
ATOM   10765 C CB  . VAL D 1 105 ? 13.389  12.104  56.835   1.00 60.34  ? 160  VAL D CB  1 
ATOM   10766 C CG1 . VAL D 1 105 ? 14.014  11.769  58.179   1.00 65.40  ? 160  VAL D CG1 1 
ATOM   10767 C CG2 . VAL D 1 105 ? 13.641  11.001  55.824   1.00 74.36  ? 160  VAL D CG2 1 
ATOM   10768 N N   . ILE D 1 106 ? 12.139  14.478  58.114   1.00 52.18  ? 161  ILE D N   1 
ATOM   10769 C CA  . ILE D 1 106 ? 11.997  15.425  59.216   1.00 58.00  ? 161  ILE D CA  1 
ATOM   10770 C C   . ILE D 1 106 ? 10.556  15.501  59.739   1.00 61.49  ? 161  ILE D C   1 
ATOM   10771 O O   . ILE D 1 106 ? 10.287  15.213  60.921   1.00 61.14  ? 161  ILE D O   1 
ATOM   10772 C CB  . ILE D 1 106 ? 12.504  16.824  58.829   1.00 56.89  ? 161  ILE D CB  1 
ATOM   10773 C CG1 . ILE D 1 106 ? 13.965  16.744  58.384   1.00 62.06  ? 161  ILE D CG1 1 
ATOM   10774 C CG2 . ILE D 1 106 ? 12.364  17.784  59.996   1.00 54.78  ? 161  ILE D CG2 1 
ATOM   10775 C CD1 . ILE D 1 106 ? 14.593  18.079  58.085   1.00 62.63  ? 161  ILE D CD1 1 
ATOM   10776 N N   . SER D 1 107 ? 9.635   15.908  58.867   1.00 57.20  ? 162  SER D N   1 
ATOM   10777 C CA  . SER D 1 107 ? 8.227   16.021  59.254   1.00 53.34  ? 162  SER D CA  1 
ATOM   10778 C C   . SER D 1 107 ? 7.683   14.765  59.947   1.00 59.27  ? 162  SER D C   1 
ATOM   10779 O O   . SER D 1 107 ? 7.056   14.845  61.012   1.00 62.29  ? 162  SER D O   1 
ATOM   10780 C CB  . SER D 1 107 ? 7.374   16.344  58.034   1.00 62.22  ? 162  SER D CB  1 
ATOM   10781 O OG  . SER D 1 107 ? 7.902   17.461  57.347   1.00 69.64  ? 162  SER D OG  1 
ATOM   10782 N N   . PHE D 1 108 ? 7.914   13.607  59.334   1.00 56.22  ? 163  PHE D N   1 
ATOM   10783 C CA  . PHE D 1 108 ? 7.464   12.343  59.904   1.00 51.83  ? 163  PHE D CA  1 
ATOM   10784 C C   . PHE D 1 108 ? 8.083   12.102  61.271   1.00 48.22  ? 163  PHE D C   1 
ATOM   10785 O O   . PHE D 1 108 ? 7.427   11.589  62.170   1.00 48.28  ? 163  PHE D O   1 
ATOM   10786 C CB  . PHE D 1 108 ? 7.786   11.179  58.968   1.00 55.61  ? 163  PHE D CB  1 
ATOM   10787 C CG  . PHE D 1 108 ? 6.620   10.739  58.122   1.00 60.20  ? 163  PHE D CG  1 
ATOM   10788 C CD1 . PHE D 1 108 ? 6.533   11.097  56.787   1.00 65.56  ? 163  PHE D CD1 1 
ATOM   10789 C CD2 . PHE D 1 108 ? 5.613   9.963   58.662   1.00 58.98  ? 163  PHE D CD2 1 
ATOM   10790 C CE1 . PHE D 1 108 ? 5.457   10.687  56.005   1.00 62.78  ? 163  PHE D CE1 1 
ATOM   10791 C CE2 . PHE D 1 108 ? 4.537   9.550   57.887   1.00 67.80  ? 163  PHE D CE2 1 
ATOM   10792 C CZ  . PHE D 1 108 ? 4.459   9.914   56.557   1.00 60.16  ? 163  PHE D CZ  1 
ATOM   10793 N N   . ASP D 1 109 ? 9.350   12.475  61.417   1.00 48.21  ? 164  ASP D N   1 
ATOM   10794 C CA  . ASP D 1 109 ? 10.070  12.347  62.682   1.00 51.19  ? 164  ASP D CA  1 
ATOM   10795 C C   . ASP D 1 109 ? 9.355   13.111  63.785   1.00 57.02  ? 164  ASP D C   1 
ATOM   10796 O O   . ASP D 1 109 ? 8.996   12.543  64.826   1.00 56.41  ? 164  ASP D O   1 
ATOM   10797 C CB  . ASP D 1 109 ? 11.495  12.881  62.530   1.00 53.36  ? 164  ASP D CB  1 
ATOM   10798 C CG  . ASP D 1 109 ? 12.303  12.784  63.813   1.00 57.17  ? 164  ASP D CG  1 
ATOM   10799 O OD1 . ASP D 1 109 ? 13.221  11.944  63.878   1.00 58.48  ? 164  ASP D OD1 1 
ATOM   10800 O OD2 . ASP D 1 109 ? 12.027  13.551  64.756   1.00 59.63  ? 164  ASP D OD2 1 
ATOM   10801 N N   . ARG D 1 110 ? 9.157   14.406  63.557   1.00 54.36  ? 165  ARG D N   1 
ATOM   10802 C CA  . ARG D 1 110 ? 8.394   15.220  64.501   1.00 56.70  ? 165  ARG D CA  1 
