data_4DAY
# 
_entry.id   4DAY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4DAY         
RCSB  RCSB070102   
WWPDB D_1000070102 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3MXN 'Crystal structure of the RMI core complex'                                               unspecified 
PDB 3NBH 'Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex' unspecified 
# 
_pdbx_database_status.entry_id                        4DAY 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-01-13 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hoadley, K.A.' 1 
'Keck, J.L.'    2 
# 
_citation.id                        primary 
_citation.title                     
'Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            109 
_citation.page_first                4437 
_citation.page_last                 4442 
_citation.year                      2012 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22392978 
_citation.pdbx_database_id_DOI      10.1073/pnas.1117279109 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hoadley, K.A.' 1 
primary 'Xue, Y.'       2 
primary 'Ling, C.'      3 
primary 'Takata, M.'    4 
primary 'Wang, W.'      5 
primary 'Keck, J.L.'    6 
# 
_cell.length_a           75.312 
_cell.length_b           96.440 
_cell.length_c           99.025 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4DAY 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'I 21 21 21' 
_symmetry.entry_id                         4DAY 
_symmetry.Int_Tables_number                24 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'RecQ-mediated genome instability protein 1' 17401.254 1 ?        ? 'C-terminal OB domain (residues 473-625)' ? 
2 polymer man 'RecQ-mediated genome instability protein 2' 16168.581 1 ?        ? ?                                         ? 
3 polymer man 'Fanconi anemia group M protein'             4199.458  1 3.6.4.13 ? 'MM2 peptide (residues 1218-1251)'        ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'BLM-associated protein of 75 kDa, BLAP75, FAAP75' 
2 'hRMI2, BLM-associated protein of 18 kDa, BLAP18' 
3 
'Protein FACM, ATP-dependent RNA helicase FANCM, Fanconi anemia-associated polypeptide of 250 kDa, FAAP250, Protein Hef ortholog' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSHMSSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDE
ILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
;
;GSHMSSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDE
ILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
;
A ? 
2 'polypeptide(L)' no no 
;GSHMAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDP
SGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
;
;GSHMAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDP
SGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
;
B ? 
3 'polypeptide(L)' no no GHMEDIFDCSRDLFSVTFDLGFCSPDSDDEILEHTSD GHMEDIFDCSRDLFSVTFDLGFCSPDSDDEILEHTSD C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   SER n 
1 6   SER n 
1 7   GLU n 
1 8   ASN n 
1 9   SER n 
1 10  ILE n 
1 11  ASN n 
1 12  LEU n 
1 13  SER n 
1 14  ILE n 
1 15  ALA n 
1 16  MET n 
1 17  ASP n 
1 18  LEU n 
1 19  TYR n 
1 20  SER n 
1 21  PRO n 
1 22  PRO n 
1 23  PHE n 
1 24  VAL n 
1 25  TYR n 
1 26  LEU n 
1 27  SER n 
1 28  VAL n 
1 29  LEU n 
1 30  MET n 
1 31  ALA n 
1 32  SER n 
1 33  LYS n 
1 34  PRO n 
1 35  LYS n 
1 36  GLU n 
1 37  VAL n 
1 38  THR n 
1 39  THR n 
1 40  VAL n 
1 41  LYS n 
1 42  VAL n 
1 43  LYS n 
1 44  ALA n 
1 45  PHE n 
1 46  ILE n 
1 47  VAL n 
1 48  THR n 
1 49  LEU n 
1 50  THR n 
1 51  GLY n 
1 52  ASN n 
1 53  LEU n 
1 54  SER n 
1 55  SER n 
1 56  SER n 
1 57  GLY n 
1 58  GLY n 
1 59  ILE n 
1 60  TRP n 
1 61  SER n 
1 62  ILE n 
1 63  THR n 
1 64  ALA n 
1 65  LYS n 
1 66  VAL n 
1 67  SER n 
1 68  ASP n 
1 69  GLY n 
1 70  THR n 
1 71  ALA n 
1 72  TYR n 
1 73  LEU n 
1 74  ASP n 
1 75  VAL n 
1 76  ASP n 
1 77  PHE n 
1 78  VAL n 
1 79  ASP n 
1 80  GLU n 
1 81  ILE n 
1 82  LEU n 
1 83  THR n 
1 84  SER n 
1 85  LEU n 
1 86  ILE n 
1 87  GLY n 
1 88  PHE n 
1 89  SER n 
1 90  VAL n 
1 91  PRO n 
1 92  GLU n 
1 93  MET n 
1 94  LYS n 
1 95  GLN n 
1 96  SER n 
1 97  LYS n 
1 98  LYS n 
1 99  ASP n 
1 100 PRO n 
1 101 LEU n 
1 102 GLN n 
1 103 TYR n 
1 104 GLN n 
1 105 LYS n 
1 106 PHE n 
1 107 LEU n 
1 108 GLU n 
1 109 GLY n 
1 110 LEU n 
1 111 GLN n 
1 112 LYS n 
1 113 CYS n 
1 114 GLN n 
1 115 ARG n 
1 116 ASP n 
1 117 LEU n 
1 118 ILE n 
1 119 ASP n 
1 120 LEU n 
1 121 CYS n 
1 122 CYS n 
1 123 LEU n 
1 124 MET n 
1 125 THR n 
1 126 ILE n 
1 127 SER n 
1 128 PHE n 
1 129 ASN n 
1 130 PRO n 
1 131 SER n 
1 132 LEU n 
1 133 SER n 
1 134 LYS n 
1 135 ALA n 
1 136 MET n 
1 137 VAL n 
1 138 LEU n 
1 139 ALA n 
1 140 LEU n 
1 141 GLN n 
1 142 ASP n 
1 143 VAL n 
1 144 ASN n 
1 145 MET n 
1 146 GLU n 
1 147 HIS n 
1 148 LEU n 
1 149 GLU n 
1 150 ASN n 
1 151 LEU n 
1 152 LYS n 
1 153 LYS n 
1 154 ARG n 
1 155 LEU n 
1 156 ASN n 
1 157 LYS n 
2 1   GLY n 
2 2   SER n 
2 3   HIS n 
2 4   MET n 
2 5   ALA n 
2 6   ALA n 
2 7   ALA n 
2 8   ALA n 
2 9   ASP n 
2 10  SER n 
2 11  PHE n 
2 12  SER n 
2 13  GLY n 
2 14  GLY n 
2 15  PRO n 
2 16  ALA n 
2 17  GLY n 
2 18  VAL n 
2 19  ARG n 
2 20  LEU n 
2 21  PRO n 
2 22  ARG n 
2 23  SER n 
2 24  PRO n 
2 25  PRO n 
2 26  LEU n 
2 27  LYS n 
2 28  VAL n 
2 29  LEU n 
2 30  ALA n 
2 31  GLU n 
2 32  GLN n 
2 33  LEU n 
2 34  ARG n 
2 35  ARG n 
2 36  ASP n 
2 37  ALA n 
2 38  GLU n 
2 39  GLY n 
2 40  GLY n 
2 41  PRO n 
2 42  GLY n 
2 43  ALA n 
2 44  TRP n 
2 45  ARG n 
2 46  LEU n 
2 47  SER n 
2 48  ARG n 
2 49  ALA n 
2 50  ALA n 
2 51  ALA n 
2 52  GLY n 
2 53  ARG n 
2 54  GLY n 
2 55  PRO n 
2 56  LEU n 
2 57  ASP n 
2 58  LEU n 
2 59  ALA n 
2 60  ALA n 
2 61  VAL n 
2 62  TRP n 
2 63  MET n 
2 64  GLN n 
2 65  GLY n 
2 66  ARG n 
2 67  VAL n 
2 68  VAL n 
2 69  MET n 
2 70  ALA n 
2 71  ASP n 
2 72  ARG n 
2 73  GLY n 
2 74  GLU n 
2 75  ALA n 
2 76  ARG n 
2 77  LEU n 
2 78  ARG n 
2 79  ASP n 
2 80  PRO n 
2 81  SER n 
2 82  GLY n 
2 83  ASP n 
2 84  PHE n 
2 85  SER n 
2 86  VAL n 
2 87  ARG n 
2 88  GLY n 
2 89  LEU n 
2 90  GLU n 
2 91  ARG n 
2 92  VAL n 
2 93  PRO n 
2 94  ARG n 
2 95  GLY n 
2 96  ARG n 
2 97  PRO n 
2 98  CYS n 
2 99  LEU n 
2 100 VAL n 
2 101 PRO n 
2 102 GLY n 
2 103 LYS n 
2 104 TYR n 
2 105 VAL n 
2 106 MET n 
2 107 VAL n 
2 108 MET n 
2 109 GLY n 
2 110 VAL n 
2 111 VAL n 
2 112 GLN n 
2 113 ALA n 
2 114 CYS n 
2 115 SER n 
2 116 PRO n 
2 117 GLU n 
2 118 PRO n 
2 119 CYS n 
2 120 LEU n 
2 121 GLN n 
2 122 ALA n 
2 123 VAL n 
2 124 LYS n 
2 125 MET n 
2 126 THR n 
2 127 ASP n 
2 128 LEU n 
2 129 SER n 
2 130 ASP n 
2 131 ASN n 
2 132 PRO n 
2 133 ILE n 
2 134 HIS n 
2 135 GLU n 
2 136 SER n 
2 137 MET n 
2 138 TRP n 
2 139 GLU n 
2 140 LEU n 
2 141 GLU n 
2 142 VAL n 
2 143 GLU n 
2 144 ASP n 
2 145 LEU n 
2 146 HIS n 
2 147 ARG n 
2 148 ASN n 
2 149 ILE n 
2 150 PRO n 
3 1   GLY n 
3 2   HIS n 
3 3   MET n 
3 4   GLU n 
3 5   ASP n 
3 6   ILE n 
3 7   PHE n 
3 8   ASP n 
3 9   CYS n 
3 10  SER n 
3 11  ARG n 
3 12  ASP n 
3 13  LEU n 
3 14  PHE n 
3 15  SER n 
3 16  VAL n 
3 17  THR n 
3 18  PHE n 
3 19  ASP n 
3 20  LEU n 
3 21  GLY n 
3 22  PHE n 
3 23  CYS n 
3 24  SER n 
3 25  PRO n 
3 26  ASP n 
3 27  SER n 
3 28  ASP n 
3 29  ASP n 
3 30  GLU n 
3 31  ILE n 
3 32  LEU n 
3 33  GLU n 
3 34  HIS n 
3 35  THR n 
3 36  SER n 
3 37  ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'RMI1, C9orf76'   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human ? 'RMI2, C16orf75'  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? human ? 'FANCM, KIAA1596' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RMI1_HUMAN  Q9H9A7 1 
;SSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTS
LIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
;
473  ? 
2 UNP RMI2_HUMAN  Q96E14 2 
;MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGD
FSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
;
1    ? 
3 UNP FANCM_HUMAN Q8IYD8 3 EDIFDCSRDLFSVTFDLGFCSPDSDDEILEHTSD 1218 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4DAY A 5 ? 157 ? Q9H9A7 473  ? 625  ? 473  625  
2 2 4DAY B 4 ? 150 ? Q96E14 1    ? 147  ? 1    147  
3 3 4DAY C 4 ? 37  ? Q8IYD8 1218 ? 1251 ? 1218 1251 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4DAY GLY A 1 ? UNP Q9H9A7 ? ? 'EXPRESSION TAG' 469  1  
1 4DAY SER A 2 ? UNP Q9H9A7 ? ? 'EXPRESSION TAG' 470  2  
1 4DAY HIS A 3 ? UNP Q9H9A7 ? ? 'EXPRESSION TAG' 471  3  
1 4DAY MET A 4 ? UNP Q9H9A7 ? ? 'EXPRESSION TAG' 472  4  
2 4DAY GLY B 1 ? UNP Q96E14 ? ? 'EXPRESSION TAG' -2   5  
2 4DAY SER B 2 ? UNP Q96E14 ? ? 'EXPRESSION TAG' -1   6  
2 4DAY HIS B 3 ? UNP Q96E14 ? ? 'EXPRESSION TAG' 0    7  
3 4DAY GLY C 1 ? UNP Q8IYD8 ? ? 'EXPRESSION TAG' 1215 8  
3 4DAY HIS C 2 ? UNP Q8IYD8 ? ? 'EXPRESSION TAG' 1216 9  
3 4DAY MET C 3 ? UNP Q8IYD8 ? ? 'EXPRESSION TAG' 1217 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4DAY 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.38 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   48.33 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              8.8 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'200 mM Na2SO4, 5% polyethylene glycol 3350, pH 8.8, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-02-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Diamond [111]' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97856 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97856 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
# 
_reflns.entry_id                     4DAY 
_reflns.d_resolution_high            3.300 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   5711 
_reflns.pdbx_Rmerge_I_obs            0.081 
_reflns.pdbx_netI_over_sigmaI        9.100 
_reflns.pdbx_chi_squared             1.163 
_reflns.pdbx_redundancy              5.100 
_reflns.percent_possible_obs         99.700 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.number_all                   5728 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
3.300 3.360  ? ? ? 0.587 ? ? 1.029 5.100 ? 260 100.000 1  1 
3.360 3.420  ? ? ? 0.382 ? ? 0.921 5.300 ? 291 99.700  2  1 
3.420 3.480  ? ? ? 0.380 ? ? 1.067 5.200 ? 272 100.000 3  1 
3.480 3.550  ? ? ? 0.278 ? ? 0.965 5.300 ? 277 100.000 4  1 
3.550 3.630  ? ? ? 0.265 ? ? 1.047 5.200 ? 279 100.000 5  1 
3.630 3.720  ? ? ? 0.186 ? ? 0.957 5.200 ? 287 100.000 6  1 
3.720 3.810  ? ? ? 0.173 ? ? 0.916 5.200 ? 274 99.600  7  1 
3.810 3.910  ? ? ? 0.158 ? ? 1.009 5.100 ? 288 100.000 8  1 
3.910 4.030  ? ? ? 0.137 ? ? 1.093 5.200 ? 292 100.000 9  1 
4.030 4.160  ? ? ? 0.117 ? ? 1.182 5.200 ? 287 99.700  10 1 
4.160 4.310  ? ? ? 0.100 ? ? 1.338 5.200 ? 268 100.000 11 1 
4.310 4.480  ? ? ? 0.082 ? ? 1.438 5.100 ? 287 100.000 12 1 
4.480 4.680  ? ? ? 0.079 ? ? 1.497 5.000 ? 283 99.600  13 1 
4.680 4.930  ? ? ? 0.068 ? ? 1.486 5.200 ? 294 100.000 14 1 
4.930 5.240  ? ? ? 0.064 ? ? 1.253 5.100 ? 280 100.000 15 1 
5.240 5.640  ? ? ? 0.065 ? ? 1.312 5.000 ? 292 100.000 16 1 
5.640 6.210  ? ? ? 0.052 ? ? 1.125 5.100 ? 291 99.700  17 1 
6.210 7.100  ? ? ? 0.049 ? ? 1.181 5.000 ? 293 100.000 18 1 
7.100 8.940  ? ? ? 0.034 ? ? 1.240 4.900 ? 300 99.700  19 1 
8.940 50.000 ? ? ? 0.026 ? ? 1.233 4.400 ? 316 96.900  20 1 
# 
_refine.entry_id                                 4DAY 
_refine.ls_d_res_high                            3.3 
_refine.ls_d_res_low                             50.0 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_number_reflns_obs                     5711 
_refine.ls_number_reflns_all                     5728 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : RESIDUAL ONLY' 
_refine.ls_R_factor_all                          0.2552 
_refine.ls_R_factor_obs                          0.2217 
_refine.ls_R_factor_R_work                       0.2165 
_refine.ls_wR_factor_R_work                      0.1997 
_refine.ls_R_factor_R_free                       0.3254 
_refine.ls_wR_factor_R_free                      0.3042 
_refine.ls_percent_reflns_R_free                 4.8000 
_refine.ls_number_reflns_R_free                  273 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               92.948 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            5.4400 
_refine.aniso_B[2][2]                            -0.0500 
_refine.aniso_B[3][3]                            -5.3800 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9310 
_refine.correlation_coeff_Fo_to_Fc_free          0.8200 
_refine.overall_SU_R_Cruickshank_DPI             0.4697 
_refine.overall_SU_R_free                        0.6787 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.6790 
_refine.overall_SU_ML                            0.5570 
_refine.overall_SU_B                             75.3960 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'pdb entry 3mxn' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.7471 
_refine.B_iso_max                                100.780 
_refine.B_iso_min                                23.860 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2098 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               2098 
_refine_hist.d_res_high                       3.3 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       2135 0.010  0.022  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    2885 1.385  1.995  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 265  6.801  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 85   37.042 24.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 394  20.333 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 15   16.212 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         334  0.083  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   1561 0.005  0.021  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            1344 0.375  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           2180 0.729  2.000  ? ? 'X-RAY DIFFRACTION' 
r_scbond_it            791  0.964  3.000  ? ? 'X-RAY DIFFRACTION' 
r_scangle_it           705  1.748  4.500  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       3.2860 
_refine_ls_shell.d_res_low                        3.3710 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               97.1600 
_refine_ls_shell.number_reflns_R_work             359 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3290 
_refine_ls_shell.R_factor_R_free                  0.3570 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             18 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                377 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4DAY 
_struct.title                     'Crystal structure of the RMI core complex with MM2 peptide from FANCM' 
_struct.pdbx_descriptor           
;RecQ-mediated genome instability protein 1, RecQ-mediated genome instability protein 2, Fanconi anemia group M protein (E.C.3.6.4.13)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4DAY 
_struct_keywords.pdbx_keywords   'protein binding/Hydrolase' 
_struct_keywords.text            'OB fold, protein binding-Hydrolase complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 TYR A 25  ? LYS A 33  ? TYR A 493 LYS A 501 1 ? 9  
HELX_P HELX_P2 2 SER A 55  ? ILE A 59  ? SER A 523 ILE A 527 5 ? 5  
HELX_P HELX_P3 3 VAL A 78  ? GLY A 87  ? VAL A 546 GLY A 555 1 ? 10 
HELX_P HELX_P4 4 SER A 89  ? ASP A 99  ? SER A 557 ASP A 567 1 ? 11 
HELX_P HELX_P5 5 ASP A 99  ? ASP A 119 ? ASP A 567 ASP A 587 1 ? 21 
HELX_P HELX_P6 6 ASN A 144 ? LEU A 155 ? ASN A 612 LEU A 623 1 ? 12 
HELX_P HELX_P7 7 LEU B 29  ? ASP B 36  ? LEU B 26  ASP B 33  1 ? 8  
HELX_P HELX_P8 8 GLY B 88  ? VAL B 92  ? GLY B 85  VAL B 89  5 ? 5  
HELX_P HELX_P9 9 PRO B 132 ? ASN B 148 ? PRO B 129 ASN B 145 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 21  A . ? PRO 489 A PRO 22  A ? PRO 490 A 1 5.38   
2 SER 115 B . ? SER 112 B PRO 116 B ? PRO 113 B 1 -12.16 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 38  ? LEU A 49  ? THR A 506 LEU A 517 
A 2 ALA A 64  ? SER A 67  ? ALA A 532 SER A 535 
A 3 TYR A 72  ? PHE A 77  ? TYR A 540 PHE A 545 
A 4 ALA A 135 ? GLN A 141 ? ALA A 603 GLN A 609 
A 5 CYS A 121 ? PHE A 128 ? CYS A 589 PHE A 596 
A 6 THR A 38  ? LEU A 49  ? THR A 506 LEU A 517 
B 1 LEU B 26  ? LYS B 27  ? LEU B 23  LYS B 24  
B 2 ALA B 60  ? ASP B 71  ? ALA B 57  ASP B 68  
B 3 TYR B 104 ? VAL B 111 ? TYR B 101 VAL B 108 
B 4 CYS B 119 ? ASP B 127 ? CYS B 116 ASP B 124 
B 5 ASP B 83  ? ARG B 87  ? ASP B 80  ARG B 84  
B 6 GLU B 74  ? ARG B 78  ? GLU B 71  ARG B 75  
B 7 ALA B 60  ? ASP B 71  ? ALA B 57  ASP B 68  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 47  ? N VAL A 515 O LYS A 65  ? O LYS A 533 
A 2 3 N ALA A 64  ? N ALA A 532 O VAL A 75  ? O VAL A 543 
A 3 4 N ASP A 76  ? N ASP A 544 O VAL A 137 ? O VAL A 605 
A 4 5 O LEU A 138 ? O LEU A 606 N THR A 125 ? N THR A 593 
A 5 6 O MET A 124 ? O MET A 592 N VAL A 42  ? N VAL A 510 
B 1 2 N LEU B 26  ? N LEU B 23  O TRP B 62  ? O TRP B 59  
B 2 3 N MET B 63  ? N MET B 60  O VAL B 107 ? O VAL B 104 
B 3 4 N MET B 108 ? N MET B 105 O LYS B 124 ? O LYS B 121 
B 4 5 O ALA B 122 ? O ALA B 119 N ARG B 87  ? N ARG B 84  
B 5 6 O PHE B 84  ? O PHE B 81  N LEU B 77  ? N LEU B 74  
B 6 7 O ARG B 78  ? O ARG B 75  N ARG B 66  ? N ARG B 63  
# 
_atom_sites.entry_id                    4DAY 
_atom_sites.fract_transf_matrix[1][1]   0.013278 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010369 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010098 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . ILE A 1 14  ? -5.393  2.631   -17.967 1.00 142.96 ? 482  ILE A N   1 
ATOM 2    C CA  . ILE A 1 14  ? -4.174  1.756   -17.948 1.00 140.85 ? 482  ILE A CA  1 
ATOM 3    C C   . ILE A 1 14  ? -3.783  1.413   -16.486 1.00 137.84 ? 482  ILE A C   1 
ATOM 4    O O   . ILE A 1 14  ? -3.162  2.226   -15.791 1.00 135.68 ? 482  ILE A O   1 
ATOM 5    C CB  . ILE A 1 14  ? -2.978  2.395   -18.756 1.00 140.18 ? 482  ILE A CB  1 
ATOM 6    C CG1 . ILE A 1 14  ? -3.491  3.361   -19.843 1.00 142.73 ? 482  ILE A CG1 1 
ATOM 7    C CG2 . ILE A 1 14  ? -2.076  1.300   -19.364 1.00 139.72 ? 482  ILE A CG2 1 
ATOM 8    C CD1 . ILE A 1 14  ? -2.553  4.524   -20.170 1.00 141.14 ? 482  ILE A CD1 1 
ATOM 9    N N   . ALA A 1 15  ? -4.161  0.211   -16.030 1.00 137.95 ? 483  ALA A N   1 
ATOM 10   C CA  . ALA A 1 15  ? -4.006  -0.196  -14.613 1.00 135.41 ? 483  ALA A CA  1 
ATOM 11   C C   . ALA A 1 15  ? -3.312  -1.557  -14.356 1.00 134.01 ? 483  ALA A C   1 
ATOM 12   O O   . ALA A 1 15  ? -3.366  -2.086  -13.234 1.00 132.64 ? 483  ALA A O   1 
ATOM 13   C CB  . ALA A 1 15  ? -5.365  -0.123  -13.876 1.00 136.94 ? 483  ALA A CB  1 
ATOM 14   N N   . MET A 1 16  ? -2.671  -2.115  -15.389 1.00 134.34 ? 484  MET A N   1 
ATOM 15   C CA  . MET A 1 16  ? -1.784  -3.283  -15.228 1.00 132.89 ? 484  MET A CA  1 
ATOM 16   C C   . MET A 1 16  ? -0.472  -2.840  -14.561 1.00 129.11 ? 484  MET A C   1 
ATOM 17   O O   . MET A 1 16  ? 0.587   -2.722  -15.200 1.00 128.49 ? 484  MET A O   1 
ATOM 18   C CB  . MET A 1 16  ? -1.522  -3.993  -16.570 1.00 135.25 ? 484  MET A CB  1 
ATOM 19   C CG  . MET A 1 16  ? -0.524  -5.169  -16.498 1.00 134.86 ? 484  MET A CG  1 
ATOM 20   S SD  . MET A 1 16  ? 0.278   -5.527  -18.084 1.00 137.80 ? 484  MET A SD  1 
ATOM 21   C CE  . MET A 1 16  ? 1.909   -6.075  -17.576 1.00 134.07 ? 484  MET A CE  1 
ATOM 22   N N   . ASP A 1 17  ? -0.564  -2.579  -13.262 1.00 126.49 ? 485  ASP A N   1 
ATOM 23   C CA  . ASP A 1 17  ? 0.591   -2.186  -12.466 1.00 122.84 ? 485  ASP A CA  1 
ATOM 24   C C   . ASP A 1 17  ? 1.518   -3.395  -12.246 1.00 121.09 ? 485  ASP A C   1 
ATOM 25   O O   . ASP A 1 17  ? 2.035   -3.587  -11.143 1.00 119.60 ? 485  ASP A O   1 
ATOM 26   C CB  . ASP A 1 17  ? 0.139   -1.610  -11.096 1.00 121.70 ? 485  ASP A CB  1 
ATOM 27   C CG  . ASP A 1 17  ? -0.109  -0.096  -11.117 1.00 121.57 ? 485  ASP A CG  1 
ATOM 28   O OD1 . ASP A 1 17  ? -0.559  0.454   -12.153 1.00 124.03 ? 485  ASP A OD1 1 
ATOM 29   O OD2 . ASP A 1 17  ? 0.131   0.538   -10.066 1.00 118.84 ? 485  ASP A OD2 1 
ATOM 30   N N   . LEU A 1 18  ? 1.728   -4.226  -13.261 1.00 121.18 ? 486  LEU A N   1 
ATOM 31   C CA  . LEU A 1 18  ? 2.570   -5.390  -13.032 1.00 119.28 ? 486  LEU A CA  1 
ATOM 32   C C   . LEU A 1 18  ? 4.010   -4.974  -12.744 1.00 116.11 ? 486  LEU A C   1 
ATOM 33   O O   . LEU A 1 18  ? 4.532   -5.245  -11.657 1.00 114.10 ? 486  LEU A O   1 
ATOM 34   C CB  . LEU A 1 18  ? 2.475   -6.413  -14.174 1.00 122.22 ? 486  LEU A CB  1 
ATOM 35   C CG  . LEU A 1 18  ? 1.594   -7.647  -13.918 1.00 123.93 ? 486  LEU A CG  1 
ATOM 36   C CD1 . LEU A 1 18  ? 1.541   -8.588  -15.126 1.00 126.02 ? 486  LEU A CD1 1 
ATOM 37   C CD2 . LEU A 1 18  ? 2.051   -8.400  -12.658 1.00 122.11 ? 486  LEU A CD2 1 
ATOM 38   N N   . TYR A 1 19  ? 4.626   -4.275  -13.696 1.00 115.26 ? 487  TYR A N   1 
ATOM 39   C CA  . TYR A 1 19  ? 6.034   -3.889  -13.581 1.00 112.51 ? 487  TYR A CA  1 
ATOM 40   C C   . TYR A 1 19  ? 6.262   -2.381  -13.650 1.00 110.93 ? 487  TYR A C   1 
ATOM 41   O O   . TYR A 1 19  ? 7.403   -1.922  -13.562 1.00 109.94 ? 487  TYR A O   1 
ATOM 42   C CB  . TYR A 1 19  ? 6.877   -4.628  -14.629 1.00 114.08 ? 487  TYR A CB  1 
ATOM 43   C CG  . TYR A 1 19  ? 6.784   -6.124  -14.478 1.00 114.20 ? 487  TYR A CG  1 
ATOM 44   C CD1 . TYR A 1 19  ? 7.591   -6.802  -13.569 1.00 112.73 ? 487  TYR A CD1 1 
ATOM 45   C CD2 . TYR A 1 19  ? 5.860   -6.858  -15.219 1.00 116.03 ? 487  TYR A CD2 1 
ATOM 46   C CE1 . TYR A 1 19  ? 7.487   -8.181  -13.416 1.00 114.00 ? 487  TYR A CE1 1 
ATOM 47   C CE2 . TYR A 1 19  ? 5.748   -8.233  -15.076 1.00 116.80 ? 487  TYR A CE2 1 
ATOM 48   C CZ  . TYR A 1 19  ? 6.562   -8.887  -14.176 1.00 115.90 ? 487  TYR A CZ  1 
ATOM 49   O OH  . TYR A 1 19  ? 6.451   -10.247 -14.035 1.00 117.44 ? 487  TYR A OH  1 
ATOM 50   N N   . SER A 1 20  ? 5.170   -1.626  -13.794 1.00 110.40 ? 488  SER A N   1 
ATOM 51   C CA  . SER A 1 20  ? 5.210   -0.165  -13.835 1.00 108.85 ? 488  SER A CA  1 
ATOM 52   C C   . SER A 1 20  ? 5.982   0.399   -12.639 1.00 105.64 ? 488  SER A C   1 
ATOM 53   O O   . SER A 1 20  ? 5.582   0.198   -11.484 1.00 104.41 ? 488  SER A O   1 
ATOM 54   C CB  . SER A 1 20  ? 3.794   0.399   -13.860 1.00 109.89 ? 488  SER A CB  1 
ATOM 55   O OG  . SER A 1 20  ? 3.151   0.150   -12.624 1.00 108.73 ? 488  SER A OG  1 
ATOM 56   N N   . PRO A 1 21  ? 7.108   1.086   -12.913 1.00 104.34 ? 489  PRO A N   1 
ATOM 57   C CA  . PRO A 1 21  ? 7.968   1.616   -11.865 1.00 101.62 ? 489  PRO A CA  1 
ATOM 58   C C   . PRO A 1 21  ? 7.347   2.864   -11.262 1.00 100.25 ? 489  PRO A C   1 
ATOM 59   O O   . PRO A 1 21  ? 6.489   3.475   -11.909 1.00 101.48 ? 489  PRO A O   1 
ATOM 60   C CB  . PRO A 1 21  ? 9.261   1.965   -12.617 1.00 102.42 ? 489  PRO A CB  1 
ATOM 61   C CG  . PRO A 1 21  ? 9.154   1.266   -13.938 1.00 104.72 ? 489  PRO A CG  1 
ATOM 62   C CD  . PRO A 1 21  ? 7.701   1.303   -14.242 1.00 106.03 ? 489  PRO A CD  1 
ATOM 63   N N   . PRO A 1 22  ? 7.788   3.262   -10.048 1.00 97.75  ? 490  PRO A N   1 
ATOM 64   C CA  . PRO A 1 22  ? 8.881   2.711   -9.249  1.00 95.67  ? 490  PRO A CA  1 
ATOM 65   C C   . PRO A 1 22  ? 8.518   1.512   -8.387  1.00 93.97  ? 490  PRO A C   1 
ATOM 66   O O   . PRO A 1 22  ? 9.393   0.711   -8.060  1.00 93.56  ? 490  PRO A O   1 
ATOM 67   C CB  . PRO A 1 22  ? 9.261   3.878   -8.349  1.00 95.02  ? 490  PRO A CB  1 
ATOM 68   C CG  . PRO A 1 22  ? 8.035   4.623   -8.172  1.00 95.40  ? 490  PRO A CG  1 
ATOM 69   C CD  . PRO A 1 22  ? 7.245   4.483   -9.428  1.00 97.65  ? 490  PRO A CD  1 
ATOM 70   N N   . PHE A 1 23  ? 7.247   1.411   -8.012  1.00 93.14  ? 491  PHE A N   1 
ATOM 71   C CA  . PHE A 1 23  ? 6.735   0.304   -7.211  1.00 91.52  ? 491  PHE A CA  1 
ATOM 72   C C   . PHE A 1 23  ? 5.289   0.059   -7.621  1.00 92.11  ? 491  PHE A C   1 
ATOM 73   O O   . PHE A 1 23  ? 4.772   0.736   -8.506  1.00 93.16  ? 491  PHE A O   1 
ATOM 74   C CB  . PHE A 1 23  ? 6.845   0.612   -5.708  1.00 90.08  ? 491  PHE A CB  1 
ATOM 75   C CG  . PHE A 1 23  ? 6.075   1.830   -5.284  1.00 90.86  ? 491  PHE A CG  1 
ATOM 76   C CD1 . PHE A 1 23  ? 4.755   1.722   -4.844  1.00 92.24  ? 491  PHE A CD1 1 
ATOM 77   C CD2 . PHE A 1 23  ? 6.662   3.094   -5.330  1.00 91.09  ? 491  PHE A CD2 1 
ATOM 78   C CE1 . PHE A 1 23  ? 4.024   2.865   -4.462  1.00 93.01  ? 491  PHE A CE1 1 
ATOM 79   C CE2 . PHE A 1 23  ? 5.941   4.240   -4.955  1.00 91.61  ? 491  PHE A CE2 1 
ATOM 80   C CZ  . PHE A 1 23  ? 4.620   4.125   -4.519  1.00 92.25  ? 491  PHE A CZ  1 
ATOM 81   N N   . VAL A 1 24  ? 4.643   -0.910  -6.981  1.00 91.37  ? 492  VAL A N   1 
ATOM 82   C CA  . VAL A 1 24  ? 3.244   -1.229  -7.260  1.00 92.31  ? 492  VAL A CA  1 
ATOM 83   C C   . VAL A 1 24  ? 2.424   -1.359  -5.965  1.00 91.78  ? 492  VAL A C   1 
ATOM 84   O O   . VAL A 1 24  ? 2.889   -0.974  -4.882  1.00 90.34  ? 492  VAL A O   1 
ATOM 85   C CB  . VAL A 1 24  ? 3.108   -2.484  -8.165  1.00 93.54  ? 492  VAL A CB  1 
ATOM 86   C CG1 . VAL A 1 24  ? 3.931   -2.313  -9.422  1.00 94.35  ? 492  VAL A CG1 1 
ATOM 87   C CG2 . VAL A 1 24  ? 3.549   -3.742  -7.439  1.00 92.86  ? 492  VAL A CG2 1 
ATOM 88   N N   . TYR A 1 25  ? 1.209   -1.900  -6.085  1.00 93.04  ? 493  TYR A N   1 
ATOM 89   C CA  . TYR A 1 25  ? 0.274   -1.988  -4.962  1.00 92.90  ? 493  TYR A CA  1 
ATOM 90   C C   . TYR A 1 25  ? -0.209  -3.393  -4.655  1.00 93.57  ? 493  TYR A C   1 
ATOM 91   O O   . TYR A 1 25  ? -0.340  -4.215  -5.556  1.00 94.77  ? 493  TYR A O   1 
ATOM 92   C CB  . TYR A 1 25  ? -0.899  -1.038  -5.197  1.00 94.56  ? 493  TYR A CB  1 
ATOM 93   C CG  . TYR A 1 25  ? -0.429  0.383   -5.176  1.00 93.63  ? 493  TYR A CG  1 
ATOM 94   C CD1 . TYR A 1 25  ? -0.033  0.972   -3.983  1.00 93.07  ? 493  TYR A CD1 1 
ATOM 95   C CD2 . TYR A 1 25  ? -0.320  1.122   -6.341  1.00 94.60  ? 493  TYR A CD2 1 
ATOM 96   C CE1 . TYR A 1 25  ? 0.433   2.268   -3.938  1.00 93.29  ? 493  TYR A CE1 1 
ATOM 97   C CE2 . TYR A 1 25  ? 0.148   2.433   -6.310  1.00 94.89  ? 493  TYR A CE2 1 
ATOM 98   C CZ  . TYR A 1 25  ? 0.521   3.000   -5.098  1.00 94.10  ? 493  TYR A CZ  1 
ATOM 99   O OH  . TYR A 1 25  ? 0.989   4.295   -5.021  1.00 94.67  ? 493  TYR A OH  1 
ATOM 100  N N   . LEU A 1 26  ? -0.467  -3.662  -3.376  1.00 93.01  ? 494  LEU A N   1 
ATOM 101  C CA  . LEU A 1 26  ? -0.931  -4.984  -2.942  1.00 93.98  ? 494  LEU A CA  1 
ATOM 102  C C   . LEU A 1 26  ? -2.341  -5.325  -3.412  1.00 96.94  ? 494  LEU A C   1 
ATOM 103  O O   . LEU A 1 26  ? -2.619  -6.472  -3.744  1.00 98.23  ? 494  LEU A O   1 
ATOM 104  C CB  . LEU A 1 26  ? -0.836  -5.140  -1.423  1.00 93.10  ? 494  LEU A CB  1 
ATOM 105  C CG  . LEU A 1 26  ? 0.542   -5.414  -0.819  1.00 90.26  ? 494  LEU A CG  1 
ATOM 106  C CD1 . LEU A 1 26  ? 0.446   -5.540  0.691   1.00 89.76  ? 494  LEU A CD1 1 
ATOM 107  C CD2 . LEU A 1 26  ? 1.154   -6.664  -1.402  1.00 89.68  ? 494  LEU A CD2 1 
ATOM 108  N N   . SER A 1 27  ? -3.220  -4.326  -3.441  1.00 98.21  ? 495  SER A N   1 
ATOM 109  C CA  . SER A 1 27  ? -4.592  -4.520  -3.914  1.00 101.62 ? 495  SER A CA  1 
ATOM 110  C C   . SER A 1 27  ? -4.655  -4.814  -5.410  1.00 102.53 ? 495  SER A C   1 
ATOM 111  O O   . SER A 1 27  ? -5.562  -5.503  -5.863  1.00 105.46 ? 495  SER A O   1 
ATOM 112  C CB  . SER A 1 27  ? -5.456  -3.298  -3.605  1.00 102.94 ? 495  SER A CB  1 
ATOM 113  O OG  . SER A 1 27  ? -5.149  -2.226  -4.488  1.00 103.07 ? 495  SER A OG  1 
ATOM 114  N N   . VAL A 1 28  ? -3.709  -4.262  -6.164  1.00 100.40 ? 496  VAL A N   1 
ATOM 115  C CA  . VAL A 1 28  ? -3.578  -4.539  -7.588  1.00 101.46 ? 496  VAL A CA  1 
ATOM 116  C C   . VAL A 1 28  ? -3.294  -6.025  -7.780  1.00 102.04 ? 496  VAL A C   1 
ATOM 117  O O   . VAL A 1 28  ? -3.895  -6.684  -8.630  1.00 104.73 ? 496  VAL A O   1 
ATOM 118  C CB  . VAL A 1 28  ? -2.452  -3.675  -8.240  1.00 99.57  ? 496  VAL A CB  1 
ATOM 119  C CG1 . VAL A 1 28  ? -2.110  -4.152  -9.660  1.00 100.57 ? 496  VAL A CG1 1 
ATOM 120  C CG2 . VAL A 1 28  ? -2.847  -2.204  -8.265  1.00 100.16 ? 496  VAL A CG2 1 
ATOM 121  N N   . LEU A 1 29  ? -2.390  -6.550  -6.965  1.00 99.95  ? 497  LEU A N   1 
ATOM 122  C CA  . LEU A 1 29  ? -2.008  -7.951  -7.033  1.00 100.57 ? 497  LEU A CA  1 
ATOM 123  C C   . LEU A 1 29  ? -3.173  -8.865  -6.654  1.00 103.61 ? 497  LEU A C   1 
ATOM 124  O O   . LEU A 1 29  ? -3.471  -9.807  -7.386  1.00 105.96 ? 497  LEU A O   1 
ATOM 125  C CB  . LEU A 1 29  ? -0.785  -8.203  -6.148  1.00 97.80  ? 497  LEU A CB  1 
ATOM 126  C CG  . LEU A 1 29  ? -0.012  -9.511  -6.291  1.00 97.72  ? 497  LEU A CG  1 
ATOM 127  C CD1 . LEU A 1 29  ? 0.203   -9.871  -7.745  1.00 99.22  ? 497  LEU A CD1 1 
ATOM 128  C CD2 . LEU A 1 29  ? 1.311   -9.400  -5.574  1.00 94.39  ? 497  LEU A CD2 1 
ATOM 129  N N   . MET A 1 30  ? -3.833  -8.577  -5.527  1.00 103.99 ? 498  MET A N   1 
ATOM 130  C CA  . MET A 1 30  ? -5.043  -9.312  -5.131  1.00 107.44 ? 498  MET A CA  1 
ATOM 131  C C   . MET A 1 30  ? -6.029  -9.294  -6.297  1.00 110.32 ? 498  MET A C   1 
ATOM 132  O O   . MET A 1 30  ? -6.387  -10.351 -6.818  1.00 113.09 ? 498  MET A O   1 
ATOM 133  C CB  . MET A 1 30  ? -5.731  -8.738  -3.867  1.00 107.89 ? 498  MET A CB  1 
ATOM 134  C CG  . MET A 1 30  ? -4.851  -8.312  -2.671  1.00 106.17 ? 498  MET A CG  1 
ATOM 135  S SD  . MET A 1 30  ? -3.434  -9.350  -2.213  1.00 106.97 ? 498  MET A SD  1 
ATOM 136  C CE  . MET A 1 30  ? -3.175  -8.827  -0.513  1.00 103.90 ? 498  MET A CE  1 
ATOM 137  N N   . ALA A 1 31  ? -6.435  -8.089  -6.713  1.00 109.90 ? 499  ALA A N   1 
ATOM 138  C CA  . ALA A 1 31  ? -7.403  -7.894  -7.807  1.00 112.59 ? 499  ALA A CA  1 
ATOM 139  C C   . ALA A 1 31  ? -7.036  -8.634  -9.094  1.00 113.55 ? 499  ALA A C   1 
ATOM 140  O O   . ALA A 1 31  ? -7.924  -9.008  -9.858  1.00 116.95 ? 499  ALA A O   1 
ATOM 141  C CB  . ALA A 1 31  ? -7.632  -6.405  -8.087  1.00 111.71 ? 499  ALA A CB  1 
ATOM 142  N N   . SER A 1 32  ? -5.738  -8.846  -9.321  1.00 110.75 ? 500  SER A N   1 
ATOM 143  C CA  . SER A 1 32  ? -5.259  -9.594  -10.486 1.00 111.72 ? 500  SER A CA  1 
ATOM 144  C C   . SER A 1 32  ? -5.379  -11.112 -10.326 1.00 113.88 ? 500  SER A C   1 
ATOM 145  O O   . SER A 1 32  ? -5.520  -11.822 -11.319 1.00 116.73 ? 500  SER A O   1 
ATOM 146  C CB  . SER A 1 32  ? -3.817  -9.226  -10.816 1.00 108.51 ? 500  SER A CB  1 
ATOM 147  O OG  . SER A 1 32  ? -2.919  -9.962  -10.007 1.00 106.87 ? 500  SER A OG  1 
ATOM 148  N N   . LYS A 1 33  ? -5.305  -11.603 -9.088  1.00 112.98 ? 501  LYS A N   1 
ATOM 149  C CA  . LYS A 1 33  ? -5.506  -13.035 -8.759  1.00 115.32 ? 501  LYS A CA  1 
ATOM 150  C C   . LYS A 1 33  ? -4.554  -13.989 -9.510  1.00 115.45 ? 501  LYS A C   1 
ATOM 151  O O   . LYS A 1 33  ? -4.968  -14.683 -10.452 1.00 118.78 ? 501  LYS A O   1 
ATOM 152  C CB  . LYS A 1 33  ? -6.973  -13.446 -8.975  1.00 119.81 ? 501  LYS A CB  1 
ATOM 153  C CG  . LYS A 1 33  ? -7.525  -14.384 -7.913  1.00 122.03 ? 501  LYS A CG  1 
ATOM 154  C CD  . LYS A 1 33  ? -8.000  -13.613 -6.679  1.00 121.44 ? 501  LYS A CD  1 
ATOM 155  C CE  . LYS A 1 33  ? -9.196  -12.707 -6.989  1.00 123.66 ? 501  LYS A CE  1 
ATOM 156  N NZ  . LYS A 1 33  ? -10.396 -13.488 -7.420  1.00 128.95 ? 501  LYS A NZ  1 
ATOM 157  N N   . PRO A 1 34  ? -3.280  -14.042 -9.078  1.00 112.06 ? 502  PRO A N   1 
ATOM 158  C CA  . PRO A 1 34  ? -2.256  -14.726 -9.855  1.00 111.95 ? 502  PRO A CA  1 
ATOM 159  C C   . PRO A 1 34  ? -2.334  -16.245 -9.755  1.00 114.53 ? 502  PRO A C   1 
ATOM 160  O O   . PRO A 1 34  ? -2.555  -16.788 -8.665  1.00 114.49 ? 502  PRO A O   1 
ATOM 161  C CB  . PRO A 1 34  ? -0.950  -14.197 -9.253  1.00 107.92 ? 502  PRO A CB  1 
ATOM 162  C CG  . PRO A 1 34  ? -1.285  -13.868 -7.848  1.00 106.36 ? 502  PRO A CG  1 
ATOM 163  C CD  . PRO A 1 34  ? -2.756  -13.545 -7.791  1.00 108.76 ? 502  PRO A CD  1 
ATOM 164  N N   . LYS A 1 35  ? -2.154  -16.901 -10.905 1.00 116.76 ? 503  LYS A N   1 
ATOM 165  C CA  . LYS A 1 35  ? -2.174  -18.363 -11.026 1.00 119.70 ? 503  LYS A CA  1 
ATOM 166  C C   . LYS A 1 35  ? -1.024  -19.019 -10.255 1.00 117.73 ? 503  LYS A C   1 
ATOM 167  O O   . LYS A 1 35  ? -1.232  -20.031 -9.576  1.00 119.61 ? 503  LYS A O   1 
ATOM 168  C CB  . LYS A 1 35  ? -2.144  -18.787 -12.504 1.00 122.79 ? 503  LYS A CB  1 
ATOM 169  C CG  . LYS A 1 35  ? -2.156  -20.297 -12.731 1.00 126.50 ? 503  LYS A CG  1 
ATOM 170  C CD  . LYS A 1 35  ? -1.822  -20.674 -14.170 1.00 129.08 ? 503  LYS A CD  1 
ATOM 171  C CE  . LYS A 1 35  ? -1.729  -22.190 -14.325 1.00 133.33 ? 503  LYS A CE  1 
ATOM 172  N NZ  . LYS A 1 35  ? -1.593  -22.617 -15.742 1.00 136.56 ? 503  LYS A NZ  1 
ATOM 173  N N   . GLU A 1 36  ? 0.178   -18.446 -10.358 1.00 113.94 ? 504  GLU A N   1 
ATOM 174  C CA  . GLU A 1 36  ? 1.343   -18.983 -9.652  1.00 111.86 ? 504  GLU A CA  1 
ATOM 175  C C   . GLU A 1 36  ? 2.100   -17.940 -8.838  1.00 106.86 ? 504  GLU A C   1 
ATOM 176  O O   . GLU A 1 36  ? 1.595   -16.839 -8.622  1.00 105.00 ? 504  GLU A O   1 
ATOM 177  C CB  . GLU A 1 36  ? 2.263   -19.723 -10.618 1.00 113.67 ? 504  GLU A CB  1 
ATOM 178  C CG  . GLU A 1 36  ? 1.839   -21.169 -10.831 1.00 118.87 ? 504  GLU A CG  1 
ATOM 179  C CD  . GLU A 1 36  ? 2.097   -21.648 -12.242 1.00 123.49 ? 504  GLU A CD  1 
ATOM 180  O OE1 . GLU A 1 36  ? 2.745   -20.892 -13.001 1.00 122.91 ? 504  GLU A OE1 1 
ATOM 181  O OE2 . GLU A 1 36  ? 1.652   -22.769 -12.597 1.00 127.86 ? 504  GLU A OE2 1 
ATOM 182  N N   . VAL A 1 37  ? 3.292   -18.303 -8.365  1.00 104.85 ? 505  VAL A N   1 
ATOM 183  C CA  . VAL A 1 37  ? 4.131   -17.406 -7.566  1.00 100.41 ? 505  VAL A CA  1 
ATOM 184  C C   . VAL A 1 37  ? 4.531   -16.160 -8.372  1.00 98.42  ? 505  VAL A C   1 
ATOM 185  O O   . VAL A 1 37  ? 4.873   -16.264 -9.556  1.00 99.83  ? 505  VAL A O   1 
ATOM 186  C CB  . VAL A 1 37  ? 5.365   -18.161 -7.012  1.00 99.87  ? 505  VAL A CB  1 
ATOM 187  C CG1 . VAL A 1 37  ? 6.568   -17.242 -6.841  1.00 96.78  ? 505  VAL A CG1 1 
ATOM 188  C CG2 . VAL A 1 37  ? 5.018   -18.840 -5.704  1.00 99.77  ? 505  VAL A CG2 1 
ATOM 189  N N   . THR A 1 38  ? 4.474   -14.992 -7.723  1.00 95.15  ? 506  THR A N   1 
ATOM 190  C CA  . THR A 1 38  ? 4.656   -13.686 -8.389  1.00 93.18  ? 506  THR A CA  1 
ATOM 191  C C   . THR A 1 38  ? 5.626   -12.760 -7.629  1.00 89.37  ? 506  THR A C   1 
ATOM 192  O O   . THR A 1 38  ? 5.733   -12.834 -6.414  1.00 88.10  ? 506  THR A O   1 
ATOM 193  C CB  . THR A 1 38  ? 3.276   -12.970 -8.596  1.00 93.96  ? 506  THR A CB  1 
ATOM 194  O OG1 . THR A 1 38  ? 2.331   -13.873 -9.196  1.00 97.34  ? 506  THR A OG1 1 
ATOM 195  C CG2 . THR A 1 38  ? 3.404   -11.727 -9.486  1.00 93.34  ? 506  THR A CG2 1 
ATOM 196  N N   . THR A 1 39  ? 6.324   -11.891 -8.355  1.00 87.93  ? 507  THR A N   1 
ATOM 197  C CA  . THR A 1 39  ? 7.289   -10.951 -7.776  1.00 84.80  ? 507  THR A CA  1 
ATOM 198  C C   . THR A 1 39  ? 6.893   -9.491  -8.035  1.00 83.41  ? 507  THR A C   1 
ATOM 199  O O   . THR A 1 39  ? 6.712   -9.077  -9.186  1.00 84.57  ? 507  THR A O   1 
ATOM 200  C CB  . THR A 1 39  ? 8.712   -11.202 -8.347  1.00 85.19  ? 507  THR A CB  1 
ATOM 201  O OG1 . THR A 1 39  ? 9.219   -12.457 -7.870  1.00 85.89  ? 507  THR A OG1 1 
ATOM 202  C CG2 . THR A 1 39  ? 9.682   -10.082 -7.967  1.00 83.09  ? 507  THR A CG2 1 
ATOM 203  N N   . VAL A 1 40  ? 6.783   -8.718  -6.955  1.00 81.05  ? 508  VAL A N   1 
ATOM 204  C CA  . VAL A 1 40  ? 6.419   -7.296  -7.007  1.00 79.53  ? 508  VAL A CA  1 
ATOM 205  C C   . VAL A 1 40  ? 7.378   -6.411  -6.209  1.00 77.35  ? 508  VAL A C   1 
ATOM 206  O O   . VAL A 1 40  ? 8.200   -6.908  -5.432  1.00 76.83  ? 508  VAL A O   1 
ATOM 207  C CB  . VAL A 1 40  ? 5.031   -7.083  -6.414  1.00 79.61  ? 508  VAL A CB  1 
ATOM 208  C CG1 . VAL A 1 40  ? 3.981   -7.585  -7.362  1.00 82.33  ? 508  VAL A CG1 1 
ATOM 209  C CG2 . VAL A 1 40  ? 4.921   -7.789  -5.072  1.00 78.84  ? 508  VAL A CG2 1 
ATOM 210  N N   . LYS A 1 41  ? 7.273   -5.100  -6.400  1.00 76.41  ? 509  LYS A N   1 
ATOM 211  C CA  . LYS A 1 41  ? 7.857   -4.144  -5.453  1.00 74.23  ? 509  LYS A CA  1 
ATOM 212  C C   . LYS A 1 41  ? 6.752   -3.293  -4.888  1.00 73.68  ? 509  LYS A C   1 
ATOM 213  O O   . LYS A 1 41  ? 6.040   -2.618  -5.617  1.00 74.78  ? 509  LYS A O   1 
ATOM 214  C CB  . LYS A 1 41  ? 8.896   -3.226  -6.107  1.00 74.02  ? 509  LYS A CB  1 
ATOM 215  C CG  . LYS A 1 41  ? 10.334  -3.706  -6.020  1.00 73.57  ? 509  LYS A CG  1 
ATOM 216  C CD  . LYS A 1 41  ? 11.283  -2.592  -6.400  1.00 73.41  ? 509  LYS A CD  1 
ATOM 217  C CE  . LYS A 1 41  ? 11.403  -2.446  -7.902  1.00 75.56  ? 509  LYS A CE  1 
ATOM 218  N NZ  . LYS A 1 41  ? 11.726  -1.045  -8.252  1.00 76.33  ? 509  LYS A NZ  1 
ATOM 219  N N   . VAL A 1 42  ? 6.593   -3.327  -3.586  1.00 72.29  ? 510  VAL A N   1 
ATOM 220  C CA  . VAL A 1 42  ? 5.726   -2.361  -2.970  1.00 72.07  ? 510  VAL A CA  1 
ATOM 221  C C   . VAL A 1 42  ? 6.648   -1.390  -2.254  1.00 70.75  ? 510  VAL A C   1 
ATOM 222  O O   . VAL A 1 42  ? 7.803   -1.710  -2.018  1.00 69.50  ? 510  VAL A O   1 
ATOM 223  C CB  . VAL A 1 42  ? 4.717   -3.048  -2.027  1.00 72.58  ? 510  VAL A CB  1 
ATOM 224  C CG1 . VAL A 1 42  ? 3.648   -3.770  -2.833  1.00 73.72  ? 510  VAL A CG1 1 
ATOM 225  C CG2 . VAL A 1 42  ? 5.420   -4.032  -1.136  1.00 71.40  ? 510  VAL A CG2 1 
ATOM 226  N N   . LYS A 1 43  ? 6.175   -0.188  -1.962  1.00 71.29  ? 511  LYS A N   1 
ATOM 227  C CA  . LYS A 1 43  ? 6.861   0.624   -0.953  1.00 71.00  ? 511  LYS A CA  1 
ATOM 228  C C   . LYS A 1 43  ? 6.041   0.556   0.330   1.00 71.48  ? 511  LYS A C   1 
ATOM 229  O O   . LYS A 1 43  ? 5.036   1.272   0.487   1.00 72.82  ? 511  LYS A O   1 
ATOM 230  C CB  . LYS A 1 43  ? 7.077   2.083   -1.374  1.00 71.36  ? 511  LYS A CB  1 
ATOM 231  C CG  . LYS A 1 43  ? 7.749   2.902   -0.269  1.00 71.12  ? 511  LYS A CG  1 
ATOM 232  C CD  . LYS A 1 43  ? 7.590   4.399   -0.440  1.00 72.57  ? 511  LYS A CD  1 
ATOM 233  C CE  . LYS A 1 43  ? 8.101   5.159   0.795   1.00 72.67  ? 511  LYS A CE  1 
ATOM 234  N NZ  . LYS A 1 43  ? 7.047   5.413   1.840   1.00 72.57  ? 511  LYS A NZ  1 
ATOM 235  N N   . ALA A 1 44  ? 6.481   -0.308  1.242   1.00 70.87  ? 512  ALA A N   1 
ATOM 236  C CA  . ALA A 1 44  ? 5.702   -0.657  2.428   1.00 71.19  ? 512  ALA A CA  1 
ATOM 237  C C   . ALA A 1 44  ? 6.395   -0.303  3.734   1.00 70.57  ? 512  ALA A C   1 
ATOM 238  O O   . ALA A 1 44  ? 7.582   0.040   3.751   1.00 69.98  ? 512  ALA A O   1 
ATOM 239  C CB  . ALA A 1 44  ? 5.378   -2.128  2.410   1.00 71.36  ? 512  ALA A CB  1 
ATOM 240  N N   . PHE A 1 45  ? 5.635   -0.388  4.825   1.00 70.97  ? 513  PHE A N   1 
ATOM 241  C CA  . PHE A 1 45  ? 6.197   -0.306  6.160   1.00 70.29  ? 513  PHE A CA  1 
ATOM 242  C C   . PHE A 1 45  ? 5.741   -1.483  6.993   1.00 70.63  ? 513  PHE A C   1 
ATOM 243  O O   . PHE A 1 45  ? 4.692   -2.072  6.713   1.00 71.60  ? 513  PHE A O   1 
ATOM 244  C CB  . PHE A 1 45  ? 5.819   1.009   6.826   1.00 71.33  ? 513  PHE A CB  1 
ATOM 245  C CG  . PHE A 1 45  ? 4.410   1.067   7.323   1.00 72.84  ? 513  PHE A CG  1 
ATOM 246  C CD1 . PHE A 1 45  ? 3.362   1.326   6.450   1.00 74.67  ? 513  PHE A CD1 1 
ATOM 247  C CD2 . PHE A 1 45  ? 4.135   0.904   8.672   1.00 73.94  ? 513  PHE A CD2 1 
ATOM 248  C CE1 . PHE A 1 45  ? 2.054   1.403   6.910   1.00 76.79  ? 513  PHE A CE1 1 
ATOM 249  C CE2 . PHE A 1 45  ? 2.833   0.973   9.147   1.00 76.44  ? 513  PHE A CE2 1 
ATOM 250  C CZ  . PHE A 1 45  ? 1.792   1.229   8.266   1.00 77.96  ? 513  PHE A CZ  1 
ATOM 251  N N   . ILE A 1 46  ? 6.542   -1.840  7.998   1.00 70.02  ? 514  ILE A N   1 
ATOM 252  C CA  . ILE A 1 46  ? 6.186   -2.930  8.904   1.00 70.50  ? 514  ILE A CA  1 
ATOM 253  C C   . ILE A 1 46  ? 5.162   -2.414  9.880   1.00 71.74  ? 514  ILE A C   1 
ATOM 254  O O   . ILE A 1 46  ? 5.415   -1.419  10.544  1.00 72.35  ? 514  ILE A O   1 
ATOM 255  C CB  . ILE A 1 46  ? 7.386   -3.442  9.716   1.00 69.73  ? 514  ILE A CB  1 
ATOM 256  C CG1 . ILE A 1 46  ? 8.447   -4.035  8.786   1.00 68.93  ? 514  ILE A CG1 1 
ATOM 257  C CG2 . ILE A 1 46  ? 6.913   -4.493  10.713  1.00 71.00  ? 514  ILE A CG2 1 
ATOM 258  C CD1 . ILE A 1 46  ? 9.394   -5.025  9.460   1.00 69.17  ? 514  ILE A CD1 1 
ATOM 259  N N   . VAL A 1 47  ? 4.008   -3.065  9.966   1.00 72.67  ? 515  VAL A N   1 
ATOM 260  C CA  . VAL A 1 47  ? 3.033   -2.677  10.983  1.00 74.24  ? 515  VAL A CA  1 
ATOM 261  C C   . VAL A 1 47  ? 3.483   -3.244  12.339  1.00 74.42  ? 515  VAL A C   1 
ATOM 262  O O   . VAL A 1 47  ? 3.878   -2.494  13.224  1.00 74.42  ? 515  VAL A O   1 
ATOM 263  C CB  . VAL A 1 47  ? 1.577   -3.088  10.614  1.00 76.24  ? 515  VAL A CB  1 
ATOM 264  C CG1 . VAL A 1 47  ? 0.625   -2.825  11.774  1.00 78.29  ? 515  VAL A CG1 1 
ATOM 265  C CG2 . VAL A 1 47  ? 1.120   -2.340  9.390   1.00 75.48  ? 515  VAL A CG2 1 
ATOM 266  N N   . THR A 1 48  ? 3.449   -4.562  12.486  1.00 74.37  ? 516  THR A N   1 
ATOM 267  C CA  . THR A 1 48  ? 3.885   -5.192  13.717  1.00 74.49  ? 516  THR A CA  1 
ATOM 268  C C   . THR A 1 48  ? 4.827   -6.323  13.366  1.00 73.50  ? 516  THR A C   1 
ATOM 269  O O   . THR A 1 48  ? 5.037   -6.598  12.184  1.00 72.59  ? 516  THR A O   1 
ATOM 270  C CB  . THR A 1 48  ? 2.701   -5.746  14.518  1.00 76.84  ? 516  THR A CB  1 
ATOM 271  O OG1 . THR A 1 48  ? 3.192   -6.339  15.719  1.00 76.28  ? 516  THR A OG1 1 
ATOM 272  C CG2 . THR A 1 48  ? 1.955   -6.799  13.720  1.00 77.52  ? 516  THR A CG2 1 
ATOM 273  N N   . LEU A 1 49  ? 5.405   -6.960  14.381  1.00 73.75  ? 517  LEU A N   1 
ATOM 274  C CA  . LEU A 1 49  ? 6.044   -8.248  14.184  1.00 73.73  ? 517  LEU A CA  1 
ATOM 275  C C   . LEU A 1 49  ? 5.052   -9.288  14.668  1.00 76.42  ? 517  LEU A C   1 
ATOM 276  O O   . LEU A 1 49  ? 4.558   -9.179  15.790  1.00 78.46  ? 517  LEU A O   1 
ATOM 277  C CB  . LEU A 1 49  ? 7.341   -8.356  14.981  1.00 72.84  ? 517  LEU A CB  1 
ATOM 278  C CG  . LEU A 1 49  ? 8.572   -7.549  14.568  1.00 70.72  ? 517  LEU A CG  1 
ATOM 279  C CD1 . LEU A 1 49  ? 9.584   -7.684  15.630  1.00 69.81  ? 517  LEU A CD1 1 
ATOM 280  C CD2 . LEU A 1 49  ? 9.168   -8.012  13.257  1.00 70.08  ? 517  LEU A CD2 1 
ATOM 281  N N   . THR A 1 50  ? 4.738   -10.286 13.843  1.00 77.08  ? 518  THR A N   1 
ATOM 282  C CA  . THR A 1 50  ? 3.737   -11.276 14.254  1.00 79.66  ? 518  THR A CA  1 
ATOM 283  C C   . THR A 1 50  ? 4.336   -12.448 15.034  1.00 80.62  ? 518  THR A C   1 
ATOM 284  O O   . THR A 1 50  ? 3.601   -13.297 15.550  1.00 83.32  ? 518  THR A O   1 
ATOM 285  C CB  . THR A 1 50  ? 2.849   -11.763 13.083  1.00 80.55  ? 518  THR A CB  1 
ATOM 286  O OG1 . THR A 1 50  ? 3.660   -12.337 12.053  1.00 78.77  ? 518  THR A OG1 1 
ATOM 287  C CG2 . THR A 1 50  ? 2.066   -10.601 12.512  1.00 80.54  ? 518  THR A CG2 1 
ATOM 288  N N   . GLY A 1 51  ? 5.661   -12.482 15.153  1.00 78.73  ? 519  GLY A N   1 
ATOM 289  C CA  . GLY A 1 51  ? 6.305   -13.603 15.824  1.00 79.73  ? 519  GLY A CA  1 
ATOM 290  C C   . GLY A 1 51  ? 7.692   -13.357 16.362  1.00 78.29  ? 519  GLY A C   1 
ATOM 291  O O   . GLY A 1 51  ? 8.295   -12.327 16.082  1.00 76.21  ? 519  GLY A O   1 
ATOM 292  N N   . ASN A 1 52  ? 8.183   -14.322 17.140  1.00 79.83  ? 520  ASN A N   1 
ATOM 293  C CA  . ASN A 1 52  ? 9.539   -14.309 17.677  1.00 79.42  ? 520  ASN A CA  1 
ATOM 294  C C   . ASN A 1 52  ? 10.563  -14.379 16.557  1.00 77.84  ? 520  ASN A C   1 
ATOM 295  O O   . ASN A 1 52  ? 10.290  -14.972 15.505  1.00 78.42  ? 520  ASN A O   1 
ATOM 296  C CB  . ASN A 1 52  ? 9.779   -15.525 18.576  1.00 81.72  ? 520  ASN A CB  1 
ATOM 297  C CG  . ASN A 1 52  ? 8.995   -15.489 19.877  1.00 84.96  ? 520  ASN A CG  1 
ATOM 298  O OD1 . ASN A 1 52  ? 8.346   -16.470 20.237  1.00 89.86  ? 520  ASN A OD1 1 
ATOM 299  N ND2 . ASN A 1 52  ? 9.074   -14.384 20.604  1.00 85.39  ? 520  ASN A ND2 1 
ATOM 300  N N   . LEU A 1 53  ? 11.742  -13.804 16.778  1.00 76.50  ? 521  LEU A N   1 
ATOM 301  C CA  . LEU A 1 53  ? 12.865  -14.047 15.884  1.00 75.70  ? 521  LEU A CA  1 
ATOM 302  C C   . LEU A 1 53  ? 13.352  -15.480 16.062  1.00 77.85  ? 521  LEU A C   1 
ATOM 303  O O   . LEU A 1 53  ? 13.717  -15.888 17.164  1.00 79.08  ? 521  LEU A O   1 
ATOM 304  C CB  . LEU A 1 53  ? 14.017  -13.061 16.120  1.00 74.17  ? 521  LEU A CB  1 
ATOM 305  C CG  . LEU A 1 53  ? 15.323  -13.349 15.350  1.00 72.59  ? 521  LEU A CG  1 
ATOM 306  C CD1 . LEU A 1 53  ? 15.098  -13.343 13.854  1.00 70.07  ? 521  LEU A CD1 1 
ATOM 307  C CD2 . LEU A 1 53  ? 16.448  -12.390 15.716  1.00 70.57  ? 521  LEU A CD2 1 
ATOM 308  N N   . SER A 1 54  ? 13.354  -16.235 14.969  1.00 78.87  ? 522  SER A N   1 
ATOM 309  C CA  . SER A 1 54  ? 13.810  -17.623 14.979  1.00 81.48  ? 522  SER A CA  1 
ATOM 310  C C   . SER A 1 54  ? 15.202  -17.762 14.361  1.00 81.27  ? 522  SER A C   1 
ATOM 311  O O   . SER A 1 54  ? 15.575  -17.011 13.464  1.00 79.49  ? 522  SER A O   1 
ATOM 312  C CB  . SER A 1 54  ? 12.793  -18.537 14.268  1.00 83.25  ? 522  SER A CB  1 
ATOM 313  O OG  . SER A 1 54  ? 13.290  -19.856 14.063  1.00 85.57  ? 522  SER A OG  1 
ATOM 314  N N   . SER A 1 55  ? 15.956  -18.731 14.876  1.00 83.61  ? 523  SER A N   1 
ATOM 315  C CA  . SER A 1 55  ? 17.301  -19.067 14.393  1.00 84.33  ? 523  SER A CA  1 
ATOM 316  C C   . SER A 1 55  ? 17.369  -20.556 14.048  1.00 86.93  ? 523  SER A C   1 
ATOM 317  O O   . SER A 1 55  ? 18.455  -21.124 13.873  1.00 88.00  ? 523  SER A O   1 
ATOM 318  C CB  . SER A 1 55  ? 18.353  -18.737 15.461  1.00 84.46  ? 523  SER A CB  1 
ATOM 319  O OG  . SER A 1 55  ? 18.485  -19.803 16.386  1.00 85.83  ? 523  SER A OG  1 
ATOM 320  N N   . SER A 1 56  ? 16.197  -21.180 13.974  1.00 88.22  ? 524  SER A N   1 
ATOM 321  C CA  . SER A 1 56  ? 16.103  -22.607 13.739  1.00 91.19  ? 524  SER A CA  1 
ATOM 322  C C   . SER A 1 56  ? 16.396  -22.892 12.276  1.00 91.39  ? 524  SER A C   1 
ATOM 323  O O   . SER A 1 56  ? 16.166  -22.041 11.405  1.00 89.61  ? 524  SER A O   1 
ATOM 324  C CB  . SER A 1 56  ? 14.720  -23.122 14.126  1.00 92.67  ? 524  SER A CB  1 
ATOM 325  O OG  . SER A 1 56  ? 13.733  -22.484 13.338  1.00 92.13  ? 524  SER A OG  1 
ATOM 326  N N   . GLY A 1 57  ? 16.913  -24.090 12.022  1.00 93.84  ? 525  GLY A N   1 
ATOM 327  C CA  . GLY A 1 57  ? 17.314  -24.488 10.687  1.00 94.41  ? 525  GLY A CA  1 
ATOM 328  C C   . GLY A 1 57  ? 18.667  -23.907 10.337  1.00 93.18  ? 525  GLY A C   1 
ATOM 329  O O   . GLY A 1 57  ? 19.101  -23.987 9.192   1.00 93.90  ? 525  GLY A O   1 
ATOM 330  N N   . GLY A 1 58  ? 19.340  -23.319 11.321  1.00 91.78  ? 526  GLY A N   1 
ATOM 331  C CA  . GLY A 1 58  ? 20.662  -22.736 11.101  1.00 90.94  ? 526  GLY A CA  1 
ATOM 332  C C   . GLY A 1 58  ? 20.667  -21.378 10.411  1.00 88.16  ? 526  GLY A C   1 
ATOM 333  O O   . GLY A 1 58  ? 21.728  -20.888 10.015  1.00 88.25  ? 526  GLY A O   1 
ATOM 334  N N   . ILE A 1 59  ? 19.484  -20.773 10.271  1.00 86.03  ? 527  ILE A N   1 
ATOM 335  C CA  . ILE A 1 59  ? 19.320  -19.446 9.652   1.00 82.77  ? 527  ILE A CA  1 
ATOM 336  C C   . ILE A 1 59  ? 18.269  -18.593 10.393  1.00 80.70  ? 527  ILE A C   1 
ATOM 337  O O   . ILE A 1 59  ? 17.453  -19.131 11.161  1.00 81.26  ? 527  ILE A O   1 
ATOM 338  C CB  . ILE A 1 59  ? 19.017  -19.540 8.118   1.00 82.88  ? 527  ILE A CB  1 
ATOM 339  C CG1 . ILE A 1 59  ? 18.004  -20.646 7.786   1.00 83.73  ? 527  ILE A CG1 1 
ATOM 340  C CG2 . ILE A 1 59  ? 20.303  -19.773 7.342   1.00 84.15  ? 527  ILE A CG2 1 
ATOM 341  C CD1 . ILE A 1 59  ? 16.555  -20.261 7.975   1.00 82.37  ? 527  ILE A CD1 1 
ATOM 342  N N   . TRP A 1 60  ? 18.305  -17.272 10.176  1.00 78.19  ? 528  TRP A N   1 
ATOM 343  C CA  . TRP A 1 60  ? 17.313  -16.359 10.765  1.00 76.23  ? 528  TRP A CA  1 
ATOM 344  C C   . TRP A 1 60  ? 15.982  -16.392 10.001  1.00 75.58  ? 528  TRP A C   1 
ATOM 345  O O   . TRP A 1 60  ? 15.955  -16.616 8.796   1.00 75.76  ? 528  TRP A O   1 
ATOM 346  C CB  . TRP A 1 60  ? 17.816  -14.908 10.820  1.00 74.45  ? 528  TRP A CB  1 
ATOM 347  C CG  . TRP A 1 60  ? 19.196  -14.663 11.376  1.00 75.52  ? 528  TRP A CG  1 
ATOM 348  C CD1 . TRP A 1 60  ? 20.300  -14.266 10.672  1.00 76.72  ? 528  TRP A CD1 1 
ATOM 349  C CD2 . TRP A 1 60  ? 19.612  -14.752 12.746  1.00 77.42  ? 528  TRP A CD2 1 
ATOM 350  N NE1 . TRP A 1 60  ? 21.380  -14.116 11.509  1.00 77.56  ? 528  TRP A NE1 1 
ATOM 351  C CE2 . TRP A 1 60  ? 20.989  -14.412 12.788  1.00 78.44  ? 528  TRP A CE2 1 
ATOM 352  C CE3 . TRP A 1 60  ? 18.963  -15.103 13.942  1.00 78.52  ? 528  TRP A CE3 1 
ATOM 353  C CZ2 . TRP A 1 60  ? 21.730  -14.410 13.984  1.00 79.91  ? 528  TRP A CZ2 1 
ATOM 354  C CZ3 . TRP A 1 60  ? 19.700  -15.101 15.134  1.00 79.42  ? 528  TRP A CZ3 1 
ATOM 355  C CH2 . TRP A 1 60  ? 21.070  -14.753 15.142  1.00 80.14  ? 528  TRP A CH2 1 
ATOM 356  N N   . SER A 1 61  ? 14.887  -16.161 10.716  1.00 75.16  ? 529  SER A N   1 
ATOM 357  C CA  . SER A 1 61  ? 13.559  -16.010 10.123  1.00 75.13  ? 529  SER A CA  1 
ATOM 358  C C   . SER A 1 61  ? 12.694  -15.192 11.063  1.00 74.46  ? 529  SER A C   1 
ATOM 359  O O   . SER A 1 61  ? 12.887  -15.247 12.273  1.00 75.18  ? 529  SER A O   1 
ATOM 360  C CB  . SER A 1 61  ? 12.911  -17.373 9.921   1.00 77.50  ? 529  SER A CB  1 
ATOM 361  O OG  . SER A 1 61  ? 12.916  -18.115 11.131  1.00 79.09  ? 529  SER A OG  1 
ATOM 362  N N   . ILE A 1 62  ? 11.745  -14.434 10.526  1.00 73.56  ? 530  ILE A N   1 
ATOM 363  C CA  . ILE A 1 62  ? 10.793  -13.715 11.377  1.00 73.15  ? 530  ILE A CA  1 
ATOM 364  C C   . ILE A 1 62  ? 9.525   -13.341 10.624  1.00 73.84  ? 530  ILE A C   1 
ATOM 365  O O   . ILE A 1 62  ? 9.568   -12.907 9.475   1.00 73.34  ? 530  ILE A O   1 
ATOM 366  C CB  . ILE A 1 62  ? 11.420  -12.464 12.025  1.00 71.31  ? 530  ILE A CB  1 
ATOM 367  C CG1 . ILE A 1 62  ? 10.540  -11.950 13.167  1.00 71.13  ? 530  ILE A CG1 1 
ATOM 368  C CG2 . ILE A 1 62  ? 11.706  -11.391 10.977  1.00 69.48  ? 530  ILE A CG2 1 
ATOM 369  C CD1 . ILE A 1 62  ? 11.238  -10.997 14.111  1.00 69.45  ? 530  ILE A CD1 1 
ATOM 370  N N   . THR A 1 63  ? 8.387   -13.519 11.274  1.00 75.65  ? 531  THR A N   1 
ATOM 371  C CA  . THR A 1 63  ? 7.118   -13.122 10.679  1.00 76.41  ? 531  THR A CA  1 
ATOM 372  C C   . THR A 1 63  ? 6.686   -11.713 11.124  1.00 75.50  ? 531  THR A C   1 
ATOM 373  O O   . THR A 1 63  ? 6.486   -11.424 12.314  1.00 75.76  ? 531  THR A O   1 
ATOM 374  C CB  . THR A 1 63  ? 6.027   -14.177 10.942  1.00 79.15  ? 531  THR A CB  1 
ATOM 375  O OG1 . THR A 1 63  ? 5.705   -14.207 12.340  1.00 81.07  ? 531  THR A OG1 1 
ATOM 376  C CG2 . THR A 1 63  ? 6.530   -15.552 10.536  1.00 80.24  ? 531  THR A CG2 1 
ATOM 377  N N   . ALA A 1 64  ? 6.585   -10.825 10.151  1.00 74.44  ? 532  ALA A N   1 
ATOM 378  C CA  . ALA A 1 64  ? 5.998   -9.530  10.398  1.00 74.44  ? 532  ALA A CA  1 
ATOM 379  C C   . ALA A 1 64  ? 4.770   -9.358  9.521   1.00 75.73  ? 532  ALA A C   1 
ATOM 380  O O   . ALA A 1 64  ? 4.580   -10.082 8.540   1.00 76.25  ? 532  ALA A O   1 
ATOM 381  C CB  . ALA A 1 64  ? 6.995   -8.443  10.137  1.00 72.45  ? 532  ALA A CB  1 
ATOM 382  N N   . LYS A 1 65  ? 3.916   -8.423  9.912   1.00 76.79  ? 533  LYS A N   1 
ATOM 383  C CA  . LYS A 1 65  ? 2.816   -7.992  9.075   1.00 78.27  ? 533  LYS A CA  1 
ATOM 384  C C   . LYS A 1 65  ? 3.157   -6.599  8.577   1.00 76.61  ? 533  LYS A C   1 
ATOM 385  O O   . LYS A 1 65  ? 3.479   -5.709  9.368   1.00 76.25  ? 533  LYS A O   1 
ATOM 386  C CB  . LYS A 1 65  ? 1.507   -7.996  9.859   1.00 81.07  ? 533  LYS A CB  1 
ATOM 387  C CG  . LYS A 1 65  ? 0.271   -7.630  9.049   1.00 84.01  ? 533  LYS A CG  1 
ATOM 388  C CD  . LYS A 1 65  ? -0.989  -8.259  9.665   1.00 89.65  ? 533  LYS A CD  1 
ATOM 389  C CE  . LYS A 1 65  ? -1.345  -9.598  9.011   1.00 92.11  ? 533  LYS A CE  1 
ATOM 390  N NZ  . LYS A 1 65  ? -2.339  -10.405 9.791   1.00 96.52  ? 533  LYS A NZ  1 
ATOM 391  N N   . VAL A 1 66  ? 3.121   -6.430  7.261   1.00 76.02  ? 534  VAL A N   1 
ATOM 392  C CA  . VAL A 1 66  ? 3.453   -5.155  6.631   1.00 74.74  ? 534  VAL A CA  1 
ATOM 393  C C   . VAL A 1 66  ? 2.231   -4.602  5.907   1.00 76.29  ? 534  VAL A C   1 
ATOM 394  O O   . VAL A 1 66  ? 1.162   -5.226  5.908   1.00 78.36  ? 534  VAL A O   1 
ATOM 395  C CB  . VAL A 1 66  ? 4.647   -5.272  5.659   1.00 72.93  ? 534  VAL A CB  1 
ATOM 396  C CG1 . VAL A 1 66  ? 5.895   -5.725  6.400   1.00 71.38  ? 534  VAL A CG1 1 
ATOM 397  C CG2 . VAL A 1 66  ? 4.319   -6.216  4.499   1.00 73.91  ? 534  VAL A CG2 1 
ATOM 398  N N   . SER A 1 67  ? 2.390   -3.426  5.309   1.00 75.50  ? 535  SER A N   1 
ATOM 399  C CA  . SER A 1 67  ? 1.303   -2.766  4.608   1.00 77.03  ? 535  SER A CA  1 
ATOM 400  C C   . SER A 1 67  ? 1.875   -1.762  3.625   1.00 76.28  ? 535  SER A C   1 
ATOM 401  O O   . SER A 1 67  ? 3.006   -1.310  3.796   1.00 74.90  ? 535  SER A O   1 
ATOM 402  C CB  . SER A 1 67  ? 0.379   -2.054  5.592   1.00 78.43  ? 535  SER A CB  1 
ATOM 403  O OG  . SER A 1 67  ? -0.508  -1.183  4.909   1.00 80.10  ? 535  SER A OG  1 
ATOM 404  N N   . ASP A 1 68  ? 1.084   -1.421  2.604   1.00 77.62  ? 536  ASP A N   1 
ATOM 405  C CA  . ASP A 1 68  ? 1.467   -0.452  1.578   1.00 77.11  ? 536  ASP A CA  1 
ATOM 406  C C   . ASP A 1 68  ? 0.337   0.553   1.344   1.00 78.96  ? 536  ASP A C   1 
ATOM 407  O O   . ASP A 1 68  ? 0.380   1.338   0.390   1.00 79.21  ? 536  ASP A O   1 
ATOM 408  C CB  . ASP A 1 68  ? 1.798   -1.164  0.270   1.00 76.85  ? 536  ASP A CB  1 
ATOM 409  C CG  . ASP A 1 68  ? 0.557   -1.528  -0.516  1.00 79.49  ? 536  ASP A CG  1 
ATOM 410  O OD1 . ASP A 1 68  ? -0.433  -1.987  0.085   1.00 81.79  ? 536  ASP A OD1 1 
ATOM 411  O OD2 . ASP A 1 68  ? 0.555   -1.343  -1.742  1.00 81.47  ? 536  ASP A OD2 1 
ATOM 412  N N   . GLY A 1 69  ? -0.672  0.520   2.210   1.00 80.51  ? 537  GLY A N   1 
ATOM 413  C CA  . GLY A 1 69  ? -1.763  1.466   2.124   1.00 82.95  ? 537  GLY A CA  1 
ATOM 414  C C   . GLY A 1 69  ? -2.977  0.908   1.414   1.00 85.63  ? 537  GLY A C   1 
ATOM 415  O O   . GLY A 1 69  ? -4.088  1.415   1.586   1.00 88.23  ? 537  GLY A O   1 
ATOM 416  N N   . THR A 1 70  ? -2.769  -0.135  0.613   1.00 85.55  ? 538  THR A N   1 
ATOM 417  C CA  . THR A 1 70  ? -3.869  -0.808  -0.094  1.00 88.06  ? 538  THR A CA  1 
ATOM 418  C C   . THR A 1 70  ? -4.355  -2.093  0.603   1.00 89.51  ? 538  THR A C   1 
ATOM 419  O O   . THR A 1 70  ? -5.554  -2.402  0.573   1.00 92.34  ? 538  THR A O   1 
ATOM 420  C CB  . THR A 1 70  ? -3.534  -1.111  -1.590  1.00 87.71  ? 538  THR A CB  1 
ATOM 421  O OG1 . THR A 1 70  ? -2.420  -2.013  -1.697  1.00 85.26  ? 538  THR A OG1 1 
ATOM 422  C CG2 . THR A 1 70  ? -3.240  0.158   -2.335  1.00 86.85  ? 538  THR A CG2 1 
ATOM 423  N N   . ALA A 1 71  ? -3.428  -2.826  1.222   1.00 87.72  ? 539  ALA A N   1 
ATOM 424  C CA  . ALA A 1 71  ? -3.745  -4.066  1.925   1.00 88.95  ? 539  ALA A CA  1 
ATOM 425  C C   . ALA A 1 71  ? -2.820  -4.263  3.124   1.00 87.21  ? 539  ALA A C   1 
ATOM 426  O O   . ALA A 1 71  ? -1.922  -3.449  3.350   1.00 85.14  ? 539  ALA A O   1 
ATOM 427  C CB  . ALA A 1 71  ? -3.644  -5.245  0.971   1.00 89.44  ? 539  ALA A CB  1 
ATOM 428  N N   . TYR A 1 72  ? -3.068  -5.321  3.901   1.00 88.32  ? 540  TYR A N   1 
ATOM 429  C CA  . TYR A 1 72  ? -2.094  -5.822  4.879   1.00 86.86  ? 540  TYR A CA  1 
ATOM 430  C C   . TYR A 1 72  ? -1.479  -7.120  4.343   1.00 86.58  ? 540  TYR A C   1 
ATOM 431  O O   . TYR A 1 72  ? -2.097  -7.808  3.528   1.00 88.21  ? 540  TYR A O   1 
ATOM 432  C CB  . TYR A 1 72  ? -2.739  -6.090  6.249   1.00 88.70  ? 540  TYR A CB  1 
ATOM 433  C CG  . TYR A 1 72  ? -3.273  -4.875  6.994   1.00 88.97  ? 540  TYR A CG  1 
ATOM 434  C CD1 . TYR A 1 72  ? -2.432  -4.066  7.754   1.00 86.61  ? 540  TYR A CD1 1 
ATOM 435  C CD2 . TYR A 1 72  ? -4.633  -4.558  6.969   1.00 91.30  ? 540  TYR A CD2 1 
ATOM 436  C CE1 . TYR A 1 72  ? -2.937  -2.953  8.446   1.00 86.86  ? 540  TYR A CE1 1 
ATOM 437  C CE2 . TYR A 1 72  ? -5.140  -3.459  7.663   1.00 91.03  ? 540  TYR A CE2 1 
ATOM 438  C CZ  . TYR A 1 72  ? -4.289  -2.663  8.393   1.00 88.78  ? 540  TYR A CZ  1 
ATOM 439  O OH  . TYR A 1 72  ? -4.786  -1.574  9.064   1.00 89.53  ? 540  TYR A OH  1 
ATOM 440  N N   . LEU A 1 73  ? -0.272  -7.458  4.806   1.00 84.96  ? 541  LEU A N   1 
ATOM 441  C CA  . LEU A 1 73  ? 0.413   -8.685  4.372   1.00 84.96  ? 541  LEU A CA  1 
ATOM 442  C C   . LEU A 1 73  ? 1.334   -9.291  5.429   1.00 84.32  ? 541  LEU A C   1 
ATOM 443  O O   . LEU A 1 73  ? 2.209   -8.615  5.959   1.00 82.37  ? 541  LEU A O   1 
ATOM 444  C CB  . LEU A 1 73  ? 1.221   -8.432  3.093   1.00 83.39  ? 541  LEU A CB  1 
ATOM 445  C CG  . LEU A 1 73  ? 1.612   -9.659  2.258   1.00 83.77  ? 541  LEU A CG  1 
ATOM 446  C CD1 . LEU A 1 73  ? 0.431   -10.199 1.434   1.00 86.24  ? 541  LEU A CD1 1 
ATOM 447  C CD2 . LEU A 1 73  ? 2.781   -9.331  1.357   1.00 81.24  ? 541  LEU A CD2 1 
ATOM 448  N N   . ASP A 1 74  ? 1.127   -10.572 5.717   1.00 86.35  ? 542  ASP A N   1 
ATOM 449  C CA  . ASP A 1 74  ? 2.056   -11.345 6.517   1.00 86.29  ? 542  ASP A CA  1 
ATOM 450  C C   . ASP A 1 74  ? 3.246   -11.740 5.667   1.00 84.92  ? 542  ASP A C   1 
ATOM 451  O O   . ASP A 1 74  ? 3.084   -12.339 4.597   1.00 85.85  ? 542  ASP A O   1 
ATOM 452  C CB  . ASP A 1 74  ? 1.382   -12.613 7.026   1.00 89.39  ? 542  ASP A CB  1 
ATOM 453  C CG  . ASP A 1 74  ? 0.514   -12.367 8.231   1.00 92.34  ? 542  ASP A CG  1 
ATOM 454  O OD1 . ASP A 1 74  ? -0.653  -12.802 8.198   1.00 96.83  ? 542  ASP A OD1 1 
ATOM 455  O OD2 . ASP A 1 74  ? 0.990   -11.746 9.212   1.00 92.95  ? 542  ASP A OD2 1 
ATOM 456  N N   . VAL A 1 75  ? 4.441   -11.416 6.149   1.00 83.18  ? 543  VAL A N   1 
ATOM 457  C CA  . VAL A 1 75  ? 5.674   -11.787 5.453   1.00 82.37  ? 543  VAL A CA  1 
ATOM 458  C C   . VAL A 1 75  ? 6.656   -12.546 6.330   1.00 82.60  ? 543  VAL A C   1 
ATOM 459  O O   . VAL A 1 75  ? 6.681   -12.382 7.553   1.00 82.79  ? 543  VAL A O   1 
ATOM 460  C CB  . VAL A 1 75  ? 6.412   -10.574 4.827   1.00 80.14  ? 543  VAL A CB  1 
ATOM 461  C CG1 . VAL A 1 75  ? 5.702   -10.117 3.582   1.00 80.77  ? 543  VAL A CG1 1 
ATOM 462  C CG2 . VAL A 1 75  ? 6.570   -9.428  5.825   1.00 78.48  ? 543  VAL A CG2 1 
ATOM 463  N N   . ASP A 1 76  ? 7.448   -13.391 5.680   1.00 83.29  ? 544  ASP A N   1 
ATOM 464  C CA  . ASP A 1 76  ? 8.601   -14.029 6.292   1.00 83.51  ? 544  ASP A CA  1 
ATOM 465  C C   . ASP A 1 76  ? 9.786   -13.242 5.772   1.00 81.44  ? 544  ASP A C   1 
ATOM 466  O O   . ASP A 1 76  ? 9.678   -12.543 4.761   1.00 80.85  ? 544  ASP A O   1 
ATOM 467  C CB  . ASP A 1 76  ? 8.733   -15.499 5.856   1.00 86.06  ? 544  ASP A CB  1 
ATOM 468  C CG  . ASP A 1 76  ? 7.390   -16.278 5.889   1.00 90.20  ? 544  ASP A CG  1 
ATOM 469  O OD1 . ASP A 1 76  ? 6.554   -16.053 6.802   1.00 92.42  ? 544  ASP A OD1 1 
ATOM 470  O OD2 . ASP A 1 76  ? 7.183   -17.142 4.997   1.00 93.13  ? 544  ASP A OD2 1 
ATOM 471  N N   . PHE A 1 77  ? 10.919  -13.356 6.451   1.00 80.62  ? 545  PHE A N   1 
ATOM 472  C CA  . PHE A 1 77  ? 12.106  -12.645 6.023   1.00 78.84  ? 545  PHE A CA  1 
ATOM 473  C C   . PHE A 1 77  ? 13.229  -13.578 5.638   1.00 79.81  ? 545  PHE A C   1 
ATOM 474  O O   . PHE A 1 77  ? 13.606  -14.489 6.382   1.00 80.66  ? 545  PHE A O   1 
ATOM 475  C CB  . PHE A 1 77  ? 12.568  -11.663 7.084   1.00 77.40  ? 545  PHE A CB  1 
ATOM 476  C CG  . PHE A 1 77  ? 11.801  -10.375 7.087   1.00 75.90  ? 545  PHE A CG  1 
ATOM 477  C CD1 . PHE A 1 77  ? 12.335  -9.236  6.503   1.00 74.50  ? 545  PHE A CD1 1 
ATOM 478  C CD2 . PHE A 1 77  ? 10.549  -10.295 7.678   1.00 75.61  ? 545  PHE A CD2 1 
ATOM 479  C CE1 . PHE A 1 77  ? 11.634  -8.040  6.511   1.00 73.09  ? 545  PHE A CE1 1 
ATOM 480  C CE2 . PHE A 1 77  ? 9.846   -9.106  7.689   1.00 74.37  ? 545  PHE A CE2 1 
ATOM 481  C CZ  . PHE A 1 77  ? 10.390  -7.977  7.108   1.00 73.18  ? 545  PHE A CZ  1 
ATOM 482  N N   . VAL A 1 78  ? 13.739  -13.332 4.439   1.00 79.86  ? 546  VAL A N   1 
ATOM 483  C CA  . VAL A 1 78  ? 14.910  -14.003 3.911   1.00 80.77  ? 546  VAL A CA  1 
ATOM 484  C C   . VAL A 1 78  ? 16.041  -13.814 4.898   1.00 79.83  ? 546  VAL A C   1 
ATOM 485  O O   . VAL A 1 78  ? 16.384  -12.674 5.260   1.00 78.68  ? 546  VAL A O   1 
ATOM 486  C CB  . VAL A 1 78  ? 15.282  -13.426 2.501   1.00 81.11  ? 546  VAL A CB  1 
ATOM 487  C CG1 . VAL A 1 78  ? 16.780  -13.533 2.196   1.00 81.50  ? 546  VAL A CG1 1 
ATOM 488  C CG2 . VAL A 1 78  ? 14.452  -14.120 1.403   1.00 83.22  ? 546  VAL A CG2 1 
ATOM 489  N N   . ASP A 1 79  ? 16.589  -14.938 5.348   1.00 80.30  ? 547  ASP A N   1 
ATOM 490  C CA  . ASP A 1 79  ? 17.781  -14.952 6.187   1.00 79.85  ? 547  ASP A CA  1 
ATOM 491  C C   . ASP A 1 79  ? 18.862  -13.917 5.808   1.00 78.73  ? 547  ASP A C   1 
ATOM 492  O O   . ASP A 1 79  ? 19.474  -13.319 6.699   1.00 78.05  ? 547  ASP A O   1 
ATOM 493  C CB  . ASP A 1 79  ? 18.375  -16.354 6.201   1.00 81.97  ? 547  ASP A CB  1 
ATOM 494  C CG  . ASP A 1 79  ? 19.855  -16.351 6.481   1.00 82.95  ? 547  ASP A CG  1 
ATOM 495  O OD1 . ASP A 1 79  ? 20.257  -15.977 7.613   1.00 81.82  ? 547  ASP A OD1 1 
ATOM 496  O OD2 . ASP A 1 79  ? 20.610  -16.733 5.557   1.00 84.66  ? 547  ASP A OD2 1 
ATOM 497  N N   . GLU A 1 80  ? 19.087  -13.720 4.503   1.00 78.44  ? 548  GLU A N   1 
ATOM 498  C CA  . GLU A 1 80  ? 20.000  -12.682 3.978   1.00 77.65  ? 548  GLU A CA  1 
ATOM 499  C C   . GLU A 1 80  ? 19.801  -11.260 4.542   1.00 74.92  ? 548  GLU A C   1 
ATOM 500  O O   . GLU A 1 80  ? 20.769  -10.607 4.943   1.00 74.65  ? 548  GLU A O   1 
ATOM 501  C CB  . GLU A 1 80  ? 19.929  -12.625 2.447   1.00 78.70  ? 548  GLU A CB  1 
ATOM 502  C CG  . GLU A 1 80  ? 20.911  -13.543 1.725   1.00 82.69  ? 548  GLU A CG  1 
ATOM 503  C CD  . GLU A 1 80  ? 20.405  -14.969 1.601   1.00 86.55  ? 548  GLU A CD  1 
ATOM 504  O OE1 . GLU A 1 80  ? 19.567  -15.362 2.451   1.00 87.25  ? 548  GLU A OE1 1 
ATOM 505  O OE2 . GLU A 1 80  ? 20.842  -15.690 0.659   1.00 88.47  ? 548  GLU A OE2 1 
ATOM 506  N N   . ILE A 1 81  ? 18.556  -10.788 4.548   1.00 72.60  ? 549  ILE A N   1 
ATOM 507  C CA  . ILE A 1 81  ? 18.224  -9.491  5.119   1.00 70.26  ? 549  ILE A CA  1 
ATOM 508  C C   . ILE A 1 81  ? 18.640  -9.429  6.591   1.00 69.74  ? 549  ILE A C   1 
ATOM 509  O O   . ILE A 1 81  ? 19.369  -8.522  7.014   1.00 69.32  ? 549  ILE A O   1 
ATOM 510  C CB  . ILE A 1 81  ? 16.718  -9.199  5.004   1.00 69.34  ? 549  ILE A CB  1 
ATOM 511  C CG1 . ILE A 1 81  ? 16.313  -9.063  3.545   1.00 68.97  ? 549  ILE A CG1 1 
ATOM 512  C CG2 . ILE A 1 81  ? 16.355  -7.925  5.756   1.00 68.25  ? 549  ILE A CG2 1 
ATOM 513  C CD1 . ILE A 1 81  ? 14.881  -8.665  3.366   1.00 67.98  ? 549  ILE A CD1 1 
ATOM 514  N N   . LEU A 1 82  ? 18.181  -10.412 7.359   1.00 69.48  ? 550  LEU A N   1 
ATOM 515  C CA  . LEU A 1 82  ? 18.394  -10.414 8.794   1.00 68.99  ? 550  LEU A CA  1 
ATOM 516  C C   . LEU A 1 82  ? 19.883  -10.413 9.156   1.00 69.85  ? 550  LEU A C   1 
ATOM 517  O O   . LEU A 1 82  ? 20.330  -9.569  9.928   1.00 69.73  ? 550  LEU A O   1 
ATOM 518  C CB  . LEU A 1 82  ? 17.621  -11.564 9.438   1.00 69.23  ? 550  LEU A CB  1 
ATOM 519  C CG  . LEU A 1 82  ? 16.124  -11.530 9.112   1.00 68.14  ? 550  LEU A CG  1 
ATOM 520  C CD1 . LEU A 1 82  ? 15.411  -12.783 9.550   1.00 68.70  ? 550  LEU A CD1 1 
ATOM 521  C CD2 . LEU A 1 82  ? 15.447  -10.318 9.725   1.00 67.08  ? 550  LEU A CD2 1 
ATOM 522  N N   . THR A 1 83  ? 20.653  -11.319 8.561   1.00 71.04  ? 551  THR A N   1 
ATOM 523  C CA  . THR A 1 83  ? 22.091  -11.395 8.803   1.00 72.52  ? 551  THR A CA  1 
ATOM 524  C C   . THR A 1 83  ? 22.741  -10.015 8.662   1.00 72.18  ? 551  THR A C   1 
ATOM 525  O O   . THR A 1 83  ? 23.562  -9.624  9.489   1.00 72.83  ? 551  THR A O   1 
ATOM 526  C CB  . THR A 1 83  ? 22.777  -12.406 7.843   1.00 74.40  ? 551  THR A CB  1 
ATOM 527  O OG1 . THR A 1 83  ? 22.125  -13.679 7.929   1.00 75.53  ? 551  THR A OG1 1 
ATOM 528  C CG2 . THR A 1 83  ? 24.254  -12.586 8.180   1.00 76.36  ? 551  THR A CG2 1 
ATOM 529  N N   . SER A 1 84  ? 22.357  -9.280  7.619   1.00 71.49  ? 552  SER A N   1 
ATOM 530  C CA  . SER A 1 84  ? 22.896  -7.936  7.366   1.00 71.15  ? 552  SER A CA  1 
ATOM 531  C C   . SER A 1 84  ? 22.443  -6.936  8.424   1.00 70.16  ? 552  SER A C   1 
ATOM 532  O O   . SER A 1 84  ? 23.228  -6.076  8.843   1.00 71.00  ? 552  SER A O   1 
ATOM 533  C CB  . SER A 1 84  ? 22.467  -7.432  5.992   1.00 70.51  ? 552  SER A CB  1 
ATOM 534  O OG  . SER A 1 84  ? 21.120  -7.006  6.005   1.00 68.53  ? 552  SER A OG  1 
ATOM 535  N N   . LEU A 1 85  ? 21.176  -7.050  8.831   1.00 68.56  ? 553  LEU A N   1 
ATOM 536  C CA  . LEU A 1 85  ? 20.576  -6.151  9.819   1.00 67.63  ? 553  LEU A CA  1 
ATOM 537  C C   . LEU A 1 85  ? 21.172  -6.338  11.205  1.00 68.42  ? 553  LEU A C   1 
ATOM 538  O O   . LEU A 1 85  ? 21.168  -5.412  12.022  1.00 68.38  ? 553  LEU A O   1 
ATOM 539  C CB  . LEU A 1 85  ? 19.066  -6.373  9.901   1.00 66.48  ? 553  LEU A CB  1 
ATOM 540  C CG  . LEU A 1 85  ? 18.138  -5.784  8.840   1.00 65.21  ? 553  LEU A CG  1 
ATOM 541  C CD1 . LEU A 1 85  ? 16.711  -6.126  9.174   1.00 64.41  ? 553  LEU A CD1 1 
ATOM 542  C CD2 . LEU A 1 85  ? 18.291  -4.288  8.751   1.00 64.85  ? 553  LEU A CD2 1 
ATOM 543  N N   . ILE A 1 86  ? 21.676  -7.545  11.449  1.00 69.12  ? 554  ILE A N   1 
ATOM 544  C CA  . ILE A 1 86  ? 22.206  -7.936  12.745  1.00 70.18  ? 554  ILE A CA  1 
ATOM 545  C C   . ILE A 1 86  ? 23.721  -7.975  12.694  1.00 72.24  ? 554  ILE A C   1 
ATOM 546  O O   . ILE A 1 86  ? 24.385  -7.919  13.729  1.00 73.22  ? 554  ILE A O   1 
ATOM 547  C CB  . ILE A 1 86  ? 21.659  -9.309  13.153  1.00 70.20  ? 554  ILE A CB  1 