ATOM   10803 C C   . ARG D 1 110 ? 7.071   14.522  64.828   1.00 47.65  ? 165  ARG D C   1 
ATOM   10804 O O   . ARG D 1 110 ? 6.718   14.340  65.994   1.00 48.47  ? 165  ARG D O   1 
ATOM   10805 C CB  . ARG D 1 110 ? 8.117   16.616  63.925   1.00 59.84  ? 165  ARG D CB  1 
ATOM   10806 C CG  . ARG D 1 110 ? 9.352   17.454  63.573   1.00 54.02  ? 165  ARG D CG  1 
ATOM   10807 C CD  . ARG D 1 110 ? 9.973   18.122  64.796   1.00 59.93  ? 165  ARG D CD  1 
ATOM   10808 N NE  . ARG D 1 110 ? 11.201  18.845  64.470   1.00 69.39  ? 165  ARG D NE  1 
ATOM   10809 C CZ  . ARG D 1 110 ? 12.328  18.263  64.061   1.00 75.00  ? 165  ARG D CZ  1 
ATOM   10810 N NH1 . ARG D 1 110 ? 12.387  16.947  63.911   1.00 68.35  ? 165  ARG D NH1 1 
ATOM   10811 N NH2 . ARG D 1 110 ? 13.398  18.995  63.790   1.00 82.80  ? 165  ARG D NH2 1 
ATOM   10812 N N   . TYR D 1 111 ? 6.360   14.106  63.785   1.00 44.23  ? 166  TYR D N   1 
ATOM   10813 C CA  . TYR D 1 111 ? 5.016   13.553  63.938   1.00 48.30  ? 166  TYR D CA  1 
ATOM   10814 C C   . TYR D 1 111 ? 4.951   12.293  64.798   1.00 54.58  ? 166  TYR D C   1 
ATOM   10815 O O   . TYR D 1 111 ? 4.058   12.159  65.630   1.00 59.96  ? 166  TYR D O   1 
ATOM   10816 C CB  . TYR D 1 111 ? 4.398   13.272  62.569   1.00 51.34  ? 166  TYR D CB  1 
ATOM   10817 C CG  . TYR D 1 111 ? 2.944   12.836  62.598   1.00 53.24  ? 166  TYR D CG  1 
ATOM   10818 C CD1 . TYR D 1 111 ? 1.917   13.768  62.547   1.00 53.95  ? 166  TYR D CD1 1 
ATOM   10819 C CD2 . TYR D 1 111 ? 2.602   11.492  62.649   1.00 57.77  ? 166  TYR D CD2 1 
ATOM   10820 C CE1 . TYR D 1 111 ? 0.595   13.374  62.556   1.00 60.88  ? 166  TYR D CE1 1 
ATOM   10821 C CE2 . TYR D 1 111 ? 1.281   11.088  62.658   1.00 59.13  ? 166  TYR D CE2 1 
ATOM   10822 C CZ  . TYR D 1 111 ? 0.283   12.032  62.610   1.00 61.22  ? 166  TYR D CZ  1 
ATOM   10823 O OH  . TYR D 1 111 ? -1.034  11.633  62.617   1.00 67.05  ? 166  TYR D OH  1 
ATOM   10824 N N   . PHE D 1 112 ? 5.883   11.366  64.592   1.00 53.93  ? 167  PHE D N   1 
ATOM   10825 C CA  . PHE D 1 112 ? 5.894   10.111  65.341   1.00 49.62  ? 167  PHE D CA  1 
ATOM   10826 C C   . PHE D 1 112 ? 6.419   10.342  66.741   1.00 52.75  ? 167  PHE D C   1 
ATOM   10827 O O   . PHE D 1 112 ? 6.100   9.596   67.666   1.00 54.61  ? 167  PHE D O   1 
ATOM   10828 C CB  . PHE D 1 112 ? 6.741   9.063   64.633   1.00 40.71  ? 167  PHE D CB  1 
ATOM   10829 C CG  . PHE D 1 112 ? 6.177   8.630   63.326   1.00 44.17  ? 167  PHE D CG  1 
ATOM   10830 C CD1 . PHE D 1 112 ? 4.816   8.458   63.173   1.00 44.32  ? 167  PHE D CD1 1 
ATOM   10831 C CD2 . PHE D 1 112 ? 7.004   8.408   62.241   1.00 46.85  ? 167  PHE D CD2 1 
ATOM   10832 C CE1 . PHE D 1 112 ? 4.291   8.064   61.968   1.00 48.39  ? 167  PHE D CE1 1 
ATOM   10833 C CE2 . PHE D 1 112 ? 6.485   8.015   61.030   1.00 42.21  ? 167  PHE D CE2 1 
ATOM   10834 C CZ  . PHE D 1 112 ? 5.125   7.843   60.893   1.00 43.44  ? 167  PHE D CZ  1 
ATOM   10835 N N   . SER D 1 113 ? 7.241   11.373  66.892   1.00 51.42  ? 168  SER D N   1 
ATOM   10836 C CA  . SER D 1 113 ? 7.632   11.806  68.220   1.00 56.92  ? 168  SER D CA  1 
ATOM   10837 C C   . SER D 1 113 ? 6.389   12.232  68.997   1.00 58.98  ? 168  SER D C   1 
ATOM   10838 O O   . SER D 1 113 ? 6.197   11.835  70.147   1.00 62.12  ? 168  SER D O   1 
ATOM   10839 C CB  . SER D 1 113 ? 8.624   12.959  68.136   1.00 55.87  ? 168  SER D CB  1 
ATOM   10840 O OG  . SER D 1 113 ? 9.737   1