ATOM 548  C CG1 . ILE A 1 86  ? 20.132  -9.248  13.209  1.00 68.33  ? 554  ILE A CG1 1 
ATOM 549  C CG2 . ILE A 1 86  ? 22.268  -9.775  14.480  1.00 70.96  ? 554  ILE A CG2 1 
ATOM 550  C CD1 . ILE A 1 86  ? 19.456  -10.528 12.870  1.00 67.79  ? 554  ILE A CD1 1 
ATOM 551  N N   . GLY A 1 87  ? 24.256  -8.070  11.476  1.00 73.23  ? 555  GLY A N   1 
ATOM 552  C CA  . GLY A 1 87  ? 25.708  -8.105  11.240  1.00 76.05  ? 555  GLY A CA  1 
ATOM 553  C C   . GLY A 1 87  ? 26.302  -9.451  11.582  1.00 77.91  ? 555  GLY A C   1 
ATOM 554  O O   . GLY A 1 87  ? 27.517  -9.654  11.493  1.00 79.98  ? 555  GLY A O   1 
ATOM 555  N N   . PHE A 1 88  ? 25.420  -10.364 11.977  1.00 77.72  ? 556  PHE A N   1 
ATOM 556  C CA  . PHE A 1 88  ? 25.789  -11.682 12.441  1.00 79.51  ? 556  PHE A CA  1 
ATOM 557  C C   . PHE A 1 88  ? 24.962  -12.747 11.754  1.00 79.10  ? 556  PHE A C   1 
ATOM 558  O O   . PHE A 1 88  ? 23.730  -12.669 11.701  1.00 77.36  ? 556  PHE A O   1 
ATOM 559  C CB  . PHE A 1 88  ? 25.569  -11.785 13.950  1.00 80.05  ? 556  PHE A CB  1 
ATOM 560  C CG  . PHE A 1 88  ? 26.660  -11.140 14.783  1.00 82.52  ? 556  PHE A CG  1 
ATOM 561  C CD1 . PHE A 1 88  ? 26.715  -9.751  14.948  1.00 82.34  ? 556  PHE A CD1 1 
ATOM 562  C CD2 . PHE A 1 88  ? 27.606  -11.923 15.433  1.00 84.86  ? 556  PHE A CD2 1 
ATOM 563  C CE1 . PHE A 1 88  ? 27.704  -9.155  15.726  1.00 83.08  ? 556  PHE A CE1 1 
ATOM 564  C CE2 . PHE A 1 88  ? 28.598  -11.330 16.209  1.00 86.56  ? 556  PHE A CE2 1 
ATOM 565  C CZ  . PHE A 1 88  ? 28.643  -9.941  16.352  1.00 85.44  ? 556  PHE A CZ  1 
ATOM 566  N N   . SER A 1 89  ? 25.660  -13.741 11.220  1.00 81.05  ? 557  SER A N   1 
ATOM 567  C CA  . SER A 1 89  ? 25.034  -14.991 10.830  1.00 81.76  ? 557  SER A CA  1 
ATOM 568  C C   . SER A 1 89  ? 24.705  -15.812 12.075  1.00 82.61  ? 557  SER A C   1 
ATOM 569  O O   . SER A 1 89  ? 25.161  -15.510 13.193  1.00 83.08  ? 557  SER A O   1 
ATOM 570  C CB  . SER A 1 89  ? 25.956  -15.793 9.917   1.00 83.85  ? 557  SER A CB  1 
ATOM 571  O OG  . SER A 1 89  ? 27.012  -16.380 10.653  1.00 85.82  ? 557  SER A OG  1 
ATOM 572  N N   . VAL A 1 90  ? 23.905  -16.850 11.869  1.00 83.08  ? 558  VAL A N   1 
ATOM 573  C CA  . VAL A 1 90  ? 23.573  -17.800 12.918  1.00 84.22  ? 558  VAL A CA  1 
ATOM 574  C C   . VAL A 1 90  ? 24.859  -18.488 13.460  1.00 86.98  ? 558  VAL A C   1 
ATOM 575  O O   . VAL A 1 90  ? 25.096  -18.478 14.680  1.00 87.47  ? 558  VAL A O   1 
ATOM 576  C CB  . VAL A 1 90  ? 22.504  -18.798 12.415  1.00 84.45  ? 558  VAL A CB  1 
ATOM 577  C CG1 . VAL A 1 90  ? 21.872  -19.543 13.552  1.00 85.03  ? 558  VAL A CG1 1 
ATOM 578  C CG2 . VAL A 1 90  ? 21.444  -18.047 11.662  1.00 82.43  ? 558  VAL A CG2 1 
ATOM 579  N N   . PRO A 1 91  ? 25.706  -19.053 12.564  1.00 88.80  ? 559  PRO A N   1 
ATOM 580  C CA  . PRO A 1 91  ? 26.975  -19.619 13.037  1.00 91.68  ? 559  PRO A CA  1 
ATOM 581  C C   . PRO A 1 91  ? 27.899  -18.629 13.770  1.00 92.30  ? 559  PRO A C   1 
ATOM 582  O O   . PRO A 1 91  ? 28.478  -18.996 14.790  1.00 93.84  ? 559  PRO A O   1 
ATOM 583  C CB  . PRO A 1 91  ? 27.613  -20.132 11.753  1.00 93.30  ? 559  PRO A CB  1 
ATOM 584  C CG  . PRO A 1 91  ? 26.441  -20.474 10.898  1.00 91.77  ? 559  PRO A CG  1 
ATOM 585  C CD  . PRO A 1 91  ? 25.476  -19.380 11.143  1.00 88.63  ? 559  PRO A CD  1 
ATOM 586  N N   . GLU A 1 92  ? 28.026  -17.395 13.269  1.00 91.69  ? 560  GLU A N   1 
ATOM 587  C CA  . GLU A 1 92  ? 28.747  -16.323 13.987  1.00 92.49  ? 560  GLU A CA  1 
ATOM 588  C C   . GLU A 1 92  ? 28.126  -16.042 15.350  1.00 92.14  ? 560  GLU A C   1 
ATOM 589  O O   . GLU A 1 92  ? 28.853  -15.768 16.311  1.00 93.76  ? 560  GLU A O   1 
ATOM 590  C CB  . GLU A 1 92  ? 28.777  -15.023 13.194  1.00 90.88  ? 560  GLU A CB  1 
ATOM 591  C CG  . GLU A 1 92  ? 29.788  -14.984 12.075  1.00 93.32  ? 560  GLU A CG  1 
ATOM 592  C CD  . GLU A 1 92  ? 29.295  -14.187 10.867  1.00 92.62  ? 560  GLU A CD  1 
ATOM 593  O OE1 . GLU A 1 92  ? 28.678  -13.113 11.062  1.00 90.57  ? 560  GLU A OE1 1 
ATOM 594  O OE2 . GLU A 1 92  ? 29.520  -14.644 9.720   1.00 94.03  ? 560  GLU A OE2 1 
ATOM 595  N N   . MET A 1 93  ? 26.794  -16.101 15.429  1.00 90.71  ? 561  MET A N   1 
ATOM 596  C CA  . MET A 1 93  ? 26.099  -16.031 16.711  1.00 90.67  ? 561  MET A CA  1 
ATOM 597  C C   . MET A 1 93  ? 26.596  -17.118 17.666  1.00 93.93  ? 561  MET A C   1 
ATOM 598  O O   . MET A 1 93  ? 26.931  -16.820 18.815  1.00 94.66  ? 561  MET A O   1 
ATOM 599  C CB  . MET A 1 93  ? 24.587  -16.127 16.527  1.00 88.55  ? 561  MET A CB  1 
ATOM 600  C CG  . MET A 1 93  ? 23.798  -15.877 17.798  1.00 86.59  ? 561  MET A CG  1 
ATOM 601  S SD  . MET A 1 93  ? 23.549  -17.321 18.835  1.00 85.69  ? 561  MET A SD  1 
ATOM 602  C CE  . MET A 1 93  ? 21.967  -17.895 18.240  1.00 84.53  ? 561  MET A CE  1 
ATOM 603  N N   . LYS A 1 94  ? 26.657  -18.362 17.186  1.00 96.45  ? 562  LYS A N   1 
ATOM 604  C CA  . LYS A 1 94  ? 27.152  -19.481 18.003  1.00 100.35 ? 562  LYS A CA  1 
ATOM 605  C C   . LYS A 1 94  ? 28.518  -19.176 18.612  1.00 102.73 ? 562  LYS A C   1 
ATOM 606  O O   . LYS A 1 94  ? 28.712  -19.352 19.818  1.00 104.23 ? 562  LYS A O   1 
ATOM 607  C CB  . LYS A 1 94  ? 27.260  -20.801 17.215  1.00 102.36 ? 562  LYS A CB  1 
ATOM 608  C CG  . LYS A 1 94  ? 26.096  -21.185 16.293  1.00 102.15 ? 562  LYS A CG  1 
ATOM 609  C CD  . LYS A 1 94  ? 24.856  -21.651 17.036  1.00 102.63 ? 562  LYS A CD  1 
ATOM 610  C CE  . LYS A 1 94  ? 23.769  -20.594 16.966  1.00 100.56 ? 562  LYS A CE  1 
ATOM 611  N NZ  . LYS A 1 94  ? 22.575  -20.966 17.772  1.00 101.56 ? 562  LYS A NZ  1 
ATOM 612  N N   . GLN A 1 95  ? 29.460  -18.727 17.781  1.00 103.68 ? 563  GLN A N   1 
ATOM 613  C CA  . GLN A 1 95  ? 30.817  -18.467 18.262  1.00 106.64 ? 563  GLN A CA  1 
ATOM 614  C C   . GLN A 1 95  ? 30.936  -17.168 19.045  1.00 105.68 ? 563  GLN A C   1 
ATOM 615  O O   . GLN A 1 95  ? 31.850  -17.016 19.863  1.00 107.72 ? 563  GLN A O   1 
ATOM 616  C CB  . GLN A 1 95  ? 31.841  -18.499 17.130  1.00 108.42 ? 563  GLN A CB  1 
ATOM 617  C CG  . GLN A 1 95  ? 32.119  -19.888 16.589  1.00 112.51 ? 563  GLN A CG  1 
ATOM 618  C CD  . GLN A 1 95  ? 31.208  -20.236 15.429  1.00 112.97 ? 563  GLN A CD  1 
ATOM 619  O OE1 . GLN A 1 95  ? 31.299  -19.632 14.356  1.00 113.18 ? 563  GLN A OE1 1 
ATOM 620  N NE2 . GLN A 1 95  ? 30.318  -21.205 15.638  1.00 113.10 ? 563  GLN A NE2 1 
ATOM 621  N N   . SER A 1 96  ? 30.018  -16.235 18.804  1.00 102.92 ? 564  SER A N   1 
ATOM 622  C CA  . SER A 1 96  ? 29.989  -15.027 19.611  1.00 102.34 ? 564  SER A CA  1 
ATOM 623  C C   . SER A 1 96  ? 29.693  -15.392 21.078  1.00 103.58 ? 564  SER A C   1 
ATOM 624  O O   . SER A 1 96  ? 29.541  -14.520 21.928  1.00 103.71 ? 564  SER A O   1 
ATOM 625  C CB  . SER A 1 96  ? 29.012  -13.976 19.050  1.00 99.27  ? 564  SER A CB  1 
ATOM 626  O OG  . SER A 1 96  ? 27.665  -14.256 19.378  1.00 96.94  ? 564  SER A OG  1 
ATOM 627  N N   . LYS A 1 97  ? 29.633  -16.686 21.377  1.00 104.96 ? 565  LYS A N   1 
ATOM 628  C CA  . LYS A 1 97  ? 29.500  -17.124 22.763  1.00 106.49 ? 565  LYS A CA  1 
ATOM 629  C C   . LYS A 1 97  ? 30.845  -17.473 23.401  1.00 109.70 ? 565  LYS A C   1 
ATOM 630  O O   . LYS A 1 97  ? 31.174  -16.949 24.471  1.00 110.73 ? 565  LYS A O   1 
ATOM 631  C CB  . LYS A 1 97  ? 28.494  -18.265 22.891  1.00 106.38 ? 565  LYS A CB  1 
ATOM 632  C CG  . LYS A 1 97  ? 27.070  -17.773 23.088  1.00 104.11 ? 565  LYS A CG  1 
ATOM 633  C CD  . LYS A 1 97  ? 26.050  -18.890 22.943  1.00 104.23 ? 565  LYS A CD  1 
ATOM 634  C CE  . LYS A 1 97  ? 25.763  -19.190 21.481  1.00 103.11 ? 565  LYS A CE  1 
ATOM 635  N NZ  . LYS A 1 97  ? 24.805  -20.314 21.319  1.00 103.79 ? 565  LYS A NZ  1 
ATOM 636  N N   . LYS A 1 98  ? 31.621  -18.335 22.739  1.00 111.43 ? 566  LYS A N   1 
ATOM 637  C CA  . LYS A 1 98  ? 32.970  -18.690 23.192  1.00 114.79 ? 566  LYS A CA  1 
ATOM 638  C C   . LYS A 1 98  ? 33.602  -17.467 23.831  1.00 115.30 ? 566  LYS A C   1 
ATOM 639  O O   . LYS A 1 98  ? 34.105  -17.525 24.949  1.00 117.73 ? 566  LYS A O   1 
ATOM 640  C CB  . LYS A 1 98  ? 33.860  -19.143 22.023  1.00 116.23 ? 566  LYS A CB  1 
ATOM 641  C CG  . LYS A 1 98  ? 33.184  -19.984 20.942  1.00 115.28 ? 566  LYS A CG  1 
ATOM 642  C CD  . LYS A 1 98  ? 33.154  -21.464 21.292  1.00 117.43 ? 566  LYS A CD  1 
ATOM 643  C CE  . LYS A 1 98  ? 32.001  -22.155 20.582  1.00 115.80 ? 566  LYS A CE  1 
ATOM 644  N NZ  . LYS A 1 98  ? 30.681  -21.574 20.987  1.00 112.32 ? 566  LYS A NZ  1 
ATOM 645  N N   . ASP A 1 99  ? 33.548  -16.359 23.101  1.00 113.49 ? 567  ASP A N   1 
ATOM 646  C CA  . ASP A 1 99  ? 34.060  -15.078 23.546  1.00 113.99 ? 567  ASP A CA  1 
ATOM 647  C C   . ASP A 1 99  ? 32.878  -14.185 23.948  1.00 111.39 ? 567  ASP A C   1 
ATOM 648  O O   . ASP A 1 99  ? 31.966  -13.959 23.145  1.00 108.43 ? 567  ASP A O   1 
ATOM 649  C CB  . ASP A 1 99  ? 34.878  -14.444 22.414  1.00 114.38 ? 567  ASP A CB  1 
ATOM 650  C CG  . ASP A 1 99  ? 35.758  -13.304 22.883  1.00 115.99 ? 567  ASP A CG  1 
ATOM 651  O OD1 . ASP A 1 99  ? 35.233  -12.233 23.250  1.00 114.65 ? 567  ASP A OD1 1 
ATOM 652  O OD2 . ASP A 1 99  ? 36.990  -13.473 22.855  1.00 119.23 ? 567  ASP A OD2 1 
ATOM 653  N N   . PRO A 1 100 ? 32.889  -13.681 25.200  1.00 112.55 ? 568  PRO A N   1 
ATOM 654  C CA  . PRO A 1 100 ? 31.813  -12.835 25.721  1.00 110.65 ? 568  PRO A CA  1 
ATOM 655  C C   . PRO A 1 100 ? 31.806  -11.434 25.105  1.00 109.34 ? 568  PRO A C   1 
ATOM 656  O O   . PRO A 1 100 ? 30.735  -10.899 24.828  1.00 106.98 ? 568  PRO A O   1 
ATOM 657  C CB  . PRO A 1 100 ? 32.124  -12.758 27.213  1.00 113.03 ? 568  PRO A CB  1 
ATOM 658  C CG  . PRO A 1 100 ? 33.600  -12.913 27.287  1.00 116.26 ? 568  PRO A CG  1 
ATOM 659  C CD  . PRO A 1 100 ? 33.968  -13.866 26.189  1.00 116.11 ? 568  PRO A CD  1 
ATOM 660  N N   . LEU A 1 101 ? 32.984  -10.846 24.895  1.00 111.16 ? 569  LEU A N   1 
ATOM 661  C CA  . LEU A 1 101 ? 33.082  -9.557  24.214  1.00 110.16 ? 569  LEU A CA  1 
ATOM 662  C C   . LEU A 1 101 ? 32.457  -9.619  22.817  1.00 107.24 ? 569  LEU A C   1 
ATOM 663  O O   . LEU A 1 101 ? 31.922  -8.620  22.336  1.00 105.65 ? 569  LEU A O   1 
ATOM 664  C CB  . LEU A 1 101 ? 34.538  -9.080  24.141  1.00 113.25 ? 569  LEU A CB  1 
ATOM 665  C CG  . LEU A 1 101 ? 34.901  -7.977  23.133  1.00 112.94 ? 569  LEU A CG  1 
ATOM 666  C CD1 . LEU A 1 101 ? 34.389  -6.599  23.567  1.00 111.95 ? 569  LEU A CD1 1 
ATOM 667  C CD2 . LEU A 1 101 ? 36.404  -7.960  22.890  1.00 116.40 ? 569  LEU A CD2 1 
ATOM 668  N N   . GLN A 1 102 ? 32.524  -10.790 22.179  1.00 106.84 ? 570  GLN A N   1 
ATOM 669  C CA  . GLN A 1 102 ? 31.909  -11.003 20.861  1.00 104.33 ? 570  GLN A CA  1 
ATOM 670  C C   . GLN A 1 102 ? 30.395  -11.093 20.970  1.00 101.27 ? 570  GLN A C   1 
ATOM 671  O O   . GLN A 1 102 ? 29.677  -10.748 20.036  1.00 98.80  ? 570  GLN A O   1 
ATOM 672  C CB  . GLN A 1 102 ? 32.448  -12.275 20.185  1.00 105.65 ? 570  GLN A CB  1 
ATOM 673  C CG  . GLN A 1 102 ? 33.956  -12.296 19.942  1.00 109.06 ? 570  GLN A CG  1 
ATOM 674  C CD  . GLN A 1 102 ? 34.496  -10.964 19.455  1.00 109.64 ? 570  GLN A CD  1 
ATOM 675  O OE1 . GLN A 1 102 ? 34.244  -10.555 18.320  1.00 107.55 ? 570  GLN A OE1 1 
ATOM 676  N NE2 . GLN A 1 102 ? 35.248  -10.278 20.318  1.00 112.20 ? 570  GLN A NE2 1 
ATOM 677  N N   . TYR A 1 103 ? 29.930  -11.575 22.119  1.00 101.50 ? 571  TYR A N   1 
ATOM 678  C CA  . TYR A 1 103 ? 28.510  -11.706 22.401  1.00 99.24  ? 571  TYR A CA  1 
ATOM 679  C C   . TYR A 1 103 ? 27.929  -10.323 22.552  1.00 97.83  ? 571  TYR A C   1 
ATOM 680  O O   . TYR A 1 103 ? 26.911  -9.995  21.950  1.00 95.53  ? 571  TYR A O   1 
ATOM 681  C CB  . TYR A 1 103 ? 28.302  -12.518 23.684  1.00 100.62 ? 571  TYR A CB  1 
ATOM 682  C CG  . TYR A 1 103 ? 26.918  -13.096 23.831  1.00 99.20  ? 571  TYR A CG  1 
ATOM 683  C CD1 . TYR A 1 103 ? 26.376  -13.920 22.837  1.00 98.31  ? 571  TYR A CD1 1 
ATOM 684  C CD2 . TYR A 1 103 ? 26.148  -12.830 24.966  1.00 98.93  ? 571  TYR A CD2 1 
ATOM 685  C CE1 . TYR A 1 103 ? 25.095  -14.453 22.963  1.00 97.54  ? 571  TYR A CE1 1 
ATOM 686  C CE2 . TYR A 1 103 ? 24.867  -13.362 25.106  1.00 98.25  ? 571  TYR A CE2 1 
ATOM 687  C CZ  . TYR A 1 103 ? 24.348  -14.172 24.102  1.00 97.89  ? 571  TYR A CZ  1 
ATOM 688  O OH  . TYR A 1 103 ? 23.086  -14.704 24.230  1.00 98.42  ? 571  TYR A OH  1 
ATOM 689  N N   . GLN A 1 104 ? 28.606  -9.512  23.357  1.00 99.55  ? 572  GLN A N   1 
ATOM 690  C CA  . GLN A 1 104 ? 28.243  -8.122  23.558  1.00 99.12  ? 572  GLN A CA  1 
ATOM 691  C C   . GLN A 1 104 ? 27.961  -7.486  22.210  1.00 97.08  ? 572  GLN A C   1 
ATOM 692  O O   . GLN A 1 104 ? 26.893  -6.915  21.982  1.00 95.38  ? 572  GLN A O   1 
ATOM 693  C CB  . GLN A 1 104 ? 29.381  -7.370  24.272  1.00 101.88 ? 572  GLN A CB  1 
ATOM 694  C CG  . GLN A 1 104 ? 28.980  -6.009  24.821  1.00 102.11 ? 572  GLN A CG  1 
ATOM 695  C CD  . GLN A 1 104 ? 27.627  -6.057  25.512  1.00 101.45 ? 572  GLN A CD  1 
ATOM 696  O OE1 . GLN A 1 104 ? 27.389  -6.899  26.387  1.00 101.84 ? 572  GLN A OE1 1 
ATOM 697  N NE2 . GLN A 1 104 ? 26.726  -5.165  25.109  1.00 99.74  ? 572  GLN A NE2 1 
ATOM 698  N N   . LYS A 1 105 ? 28.924  -7.634  21.310  1.00 97.52  ? 573  LYS A N   1 
ATOM 699  C CA  . LYS A 1 105 ? 28.886  -6.994  20.017  1.00 96.20  ? 573  LYS A CA  1 
ATOM 700  C C   . LYS A 1 105 ? 27.666  -7.471  19.228  1.00 93.29  ? 573  LYS A C   1 
ATOM 701  O O   . LYS A 1 105 ? 27.089  -6.719  18.449  1.00 92.02  ? 573  LYS A O   1 
ATOM 702  C CB  . LYS A 1 105 ? 30.196  -7.273  19.280  1.00 97.95  ? 573  LYS A CB  1 
ATOM 703  C CG  . LYS A 1 105 ? 30.688  -6.119  18.418  1.00 99.24  ? 573  LYS A CG  1 
ATOM 704  C CD  . LYS A 1 105 ? 31.724  -5.222  19.097  1.00 102.94 ? 573  LYS A CD  1 
ATOM 705  C CE  . LYS A 1 105 ? 32.422  -4.342  18.045  1.00 104.72 ? 573  LYS A CE  1 
ATOM 706  N NZ  . LYS A 1 105 ? 33.236  -3.236  18.620  1.00 107.79 ? 573  LYS A NZ  1 
ATOM 707  N N   . PHE A 1 106 ? 27.263  -8.714  19.471  1.00 92.84  ? 574  PHE A N   1 
ATOM 708  C CA  . PHE A 1 106 ? 26.063  -9.304  18.873  1.00 90.52  ? 574  PHE A CA  1 
ATOM 709  C C   . PHE A 1 106 ? 24.812  -8.717  19.499  1.00 89.07  ? 574  PHE A C   1 
ATOM 710  O O   . PHE A 1 106 ? 23.932  -8.218  18.801  1.00 87.37  ? 574  PHE A O   1 
ATOM 711  C CB  . PHE A 1 106 ? 26.086  -10.831 19.060  1.00 91.49  ? 574  PHE A CB  1 
ATOM 712  C CG  . PHE A 1 106 ? 24.773  -11.510 18.783  1.00 89.64  ? 574  PHE A CG  1 
ATOM 713  C CD1 . PHE A 1 106 ? 24.478  -11.988 17.510  1.00 88.29  ? 574  PHE A CD1 1 
ATOM 714  C CD2 . PHE A 1 106 ? 23.843  -11.700 19.799  1.00 89.37  ? 574  PHE A CD2 1 
ATOM 715  C CE1 . PHE A 1 106 ? 23.267  -12.627 17.248  1.00 86.75  ? 574  PHE A CE1 1 
ATOM 716  C CE2 . PHE A 1 106 ? 22.632  -12.337 19.544  1.00 88.33  ? 574  PHE A CE2 1 
ATOM 717  C CZ  . PHE A 1 106 ? 22.345  -12.801 18.266  1.00 86.61  ? 574  PHE A CZ  1 
ATOM 718  N N   . LEU A 1 107 ? 24.739  -8.781  20.822  1.00 89.87  ? 575  LEU A N   1 
ATOM 719  C CA  . LEU A 1 107 ? 23.611  -8.226  21.554  1.00 89.20  ? 575  LEU A CA  1 
ATOM 720  C C   . LEU A 1 107 ? 23.230  -6.836  21.054  1.00 88.03  ? 575  LEU A C   1 
ATOM 721  O O   . LEU A 1 107 ? 22.042  -6.499  20.978  1.00 86.87  ? 575  LEU A O   1 
ATOM 722  C CB  . LEU A 1 107 ? 23.915  -8.187  23.048  1.00 91.14  ? 575  LEU A CB  1 
ATOM 723  C CG  . LEU A 1 107 ? 23.929  -9.536  23.760  1.00 91.99  ? 575  LEU A CG  1 
ATOM 724  C CD1 . LEU A 1 107 ? 24.587  -9.372  25.107  1.00 94.66  ? 575  LEU A CD1 1 
ATOM 725  C CD2 . LEU A 1 107 ? 22.525  -10.131 23.901  1.00 90.72  ? 575  LEU A CD2 1 
ATOM 726  N N   . GLU A 1 108 ? 24.245  -6.044  20.712  1.00 88.48  ? 576  GLU A N   1 
ATOM 727  C CA  . GLU A 1 108 ? 24.038  -4.751  20.087  1.00 87.67  ? 576  GLU A CA  1 
ATOM 728  C C   . GLU A 1 108 ? 23.379  -4.939  18.735  1.00 85.45  ? 576  GLU A C   1 
ATOM 729  O O   . GLU A 1 108 ? 22.256  -4.478  18.532  1.00 84.56  ? 576  GLU A O   1 
ATOM 730  C CB  . GLU A 1 108 ? 25.351  -3.990  19.950  1.00 89.24  ? 576  GLU A CB  1 
ATOM 731  C CG  . GLU A 1 108 ? 25.686  -3.169  21.171  1.00 91.84  ? 576  GLU A CG  1 
ATOM 732  C CD  . GLU A 1 108 ? 27.161  -3.212  21.498  1.00 95.24  ? 576  GLU A CD  1 
ATOM 733  O OE1 . GLU A 1 108 ? 27.519  -3.811  22.537  1.00 97.39  ? 576  GLU A OE1 1 
ATOM 734  O OE2 . GLU A 1 108 ? 27.967  -2.668  20.714  1.00 96.13  ? 576  GLU A OE2 1 
ATOM 735  N N   . GLY A 1 109 ? 24.059  -5.640  17.826  1.00 84.96  ? 577  GLY A N   1 
ATOM 736  C CA  . GLY A 1 109 ? 23.526  -5.901  16.487  1.00 83.02  ? 577  GLY A CA  1 
ATOM 737  C C   . GLY A 1 109 ? 22.066  -6.321  16.517  1.00 81.47  ? 577  GLY A C   1 
ATOM 738  O O   . GLY A 1 109 ? 21.325  -6.102  15.560  1.00 80.24  ? 577  GLY A O   1 
ATOM 739  N N   . LEU A 1 110 ? 21.651  -6.903  17.638  1.00 81.74  ? 578  LEU A N   1 
ATOM 740  C CA  . LEU A 1 110 ? 20.296  -7.387  17.803  1.00 80.73  ? 578  LEU A CA  1 
ATOM 741  C C   . LEU A 1 110 ? 19.263  -6.293  18.107  1.00 80.05  ? 578  LEU A C   1 
ATOM 742  O O   . LEU A 1 110 ? 18.214  -6.253  17.477  1.00 78.94  ? 578  LEU A O   1 
ATOM 743  C CB  . LEU A 1 110 ? 20.267  -8.486  18.857  1.00 82.10  ? 578  LEU A CB  1 
ATOM 744  C CG  . LEU A 1 110 ? 19.284  -9.617  18.546  1.00 82.24  ? 578  LEU A CG  1 
ATOM 745  C CD1 . LEU A 1 110 ? 19.509  -10.155 17.146  1.00 82.17  ? 578  LEU A CD1 1 
ATOM 746  C CD2 . LEU A 1 110 ? 19.376  -10.739 19.568  1.00 83.61  ? 578  LEU A CD2 1 
ATOM 747  N N   . GLN A 1 111 ? 19.542  -5.413  19.067  1.00 80.87  ? 579  GLN A N   1 
ATOM 748  C CA  . GLN A 1 111 ? 18.672  -4.242  19.278  1.00 80.66  ? 579  GLN A CA  1 
ATOM 749  C C   . GLN A 1 111 ? 18.885  -3.204  18.189  1.00 78.87  ? 579  GLN A C   1 
ATOM 750  O O   . GLN A 1 111 ? 18.055  -2.318  18.012  1.00 78.90  ? 579  GLN A O   1 
ATOM 751  C CB  . GLN A 1 111 ? 18.845  -3.598  20.660  1.00 82.81  ? 579  GLN A CB  1 
ATOM 752  C CG  . GLN A 1 111 ? 20.270  -3.604  21.177  1.00 86.91  ? 579  GLN A CG  1 
ATOM 753  C CD  . GLN A 1 111 ? 20.785  -2.216  21.529  1.00 91.60  ? 579  GLN A CD  1 
ATOM 754  O OE1 . GLN A 1 111 ? 21.141  -1.428  20.643  1.00 92.23  ? 579  GLN A OE1 1 
ATOM 755  N NE2 . GLN A 1 111 ? 20.855  -1.918  22.829  1.00 94.27  ? 579  GLN A NE2 1 
ATOM 756  N N   . LYS A 1 112 ? 20.002  -3.315  17.473  1.00 77.59  ? 580  LYS A N   1 
ATOM 757  C CA  . LYS A 1 112 ? 20.254  -2.514  16.281  1.00 75.89  ? 580  LYS A CA  1 
ATOM 758  C C   . LYS A 1 112 ? 19.282  -2.990  15.203  1.00 73.04  ? 580  LYS A C   1 
ATOM 759  O O   . LYS A 1 112 ? 18.728  -2.191  14.447  1.00 72.02  ? 580  LYS A O   1 
ATOM 760  C CB  . LYS A 1 112 ? 21.715  -2.682  15.836  1.00 76.89  ? 580  LYS A CB  1 
ATOM 761  C CG  . LYS A 1 112 ? 22.161  -1.846  14.618  1.00 79.08  ? 580  LYS A CG  1 
ATOM 762  C CD  . LYS A 1 112 ? 21.972  -2.579  13.257  1.00 81.26  ? 580  LYS A CD  1 
ATOM 763  C CE  . LYS A 1 112 ? 22.549  -1.799  12.049  1.00 82.74  ? 580  LYS A CE  1 
ATOM 764  N NZ  . LYS A 1 112 ? 22.292  -2.491  10.718  1.00 82.79  ? 580  LYS A NZ  1 
ATOM 765  N N   . CYS A 1 113 ? 19.075  -4.304  15.155  1.00 71.34  ? 581  CYS A N   1 
ATOM 766  C CA  . CYS A 1 113 ? 18.135  -4.912  14.226  1.00 68.84  ? 581  CYS A CA  1 
ATOM 767  C C   . CYS A 1 113 ? 16.724  -4.439  14.520  1.00 68.33  ? 581  CYS A C   1 
ATOM 768  O O   . CYS A 1 113 ? 15.996  -4.055  13.621  1.00 67.73  ? 581  CYS A O   1 
ATOM 769  C CB  . CYS A 1 113 ? 18.207  -6.435  14.316  1.00 68.85  ? 581  CYS A CB  1 
ATOM 770  S SG  . CYS A 1 113 ? 17.078  -7.309  13.239  1.00 64.95  ? 581  CYS A SG  1 
ATOM 771  N N   . GLN A 1 114 ? 16.361  -4.456  15.794  1.00 68.79  ? 582  GLN A N   1 
ATOM 772  C CA  . GLN A 1 114 ? 15.051  -4.034  16.259  1.00 68.50  ? 582  GLN A CA  1 
ATOM 773  C C   . GLN A 1 114 ? 14.769  -2.582  15.933  1.00 68.29  ? 582  GLN A C   1 
ATOM 774  O O   . GLN A 1 114 ? 13.669  -2.247  15.526  1.00 67.78  ? 582  GLN A O   1 
ATOM 775  C CB  . GLN A 1 114 ? 14.993  -4.221  17.753  1.00 69.83  ? 582  GLN A CB  1 
ATOM 776  C CG  . GLN A 1 114 ? 13.620  -4.341  18.288  1.00 70.43  ? 582  GLN A CG  1 
ATOM 777  C CD  . GLN A 1 114 ? 13.560  -3.782  19.652  1.00 71.79  ? 582  GLN A CD  1 
ATOM 778  O OE1 . GLN A 1 114 ? 13.917  -2.626  19.857  1.00 72.84  ? 582  GLN A OE1 1 
ATOM 779  N NE2 . GLN A 1 114 ? 13.143  -4.591  20.613  1.00 73.09  ? 582  GLN A NE2 1 
ATOM 780  N N   . ARG A 1 115 ? 15.777  -1.731  16.120  1.00 68.97  ? 583  ARG A N   1 
ATOM 781  C CA  . ARG A 1 115 ? 15.719  -0.330  15.720  1.00 69.50  ? 583  ARG A CA  1 
ATOM 782  C C   . ARG A 1 115 ? 15.482  -0.196  14.232  1.00 68.29  ? 583  ARG A C   1 
ATOM 783  O O   . ARG A 1 115 ? 14.713  0.655   13.804  1.00 68.14  ? 583  ARG A O   1 
ATOM 784  C CB  . ARG A 1 115 ? 17.017  0.401   16.066  1.00 70.62  ? 583  ARG A CB  1 
ATOM 785  C CG  . ARG A 1 115 ? 16.996  1.858   15.591  1.00 73.23  ? 583  ARG A CG  1 
ATOM 786  C CD  . ARG A 1 115 ? 18.369  2.519   15.481  1.00 77.02  ? 583  ARG A CD  1 
ATOM 787  N NE  . ARG A 1 115 ? 19.003  2.289   14.182  1.00 78.63  ? 583  ARG A NE  1 
ATOM 788  C CZ  . ARG A 1 115 ? 20.033  1.462   13.998  1.00 80.59  ? 583  ARG A CZ  1 
ATOM 789  N NH1 . ARG A 1 115 ? 20.544  0.804   15.038  1.00 83.18  ? 583  ARG A NH1 1 
ATOM 790  N NH2 . ARG A 1 115 ? 20.558  1.290   12.786  1.00 79.27  ? 583  ARG A NH2 1 
ATOM 791  N N   . ASP A 1 116 ? 16.170  -1.034  13.454  1.00 67.94  ? 584  ASP A N   1 
ATOM 792  C CA  . ASP A 1 116 ? 16.109  -0.984  11.991  1.00 67.28  ? 584  ASP A CA  1 
ATOM 793  C C   . ASP A 1 116 ? 14.711  -1.245  11.507  1.00 66.44  ? 584  ASP A C   1 
ATOM 794  O O   . ASP A 1 116 ? 14.186  -0.466  10.733  1.00 66.54  ? 584  ASP A O   1 
ATOM 795  C CB  . ASP A 1 116 ? 17.085  -1.974  11.344  1.00 67.25  ? 584  ASP A CB  1 
ATOM 796  C CG  . ASP A 1 116 ? 18.533  -1.454  11.313  1.00 69.10  ? 584  ASP A CG  1 
ATOM 797  O OD1 . ASP A 1 116 ? 18.785  -0.334  11.815  1.00 70.15  ? 584  ASP A OD1 1 
ATOM 798  O OD2 . ASP A 1 116 ? 19.425  -2.170  10.784  1.00 70.29  ? 584  ASP A OD2 1 
ATOM 799  N N   . LEU A 1 117 ? 14.114  -2.325  11.999  1.00 66.36  ? 585  LEU A N   1 
ATOM 800  C CA  . LEU A 1 117 ? 12.748  -2.733  11.664  1.00 66.28  ? 585  LEU A CA  1 
ATOM 801  C C   . LEU A 1 117 ? 11.687  -1.760  12.138  1.00 67.13  ? 585  LEU A C   1 
ATOM 802  O O   . LEU A 1 117 ? 10.638  -1.632  11.505  1.00 67.23  ? 585  LEU A O   1 
ATOM 803  C CB  . LEU A 1 117 ? 12.443  -4.093  12.279  1.00 66.73  ? 585  LEU A CB  1 
ATOM 804  C CG  . LEU A 1 117 ? 13.332  -5.266  11.876  1.00 66.26  ? 585  LEU A CG  1 
ATOM 805  C CD1 . LEU A 1 117 ? 13.208  -6.400  12.881  1.00 66.09  ? 585  LEU A CD1 1 
ATOM 806  C CD2 . LEU A 1 117 ? 12.978  -5.711  10.472  1.00 65.78  ? 585  LEU A CD2 1 
ATOM 807  N N   . ILE A 1 118 ? 11.948  -1.100  13.262  1.00 68.23  ? 586  ILE A N   1 
ATOM 808  C CA  . ILE A 1 118 ? 11.059  -0.054  13.760  1.00 69.81  ? 586  ILE A CA  1 
ATOM 809  C C   . ILE A 1 118 ? 10.946  1.052   12.719  1.00 70.23  ? 586  ILE A C   1 
ATOM 810  O O   . ILE A 1 118 ? 9.843   1.482   12.372  1.00 70.59  ? 586  ILE A O   1 
ATOM 811  C CB  . ILE A 1 118 ? 11.574  0.557   15.094  1.00 70.97  ? 586  ILE A CB  1 
ATOM 812  C CG1 . ILE A 1 118 ? 11.517  -0.474  16.233  1.00 70.43  ? 586  ILE A CG1 1 
ATOM 813  C CG2 . ILE A 1 118 ? 10.824  1.876   15.437  1.00 72.34  ? 586  ILE A CG2 1 
ATOM 814  C CD1 . ILE A 1 118 ? 10.410  -0.283  17.207  1.00 69.05  ? 586  ILE A CD1 1 
ATOM 815  N N   . ASP A 1 119 ? 12.109  1.479   12.223  1.00 70.75  ? 587  ASP A N   1 
ATOM 816  C CA  . ASP A 1 119 ? 12.250  2.637   11.336  1.00 71.65  ? 587  ASP A CA  1 
ATOM 817  C C   . ASP A 1 119 ? 12.296  2.252   9.867   1.00 70.68  ? 587  ASP A C   1 
ATOM 818  O O   . ASP A 1 119 ? 12.674  3.059   9.024   1.00 70.93  ? 587  ASP A O   1 
ATOM 819  C CB  . ASP A 1 119 ? 13.512  3.426   11.702  1.00 72.53  ? 587  ASP A CB  1 
ATOM 820  C CG  . ASP A 1 119 ? 13.411  4.104   13.070  1.00 75.91  ? 587  ASP A CG  1 
ATOM 821  O OD1 . ASP A 1 119 ? 12.284  4.477   13.497  1.00 77.44  ? 587  ASP A OD1 1 
ATOM 822  O OD2 . ASP A 1 119 ? 14.476  4.275   13.714  1.00 79.03  ? 587  ASP A OD2 1 
ATOM 823  N N   . LEU A 1 120 ? 11.893  1.025   9.563   1.00 70.33  ? 588  LEU A N   1 
ATOM 824  C CA  . LEU A 1 120 ? 11.958  0.527   8.207   1.00 70.08  ? 588  LEU A CA  1 
ATOM 825  C C   . LEU A 1 120 ? 10.715  0.875   7.413   1.00 71.11  ? 588  LEU A C   1 
ATOM 826  O O   . LEU A 1 120 ? 9.598   0.507   7.799   1.00 71.72  ? 588  LEU A O   1 
ATOM 827  C CB  . LEU A 1 120 ? 12.121  -0.978  8.194   1.00 69.28  ? 588  LEU A CB  1 
ATOM 828  C CG  . LEU A 1 120 ? 12.259  -1.515  6.780   1.00 68.47  ? 588  LEU A CG  1 
ATOM 829  C CD1 . LEU A 1 120 ? 13.724  -1.580  6.417   1.00 68.60  ? 588  LEU A CD1 1 
ATOM 830  C CD2 . LEU A 1 120 ? 11.614  -2.870  6.675   1.00 68.74  ? 588  LEU A CD2 1 
ATOM 831  N N   . CYS A 1 121 ? 10.945  1.564   6.293   1.00 71.85  ? 589  CYS A N   1 
ATOM 832  C CA  . CYS A 1 121 ? 9.933   1.896   5.283   1.00 72.69  ? 589  CYS A CA  1 
ATOM 833  C C   . CYS A 1 121 ? 10.660  2.171   3.959   1.00 72.80  ? 589  CYS A C   1 
ATOM 834  O O   . CYS A 1 121 ? 11.526  3.050   3.890   1.00 73.55  ? 589  CYS A O   1 
ATOM 835  C CB  . CYS A 1 121 ? 9.102   3.114   5.719   1.00 73.96  ? 589  CYS A CB  1 
ATOM 836  S SG  . CYS A 1 121 ? 8.075   3.896   4.436   1.00 75.18  ? 589  CYS A SG  1 
ATOM 837  N N   . CYS A 1 122 ? 10.311  1.411   2.919   1.00 72.68  ? 590  CYS A N   1 
ATOM 838  C CA  . CYS A 1 122 ? 11.027  1.437   1.645   1.00 72.51  ? 590  CYS A CA  1 
ATOM 839  C C   . CYS A 1 122 ? 10.414  0.422   0.691   1.00 72.69  ? 590  CYS A C   1 
ATOM 840  O O   . CYS A 1 122 ? 9.443   -0.249  1.038   1.00 72.43  ? 590  CYS A O   1 
ATOM 841  C CB  . CYS A 1 122 ? 12.504  1.092   1.865   1.00 72.36  ? 590  CYS A CB  1 
ATOM 842  S SG  . CYS A 1 122 ? 12.793  -0.570  2.538   1.00 71.03  ? 590  CYS A SG  1 
ATOM 843  N N   . LEU A 1 123 ? 10.996  0.321   -0.507  1.00 73.43  ? 591  LEU A N   1 
ATOM 844  C CA  . LEU A 1 123 ? 10.580  -0.647  -1.523  1.00 73.91  ? 591  LEU A CA  1 
ATOM 845  C C   . LEU A 1 123 ? 10.986  -2.036  -1.090  1.00 73.86  ? 591  LEU A C   1 
ATOM 846  O O   . LEU A 1 123 ? 12.134  -2.261  -0.699  1.00 73.79  ? 591  LEU A O   1 
ATOM 847  C CB  . LEU A 1 123 ? 11.238  -0.366  -2.871  1.00 74.38  ? 591  LEU A CB  1 
ATOM 848  C CG  . LEU A 1 123 ? 11.283  1.007   -3.536  1.00 74.99  ? 591  LEU A CG  1 
ATOM 849  C CD1 . LEU A 1 123 ? 11.957  0.836   -4.882  1.00 76.70  ? 591  LEU A CD1 1 
ATOM 850  C CD2 . LEU A 1 123 ? 9.912   1.640   -3.721  1.00 75.42  ? 591  LEU A CD2 1 
ATOM 851  N N   . MET A 1 124 ? 10.041  -2.965  -1.162  1.00 74.52  ? 592  MET A N   1 
ATOM 852  C CA  . MET A 1 124 ? 10.307  -4.349  -0.819  1.00 74.83  ? 592  MET A CA  1 
ATOM 853  C C   . MET A 1 124 ? 10.027  -5.238  -1.989  1.00 76.45  ? 592  MET A C   1 
ATOM 854  O O   . MET A 1 124 ? 8.882   -5.354  -2.434  1.00 77.30  ? 592  MET A O   1 
ATOM 855  C CB  . MET A 1 124 ? 9.431   -4.793  0.329   1.00 74.39  ? 592  MET A CB  1 
ATOM 856  C CG  . MET A 1 124 ? 9.773   -4.134  1.600   1.00 73.74  ? 592  MET A CG  1 
ATOM 857  S SD  . MET A 1 124 ? 8.620   -4.594  2.876   1.00 74.25  ? 592  MET A SD  1 
ATOM 858  C CE  . MET A 1 124 ? 8.988   -3.281  4.043   1.00 73.36  ? 592  MET A CE  1 
ATOM 859  N N   . THR A 1 125 ? 11.071  -5.867  -2.502  1.00 77.51  ? 593  THR A N   1 
ATOM 860  C CA  . THR A 1 125 ? 10.844  -6.969  -3.394  1.00 79.76  ? 593  THR A CA  1 
ATOM 861  C C   . THR A 1 125 ? 10.198  -8.066  -2.551  1.00 80.43  ? 593  THR A C   1 
ATOM 862  O O   . THR A 1 125 ? 10.791  -8.575  -1.588  1.00 80.04  ? 593  THR A O   1 
ATOM 863  C CB  . THR A 1 125 ? 12.121  -7.404  -4.109  1.00 80.57  ? 593  THR A CB  1 
ATOM 864  O OG1 . THR A 1 125 ? 12.468  -6.399  -5.071  1.00 81.87  ? 593  THR A OG1 1 
ATOM 865  C CG2 . THR A 1 125 ? 11.903  -8.707  -4.850  1.00 82.71  ? 593  THR A CG2 1 
ATOM 866  N N   . ILE A 1 126 ? 8.950   -8.366  -2.899  1.00 81.75  ? 594  ILE A N   1 
ATOM 867  C CA  . ILE A 1 126 ? 8.143   -9.345  -2.198  1.00 82.95  ? 594  ILE A CA  1 
ATOM 868  C C   . ILE A 1 126 ? 7.759   -10.492 -3.132  1.00 85.47  ? 594  ILE A C   1 
ATOM 869  O O   . ILE A 1 126 ? 7.347   -10.259 -4.269  1.00 86.59  ? 594  ILE A O   1 
ATOM 870  C CB  . ILE A 1 126 ? 6.881   -8.686  -1.632  1.00 82.70  ? 594  ILE A CB  1 
ATOM 871  C CG1 . ILE A 1 126 ? 7.224   -7.952  -0.346  1.00 81.28  ? 594  ILE A CG1 1 
ATOM 872  C CG2 . ILE A 1 126 ? 5.785   -9.717  -1.359  1.00 84.81  ? 594  ILE A CG2 1 
ATOM 873  C CD1 . ILE A 1 126 ? 6.053   -7.181  0.255   1.00 82.02  ? 594  ILE A CD1 1 
ATOM 874  N N   . SER A 1 127 ? 7.895   -11.723 -2.641  1.00 86.79  ? 595  SER A N   1 
ATOM 875  C CA  . SER A 1 127 ? 7.512   -12.914 -3.384  1.00 89.53  ? 595  SER A CA  1 
ATOM 876  C C   . SER A 1 127 ? 6.229   -13.517 -2.837  1.00 91.38  ? 595  SER A C   1 
ATOM 877  O O   . SER A 1 127 ? 6.240   -14.199 -1.821  1.00 91.78  ? 595  SER A O   1 
ATOM 878  C CB  . SER A 1 127 ? 8.629   -13.949 -3.331  1.00 90.18  ? 595  SER A CB  1 
ATOM 879  O OG  . SER A 1 127 ? 8.282   -15.096 -4.084  1.00 92.85  ? 595  SER A OG  1 
ATOM 880  N N   . PHE A 1 128 ? 5.129   -13.274 -3.535  1.00 93.33  ? 596  PHE A N   1 
ATOM 881  C CA  . PHE A 1 128 ? 3.812   -13.713 -3.102  1.00 95.85  ? 596  PHE A CA  1 
ATOM 882  C C   . PHE A 1 128 ? 3.486   -15.123 -3.579  1.00 99.22  ? 596  PHE A C   1 
ATOM 883  O O   . PHE A 1 128 ? 3.495   -15.399 -4.784  1.00 100.80 ? 596  PHE A O   1 
ATOM 884  C CB  . PHE A 1 128 ? 2.745   -12.734 -3.608  1.00 96.29  ? 596  PHE A CB  1 
ATOM 885  C CG  . PHE A 1 128 ? 1.365   -13.004 -3.072  1.00 99.49  ? 596  PHE A CG  1 
ATOM 886  C CD1 . PHE A 1 128 ? 0.970   -12.484 -1.839  1.00 99.28  ? 596  PHE A CD1 1 
ATOM 887  C CD2 . PHE A 1 128 ? 0.451   -13.775 -3.805  1.00 103.53 ? 596  PHE A CD2 1 
ATOM 888  C CE1 . PHE A 1 128 ? -0.306  -12.732 -1.341  1.00 102.50 ? 596  PHE A CE1 1 
ATOM 889  C CE2 . PHE A 1 128 ? -0.828  -14.030 -3.319  1.00 105.87 ? 596  PHE A CE2 1 
ATOM 890  C CZ  . PHE A 1 128 ? -1.208  -13.514 -2.084  1.00 105.99 ? 596  PHE A CZ  1 
ATOM 891  N N   . ASN A 1 129 ? 3.198   -16.013 -2.630  1.00 100.93 ? 597  ASN A N   1 
ATOM 892  C CA  . ASN A 1 129 ? 2.567   -17.286 -2.962  1.00 104.86 ? 597  ASN A CA  1 
ATOM 893  C C   . ASN A 1 129 ? 1.058   -17.173 -2.777  1.00 107.19 ? 597  ASN A C   1 
ATOM 894  O O   . ASN A 1 129 ? 0.593   -16.916 -1.664  1.00 106.67 ? 597  ASN A O   1 
ATOM 895  C CB  . ASN A 1 129 ? 3.124   -18.437 -2.129  1.00 105.65 ? 597  ASN A CB  1 
ATOM 896  C CG  . ASN A 1 129 ? 2.550   -19.778 -2.548  1.00 109.72 ? 597  ASN A CG  1 
ATOM 897  O OD1 . ASN A 1 129 ? 1.367   -20.057 -2.343  1.00 111.91 ? 597  ASN A OD1 1 
ATOM 898  N ND2 . ASN A 1 129 ? 3.387   -20.612 -3.146  1.00 110.79 ? 597  ASN A ND2 1 
ATOM 899  N N   . PRO A 1 130 ? 0.293   -17.350 -3.869  1.00 110.10 ? 598  PRO A N   1 
ATOM 900  C CA  . PRO A 1 130 ? -1.160  -17.201 -3.822  1.00 112.86 ? 598  PRO A CA  1 
ATOM 901  C C   . PRO A 1 130 ? -1.866  -18.369 -3.137  1.00 116.65 ? 598  PRO A C   1 
ATOM 902  O O   . PRO A 1 130 ? -2.884  -18.163 -2.466  1.00 117.71 ? 598  PRO A O   1 
ATOM 903  C CB  . PRO A 1 130 ? -1.552  -17.110 -5.300  1.00 114.70 ? 598  PRO A CB  1 
ATOM 904  C CG  . PRO A 1 130 ? -0.475  -17.814 -6.026  1.00 114.64 ? 598  PRO A CG  1 
ATOM 905  C CD  . PRO A 1 130 ? 0.779   -17.616 -5.235  1.00 111.11 ? 598  PRO A CD  1 
ATOM 906  N N   . SER A 1 131 ? -1.319  -19.573 -3.300  1.00 119.08 ? 599  SER A N   1 
ATOM 907  C CA  . SER A 1 131 ? -1.918  -20.784 -2.742  1.00 123.53 ? 599  SER A CA  1 
ATOM 908  C C   . SER A 1 131 ? -1.783  -20.824 -1.218  1.00 122.76 ? 599  SER A C   1 
ATOM 909  O O   . SER A 1 131 ? -2.779  -20.639 -0.507  1.00 124.15 ? 599  SER A O   1 
ATOM 910  C CB  . SER A 1 131 ? -1.344  -22.047 -3.400  1.00 126.01 ? 599  SER A CB  1 
ATOM 911  O OG  . SER A 1 131 ? 0.058   -21.941 -3.587  1.00 123.53 ? 599  SER A OG  1 
ATOM 912  N N   . LEU A 1 132 ? -0.562  -21.035 -0.718  1.00 121.03 ? 600  LEU A N   1 
ATOM 913  C CA  . LEU A 1 132 ? -0.320  -21.036 0.735   1.00 120.28 ? 600  LEU A CA  1 
ATOM 914  C C   . LEU A 1 132 ? -0.282  -19.613 1.323   1.00 116.82 ? 600  LEU A C   1 
ATOM 915  O O   . LEU A 1 132 ? 0.186   -19.375 2.440   1.00 115.06 ? 600  LEU A O   1 
ATOM 916  C CB  . LEU A 1 132 ? 0.886   -21.919 1.119   1.00 120.07 ? 600  LEU A CB  1 
ATOM 917  C CG  . LEU A 1 132 ? 2.309   -21.636 0.627   1.00 117.92 ? 600  LEU A CG  1 
ATOM 918  C CD1 . LEU A 1 132 ? 3.114   -20.930 1.732   1.00 115.22 ? 600  LEU A CD1 1 
ATOM 919  C CD2 . LEU A 1 132 ? 3.014   -22.926 0.176   1.00 119.90 ? 600  LEU A CD2 1 
ATOM 920  N N   . SER A 1 133 ? -0.772  -18.674 0.517   1.00 116.31 ? 601  SER A N   1 
ATOM 921  C CA  . SER A 1 133 ? -1.350  -17.405 0.966   1.00 114.89 ? 601  SER A CA  1 
ATOM 922  C C   . SER A 1 133 ? -0.437  -16.306 1.505   1.00 110.94 ? 601  SER A C   1 
ATOM 923  O O   . SER A 1 133 ? -0.795  -15.125 1.407   1.00 109.55 ? 601  SER A O   1 
ATOM 924  C CB  . SER A 1 133 ? -2.489  -17.645 1.955   1.00 117.41 ? 601  SER A CB  1 
ATOM 925  O OG  . SER A 1 133 ? -3.019  -16.402 2.373   1.00 116.55 ? 601  SER A OG  1 
ATOM 926  N N   . LYS A 1 134 ? 0.706   -16.676 2.086   1.00 109.48 ? 602  LYS A N   1 
ATOM 927  C CA  . LYS A 1 134 ? 1.630   -15.667 2.645   1.00 105.88 ? 602  LYS A CA  1 
ATOM 928  C C   . LYS A 1 134 ? 2.957   -15.496 1.880   1.00 103.22 ? 602  LYS A C   1 
ATOM 929  O O   . LYS A 1 134 ? 3.485   -16.448 1.283   1.00 104.30 ? 602  LYS A O   1 
ATOM 930  C CB  . LYS A 1 134 ? 1.843   -15.859 4.158   1.00 105.78 ? 602  LYS A CB  1 
ATOM 931  C CG  . LYS A 1 134 ? 2.678   -17.070 4.598   1.00 107.34 ? 602  LYS A CG  1 
ATOM 932  C CD  . LYS A 1 134 ? 2.710   -17.184 6.144   1.00 108.99 ? 602  LYS A CD  1 
ATOM 933  C CE  . LYS A 1 134 ? 3.306   -15.931 6.842   1.00 106.10 ? 602  LYS A CE  1 
ATOM 934  N NZ  . LYS A 1 134 ? 2.906   -15.770 8.286   1.00 106.05 ? 602  LYS A NZ  1 
ATOM 935  N N   . ALA A 1 135 ? 3.469   -14.267 1.914   1.00 99.78  ? 603  ALA A N   1 
ATOM 936  C CA  . ALA A 1 135 ? 4.606   -13.858 1.095   1.00 97.51  ? 603  ALA A CA  1 
ATOM 937  C C   . ALA A 1 135 ? 5.922   -13.872 1.856   1.00 95.28  ? 603  ALA A C   1 
ATOM 938  O O   . ALA A 1 135 ? 5.948   -14.176 3.040   1.00 95.61  ? 603  ALA A O   1 
ATOM 939  C CB  . ALA A 1 135 ? 4.358   -12.483 0.517   1.00 96.41  ? 603  ALA A CB  1 
ATOM 940  N N   . MET A 1 136 ? 7.006   -13.511 1.171   1.00 93.27  ? 604  MET A N   1 
ATOM 941  C CA  . MET A 1 136 ? 8.353   -13.625 1.713   1.00 91.45  ? 604  MET A CA  1 
ATOM 942  C C   . MET A 1 136 ? 9.256   -12.550 1.113   1.00 88.90  ? 604  MET A C   1 
ATOM 943  O O   . MET A 1 136 ? 9.520   -12.561 -0.089  1.00 89.41  ? 604  MET A O   1 
ATOM 944  C CB  . MET A 1 136 ? 8.882   -15.022 1.403   1.00 93.58  ? 604  MET A CB  1 
ATOM 945  C CG  . MET A 1 136 ? 10.351  -15.278 1.704   1.00 94.47  ? 604  MET A CG  1 
ATOM 946  S SD  . MET A 1 136 ? 10.799  -16.959 1.183   1.00 99.52  ? 604  MET A SD  1 
ATOM 947  C CE  . MET A 1 136 ? 10.103  -17.940 2.535   1.00 100.80 ? 604  MET A CE  1 
ATOM 948  N N   . VAL A 1 137 ? 9.723   -11.631 1.957   1.00 86.12  ? 605  VAL A N   1 
ATOM 949  C CA  . VAL A 1 137 ? 10.497  -10.465 1.525   1.00 83.66  ? 605  VAL A CA  1 
ATOM 950  C C   . VAL A 1 137 ? 11.897  -10.859 1.091   1.00 83.27  ? 605  VAL A C   1 
ATOM 951  O O   . VAL A 1 137 ? 12.626  -11.499 1.837   1.00 83.00  ? 605  VAL A O   1 
ATOM 952  C CB  . VAL A 1 137 ? 10.597  -9.419  2.651   1.00 82.21  ? 605  VAL A CB  1 
ATOM 953  C CG1 . VAL A 1 137 ? 11.440  -8.240  2.221   1.00 81.29  ? 605  VAL A CG1 1 
ATOM 954  C CG2 . VAL A 1 137 ? 9.225   -8.940  3.054   1.00 82.37  ? 605  VAL A CG2 1 
ATOM 955  N N   . LEU A 1 138 ? 12.274  -10.444 -0.113  1.00 83.26  ? 606  LEU A N   1 
ATOM 956  C CA  . LEU A 1 138 ? 13.528  -10.893 -0.744  1.00 83.92  ? 606  LEU A CA  1 
ATOM 957  C C   . LEU A 1 138 ? 14.612  -9.819  -0.817  1.00 82.89  ? 606  LEU A C   1 
ATOM 958  O O   . LEU A 1 138 ? 15.811  -10.116 -0.703  1.00 83.45  ? 606  LEU A O   1 
ATOM 959  C CB  . LEU A 1 138 ? 13.263  -11.415 -2.162  1.00 85.54  ? 606  LEU A CB  1 
ATOM 960  C CG  . LEU A 1 138 ? 12.287  -12.573 -2.345  1.00 86.82  ? 606  LEU A CG  1 
ATOM 961  C CD1 . LEU A 1 138 ? 11.766  -12.560 -3.759  1.00 87.80  ? 606  LEU A CD1 1 
ATOM 962  C CD2 . LEU A 1 138 ? 12.955  -13.898 -2.004  1.00 88.20  ? 606  LEU A CD2 1 
ATOM 963  N N   . ALA A 1 139 ? 14.193  -8.580  -1.047  1.00 81.38  ? 607  ALA A N   1 
ATOM 964  C CA  . ALA A 1 139 ? 15.118  -7.475  -1.044  1.00 80.27  ? 607  ALA A CA  1 
ATOM 965  C C   . ALA A 1 139 ? 14.450  -6.269  -0.432  1.00 78.71  ? 607  ALA A C   1 
ATOM 966  O O   . ALA A 1 139 ? 13.243  -6.258  -0.207  1.00 78.37  ? 607  ALA A O   1 
ATOM 967  C CB  . ALA A 1 139 ? 15.580  -7.174  -2.452  1.00 81.46  ? 607  ALA A CB  1 
ATOM 968  N N   . LEU A 1 140 ? 15.256  -5.261  -0.148  1.00 77.92  ? 608  LEU A N   1 
ATOM 969  C CA  . LEU A 1 140 ? 14.767  -4.014  0.357   1.00 76.95  ? 608  LEU A CA  1 
ATOM 970  C C   . LEU A 1 140 ? 15.535  -2.968  -0.380  1.00 77.95  ? 608  LEU A C   1 
ATOM 971  O O   . LEU A 1 140 ? 16.733  -2.826  -0.193  1.00 78.50  ? 608  LEU A O   1 
ATOM 972  C CB  . LEU A 1 140 ? 15.041  -3.900  1.847   1.00 75.90  ? 608  LEU A CB  1 
ATOM 973  C CG  . LEU A 1 140 ? 14.259  -4.819  2.776   1.00 74.71  ? 608  LEU A CG  1 
ATOM 974  C CD1 . LEU A 1 140 ? 14.941  -4.882  4.114   1.00 73.32  ? 608  LEU A CD1 1 
ATOM 975  C CD2 . LEU A 1 140 ? 12.837  -4.343  2.925   1.00 74.30  ? 608  LEU A CD2 1 
ATOM 976  N N   . GLN A 1 141 ? 14.853  -2.256  -1.253  1.00 79.00  ? 609  GLN A N   1 
ATOM 977  C CA  . GLN A 1 141 ? 15.483  -1.171  -1.975  1.00 80.69  ? 609  GLN A CA  1 
ATOM 978  C C   . GLN A 1 141 ? 15.138  0.099   -1.219  1.00 80.30  ? 609  GLN A C   1 
ATOM 979  O O   . GLN A 1 141 ? 13.982  0.326   -0.864  1.00 79.72  ? 609  GLN A O   1 
ATOM 980  C CB  . GLN A 1 141 ? 14.959  -1.124  -3.422  1.00 81.99  ? 609  GLN A CB  1 
ATOM 981  C CG  . GLN A 1 141 ? 15.965  -0.673  -4.490  1.00 85.07  ? 609  GLN A CG  1 
ATOM 982  C CD  . GLN A 1 141 ? 15.641  -1.227  -5.878  1.00 89.25  ? 609  GLN A CD  1 
ATOM 983  O OE1 . GLN A 1 141 ? 15.369  -2.423  -6.034  1.00 90.08  ? 609  GLN A OE1 1 
ATOM 984  N NE2 . GLN A 1 141 ? 15.677  -0.358  -6.897  1.00 92.13  ? 609  GLN A NE2 1 
ATOM 985  N N   . ASP A 1 142 ? 16.143  0.916   -0.952  1.00 81.12  ? 610  ASP A N   1 
ATOM 986  C CA  . ASP A 1 142 ? 15.920  2.189   -0.291  1.00 81.72  ? 610  ASP A CA  1 
ATOM 987  C C   . ASP A 1 142 ? 15.505  3.242   -1.329  1.00 82.49  ? 610  ASP A C   1 
ATOM 988  O O   . ASP A 1 142 ? 16.222  3.440   -2.312  1.00 84.00  ? 610  ASP A O   1 
ATOM 989  C CB  . ASP A 1 142 ? 17.205  2.597   0.423   1.00 82.68  ? 610  ASP A CB  1 
ATOM 990  C CG  . ASP A 1 142 ? 16.953  3.432   1.662   1.00 84.16  ? 610  ASP A CG  1 
ATOM 991  O OD1 . ASP A 1 142 ? 15.804  3.936   1.826   1.00 85.09  ? 610  ASP A OD1 1 
ATOM 992  O OD2 . ASP A 1 142 ? 17.917  3.587   2.459   1.00 85.37  ? 610  ASP A OD2 1 
ATOM 993  N N   . VAL A 1 143 ? 14.368  3.915   -1.116  1.00 82.10  ? 611  VAL A N   1 
ATOM 994  C CA  . VAL A 1 143 ? 13.751  4.808   -2.149  1.00 82.75  ? 611  VAL A CA  1 
ATOM 995  C C   . VAL A 1 143 ? 14.565  6.066   -2.542  1.00 84.09  ? 611  VAL A C   1 
ATOM 996  O O   . VAL A 1 143 ? 14.788  6.956   -1.713  1.00 84.70  ? 611  VAL A O   1 
ATOM 997  C CB  . VAL A 1 143 ? 12.276  5.204   -1.789  1.00 82.51  ? 611  VAL A CB  1 
ATOM 998  C CG1 . VAL A 1 143 ? 11.434  3.974   -1.519  1.00 81.26  ? 611  VAL A CG1 1 
ATOM 999  C CG2 . VAL A 1 143 ? 12.224  6.118   -0.576  1.00 83.19  ? 611  VAL A CG2 1 
ATOM 1000 N N   . ASN A 1 144 ? 14.991  6.141   -3.806  1.00 84.78  ? 612  ASN A N   1 
ATOM 1001 C CA  . ASN A 1 144 ? 15.875  7.226   -4.275  1.00 86.38  ? 612  ASN A CA  1 
ATOM 1002 C C   . ASN A 1 144 ? 15.242  8.186   -5.286  1.00 87.41  ? 612  ASN A C   1 
ATOM 1003 O O   . ASN A 1 144 ? 14.081  8.042   -5.628  1.00 87.12  ? 612  ASN A O   1 
ATOM 1004 C CB  . ASN A 1 144 ? 17.180  6.655   -4.823  1.00 87.36  ? 612  ASN A CB  1 
ATOM 1005 C CG  . ASN A 1 144 ? 17.001  5.960   -6.156  1.00 88.42  ? 612  ASN A CG  1 
ATOM 1006 O OD1 . ASN A 1 144 ? 16.248  6.414   -7.012  1.00 89.71  ? 612  ASN A OD1 1 
ATOM 1007 N ND2 . ASN A 1 144 ? 17.713  4.859   -6.345  1.00 89.18  ? 612  ASN A ND2 1 
ATOM 1008 N N   . MET A 1 145 ? 16.011  9.150   -5.781  1.00 89.28  ? 613  MET A N   1 
ATOM 1009 C CA  . MET A 1 145 ? 15.453  10.246  -6.593  1.00 90.90  ? 613  MET A CA  1 
ATOM 1010 C C   . MET A 1 145 ? 15.027  9.803   -7.983  1.00 91.10  ? 613  MET A C   1 
ATOM 1011 O O   . MET A 1 145 ? 14.200  10.441  -8.624  1.00 91.87  ? 613  MET A O   1 
ATOM 1012 C CB  . MET A 1 145 ? 16.466  11.375  -6.717  1.00 93.59  ? 613  MET A CB  1 
ATOM 1013 C CG  . MET A 1 145 ? 15.865  12.744  -6.907  1.00 95.50  ? 613  MET A CG  1 
ATOM 1014 S SD  . MET A 1 145 ? 17.178  13.897  -7.333  1.00 101.55 ? 613  MET A SD  1 
ATOM 1015 C CE  . MET A 1 145 ? 18.227  13.870  -5.871  1.00 99.69  ? 613  MET A CE  1 
ATOM 1016 N N   . GLU A 1 146 ? 15.624  8.712   -8.441  1.00 90.58  ? 614  GLU A N   1 
ATOM 1017 C CA  . GLU A 1 146 ? 15.263  8.089   -9.697  1.00 90.85  ? 614  GLU A CA  1 
ATOM 1018 C C   . GLU A 1 146 ? 13.863  7.495   -9.586  1.00 88.93  ? 614  GLU A C   1 
ATOM 1019 O O   . GLU A 1 146 ? 13.083  7.565   -10.525 1.00 89.65  ? 614  GLU A O   1 
ATOM 1020 C CB  . GLU A 1 146 ? 16.295  7.020   -10.050 1.00 91.14  ? 614  GLU A CB  1 
ATOM 1021 C CG  . GLU A 1 146 ? 16.323  6.633   -11.517 1.00 93.94  ? 614  GLU A CG  1 
ATOM 1022 C CD  . GLU A 1 146 ? 15.393  5.473   -11.844 1.00 93.81  ? 614  GLU A CD  1 
ATOM 1023 O OE1 . GLU A 1 146 ? 15.033  5.317   -13.039 1.00 95.90  ? 614  GLU A OE1 1 
ATOM 1024 O OE2 . GLU A 1 146 ? 15.034  4.715   -10.913 1.00 91.89  ? 614  GLU A OE2 1 
ATOM 1025 N N   . HIS A 1 147 ? 13.547  6.926   -8.426  1.00 86.84  ? 615  HIS A N   1 
ATOM 1026 C CA  . HIS A 1 147 ? 12.199  6.442   -8.139  1.00 85.51  ? 615  HIS A CA  1 
ATOM 1027 C C   . HIS A 1 147 ? 11.228  7.612   -8.111  1.00 86.57  ? 615  HIS A C   1 
ATOM 1028 O O   . HIS A 1 147 ? 10.112  7.509   -8.617  1.00 86.88  ? 615  HIS A O   1 
ATOM 1029 C CB  . HIS A 1 147 ? 12.153  5.682   -6.808  1.00 83.34  ? 615  HIS A CB  1 
ATOM 1030 C CG  . HIS A 1 147 ? 12.931  4.400   -6.813  1.00 82.38  ? 615  HIS A CG  1 
ATOM 1031 N ND1 . HIS A 1 147 ? 14.025  4.189   -6.002  1.00 81.66  ? 615  HIS A ND1 1 
ATOM 1032 C CD2 . HIS A 1 147 ? 12.777  3.265   -7.537  1.00 82.78  ? 615  HIS A CD2 1 
ATOM 1033 C CE1 . HIS A 1 147 ? 14.510  2.980   -6.223  1.00 81.55  ? 615  HIS A CE1 1 
ATOM 1034 N NE2 . HIS A 1 147 ? 13.772  2.398   -7.151  1.00 82.35  ? 615  HIS A NE2 1 
ATOM 1035 N N   . LEU A 1 148 ? 11.670  8.729   -7.535  1.00 87.56  ? 616  LEU A N   1 
ATOM 1036 C CA  . LEU A 1 148 ? 10.855  9.933   -7.450  1.00 89.09  ? 616  LEU A CA  1 
ATOM 1037 C C   . LEU A 1 148 ? 10.409  10.408  -8.824  1.00 91.44  ? 616  LEU A C   1 
ATOM 1038 O O   . LEU A 1 148 ? 9.257   10.795  -8.982  1.00 92.19  ? 616  LEU A O   1 
ATOM 1039 C CB  . LEU A 1 148 ? 11.585  11.045  -6.683  1.00 89.77  ? 616  LEU A CB  1 
ATOM 1040 C CG  . LEU A 1 148 ? 11.157  12.527  -6.755  1.00 91.54  ? 616  LEU A CG  1 
ATOM 1041 C CD1 . LEU A 1 148 ? 9.676   12.771  -6.476  1.00 90.80  ? 616  LEU A CD1 1 
ATOM 1042 C CD2 . LEU A 1 148 ? 12.014  13.379  -5.819  1.00 91.99  ? 616  LEU A CD2 1 
ATOM 1043 N N   . GLU A 1 149 ? 11.305  10.359  -9.810  1.00 93.29  ? 617  GLU A N   1 
ATOM 1044 C CA  . GLU A 1 149 ? 10.982  10.816  -11.175 1.00 96.30  ? 617  GLU A CA  1 
ATOM 1045 C C   . GLU A 1 149 ? 10.092  9.828   -11.941 1.00 96.34  ? 617  GLU A C   1 
ATOM 1046 O O   . GLU A 1 149 ? 9.365   10.216  -12.862 1.00 97.77  ? 617  GLU A O   1 
ATOM 1047 C CB  . GLU A 1 149 ? 12.252  11.128  -11.981 1.00 98.11  ? 617  GLU A CB  1 
ATOM 1048 C CG  . GLU A 1 149 ? 13.334  11.932  -11.231 1.00 100.14 ? 617  GLU A CG  1 
ATOM 1049 C CD  . GLU A 1 149 ? 12.991  13.415  -10.981 1.00 103.26 ? 617  GLU A CD  1 
ATOM 1050 O OE1 . GLU A 1 149 ? 12.010  13.938  -11.557 1.00 104.67 ? 617  GLU A OE1 1 
ATOM 1051 O OE2 . GLU A 1 149 ? 13.728  14.065  -10.201 1.00 104.44 ? 617  GLU A OE2 1 
ATOM 1052 N N   . ASN A 1 150 ? 10.162  8.557   -11.544 1.00 95.24  ? 618  ASN A N   1 
ATOM 1053 C CA  . ASN A 1 150 ? 9.313   7.484   -12.078 1.00 95.55  ? 618  ASN A CA  1 
ATOM 1054 C C   . ASN A 1 150 ? 7.833   7.699   -11.780 1.00 95.64  ? 618  ASN A C   1 
ATOM 1055 O O   . ASN A 1 150 ? 6.953   7.272   -12.533 1.00 96.39  ? 618  ASN A O   1 
ATOM 1056 C CB  . ASN A 1 150 ? 9.731   6.137   -11.474 1.00 93.96  ? 618  ASN A CB  1 
ATOM 1057 C CG  . ASN A 1 150 ? 10.793  5.414   -12.290 1.00 94.96  ? 618  ASN A CG  1 
ATOM 1058 O OD1 . ASN A 1 150 ? 11.426  4.473   -11.795 1.00 94.59  ? 618  ASN A OD1 1 
ATOM 1059 N ND2 . ASN A 1 150 ? 10.984  5.833   -13.544 1.00 96.83  ? 618  ASN A ND2 1 
ATOM 1060 N N   . LEU A 1 151 ? 7.584   8.345   -10.651 1.00 95.20  ? 619  LEU A N   1 
ATOM 1061 C CA  . LEU A 1 151 ? 6.244   8.621   -10.191 1.00 95.90  ? 619  LEU A CA  1 
ATOM 1062 C C   . LEU A 1 151 ? 5.729   9.932   -10.793 1.00 98.51  ? 619  LEU A C   1 
ATOM 1063 O O   . LEU A 1 151 ? 4.525   10.179  -10.829 1.00 99.75  ? 619  LEU A O   1 
ATOM 1064 C CB  . LEU A 1 151 ? 6.231   8.675   -8.659  1.00 94.33  ? 619  LEU A CB  1 
ATOM 1065 C CG  . LEU A 1 151 ? 5.013   8.133   -7.912  1.00 93.46  ? 619  LEU A CG  1 
ATOM 1066 C CD1 . LEU A 1 151 ? 4.454   6.867   -8.558  1.00 93.23  ? 619  LEU A CD1 1 
ATOM 1067 C CD2 . LEU A 1 151 ? 5.397   7.867   -6.475  1.00 91.40  ? 619  LEU A CD2 1 
ATOM 1068 N N   . LYS A 1 152 ? 6.638   10.771  -11.270 1.00 99.81  ? 620  LYS A N   1 
ATOM 1069 C CA  . LYS A 1 152 ? 6.229   11.994  -11.922 1.00 102.63 ? 620  LYS A CA  1 
ATOM 1070 C C   . LYS A 1 152 ? 5.582   11.667  -13.274 1.00 104.56 ? 620  LYS A C   1 
ATOM 1071 O O   . LYS A 1 152 ? 4.514   12.195  -13.606 1.00 106.09 ? 620  LYS A O   1 
ATOM 1072 C CB  . LYS A 1 152 ? 7.425   12.938  -12.073 1.00 103.78 ? 620  LYS A CB  1 
ATOM 1073 C CG  . LYS A 1 152 ? 7.848   13.622  -10.770 1.00 103.65 ? 620  LYS A CG  1 
ATOM 1074 C CD  . LYS A 1 152 ? 8.591   14.946  -11.017 1.00 106.65 ? 620  LYS A CD  1 
ATOM 1075 C CE  . LYS A 1 152 ? 8.740   15.772  -9.728  1.00 107.04 ? 620  LYS A CE  1 
ATOM 1076 N NZ  . LYS A 1 152 ? 9.355   17.124  -9.937  1.00 109.62 ? 620  LYS A NZ  1 
ATOM 1077 N N   . LYS A 1 153 ? 6.228   10.763  -14.018 1.00 104.79 ? 621  LYS A N   1 
ATOM 1078 C CA  . LYS A 1 153 ? 5.808   10.339  -15.363 1.00 106.80 ? 621  LYS A CA  1 
ATOM 1079 C C   . LYS A 1 153 ? 4.525   9.521   -15.341 1.00 106.81 ? 621  LYS A C   1 
ATOM 1080 O O   . LYS A 1 153 ? 3.659   9.681   -16.205 1.00 108.97 ? 621  LYS A O   1 
ATOM 1081 C CB  . LYS A 1 153 ? 6.910   9.505   -16.027 1.00 106.61 ? 621  LYS A CB  1 
ATOM 1082 C CG  . LYS A 1 153 ? 8.231   10.234  -16.178 1.00 108.12 ? 621  LYS A CG  1 
ATOM 1083 C CD  . LYS A 1 153 ? 9.200   9.490   -17.075 1.00 109.31 ? 621  LYS A CD  1 
ATOM 1084 C CE  . LYS A 1 153 ? 10.451  10.321  -17.287 1.00 110.98 ? 621  LYS A CE  1 
ATOM 1085 N NZ  . LYS A 1 153 ? 11.468  9.590   -18.078 1.00 112.55 ? 621  LYS A NZ  1 
ATOM 1086 N N   . ARG A 1 154 ? 4.434   8.636   -14.353 1.00 104.88 ? 622  ARG A N   1 
ATOM 1087 C CA  . ARG A 1 154 ? 3.274   7.790   -14.115 1.00 104.91 ? 622  ARG A CA  1 
ATOM 1088 C C   . ARG A 1 154 ? 2.034   8.632   -13.825 1.00 106.49 ? 622  ARG A C   1 
ATOM 1089 O O   . ARG A 1 154 ? 0.928   8.260   -14.213 1.00 107.95 ? 622  ARG A O   1 
ATOM 1090 C CB  . ARG A 1 154 ? 3.592   6.877   -12.939 1.00 102.57 ? 622  ARG A CB  1 
ATOM 1091 C CG  . ARG A 1 154 ? 2.653   5.723   -12.665 1.00 102.38 ? 622  ARG A CG  1 
ATOM 1092 C CD  . ARG A 1 154 ? 3.349   4.853   -11.631 1.00 100.15 ? 622  ARG A CD  1 
ATOM 1093 N NE  . ARG A 1 154 ? 2.478   3.901   -10.961 1.00 99.40  ? 622  ARG A NE  1 
ATOM 1094 C CZ  . ARG A 1 154 ? 2.910   2.982   -10.106 1.00 97.18  ? 622  ARG A CZ  1 
ATOM 1095 N NH1 . ARG A 1 154 ? 4.199   2.886   -9.823  1.00 94.83  ? 622  ARG A NH1 1 
ATOM 1096 N NH2 . ARG A 1 154 ? 2.051   2.152   -9.542  1.00 98.08  ? 622  ARG A NH2 1 
ATOM 1097 N N   . LEU A 1 155 ? 2.229   9.768   -13.155 1.00 106.78 ? 623  LEU A N   1 
ATOM 1098 C CA  . LEU A 1 155 ? 1.155   10.736  -12.928 1.00 108.92 ? 623  LEU A CA  1 
ATOM 1099 C C   . LEU A 1 155 ? 1.115   11.771  -14.046 1.00 111.82 ? 623  LEU A C   1 
ATOM 1100 O O   . LEU A 1 155 ? 0.776   12.933  -13.821 1.00 113.20 ? 623  LEU A O   1 
ATOM 1101 C CB  . LEU A 1 155 ? 1.306   11.418  -11.568 1.00 108.03 ? 623  LEU A CB  1 
ATOM 1102 C CG  . LEU A 1 155 ? 1.337   10.553  -10.300 1.00 105.90 ? 623  LEU A CG  1 
ATOM 1103 C CD1 . LEU A 1 155 ? 1.473   11.429  -9.074  1.00 105.88 ? 623  LEU A CD1 1 
ATOM 1104 C CD2 . LEU A 1 155 ? 0.113   9.666   -10.172 1.00 106.67 ? 623  LEU A CD2 1 
ATOM 1105 N N   . ASN A 1 156 ? 1.479   11.317  -15.246 1.00 113.27 ? 624  ASN A N   1 
ATOM 1106 C CA  . ASN A 1 156 ? 1.394   12.070  -16.511 1.00 116.57 ? 624  ASN A CA  1 
ATOM 1107 C C   . ASN A 1 156 ? 1.801   13.542  -16.432 1.00 118.17 ? 624  ASN A C   1 
ATOM 1108 O O   . ASN A 1 156 ? 1.048   14.444  -16.841 1.00 120.60 ? 624  ASN A O   1 
ATOM 1109 C CB  . ASN A 1 156 ? 0.021   11.870  -17.180 1.00 118.84 ? 624  ASN A CB  1 
ATOM 1110 C CG  . ASN A 1 156 ? -0.294  10.390  -17.448 1.00 118.57 ? 624  ASN A CG  1 
ATOM 1111 O OD1 . ASN A 1 156 ? 0.592   9.601   -17.800 1.00 117.38 ? 624  ASN A OD1 1 
ATOM 1112 N ND2 . ASN A 1 156 ? -1.562  10.014  -17.275 1.00 119.83 ? 624  ASN A ND2 1 
ATOM 1113 N N   . LYS A 1 157 ? 3.004   13.755  -15.891 1.00 117.02 ? 625  LYS A N   1 
ATOM 1114 C CA  . LYS A 1 157 ? 3.651   15.068  -15.846 1.00 118.50 ? 625  LYS A CA  1 
ATOM 1115 C C   . LYS A 1 157 ? 4.795   15.128  -16.868 1.00 119.59 ? 625  LYS A C   1 
ATOM 1116 O O   . LYS A 1 157 ? 4.638   15.651  -17.980 1.00 122.11 ? 625  LYS A O   1 
ATOM 1117 C CB  . LYS A 1 157 ? 4.184   15.371  -14.438 1.00 116.70 ? 625  LYS A CB  1 
ATOM 1118 C CG  . LYS A 1 157 ? 3.145   15.260  -13.333 1.00 115.48 ? 625  LYS A CG  1 
ATOM 1119 C CD  . LYS A 1 157 ? 3.703   15.733  -11.997 1.00 113.89 ? 625  LYS A CD  1 
ATOM 1120 C CE  . LYS A 1 157 ? 2.902   15.176  -10.815 1.00 111.96 ? 625  LYS A CE  1 
ATOM 1121 N NZ  . LYS A 1 157 ? 1.486   15.649  -10.738 1.00 113.14 ? 625  LYS A NZ  1 
ATOM 1122 N N   . ALA B 2 16  ? -0.085  -12.065 16.676  1.00 118.72 ? 13   ALA B N   1 
ATOM 1123 C CA  . ALA B 2 16  ? 0.002   -12.792 17.982  1.00 122.31 ? 13   ALA B CA  1 
ATOM 1124 C C   . ALA B 2 16  ? -0.305  -11.888 19.188  1.00 121.36 ? 13   ALA B C   1 
ATOM 1125 O O   . ALA B 2 16  ? -1.443  -11.881 19.661  1.00 123.35 ? 13   ALA B O   1 
ATOM 1126 C CB  . ALA B 2 16  ? 1.363   -13.501 18.136  1.00 123.52 ? 13   ALA B CB  1 
ATOM 1127 N N   . GLY B 2 17  ? 0.689   -11.135 19.680  1.00 118.88 ? 14   GLY B N   1 
ATOM 1128 C CA  . GLY B 2 17  ? 0.479   -10.150 20.763  1.00 117.89 ? 14   GLY B CA  1 
ATOM 1129 C C   . GLY B 2 17  ? 0.052   -8.761  20.280  1.00 114.10 ? 14   GLY B C   1 
ATOM 1130 O O   . GLY B 2 17  ? 0.379   -7.749  20.903  1.00 112.46 ? 14   GLY B O   1 
ATOM 1131 N N   . VAL B 2 18  ? -0.707  -8.731  19.180  1.00 113.10 ? 15   VAL B N   1 
ATOM 1132 C CA  . VAL B 2 18  ? -1.017  -7.517  18.401  1.00 109.37 ? 15   VAL B CA  1 
ATOM 1133 C C   . VAL B 2 18  ? -2.525  -7.361  18.093  1.00 110.55 ? 15   VAL B C   1 
ATOM 1134 O O   . VAL B 2 18  ? -3.276  -8.349  18.111  1.00 113.81 ? 15   VAL B O   1 
ATOM 1135 C CB  . VAL B 2 18  ? -0.168  -7.474  17.070  1.00 106.80 ? 15   VAL B CB  1 
ATOM 1136 C CG1 . VAL B 2 18  ? 0.573   -8.791  16.826  1.00 109.06 ? 15   VAL B CG1 1 
ATOM 1137 C CG2 . VAL B 2 18  ? -1.018  -7.131  15.851  1.00 105.22 ? 15   VAL B CG2 1 
ATOM 1138 N N   . ARG B 2 19  ? -2.953  -6.121  17.821  1.00 108.13 ? 16   ARG B N   1 
ATOM 1139 C CA  . ARG B 2 19  ? -4.325  -5.829  17.355  1.00 108.98 ? 16   ARG B CA  1 
ATOM 1140 C C   . ARG B 2 19  ? -4.478  -4.468  16.657  1.00 105.58 ? 16   ARG B C   1 
ATOM 1141 O O   . ARG B 2 19  ? -4.173  -3.425  17.242  1.00 103.99 ? 16   ARG B O   1 
ATOM 1142 C CB  . ARG B 2 19  ? -5.343  -5.978  18.489  1.00 112.49 ? 16   ARG B CB  1 
ATOM 1143 C CG  . ARG B 2 19  ? -5.014  -5.229  19.773  1.00 113.61 ? 16   ARG B CG  1 
ATOM 1144 C CD  . ARG B 2 19  ? -6.184  -5.294  20.750  1.00 119.86 ? 16   ARG B CD  1 
ATOM 1145 N NE  . ARG B 2 19  ? -7.473  -5.317  20.051  1.00 123.04 ? 16   ARG B NE  1 
ATOM 1146 C CZ  . ARG B 2 19  ? -8.048  -4.262  19.474  1.00 122.46 ? 16   ARG B CZ  1 
ATOM 1147 N NH1 . ARG B 2 19  ? -7.459  -3.073  19.506  1.00 120.13 ? 16   ARG B NH1 1 
ATOM 1148 N NH2 . ARG B 2 19  ? -9.216  -4.399  18.860  1.00 124.71 ? 16   ARG B NH2 1 
ATOM 1149 N N   . LEU B 2 20  ? -4.961  -4.500  15.410  1.00 104.94 ? 17   LEU B N   1 
ATOM 1150 C CA  . LEU B 2 20  ? -5.069  -3.310  14.538  1.00 102.00 ? 17   LEU B CA  1 
ATOM 1151 C C   . LEU B 2 20  ? -6.346  -3.278  13.668  1.00 103.75 ? 17   LEU B C   1 
ATOM 1152 O O   . LEU B 2 20  ? -6.951  -4.321  13.421  1.00 106.63 ? 17   LEU B O   1 
ATOM 1153 C CB  . LEU B 2 20  ? -3.823  -3.166  13.657  1.00 98.91  ? 17   LEU B CB  1 
ATOM 1154 C CG  . LEU B 2 20  ? -3.168  -4.443  13.142  1.00 99.79  ? 17   LEU B CG  1 
ATOM 1155 C CD1 . LEU B 2 20  ? -2.946  -4.374  11.660  1.00 99.44  ? 17   LEU B CD1 1 
ATOM 1156 C CD2 . LEU B 2 20  ? -1.863  -4.677  13.854  1.00 99.01  ? 17   LEU B CD2 1 
ATOM 1157 N N   . PRO B 2 21  ? -6.749  -2.077  13.189  1.00 102.46 ? 18   PRO B N   1 
ATOM 1158 C CA  . PRO B 2 21  ? -8.013  -1.883  12.456  1.00 104.64 ? 18   PRO B CA  1 
ATOM 1159 C C   . PRO B 2 21  ? -8.118  -2.725  11.192  1.00 105.86 ? 18   PRO B C   1 
ATOM 1160 O O   . PRO B 2 21  ? -7.096  -3.042  10.583  1.00 104.27 ? 18   PRO B O   1 
ATOM 1161 C CB  . PRO B 2 21  ? -7.979  -0.396  12.082  1.00 102.50 ? 18   PRO B CB  1 
ATOM 1162 C CG  . PRO B 2 21  ? -6.541  -0.028  12.128  1.00 98.89  ? 18   PRO B CG  1 
ATOM 1163 C CD  . PRO B 2 21  ? -5.979  -0.821  13.254  1.00 99.26  ? 18   PRO B CD  1 
ATOM 1164 N N   . ARG B 2 22  ? -9.349  -3.052  10.799  1.00 109.14 ? 19   ARG B N   1 
ATOM 1165 C CA  . ARG B 2 22  ? -9.612  -4.002  9.705   1.00 111.44 ? 19   ARG B CA  1 
ATOM 1166 C C   . ARG B 2 22  ? -9.193  -3.554  8.290   1.00 109.61 ? 19   ARG B C   1 
ATOM 1167 O O   . ARG B 2 22  ? -8.858  -4.385  7.441   1.00 110.64 ? 19   ARG B O   1 
ATOM 1168 C CB  . ARG B 2 22  ? -11.091 -4.389  9.683   1.00 116.44 ? 19   ARG B CB  1 
ATOM 1169 C CG  . ARG B 2 22  ? -11.642 -5.016  10.954  1.00 119.39 ? 19   ARG B CG  1 
ATOM 1170 C CD  . ARG B 2 22  ? -13.111 -5.422  10.758  1.00 126.42 ? 19   ARG B CD  1 
ATOM 1171 N NE  . ARG B 2 22  ? -13.940 -4.330  10.225  1.00 128.48 ? 19   ARG B NE  1 
ATOM 1172 C CZ  . ARG B 2 22  ? -14.338 -4.211  8.954   1.00 130.59 ? 19   ARG B CZ  1 
ATOM 1173 N NH1 . ARG B 2 22  ? -13.998 -5.119  8.044   1.00 132.34 ? 19   ARG B NH1 1 
ATOM 1174 N NH2 . ARG B 2 22  ? -15.082 -3.174  8.585   1.00 131.27 ? 19   ARG B NH2 1 
ATOM 1175 N N   . SER B 2 23  ? -9.233  -2.251  8.033   1.00 107.05 ? 20   SER B N   1 
ATOM 1176 C CA  . SER B 2 23  ? -8.905  -1.738  6.706   1.00 105.99 ? 20   SER B CA  1 
ATOM 1177 C C   . SER B 2 23  ? -7.598  -0.928  6.695   1.00 101.12 ? 20   SER B C   1 
ATOM 1178 O O   . SER B 2 23  ? -7.296  -0.214  7.662   1.00 98.82  ? 20   SER B O   1 
ATOM 1179 C CB  . SER B 2 23  ? -10.088 -0.957  6.112   1.00 108.61 ? 20   SER B CB  1 
ATOM 1180 O OG  . SER B 2 23  ? -10.517 0.087   6.964   1.00 107.91 ? 20   SER B OG  1 
ATOM 1181 N N   . PRO B 2 24  ? -6.823  -1.034  5.593   1.00 99.93  ? 21   PRO B N   1 
ATOM 1182 C CA  . PRO B 2 24  ? -5.441  -0.552  5.512   1.00 95.98  ? 21   PRO B CA  1 
ATOM 1183 C C   . PRO B 2 24  ? -5.300  0.957   5.677   1.00 93.20  ? 21   PRO B C   1 
ATOM 1184 O O   . PRO B 2 24  ? -6.170  1.704   5.224   1.00 94.90  ? 21   PRO B O   1 
ATOM 1185 C CB  . PRO B 2 24  ? -5.010  -0.961  4.097   1.00 97.17  ? 21   PRO B CB  1 
ATOM 1186 C CG  . PRO B 2 24  ? -5.992  -1.972  3.674   1.00 101.50 ? 21   PRO B CG  1 
ATOM 1187 C CD  . PRO B 2 24  ? -7.265  -1.572  4.298   1.00 103.09 ? 21   PRO B CD  1 
ATOM 1188 N N   . PRO B 2 25  ? -4.204  1.402   6.317   1.00 89.54  ? 22   PRO B N   1 
ATOM 1189 C CA  . PRO B 2 25  ? -3.862  2.817   6.478   1.00 87.24  ? 22   PRO B CA  1 
ATOM 1190 C C   . PRO B 2 25  ? -3.870  3.548   5.145   1.00 87.63  ? 22   PRO B C   1 
ATOM 1191 O O   . PRO B 2 25  ? -3.209  3.115   4.207   1.00 88.09  ? 22   PRO B O   1 
ATOM 1192 C CB  . PRO B 2 25  ? -2.430  2.773   7.019   1.00 84.36  ? 22   PRO B CB  1 
ATOM 1193 C CG  . PRO B 2 25  ? -1.953  1.374   6.764   1.00 85.20  ? 22   PRO B CG  1 
ATOM 1194 C CD  . PRO B 2 25  ? -3.166  0.531   6.886   1.00 88.14  ? 22   PRO B CD  1 
ATOM 1195 N N   . LEU B 2 26  ? -4.614  4.642   5.049   1.00 88.10  ? 23   LEU B N   1 
ATOM 1196 C CA  . LEU B 2 26  ? -4.680  5.365   3.788   1.00 88.69  ? 23   LEU B CA  1 
ATOM 1197 C C   . LEU B 2 26  ? -3.667  6.498   3.746   1.00 86.11  ? 23   LEU B C   1 
ATOM 1198 O O   . LEU B 2 26  ? -3.548  7.244   4.707   1.00 85.10  ? 23   LEU B O   1 
ATOM 1199 C CB  . LEU B 2 26  ? -6.084  5.910   3.558   1.00 91.52  ? 23   LEU B CB  1 
ATOM 1200 C CG  . LEU B 2 26  ? -6.466  5.804   2.085   1.00 94.25  ? 23   LEU B CG  1 
ATOM 1201 C CD1 . LEU B 2 26  ? -7.214  4.492   1.831   1.00 97.08  ? 23   LEU B CD1 1 
ATOM 1202 C CD2 . LEU B 2 26  ? -7.290  7.003   1.664   1.00 95.92  ? 23   LEU B CD2 1 
ATOM 1203 N N   . LYS B 2 27  ? -2.940  6.626   2.639   1.00 85.53  ? 24   LYS B N   1 
ATOM 1204 C CA  . LYS B 2 27  ? -2.056  7.773   2.439   1.00 83.81  ? 24   LYS B CA  1 
ATOM 1205 C C   . LYS B 2 27  ? -2.919  9.004   2.255   1.00 85.25  ? 24   LYS B C   1 
ATOM 1206 O O   . LYS B 2 27  ? -3.629  9.125   1.259   1.00 87.95  ? 24   LYS B O   1 
ATOM 1207 C CB  . LYS B 2 27  ? -1.164  7.587   1.212   1.00 84.17  ? 24   LYS B CB  1 
ATOM 1208 C CG  . LYS B 2 27  ? -0.352  6.309   1.218   1.00 83.99  ? 24   LYS B CG  1 
ATOM 1209 C CD  . LYS B 2 27  ? 0.493   6.161   -0.023  1.00 85.32  ? 24   LYS B CD  1 
ATOM 1210 C CE  . LYS B 2 27  ? 1.611   5.157   0.231   1.00 84.68  ? 24   LYS B CE  1 
ATOM 1211 N NZ  . LYS B 2 27  ? 2.756   5.441   -0.692  1.00 86.66  ? 24   LYS B NZ  1 
ATOM 1212 N N   . VAL B 2 28  ? -2.887  9.902   3.232   1.00 84.07  ? 25   VAL B N   1 
ATOM 1213 C CA  . VAL B 2 28  ? -3.663  11.137  3.160   1.00 85.71  ? 25   VAL B CA  1 
ATOM 1214 C C   . VAL B 2 28  ? -2.880  12.340  3.649   1.00 84.80  ? 25   VAL B C   1 
ATOM 1215 O O   . VAL B 2 28  ? -1.951  12.220  4.459   1.00 82.78  ? 25   VAL B O   1 
ATOM 1216 C CB  . VAL B 2 28  ? -4.993  11.049  3.933   1.00 87.21  ? 25   VAL B CB  1 
ATOM 1217 C CG1 . VAL B 2 28  ? -6.039  10.349  3.098   1.00 90.28  ? 25   VAL B CG1 1 
ATOM 1218 C CG2 . VAL B 2 28  ? -4.804  10.349  5.250   1.00 84.84  ? 25   VAL B CG2 1 
ATOM 1219 N N   . LEU B 2 29  ? -3.264  13.502  3.137   1.00 86.87  ? 26   LEU B N   1 
ATOM 1220 C CA  . LEU B 2 29  ? -2.664  14.758  3.541   1.00 87.05  ? 26   LEU B CA  1 
ATOM 1221 C C   . LEU B 2 29  ? -3.548  15.450  4.565   1.00 88.92  ? 26   LEU B C   1 
ATOM 1222 O O   . LEU B 2 29  ? -4.749  15.174  4.627   1.00 91.23  ? 26   LEU B O   1 
ATOM 1223 C CB  . LEU B 2 29  ? -2.478  15.644  2.320   1.00 88.67  ? 26   LEU B CB  1 
ATOM 1224 C CG  . LEU B 2 29  ? -1.572  15.019  1.265   1.00 87.81  ? 26   LEU B CG  1 
ATOM 1225 C CD1 . LEU B 2 29  ? -1.786  15.680  -0.073  1.00 90.91  ? 26   LEU B CD1 1 
ATOM 1226 C CD2 . LEU B 2 29  ? -0.107  15.106  1.691   1.00 86.14  ? 26   LEU B CD2 1 
ATOM 1227 N N   . ALA B 2 30  ? -2.965  16.338  5.368   1.00 88.86  ? 27   ALA B N   1 
ATOM 1228 C CA  . ALA B 2 30  ? -3.728  17.092  6.355   1.00 91.17  ? 27   ALA B CA  1 
ATOM 1229 C C   . ALA B 2 30  ? -5.001  17.658  5.726   1.00 94.98  ? 27   ALA B C   1 
ATOM 1230 O O   . ALA B 2 30  ? -6.112  17.355  6.161   1.00 96.42  ? 27   ALA B O   1 
ATOM 1231 C CB  . ALA B 2 30  ? -2.874  18.198  6.952   1.00 91.36  ? 27   ALA B CB  1 
ATOM 1232 N N   . GLU B 2 31  ? -4.822  18.443  4.669   1.00 97.26  ? 28   GLU B N   1 
ATOM 1233 C CA  . GLU B 2 31  ? -5.920  19.067  3.939   1.00 101.88 ? 28   GLU B CA  1 
ATOM 1234 C C   . GLU B 2 31  ? -7.015  18.084  3.537   1.00 102.89 ? 28   GLU B C   1 
ATOM 1235 O O   . GLU B 2 31  ? -8.197  18.398  3.644   1.00 106.42 ? 28   GLU B O   1 
ATOM 1236 C CB  . GLU B 2 31  ? -5.398  19.770  2.686   1.00 103.32 ? 28   GLU B CB  1 
ATOM 1237 C CG  . GLU B 2 31  ? -6.390  20.760  2.088   1.00 110.19 ? 28   GLU B CG  1 
ATOM 1238 C CD  . GLU B 2 31  ? -6.349  20.808  0.568   1.00 114.65 ? 28   GLU B CD  1 
ATOM 1239 O OE1 . GLU B 2 31  ? -5.417  20.191  -0.011  1.00 112.94 ? 28   GLU B OE1 1 
ATOM 1240 O OE2 . GLU B 2 31  ? -7.252  21.463  -0.033  1.00 119.35 ? 28   GLU B OE2 1 
ATOM 1241 N N   . GLN B 2 32  ? -6.625  16.903  3.068   1.00 100.73 ? 29   GLN B N   1 
ATOM 1242 C CA  . GLN B 2 32  ? -7.594  15.922  2.582   1.00 102.11 ? 29   GLN B CA  1 
ATOM 1243 C C   . GLN B 2 32  ? -8.564  15.497  3.672   1.00 103.15 ? 29   GLN B C   1 
ATOM 1244 O O   . GLN B 2 32  ? -9.758  15.306  3.411   1.00 106.33 ? 29   GLN B O   1 
ATOM 1245 C CB  . GLN B 2 32  ? -6.895  14.721  1.957   1.00 99.63  ? 29   GLN B CB  1 
ATOM 1246 C CG  . GLN B 2 32  ? -6.399  15.010  0.553   1.00 99.79  ? 29   GLN B CG  1 
ATOM 1247 C CD  . GLN B 2 32  ? -5.793  13.806  -0.121  1.00 97.60  ? 29   GLN B CD  1 
ATOM 1248 O OE1 . GLN B 2 32  ? -5.069  13.942  -1.101  1.00 97.33  ? 29   GLN B OE1 1 
ATOM 1249 N NE2 . GLN B 2 32  ? -6.082  12.615  0.399   1.00 96.81  ? 29   GLN B NE2 1 
ATOM 1250 N N   . LEU B 2 33  ? -8.045  15.377  4.891   1.00 100.84 ? 30   LEU B N   1 
ATOM 1251 C CA  . LEU B 2 33  ? -8.868  15.090  6.049   1.00 102.15 ? 30   LEU B CA  1 
ATOM 1252 C C   . LEU B 2 33  ? -9.641  16.311  6.462   1.00 105.96 ? 30   LEU B C   1 
ATOM 1253 O O   . LEU B 2 33  ? -10.844 16.242  6.706   1.00 109.23 ? 30   LEU B O   1 
ATOM 1254 C CB  . LEU B 2 33  ? -7.996  14.650  7.203   1.00 98.87  ? 30   LEU B CB  1 
ATOM 1255 C CG  . LEU B 2 33  ? -7.798  13.149  7.262   1.00 96.82  ? 30   LEU B CG  1 
ATOM 1256 C CD1 . LEU B 2 33  ? -6.392  12.831  7.729   1.00 93.31  ? 30   LEU B CD1 1 
ATOM 1257 C CD2 . LEU B 2 33  ? -8.860  12.541  8.171   1.00 98.60  ? 30   LEU B CD2 1 
ATOM 1258 N N   . ARG B 2 34  ? -8.931  17.432  6.536   1.00 106.38 ? 31   ARG B N   1 
ATOM 1259 C CA  . ARG B 2 34  ? -9.500  18.691  6.987   1.00 110.48 ? 31   ARG B CA  1 
ATOM 1260 C C   . ARG B 2 34  ? -10.674 19.131  6.121   1.00 115.09 ? 31   ARG B C   1 
ATOM 1261 O O   . ARG B 2 34  ? -11.636 19.702  6.624   1.00 118.89 ? 31   ARG B O   1 
ATOM 1262 C CB  . ARG B 2 34  ? -8.433  19.782  7.019   1.00 109.81 ? 31   ARG B CB  1 
ATOM 1263 C CG  . ARG B 2 34  ? -8.741  20.867  8.017   1.00 113.49 ? 31   ARG B CG  1 
ATOM 1264 C CD  . ARG B 2 34  ? -7.965  22.132  7.750   1.00 115.47 ? 31   ARG B CD  1 
ATOM 1265 N NE  . ARG B 2 34  ? -8.571  22.948  6.699   1.00 119.40 ? 31   ARG B NE  1 
ATOM 1266 C CZ  . ARG B 2 34  ? -8.044  23.118  5.490   1.00 119.12 ? 31   ARG B CZ  1 
ATOM 1267 N NH1 . ARG B 2 34  ? -6.891  22.527  5.170   1.00 115.24 ? 31   ARG B NH1 1 
ATOM 1268 N NH2 . ARG B 2 34  ? -8.662  23.889  4.604   1.00 122.10 ? 31   ARG B NH2 1 
ATOM 1269 N N   . ARG B 2 35  ? -10.596 18.866  4.822   1.00 115.65 ? 32   ARG B N   1 
ATOM 1270 C CA  . ARG B 2 35  ? -11.707 19.183  3.940   1.00 120.70 ? 32   ARG B CA  1 
ATOM 1271 C C   . ARG B 2 35  ? -12.700 18.012  3.923   1.00 122.13 ? 32   ARG B C   1 
ATOM 1272 O O   . ARG B 2 35  ? -13.892 18.216  4.176   1.00 126.26 ? 32   ARG B O   1 
ATOM 1273 C CB  . ARG B 2 35  ? -11.231 19.619  2.538   1.00 121.40 ? 32   ARG B CB  1 
ATOM 1274 C CG  . ARG B 2 35  ? -10.009 20.562  2.560   1.00 120.23 ? 32   ARG B CG  1 
ATOM 1275 C CD  . ARG B 2 35  ? -10.176 21.875  1.774   1.00 125.91 ? 32   ARG B CD  1 
ATOM 1276 N NE  . ARG B 2 35  ? -10.706 22.967  2.609   1.00 130.15 ? 32   ARG B NE  1 
ATOM 1277 C CZ  . ARG B 2 35  ? -10.450 24.268  2.438   1.00 132.61 ? 32   ARG B CZ  1 
ATOM 1278 N NH1 . ARG B 2 35  ? -9.644  24.682  1.469   1.00 132.35 ? 32   ARG B NH1 1 
ATOM 1279 N NH2 . ARG B 2 35  ? -10.990 25.162  3.257   1.00 135.80 ? 32   ARG B NH2 1 
ATOM 1280 N N   . ASP B 2 36  ? -12.207 16.793  3.679   1.00 119.37 ? 33   ASP B N   1 
ATOM 1281 C CA  . ASP B 2 36  ? -13.059 15.584  3.692   1.00 120.80 ? 33   ASP B CA  1 
ATOM 1282 C C   . ASP B 2 36  ? -12.760 14.681  4.898   1.00 117.85 ? 33   ASP B C   1 
ATOM 1283 O O   . ASP B 2 36  ? -13.518 13.759  5.213   1.00 119.10 ? 33   ASP B O   1 
ATOM 1284 C CB  . ASP B 2 36  ? -12.917 14.779  2.387   1.00 120.95 ? 33   ASP B CB  1 
ATOM 1285 C CG  . ASP B 2 36  ? -13.014 15.646  1.134   1.00 124.02 ? 33   ASP B CG  1 
ATOM 1286 O OD1 . ASP B 2 36  ? -14.011 16.388  0.974   1.00 128.25 ? 33   ASP B OD1 1 
ATOM 1287 O OD2 . ASP B 2 36  ? -12.087 15.570  0.298   1.00 122.58 ? 33   ASP B OD2 1 
ATOM 1288 N N   . ALA B 2 59  ? -10.860 5.572   8.210   1.00 94.62  ? 56   ALA B N   1 
ATOM 1289 C CA  . ALA B 2 59  ? -10.871 5.837   9.651   1.00 94.36  ? 56   ALA B CA  1 
ATOM 1290 C C   . ALA B 2 59  ? -9.507  5.537   10.271  1.00 90.70  ? 56   ALA B C   1 
ATOM 1291 O O   . ALA B 2 59  ? -9.163  6.095   11.334  1.00 89.78  ? 56   ALA B O   1 
ATOM 1292 C CB  . ALA B 2 59  ? -11.986 5.036   10.355  1.00 97.76  ? 56   ALA B CB  1 
ATOM 1293 N N   . ALA B 2 60  ? -8.753  4.655   9.595   1.00 88.97  ? 57   ALA B N   1 
ATOM 1294 C CA  . ALA B 2 60  ? -7.348  4.328   9.921   1.00 85.37  ? 57   ALA B CA  1 
ATOM 1295 C C   . ALA B 2 60  ? -6.408  4.740   8.784   1.00 82.84  ? 57   ALA B C   1 
ATOM 1296 O O   . ALA B 2 60  ? -6.557  4.270   7.654   1.00 83.53  ? 57   ALA B O   1 
ATOM 1297 C CB  . ALA B 2 60  ? -7.204  2.857   10.202  1.00 86.04  ? 57   ALA B CB  1 
ATOM 1298 N N   . VAL B 2 61  ? -5.440  5.606   9.093   1.00 80.17  ? 58   VAL B N   1 
ATOM 1299 C CA  . VAL B 2 61  ? -4.660  6.298   8.051   1.00 78.58  ? 58   VAL B CA  1 
ATOM 1300 C C   . VAL B 2 61  ? -3.123  6.231   8.116   1.00 75.92  ? 58   VAL B C   1 
ATOM 1301 O O   . VAL B 2 61  ? -2.526  5.754   9.080   1.00 74.98  ? 58   VAL B O   1 
ATOM 1302 C CB  . VAL B 2 61  ? -5.077  7.784   7.900   1.00 79.14  ? 58   VAL B CB  1 
ATOM 1303 C CG1 . VAL B 2 61  ? -6.436  7.894   7.236   1.00 82.65  ? 58   VAL B CG1 1 
ATOM 1304 C CG2 . VAL B 2 61  ? -5.054  8.499   9.232   1.00 78.60  ? 58   VAL B CG2 1 
ATOM 1305 N N   . TRP B 2 62  ? -2.516  6.753   7.057   1.00 75.15  ? 59   TRP B N   1 
ATOM 1306 C CA  . TRP B 2 62  ? -1.088  6.800   6.863   1.00 73.25  ? 59   TRP B CA  1 
ATOM 1307 C C   . TRP B 2 62  ? -0.732  8.239   6.482   1.00 73.44  ? 59   TRP B C   1 
ATOM 1308 O O   . TRP B 2 62  ? -1.044  8.684   5.383   1.00 74.75  ? 59   TRP B O   1 
ATOM 1309 C CB  . TRP B 2 62  ? -0.730  5.844   5.721   1.00 73.17  ? 59   TRP B CB  1 
ATOM 1310 C CG  . TRP B 2 62  ? 0.684   5.919   5.226   1.00 71.03  ? 59   TRP B CG  1 
ATOM 1311 C CD1 . TRP B 2 62  ? 1.532   7.005   5.259   1.00 69.58  ? 59   TRP B CD1 1 
ATOM 1312 C CD2 . TRP B 2 62  ? 1.406   4.874   4.579   1.00 70.08  ? 59   TRP B CD2 1 
ATOM 1313 N NE1 . TRP B 2 62  ? 2.741   6.683   4.694   1.00 68.60  ? 59   TRP B NE1 1 
ATOM 1314 C CE2 . TRP B 2 62  ? 2.691   5.383   4.262   1.00 69.04  ? 59   TRP B CE2 1 
ATOM 1315 C CE3 . TRP B 2 62  ? 1.097   3.555   4.236   1.00 71.09  ? 59   TRP B CE3 1 
ATOM 1316 C CZ2 . TRP B 2 62  ? 3.661   4.616   3.617   1.00 69.31  ? 59   TRP B CZ2 1 
ATOM 1317 C CZ3 . TRP B 2 62  ? 2.065   2.791   3.598   1.00 71.81  ? 59   TRP B CZ3 1 
ATOM 1318 C CH2 . TRP B 2 62  ? 3.331   3.323   3.294   1.00 70.63  ? 59   TRP B CH2 1 
ATOM 1319 N N   . MET B 2 63  ? -0.092  8.974   7.385   1.00 73.05  ? 60   MET B N   1 
ATOM 1320 C CA  . MET B 2 63  ? 0.327   10.348  7.087   1.00 73.56  ? 60   MET B CA  1 
ATOM 1321 C C   . MET B 2 63  ? 1.789   10.601  7.454   1.00 72.55  ? 60   MET B C   1 
ATOM 1322 O O   . MET B 2 63  ? 2.363   9.914   8.305   1.00 71.83  ? 60   MET B O   1 
ATOM 1323 C CB  . MET B 2 63  ? -0.528  11.348  7.843   1.00 75.01  ? 60   MET B CB  1 
ATOM 1324 C CG  . MET B 2 63  ? -2.013  11.155  7.746   1.00 77.63  ? 60   MET B CG  1 
ATOM 1325 S SD  . MET B 2 63  ? -2.875  12.435  8.696   1.00 81.94  ? 60   MET B SD  1 
ATOM 1326 C CE  . MET B 2 63  ? -2.646  13.896  7.673   1.00 81.22  ? 60   MET B CE  1 
ATOM 1327 N N   . GLN B 2 64  ? 2.382   11.609  6.824   1.00 72.97  ? 61   GLN B N   1 
ATOM 1328 C CA  . GLN B 2 64  ? 3.778   11.937  7.059   1.00 72.44  ? 61   GLN B CA  1 
ATOM 1329 C C   . GLN B 2 64  ? 3.914   13.421  7.284   1.00 73.66  ? 61   GLN B C   1 
ATOM 1330 O O   . GLN B 2 64  ? 2.963   14.167  7.085   1.00 74.97  ? 61   GLN B O   1 
ATOM 1331 C CB  . GLN B 2 64  ? 4.641   11.499  5.875   1.00 72.12  ? 61   GLN B CB  1 
ATOM 1332 C CG  . GLN B 2 64  ? 4.536   10.016  5.573   1.00 72.59  ? 61   GLN B CG  1 
ATOM 1333 C CD  . GLN B 2 64  ? 5.503   9.539   4.518   1.00 74.43  ? 61   GLN B CD  1 
ATOM 1334 O OE1 . GLN B 2 64  ? 5.482   8.364   4.148   1.00 76.17  ? 61   GLN B OE1 1 
ATOM 1335 N NE2 . GLN B 2 64  ? 6.352   10.438  4.017   1.00 74.73  ? 61   GLN B NE2 1 
ATOM 1336 N N   . GLY B 2 65  ? 5.100   13.847  7.707   1.00 73.91  ? 62   GLY B N   1 
ATOM 1337 C CA  . GLY B 2 65  ? 5.351   15.262  7.953   1.00 75.58  ? 62   GLY B CA  1 
ATOM 1338 C C   . GLY B 2 65  ? 6.501   15.553  8.892   1.00 75.91  ? 62   GLY B C   1 
ATOM 1339 O O   . GLY B 2 65  ? 6.854   14.729  9.731   1.00 74.96  ? 62   GLY B O   1 
ATOM 1340 N N   . ARG B 2 66  ? 7.083   16.739  8.723   1.00 77.76  ? 63   ARG B N   1 
ATOM 1341 C CA  . ARG B 2 66  ? 8.151   17.233  9.571   1.00 79.27  ? 63   ARG B CA  1 
ATOM 1342 C C   . ARG B 2 66  ? 7.602   17.466  10.952  1.00 80.59  ? 63   ARG B C   1 
ATOM 1343 O O   . ARG B 2 66  ? 6.433   17.795  11.105  1.00 81.06  ? 63   ARG B O   1 
ATOM 1344 C CB  . ARG B 2 66  ? 8.691   18.542  9.019   1.00 81.46  ? 63   ARG B CB  1 
ATOM 1345 C CG  . ARG B 2 66  ? 9.750   18.380  7.971   1.00 82.12  ? 63   ARG B CG  1 
ATOM 1346 C CD  . ARG B 2 66  ? 11.121  18.554  8.589   1.00 85.86  ? 63   ARG B CD  1 
ATOM 1347 N NE  . ARG B 2 66  ? 12.186  17.940  7.792   1.00 87.15  ? 63   ARG B NE  1 
ATOM 1348 C CZ  . ARG B 2 66  ? 12.779  18.513  6.745   1.00 89.32  ? 63   ARG B CZ  1 
ATOM 1349 N NH1 . ARG B 2 66  ? 12.408  19.727  6.331   1.00 91.90  ? 63   ARG B NH1 1 
ATOM 1350 N NH2 . ARG B 2 66  ? 13.741  17.861  6.101   1.00 88.81  ? 63   ARG B NH2 1 
ATOM 1351 N N   . VAL B 2 67  ? 8.442   17.283  11.959  1.00 81.79  ? 64   VAL B N   1 
ATOM 1352 C CA  . VAL B 2 67  ? 8.025   17.518  13.328  1.00 84.17  ? 64   VAL B CA  1 
ATOM 1353 C C   . VAL B 2 67  ? 8.169   19.002  13.610  1.00 88.08  ? 64   VAL B C   1 
ATOM 1354 O O   . VAL B 2 67  ? 9.265   19.564  13.459  1.00 89.56  ? 64   VAL B O   1 
ATOM 1355 C CB  . VAL B 2 67  ? 8.838   16.690  14.345  1.00 84.22  ? 64   VAL B CB  1 
ATOM 1356 C CG1 . VAL B 2 67  ? 8.266   16.841  15.742  1.00 86.21  ? 64   VAL B CG1 1 
ATOM 1357 C CG2 . VAL B 2 67  ? 8.833   15.233  13.956  1.00 81.67  ? 64   VAL B CG2 1 
ATOM 1358 N N   . VAL B 2 68  ? 7.046   19.621  13.993  1.00 90.29  ? 65   VAL B N   1 
ATOM 1359 C CA  . VAL B 2 68  ? 6.975   21.046  14.344  1.00 94.58  ? 65   VAL B CA  1 
ATOM 1360 C C   . VAL B 2 68  ? 7.138   21.230  15.843  1.00 97.90  ? 65   VAL B C   1 
ATOM 1361 O O   . VAL B 2 68  ? 7.934   22.057  16.292  1.00 101.10 ? 65   VAL B O   1 
ATOM 1362 C CB  . VAL B 2 68  ? 5.629   21.676  13.937  1.00 95.46  ? 65   VAL B CB  1 
ATOM 1363 C CG1 . VAL B 2 68  ? 5.701   23.184  14.045  1.00 99.43  ? 65   VAL B CG1 1 
ATOM 1364 C CG2 . VAL B 2 68  ? 5.247   21.266  12.523  1.00 93.09  ? 65   VAL B CG2 1 
ATOM 1365 N N   . MET B 2 69  ? 6.365   20.462  16.604  1.00 97.71  ? 66   MET B N   1 
ATOM 1366 C CA  . MET B 2 69  ? 6.478   20.440  18.053  1.00 101.33 ? 66   MET B CA  1 
ATOM 1367 C C   . MET B 2 69  ? 6.275   19.038  18.595  1.00 99.49  ? 66   MET B C   1 
ATOM 1368 O O   . MET B 2 69  ? 5.386   18.321  18.148  1.00 97.09  ? 66   MET B O   1 
ATOM 1369 C CB  . MET B 2 69  ? 5.466   21.390  18.685  1.00 105.14 ? 66   MET B CB  1 
ATOM 1370 C CG  . MET B 2 69  ? 6.030   22.756  18.946  1.00 110.22 ? 66   MET B CG  1 
ATOM 1371 S SD  . MET B 2 69  ? 4.787   23.883  19.576  1.00 116.50 ? 66   MET B SD  1 
ATOM 1372 C CE  . MET B 2 69  ? 5.822   25.287  20.028  1.00 121.43 ? 66   MET B CE  1 
ATOM 1373 N N   . ALA B 2 70  ? 7.107   18.654  19.557  1.00 101.28 ? 67   ALA B N   1 
ATOM 1374 C CA  . ALA B 2 70  ? 6.970   17.370  20.229  1.00 100.53 ? 67   ALA B CA  1 
ATOM 1375 C C   . ALA B 2 70  ? 7.079   17.597  21.724  1.00 105.24 ? 67   ALA B C   1 
ATOM 1376 O O   . ALA B 2 70  ? 8.015   18.233  22.191  1.00 108.68 ? 67   ALA B O   1 
ATOM 1377 C CB  . ALA B 2 70  ? 8.042   16.399  19.757  1.00 97.80  ? 67   ALA B CB  1 
ATOM 1378 N N   . ASP B 2 71  ? 6.111   17.089  22.472  1.00 106.24 ? 68   ASP B N   1 
ATOM 1379 C CA  . ASP B 2 71  ? 6.126   17.210  23.913  1.00 110.92 ? 68   ASP B CA  1 
ATOM 1380 C C   . ASP B 2 71  ? 5.346   16.057  24.471  1.00 110.00 ? 68   ASP B C   1 
ATOM 1381 O O   . ASP B 2 71  ? 4.224   15.812  24.044  1.00 108.41 ? 68   ASP B O   1 
ATOM 1382 C CB  . ASP B 2 71  ? 5.500   18.536  24.352  1.00 115.44 ? 68   ASP B CB  1 
ATOM 1383 C CG  . ASP B 2 71  ? 6.544   19.608  24.657  1.00 120.79 ? 68   ASP B CG  1 
ATOM 1384 O OD1 . ASP B 2 71  ? 7.762   19.296  24.631  1.00 122.26 ? 68   ASP B OD1 1 
ATOM 1385 O OD2 . ASP B 2 71  ? 6.149   20.766  24.940  1.00 126.00 ? 68   ASP B OD2 1 
ATOM 1386 N N   . ARG B 2 72  ? 5.950   15.341  25.413  1.00 111.57 ? 69   ARG B N   1 
ATOM 1387 C CA  . ARG B 2 72  ? 5.333   14.166  26.022  1.00 111.14 ? 69   ARG B CA  1 
ATOM 1388 C C   . ARG B 2 72  ? 4.620   13.275  24.992  1.00 106.22 ? 69   ARG B C   1 
ATOM 1389 O O   . ARG B 2 72  ? 5.168   13.008  23.914  1.00 102.72 ? 69   ARG B O   1 
ATOM 1390 C CB  . ARG B 2 72  ? 4.396   14.588  27.148  1.00 115.66 ? 69   ARG B CB  1 
ATOM 1391 C CG  . ARG B 2 72  ? 4.140   13.502  28.179  1.00 117.75 ? 69   ARG B CG  1 
ATOM 1392 C CD  . ARG B 2 72  ? 5.401   13.092  28.946  1.00 118.79 ? 69   ARG B CD  1 
ATOM 1393 N NE  . ARG B 2 72  ? 5.059   12.201  30.056  1.00 120.86 ? 69   ARG B NE  1 
ATOM 1394 C CZ  . ARG B 2 72  ? 5.940   11.496  30.750  1.00 121.53 ? 69   ARG B CZ  1 
ATOM 1395 N NH1 . ARG B 2 72  ? 5.534   10.715  31.737  1.00 124.11 ? 69   ARG B NH1 1 
ATOM 1396 N NH2 . ARG B 2 72  ? 7.224   11.577  30.450  1.00 120.03 ? 69   ARG B NH2 1 
ATOM 1397 N N   . GLY B 2 73  ? 3.404   12.831  25.302  1.00 106.47 ? 70   GLY B N   1 
ATOM 1398 C CA  . GLY B 2 73  ? 2.706   11.852  24.459  1.00 102.63 ? 70   GLY B CA  1 
ATOM 1399 C C   . GLY B 2 73  ? 2.191   12.339  23.118  1.00 99.29  ? 70   GLY B C   1 
ATOM 1400 O O   . GLY B 2 73  ? 1.609   11.572  22.362  1.00 96.34  ? 70   GLY B O   1 
ATOM 1401 N N   . GLU B 2 74  ? 2.420   13.617  22.831  1.00 100.33 ? 71   GLU B N   1 
ATOM 1402 C CA  . GLU B 2 74  ? 1.862   14.273  21.655  1.00 98.58  ? 71   GLU B CA  1 
ATOM 1403 C C   . GLU B 2 74  ? 2.908   15.017  20.847  1.00 96.84  ? 71   GLU B C   1 
ATOM 1404 O O   . GLU B 2 74  ? 4.026   15.252  21.305  1.00 97.65  ? 71   GLU B O   1 
ATOM 1405 C CB  . GLU B 2 74  ? 0.687   15.205  22.032  1.00 102.08 ? 71   GLU B CB  1 
ATOM 1406 C CG  . GLU B 2 74  ? 0.992   16.305  23.073  1.00 108.59 ? 71   GLU B CG  1 
ATOM 1407 C CD  . GLU B 2 74  ? 1.514   17.612  22.457  1.00 111.85 ? 71   GLU B CD  1 
ATOM 1408 O OE1 . GLU B 2 74  ? 2.062   18.451  23.223  1.00 115.72 ? 71   GLU B OE1 1 
ATOM 1409 O OE2 . GLU B 2 74  ? 1.368   17.804  21.218  1.00 110.35 ? 71   GLU B OE2 1 
ATOM 1410 N N   . ALA B 2 75  ? 2.507   15.377  19.632  1.00 94.79  ? 72   ALA B N   1 
ATOM 1411 C CA  . ALA B 2 75  ? 3.338   16.093  18.674  1.00 93.48  ? 72   ALA B CA  1 
ATOM 1412 C C   . ALA B 2 75  ? 2.487   16.624  17.522  1.00 92.30  ? 72   ALA B C   1 
ATOM 1413 O O   . ALA B 2 75  ? 1.466   16.032  17.164  1.00 91.15  ? 72   ALA B O   1 
ATOM 1414 C CB  . ALA B 2 75  ? 4.439   15.187  18.136  1.00 90.73  ? 72   ALA B CB  1 
ATOM 1415 N N   . ARG B 2 76  ? 2.926   17.741  16.950  1.00 92.91  ? 73   ARG B N   1 
ATOM 1416 C CA  . ARG B 2 76  ? 2.265   18.360  15.810  1.00 92.33  ? 73   ARG B CA  1 
ATOM 1417 C C   . ARG B 2 76  ? 3.192   18.327  14.599  1.00 89.67  ? 73   ARG B C   1 
ATOM 1418 O O   . ARG B 2 76  ? 4.350   18.746  14.677  1.00 90.20  ? 73   ARG B O   1 
ATOM 1419 C CB  . ARG B 2 76  ? 1.888   19.795  16.147  1.00 96.34  ? 73   ARG B CB  1 
ATOM 1420 C CG  . ARG B 2 76  ? 0.742   20.352  15.335  1.00 97.93  ? 73   ARG B CG  1 
ATOM 1421 C CD  . ARG B 2 76  ? 0.210   21.635  15.947  1.00 103.49 ? 73   ARG B CD  1 
ATOM 1422 N NE  . ARG B 2 76  ? 1.119   22.757  15.734  1.00 106.96 ? 73   ARG B NE  1 
ATOM 1423 C CZ  . ARG B 2 76  ? 1.988   23.220  16.635  1.00 110.60 ? 73   ARG B CZ  1 
ATOM 1424 N NH1 . ARG B 2 76  ? 2.093   22.661  17.840  1.00 111.81 ? 73   ARG B NH1 1 
ATOM 1425 N NH2 . ARG B 2 76  ? 2.757   24.258  16.328  1.00 113.04 ? 73   ARG B NH2 1 
ATOM 1426 N N   . LEU B 2 77  ? 2.673   17.825  13.485  1.00 87.14  ? 74   LEU B N   1 
ATOM 1427 C CA  . LEU B 2 77  ? 3.480   17.572  12.306  1.00 84.85  ? 74   LEU B CA  1 
ATOM 1428 C C   . LEU B 2 77  ? 3.140   18.523  11.167  1.00 85.98  ? 74   LEU B C   1 
ATOM 1429 O O   . LEU B 2 77  ? 2.052   19.104  11.134  1.00 87.62  ? 74   LEU B O   1 
ATOM 1430 C CB  . LEU B 2 77  ? 3.310   16.122  11.846  1.00 81.94  ? 74   LEU B CB  1 
ATOM 1431 C CG  . LEU B 2 77  ? 3.838   15.023  12.770  1.00 80.54  ? 74   LEU B CG  1 
ATOM 1432 C CD1 . LEU B 2 77  ? 3.197   13.687  12.456  1.00 77.76  ? 74   LEU B CD1 1 
ATOM 1433 C CD2 . LEU B 2 77  ? 5.342   14.926  12.677  1.00 79.95  ? 74   LEU B CD2 1 
ATOM 1434 N N   . ARG B 2 78  ? 4.085   18.676  10.237  1.00 85.31  ? 75   ARG B N   1 
ATOM 1435 C CA  . ARG B 2 78  ? 3.876   19.485  9.042   1.00 86.16  ? 75   ARG B CA  1 
ATOM 1436 C C   . ARG B 2 78  ? 4.231   18.742  7.743   1.00 83.81  ? 75   ARG B C   1 
ATOM 1437 O O   . ARG B 2 78  ? 5.408   18.471  7.464   1.00 82.94  ? 75   ARG B O   1 
ATOM 1438 C CB  . ARG B 2 78  ? 4.647   20.804  9.126   1.00 88.74  ? 75   ARG B CB  1 
ATOM 1439 C CG  . ARG B 2 78  ? 4.093   21.860  8.182   1.00 92.04  ? 75   ARG B CG  1 
ATOM 1440 C CD  . ARG B 2 78  ? 5.159   22.800  7.654   1.00 95.28  ? 75   ARG B CD  1 
ATOM 1441 N NE  . ARG B 2 78  ? 6.137   22.124  6.800   1.00 93.52  ? 75   ARG B NE  1 
ATOM 1442 C CZ  . ARG B 2 78  ? 7.442   22.068  7.055   1.00 93.84  ? 75   ARG B CZ  1 
ATOM 1443 N NH1 . ARG B 2 78  ? 8.257   21.420  6.217   1.00 92.31  ? 75   ARG B NH1 1 
ATOM 1444 N NH2 . ARG B 2 78  ? 7.930   22.665  8.146   1.00 95.48  ? 75   ARG B NH2 1 
ATOM 1445 N N   . ASP B 2 79  ? 3.197   18.419  6.963   1.00 83.16  ? 76   ASP B N   1 
ATOM 1446 C CA  . ASP B 2 79  ? 3.368   17.959  5.579   1.00 81.73  ? 76   ASP B CA  1 
ATOM 1447 C C   . ASP B 2 79  ? 2.992   19.090  4.585   1.00 83.83  ? 76   ASP B C   1 
ATOM 1448 O O   . ASP B 2 79  ? 2.530   20.154  5.030   1.00 85.70  ? 76   ASP B O   1 
ATOM 1449 C CB  . ASP B 2 79  ? 2.640   16.617  5.332   1.00 80.19  ? 76   ASP B CB  1 
ATOM 1450 C CG  . ASP B 2 79  ? 1.121   16.745  5.226   1.00 80.60  ? 76   ASP B CG  1 
ATOM 1451 O OD1 . ASP B 2 79  ? 0.585   17.867  5.138   1.00 81.64  ? 76   ASP B OD1 1 
ATOM 1452 O OD2 . ASP B 2 79  ? 0.463   15.681  5.213   1.00 79.07  ? 76   ASP B OD2 1 
ATOM 1453 N N   . PRO B 2 80  ? 3.198   18.877  3.251   1.00 83.59  ? 77   PRO B N   1 
ATOM 1454 C CA  . PRO B 2 80  ? 3.140   20.004  2.299   1.00 86.02  ? 77   PRO B CA  1 
ATOM 1455 C C   . PRO B 2 80  ? 1.758   20.669  2.244   1.00 88.13  ? 77   PRO B C   1 
ATOM 1456 O O   . PRO B 2 80  ? 1.635   21.842  1.890   1.00 90.75  ? 77   PRO B O   1 
ATOM 1457 C CB  . PRO B 2 80  ? 3.476   19.343  0.954   1.00 85.73  ? 77   PRO B CB  1 
ATOM 1458 C CG  . PRO B 2 80  ? 4.077   18.028  1.294   1.00 82.67  ? 77   PRO B CG  1 
ATOM 1459 C CD  . PRO B 2 80  ? 3.380   17.602  2.530   1.00 81.69  ? 77   PRO B CD  1 
ATOM 1460 N N   . SER B 2 81  ? 0.742   19.895  2.605   1.00 86.97  ? 78   SER B N   1 
ATOM 1461 C CA  . SER B 2 81  ? -0.617  20.363  2.745   1.00 88.87  ? 78   SER B CA  1 
ATOM 1462 C C   . SER B 2 81  ? -0.768  21.272  3.966   1.00 90.21  ? 78   SER B C   1 
ATOM 1463 O O   . SER B 2 81  ? -1.289  22.378  3.850   1.00 93.34  ? 78   SER B O   1 
ATOM 1464 C CB  . SER B 2 81  ? -1.548  19.154  2.822   1.00 87.55  ? 78   SER B CB  1 
ATOM 1465 O OG  . SER B 2 81  ? -2.470  19.274  3.875   1.00 88.24  ? 78   SER B OG  1 
ATOM 1466 N N   . GLY B 2 82  ? -0.304  20.808  5.129   1.00 88.39  ? 79   GLY B N   1 
ATOM 1467 C CA  . GLY B 2 82  ? -0.414  21.577  6.379   1.00 89.97  ? 79   GLY B CA  1 
ATOM 1468 C C   . GLY B 2 82  ? -0.065  20.824  7.653   1.00 87.83  ? 79   GLY B C   1 
ATOM 1469 O O   . GLY B 2 82  ? 0.732   19.890  7.628   1.00 85.20  ? 79   GLY B O   1 
ATOM 1470 N N   . ASP B 2 83  ? -0.675  21.237  8.765   1.00 89.65  ? 80   ASP B N   1 
ATOM 1471 C CA  . ASP B 2 83  ? -0.366  20.705  10.101  1.00 88.55  ? 80   ASP B CA  1 
ATOM 1472 C C   . ASP B 2 83  ? -1.380  19.701  10.630  1.00 87.43  ? 80   ASP B C   1 
ATOM 1473 O O   . ASP B 2 83  ? -2.557  19.753  10.302  1.00 88.73  ? 80   ASP B O   1 
ATOM 1474 C CB  . ASP B 2 83  ? -0.244  21.844  11.118  1.00 91.97  ? 80   ASP B CB  1 
ATOM 1475 C CG  . ASP B 2 83  ? 1.002   22.690  10.916  1.00 93.75  ? 80   ASP B CG  1 
ATOM 1476 O OD1 . ASP B 2 83  ? 1.646   22.595  9.842   1.00 93.04  ? 80   ASP B OD1 1 
ATOM 1477 O OD2 . ASP B 2 83  ? 1.331   23.462  11.844  1.00 97.05  ? 80   ASP B OD2 1 
ATOM 1478 N N   . PHE B 2 84  ? -0.903  18.789  11.465  1.00 85.35  ? 81   PHE B N   1 
ATOM 1479 C CA  . PHE B 2 84  ? -1.771  17.836  12.144  1.00 84.96  ? 81   PHE B CA  1 
ATOM 1480 C C   . PHE B 2 84  ? -1.158  17.323  13.455  1.00 84.45  ? 81   PHE B C   1 
ATOM 1481 O O   . PHE B 2 84  ? 0.048   17.127  13.562  1.00 82.97  ? 81   PHE B O   1 
ATOM 1482 C CB  . PHE B 2 84  ? -2.217  16.692  11.206  1.00 82.80  ? 81   PHE B CB  1 
ATOM 1483 C CG  . PHE B 2 84  ? -1.096  15.822  10.696  1.00 79.58  ? 81   PHE B CG  1 
ATOM 1484 C CD1 . PHE B 2 84  ? -0.142  16.322  9.812   1.00 79.50  ? 81   PHE B CD1 1 
ATOM 1485 C CD2 . PHE B 2 84  ? -1.018  14.490  11.072  1.00 77.50  ? 81   PHE B CD2 1 
ATOM 1486 C CE1 . PHE B 2 84  ? 0.891   15.515  9.337   1.00 77.42  ? 81   PHE B CE1 1 
ATOM 1487 C CE2 . PHE B 2 84  ? 0.004   13.678  10.605  1.00 75.65  ? 81   PHE B CE2 1 
ATOM 1488 C CZ  . PHE B 2 84  ? 0.963   14.189  9.736   1.00 75.39  ? 81   PHE B CZ  1 
ATOM 1489 N N   . SER B 2 85  ? -2.011  17.154  14.453  1.00 86.13  ? 82   SER B N   1 
ATOM 1490 C CA  . SER B 2 85  ? -1.616  16.700  15.762  1.00 86.53  ? 82   SER B CA  1 
ATOM 1491 C C   . SER B 2 85  ? -1.771  15.185  15.843  1.00 84.24  ? 82   SER B C   1 
ATOM 1492 O O   . SER B 2 85  ? -2.645  14.610  15.193  1.00 83.53  ? 82   SER B O   1 
ATOM 1493 C CB  . SER B 2 85  ? -2.491  17.404  16.806  1.00 90.74  ? 82   SER B CB  1 
ATOM 1494 O OG  . SER B 2 85  ? -2.812  16.567  17.909  1.00 92.36  ? 82   SER B OG  1 
ATOM 1495 N N   . VAL B 2 86  ? -0.902  14.553  16.627  1.00 83.56  ? 83   VAL B N   1 
ATOM 1496 C CA  . VAL B 2 86  ? -1.013  13.131  16.967  1.00 82.61  ? 83   VAL B CA  1 
ATOM 1497 C C   . VAL B 2 86  ? -0.843  12.953  18.470  1.00 85.15  ? 83   VAL B C   1 
ATOM 1498 O O   . VAL B 2 86  ? 0.040   13.561  19.078  1.00 86.65  ? 83   VAL B O   1 
ATOM 1499 C CB  . VAL B 2 86  ? 0.075   12.267  16.293  1.00 79.43  ? 83   VAL B CB  1 
ATOM 1500 C CG1 . VAL B 2 86  ? -0.018  12.324  14.781  1.00 77.80  ? 83   VAL B CG1 1 
ATOM 1501 C CG2 . VAL B 2 86  ? 1.455   12.700  16.746  1.00 79.72  ? 83   VAL B CG2 1 
ATOM 1502 N N   . ARG B 2 87  ? -1.679  12.115  19.070  1.00 86.38  ? 84   ARG B N   1 
ATOM 1503 C CA  . ARG B 2 87  ? -1.532  11.768  20.481  1.00 88.69  ? 84   ARG B CA  1 
ATOM 1504 C C   . ARG B 2 87  ? -1.267  10.269  20.579  1.00 87.19  ? 84   ARG B C   1 
ATOM 1505 O O   . ARG B 2 87  ? -1.259  9.573   19.569  1.00 84.40  ? 84   ARG B O   1 
ATOM 1506 C CB  . ARG B 2 87  ? -2.790  12.146  21.261  1.00 92.26  ? 84   ARG B CB  1 
ATOM 1507 C CG  . ARG B 2 87  ? -3.265  13.567  21.035  1.00 94.94  ? 84   ARG B CG  1 
ATOM 1508 C CD  . ARG B 2 87  ? -4.561  13.849  21.794  1.00 100.98 ? 84   ARG B CD  1 
ATOM 1509 N NE  . ARG B 2 87  ? -4.356  14.606  23.036  1.00 106.19 ? 84   ARG B NE  1 
ATOM 1510 C CZ  . ARG B 2 87  ? -4.071  14.077  24.231  1.00 108.76 ? 84   ARG B CZ  1 
ATOM 1511 N NH1 . ARG B 2 87  ? -3.925  12.764  24.393  1.00 107.64 ? 84   ARG B NH1 1 
ATOM 1512 N NH2 . ARG B 2 87  ? -3.922  14.871  25.280  1.00 112.94 ? 84   ARG B NH2 1 
ATOM 1513 N N   . GLY B 2 88  ? -1.034  9.771   21.786  1.00 89.59  ? 85   GLY B N   1 
ATOM 1514 C CA  . GLY B 2 88  ? -0.865  8.338   21.978  1.00 89.33  ? 85   GLY B CA  1 
ATOM 1515 C C   . GLY B 2 88  ? 0.500   7.776   21.614  1.00 87.34  ? 85   GLY B C   1 
ATOM 1516 O O   . GLY B 2 88  ? 0.705   6.568   21.725  1.00 87.20  ? 85   GLY B O   1 
ATOM 1517 N N   . LEU B 2 89  ? 1.425   8.635   21.169  1.00 86.34  ? 86   LEU B N   1 
ATOM 1518 C CA  . LEU B 2 89  ? 2.845   8.271   21.001  1.00 84.93  ? 86   LEU B CA  1 
ATOM 1519 C C   . LEU B 2 89  ? 3.306   7.713   22.315  1.00 87.79  ? 86   LEU B C   1 
ATOM 1520 O O   . LEU B 2 89  ? 4.279   6.970   22.393  1.00 87.36  ? 86   LEU B O   1 
ATOM 1521 C CB  . LEU B 2 89  ? 3.697   9.494   20.685  1.00 84.50  ? 86   LEU B CB  1 
ATOM 1522 C CG  . LEU B 2 89  ? 3.253   10.362  19.513  1.00 82.99  ? 86   LEU B CG  1 
ATOM 1523 C CD1 . LEU B 2 89  ? 4.044   11.667  19.454  1.00 83.54  ? 86   LEU B CD1 1 
ATOM 1524 C CD2 . LEU B 2 89  ? 3.375   9.583   18.217  1.00 80.35  ? 86   LEU B CD2 1 
ATOM 1525 N N   . GLU B 2 90  ? 2.586   8.129   23.349  1.00 91.38  ? 87   GLU B N   1 
ATOM 1526 C CA  . GLU B 2 90  ? 2.626   7.554   24.677  1.00 95.26  ? 87   GLU B CA  1 
ATOM 1527 C C   . GLU B 2 90  ? 2.947   6.027   24.618  1.00 94.31  ? 87   GLU B C   1 
ATOM 1528 O O   . GLU B 2 90  ? 3.705   5.523   25.448  1.00 96.36  ? 87   GLU B O   1 
ATOM 1529 C CB  . GLU B 2 90  ? 1.265   7.845   25.385  1.00 98.49  ? 87   GLU B CB  1 
ATOM 1530 C CG  . GLU B 2 90  ? 0.507   9.165   24.905  1.00 99.27  ? 87   GLU B CG  1 
ATOM 1531 C CD  . GLU B 2 90  ? -0.975  9.362   25.407  1.00 103.16 ? 87   GLU B CD  1 
ATOM 1532 O OE1 . GLU B 2 90  ? -1.431  8.690   26.367  1.00 106.25 ? 87   GLU B OE1 1 
ATOM 1533 O OE2 . GLU B 2 90  ? -1.683  10.229  24.834  1.00 101.71 ? 87   GLU B OE2 1 
ATOM 1534 N N   . ARG B 2 91  ? 2.414   5.329   23.605  1.00 91.30  ? 88   ARG B N   1 
ATOM 1535 C CA  . ARG B 2 91  ? 2.360   3.860   23.577  1.00 91.20  ? 88   ARG B CA  1 
ATOM 1536 C C   . ARG B 2 91  ? 2.859   3.226   22.270  1.00 87.57  ? 88   ARG B C   1 
ATOM 1537 O O   . ARG B 2 91  ? 2.537   2.083   21.966  1.00 87.44  ? 88   ARG B O   1 
ATOM 1538 C CB  . ARG B 2 91  ? 0.919   3.365   23.826  1.00 92.93  ? 88   ARG B CB  1 
ATOM 1539 C CG  . ARG B 2 91  ? -0.105  4.448   24.143  1.00 96.26  ? 88   ARG B CG  1 
ATOM 1540 C CD  . ARG B 2 91  ? -1.531  4.061   23.764  1.00 100.09 ? 88   ARG B CD  1 
ATOM 1541 N NE  . ARG B 2 91  ? -2.377  3.810   24.942  1.00 108.31 ? 88   ARG B NE  1 
ATOM 1542 C CZ  . ARG B 2 91  ? -3.086  4.734   25.612  1.00 112.54 ? 88   ARG B CZ  1 
ATOM 1543 N NH1 . ARG B 2 91  ? -3.819  4.372   26.669  1.00 116.55 ? 88   ARG B NH1 1 
ATOM 1544 N NH2 . ARG B 2 91  ? -3.072  6.017   25.243  1.00 112.02 ? 88   ARG B NH2 1 
ATOM 1545 N N   . VAL B 2 92  ? 3.627   3.945   21.473  1.00 85.28  ? 89   VAL B N   1 
ATOM 1546 C CA  . VAL B 2 92  ? 4.136   3.335   20.250  1.00 82.65  ? 89   VAL B CA  1 
ATOM 1547 C C   . VAL B 2 92  ? 5.605   2.969   20.416  1.00 83.38  ? 89   VAL B C   1 
ATOM 1548 O O   . VAL B 2 92  ? 6.278   3.499   21.304  1.00 85.20  ? 89   VAL B O   1 
ATOM 1549 C CB  . VAL B 2 92  ? 3.930   4.224   19.004  1.00 79.91  ? 89   VAL B CB  1 
ATOM 1550 C CG1 . VAL B 2 92  ? 2.454   4.478   18.767  1.00 79.70  ? 89   VAL B CG1 1 
ATOM 1551 C CG2 . VAL B 2 92  ? 4.709   5.526   19.126  1.00 79.90  ? 89   VAL B CG2 1 
ATOM 1552 N N   . PRO B 2 93  ? 6.111   2.054   19.573  1.00 82.54  ? 90   PRO B N   1 
ATOM 1553 C CA  . PRO B 2 93  ? 7.513   1.701   19.723  1.00 83.78  ? 90   PRO B CA  1 
ATOM 1554 C C   . PRO B 2 93  ? 8.401   2.834   19.218  1.00 83.22  ? 90   PRO B C   1 
ATOM 1555 O O   . PRO B 2 93  ? 7.966   3.619   18.371  1.00 81.64  ? 90   PRO B O   1 
ATOM 1556 C CB  . PRO B 2 93  ? 7.651   0.464   18.828  1.00 83.02  ? 90   PRO B CB  1 
ATOM 1557 C CG  . PRO B 2 93  ? 6.245   0.049   18.458  1.00 81.79  ? 90   PRO B CG  1 
ATOM 1558 C CD  . PRO B 2 93  ? 5.477   1.305   18.474  1.00 80.92  ? 90   PRO B CD  1 
ATOM 1559 N N   . ARG B 2 94  ? 9.626   2.930   19.730  1.00 85.28  ? 91   ARG B N   1 
ATOM 1560 C CA  . ARG B 2 94  ? 10.564  3.944   19.229  1.00 85.09  ? 91   ARG B CA  1 
ATOM 1561 C C   . ARG B 2 94  ? 12.003  3.430   18.989  1.00 85.85  ? 91   ARG B C   1 
ATOM 1562 O O   . ARG B 2 94  ? 12.565  2.736   19.821  1.00 88.05  ? 91   ARG B O   1 
ATOM 1563 C CB  . ARG B 2 94  ? 10.524  5.214   20.101  1.00 86.79  ? 91   ARG B CB  1 
ATOM 1564 C CG  . ARG B 2 94  ? 10.463  4.991   21.624  1.00 92.09  ? 91   ARG B CG  1 
ATOM 1565 C CD  . ARG B 2 94  ? 11.760  4.372   22.225  1.00 97.23  ? 91   ARG B CD  1 
ATOM 1566 N NE  . ARG B 2 94  ? 11.858  4.526   23.687  1.00 102.74 ? 91   ARG B NE  1 
ATOM 1567 C CZ  . ARG B 2 94  ? 12.844  4.044   24.450  1.00 106.36 ? 91   ARG B CZ  1 
ATOM 1568 N NH1 . ARG B 2 94  ? 13.847  3.353   23.913  1.00 106.12 ? 91   ARG B NH1 1 
ATOM 1569 N NH2 . ARG B 2 94  ? 12.827  4.253   25.764  1.00 110.02 ? 91   ARG B NH2 1 
ATOM 1570 N N   . GLY B 2 95  ? 12.573  3.772   17.836  1.00 84.52  ? 92   GLY B N   1 
ATOM 1571 C CA  . GLY B 2 95  ? 13.962  3.449   17.519  1.00 86.37  ? 92   GLY B CA  1 
ATOM 1572 C C   . GLY B 2 95  ? 14.959  4.300   18.295  1.00 89.67  ? 92   GLY B C   1 
ATOM 1573 O O   . GLY B 2 95  ? 15.864  3.770   18.944  1.00 92.53  ? 92   GLY B O   1 
ATOM 1574 N N   . ARG B 2 96  ? 14.808  5.622   18.206  1.00 89.79  ? 93   ARG B N   1 
ATOM 1575 C CA  . ARG B 2 96  ? 15.516  6.568   19.088  1.00 93.18  ? 93   ARG B CA  1 
ATOM 1576 C C   . ARG B 2 96  ? 14.573  6.976   20.213  1.00 93.78  ? 93   ARG B C   1 
ATOM 1577 O O   . ARG B 2 96  ? 13.388  7.231   19.966  1.00 91.63  ? 93   ARG B O   1 
ATOM 1578 C CB  . ARG B 2 96  ? 15.941  7.844   18.337  1.00 93.35  ? 93   ARG B CB  1 
ATOM 1579 C CG  . ARG B 2 96  ? 16.538  7.644   16.946  1.00 93.97  ? 93   ARG B CG  1 
ATOM 1580 C CD  . ARG B 2 96  ? 17.925  7.039   17.026  1.00 100.73 ? 93   ARG B CD  1 
ATOM 1581 N NE  . ARG B 2 96  ? 18.338  6.525   15.726  1.00 102.78 ? 93   ARG B NE  1 
ATOM 1582 C CZ  . ARG B 2 96  ? 19.356  5.687   15.527  1.00 106.40 ? 93   ARG B CZ  1 
ATOM 1583 N NH1 . ARG B 2 96  ? 20.091  5.245   16.548  1.00 109.67 ? 93   ARG B NH1 1 
ATOM 1584 N NH2 . ARG B 2 96  ? 19.633  5.283   14.292  1.00 106.51 ? 93   ARG B NH2 1 
ATOM 1585 N N   . PRO B 2 97  ? 15.093  7.082   21.444  1.00 97.15  ? 94   PRO B N   1 
ATOM 1586 C CA  . PRO B 2 97  ? 14.252  7.482   22.573  1.00 98.79  ? 94   PRO B CA  1 
ATOM 1587 C C   . PRO B 2 97  ? 13.641  8.889   22.462  1.00 98.22  ? 94   PRO B C   1 
ATOM 1588 O O   . PRO B 2 97  ? 12.707  9.196   23.199  1.00 99.29  ? 94   PRO B O   1 
ATOM 1589 C CB  . PRO B 2 97  ? 15.213  7.420   23.762  1.00 103.58 ? 94   PRO B CB  1 
ATOM 1590 C CG  . PRO B 2 97  ? 16.570  7.562   23.165  1.00 104.38 ? 94   PRO B CG  1 
ATOM 1591 C CD  . PRO B 2 97  ? 16.493  6.870   21.846  1.00 100.45 ? 94   PRO B CD  1 
ATOM 1592 N N   . CYS B 2 98  ? 14.137  9.718   21.541  1.00 96.78  ? 95   CYS B N   1 
ATOM 1593 C CA  . CYS B 2 98  ? 13.763  11.139  21.504  1.00 97.15  ? 95   CYS B CA  1 
ATOM 1594 C C   . CYS B 2 98  ? 13.138  11.711  20.220  1.00 93.77  ? 95   CYS B C   1 
ATOM 1595 O O   . CYS B 2 98  ? 13.818  11.891  19.214  1.00 92.58  ? 95   CYS B O   1 
ATOM 1596 C CB  . CYS B 2 98  ? 14.963  11.986  21.901  1.00 100.67 ? 95   CYS B CB  1 
ATOM 1597 S SG  . CYS B 2 98  ? 14.936  12.383  23.622  1.00 105.45 ? 95   CYS B SG  1 
ATOM 1598 N N   . LEU B 2 99  ? 11.849  12.036  20.274  1.00 92.94  ? 96   LEU B N   1 
ATOM 1599 C CA  . LEU B 2 99  ? 11.193  12.732  19.159  1.00 90.60  ? 96   LEU B CA  1 
ATOM 1600 C C   . LEU B 2 99  ? 11.389  14.251  19.197  1.00 93.03  ? 96   LEU B C   1 
ATOM 1601 O O   . LEU B 2 99  ? 10.785  14.981  20.006  1.00 95.66  ? 96   LEU B O   1 
ATOM 1602 C CB  . LEU B 2 99  ? 9.709   12.376  19.054  1.00 88.88  ? 96   LEU B CB  1 
ATOM 1603 C CG  . LEU B 2 99  ? 8.973   12.956  17.840  1.00 86.76  ? 96   LEU B CG  1 
ATOM 1604 C CD1 . LEU B 2 99  ? 9.809   12.841  16.561  1.00 85.20  ? 96   LEU B CD1 1 
ATOM 1605 C CD2 . LEU B 2 99  ? 7.617   12.281  17.666  1.00 84.81  ? 96   LEU B CD2 1 
ATOM 1606 N N   . VAL B 2 100 ? 12.227  14.699  18.271  1.00 92.35  ? 97   VAL B N   1 
ATOM 1607 C CA  . VAL B 2 100 ? 12.727  16.063  18.201  1.00 94.47  ? 97   VAL B CA  1 
ATOM 1608 C C   . VAL B 2 100 ? 12.088  16.803  17.011  1.00 92.32  ? 97   VAL B C   1 
ATOM 1609 O O   . VAL B 2 100 ? 11.736  16.176  16.008  1.00 89.03  ? 97   VAL B O   1 
ATOM 1610 C CB  . VAL B 2 100 ? 14.285  16.003  18.126  1.00 96.08  ? 97   VAL B CB  1 
ATOM 1611 C CG1 . VAL B 2 100 ? 14.898  17.126  17.280  1.00 97.23  ? 97   VAL B CG1 1 
ATOM 1612 C CG2 . VAL B 2 100 ? 14.867  15.957  19.539  1.00 100.02 ? 97   VAL B CG2 1 
ATOM 1613 N N   . PRO B 2 101 ? 11.895  18.130  17.130  1.00 94.60  ? 98   PRO B N   1 
ATOM 1614 C CA  . PRO B 2 101 ? 11.496  18.943  15.975  1.00 93.47  ? 98   PRO B CA  1 
ATOM 1615 C C   . PRO B 2 101 ? 12.552  18.946  14.862  1.00 92.22  ? 98   PRO B C   1 
ATOM 1616 O O   . PRO B 2 101 ? 13.755  19.006  15.150  1.00 94.20  ? 98   PRO B O   1 
ATOM 1617 C CB  . PRO B 2 101 ? 11.358  20.348  16.571  1.00 97.65  ? 98   PRO B CB  1 
ATOM 1618 C CG  . PRO B 2 101 ? 12.152  20.301  17.842  1.00 101.09 ? 98   PRO B CG  1 
ATOM 1619 C CD  . PRO B 2 101 ? 11.919  18.930  18.363  1.00 98.93  ? 98   PRO B CD  1 
ATOM 1620 N N   . GLY B 2 102 ? 12.103  18.881  13.610  1.00 89.23  ? 99   GLY B N   1 
ATOM 1621 C CA  . GLY B 2 102 ? 13.016  18.824  12.467  1.00 88.36  ? 99   GLY B CA  1 
ATOM 1622 C C   . GLY B 2 102 ? 13.192  17.428  11.888  1.00 85.07  ? 99   GLY B C   1 
ATOM 1623 O O   . GLY B 2 102 ? 13.702  17.257  10.780  1.00 84.27  ? 99   GLY B O   1 
ATOM 1624 N N   . LYS B 2 103 ? 12.776  16.425  12.650  1.00 83.50  ? 100  LYS B N   1 
ATOM 1625 C CA  . LYS B 2 103 ? 12.674  15.077  12.147  1.00 80.60  ? 100  LYS B CA  1 
ATOM 1626 C C   . LYS B 2 103 ? 11.520  15.004  11.159  1.00 78.43  ? 100  LYS B C   1 
ATOM 1627 O O   . LYS B 2 103 ? 10.664  15.880  11.137  1.00 79.16  ? 100  LYS B O   1 
ATOM 1628 C CB  . LYS B 2 103 ? 12.416  14.121  13.304  1.00 80.50  ? 100  LYS B CB  1 
ATOM 1629 C CG  . LYS B 2 103 ? 13.471  14.157  14.390  1.00 83.98  ? 100  LYS B CG  1 
ATOM 1630 C CD  . LYS B 2 103 ? 14.828  13.739  13.864  1.00 85.65  ? 100  LYS B CD  1 
ATOM 1631 C CE  . LYS B 2 103 ? 15.864  13.756  14.966  1.00 89.63  ? 100  LYS B CE  1 
ATOM 1632 N NZ  . LYS B 2 103 ? 17.182  13.368  14.392  1.00 91.50  ? 100  LYS B NZ  1 
ATOM 1633 N N   . TYR B 2 104 ? 11.510  13.960  10.337  1.00 76.48  ? 101  TYR B N   1 
ATOM 1634 C CA  . TYR B 2 104 ? 10.441  13.702  9.381   1.00 74.74  ? 101  TYR B CA  1 
ATOM 1635 C C   . TYR B 2 104 ? 9.978   12.302  9.673   1.00 72.86  ? 101  TYR B C   1 
ATOM 1636 O O   . TYR B 2 104 ? 10.805  11.411  9.775   1.00 72.85  ? 101  TYR B O   1 
ATOM 1637 C CB  . TYR B 2 104 ? 10.986  13.779  7.957   1.00 74.79  ? 101  TYR B CB  1 
ATOM 1638 C CG  . TYR B 2 104 ? 9.919   13.692  6.893   1.00 75.32  ? 101  TYR B CG  1 
ATOM 1639 C CD1 . TYR B 2 104 ? 9.243   14.830  6.466   1.00 77.30  ? 101  TYR B CD1 1 
ATOM 1640 C CD2 . TYR B 2 104 ? 9.586   12.473  6.306   1.00 74.96  ? 101  TYR B CD2 1 
ATOM 1641 C CE1 . TYR B 2 104 ? 8.266   14.754  5.493   1.00 77.68  ? 101  TYR B CE1 1 
ATOM 1642 C CE2 . TYR B 2 104 ? 8.605   12.389  5.328   1.00 74.70  ? 101  TYR B CE2 1 
ATOM 1643 C CZ  . TYR B 2 104 ? 7.955   13.531  4.932   1.00 76.58  ? 101  TYR B CZ  1 
ATOM 1644 O OH  . TYR B 2 104 ? 6.987   13.468  3.967   1.00 79.01  ? 101  TYR B OH  1 
ATOM 1645 N N   . VAL B 2 105 ? 8.679   12.090  9.840   1.00 72.04  ? 102  VAL B N   1 
ATOM 1646 C CA  . VAL B 2 105 ? 8.204   10.762  10.243  1.00 71.37  ? 102  VAL B CA  1 
ATOM 1647 C C   . VAL B 2 105 ? 6.903   10.379  9.583   1.00 70.71  ? 102  VAL B C   1 
ATOM 1648 O O   . VAL B 2 105 ? 6.129   11.254  9.202   1.00 71.21  ? 102  VAL B O   1 
ATOM 1649 C CB  . VAL B 2 105 ? 8.013   10.610  11.801  1.00 72.39  ? 102  VAL B CB  1 
ATOM 1650 C CG1 . VAL B 2 105 ? 9.318   10.786  12.555  1.00 73.89  ? 102  VAL B CG1 1 
ATOM 1651 C CG2 . VAL B 2 105 ? 6.942   11.555  12.347  1.00 73.48  ? 102  VAL B CG2 1 
ATOM 1652 N N   . MET B 2 106 ? 6.662   9.071   9.464   1.00 70.39  ? 103  MET B N   1 
ATOM 1653 C CA  . MET B 2 106 ? 5.346   8.561   9.045   1.00 70.63  ? 103  MET B CA  1 
ATOM 1654 C C   . MET B 2 106 ? 4.567   8.032   10.232  1.00 71.44  ? 103  MET B C   1 
ATOM 1655 O O   . MET B 2 106 ? 5.120   7.383   11.113  1.00 71.65  ? 103  MET B O   1 
ATOM 1656 C CB  . MET B 2 106 ? 5.428   7.508   7.915   1.00 70.26  ? 103  MET B CB  1 
ATOM 1657 C CG  . MET B 2 106 ? 5.615   6.035   8.327   1.00 69.22  ? 103  MET B CG  1 
ATOM 1658 S SD  . MET B 2 106 ? 4.185   5.249   9.101   1.00 67.12  ? 103  MET B SD  1 
ATOM 1659 C CE  . MET B 2 106 ? 3.130   4.834   7.723   1.00 66.61  ? 103  MET B CE  1 
ATOM 1660 N N   . VAL B 2 107 ? 3.274   8.316   10.241  1.00 72.59  ? 104  VAL B N   1 
ATOM 1661 C CA  . VAL B 2 107 ? 2.405   7.858   11.301  1.00 73.97  ? 104  VAL B CA  1 
ATOM 1662 C C   . VAL B 2 107 ? 1.277   7.023   10.729  1.00 75.07  ? 104  VAL B C   1 
ATOM 1663 O O   . VAL B 2 107 ? 0.589   7.426   9.787   1.00 75.57  ? 104  VAL B O   1 
ATOM 1664 C CB  . VAL B 2 107 ? 1.839   9.040   12.089  1.00 74.98  ? 104  VAL B CB  1 
ATOM 1665 C CG1 . VAL B 2 107 ? 0.621   8.631   12.922  1.00 76.39  ? 104  VAL B CG1 1 
ATOM 1666 C CG2 . VAL B 2 107 ? 2.922   9.629   12.968  1.00 75.71  ? 104  VAL B CG2 1 
ATOM 1667 N N   . MET B 2 108 ? 1.119   5.834   11.288  1.00 76.18  ? 105  MET B N   1 
ATOM 1668 C CA  . MET B 2 108 ? -0.100  5.090   11.108  1.00 78.08  ? 105  MET B CA  1 
ATOM 1669 C C   . MET B 2 108 ? -0.949  5.398   12.331  1.00 80.18  ? 105  MET B C   1 
ATOM 1670 O O   . MET B 2 108 ? -0.547  5.104   13.464  1.00 80.74  ? 105  MET B O   1 
ATOM 1671 C CB  . MET B 2 108 ? 0.176   3.595   10.996  1.00 78.20  ? 105  MET B CB  1 
ATOM 1672 C CG  . MET B 2 108 ? -1.027  2.839   10.505  1.00 79.50  ? 105  MET B CG  1 
ATOM 1673 S SD  . MET B 2 108 ? -1.056  1.144   11.067  1.00 80.47  ? 105  MET B SD  1 
ATOM 1674 C CE  . MET B 2 108 ? -2.814  0.802   10.977  1.00 82.56  ? 105  MET B CE  1 
ATOM 1675 N N   . GLY B 2 109 ? -2.105  6.014   12.103  1.00 82.08  ? 106  GLY B N   1 
ATOM 1676 C CA  . GLY B 2 109 ? -2.957  6.465   13.193  1.00 84.81  ? 106  GLY B CA  1 
ATOM 1677 C C   . GLY B 2 109 ? -4.426  6.268   12.919  1.00 87.76  ? 106  GLY B C   1 
ATOM 1678 O O   . GLY B 2 109 ? -4.834  6.042   11.780  1.00 87.83  ? 106  GLY B O   1 
ATOM 1679 N N   . VAL B 2 110 ? -5.220  6.333   13.980  1.00 90.92  ? 107  VAL B N   1 
ATOM 1680 C CA  . VAL B 2 110 ? -6.666  6.359   13.845  1.00 94.78  ? 107  VAL B CA  1 
ATOM 1681 C C   . VAL B 2 110 ? -7.088  7.817   13.962  1.00 96.80  ? 107  VAL B C   1 
ATOM 1682 O O   . VAL B 2 110 ? -6.636  8.523   14.872  1.00 96.94  ? 107  VAL B O   1 
ATOM 1683 C CB  . VAL B 2 110 ? -7.362  5.514   14.930  1.00 97.03  ? 107  VAL B CB  1 
ATOM 1684 C CG1 . VAL B 2 110 ? -8.864  5.455   14.681  1.00 100.64 ? 107  VAL B CG1 1 
ATOM 1685 C CG2 . VAL B 2 110 ? -6.792  4.115   14.965  1.00 96.02  ? 107  VAL B CG2 1 
ATOM 1686 N N   . VAL B 2 111 ? -7.932  8.268   13.033  1.00 99.24  ? 108  VAL B N   1 
ATOM 1687 C CA  . VAL B 2 111 ? -8.386  9.663   13.012  1.00 102.11 ? 108  VAL B CA  1 
ATOM 1688 C C   . VAL B 2 111 ? -9.182  10.005  14.274  1.00 106.24 ? 108  VAL B C   1 
ATOM 1689 O O   . VAL B 2 111 ? -9.926  9.168   14.793  1.00 108.45 ? 108  VAL B O   1 
ATOM 1690 C CB  . VAL B 2 111 ? -9.232  9.961   11.767  1.00 103.42 ? 108  VAL B CB  1 
ATOM 1691 C CG1 . VAL B 2 111 ? -9.660  11.416  11.746  1.00 105.50 ? 108  VAL B CG1 1 
ATOM 1692 C CG2 . VAL B 2 111 ? -8.448  9.644   10.526  1.00 101.17 ? 108  VAL B CG2 1 
ATOM 1693 N N   . GLN B 2 112 ? -9.022  11.230  14.767  1.00 108.36 ? 109  GLN B N   1 
ATOM 1694 C CA  . GLN B 2 112 ? -9.668  11.616  16.014  1.00 112.88 ? 109  GLN B CA  1 
ATOM 1695 C C   . GLN B 2 112 ? -10.792 12.630  15.831  1.00 117.40 ? 109  GLN B C   1 
ATOM 1696 O O   . GLN B 2 112 ? -11.957 12.304  16.077  1.00 120.82 ? 109  GLN B O   1 
ATOM 1697 C CB  . GLN B 2 112 ? -8.637  12.104  17.037  1.00 112.34 ? 109  GLN B CB  1 
ATOM 1698 C CG  . GLN B 2 112 ? -7.875  10.982  17.742  1.00 110.88 ? 109  GLN B CG  1 
ATOM 1699 C CD  . GLN B 2 112 ? -8.784  10.081  18.558  1.00 113.65 ? 109  GLN B CD  1 
ATOM 1700 O OE1 . GLN B 2 112 ? -8.896  8.889   18.284  1.00 113.02 ? 109  GLN B OE1 1 
ATOM 1701 N NE2 . GLN B 2 112 ? -9.447  10.651  19.561  1.00 117.08 ? 109  GLN B NE2 1 
ATOM 1702 N N   . ALA B 2 113 ? -10.447 13.848  15.404  1.00 118.40 ? 110  ALA B N   1 
ATOM 1703 C CA  . ALA B 2 113 ? -11.427 14.947  15.268  1.00 123.13 ? 110  ALA B CA  1 
ATOM 1704 C C   . ALA B 2 113 ? -11.020 15.996  14.217  1.00 122.88 ? 110  ALA B C   1 
ATOM 1705 O O   . ALA B 2 113 ? -10.585 17.105  14.569  1.00 124.10 ? 110  ALA B O   1 
ATOM 1706 C CB  . ALA B 2 113 ? -11.712 15.615  16.647  1.00 126.54 ? 110  ALA B CB  1 
ATOM 1707 N N   . CYS B 2 114 ? -11.181 15.628  12.938  1.00 121.92 ? 111  CYS B N   1 
ATOM 1708 C CA  . CYS B 2 114 ? -10.863 16.467  11.754  1.00 121.69 ? 111  CYS B CA  1 
ATOM 1709 C C   . CYS B 2 114 ? -10.967 17.984  11.961  1.00 124.34 ? 111  CYS B C   1 
ATOM 1710 O O   . CYS B 2 114 ? -10.134 18.740  11.446  1.00 123.19 ? 111  CYS B O   1 
ATOM 1711 C CB  . CYS B 2 114 ? -11.752 16.079  10.561  1.00 123.23 ? 111  CYS B CB  1 
ATOM 1712 S SG  . CYS B 2 114 ? -12.008 14.297  10.303  1.00 123.01 ? 111  CYS B SG  1 
ATOM 1713 N N   . SER B 2 115 ? -11.999 18.412  12.692  1.00 128.05 ? 112  SER B N   1 
ATOM 1714 C CA  . SER B 2 115 ? -12.213 19.817  13.030  1.00 131.29 ? 112  SER B CA  1 
ATOM 1715 C C   . SER B 2 115 ? -11.421 20.220  14.289  1.00 130.87 ? 112  SER B C   1 
ATOM 1716 O O   . SER B 2 115 ? -11.324 19.424  15.235  1.00 129.99 ? 112  SER B O   1 
ATOM 1717 C CB  . SER B 2 115 ? -13.712 20.072  13.231  1.00 136.56 ? 112  SER B CB  1 
ATOM 1718 O OG  . SER B 2 115 ? -13.976 21.390  13.687  1.00 140.75 ? 112  SER B OG  1 
ATOM 1719 N N   . PRO B 2 116 ? -10.819 21.439  14.295  1.00 131.60 ? 113  PRO B N   1 
ATOM 1720 C CA  . PRO B 2 116 ? -10.610 22.353  13.158  1.00 131.51 ? 113  PRO B CA  1 
ATOM 1721 C C   . PRO B 2 116 ? -9.255  22.098  12.485  1.00 126.11 ? 113  PRO B C   1 
ATOM 1722 O O   . PRO B 2 116 ? -8.934  22.693  11.454  1.00 125.93 ? 113  PRO B O   1 
ATOM 1723 C CB  . PRO B 2 116 ? -10.638 23.751  13.808  1.00 136.05 ? 113  PRO B CB  1 
ATOM 1724 C CG  . PRO B 2 116 ? -10.824 23.530  15.299  1.00 138.14 ? 113  PRO B CG  1 
ATOM 1725 C CD  . PRO B 2 116 ? -10.471 22.099  15.566  1.00 134.06 ? 113  PRO B CD  1 
ATOM 1726 N N   . GLU B 2 117 ? -8.476  21.212  13.089  1.00 121.86 ? 114  GLU B N   1 
ATOM 1727 C CA  . GLU B 2 117 ? -7.228  20.745  12.538  1.00 116.81 ? 114  GLU B CA  1 
ATOM 1728 C C   . GLU B 2 117 ? -7.134  19.289  12.965  1.00 112.99 ? 114  GLU B C   1 
ATOM 1729 O O   . GLU B 2 117 ? -7.244  18.994  14.156  1.00 114.06 ? 114  GLU B O   1 
ATOM 1730 C CB  . GLU B 2 117 ? -6.077  21.570  13.099  1.00 117.22 ? 114  GLU B CB  1 
ATOM 1731 C CG  . GLU B 2 117 ? -4.692  21.127  12.669  1.00 114.68 ? 114  GLU B CG  1 
ATOM 1732 C CD  . GLU B 2 117 ? -3.672  22.259  12.725  1.00 117.85 ? 114  GLU B CD  1 
ATOM 1733 O OE1 . GLU B 2 117 ? -3.886  23.292  12.041  1.00 120.41 ? 114  GLU B OE1 1 
ATOM 1734 O OE2 . GLU B 2 117 ? -2.654  22.107  13.444  1.00 117.50 ? 114  GLU B OE2 1 
ATOM 1735 N N   . PRO B 2 118 ? -6.950  18.373  11.996  1.00 109.08 ? 115  PRO B N   1 
ATOM 1736 C CA  . PRO B 2 118 ? -7.065  16.921  12.180  1.00 106.15 ? 115  PRO B CA  1 
ATOM 1737 C C   . PRO B 2 118 ? -6.160  16.352  13.263  1.00 103.46 ? 115  PRO B C   1 
ATOM 1738 O O   . PRO B 2 118 ? -4.945  16.559  13.229  1.00 101.53 ? 115  PRO B O   1 
ATOM 1739 C CB  . PRO B 2 118 ? -6.635  16.361  10.818  1.00 103.54 ? 115  PRO B CB  1 
ATOM 1740 C CG  . PRO B 2 118 ? -5.822  17.433  10.208  1.00 103.61 ? 115  PRO B CG  1 
ATOM 1741 C CD  . PRO B 2 118 ? -6.503  18.696  10.633  1.00 107.93 ? 115  PRO B CD  1 
ATOM 1742 N N   . CYS B 2 119 ? -6.755  15.637  14.214  1.00 103.39 ? 116  CYS B N   1 
ATOM 1743 C CA  . CYS B 2 119 ? -5.977  14.954  15.236  1.00 100.86 ? 116  CYS B CA  1 
ATOM 1744 C C   . CYS B 2 119 ? -5.889  13.478  14.900  1.00 97.37  ? 116  CYS B C   1 
ATOM 1745 O O   . CYS B 2 119 ? -6.785  12.921  14.266  1.00 97.86  ? 116  CYS B O   1 
ATOM 1746 C CB  . CYS B 2 119 ? -6.574  15.165  16.633  1.00 104.27 ? 116  CYS B CB  1 
ATOM 1747 S SG  . CYS B 2 119 ? -5.458  14.656  17.969  1.00 103.85 ? 116  CYS B SG  1 
ATOM 1748 N N   . LEU B 2 120 ? -4.801  12.853  15.316  1.00 93.95  ? 117  LEU B N   1 
ATOM 1749 C CA  . LEU B 2 120 ? -4.631  11.432  15.115  1.00 91.08  ? 117  LEU B CA  1 
ATOM 1750 C C   . LEU B 2 120 ? -4.391  10.695  16.414  1.00 91.00  ? 117  LEU B C   1 
ATOM 1751 O O   . LEU B 2 120 ? -3.985  11.288  17.409  1.00 92.40  ? 117  LEU B O   1 
ATOM 1752 C CB  . LEU B 2 120 ? -3.462  11.182  14.187  1.00 88.16  ? 117  LEU B CB  1 
ATOM 1753 C CG  . LEU B 2 120 ? -3.794  11.061  12.715  1.00 87.56  ? 117  LEU B CG  1 
ATOM 1754 C CD1 . LEU B 2 120 ? -2.510  11.024  11.925  1.00 85.40  ? 117  LEU B CD1 1 
ATOM 1755 C CD2 . LEU B 2 120 ? -4.579  9.790   12.506  1.00 88.81  ? 117  LEU B CD2 1 
ATOM 1756 N N   . GLN B 2 121 ? -4.641  9.395   16.391  1.00 89.48  ? 118  GLN B N   1 
ATOM 1757 C CA  . GLN B 2 121 ? -4.374  8.549   17.533  1.00 89.39  ? 118  GLN B CA  1 
ATOM 1758 C C   . GLN B 2 121 ? -3.386  7.497   17.074  1.00 86.28  ? 118  GLN B C   1 
ATOM 1759 O O   . GLN B 2 121 ? -3.761  6.513   16.440  1.00 85.58  ? 118  GLN B O   1 
ATOM 1760 C CB  . GLN B 2 121 ? -5.677  7.927   18.059  1.00 92.30  ? 118  GLN B CB  1 
ATOM 1761 C CG  . GLN B 2 121 ? -5.553  7.126   19.365  1.00 93.60  ? 118  GLN B CG  1 
ATOM 1762 C CD  . GLN B 2 121 ? -5.067  7.959   20.541  1.00 95.29  ? 118  GLN B CD  1 
ATOM 1763 O OE1 . GLN B 2 121 ? -5.388  9.138   20.662  1.00 97.44  ? 118  GLN B OE1 1 
ATOM 1764 N NE2 . GLN B 2 121 ? -4.288  7.344   21.414  1.00 95.68  ? 118  GLN B NE2 1 
ATOM 1765 N N   . ALA B 2 122 ? -2.116  7.732   17.386  1.00 84.70  ? 119  ALA B N   1 
ATOM 1766 C CA  . ALA B 2 122 ? -1.005  6.927   16.870  1.00 82.17  ? 119  ALA B CA  1 
ATOM 1767 C C   . ALA B 2 122 ? -1.148  5.448   17.205  1.00 82.68  ? 119  ALA B C   1 
ATOM 1768 O O   . ALA B 2 122 ? -1.365  5.085   18.367  1.00 84.82  ? 119  ALA B O   1 
ATOM 1769 C CB  . ALA B 2 122 ? 0.337   7.466   17.374  1.00 81.43  ? 119  ALA B CB  1 
ATOM 1770 N N   . VAL B 2 123 ? -1.048  4.611   16.169  1.00 81.18  ? 120  VAL B N   1 
ATOM 1771 C CA  . VAL B 2 123 ? -0.988  3.150   16.305  1.00 81.35  ? 120  VAL B CA  1 
ATOM 1772 C C   . VAL B 2 123 ? 0.468   2.719   16.138  1.00 79.95  ? 120  VAL B C   1 
ATOM 1773 O O   . VAL B 2 123 ? 0.999   1.953   16.944  1.00 80.89  ? 120  VAL B O   1 
ATOM 1774 C CB  . VAL B 2 123 ? -1.897  2.439   15.282  1.00 81.40  ? 120  VAL B CB  1 
ATOM 1775 C CG1 . VAL B 2 123 ? -1.654  0.947   15.284  1.00 81.96  ? 120  VAL B CG1 1 
ATOM 1776 C CG2 . VAL B 2 123 ? -3.345  2.724   15.591  1.00 83.19  ? 120  VAL B CG2 1 
ATOM 1777 N N   . LYS B 2 124 ? 1.106   3.228   15.092  1.00 78.00  ? 121  LYS B N   1 
ATOM 1778 C CA  . LYS B 2 124 ? 2.539   3.070   14.925  1.00 77.25  ? 121  LYS B CA  1 
ATOM 1779 C C   . LYS B 2 124 ? 3.124   4.222   14.146  1.00 76.22  ? 121  LYS B C   1 
ATOM 1780 O O   . LYS B 2 124 ? 2.446   4.870   13.350  1.00 75.82  ? 121  LYS B O   1 
ATOM 1781 C CB  . LYS B 2 124 ? 2.888   1.777   14.207  1.00 77.01  ? 121  LYS B CB  1 
ATOM 1782 C CG  . LYS B 2 124 ? 4.375   1.526   14.141  1.00 75.72  ? 121  LYS B CG  1 
ATOM 1783 C CD  . LYS B 2 124 ? 4.736   0.786   12.893  1.00 74.91  ? 121  LYS B CD  1 
ATOM 1784 C CE  . LYS B 2 124 ? 6.226   0.525   12.835  1.00 75.73  ? 121  LYS B CE  1 
ATOM 1785 N NZ  . LYS B 2 124 ? 7.025   1.660   12.293  1.00 75.46  ? 121  LYS B NZ  1 
ATOM 1786 N N   . MET B 2 125 ? 4.413   4.437   14.361  1.00 76.37  ? 122  MET B N   1 
ATOM 1787 C CA  . MET B 2 125 ? 5.104   5.565   13.796  1.00 75.85  ? 122  MET B CA  1 
ATOM 1788 C C   . MET B 2 125 ? 6.536   5.167   13.410  1.00 75.16  ? 122  MET B C   1 
ATOM 1789 O O   . MET B 2 125 ? 7.177   4.378   14.097  1.00 76.19  ? 122  MET B O   1 
ATOM 1790 C CB  . MET B 2 125 ? 5.060   6.692   14.811  1.00 77.04  ? 122  MET B CB  1 
ATOM 1791 C CG  . MET B 2 125 ? 5.784   7.921   14.419  1.00 78.85  ? 122  MET B CG  1 
ATOM 1792 S SD  . MET B 2 125 ? 6.696   8.429   15.869  1.00 86.13  ? 122  MET B SD  1 
ATOM 1793 C CE  . MET B 2 125 ? 8.034   7.194   15.889  1.00 85.47  ? 122  MET B CE  1 
ATOM 1794 N N   . THR B 2 126 ? 7.014   5.722   12.303  1.00 74.12  ? 123  THR B N   1 
ATOM 1795 C CA  . THR B 2 126 ? 8.242   5.289   11.642  1.00 73.97  ? 123  THR B CA  1 
ATOM 1796 C C   . THR B 2 126 ? 9.100   6.512   11.305  1.00 73.54  ? 123  THR B C   1 
ATOM 1797 O O   . THR B 2 126 ? 8.589   7.507   10.782  1.00 73.25  ? 123  THR B O   1 
ATOM 1798 C CB  . THR B 2 126 ? 7.893   4.574   10.315  1.00 73.74  ? 123  THR B CB  1 
ATOM 1799 O OG1 . THR B 2 126 ? 6.725   3.760   10.486  1.00 74.33  ? 123  THR B OG1 1 
ATOM 1800 C CG2 . THR B 2 126 ? 9.046   3.723   9.815   1.00 74.96  ? 123  THR B CG2 1 
ATOM 1801 N N   . ASP B 2 127 ? 10.397  6.456   11.581  1.00 73.67  ? 124  ASP B N   1 
ATOM 1802 C CA  . ASP B 2 127 ? 11.211  7.632   11.334  1.00 73.89  ? 124  ASP B CA  1 
ATOM 1803 C C   . ASP B 2 127 ? 11.858  7.641   9.957   1.00 73.47  ? 124  ASP B C   1 
ATOM 1804 O O   . ASP B 2 127 ? 12.627  6.742   9.606   1.00 74.60  ? 124  ASP B O   1 
ATOM 1805 C CB  . ASP B 2 127 ? 12.275  7.810   12.402  1.00 75.78  ? 124  ASP B CB  1 
ATOM 1806 C CG  . ASP B 2 127 ? 13.060  9.089   12.211  1.00 77.83  ? 124  ASP B CG  1 
ATOM 1807 O OD1 . ASP B 2 127 ? 12.483  10.065  11.676  1.00 77.28  ? 124  ASP B OD1 1 
ATOM 1808 O OD2 . ASP B 2 127 ? 14.255  9.115   12.582  1.00 81.34  ? 124  ASP B OD2 1 
ATOM 1809 N N   . LEU B 2 128 ? 11.583  8.684   9.188   1.00 72.45  ? 125  LEU B N   1 
ATOM 1810 C CA  . LEU B 2 128 ? 12.070  8.740   7.825   1.00 71.73  ? 125  LEU B CA  1 
ATOM 1811 C C   . LEU B 2 128 ? 13.193  9.748   7.620   1.00 73.26  ? 125  LEU B C   1 
ATOM 1812 O O   . LEU B 2 128 ? 13.659  9.920   6.500   1.00 73.83  ? 125  LEU B O   1 
ATOM 1813 C CB  . LEU B 2 128 ? 10.912  8.982   6.856   1.00 70.42  ? 125  LEU B CB  1 
ATOM 1814 C CG  . LEU B 2 128 ? 9.650   8.144   7.084   1.00 68.48  ? 125  LEU B CG  1 
ATOM 1815 C CD1 . LEU B 2 128 ? 8.514   8.722   6.305   1.00 68.12  ? 125  LEU B CD1 1 
ATOM 1816 C CD2 . LEU B 2 128 ? 9.830   6.703   6.704   1.00 68.18  ? 125  LEU B CD2 1 
ATOM 1817 N N   . SER B 2 129 ? 13.655  10.378  8.700   1.00 74.65  ? 126  SER B N   1 
ATOM 1818 C CA  . SER B 2 129 ? 14.647  11.462  8.621   1.00 77.15  ? 126  SER B CA  1 
ATOM 1819 C C   . SER B 2 129 ? 15.954  11.036  7.960   1.00 79.12  ? 126  SER B C   1 
ATOM 1820 O O   . SER B 2 129 ? 16.742  11.866  7.505   1.00 80.94  ? 126  SER B O   1 
ATOM 1821 C CB  . SER B 2 129 ? 14.942  12.001  10.010  1.00 78.53  ? 126  SER B CB  1 
ATOM 1822 O OG  . SER B 2 129 ? 13.765  12.003  10.786  1.00 77.57  ? 126  SER B OG  1 
ATOM 1823 N N   . ASP B 2 130 ? 16.166  9.727   7.923   1.00 79.60  ? 127  ASP B N   1 
ATOM 1824 C CA  . ASP B 2 130 ? 17.319  9.098   7.294   1.00 81.69  ? 127  ASP B CA  1 
ATOM 1825 C C   . ASP B 2 130 ? 17.443  9.530   5.849   1.00 82.03  ? 127  ASP B C   1 
ATOM 1826 O O   . ASP B 2 130 ? 18.532  9.860   5.392   1.00 83.85  ? 127  ASP B O   1 
ATOM 1827 C CB  . ASP B 2 130 ? 17.142  7.579   7.363   1.00 81.51  ? 127  ASP B CB  1 
ATOM 1828 C CG  . ASP B 2 130 ? 16.780  7.090   8.784   1.00 83.30  ? 127  ASP B CG  1 
ATOM 1829 O OD1 . ASP B 2 130 ? 17.715  7.006   9.628   1.00 87.72  ? 127  ASP B OD1 1 
ATOM 1830 O OD2 . ASP B 2 130 ? 15.576  6.792   9.055   1.00 81.43  ? 127  ASP B OD2 1 
ATOM 1831 N N   . ASN B 2 131 ? 16.301  9.553   5.159   1.00 80.75  ? 128  ASN B N   1 
ATOM 1832 C CA  . ASN B 2 131 ? 16.225  9.773   3.714   1.00 81.65  ? 128  ASN B CA  1 
ATOM 1833 C C   . ASN B 2 131 ? 15.521  11.073  3.317   1.00 81.70  ? 128  ASN B C   1 
ATOM 1834 O O   . ASN B 2 131 ? 14.303  11.206  3.492   1.00 80.59  ? 128  ASN B O   1 
ATOM 1835 C CB  . ASN B 2 131 ? 15.506  8.593   3.062   1.00 80.88  ? 128  ASN B CB  1 
ATOM 1836 C CG  . ASN B 2 131 ? 15.947  8.344   1.627   1.00 83.07  ? 128  ASN B CG  1 
ATOM 1837 O OD1 . ASN B 2 131 ? 16.318  9.271   0.899   1.00 85.08  ? 128  ASN B OD1 1 
ATOM 1838 N ND2 . ASN B 2 131 ? 15.899  7.076   1.210   1.00 83.31  ? 128  ASN B ND2 1 
ATOM 1839 N N   . PRO B 2 132 ? 16.280  12.035  2.759   1.00 83.61  ? 129  PRO B N   1 
ATOM 1840 C CA  . PRO B 2 132 ? 15.705  13.310  2.352   1.00 84.02  ? 129  PRO B CA  1 
ATOM 1841 C C   . PRO B 2 132 ? 14.641  13.171  1.262   1.00 83.60  ? 129  PRO B C   1 
ATOM 1842 O O   . PRO B 2 132 ? 13.866  14.106  1.045   1.00 84.24  ? 129  PRO B O   1 
ATOM 1843 C CB  . PRO B 2 132 ? 16.910  14.084  1.806   1.00 86.69  ? 129  PRO B CB  1 
ATOM 1844 C CG  . PRO B 2 132 ? 18.076  13.449  2.400   1.00 87.74  ? 129  PRO B CG  1 
ATOM 1845 C CD  . PRO B 2 132 ? 17.732  12.001  2.532   1.00 85.92  ? 129  PRO B CD  1 
ATOM 1846 N N   . ILE B 2 133 ? 14.599  12.026  0.586   1.00 83.36  ? 130  ILE B N   1 
ATOM 1847 C CA  . ILE B 2 133 ? 13.655  11.823  -0.521  1.00 83.76  ? 130  ILE B CA  1 
ATOM 1848 C C   . ILE B 2 133 ? 12.207  11.667  -0.036  1.00 82.07  ? 130  ILE B C   1 
ATOM 1849 O O   . ILE B 2 133 ? 11.288  12.236  -0.616  1.00 82.59  ? 130  ILE B O   1 
ATOM 1850 C CB  . ILE B 2 133 ? 14.092  10.651  -1.475  1.00 84.91  ? 130  ILE B CB  1 
ATOM 1851 C CG1 . ILE B 2 133 ? 15.100  11.143  -2.514  1.00 87.35  ? 130  ILE B CG1 1 
ATOM 1852 C CG2 . ILE B 2 133 ? 12.917  10.054  -2.213  1.00 84.71  ? 130  ILE B CG2 1 
ATOM 1853 C CD1 . ILE B 2 133 ? 16.537  10.852  -2.155  1.00 88.34  ? 130  ILE B CD1 1 
ATOM 1854 N N   . HIS B 2 134 ? 12.015  10.919  1.041   1.00 80.60  ? 131  HIS B N   1 
ATOM 1855 C CA  . HIS B 2 134 ? 10.680  10.611  1.511   1.00 79.67  ? 131  HIS B CA  1 
ATOM 1856 C C   . HIS B 2 134 ? 9.804   11.832  1.521   1.00 80.12  ? 131  HIS B C   1 
ATOM 1857 O O   . HIS B 2 134 ? 8.626   11.752  1.187   1.00 80.20  ? 131  HIS B O   1 
ATOM 1858 C CB  . HIS B 2 134 ? 10.731  10.043  2.914   1.00 78.51  ? 131  HIS B CB  1 
ATOM 1859 C CG  . HIS B 2 134 ? 11.155  8.614   2.968   1.00 78.43  ? 131  HIS B CG  1 
ATOM 1860 N ND1 . HIS B 2 134 ? 10.411  7.599   2.410   1.00 79.17  ? 131  HIS B ND1 1 
ATOM 1861 C CD2 . HIS B 2 134 ? 12.235  8.026   3.531   1.00 78.91  ? 131  HIS B CD2 1 
ATOM 1862 C CE1 . HIS B 2 134 ? 11.019  6.445   2.621   1.00 80.11  ? 131  HIS B CE1 1 
ATOM 1863 N NE2 . HIS B 2 134 ? 12.128  6.677   3.299   1.00 80.09  ? 131  HIS B NE2 1 
ATOM 1864 N N   . GLU B 2 135 ? 10.396  12.954  1.917   1.00 81.16  ? 132  GLU B N   1 
ATOM 1865 C CA  . GLU B 2 135 ? 9.704   14.236  1.981   1.00 82.43  ? 132  GLU B CA  1 
ATOM 1866 C C   . GLU B 2 135 ? 9.237   14.668  0.601   1.00 83.92  ? 132  GLU B C   1 
ATOM 1867 O O   . GLU B 2 135 ? 8.053   14.943  0.402   1.00 84.41  ? 132  GLU B O   1 
ATOM 1868 C CB  . GLU B 2 135 ? 10.617  15.298  2.594   1.00 83.69  ? 132  GLU B CB  1 
ATOM 1869 C CG  . GLU B 2 135 ? 9.907   16.581  3.000   1.00 86.26  ? 132  GLU B CG  1 
ATOM 1870 C CD  . GLU B 2 135 ? 10.842  17.593  3.652   1.00 89.88  ? 132  GLU B CD  1 
ATOM 1871 O OE1 . GLU B 2 135 ? 12.056  17.288  3.777   1.00 90.28  ? 132  GLU B OE1 1 
ATOM 1872 O OE2 . GLU B 2 135 ? 10.358  18.692  4.039   1.00 91.92  ? 132  GLU B OE2 1 
ATOM 1873 N N   . SER B 2 136 ? 10.177  14.716  -0.342  1.00 85.41  ? 133  SER B N   1 
ATOM 1874 C CA  . SER B 2 136 ? 9.902   15.072  -1.738  1.00 87.65  ? 133  SER B CA  1 
ATOM 1875 C C   . SER B 2 136 ? 8.812   14.162  -2.305  1.00 87.66  ? 133  SER B C   1 
ATOM 1876 O O   . SER B 2 136 ? 7.795   14.633  -2.818  1.00 89.01  ? 133  SER B O   1 
ATOM 1877 C CB  . SER B 2 136 ? 11.177  14.931  -2.581  1.00 89.17  ? 133  SER B CB  1 
ATOM 1878 O OG  . SER B 2 136 ? 12.349  15.082  -1.796  1.00 88.42  ? 133  SER B OG  1 
ATOM 1879 N N   . MET B 2 137 ? 9.041   12.857  -2.171  1.00 86.64  ? 134  MET B N   1 
ATOM 1880 C CA  . MET B 2 137 ? 8.172   11.810  -2.685  1.00 86.89  ? 134  MET B CA  1 
ATOM 1881 C C   . MET B 2 137 ? 6.773   11.835  -2.129  1.00 85.92  ? 134  MET B C   1 
ATOM 1882 O O   . MET B 2 137 ? 5.827   11.527  -2.844  1.00 87.64  ? 134  MET B O   1 
ATOM 1883 C CB  . MET B 2 137 ? 8.738   10.452  -2.305  1.00 86.15  ? 134  MET B CB  1 
ATOM 1884 C CG  . MET B 2 137 ? 9.672   9.823   -3.289  1.00 88.99  ? 134  MET B CG  1 
ATOM 1885 S SD  . MET B 2 137 ? 9.400   8.040   -3.262  1.00 91.46  ? 134  MET B SD  1 
ATOM 1886 C CE  . MET B 2 137 ? 8.843   7.779   -4.950  1.00 94.68  ? 134  MET B CE  1 
ATOM 1887 N N   . TRP B 2 138 ? 6.648   12.156  -0.846  1.00 83.81  ? 135  TRP B N   1 
ATOM 1888 C CA  . TRP B 2 138 ? 5.396   11.953  -0.133  1.00 83.14  ? 135  TRP B CA  1 
ATOM 1889 C C   . TRP B 2 138 ? 4.165   12.571  -0.790  1.00 85.15  ? 135  TRP B C   1 
ATOM 1890 O O   . TRP B 2 138 ? 3.109   11.936  -0.830  1.00 85.48  ? 135  TRP B O   1 
ATOM 1891 C CB  . TRP B 2 138 ? 5.498   12.431  1.314   1.00 81.82  ? 135  TRP B CB  1 
ATOM 1892 C CG  . TRP B 2 138 ? 4.180   12.406  2.027   1.00 81.40  ? 135  TRP B CG  1 
ATOM 1893 C CD1 . TRP B 2 138 ? 3.511   13.471  2.548   1.00 81.94  ? 135  TRP B CD1 1 
ATOM 1894 C CD2 . TRP B 2 138 ? 3.359   11.259  2.264   1.00 80.78  ? 135  TRP B CD2 1 
ATOM 1895 N NE1 . TRP B 2 138 ? 2.323   13.055  3.107   1.00 82.32  ? 135  TRP B NE1 1 
ATOM 1896 C CE2 . TRP B 2 138 ? 2.209   11.701  2.942   1.00 81.71  ? 135  TRP B CE2 1 
ATOM 1897 C CE3 . TRP B 2 138 ? 3.486   9.899   1.969   1.00 80.32  ? 135  TRP B CE3 1 
ATOM 1898 C CZ2 . TRP B 2 138 ? 1.197   10.828  3.337   1.00 82.80  ? 135  TRP B CZ2 1 
ATOM 1899 C CZ3 . TRP B 2 138 ? 2.477   9.034   2.363   1.00 80.54  ? 135  TRP B CZ3 1 
ATOM 1900 C CH2 . TRP B 2 138 ? 1.350   9.499   3.035   1.00 81.25  ? 135  TRP B CH2 1 
ATOM 1901 N N   . GLU B 2 139 ? 4.287   13.797  -1.298  1.00 86.86  ? 136  GLU B N   1 
ATOM 1902 C CA  . GLU B 2 139 ? 3.123   14.470  -1.876  1.00 89.38  ? 136  GLU B CA  1 
ATOM 1903 C C   . GLU B 2 139 ? 2.540   13.661  -3.017  1.00 91.06  ? 136  GLU B C   1 
ATOM 1904 O O   . GLU B 2 139 ? 1.322   13.568  -3.157  1.00 92.38  ? 136  GLU B O   1 
ATOM 1905 C CB  . GLU B 2 139 ? 3.444   15.884  -2.354  1.00 91.60  ? 136  GLU B CB  1 
ATOM 1906 C CG  . GLU B 2 139 ? 2.305   16.853  -2.023  1.00 94.73  ? 136  GLU B CG  1 
ATOM 1907 C CD  . GLU B 2 139 ? 1.763   17.613  -3.228  1.00 101.05 ? 136  GLU B CD  1 
ATOM 1908 O OE1 . GLU B 2 139 ? 1.196   16.972  -4.155  1.00 103.75 ? 136  GLU B OE1 1 
ATOM 1909 O OE2 . GLU B 2 139 ? 1.876   18.862  -3.231  1.00 103.57 ? 136  GLU B OE2 1 
ATOM 1910 N N   . LEU B 2 140 ? 3.431   13.073  -3.814  1.00 91.49  ? 137  LEU B N   1 
ATOM 1911 C CA  . LEU B 2 140 ? 3.066   12.236  -4.947  1.00 93.72  ? 137  LEU B CA  1 
ATOM 1912 C C   . LEU B 2 140 ? 2.552   10.876  -4.505  1.00 92.91  ? 137  LEU B C   1 
ATOM 1913 O O   . LEU B 2 140 ? 1.481   10.455  -4.942  1.00 94.98  ? 137  LEU B O   1 
ATOM 1914 C CB  . LEU B 2 140 ? 4.252   12.077  -5.892  1.00 94.83  ? 137  LEU B CB  1 
ATOM 1915 C CG  . LEU B 2 140 ? 4.937   13.365  -6.350  1.00 96.09  ? 137  LEU B CG  1 
ATOM 1916 C CD1 . LEU B 2 140 ? 6.134   13.056  -7.234  1.00 97.20  ? 137  LEU B CD1 1 
ATOM 1917 C CD2 . LEU B 2 140 ? 3.953   14.279  -7.078  1.00 100.09 ? 137  LEU B CD2 1 
ATOM 1918 N N   . GLU B 2 141 ? 3.303   10.199  -3.635  1.00 90.50  ? 138  GLU B N   1 
ATOM 1919 C CA  . GLU B 2 141 ? 2.872   8.918   -3.049  1.00 90.31  ? 138  GLU B CA  1 
ATOM 1920 C C   . GLU B 2 141 ? 1.341   8.855   -2.844  1.00 91.28  ? 138  GLU B C   1 
ATOM 1921 O O   . GLU B 2 141 ? 0.703   7.808   -3.036  1.00 92.26  ? 138  GLU B O   1 
ATOM 1922 C CB  . GLU B 2 141 ? 3.586   8.658   -1.708  1.00 87.40  ? 138  GLU B CB  1 
ATOM 1923 C CG  . GLU B 2 141 ? 5.084   8.285   -1.771  1.00 88.77  ? 138  GLU B CG  1 
ATOM 1924 C CD  . GLU B 2 141 ? 5.705   8.038   -0.373  1.00 89.37  ? 138  GLU B CD  1 
ATOM 1925 O OE1 . GLU B 2 141 ? 5.130   7.240   0.408   1.00 89.45  ? 138  GLU B OE1 1 
ATOM 1926 O OE2 . GLU B 2 141 ? 6.768   8.634   -0.050  1.00 89.64  ? 138  GLU B OE2 1 
ATOM 1927 N N   . VAL B 2 142 ? 0.773   9.997   -2.463  1.00 91.32  ? 139  VAL B N   1 
ATOM 1928 C CA  . VAL B 2 142 ? -0.637  10.115  -2.148  1.00 92.72  ? 139  VAL B CA  1 
ATOM 1929 C C   . VAL B 2 142 ? -1.473  10.149  -3.416  1.00 97.25  ? 139  VAL B C   1 
ATOM 1930 O O   . VAL B 2 142 ? -2.413  9.369   -3.563  1.00 99.40  ? 139  VAL B O   1 
ATOM 1931 C CB  . VAL B 2 142 ? -0.910  11.360  -1.291  1.00 91.51  ? 139  VAL B CB  1 
ATOM 1932 C CG1 . VAL B 2 142 ? -2.395  11.534  -1.051  1.00 93.19  ? 139  VAL B CG1 1 
ATOM 1933 C CG2 . VAL B 2 142 ? -0.182  11.249  0.029   1.00 88.11  ? 139  VAL B CG2 1 
ATOM 1934 N N   . GLU B 2 143 ? -1.134  11.046  -4.335  1.00 99.59  ? 140  GLU B N   1 
ATOM 1935 C CA  . GLU B 2 143 ? -1.878  11.145  -5.578  1.00 104.47 ? 140  GLU B CA  1 
ATOM 1936 C C   . GLU B 2 143 ? -1.944  9.777   -6.221  1.00 106.28 ? 140  GLU B C   1 
ATOM 1937 O O   . GLU B 2 143 ? -3.028  9.313   -6.563  1.00 109.17 ? 140  GLU B O   1 
ATOM 1938 C CB  . GLU B 2 143 ? -1.247  12.164  -6.523  1.00 106.37 ? 140  GLU B CB  1 
ATOM 1939 C CG  . GLU B 2 143 ? -1.431  13.602  -6.062  1.00 107.95 ? 140  GLU B CG  1 
ATOM 1940 C CD  . GLU B 2 143 ? -0.740  14.621  -6.960  1.00 112.17 ? 140  GLU B CD  1 
ATOM 1941 O OE1 . GLU B 2 143 ? 0.122   15.376  -6.439  1.00 111.25 ? 140  GLU B OE1 1 
ATOM 1942 O OE2 . GLU B 2 143 ? -1.059  14.672  -8.175  1.00 115.99 ? 140  GLU B OE2 1 
ATOM 1943 N N   . ASP B 2 144 ? -0.788  9.117   -6.325  1.00 105.21 ? 141  ASP B N   1 
ATOM 1944 C CA  . ASP B 2 144 ? -0.674  7.832   -7.020  1.00 107.81 ? 141  ASP B CA  1 
ATOM 1945 C C   . ASP B 2 144 ? -1.563  6.759   -6.418  1.00 108.41 ? 141  ASP B C   1 
ATOM 1946 O O   . ASP B 2 144 ? -2.133  5.940   -7.144  1.00 112.23 ? 141  ASP B O   1 
ATOM 1947 C CB  . ASP B 2 144 ? 0.775   7.336   -7.072  1.00 105.94 ? 141  ASP B CB  1 
ATOM 1948 C CG  . ASP B 2 144 ? 0.972   6.207   -8.084  1.00 109.13 ? 141  ASP B CG  1 
ATOM 1949 O OD1 . ASP B 2 144 ? 0.844   6.459   -9.301  1.00 113.71 ? 141  ASP B OD1 1 
ATOM 1950 O OD2 . ASP B 2 144 ? 1.264   5.068   -7.672  1.00 107.28 ? 141  ASP B OD2 1 
ATOM 1951 N N   . LEU B 2 145 ? -1.678  6.762   -5.096  1.00 105.51 ? 142  LEU B N   1 
ATOM 1952 C CA  . LEU B 2 145 ? -2.557  5.825   -4.423  1.00 106.36 ? 142  LEU B CA  1 
ATOM 1953 C C   . LEU B 2 145 ? -4.003  6.122   -4.777  1.00 110.14 ? 142  LEU B C   1 
ATOM 1954 O O   . LEU B 2 145 ? -4.780  5.202   -5.041  1.00 113.24 ? 142  LEU B O   1 
ATOM 1955 C CB  . LEU B 2 145 ? -2.375  5.904   -2.911  1.00 102.57 ? 142  LEU B CB  1 
ATOM 1956 C CG  . LEU B 2 145 ? -3.135  4.820   -2.149  1.00 103.32 ? 142  LEU B CG  1 
ATOM 1957 C CD1 . LEU B 2 145 ? -2.430  3.486   -2.312  1.00 103.99 ? 142  LEU B CD1 1 
ATOM 1958 C CD2 . LEU B 2 145 ? -3.309  5.170   -0.675  1.00 100.76 ? 142  LEU B CD2 1 
ATOM 1959 N N   . HIS B 2 146 ? -4.346  7.412   -4.790  1.00 110.63 ? 143  HIS B N   1 
ATOM 1960 C CA  . HIS B 2 146 ? -5.719  7.866   -5.021  1.00 114.39 ? 143  HIS B CA  1 
ATOM 1961 C C   . HIS B 2 146 ? -6.179  7.729   -6.466  1.00 119.40 ? 143  HIS B C   1 
ATOM 1962 O O   . HIS B 2 146 ? -7.372  7.603   -6.722  1.00 123.14 ? 143  HIS B O   1 
ATOM 1963 C CB  . HIS B 2 146 ? -5.917  9.296   -4.507  1.00 113.51 ? 143  HIS B CB  1 
ATOM 1964 C CG  . HIS B 2 146 ? -6.127  9.375   -3.024  1.00 111.43 ? 143  HIS B CG  1 
ATOM 1965 N ND1 . HIS B 2 146 ? -7.296  9.844   -2.460  1.00 114.20 ? 143  HIS B ND1 1 
ATOM 1966 C CD2 . HIS B 2 146 ? -5.324  9.023   -1.990  1.00 107.70 ? 143  HIS B CD2 1 
ATOM 1967 C CE1 . HIS B 2 146 ? -7.200  9.790   -1.143  1.00 111.52 ? 143  HIS B CE1 1 
ATOM 1968 N NE2 . HIS B 2 146 ? -6.014  9.295   -0.831  1.00 107.92 ? 143  HIS B NE2 1 
ATOM 1969 N N   . ARG B 2 147 ? -5.237  7.758   -7.402  1.00 120.08 ? 144  ARG B N   1 
ATOM 1970 C CA  . ARG B 2 147 ? -5.530  7.392   -8.775  1.00 125.45 ? 144  ARG B CA  1 
ATOM 1971 C C   . ARG B 2 147 ? -5.874  5.903   -8.825  1.00 127.67 ? 144  ARG B C   1 
ATOM 1972 O O   . ARG B 2 147 ? -6.842  5.502   -9.476  1.00 132.66 ? 144  ARG B O   1 
ATOM 1973 C CB  . ARG B 2 147 ? -4.339  7.685   -9.681  1.00 125.60 ? 144  ARG B CB  1 
ATOM 1974 C CG  . ARG B 2 147 ? -4.255  9.109   -10.209 1.00 126.80 ? 144  ARG B CG  1 
ATOM 1975 C CD  . ARG B 2 147 ? -3.317  9.139   -11.418 1.00 130.26 ? 144  ARG B CD  1 
ATOM 1976 N NE  . ARG B 2 147 ? -3.283  10.424  -12.124 1.00 133.42 ? 144  ARG B NE  1 
ATOM 1977 C CZ  . ARG B 2 147 ? -2.925  10.575  -13.403 1.00 138.38 ? 144  ARG B CZ  1 
ATOM 1978 N NH1 . ARG B 2 147 ? -2.575  9.525   -14.142 1.00 141.05 ? 144  ARG B NH1 1 
ATOM 1979 N NH2 . ARG B 2 147 ? -2.928  11.780  -13.959 1.00 140.86 ? 144  ARG B NH2 1 
ATOM 1980 N N   . ASN B 2 148 ? -5.096  5.099   -8.097  1.00 124.53 ? 145  ASN B N   1 
ATOM 1981 C CA  . ASN B 2 148 ? -5.177  3.632   -8.163  1.00 126.81 ? 145  ASN B CA  1 
ATOM 1982 C C   . ASN B 2 148 ? -6.224  2.925   -7.283  1.00 127.47 ? 145  ASN B C   1 
ATOM 1983 O O   . ASN B 2 148 ? -6.245  1.693   -7.222  1.00 128.89 ? 145  ASN B O   1 
ATOM 1984 C CB  . ASN B 2 148 ? -3.792  3.012   -7.927  1.00 123.72 ? 145  ASN B CB  1 
ATOM 1985 C CG  . ASN B 2 148 ? -2.930  3.023   -9.172  1.00 126.17 ? 145  ASN B CG  1 
ATOM 1986 O OD1 . ASN B 2 148 ? -2.581  4.081   -9.692  1.00 126.13 ? 145  ASN B OD1 1 
ATOM 1987 N ND2 . ASN B 2 148 ? -2.577  1.838   -9.653  1.00 128.96 ? 145  ASN B ND2 1 
ATOM 1988 N N   . ILE B 2 149 ? -7.082  3.686   -6.605  1.00 126.98 ? 146  ILE B N   1 
ATOM 1989 C CA  . ILE B 2 149 ? -8.171  3.084   -5.829  1.00 128.52 ? 146  ILE B CA  1 
ATOM 1990 C C   . ILE B 2 149 ? -9.507  3.790   -6.045  1.00 132.48 ? 146  ILE B C   1 
ATOM 1991 O O   . ILE B 2 149 ? -9.686  4.930   -5.593  1.00 130.64 ? 146  ILE B O   1 
ATOM 1992 C CB  . ILE B 2 149 ? -7.883  3.068   -4.321  1.00 123.45 ? 146  ILE B CB  1 
ATOM 1993 C CG1 . ILE B 2 149 ? -6.555  2.364   -4.033  1.00 120.30 ? 146  ILE B CG1 1 
ATOM 1994 C CG2 . ILE B 2 149 ? -9.052  2.402   -3.577  1.00 125.54 ? 146  ILE B CG2 1 
ATOM 1995 C CD1 . ILE B 2 149 ? -6.110  2.466   -2.593  1.00 116.00 ? 146  ILE B CD1 1 
ATOM 1996 N N   . PRO B 2 150 ? -10.457 3.109   -6.723  1.00 138.44 ? 147  PRO B N   1 
ATOM 1997 C CA  . PRO B 2 150 ? -11.804 3.673   -6.929  1.00 142.89 ? 147  PRO B CA  1 
ATOM 1998 C C   . PRO B 2 150 ? -12.620 3.810   -5.627  1.00 141.50 ? 147  PRO B C   1 
ATOM 1999 O O   . PRO B 2 150 ? -12.161 3.488   -4.521  1.00 137.10 ? 147  PRO B O   1 
ATOM 2000 C CB  . PRO B 2 150 ? -12.465 2.673   -7.895  1.00 149.40 ? 147  PRO B CB  1 
ATOM 2001 C CG  . PRO B 2 150 ? -11.329 1.932   -8.529  1.00 148.76 ? 147  PRO B CG  1 
ATOM 2002 C CD  . PRO B 2 150 ? -10.280 1.844   -7.459  1.00 141.85 ? 147  PRO B CD  1 
ATOM 2003 O OXT . PRO B 2 150 ? -13.768 4.266   -5.653  1.00 145.10 ? 147  PRO B OXT 1 
ATOM 2004 N N   . ASP C 3 12  ? 18.075  -16.977 26.600  1.00 110.81 ? 1226 ASP C N   1 
ATOM 2005 C CA  . ASP C 3 12  ? 17.181  -18.037 26.030  1.00 110.36 ? 1226 ASP C CA  1 
ATOM 2006 C C   . ASP C 3 12  ? 16.166  -17.480 25.013  1.00 106.46 ? 1226 ASP C C   1 
ATOM 2007 O O   . ASP C 3 12  ? 15.998  -18.038 23.916  1.00 104.28 ? 1226 ASP C O   1 
ATOM 2008 C CB  . ASP C 3 12  ? 16.453  -18.779 27.158  1.00 115.48 ? 1226 ASP C CB  1 
ATOM 2009 C CG  . ASP C 3 12  ? 17.406  -19.511 28.080  1.00 120.04 ? 1226 ASP C CG  1 
ATOM 2010 O OD1 . ASP C 3 12  ? 17.423  -19.210 29.291  1.00 124.48 ? 1226 ASP C OD1 1 
ATOM 2011 O OD2 . ASP C 3 12  ? 18.149  -20.385 27.591  1.00 119.54 ? 1226 ASP C OD2 1 
ATOM 2012 N N   . LEU C 3 13  ? 15.491  -16.389 25.385  1.00 105.85 ? 1227 LEU C N   1 
ATOM 2013 C CA  . LEU C 3 13  ? 14.524  -15.744 24.505  1.00 102.17 ? 1227 LEU C CA  1 
ATOM 2014 C C   . LEU C 3 13  ? 15.254  -14.819 23.532  1.00 98.18  ? 1227 LEU C C   1 
ATOM 2015 O O   . LEU C 3 13  ? 16.271  -14.202 23.883  1.00 98.37  ? 1227 LEU C O   1 
ATOM 2016 C CB  . LEU C 3 13  ? 13.465  -14.972 25.313  1.00 103.81 ? 1227 LEU C CB  1 
ATOM 2017 C CG  . LEU C 3 13  ? 12.064  -14.665 24.738  1.00 102.49 ? 1227 LEU C CG  1 
ATOM 2018 C CD1 . LEU C 3 13  ? 11.138  -15.898 24.685  1.00 105.03 ? 1227 LEU C CD1 1 
ATOM 2019 C CD2 . LEU C 3 13  ? 11.380  -13.555 25.529  1.00 103.22 ? 1227 LEU C CD2 1 
ATOM 2020 N N   . PHE C 3 14  ? 14.752  -14.780 22.297  1.00 94.94  ? 1228 PHE C N   1 
ATOM 2021 C CA  . PHE C 3 14  ? 15.135  -13.785 21.314  1.00 91.18  ? 1228 PHE C CA  1 
ATOM 2022 C C   . PHE C 3 14  ? 13.914  -12.944 21.087  1.00 89.85  ? 1228 PHE C C   1 
ATOM 2023 O O   . PHE C 3 14  ? 13.459  -12.241 21.979  1.00 90.84  ? 1228 PHE C O   1 
ATOM 2024 C CB  . PHE C 3 14  ? 15.524  -14.427 19.987  1.00 89.53  ? 1228 PHE C CB  1 
ATOM 2025 C CG  . PHE C 3 14  ? 16.959  -14.807 19.891  1.00 89.80  ? 1228 PHE C CG  1 
ATOM 2026 C CD1 . PHE C 3 14  ? 17.930  -14.122 20.621  1.00 90.79  ? 1228 PHE C CD1 1 
ATOM 2027 C CD2 . PHE C 3 14  ? 17.355  -15.840 19.040  1.00 89.74  ? 1228 PHE C CD2 1 
ATOM 2028 C CE1 . PHE C 3 14  ? 19.289  -14.479 20.521  1.00 91.84  ? 1228 PHE C CE1 1 
ATOM 2029 C CE2 . PHE C 3 14  ? 18.705  -16.208 18.929  1.00 90.35  ? 1228 PHE C CE2 1 
ATOM 2030 C CZ  . PHE C 3 14  ? 19.674  -15.527 19.674  1.00 91.32  ? 1228 PHE C CZ  1 
ATOM 2031 N N   . SER C 3 15  ? 13.375  -13.057 19.879  1.00 88.28  ? 1229 SER C N   1 
ATOM 2032 C CA  . SER C 3 15  ? 12.279  -12.229 19.386  1.00 87.13  ? 1229 SER C CA  1 
ATOM 2033 C C   . SER C 3 15  ? 12.499  -10.751 19.575  1.00 85.87  ? 1229 SER C C   1 
ATOM 2034 O O   . SER C 3 15  ? 11.795  -10.138 20.358  1.00 86.28  ? 1229 SER C O   1 
ATOM 2035 C CB  . SER C 3 15  ? 10.977  -12.620 20.056  1.00 88.95  ? 1229 SER C CB  1 
ATOM 2036 O OG  . SER C 3 15  ? 11.096  -12.550 21.460  1.00 91.80  ? 1229 SER C OG  1 
ATOM 2037 N N   . VAL C 3 16  ? 13.481  -10.176 18.882  1.00 85.16  ? 1230 VAL C N   1 
ATOM 2038 C CA  . VAL C 3 16  ? 13.597  -8.722  18.875  1.00 84.95  ? 1230 VAL C CA  1 
ATOM 2039 C C   . VAL C 3 16  ? 12.196  -8.351  18.463  1.00 84.68  ? 1230 VAL C C   1 
ATOM 2040 O O   . VAL C 3 16  ? 11.846  -8.497  17.298  1.00 84.78  ? 1230 VAL C O   1 
ATOM 2041 C CB  . VAL C 3 16  ? 14.648  -8.150  17.851  1.00 84.26  ? 1230 VAL C CB  1 
ATOM 2042 C CG1 . VAL C 3 16  ? 16.056  -8.417  18.308  1.00 85.23  ? 1230 VAL C CG1 1 
ATOM 2043 C CG2 . VAL C 3 16  ? 14.434  -8.674  16.449  1.00 82.54  ? 1230 VAL C CG2 1 
ATOM 2044 N N   . THR C 3 17  ? 11.355  -7.960  19.410  1.00 85.36  ? 1231 THR C N   1 
ATOM 2045 C CA  . THR C 3 17  ? 9.975   -7.764  19.044  1.00 85.01  ? 1231 THR C CA  1 
ATOM 2046 C C   . THR C 3 17  ? 9.506   -6.369  19.238  1.00 84.68  ? 1231 THR C C   1 
ATOM 2047 O O   . THR C 3 17  ? 9.305   -5.936  20.366  1.00 86.50  ? 1231 THR C O   1 
ATOM 2048 C CB  . THR C 3 17  ? 9.021   -8.709  19.772  1.00 87.00  ? 1231 THR C CB  1 
ATOM 2049 O OG1 . THR C 3 17  ? 9.350   -8.773  21.177  1.00 89.21  ? 1231 THR C OG1 1 
ATOM 2050 C CG2 . THR C 3 17  ? 9.082   -10.075 19.114  1.00 87.22  ? 1231 THR C CG2 1 
ATOM 2051 N N   . PHE C 3 18  ? 9.334   -5.668  18.128  1.00 83.18  ? 1232 PHE C N   1 
ATOM 2052 C CA  . PHE C 3 18  ? 8.466   -4.517  18.119  1.00 83.12  ? 1232 PHE C CA  1 
ATOM 2053 C C   . PHE C 3 18  ? 7.072   -4.984  17.643  1.00 83.49  ? 1232 PHE C C   1 
ATOM 2054 O O   . PHE C 3 18  ? 6.961   -5.774  16.708  1.00 83.72  ? 1232 PHE C O   1 
ATOM 2055 C CB  . PHE C 3 18  ? 9.075   -3.398  17.274  1.00 82.50  ? 1232 PHE C CB  1 
ATOM 2056 C CG  . PHE C 3 18  ? 8.440   -3.225  15.930  1.00 81.48  ? 1232 PHE C CG  1 
ATOM 2057 C CD1 . PHE C 3 18  ? 7.177   -2.641  15.814  1.00 80.20  ? 1232 PHE C CD1 1 
ATOM 2058 C CD2 . PHE C 3 18  ? 9.108   -3.619  14.781  1.00 80.32  ? 1232 PHE C CD2 1 
ATOM 2059 C CE1 . PHE C 3 18  ? 6.589   -2.486  14.595  1.00 79.25  ? 1232 PHE C CE1 1 
ATOM 2060 C CE2 . PHE C 3 18  ? 8.523   -3.454  13.552  1.00 80.11  ? 1232 PHE C CE2 1 
ATOM 2061 C CZ  . PHE C 3 18  ? 7.257   -2.889  13.462  1.00 80.26  ? 1232 PHE C CZ  1 
ATOM 2062 N N   . ASP C 3 19  ? 6.017   -4.511  18.304  1.00 84.54  ? 1233 ASP C N   1 
ATOM 2063 C CA  . ASP C 3 19  ? 4.652   -5.055  18.132  1.00 85.86  ? 1233 ASP C CA  1 
ATOM 2064 C C   . ASP C 3 19  ? 3.595   -4.136  18.761  1.00 86.94  ? 1233 ASP C C   1 
ATOM 2065 O O   . ASP C 3 19  ? 3.913   -3.362  19.660  1.00 87.68  ? 1233 ASP C O   1 
ATOM 2066 C CB  . ASP C 3 19  ? 4.584   -6.422  18.789  1.00 87.21  ? 1233 ASP C CB  1 
ATOM 2067 C CG  . ASP C 3 19  ? 5.397   -6.482  20.067  1.00 88.60  ? 1233 ASP C CG  1 
ATOM 2068 O OD1 . ASP C 3 19  ? 5.026   -7.266  20.959  1.00 94.40  ? 1233 ASP C OD1 1 
ATOM 2069 O OD2 . ASP C 3 19  ? 6.398   -5.743  20.204  1.00 86.22  ? 1233 ASP C OD2 1 
ATOM 2070 N N   . LEU C 3 20  ? 2.340   -4.209  18.327  1.00 87.86  ? 1234 LEU C N   1 
ATOM 2071 C CA  . LEU C 3 20  ? 1.404   -3.152  18.738  1.00 88.89  ? 1234 LEU C CA  1 
ATOM 2072 C C   . LEU C 3 20  ? -0.104  -3.436  18.790  1.00 91.33  ? 1234 LEU C C   1 
ATOM 2073 O O   . LEU C 3 20  ? -0.625  -4.296  18.079  1.00 92.20  ? 1234 LEU C O   1 
ATOM 2074 C CB  . LEU C 3 20  ? 1.640   -1.935  17.861  1.00 87.43  ? 1234 LEU C CB  1 
ATOM 2075 C CG  . LEU C 3 20  ? 2.026   -2.285  16.427  1.00 86.69  ? 1234 LEU C CG  1 
ATOM 2076 C CD1 . LEU C 3 20  ? 0.831   -2.656  15.558  1.00 88.07  ? 1234 LEU C CD1 1 
ATOM 2077 C CD2 . LEU C 3 20  ? 2.731   -1.096  15.870  1.00 86.80  ? 1234 LEU C CD2 1 
ATOM 2078 N N   . GLY C 3 21  ? -0.795  -2.674  19.635  1.00 92.92  ? 1235 GLY C N   1 
ATOM 2079 C CA  . GLY C 3 21  ? -2.249  -2.697  19.682  1.00 95.44  ? 1235 GLY C CA  1 
ATOM 2080 C C   . GLY C 3 21  ? -2.839  -1.304  19.588  1.00 95.46  ? 1235 GLY C C   1 
ATOM 2081 O O   . GLY C 3 21  ? -2.108  -0.305  19.558  1.00 93.80  ? 1235 GLY C O   1 
ATOM 2082 N N   . PHE C 3 22  ? -4.167  -1.239  19.528  1.00 97.81  ? 1236 PHE C N   1 
ATOM 2083 C CA  . PHE C 3 22  ? -4.887  0.029   19.691  1.00 98.59  ? 1236 PHE C CA  1 
ATOM 2084 C C   . PHE C 3 22  ? -6.147  -0.133  20.560  1.00 102.43 ? 1236 PHE C C   1 
ATOM 2085 O O   . PHE C 3 22  ? -6.470  -1.244  20.997  1.00 104.61 ? 1236 PHE C O   1 
ATOM 2086 C CB  . PHE C 3 22  ? -5.161  0.718   18.332  1.00 97.24  ? 1236 PHE C CB  1 
ATOM 2087 C CG  . PHE C 3 22  ? -6.333  0.150   17.551  1.00 99.24  ? 1236 PHE C CG  1 
ATOM 2088 C CD1 . PHE C 3 22  ? -7.375  0.984   17.140  1.00 100.88 ? 1236 PHE C CD1 1 
ATOM 2089 C CD2 . PHE C 3 22  ? -6.388  -1.195  17.197  1.00 99.84  ? 1236 PHE C CD2 1 
ATOM 2090 C CE1 . PHE C 3 22  ? -8.463  0.478   16.403  1.00 102.93 ? 1236 PHE C CE1 1 
ATOM 2091 C CE2 . PHE C 3 22  ? -7.477  -1.706  16.465  1.00 102.38 ? 1236 PHE C CE2 1 
ATOM 2092 C CZ  . PHE C 3 22  ? -8.508  -0.869  16.067  1.00 103.65 ? 1236 PHE C CZ  1 
ATOM 2093 N N   . CYS C 3 23  ? -6.817  0.992   20.830  1.00 103.56 ? 1237 CYS C N   1 
ATOM 2094 C CA  . CYS C 3 23  ? -8.033  1.063   21.667  1.00 107.54 ? 1237 CYS C CA  1 
ATOM 2095 C C   . CYS C 3 23  ? -7.699  1.194   23.148  1.00 109.74 ? 1237 CYS C C   1 
ATOM 2096 O O   . CYS C 3 23  ? -7.044  2.157   23.548  1.00 108.64 ? 1237 CYS C O   1 
ATOM 2097 C CB  . CYS C 3 23  ? -8.976  -0.121  21.426  1.00 110.45 ? 1237 CYS C CB  1 
ATOM 2098 S SG  . CYS C 3 23  ? -10.520 0.359   20.620  1.00 112.78 ? 1237 CYS C SG  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ILE A 14  ? 1.7856 2.0568 1.5895 0.0694  -0.2989 -0.0513 482  ILE A N   
2    C CA  . ILE A 14  ? 1.7824 2.0124 1.5567 0.0513  -0.2801 -0.0653 482  ILE A CA  
3    C C   . ILE A 14  ? 1.7313 1.9595 1.5467 0.0426  -0.2514 -0.0645 482  ILE A C   
4    O O   . ILE A 14  ? 1.7124 1.9210 1.5217 0.0545  -0.2288 -0.0524 482  ILE A O   
5    C CB  . ILE A 14  ? 1.8137 1.9968 1.5158 0.0617  -0.2690 -0.0602 482  ILE A CB  
6    C CG1 . ILE A 14  ? 1.8566 2.0433 1.5231 0.0805  -0.2921 -0.0489 482  ILE A CG1 
7    C CG2 . ILE A 14  ? 1.8304 1.9848 1.4935 0.0468  -0.2641 -0.0790 482  ILE A CG2 
8    C CD1 . ILE A 14  ? 1.8669 2.0150 1.4807 0.0953  -0.2767 -0.0310 482  ILE A CD1 
9    N N   . ALA A 15  ? 1.7138 1.9595 1.5682 0.0210  -0.2545 -0.0767 483  ALA A N   
10   C CA  . ALA A 15  ? 1.6655 1.9160 1.5634 0.0122  -0.2304 -0.0746 483  ALA A CA  
11   C C   . ALA A 15  ? 1.6580 1.8814 1.5526 -0.0112 -0.2213 -0.0909 483  ALA A C   
12   O O   . ALA A 15  ? 1.6251 1.8560 1.5587 -0.0220 -0.2064 -0.0895 483  ALA A O   
13   C CB  . ALA A 15  ? 1.6431 1.9519 1.6081 0.0128  -0.2377 -0.0648 483  ALA A CB  
14   N N   . MET A 16  ? 1.6897 1.8802 1.5346 -0.0167 -0.2300 -0.1059 484  MET A N   
15   C CA  . MET A 16  ? 1.6890 1.8429 1.5171 -0.0311 -0.2187 -0.1217 484  MET A CA  
16   C C   . MET A 16  ? 1.6560 1.7826 1.4669 -0.0205 -0.1855 -0.1143 484  MET A C   
17   O O   . MET A 16  ? 1.6741 1.7719 1.4361 -0.0122 -0.1761 -0.1177 484  MET A O   
18   C CB  . MET A 16  ? 1.7462 1.8722 1.5206 -0.0350 -0.2383 -0.1413 484  MET A CB  
19   C CG  . MET A 16  ? 1.7646 1.8469 1.5124 -0.0431 -0.2263 -0.1590 484  MET A CG  
20   S SD  . MET A 16  ? 1.8438 1.8856 1.5063 -0.0314 -0.2352 -0.1779 484  MET A SD  
21   C CE  . MET A 16  ? 1.8171 1.8213 1.4558 -0.0236 -0.1994 -0.1834 484  MET A CE  
22   N N   . ASP A 17  ? 1.6049 1.7441 1.4571 -0.0206 -0.1681 -0.1029 485  ASP A N   
23   C CA  . ASP A 17  ? 1.5697 1.6853 1.4123 -0.0134 -0.1400 -0.0954 485  ASP A CA  
24   C C   . ASP A 17  ? 1.5611 1.6473 1.3926 -0.0246 -0.1285 -0.1093 485  ASP A C   
25   O O   . ASP A 17  ? 1.5389 1.6166 1.3888 -0.0271 -0.1094 -0.1053 485  ASP A O   
26   C CB  . ASP A 17  ? 1.5345 1.6693 1.4202 -0.0088 -0.1271 -0.0811 485  ASP A CB  
27   C CG  . ASP A 17  ? 1.5329 1.6753 1.4109 0.0117  -0.1275 -0.0650 485  ASP A CG  
28   O OD1 . ASP A 17  ? 1.5676 1.7187 1.4264 0.0201  -0.1453 -0.0628 485  ASP A OD1 
29   O OD2 . ASP A 17  ? 1.4970 1.6330 1.3855 0.0203  -0.1113 -0.0546 485  ASP A OD2 
30   N N   . LEU A 18  ? 1.5791 1.6474 1.3779 -0.0293 -0.1407 -0.1260 486  LEU A N   
31   C CA  . LEU A 18  ? 1.5695 1.6067 1.3560 -0.0358 -0.1304 -0.1398 486  LEU A CA  
32   C C   . LEU A 18  ? 1.5418 1.5628 1.3070 -0.0231 -0.1037 -0.1327 486  LEU A C   
33   O O   . LEU A 18  ? 1.5116 1.5254 1.2981 -0.0258 -0.0867 -0.1289 486  LEU A O   
34   C CB  . LEU A 18  ? 1.6266 1.6409 1.3762 -0.0406 -0.1505 -0.1618 486  LEU A CB  
35   C CG  . LEU A 18  ? 1.6421 1.6495 1.4172 -0.0630 -0.1702 -0.1748 486  LEU A CG  
36   C CD1 . LEU A 18  ? 1.6951 1.6699 1.4232 -0.0665 -0.1939 -0.1986 486  LEU A CD1 
37   C CD2 . LEU A 18  ? 1.6158 1.6063 1.4174 -0.0715 -0.1518 -0.1736 486  LEU A CD2 
38   N N   . TYR A 19  ? 1.5453 1.5640 1.2703 -0.0101 -0.1006 -0.1287 487  TYR A N   
39   C CA  . TYR A 19  ? 1.5197 1.5296 1.2253 -0.0004 -0.0766 -0.1199 487  TYR A CA  
40   C C   . TYR A 19  ? 1.4977 1.5195 1.1976 0.0065  -0.0706 -0.0979 487  TYR A C   
41   O O   . TYR A 19  ? 1.4904 1.5089 1.1779 0.0109  -0.0526 -0.0867 487  TYR A O   
42   C CB  . TYR A 19  ? 1.5612 1.5540 1.2194 0.0086  -0.0728 -0.1342 487  TYR A CB  
43   C CG  . TYR A 19  ? 1.5705 1.5398 1.2287 0.0033  -0.0788 -0.1565 487  TYR A CG  
44   C CD1 . TYR A 19  ? 1.5513 1.5073 1.2245 0.0037  -0.0616 -0.1587 487  TYR A CD1 
45   C CD2 . TYR A 19  ? 1.6030 1.5599 1.2455 -0.0030 -0.1044 -0.1747 487  TYR A CD2 
46   C CE1 . TYR A 19  ? 1.5782 1.5050 1.2480 -0.0009 -0.0687 -0.1782 487  TYR A CE1 
47   C CE2 . TYR A 19  ? 1.6240 1.5507 1.2632 -0.0104 -0.1131 -0.1949 487  TYR A CE2 
48   C CZ  . TYR A 19  ? 1.6140 1.5237 1.2658 -0.0087 -0.0946 -0.1963 487  TYR A CZ  
49   O OH  . TYR A 19  ? 1.6482 1.5210 1.2930 -0.0154 -0.1045 -0.2154 487  TYR A OH  
50   N N   . SER A 20  ? 1.4830 1.5185 1.1931 0.0072  -0.0868 -0.0908 488  SER A N   
51   C CA  . SER A 20  ? 1.4649 1.5038 1.1672 0.0148  -0.0853 -0.0700 488  SER A CA  
52   C C   . SER A 20  ? 1.4207 1.4513 1.1419 0.0132  -0.0666 -0.0565 488  SER A C   
53   O O   . SER A 20  ? 1.3925 1.4257 1.1491 0.0096  -0.0638 -0.0577 488  SER A O   
54   C CB  . SER A 20  ? 1.4663 1.5221 1.1870 0.0185  -0.1055 -0.0662 488  SER A CB  
55   O OG  . SER A 20  ? 1.4322 1.4993 1.1999 0.0138  -0.1033 -0.0671 488  SER A OG  
56   N N   . PRO A 21  ? 1.4155 1.4370 1.1120 0.0148  -0.0543 -0.0426 489  PRO A N   
57   C CA  . PRO A 21  ? 1.3796 1.3914 1.0903 0.0106  -0.0398 -0.0297 489  PRO A CA  
58   C C   . PRO A 21  ? 1.3631 1.3647 1.0813 0.0144  -0.0478 -0.0157 489  PRO A C   
59   O O   . PRO A 21  ? 1.3823 1.3859 1.0877 0.0222  -0.0623 -0.0119 489  PRO A O   
60   C CB  . PRO A 21  ? 1.3997 1.4112 1.0806 0.0091  -0.0277 -0.0174 489  PRO A CB  
61   C CG  . PRO A 21  ? 1.4358 1.4563 1.0868 0.0151  -0.0312 -0.0295 489  PRO A CG  
62   C CD  . PRO A 21  ? 1.4512 1.4730 1.1045 0.0190  -0.0529 -0.0381 489  PRO A CD  
63   N N   . PRO A 22  ? 1.3304 1.3186 1.0651 0.0112  -0.0398 -0.0083 490  PRO A N   
64   C CA  . PRO A 22  ? 1.3006 1.2858 1.0487 0.0028  -0.0247 -0.0094 490  PRO A CA  
65   C C   . PRO A 22  ? 1.2668 1.2591 1.0446 0.0015  -0.0204 -0.0254 490  PRO A C   
66   O O   . PRO A 22  ? 1.2590 1.2523 1.0437 -0.0033 -0.0092 -0.0303 490  PRO A O   
67   C CB  . PRO A 22  ? 1.3004 1.2624 1.0474 0.0007  -0.0249 0.0064  490  PRO A CB  
68   C CG  . PRO A 22  ? 1.3086 1.2617 1.0545 0.0122  -0.0376 0.0078  490  PRO A CG  
69   C CD  . PRO A 22  ? 1.3353 1.3054 1.0695 0.0184  -0.0476 0.0034  490  PRO A CD  
70   N N   . PHE A 23  ? 1.2482 1.2469 1.0440 0.0060  -0.0290 -0.0315 491  PHE A N   
71   C CA  . PHE A 23  ? 1.2151 1.2219 1.0403 0.0023  -0.0257 -0.0435 491  PHE A CA  
72   C C   . PHE A 23  ? 1.2109 1.2383 1.0506 0.0046  -0.0394 -0.0501 491  PHE A C   
73   O O   . PHE A 23  ? 1.2266 1.2610 1.0519 0.0110  -0.0514 -0.0463 491  PHE A O   
74   C CB  . PHE A 23  ? 1.1953 1.1906 1.0368 0.0038  -0.0174 -0.0372 491  PHE A CB  
75   C CG  . PHE A 23  ? 1.2072 1.1979 1.0472 0.0153  -0.0234 -0.0276 491  PHE A CG  
76   C CD1 . PHE A 23  ? 1.2105 1.2203 1.0740 0.0228  -0.0269 -0.0300 491  PHE A CD1 
77   C CD2 . PHE A 23  ? 1.2265 1.1934 1.0412 0.0194  -0.0261 -0.0150 491  PHE A CD2 
78   C CE1 . PHE A 23  ? 1.2227 1.2290 1.0824 0.0394  -0.0315 -0.0216 491  PHE A CE1 
79   C CE2 . PHE A 23  ? 1.2401 1.1940 1.0467 0.0337  -0.0333 -0.0074 491  PHE A CE2 
80   C CZ  . PHE A 23  ? 1.2343 1.2084 1.0625 0.0464  -0.0353 -0.0115 491  PHE A CZ  
81   N N   . VAL A 24  ? 1.1880 1.2266 1.0571 -0.0018 -0.0386 -0.0582 492  VAL A N   
82   C CA  . VAL A 24  ? 1.1832 1.2487 1.0753 -0.0038 -0.0523 -0.0624 492  VAL A CA  
83   C C   . VAL A 24  ? 1.1585 1.2406 1.0882 -0.0037 -0.0457 -0.0573 492  VAL A C   
84   O O   . VAL A 24  ? 1.1448 1.2129 1.0749 0.0019  -0.0319 -0.0504 492  VAL A O   
85   C CB  . VAL A 24  ? 1.1994 1.2667 1.0879 -0.0165 -0.0631 -0.0781 492  VAL A CB  
86   C CG1 . VAL A 24  ? 1.2288 1.2812 1.0748 -0.0122 -0.0665 -0.0826 492  VAL A CG1 
87   C CG2 . VAL A 24  ? 1.1916 1.2441 1.0924 -0.0284 -0.0535 -0.0863 492  VAL A CG2 
88   N N   . TYR A 25  ? 1.1537 1.2673 1.1140 -0.0104 -0.0560 -0.0598 493  TYR A N   
89   C CA  . TYR A 25  ? 1.1298 1.2706 1.1292 -0.0095 -0.0489 -0.0519 493  TYR A CA  
90   C C   . TYR A 25  ? 1.1236 1.2776 1.1541 -0.0315 -0.0500 -0.0568 493  TYR A C   
91   O O   . TYR A 25  ? 1.1400 1.2924 1.1684 -0.0467 -0.0653 -0.0675 493  TYR A O   
92   C CB  . TYR A 25  ? 1.1333 1.3106 1.1489 0.0063  -0.0585 -0.0431 493  TYR A CB  
93   C CG  . TYR A 25  ? 1.1399 1.2943 1.1233 0.0289  -0.0552 -0.0359 493  TYR A CG  
94   C CD1 . TYR A 25  ? 1.1419 1.2764 1.1180 0.0412  -0.0389 -0.0291 493  TYR A CD1 
95   C CD2 . TYR A 25  ? 1.1645 1.3106 1.1195 0.0368  -0.0695 -0.0356 493  TYR A CD2 
96   C CE1 . TYR A 25  ? 1.1658 1.2702 1.1085 0.0593  -0.0389 -0.0228 493  TYR A CE1 
97   C CE2 . TYR A 25  ? 1.1882 1.3061 1.1110 0.0547  -0.0678 -0.0270 493  TYR A CE2 
98   C CZ  . TYR A 25  ? 1.1875 1.2829 1.1048 0.0651  -0.0534 -0.0210 493  TYR A CZ  
99   O OH  . TYR A 25  ? 1.2183 1.2778 1.1008 0.0804  -0.0547 -0.0129 493  TYR A OH  
100  N N   . LEU A 26  ? 1.1052 1.2681 1.1606 -0.0332 -0.0346 -0.0486 494  LEU A N   
101  C CA  . LEU A 26  ? 1.1040 1.2769 1.1898 -0.0563 -0.0342 -0.0491 494  LEU A CA  
102  C C   . LEU A 26  ? 1.1115 1.3337 1.2382 -0.0695 -0.0506 -0.0457 494  LEU A C   
103  O O   . LEU A 26  ? 1.1239 1.3442 1.2642 -0.0947 -0.0628 -0.0517 494  LEU A O   
104  C CB  . LEU A 26  ? 1.0895 1.2600 1.1881 -0.0540 -0.0120 -0.0383 494  LEU A CB  
105  C CG  . LEU A 26  ? 1.0804 1.2014 1.1476 -0.0522 0.0009  -0.0426 494  LEU A CG  
106  C CD1 . LEU A 26  ? 1.0695 1.1923 1.1487 -0.0490 0.0206  -0.0306 494  LEU A CD1 
107  C CD2 . LEU A 26  ? 1.0872 1.1774 1.1427 -0.0710 -0.0076 -0.0554 494  LEU A CD2 
108  N N   . SER A 27  ? 1.1070 1.3719 1.2526 -0.0522 -0.0526 -0.0357 495  SER A N   
109  C CA  . SER A 27  ? 1.1162 1.4386 1.3061 -0.0623 -0.0697 -0.0302 495  SER A CA  
110  C C   . SER A 27  ? 1.1355 1.4507 1.3096 -0.0741 -0.0986 -0.0439 495  SER A C   
111  O O   . SER A 27  ? 1.1508 1.4985 1.3578 -0.0955 -0.1181 -0.0441 495  SER A O   
112  C CB  . SER A 27  ? 1.1102 1.4803 1.3207 -0.0340 -0.0643 -0.0163 495  SER A CB  
113  O OG  . SER A 27  ? 1.1296 1.4828 1.3040 -0.0121 -0.0753 -0.0214 495  SER A OG  
114  N N   . VAL A 28  ? 1.1390 1.4134 1.2626 -0.0603 -0.1019 -0.0541 496  VAL A N   
115  C CA  . VAL A 28  ? 1.1668 1.4256 1.2625 -0.0681 -0.1263 -0.0683 496  VAL A CA  
116  C C   . VAL A 28  ? 1.1854 1.4149 1.2767 -0.0963 -0.1347 -0.0820 496  VAL A C   
117  O O   . VAL A 28  ? 1.2152 1.4524 1.3117 -0.1142 -0.1605 -0.0908 496  VAL A O   
118  C CB  . VAL A 28  ? 1.1751 1.3939 1.2141 -0.0477 -0.1220 -0.0734 496  VAL A CB  
119  C CG1 . VAL A 28  ? 1.2085 1.4035 1.2091 -0.0554 -0.1426 -0.0895 496  VAL A CG1 
120  C CG2 . VAL A 28  ? 1.1759 1.4163 1.2136 -0.0214 -0.1211 -0.0606 496  VAL A CG2 
121  N N   . LEU A 29  ? 1.1750 1.3680 1.2548 -0.0995 -0.1148 -0.0838 497  LEU A N   
122  C CA  . LEU A 29  ? 1.1986 1.3539 1.2686 -0.1220 -0.1206 -0.0964 497  LEU A CA  
123  C C   . LEU A 29  ? 1.2110 1.3952 1.3303 -0.1509 -0.1327 -0.0902 497  LEU A C   
124  O O   . LEU A 29  ? 1.2477 1.4160 1.3622 -0.1730 -0.1568 -0.1023 497  LEU A O   
125  C CB  . LEU A 29  ? 1.1843 1.2982 1.2334 -0.1151 -0.0958 -0.0968 497  LEU A CB  
126  C CG  . LEU A 29  ? 1.2095 1.2708 1.2325 -0.1279 -0.0987 -0.1119 497  LEU A CG  
127  C CD1 . LEU A 29  ? 1.2499 1.2864 1.2336 -0.1286 -0.1206 -0.1316 497  LEU A CD1 
128  C CD2 . LEU A 29  ? 1.1859 1.2152 1.1853 -0.1122 -0.0746 -0.1107 497  LEU A CD2 
129  N N   . MET A 30  ? 1.1867 1.4130 1.3514 -0.1510 -0.1165 -0.0706 498  MET A N   
130  C CA  . MET A 30  ? 1.1978 1.4663 1.4182 -0.1791 -0.1256 -0.0588 498  MET A CA  
131  C C   . MET A 30  ? 1.2165 1.5207 1.4544 -0.1910 -0.1587 -0.0632 498  MET A C   
132  O O   . MET A 30  ? 1.2542 1.5450 1.4978 -0.2215 -0.1832 -0.0715 498  MET A O   
133  C CB  . MET A 30  ? 1.1694 1.4934 1.4364 -0.1697 -0.1015 -0.0347 498  MET A CB  
134  C CG  . MET A 30  ? 1.1632 1.4613 1.4096 -0.1481 -0.0685 -0.0284 498  MET A CG  
135  S SD  . MET A 30  ? 1.2143 1.4320 1.4180 -0.1577 -0.0580 -0.0397 498  MET A SD  
136  C CE  . MET A 30  ? 1.1709 1.3961 1.3808 -0.1388 -0.0226 -0.0215 498  MET A CE  
137  N N   . ALA A 31  ? 1.1962 1.5407 1.4386 -0.1662 -0.1613 -0.0580 499  ALA A N   
138  C CA  . ALA A 31  ? 1.2111 1.5964 1.4706 -0.1721 -0.1933 -0.0601 499  ALA A CA  
139  C C   . ALA A 31  ? 1.2543 1.5906 1.4694 -0.1880 -0.2235 -0.0834 499  ALA A C   
140  O O   . ALA A 31  ? 1.2820 1.6447 1.5169 -0.2078 -0.2557 -0.0865 499  ALA A O   
141  C CB  . ALA A 31  ? 1.1901 1.6093 1.4452 -0.1360 -0.1897 -0.0526 499  ALA A CB  
142  N N   . SER A 32  ? 1.2618 1.5292 1.4169 -0.1784 -0.2135 -0.0996 500  SER A N   
143  C CA  . SER A 32  ? 1.3092 1.5231 1.4127 -0.1881 -0.2377 -0.1234 500  SER A CA  
144  C C   . SER A 32  ? 1.3464 1.5249 1.4557 -0.2230 -0.2519 -0.1326 500  SER A C   
145  O O   . SER A 32  ? 1.4018 1.5500 1.4832 -0.2385 -0.2828 -0.1508 500  SER A O   
146  C CB  . SER A 32  ? 1.3080 1.4683 1.3467 -0.1617 -0.2197 -0.1354 500  SER A CB  
147  O OG  . SER A 32  ? 1.3056 1.4220 1.3329 -0.1656 -0.1988 -0.1388 500  SER A OG  
148  N N   . LYS A 33  ? 1.3254 1.5022 1.4652 -0.2347 -0.2306 -0.1204 501  LYS A N   
149  C CA  . LYS A 33  ? 1.3625 1.5057 1.5133 -0.2705 -0.2428 -0.1238 501  LYS A CA  
150  C C   . LYS A 33  ? 1.4158 1.4721 1.4987 -0.2722 -0.2564 -0.1515 501  LYS A C   
151  O O   . LYS A 33  ? 1.4720 1.5041 1.5369 -0.2922 -0.2915 -0.1674 501  LYS A O   
152  C CB  . LYS A 33  ? 1.3834 1.5781 1.5907 -0.3059 -0.2733 -0.1139 501  LYS A CB  
153  C CG  . LYS A 33  ? 1.3916 1.5961 1.6489 -0.3411 -0.2686 -0.0962 501  LYS A CG  
154  C CD  . LYS A 33  ? 1.3407 1.6177 1.6558 -0.3299 -0.2353 -0.0666 501  LYS A CD  
155  C CE  . LYS A 33  ? 1.3204 1.6897 1.6886 -0.3251 -0.2459 -0.0519 501  LYS A CE  
156  N NZ  . LYS A 33  ? 1.3587 1.7652 1.7758 -0.3687 -0.2820 -0.0456 501  LYS A NZ  
157  N N   . PRO A 34  ? 1.4014 1.4107 1.4456 -0.2503 -0.2296 -0.1573 502  PRO A N   
158  C CA  . PRO A 34  ? 1.4479 1.3824 1.4233 -0.2400 -0.2372 -0.1835 502  PRO A CA  
159  C C   . PRO A 34  ? 1.5047 1.3784 1.4684 -0.2686 -0.2560 -0.1945 502  PRO A C   
160  O O   . PRO A 34  ? 1.4927 1.3656 1.4920 -0.2879 -0.2458 -0.1792 502  PRO A O   
161  C CB  . PRO A 34  ? 1.4094 1.3293 1.3619 -0.2078 -0.2004 -0.1802 502  PRO A CB  
162  C CG  . PRO A 34  ? 1.3584 1.3177 1.3650 -0.2136 -0.1772 -0.1550 502  PRO A CG  
163  C CD  . PRO A 34  ? 1.3483 1.3722 1.4120 -0.2345 -0.1921 -0.1395 502  PRO A CD  
164  N N   . LYS A 35  ? 1.5690 1.3888 1.4785 -0.2701 -0.2839 -0.2208 503  LYS A N   
165  C CA  . LYS A 35  ? 1.6399 1.3855 1.5226 -0.2946 -0.3080 -0.2367 503  LYS A CA  
166  C C   . LYS A 35  ? 1.6440 1.3304 1.4987 -0.2795 -0.2828 -0.2399 503  LYS A C   
167  O O   . LYS A 35  ? 1.6763 1.3249 1.5435 -0.3053 -0.2892 -0.2351 503  LYS A O   
168  C CB  . LYS A 35  ? 1.7169 1.4134 1.5352 -0.2913 -0.3429 -0.2674 503  LYS A CB  
169  C CG  . LYS A 35  ? 1.8065 1.4137 1.5860 -0.3145 -0.3724 -0.2877 503  LYS A CG  
170  C CD  . LYS A 35  ? 1.8871 1.4332 1.5842 -0.2988 -0.4005 -0.3223 503  LYS A CD  
171  C CE  . LYS A 35  ? 1.9907 1.4348 1.6403 -0.3174 -0.4289 -0.3444 503  LYS A CE  
172  N NZ  . LYS A 35  ? 2.0803 1.4615 1.6470 -0.3053 -0.4623 -0.3796 503  LYS A NZ  
173  N N   . GLU A 36  ? 1.6102 1.2902 1.4287 -0.2389 -0.2553 -0.2460 504  GLU A N   
174  C CA  . GLU A 36  ? 1.6082 1.2401 1.4020 -0.2199 -0.2312 -0.2482 504  GLU A CA  
175  C C   . GLU A 36  ? 1.5223 1.2002 1.3377 -0.1935 -0.1921 -0.2299 504  GLU A C   
176  O O   . GLU A 36  ? 1.4631 1.2079 1.3184 -0.1938 -0.1829 -0.2127 504  GLU A O   
177  C CB  . GLU A 36  ? 1.6819 1.2392 1.3978 -0.1963 -0.2410 -0.2789 504  GLU A CB  
178  C CG  . GLU A 36  ? 1.7827 1.2621 1.4719 -0.2225 -0.2740 -0.2956 504  GLU A CG  
179  C CD  . GLU A 36  ? 1.8855 1.3071 1.4993 -0.2073 -0.2996 -0.3290 504  GLU A CD  
180  O OE1 . GLU A 36  ? 1.8818 1.3253 1.4630 -0.1729 -0.2861 -0.3378 504  GLU A OE1 
181  O OE2 . GLU A 36  ? 1.9737 1.3263 1.5582 -0.2299 -0.3336 -0.3460 504  GLU A OE2 
182  N N   . VAL A 37  ? 1.5183 1.1585 1.3070 -0.1707 -0.1712 -0.2334 505  VAL A N   
183  C CA  . VAL A 37  ? 1.4445 1.1209 1.2497 -0.1470 -0.1372 -0.2172 505  VAL A CA  
184  C C   . VAL A 37  ? 1.4097 1.1283 1.2013 -0.1226 -0.1281 -0.2187 505  VAL A C   
185  O O   . VAL A 37  ? 1.4498 1.1480 1.1954 -0.1082 -0.1384 -0.2379 505  VAL A O   
186  C CB  . VAL A 37  ? 1.4640 1.0897 1.2408 -0.1270 -0.1213 -0.2223 505  VAL A CB  
187  C CG1 . VAL A 37  ? 1.4172 1.0724 1.1875 -0.0938 -0.0930 -0.2161 505  VAL A CG1 
188  C CG2 . VAL A 37  ? 1.4577 1.0670 1.2661 -0.1486 -0.1176 -0.2062 505  VAL A CG2 
189  N N   . THR A 38  ? 1.3379 1.1116 1.1660 -0.1180 -0.1093 -0.1979 506  THR A N   
190  C CA  . THR A 38  ? 1.3009 1.1167 1.1227 -0.1006 -0.1027 -0.1941 506  THR A CA  
191  C C   . THR A 38  ? 1.2420 1.0807 1.0728 -0.0809 -0.0741 -0.1786 506  THR A C   
192  O O   . THR A 38  ? 1.2163 1.0572 1.0737 -0.0851 -0.0608 -0.1656 506  THR A O   
193  C CB  . THR A 38  ? 1.2830 1.1468 1.1403 -0.1178 -0.1180 -0.1842 506  THR A CB  
194  O OG1 . THR A 38  ? 1.3323 1.1779 1.1881 -0.1413 -0.1478 -0.1965 506  THR A OG1 
195  C CG2 . THR A 38  ? 1.2700 1.1657 1.1109 -0.0998 -0.1169 -0.1825 506  THR A CG2 
196  N N   . THR A 39  ? 1.2264 1.0813 1.0334 -0.0608 -0.0660 -0.1791 507  THR A N   
197  C CA  . THR A 39  ? 1.1777 1.0534 0.9910 -0.0450 -0.0428 -0.1642 507  THR A CA  
198  C C   . THR A 39  ? 1.1428 1.0592 0.9670 -0.0426 -0.0421 -0.1506 507  THR A C   
199  O O   . THR A 39  ? 1.1625 1.0873 0.9635 -0.0377 -0.0518 -0.1560 507  THR A O   
200  C CB  . THR A 39  ? 1.2010 1.0596 0.9761 -0.0224 -0.0307 -0.1729 507  THR A CB  
201  O OG1 . THR A 39  ? 1.2258 1.0454 0.9924 -0.0194 -0.0282 -0.1826 507  THR A OG1 
202  C CG2 . THR A 39  ? 1.1623 1.0498 0.9450 -0.0100 -0.0107 -0.1556 507  THR A CG2 
203  N N   . VAL A 40  ? 1.0962 1.0328 0.9505 -0.0443 -0.0311 -0.1332 508  VAL A N   
204  C CA  . VAL A 40  ? 1.0638 1.0310 0.9271 -0.0398 -0.0302 -0.1192 508  VAL A CA  
205  C C   . VAL A 40  ? 1.0344 1.0049 0.8996 -0.0302 -0.0127 -0.1049 508  VAL A C   
206  O O   . VAL A 40  ? 1.0319 0.9876 0.8998 -0.0283 -0.0013 -0.1040 508  VAL A O   
207  C CB  . VAL A 40  ? 1.0451 1.0350 0.9446 -0.0510 -0.0380 -0.1116 508  VAL A CB  
208  C CG1 . VAL A 40  ? 1.0765 1.0742 0.9775 -0.0621 -0.0600 -0.1220 508  VAL A CG1 
209  C CG2 . VAL A 40  ? 1.0295 1.0110 0.9550 -0.0600 -0.0286 -0.1067 508  VAL A CG2 
210  N N   . LYS A 41  ? 1.0179 1.0050 0.8804 -0.0244 -0.0129 -0.0933 509  LYS A N   
211  C CA  . LYS A 41  ? 0.9883 0.9754 0.8567 -0.0194 -0.0017 -0.0785 509  LYS A CA  
212  C C   . LYS A 41  ? 0.9709 0.9712 0.8572 -0.0183 -0.0063 -0.0694 509  LYS A C   
213  O O   . LYS A 41  ? 0.9819 0.9955 0.8637 -0.0148 -0.0166 -0.0673 509  LYS A O   
214  C CB  . LYS A 41  ? 0.9935 0.9814 0.8376 -0.0127 0.0025  -0.0703 509  LYS A CB  
215  C CG  . LYS A 41  ? 0.9928 0.9742 0.8285 -0.0101 0.0147  -0.0706 509  LYS A CG  
216  C CD  . LYS A 41  ? 0.9929 0.9819 0.8143 -0.0079 0.0194  -0.0559 509  LYS A CD  
217  C CE  . LYS A 41  ? 1.0257 1.0250 0.8203 -0.0036 0.0172  -0.0578 509  LYS A CE  
218  N NZ  . LYS A 41  ? 1.0377 1.0423 0.8202 -0.0054 0.0164  -0.0392 509  LYS A NZ  
219  N N   . VAL A 42  ? 0.9485 0.9454 0.8530 -0.0188 0.0016  -0.0637 510  VAL A N   
220  C CA  . VAL A 42  ? 0.9384 0.9462 0.8537 -0.0115 0.0007  -0.0541 510  VAL A CA  
221  C C   . VAL A 42  ? 0.9339 0.9215 0.8328 -0.0041 0.0075  -0.0445 510  VAL A C   
222  O O   . VAL A 42  ? 0.9258 0.8986 0.8163 -0.0078 0.0136  -0.0448 510  VAL A O   
223  C CB  . VAL A 42  ? 0.9300 0.9520 0.8757 -0.0162 0.0047  -0.0533 510  VAL A CB  
224  C CG1 . VAL A 42  ? 0.9303 0.9760 0.8949 -0.0264 -0.0073 -0.0601 510  VAL A CG1 
225  C CG2 . VAL A 42  ? 0.9204 0.9233 0.8691 -0.0232 0.0152  -0.0552 510  VAL A CG2 
226  N N   . LYS A 43  ? 0.9436 0.9292 0.8361 0.0068  0.0045  -0.0362 511  LYS A N   
227  C CA  . LYS A 43  ? 0.9534 0.9132 0.8309 0.0126  0.0089  -0.0283 511  LYS A CA  
228  C C   . LYS A 43  ? 0.9543 0.9167 0.8448 0.0213  0.0160  -0.0267 511  LYS A C   
229  O O   . LYS A 43  ? 0.9678 0.9390 0.8599 0.0352  0.0138  -0.0232 511  LYS A O   
230  C CB  . LYS A 43  ? 0.9726 0.9145 0.8241 0.0200  -0.0001 -0.0197 511  LYS A CB  
231  C CG  . LYS A 43  ? 0.9870 0.8952 0.8200 0.0238  0.0005  -0.0129 511  LYS A CG  
232  C CD  . LYS A 43  ? 1.0232 0.9052 0.8288 0.0339  -0.0105 -0.0046 511  LYS A CD  
233  C CE  . LYS A 43  ? 1.0454 0.8869 0.8287 0.0385  -0.0129 -0.0006 511  LYS A CE  
234  N NZ  . LYS A 43  ? 1.0475 0.8825 0.8275 0.0601  -0.0088 -0.0039 511  LYS A NZ  
235  N N   . ALA A 44  ? 0.9463 0.9019 0.8444 0.0152  0.0253  -0.0284 512  ALA A N   
236  C CA  . ALA A 44  ? 0.9434 0.9062 0.8551 0.0210  0.0352  -0.0259 512  ALA A CA  
237  C C   . ALA A 44  ? 0.9524 0.8852 0.8438 0.0277  0.0408  -0.0218 512  ALA A C   
238  O O   . ALA A 44  ? 0.9595 0.8675 0.8319 0.0237  0.0358  -0.0212 512  ALA A O   
239  C CB  . ALA A 44  ? 0.9310 0.9114 0.8688 0.0070  0.0403  -0.0300 512  ALA A CB  
240  N N   . PHE A 45  ? 0.9543 0.8923 0.8500 0.0378  0.0509  -0.0181 513  PHE A N   
241  C CA  . PHE A 45  ? 0.9619 0.8720 0.8367 0.0440  0.0569  -0.0152 513  PHE A CA  
242  C C   . PHE A 45  ? 0.9553 0.8799 0.8485 0.0393  0.0708  -0.0121 513  PHE A C   
243  O O   . PHE A 45  ? 0.9464 0.9053 0.8689 0.0349  0.0767  -0.0100 513  PHE A O   
244  C CB  . PHE A 45  ? 0.9913 0.8816 0.8374 0.0664  0.0556  -0.0126 513  PHE A CB  
245  C CG  . PHE A 45  ? 0.9969 0.9156 0.8552 0.0837  0.0680  -0.0087 513  PHE A CG  
246  C CD1 . PHE A 45  ? 1.0007 0.9548 0.8816 0.0893  0.0659  -0.0078 513  PHE A CD1 
247  C CD2 . PHE A 45  ? 1.0167 0.9296 0.8631 0.0961  0.0817  -0.0046 513  PHE A CD2 
248  C CE1 . PHE A 45  ? 1.0100 0.9997 0.9079 0.1067  0.0780  -0.0021 513  PHE A CE1 
249  C CE2 . PHE A 45  ? 1.0327 0.9793 0.8923 0.1140  0.0962  0.0014  513  PHE A CE2 
250  C CZ  . PHE A 45  ? 1.0288 1.0166 0.9169 0.1194  0.0945  0.0030  513  PHE A CZ  
251  N N   . ILE A 46  ? 0.9618 0.8604 0.8382 0.0385  0.0746  -0.0103 514  ILE A N   
252  C CA  . ILE A 46  ? 0.9620 0.8675 0.8494 0.0344  0.0881  -0.0047 514  ILE A CA  
253  C C   . ILE A 46  ? 0.9768 0.8926 0.8563 0.0530  0.1009  0.0025  514  ILE A C   
254  O O   . ILE A 46  ? 1.0047 0.8945 0.8498 0.0709  0.0989  0.0018  514  ILE A O   
255  C CB  . ILE A 46  ? 0.9694 0.8425 0.8374 0.0307  0.0870  -0.0040 514  ILE A CB  
256  C CG1 . ILE A 46  ? 0.9580 0.8258 0.8354 0.0162  0.0770  -0.0103 514  ILE A CG1 
257  C CG2 . ILE A 46  ? 0.9822 0.8589 0.8566 0.0281  0.1016  0.0044  514  ILE A CG2 
258  C CD1 . ILE A 46  ? 0.9696 0.8172 0.8414 0.0113  0.0781  -0.0085 514  ILE A CD1 
259  N N   . VAL A 47  ? 0.9659 0.9196 0.8757 0.0493  0.1134  0.0098  515  VAL A N   
260  C CA  . VAL A 47  ? 0.9817 0.9531 0.8860 0.0692  0.1301  0.0192  515  VAL A CA  
261  C C   . VAL A 47  ? 1.0001 0.9467 0.8806 0.0711  0.1416  0.0260  515  VAL A C   
262  O O   . VAL A 47  ? 1.0246 0.9398 0.8632 0.0909  0.1425  0.0246  515  VAL A O   
263  C CB  . VAL A 47  ? 0.9717 1.0028 0.9223 0.0646  0.1402  0.0282  515  VAL A CB  
264  C CG1 . VAL A 47  ? 0.9903 1.0468 0.9374 0.0862  0.1622  0.0409  515  VAL A CG1 
265  C CG2 . VAL A 47  ? 0.9496 1.0024 0.9157 0.0689  0.1273  0.0216  515  VAL A CG2 
266  N N   . THR A 48  ? 0.9891 0.9444 0.8920 0.0503  0.1480  0.0332  516  THR A N   
267  C CA  . THR A 48  ? 1.0067 0.9372 0.8865 0.0509  0.1579  0.0415  516  THR A CA  
268  C C   . THR A 48  ? 0.9997 0.9061 0.8868 0.0284  0.1479  0.0384  516  THR A C   
269  O O   . THR A 48  ? 0.9788 0.8910 0.8883 0.0139  0.1355  0.0296  516  THR A O   
270  C CB  . THR A 48  ? 1.0188 0.9849 0.9157 0.0515  0.1812  0.0594  516  THR A CB  
271  O OG1 . THR A 48  ? 1.0311 0.9680 0.8990 0.0528  0.1902  0.0683  516  THR A OG1 
272  C CG2 . THR A 48  ? 0.9975 1.0009 0.9471 0.0233  0.1818  0.0660  516  THR A CG2 
273  N N   . LEU A 49  ? 1.0198 0.8979 0.8844 0.0282  0.1528  0.0452  517  LEU A N   
274  C CA  . LEU A 49  ? 1.0229 0.8814 0.8972 0.0089  0.1471  0.0460  517  LEU A CA  
275  C C   . LEU A 49  ? 1.0441 0.9205 0.9389 -0.0051 0.1632  0.0629  517  LEU A C   
276  O O   . LEU A 49  ? 1.0732 0.9555 0.9524 0.0052  0.1799  0.0767  517  LEU A O   
277  C CB  . LEU A 49  ? 1.0382 0.8537 0.8759 0.0171  0.1401  0.0447  517  LEU A CB  
278  C CG  . LEU A 49  ? 1.0236 0.8193 0.8442 0.0248  0.1216  0.0312  517  LEU A CG  
279  C CD1 . LEU A 49  ? 1.0347 0.7962 0.8217 0.0332  0.1166  0.0346  517  LEU A CD1 
280  C CD2 . LEU A 49  ? 1.0061 0.8055 0.8512 0.0115  0.1094  0.0209  517  LEU A CD2 
281  N N   . THR A 50  ? 1.0390 0.9233 0.9664 -0.0289 0.1581  0.0629  518  THR A N   
282  C CA  . THR A 50  ? 1.0580 0.9600 1.0089 -0.0479 0.1712  0.0815  518  THR A CA  
283  C C   . THR A 50  ? 1.0910 0.9499 1.0223 -0.0569 0.1731  0.0916  518  THR A C   
284  O O   . THR A 50  ? 1.1184 0.9846 1.0629 -0.0737 0.1847  0.1107  518  THR A O   
285  C CB  . THR A 50  ? 1.0436 0.9768 1.0401 -0.0724 0.1636  0.0796  518  THR A CB  
286  O OG1 . THR A 50  ? 1.0325 0.9330 1.0274 -0.0829 0.1435  0.0626  518  THR A OG1 
287  C CG2 . THR A 50  ? 1.0207 1.0024 1.0369 -0.0609 0.1645  0.0748  518  THR A CG2 
288  N N   . GLY A 51  ? 1.0917 0.9077 0.9921 -0.0457 0.1616  0.0810  519  GLY A N   
289  C CA  . GLY A 51  ? 1.1255 0.8979 1.0058 -0.0510 0.1606  0.0897  519  GLY A CA  
290  C C   . GLY A 51  ? 1.1319 0.8680 0.9746 -0.0309 0.1517  0.0828  519  GLY A C   
291  O O   . GLY A 51  ? 1.1067 0.8486 0.9403 -0.0159 0.1433  0.0694  519  GLY A O   
292  N N   . ASN A 52  ? 1.1710 0.8695 0.9925 -0.0320 0.1521  0.0937  520  ASN A N   
293  C CA  . ASN A 52  ? 1.1882 0.8523 0.9771 -0.0144 0.1410  0.0894  520  ASN A CA  
294  C C   . ASN A 52  ? 1.1670 0.8233 0.9672 -0.0118 0.1226  0.0700  520  ASN A C   
295  O O   . ASN A 52  ? 1.1656 0.8239 0.9902 -0.0255 0.1183  0.0624  520  ASN A O   
296  C CB  . ASN A 52  ? 1.2381 0.8617 1.0052 -0.0176 0.1437  0.1060  520  ASN A CB  
297  C CG  . ASN A 52  ? 1.2849 0.9122 1.0309 -0.0163 0.1632  0.1283  520  ASN A CG  
298  O OD1 . ASN A 52  ? 1.3494 0.9658 1.0991 -0.0327 0.1736  0.1469  520  ASN A OD1 
299  N ND2 . ASN A 52  ? 1.2949 0.9343 1.0152 0.0034  0.1680  0.1275  520  ASN A ND2 
300  N N   . LEU A 53  ? 1.1587 0.8072 0.9408 0.0055  0.1112  0.0628  521  LEU A N   
301  C CA  . LEU A 53  ? 1.1474 0.7900 0.9389 0.0104  0.0961  0.0489  521  LEU A CA  
302  C C   . LEU A 53  ? 1.1901 0.7943 0.9734 0.0110  0.0922  0.0539  521  LEU A C   
303  O O   . LEU A 53  ? 1.2228 0.8010 0.9808 0.0190  0.0922  0.0663  521  LEU A O   
304  C CB  . LEU A 53  ? 1.1297 0.7796 0.9088 0.0260  0.0840  0.0433  521  LEU A CB  
305  C CG  . LEU A 53  ? 1.1055 0.7567 0.8959 0.0339  0.0703  0.0333  521  LEU A CG  
306  C CD1 . LEU A 53  ? 1.0576 0.7297 0.8749 0.0262  0.0705  0.0199  521  LEU A CD1 
307  C CD2 . LEU A 53  ? 1.0788 0.7416 0.8609 0.0449  0.0570  0.0322  521  LEU A CD2 
308  N N   . SER A 54  ? 1.1999 0.7965 1.0002 0.0040  0.0877  0.0437  522  SER A N   
309  C CA  . SER A 54  ? 1.2512 0.8040 1.0408 0.0067  0.0820  0.0456  522  SER A CA  
310  C C   . SER A 54  ? 1.2494 0.7998 1.0387 0.0273  0.0696  0.0322  522  SER A C   
311  O O   . SER A 54  ? 1.2104 0.7941 1.0159 0.0316  0.0664  0.0192  522  SER A O   
312  C CB  . SER A 54  ? 1.2752 0.8107 1.0773 -0.0151 0.0839  0.0440  522  SER A CB  
313  O OG  . SER A 54  ? 1.3261 0.8112 1.1141 -0.0110 0.0750  0.0415  522  SER A OG  
314  N N   . SER A 55  ? 1.2980 0.8104 1.0685 0.0410  0.0635  0.0377  523  SER A N   
315  C CA  . SER A 55  ? 1.3079 0.8179 1.0783 0.0649  0.0530  0.0278  523  SER A CA  
316  C C   . SER A 55  ? 1.3634 0.8199 1.1197 0.0703  0.0486  0.0244  523  SER A C   
317  O O   . SER A 55  ? 1.3839 0.8266 1.1329 0.0951  0.0407  0.0193  523  SER A O   
318  C CB  . SER A 55  ? 1.3116 0.8275 1.0700 0.0835  0.0460  0.0381  523  SER A CB  
319  O OG  . SER A 55  ? 1.3540 0.8211 1.0862 0.0909  0.0432  0.0512  523  SER A OG  
320  N N   . SER A 56  ? 1.3911 0.8173 1.1436 0.0470  0.0528  0.0282  524  SER A N   
321  C CA  . SER A 56  ? 1.4558 0.8195 1.1897 0.0466  0.0463  0.0267  524  SER A CA  
322  C C   . SER A 56  ? 1.4574 0.8186 1.1964 0.0555  0.0397  0.0028  524  SER A C   
323  O O   . SER A 56  ? 1.4126 0.8194 1.1727 0.0494  0.0427  -0.0093 524  SER A O   
324  C CB  . SER A 56  ? 1.4843 0.8206 1.2160 0.0136  0.0515  0.0408  524  SER A CB  
325  O OG  . SER A 56  ? 1.4559 0.8305 1.2140 -0.0091 0.0562  0.0330  524  SER A OG  
326  N N   . GLY A 57  ? 1.5152 0.8197 1.2304 0.0721  0.0305  -0.0037 525  GLY A N   
327  C CA  . GLY A 57  ? 1.5281 0.8213 1.2378 0.0879  0.0242  -0.0275 525  GLY A CA  
328  C C   . GLY A 57  ? 1.4934 0.8339 1.2129 0.1227  0.0261  -0.0361 525  GLY A C   
329  O O   . GLY A 57  ? 1.5002 0.8492 1.2184 0.1396  0.0249  -0.0551 525  GLY A O   
330  N N   . GLY A 58  ? 1.4618 0.8347 1.1906 0.1331  0.0285  -0.0212 526  GLY A N   
331  C CA  . GLY A 58  ? 1.4288 0.8534 1.1731 0.1625  0.0287  -0.0250 526  GLY A CA  
332  C C   . GLY A 58  ? 1.3599 0.8557 1.1340 0.1528  0.0352  -0.0309 526  GLY A C   
333  O O   . GLY A 58  ? 1.3399 0.8830 1.1304 0.1734  0.0358  -0.0341 526  GLY A O   
334  N N   . ILE A 59  ? 1.3271 0.8321 1.1093 0.1217  0.0398  -0.0307 527  ILE A N   
335  C CA  . ILE A 59  ? 1.2579 0.8226 1.0644 0.1101  0.0449  -0.0349 527  ILE A CA  
336  C C   . ILE A 59  ? 1.2250 0.8024 1.0388 0.0824  0.0490  -0.0232 527  ILE A C   
337  O O   . ILE A 59  ? 1.2480 0.7896 1.0498 0.0684  0.0502  -0.0136 527  ILE A O   
338  C CB  . ILE A 59  ? 1.2571 0.8273 1.0647 0.1092  0.0466  -0.0543 527  ILE A CB  
339  C CG1 . ILE A 59  ? 1.2945 0.8050 1.0819 0.0956  0.0422  -0.0625 527  ILE A CG1 
340  C CG2 . ILE A 59  ? 1.2672 0.8559 1.0742 0.1416  0.0471  -0.0643 527  ILE A CG2 
341  C CD1 . ILE A 59  ? 1.2734 0.7855 1.0708 0.0605  0.0439  -0.0565 527  ILE A CD1 
342  N N   . TRP A 60  ? 1.1706 0.7979 1.0023 0.0760  0.0515  -0.0229 528  TRP A N   
343  C CA  . TRP A 60  ? 1.1397 0.7807 0.9759 0.0551  0.0558  -0.0143 528  TRP A CA  
344  C C   . TRP A 60  ? 1.1298 0.7691 0.9727 0.0346  0.0602  -0.0213 528  TRP A C   
345  O O   . TRP A 60  ? 1.1295 0.7725 0.9766 0.0354  0.0583  -0.0352 528  TRP A O   
346  C CB  . TRP A 60  ? 1.0980 0.7844 0.9463 0.0559  0.0541  -0.0116 528  TRP A CB  
347  C CG  . TRP A 60  ? 1.1063 0.8074 0.9556 0.0726  0.0463  -0.0052 528  TRP A CG  
348  C CD1 . TRP A 60  ? 1.1038 0.8414 0.9696 0.0836  0.0425  -0.0088 528  TRP A CD1 
349  C CD2 . TRP A 60  ? 1.1406 0.8254 0.9754 0.0788  0.0404  0.0075  528  TRP A CD2 
350  N NE1 . TRP A 60  ? 1.1105 0.8586 0.9778 0.0950  0.0332  0.0011  528  TRP A NE1 
351  C CE2 . TRP A 60  ? 1.1403 0.8538 0.9865 0.0929  0.0306  0.0103  528  TRP A CE2 
352  C CE3 . TRP A 60  ? 1.1734 0.8239 0.9860 0.0741  0.0426  0.0182  528  TRP A CE3 
353  C CZ2 . TRP A 60  ? 1.1646 0.8715 1.0002 0.1021  0.0197  0.0218  528  TRP A CZ2 
354  C CZ3 . TRP A 60  ? 1.1935 0.8340 0.9903 0.0849  0.0337  0.0294  528  TRP A CZ3 
355  C CH2 . TRP A 60  ? 1.1897 0.8574 0.9979 0.0987  0.0209  0.0303  528  TRP A CH2 
356  N N   . SER A 61  ? 1.1251 0.7619 0.9686 0.0175  0.0658  -0.0109 529  SER A N   
357  C CA  . SER A 61  ? 1.1169 0.7645 0.9734 -0.0030 0.0694  -0.0140 529  SER A CA  
358  C C   . SER A 61  ? 1.1007 0.7675 0.9609 -0.0124 0.0781  -0.0003 529  SER A C   
359  O O   . SER A 61  ? 1.1191 0.7724 0.9648 -0.0073 0.0818  0.0127  529  SER A O   
360  C CB  . SER A 61  ? 1.1619 0.7691 1.0138 -0.0160 0.0667  -0.0149 529  SER A CB  
361  O OG  . SER A 61  ? 1.1983 0.7713 1.0354 -0.0168 0.0696  0.0008  529  SER A OG  
362  N N   . ILE A 62  ? 1.0734 0.7713 0.9501 -0.0234 0.0813  -0.0029 530  ILE A N   
363  C CA  . ILE A 62  ? 1.0607 0.7782 0.9405 -0.0289 0.0914  0.0097  530  ILE A CA  
364  C C   . ILE A 62  ? 1.0512 0.7998 0.9546 -0.0432 0.0940  0.0072  530  ILE A C   
365  O O   . ILE A 62  ? 1.0358 0.8016 0.9491 -0.0434 0.0869  -0.0056 530  ILE A O   
366  C CB  . ILE A 62  ? 1.0377 0.7682 0.9035 -0.0133 0.0916  0.0120  530  ILE A CB  
367  C CG1 . ILE A 62  ? 1.0358 0.7739 0.8928 -0.0127 0.1035  0.0256  530  ILE A CG1 
368  C CG2 . ILE A 62  ? 1.0026 0.7597 0.8776 -0.0097 0.0849  0.0001  530  ILE A CG2 
369  C CD1 . ILE A 62  ? 1.0255 0.7575 0.8559 0.0035  0.1011  0.0286  530  ILE A CD1 
370  N N   . THR A 63  ? 1.0673 0.8264 0.9806 -0.0548 0.1043  0.0211  531  THR A N   
371  C CA  . THR A 63  ? 1.0552 0.8524 0.9957 -0.0671 0.1068  0.0217  531  THR A CA  
372  C C   . THR A 63  ? 1.0326 0.8638 0.9723 -0.0531 0.1157  0.0261  531  THR A C   
373  O O   . THR A 63  ? 1.0400 0.8722 0.9663 -0.0444 0.1281  0.0390  531  THR A O   
374  C CB  . THR A 63  ? 1.0833 0.8808 1.0432 -0.0909 0.1119  0.0353  531  THR A CB  
375  O OG1 . THR A 63  ? 1.1103 0.9088 1.0612 -0.0881 0.1283  0.0554  531  THR A OG1 
376  C CG2 . THR A 63  ? 1.1155 0.8659 1.0673 -0.1027 0.1002  0.0295  531  THR A CG2 
377  N N   . ALA A 64  ? 1.0085 0.8629 0.9572 -0.0487 0.1086  0.0149  532  ALA A N   
378  C CA  . ALA A 64  ? 0.9987 0.8824 0.9475 -0.0356 0.1148  0.0181  532  ALA A CA  
379  C C   . ALA A 64  ? 0.9907 0.9148 0.9719 -0.0454 0.1133  0.0175  532  ALA A C   
380  O O   . ALA A 64  ? 0.9908 0.9166 0.9899 -0.0622 0.1032  0.0106  532  ALA A O   
381  C CB  . ALA A 64  ? 0.9844 0.8572 0.9111 -0.0196 0.1061  0.0080  532  ALA A CB  
382  N N   . LYS A 65  ? 0.9917 0.9475 0.9785 -0.0332 0.1227  0.0246  533  LYS A N   
383  C CA  . LYS A 65  ? 0.9859 0.9853 1.0027 -0.0364 0.1196  0.0240  533  LYS A CA  
384  C C   . LYS A 65  ? 0.9711 0.9701 0.9697 -0.0161 0.1121  0.0142  533  LYS A C   
385  O O   . LYS A 65  ? 0.9804 0.9654 0.9513 0.0042  0.1180  0.0161  533  LYS A O   
386  C CB  . LYS A 65  ? 0.9993 1.0412 1.0397 -0.0354 0.1367  0.0417  533  LYS A CB  
387  C CG  . LYS A 65  ? 1.0054 1.1020 1.0844 -0.0387 0.1331  0.0438  533  LYS A CG  
388  C CD  . LYS A 65  ? 1.0482 1.1923 1.1656 -0.0516 0.1484  0.0645  533  LYS A CD  
389  C CE  . LYS A 65  ? 1.0670 1.2152 1.2177 -0.0890 0.1364  0.0669  533  LYS A CE  
390  N NZ  . LYS A 65  ? 1.0995 1.2835 1.2843 -0.1084 0.1516  0.0910  533  LYS A NZ  
391  N N   . VAL A 66  ? 0.9566 0.9655 0.9663 -0.0223 0.0977  0.0039  534  VAL A N   
392  C CA  . VAL A 66  ? 0.9473 0.9531 0.9395 -0.0065 0.0888  -0.0037 534  VAL A CA  
393  C C   . VAL A 66  ? 0.9444 0.9930 0.9613 -0.0027 0.0848  -0.0021 534  VAL A C   
394  O O   . VAL A 66  ? 0.9471 1.0321 0.9982 -0.0138 0.0886  0.0051  534  VAL A O   
395  C CB  . VAL A 66  ? 0.9385 0.9175 0.9152 -0.0131 0.0753  -0.0159 534  VAL A CB  
396  C CG1 . VAL A 66  ? 0.9381 0.8807 0.8933 -0.0132 0.0784  -0.0163 534  VAL A CG1 
397  C CG2 . VAL A 66  ? 0.9399 0.9309 0.9375 -0.0315 0.0655  -0.0233 534  VAL A CG2 
398  N N   . SER A 67  ? 0.9412 0.9861 0.9415 0.0122  0.0762  -0.0071 535  SER A N   
399  C CA  . SER A 67  ? 0.9417 1.0243 0.9607 0.0207  0.0704  -0.0055 535  SER A CA  
400  C C   . SER A 67  ? 0.9469 1.0102 0.9411 0.0292  0.0560  -0.0130 535  SER A C   
401  O O   . SER A 67  ? 0.9532 0.9771 0.9154 0.0328  0.0540  -0.0162 535  SER A O   
402  C CB  . SER A 67  ? 0.9505 1.0566 0.9730 0.0438  0.0843  0.0050  535  SER A CB  
403  O OG  . SER A 67  ? 0.9575 1.0948 0.9914 0.0591  0.0772  0.0061  535  SER A OG  
404  N N   . ASP A 68  ? 0.9489 1.0417 0.9588 0.0311  0.0451  -0.0140 536  ASP A N   
405  C CA  . ASP A 68  ? 0.9553 1.0329 0.9417 0.0391  0.0310  -0.0185 536  ASP A CA  
406  C C   . ASP A 68  ? 0.9667 1.0726 0.9606 0.0606  0.0266  -0.0129 536  ASP A C   
407  O O   . ASP A 68  ? 0.9774 1.0767 0.9556 0.0677  0.0132  -0.0145 536  ASP A O   
408  C CB  . ASP A 68  ? 0.9500 1.0296 0.9403 0.0195  0.0181  -0.0271 536  ASP A CB  
409  C CG  . ASP A 68  ? 0.9579 1.0818 0.9804 0.0134  0.0077  -0.0274 536  ASP A CG  
410  O OD1 . ASP A 68  ? 0.9640 1.1228 1.0207 0.0106  0.0140  -0.0209 536  ASP A OD1 
411  O OD2 . ASP A 68  ? 0.9850 1.1115 0.9990 0.0109  -0.0074 -0.0328 536  ASP A OD2 
412  N N   . GLY A 69  ? 0.9674 1.1065 0.9850 0.0724  0.0386  -0.0051 537  GLY A N   
413  C CA  . GLY A 69  ? 0.9850 1.1552 1.0114 0.0985  0.0368  0.0010  537  GLY A CA  
414  C C   . GLY A 69  ? 0.9814 1.2152 1.0571 0.0894  0.0295  0.0049  537  GLY A C   
415  O O   . GLY A 69  ? 0.9921 1.2701 1.0904 0.1105  0.0326  0.0132  537  GLY A O   
416  N N   . THR A 70  ? 0.9733 1.2122 1.0651 0.0590  0.0187  -0.0012 538  THR A N   
417  C CA  . THR A 70  ? 0.9708 1.2660 1.1091 0.0436  0.0070  0.0015  538  THR A CA  
418  C C   . THR A 70  ? 0.9654 1.2908 1.1448 0.0192  0.0173  0.0081  538  THR A C   
419  O O   . THR A 70  ? 0.9648 1.3514 1.1923 0.0133  0.0152  0.0180  538  THR A O   
420  C CB  . THR A 70  ? 0.9744 1.2566 1.1015 0.0261  -0.0168 -0.0101 538  THR A CB  
421  O OG1 . THR A 70  ? 0.9652 1.2032 1.0710 0.0041  -0.0160 -0.0204 538  THR A OG1 
422  C CG2 . THR A 70  ? 0.9827 1.2434 1.0738 0.0486  -0.0273 -0.0123 538  THR A CG2 
423  N N   . ALA A 71  ? 0.9626 1.2464 1.1241 0.0047  0.0276  0.0044  539  ALA A N   
424  C CA  . ALA A 71  ? 0.9627 1.2623 1.1549 -0.0195 0.0373  0.0119  539  ALA A CA  
425  C C   . ALA A 71  ? 0.9646 1.2207 1.1282 -0.0155 0.0568  0.0134  539  ALA A C   
426  O O   . ALA A 71  ? 0.9658 1.1811 1.0880 0.0039  0.0603  0.0076  539  ALA A O   
427  C CB  . ALA A 71  ? 0.9684 1.2586 1.1714 -0.0531 0.0180  0.0025  539  ALA A CB  
428  N N   . TYR A 72  ? 0.9683 1.2334 1.1541 -0.0348 0.0680  0.0228  540  TYR A N   
429  C CA  . TYR A 72  ? 0.9749 1.1928 1.1326 -0.0375 0.0816  0.0231  540  TYR A CA  
430  C C   . TYR A 72  ? 0.9836 1.1670 1.1390 -0.0676 0.0692  0.0141  540  TYR A C   
431  O O   . TYR A 72  ? 0.9884 1.1918 1.1715 -0.0903 0.0542  0.0122  540  TYR A O   
432  C CB  . TYR A 72  ? 0.9833 1.2283 1.1587 -0.0346 0.1052  0.0420  540  TYR A CB  
433  C CG  . TYR A 72  ? 0.9799 1.2519 1.1485 0.0009  0.1215  0.0503  540  TYR A CG  
434  C CD1 . TYR A 72  ? 0.9814 1.2087 1.1008 0.0270  0.1302  0.0455  540  TYR A CD1 
435  C CD2 . TYR A 72  ? 0.9719 1.3142 1.1828 0.0094  0.1274  0.0632  540  TYR A CD2 
436  C CE1 . TYR A 72  ? 0.9838 1.2273 1.0892 0.0623  0.1437  0.0510  540  TYR A CE1 
437  C CE2 . TYR A 72  ? 0.9640 1.3295 1.1651 0.0472  0.1435  0.0700  540  TYR A CE2 
438  C CZ  . TYR A 72  ? 0.9722 1.2839 1.1172 0.0742  0.1513  0.0628  540  TYR A CZ  
439  O OH  . TYR A 72  ? 0.9828 1.3085 1.1103 0.1141  0.1654  0.0673  540  TYR A OH  
440  N N   . LEU A 73  ? 0.9921 1.1227 1.1132 -0.0666 0.0740  0.0084  541  LEU A N   
441  C CA  . LEU A 73  ? 1.0080 1.0996 1.1207 -0.0888 0.0637  -0.0010 541  LEU A CA  
442  C C   . LEU A 73  ? 1.0218 1.0709 1.1112 -0.0883 0.0759  0.0025  541  LEU A C   
443  O O   . LEU A 73  ? 1.0144 1.0411 1.0743 -0.0685 0.0830  0.0007  541  LEU A O   
444  C CB  . LEU A 73  ? 1.0045 1.0714 1.0926 -0.0849 0.0468  -0.0196 541  LEU A CB  
445  C CG  . LEU A 73  ? 1.0219 1.0576 1.1034 -0.1051 0.0318  -0.0325 541  LEU A CG  
446  C CD1 . LEU A 73  ? 1.0332 1.0977 1.1457 -0.1273 0.0149  -0.0336 541  LEU A CD1 
447  C CD2 . LEU A 73  ? 1.0114 1.0175 1.0577 -0.0927 0.0243  -0.0485 541  LEU A CD2 
448  N N   . ASP A 74  ? 1.0476 1.0837 1.1494 -0.1113 0.0757  0.0082  542  ASP A N   
449  C CA  . ASP A 74  ? 1.0708 1.0597 1.1482 -0.1125 0.0825  0.0100  542  ASP A CA  
450  C C   . ASP A 74  ? 1.0776 1.0218 1.1273 -0.1104 0.0686  -0.0091 542  ASP A C   
451  O O   . ASP A 74  ? 1.0903 1.0268 1.1448 -0.1245 0.0525  -0.0205 542  ASP A O   
452  C CB  . ASP A 74  ? 1.1041 1.0899 1.2027 -0.1394 0.0851  0.0239  542  ASP A CB  
453  C CG  . ASP A 74  ? 1.1223 1.1460 1.2402 -0.1379 0.1062  0.0471  542  ASP A CG  
454  O OD1 . ASP A 74  ? 1.1531 1.2157 1.3101 -0.1596 0.1068  0.0607  542  ASP A OD1 
455  O OD2 . ASP A 74  ? 1.1405 1.1569 1.2343 -0.1151 0.1218  0.0525  542  ASP A OD2 
456  N N   . VAL A 75  ? 1.0747 0.9910 1.0947 -0.0920 0.0743  -0.0123 543  VAL A N   
457  C CA  . VAL A 75  ? 1.0845 0.9649 1.0801 -0.0862 0.0647  -0.0278 543  VAL A CA  
458  C C   . VAL A 75  ? 1.1078 0.9478 1.0830 -0.0812 0.0701  -0.0245 543  VAL A C   
459  O O   . VAL A 75  ? 1.1122 0.9506 1.0830 -0.0758 0.0818  -0.0111 543  VAL A O   
460  C CB  . VAL A 75  ? 1.0578 0.9485 1.0386 -0.0677 0.0619  -0.0364 543  VAL A CB  
461  C CG1 . VAL A 75  ? 1.0530 0.9705 1.0454 -0.0722 0.0512  -0.0442 543  VAL A CG1 
462  C CG2 . VAL A 75  ? 1.0358 0.9370 1.0089 -0.0522 0.0724  -0.0263 543  VAL A CG2 
463  N N   . ASP A 76  ? 1.1325 0.9393 1.0927 -0.0809 0.0609  -0.0370 544  ASP A N   
464  C CA  . ASP A 76  ? 1.1550 0.9245 1.0936 -0.0698 0.0633  -0.0367 544  ASP A CA  
465  C C   . ASP A 76  ? 1.1305 0.9081 1.0557 -0.0500 0.0617  -0.0460 544  ASP A C   
466  O O   . ASP A 76  ? 1.1141 0.9148 1.0429 -0.0483 0.0571  -0.0544 544  ASP A O   
467  C CB  . ASP A 76  ? 1.2052 0.9310 1.1337 -0.0786 0.0538  -0.0450 544  ASP A CB  
468  C CG  . ASP A 76  ? 1.2531 0.9742 1.1999 -0.1068 0.0492  -0.0381 544  ASP A CG  
469  O OD1 . ASP A 76  ? 1.2676 1.0112 1.2329 -0.1176 0.0594  -0.0200 544  ASP A OD1 
470  O OD2 . ASP A 76  ? 1.3008 0.9953 1.2424 -0.1184 0.0349  -0.0504 544  ASP A OD2 
471  N N   . PHE A 77  ? 1.1306 0.8912 1.0413 -0.0357 0.0648  -0.0428 545  PHE A N   
472  C CA  . PHE A 77  ? 1.1061 0.8799 1.0094 -0.0195 0.0632  -0.0481 545  PHE A CA  
473  C C   . PHE A 77  ? 1.1303 0.8813 1.0209 -0.0065 0.0600  -0.0566 545  PHE A C   
474  O O   . PHE A 77  ? 1.1541 0.8748 1.0359 -0.0019 0.0604  -0.0525 545  PHE A O   
475  C CB  . PHE A 77  ? 1.0854 0.8702 0.9853 -0.0120 0.0673  -0.0365 545  PHE A CB  
476  C CG  . PHE A 77  ? 1.0556 0.8666 0.9618 -0.0160 0.0690  -0.0325 545  PHE A CG  
477  C CD1 . PHE A 77  ? 1.0318 0.8623 0.9363 -0.0106 0.0649  -0.0348 545  PHE A CD1 
478  C CD2 . PHE A 77  ? 1.0475 0.8641 0.9610 -0.0240 0.0750  -0.0250 545  PHE A CD2 
479  C CE1 . PHE A 77  ? 1.0081 0.8551 0.9137 -0.0117 0.0649  -0.0314 545  PHE A CE1 
480  C CE2 . PHE A 77  ? 1.0229 0.8629 0.9401 -0.0224 0.0769  -0.0219 545  PHE A CE2 
481  C CZ  . PHE A 77  ? 1.0061 0.8573 0.9172 -0.0154 0.0708  -0.0259 545  PHE A CZ  
482  N N   . VAL A 78  ? 1.1267 0.8930 1.0147 0.0012  0.0573  -0.0678 546  VAL A N   
483  C CA  . VAL A 78  ? 1.1455 0.9016 1.0216 0.0196  0.0567  -0.0763 546  VAL A CA  
484  C C   . VAL A 78  ? 1.1311 0.8929 1.0092 0.0327  0.0595  -0.0652 546  VAL A C   
485  O O   . VAL A 78  ? 1.1037 0.8946 0.9910 0.0315  0.0605  -0.0559 546  VAL A O   
486  C CB  . VAL A 78  ? 1.1411 0.9260 1.0147 0.0266  0.0568  -0.0862 546  VAL A CB  
487  C CG1 . VAL A 78  ? 1.1426 0.9420 1.0120 0.0494  0.0613  -0.0872 546  VAL A CG1 
488  C CG2 . VAL A 78  ? 1.1786 0.9437 1.0396 0.0204  0.0503  -0.1021 546  VAL A CG2 
489  N N   . ASP A 79  ? 1.1509 0.8813 1.0186 0.0448  0.0585  -0.0661 547  ASP A N   
490  C CA  . ASP A 79  ? 1.1431 0.8789 1.0121 0.0609  0.0587  -0.0566 547  ASP A CA  
491  C C   . ASP A 79  ? 1.1078 0.8926 0.9909 0.0698  0.0598  -0.0527 547  ASP A C   
492  O O   . ASP A 79  ? 1.0915 0.8917 0.9823 0.0707  0.0569  -0.0404 547  ASP A O   
493  C CB  . ASP A 79  ? 1.1873 0.8861 1.0411 0.0798  0.0568  -0.0626 547  ASP A CB  
494  C CG  . ASP A 79  ? 1.1906 0.9112 1.0501 0.1040  0.0567  -0.0572 547  ASP A CG  
495  O OD1 . ASP A 79  ? 1.1717 0.8997 1.0373 0.1036  0.0537  -0.0431 547  ASP A OD1 
496  O OD2 . ASP A 79  ? 1.2093 0.9412 1.0664 0.1246  0.0594  -0.0668 547  ASP A OD2 
497  N N   . GLU A 80  ? 1.0958 0.9039 0.9805 0.0751  0.0631  -0.0621 548  GLU A N   
498  C CA  . GLU A 80  ? 1.0641 0.9226 0.9637 0.0788  0.0656  -0.0558 548  GLU A CA  
499  C C   . GLU A 80  ? 1.0187 0.8984 0.9297 0.0604  0.0614  -0.0429 548  GLU A C   
500  O O   . GLU A 80  ? 1.0018 0.9089 0.9258 0.0618  0.0581  -0.0312 548  GLU A O   
501  C CB  . GLU A 80  ? 1.0738 0.9494 0.9671 0.0834  0.0711  -0.0672 548  GLU A CB  
502  C CG  . GLU A 80  ? 1.1251 1.0062 1.0105 0.1110  0.0774  -0.0758 548  GLU A CG  
503  C CD  . GLU A 80  ? 1.2010 1.0266 1.0611 0.1212  0.0747  -0.0921 548  GLU A CD  
504  O OE1 . GLU A 80  ? 1.2241 1.0106 1.0802 0.1069  0.0680  -0.0909 548  GLU A OE1 
505  O OE2 . GLU A 80  ? 1.2333 1.0528 1.0753 0.1436  0.0791  -0.1055 548  GLU A OE2 
506  N N   . ILE A 81  ? 0.9954 0.8619 0.9010 0.0440  0.0603  -0.0450 549  ILE A N   
507  C CA  . ILE A 81  ? 0.9616 0.8374 0.8705 0.0303  0.0559  -0.0350 549  ILE A CA  
508  C C   . ILE A 81  ? 0.9602 0.8227 0.8671 0.0316  0.0505  -0.0247 549  ILE A C   
509  O O   . ILE A 81  ? 0.9480 0.8265 0.8594 0.0286  0.0435  -0.0151 549  ILE A O   
510  C CB  . ILE A 81  ? 0.9562 0.8188 0.8596 0.0179  0.0567  -0.0392 549  ILE A CB  
511  C CG1 . ILE A 81  ? 0.9466 0.8241 0.8498 0.0156  0.0584  -0.0484 549  ILE A CG1 
512  C CG2 . ILE A 81  ? 0.9427 0.8071 0.8435 0.0096  0.0525  -0.0298 549  ILE A CG2 
513  C CD1 . ILE A 81  ? 0.9358 0.8091 0.8382 0.0041  0.0570  -0.0511 549  ILE A CD1 
514  N N   . LEU A 82  ? 0.9704 0.8013 0.8681 0.0348  0.0524  -0.0260 550  LEU A N   
515  C CA  . LEU A 82  ? 0.9731 0.7863 0.8621 0.0366  0.0478  -0.0162 550  LEU A CA  
516  C C   . LEU A 82  ? 0.9761 0.8055 0.8723 0.0476  0.0401  -0.0093 550  LEU A C   
517  O O   . LEU A 82  ? 0.9734 0.8085 0.8674 0.0436  0.0307  -0.0004 550  LEU A O   
518  C CB  . LEU A 82  ? 0.9922 0.7688 0.8694 0.0371  0.0527  -0.0167 550  LEU A CB  
519  C CG  . LEU A 82  ? 0.9807 0.7506 0.8578 0.0234  0.0593  -0.0207 550  LEU A CG  
520  C CD1 . LEU A 82  ? 1.0011 0.7380 0.8713 0.0197  0.0638  -0.0195 550  LEU A CD1 
521  C CD2 . LEU A 82  ? 0.9660 0.7442 0.8385 0.0162  0.0600  -0.0142 550  LEU A CD2 
522  N N   . THR A 83  ? 0.9854 0.8236 0.8901 0.0621  0.0428  -0.0135 551  THR A N   
523  C CA  . THR A 83  ? 0.9912 0.8550 0.9093 0.0754  0.0364  -0.0059 551  THR A CA  
524  C C   . THR A 83  ? 0.9682 0.8720 0.9025 0.0637  0.0287  0.0033  551  THR A C   
525  O O   . THR A 83  ? 0.9706 0.8856 0.9110 0.0631  0.0166  0.0141  551  THR A O   
526  C CB  . THR A 83  ? 1.0081 0.8849 0.9340 0.0963  0.0436  -0.0135 551  THR A CB  
527  O OG1 . THR A 83  ? 1.0447 0.8743 0.9509 0.1046  0.0477  -0.0228 551  THR A OG1 
528  C CG2 . THR A 83  ? 1.0162 0.9252 0.9600 0.1138  0.0378  -0.0039 551  THR A CG2 
529  N N   . SER A 84  ? 0.9515 0.8738 0.8909 0.0531  0.0339  -0.0001 552  SER A N   
530  C CA  . SER A 84  ? 0.9320 0.8868 0.8844 0.0387  0.0264  0.0100  552  SER A CA  
531  C C   . SER A 84  ? 0.9332 0.8625 0.8698 0.0238  0.0137  0.0156  552  SER A C   
532  O O   . SER A 84  ? 0.9367 0.8805 0.8803 0.0141  -0.0004 0.0265  552  SER A O   
533  C CB  . SER A 84  ? 0.9170 0.8901 0.8721 0.0319  0.0353  0.0055  552  SER A CB  
534  O OG  . SER A 84  ? 0.9082 0.8510 0.8447 0.0217  0.0361  -0.0011 552  SER A OG  
535  N N   . LEU A 85  ? 0.9328 0.8248 0.8475 0.0222  0.0181  0.0083  553  LEU A N   
536  C CA  . LEU A 85  ? 0.9377 0.8015 0.8304 0.0137  0.0094  0.0113  553  LEU A CA  
537  C C   . LEU A 85  ? 0.9576 0.8039 0.8383 0.0186  -0.0023 0.0178  553  LEU A C   
538  O O   . LEU A 85  ? 0.9694 0.7976 0.8312 0.0121  -0.0153 0.0219  553  LEU A O   
539  C CB  . LEU A 85  ? 0.9373 0.7749 0.8138 0.0143  0.0206  0.0035  553  LEU A CB  
540  C CG  . LEU A 85  ? 0.9175 0.7636 0.7967 0.0074  0.0270  -0.0022 553  LEU A CG  
541  C CD1 . LEU A 85  ? 0.9175 0.7436 0.7860 0.0088  0.0365  -0.0070 553  LEU A CD1 
542  C CD2 . LEU A 85  ? 0.9147 0.7627 0.7866 -0.0020 0.0161  0.0029  553  LEU A CD2 
543  N N   . ILE A 86  ? 0.9635 0.8113 0.8514 0.0317  0.0010  0.0182  554  ILE A N   
544  C CA  . ILE A 86  ? 0.9874 0.8171 0.8620 0.0394  -0.0097 0.0248  554  ILE A CA  
545  C C   . ILE A 86  ? 0.9931 0.8589 0.8927 0.0434  -0.0224 0.0331  554  ILE A C   
546  O O   . ILE A 86  ? 1.0102 0.8697 0.9023 0.0460  -0.0383 0.0407  554  ILE A O   
547  C CB  . ILE A 86  ? 1.0012 0.8024 0.8637 0.0522  0.0018  0.0217  554  ILE A CB  
548  C CG1 . ILE A 86  ? 0.9922 0.7671 0.8368 0.0455  0.0146  0.0165  554  ILE A CG1 
549  C CG2 . ILE A 86  ? 1.0230 0.8044 0.8689 0.0624  -0.0096 0.0301  554  ILE A CG2 
550  C CD1 . ILE A 86  ? 0.9903 0.7491 0.8361 0.0499  0.0284  0.0118  554  ILE A CD1 
551  N N   . GLY A 87  ? 0.9821 0.8889 0.9113 0.0448  -0.0152 0.0325  555  GLY A N   
552  C CA  . GLY A 87  ? 0.9908 0.9464 0.9521 0.0497  -0.0235 0.0425  555  GLY A CA  
553  C C   . GLY A 87  ? 1.0123 0.9689 0.9789 0.0743  -0.0211 0.0427  555  GLY A C   
554  O O   . GLY A 87  ? 1.0148 1.0146 1.0095 0.0842  -0.0273 0.0515  555  GLY A O   
555  N N   . PHE A 88  ? 1.0347 0.9437 0.9747 0.0840  -0.0124 0.0344  556  PHE A N   
556  C CA  . PHE A 88  ? 1.0648 0.9568 0.9992 0.1071  -0.0115 0.0345  556  PHE A CA  
557  C C   . PHE A 88  ? 1.0740 0.9355 0.9959 0.1167  0.0059  0.0219  556  PHE A C   
558  O O   . PHE A 88  ? 1.0687 0.8983 0.9722 0.1037  0.0136  0.0154  556  PHE A O   
559  C CB  . PHE A 88  ? 1.0950 0.9461 1.0006 0.1067  -0.0235 0.0409  556  PHE A CB  
560  C CG  . PHE A 88  ? 1.1152 0.9905 1.0298 0.1045  -0.0462 0.0532  556  PHE A CG  
561  C CD1 . PHE A 88  ? 1.1084 0.9962 1.0240 0.0823  -0.0592 0.0570  556  PHE A CD1 
562  C CD2 . PHE A 88  ? 1.1412 1.0223 1.0605 0.1244  -0.0572 0.0611  556  PHE A CD2 
563  C CE1 . PHE A 88  ? 1.1096 1.0155 1.0317 0.0768  -0.0842 0.0680  556  PHE A CE1 
564  C CE2 . PHE A 88  ? 1.1514 1.0570 1.0804 0.1207  -0.0815 0.0729  556  PHE A CE2 
565  C CZ  . PHE A 88  ? 1.1327 1.0503 1.0633 0.0951  -0.0958 0.0761  556  PHE A CZ  
566  N N   . SER A 89  ? 1.0916 0.9640 1.0237 0.1403  0.0107  0.0187  557  SER A N   
567  C CA  . SER A 89  ? 1.1217 0.9505 1.0341 0.1531  0.0213  0.0072  557  SER A CA  
568  C C   . SER A 89  ? 1.1595 0.9342 1.0449 0.1581  0.0154  0.0127  557  SER A C   
569  O O   . SER A 89  ? 1.1660 0.9423 1.0483 0.1581  0.0032  0.0248  557  SER A O   
570  C CB  . SER A 89  ? 1.1364 0.9881 1.0614 0.1818  0.0273  0.0013  557  SER A CB  
571  O OG  . SER A 89  ? 1.1572 1.0155 1.0879 0.2056  0.0181  0.0106  557  SER A OG  
572  N N   . VAL A 90  ? 1.1893 0.9142 1.0532 0.1609  0.0229  0.0046  558  VAL A N   
573  C CA  . VAL A 90  ? 1.2317 0.9005 1.0680 0.1657  0.0192  0.0113  558  VAL A CA  
574  C C   . VAL A 90  ? 1.2657 0.9364 1.1025 0.1959  0.0090  0.0188  558  VAL A C   
575  O O   . VAL A 90  ? 1.2806 0.9378 1.1050 0.1975  -0.0011 0.0320  558  VAL A O   
576  C CB  . VAL A 90  ? 1.2587 0.8747 1.0751 0.1595  0.0276  0.0015  558  VAL A CB  
577  C CG1 . VAL A 90  ? 1.2943 0.8536 1.0828 0.1534  0.0257  0.0126  558  VAL A CG1 
578  C CG2 . VAL A 90  ? 1.2252 0.8564 1.0504 0.1340  0.0358  -0.0066 558  VAL A CG2 
579  N N   . PRO A 91  ? 1.2781 0.9680 1.1278 0.2221  0.0113  0.0109  559  PRO A N   
580  C CA  . PRO A 91  ? 1.3083 1.0109 1.1641 0.2541  0.0016  0.0190  559  PRO A CA  
581  C C   . PRO A 91  ? 1.2886 1.0481 1.1703 0.2511  -0.0117 0.0339  559  PRO A C   
582  O O   . PRO A 91  ? 1.3143 1.0630 1.1881 0.2652  -0.0250 0.0455  559  PRO A O   
583  C CB  . PRO A 91  ? 1.3167 1.0430 1.1853 0.2814  0.0105  0.0064  559  PRO A CB  
584  C CG  . PRO A 91  ? 1.3191 1.0018 1.1661 0.2670  0.0214  -0.0097 559  PRO A CG  
585  C CD  . PRO A 91  ? 1.2745 0.9665 1.1266 0.2279  0.0229  -0.0061 559  PRO A CD  
586  N N   . GLU A 92  ? 1.2528 1.0683 1.1625 0.2317  -0.0103 0.0342  560  GLU A N   
587  C CA  . GLU A 92  ? 1.2407 1.1020 1.1715 0.2200  -0.0264 0.0481  560  GLU A CA  
588  C C   . GLU A 92  ? 1.2618 1.0784 1.1609 0.2034  -0.0377 0.0555  560  GLU A C   
589  O O   . GLU A 92  ? 1.2774 1.1069 1.1782 0.2066  -0.0563 0.0675  560  GLU A O   
590  C CB  . GLU A 92  ? 1.1933 1.1075 1.1521 0.1966  -0.0231 0.0473  560  GLU A CB  
591  C CG  . GLU A 92  ? 1.1887 1.1703 1.1867 0.2120  -0.0161 0.0478  560  GLU A CG  
592  C CD  . GLU A 92  ? 1.1682 1.1742 1.1768 0.1927  -0.0021 0.0404  560  GLU A CD  
593  O OE1 . GLU A 92  ? 1.1458 1.1460 1.1493 0.1624  -0.0068 0.0423  560  GLU A OE1 
594  O OE2 . GLU A 92  ? 1.1756 1.2036 1.1935 0.2102  0.0133  0.0325  560  GLU A OE2 
595  N N   . MET A 93  ? 1.2697 1.0370 1.1399 0.1865  -0.0268 0.0491  561  MET A N   
596  C CA  . MET A 93  ? 1.2965 1.0175 1.1309 0.1757  -0.0323 0.0565  561  MET A CA  
597  C C   . MET A 93  ? 1.3565 1.0431 1.1693 0.1988  -0.0417 0.0663  561  MET A C   
598  O O   . MET A 93  ? 1.3733 1.0536 1.1698 0.1992  -0.0571 0.0773  561  MET A O   
599  C CB  . MET A 93  ? 1.2903 0.9711 1.1032 0.1574  -0.0156 0.0498  561  MET A CB  
600  C CG  . MET A 93  ? 1.2897 0.9331 1.0673 0.1457  -0.0171 0.0587  561  MET A CG  
601  S SD  . MET A 93  ? 1.3121 0.8919 1.0518 0.1594  -0.0162 0.0701  561  MET A SD  
602  C CE  . MET A 93  ? 1.3117 0.8565 1.0436 0.1407  0.0057  0.0643  561  MET A CE  
603  N N   . LYS A 94  ? 1.3984 1.0591 1.2073 0.2189  -0.0342 0.0618  562  LYS A N   
604  C CA  . LYS A 94  ? 1.4681 1.0904 1.2544 0.2441  -0.0435 0.0714  562  LYS A CA  
605  C C   . LYS A 94  ? 1.4777 1.1438 1.2819 0.2619  -0.0642 0.0823  562  LYS A C   
606  O O   . LYS A 94  ? 1.5136 1.1544 1.2923 0.2675  -0.0783 0.0949  562  LYS A O   
607  C CB  . LYS A 94  ? 1.5051 1.0970 1.2873 0.2684  -0.0354 0.0630  562  LYS A CB  
608  C CG  . LYS A 94  ? 1.5175 1.0739 1.2897 0.2527  -0.0182 0.0491  562  LYS A CG  
609  C CD  . LYS A 94  ? 1.5579 1.0482 1.2934 0.2322  -0.0133 0.0560  562  LYS A CD  
610  C CE  . LYS A 94  ? 1.5238 1.0318 1.2652 0.1975  -0.0035 0.0540  562  LYS A CE  
611  N NZ  . LYS A 94  ? 1.5640 1.0202 1.2746 0.1776  0.0033  0.0642  562  LYS A NZ  
612  N N   . GLN A 95  ? 1.4524 1.1863 1.3007 0.2703  -0.0665 0.0790  563  GLN A N   
613  C CA  . GLN A 95  ? 1.4635 1.2499 1.3383 0.2862  -0.0873 0.0910  563  GLN A CA  
614  C C   . GLN A 95  ? 1.4422 1.2533 1.3199 0.2595  -0.1051 0.0991  563  GLN A C   
615  O O   . GLN A 95  ? 1.4581 1.2920 1.3426 0.2680  -0.1284 0.1113  563  GLN A O   
616  C CB  . GLN A 95  ? 1.4460 1.3032 1.3701 0.3058  -0.0824 0.0879  563  GLN A CB  
617  C CG  . GLN A 95  ? 1.5079 1.3419 1.4252 0.3448  -0.0722 0.0817  563  GLN A CG  
618  C CD  . GLN A 95  ? 1.5280 1.3316 1.4329 0.3399  -0.0489 0.0636  563  GLN A CD  
619  O OE1 . GLN A 95  ? 1.5045 1.3577 1.4381 0.3322  -0.0373 0.0562  563  GLN A OE1 
620  N NE2 . GLN A 95  ? 1.5718 1.2927 1.4328 0.3425  -0.0432 0.0577  563  GLN A NE2 
621  N N   . SER A 96  ? 1.4121 1.2160 1.2823 0.2286  -0.0964 0.0922  564  SER A N   
622  C CA  . SER A 96  ? 1.4061 1.2160 1.2665 0.2047  -0.1139 0.0977  564  SER A CA  
623  C C   . SER A 96  ? 1.4577 1.2105 1.2675 0.2100  -0.1259 0.1059  564  SER A C   
624  O O   . SER A 96  ? 1.4712 1.2124 1.2570 0.1941  -0.1406 0.1091  564  SER A O   
625  C CB  . SER A 96  ? 1.3687 1.1766 1.2266 0.1749  -0.1015 0.0880  564  SER A CB  
626  O OG  . SER A 96  ? 1.3728 1.1210 1.1895 0.1678  -0.0857 0.0828  564  SER A OG  
627  N N   . LYS A 97  ? 1.4950 1.2087 1.2842 0.2335  -0.1203 0.1095  565  LYS A N   
628  C CA  . LYS A 97  ? 1.5476 1.2101 1.2885 0.2417  -0.1323 0.1207  565  LYS A CA  
629  C C   . LYS A 97  ? 1.5768 1.2634 1.3278 0.2660  -0.1591 0.1328  565  LYS A C   
630  O O   . LYS A 97  ? 1.5986 1.2812 1.3275 0.2617  -0.1824 0.1412  565  LYS A O   
631  C CB  . LYS A 97  ? 1.5810 1.1762 1.2849 0.2479  -0.1121 0.1211  565  LYS A CB  
632  C CG  . LYS A 97  ? 1.5735 1.1346 1.2477 0.2216  -0.0945 0.1175  565  LYS A CG  
633  C CD  . LYS A 97  ? 1.6009 1.1070 1.2522 0.2217  -0.0730 0.1185  565  LYS A CD  
634  C CE  . LYS A 97  ? 1.5703 1.0916 1.2558 0.2181  -0.0565 0.1041  565  LYS A CE  
635  N NZ  . LYS A 97  ? 1.6053 1.0695 1.2689 0.2153  -0.0402 0.1050  565  LYS A NZ  
636  N N   . LYS A 98  ? 1.5795 1.2919 1.3625 0.2930  -0.1571 0.1333  566  LYS A N   
637  C CA  . LYS A 98  ? 1.6033 1.3518 1.4064 0.3202  -0.1818 0.1453  566  LYS A CA  
638  C C   . LYS A 98  ? 1.5907 1.3830 1.4071 0.3010  -0.2100 0.1521  566  LYS A C   
639  O O   . LYS A 98  ? 1.6326 1.4140 1.4267 0.3096  -0.2359 0.1636  566  LYS A O   
640  C CB  . LYS A 98  ? 1.5831 1.3917 1.4413 0.3446  -0.1744 0.1419  566  LYS A CB  
641  C CG  . LYS A 98  ? 1.5832 1.3602 1.4369 0.3551  -0.1446 0.1282  566  LYS A CG  
642  C CD  . LYS A 98  ? 1.6435 1.3564 1.4618 0.3889  -0.1429 0.1315  566  LYS A CD  
643  C CE  . LYS A 98  ? 1.6530 1.3027 1.4441 0.3832  -0.1172 0.1181  566  LYS A CE  
644  N NZ  . LYS A 98  ? 1.6333 1.2415 1.3930 0.3438  -0.1081 0.1164  566  LYS A NZ  
645  N N   . ASP A 99  ? 1.5417 1.3791 1.3913 0.2739  -0.2062 0.1451  567  ASP A N   
646  C CA  . ASP A 99  ? 1.5315 1.4056 1.3939 0.2491  -0.2330 0.1499  567  ASP A CA  
647  C C   . ASP A 99  ? 1.5316 1.3535 1.3471 0.2193  -0.2276 0.1413  567  ASP A C   
648  O O   . ASP A 99  ? 1.4977 1.3081 1.3139 0.2057  -0.2015 0.1302  567  ASP A O   
649  C CB  . ASP A 99  ? 1.4840 1.4452 1.4169 0.2394  -0.2330 0.1506  567  ASP A CB  
650  C CG  . ASP A 99  ? 1.4799 1.4896 1.4375 0.2166  -0.2679 0.1606  567  ASP A CG  
651  O OD1 . ASP A 99  ? 1.4811 1.4634 1.4115 0.1858  -0.2779 0.1560  567  ASP A OD1 
652  O OD2 . ASP A 99  ? 1.4827 1.5592 1.4883 0.2297  -0.2863 0.1734  567  ASP A OD2 
653  N N   . PRO A 100 ? 1.5715 1.3614 1.3435 0.2117  -0.2529 0.1462  568  PRO A N   
654  C CA  . PRO A 100 ? 1.5821 1.3200 1.3021 0.1897  -0.2490 0.1383  568  PRO A CA  
655  C C   . PRO A 100 ? 1.5469 1.3160 1.2916 0.1590  -0.2549 0.1308  568  PRO A C   
656  O O   . PRO A 100 ? 1.5342 1.2737 1.2567 0.1443  -0.2358 0.1205  568  PRO A O   
657  C CB  . PRO A 100 ? 1.6415 1.3436 1.3097 0.1963  -0.2792 0.1465  568  PRO A CB  
658  C CG  . PRO A 100 ? 1.6480 1.4082 1.3609 0.2064  -0.3101 0.1577  568  PRO A CG  
659  C CD  . PRO A 100 ? 1.6132 1.4167 1.3817 0.2258  -0.2883 0.1594  568  PRO A CD  
660  N N   . LEU A 101 ? 1.5346 1.3637 1.3255 0.1490  -0.2818 0.1377  569  LEU A N   
661  C CA  . LEU A 101 ? 1.5018 1.3626 1.3210 0.1179  -0.2884 0.1338  569  LEU A CA  
662  C C   . LEU A 101 ? 1.4479 1.3283 1.2986 0.1134  -0.2520 0.1256  569  LEU A C   
663  O O   . LEU A 101 ? 1.4305 1.3050 1.2786 0.0898  -0.2470 0.1185  569  LEU A O   
664  C CB  . LEU A 101 ? 1.4990 1.4310 1.3729 0.1069  -0.3221 0.1469  569  LEU A CB  
665  C CG  . LEU A 101 ? 1.4606 1.4459 1.3847 0.0757  -0.3254 0.1488  569  LEU A CG  
666  C CD1 . LEU A 101 ? 1.4783 1.4157 1.3597 0.0441  -0.3446 0.1414  569  LEU A CD1 
667  C CD2 . LEU A 101 ? 1.4514 1.5256 1.4457 0.0727  -0.3491 0.1665  569  LEU A CD2 
668  N N   . GLN A 102 ? 1.4283 1.3272 1.3040 0.1376  -0.2286 0.1261  570  GLN A N   
669  C CA  . GLN A 102 ? 1.3845 1.2963 1.2834 0.1370  -0.1949 0.1170  570  GLN A CA  
670  C C   . GLN A 102 ? 1.3844 1.2293 1.2340 0.1329  -0.1717 0.1051  570  GLN A C   
671  O O   . GLN A 102 ? 1.3493 1.1968 1.2079 0.1210  -0.1510 0.0961  570  GLN A O   
672  C CB  . GLN A 102 ? 1.3794 1.3229 1.3119 0.1671  -0.1792 0.1193  570  GLN A CB  
673  C CG  . GLN A 102 ? 1.3769 1.4001 1.3668 0.1768  -0.1969 0.1325  570  GLN A CG  
674  C CD  . GLN A 102 ? 1.3520 1.4323 1.3817 0.1453  -0.2103 0.1385  570  GLN A CD  
675  O OE1 . GLN A 102 ? 1.3086 1.4153 1.3624 0.1332  -0.1906 0.1339  570  GLN A OE1 
676  N NE2 . GLN A 102 ? 1.3769 1.4743 1.4116 0.1304  -0.2458 0.1496  570  GLN A NE2 
677  N N   . TYR A 103 ? 1.4229 1.2119 1.2216 0.1435  -0.1754 0.1069  571  TYR A N   
678  C CA  . TYR A 103 ? 1.4295 1.1596 1.1816 0.1404  -0.1538 0.0996  571  TYR A CA  
679  C C   . TYR A 103 ? 1.4231 1.1399 1.1540 0.1171  -0.1592 0.0931  571  TYR A C   
680  O O   . TYR A 103 ? 1.3990 1.1047 1.1261 0.1071  -0.1378 0.0843  571  TYR A O   
681  C CB  . TYR A 103 ? 1.4808 1.1594 1.1829 0.1575  -0.1581 0.1072  571  TYR A CB  
682  C CG  . TYR A 103 ? 1.4918 1.1196 1.1577 0.1588  -0.1298 0.1044  571  TYR A CG  
683  C CD1 . TYR A 103 ? 1.4726 1.1014 1.1612 0.1617  -0.1041 0.0996  571  TYR A CD1 
684  C CD2 . TYR A 103 ? 1.5236 1.1035 1.1319 0.1569  -0.1292 0.1074  571  TYR A CD2 
685  C CE1 . TYR A 103 ? 1.4865 1.0726 1.1469 0.1584  -0.0803 0.0991  571  TYR A CE1 
686  C CE2 . TYR A 103 ? 1.5369 1.0789 1.1174 0.1563  -0.1017 0.1083  571  TYR A CE2 
687  C CZ  . TYR A 103 ? 1.5209 1.0678 1.1307 0.1551  -0.0783 0.1049  571  TYR A CZ  
688  O OH  . TYR A 103 ? 1.5460 1.0596 1.1337 0.1504  -0.0534 0.1078  571  TYR A OH  
689  N N   . GLN A 104 ? 1.4500 1.1666 1.1659 0.1094  -0.1904 0.0973  572  GLN A N   
690  C CA  . GLN A 104 ? 1.4587 1.1573 1.1502 0.0886  -0.2024 0.0908  572  GLN A CA  
691  C C   . GLN A 104 ? 1.4091 1.1396 1.1399 0.0715  -0.1874 0.0844  572  GLN A C   
692  O O   . GLN A 104 ? 1.4041 1.1077 1.1123 0.0639  -0.1720 0.0754  572  GLN A O   
693  C CB  . GLN A 104 ? 1.4909 1.2003 1.1798 0.0785  -0.2444 0.0971  572  GLN A CB  
694  C CG  . GLN A 104 ? 1.5233 1.1909 1.1656 0.0611  -0.2628 0.0894  572  GLN A CG  
695  C CD  . GLN A 104 ? 1.5584 1.1622 1.1343 0.0734  -0.2422 0.0809  572  GLN A CD  
696  O OE1 . GLN A 104 ? 1.5847 1.1599 1.1248 0.0929  -0.2364 0.0851  572  GLN A OE1 
697  N NE2 . GLN A 104 ? 1.5488 1.1324 1.1086 0.0632  -0.2299 0.0706  572  GLN A NE2 
698  N N   . LYS A 105 ? 1.3750 1.1657 1.1645 0.0681  -0.1907 0.0902  573  LYS A N   
699  C CA  . LYS A 105 ? 1.3329 1.1608 1.1614 0.0514  -0.1800 0.0873  573  LYS A CA  
700  C C   . LYS A 105 ? 1.3031 1.1146 1.1267 0.0576  -0.1445 0.0770  573  LYS A C   
701  O O   . LYS A 105 ? 1.2843 1.0987 1.1132 0.0432  -0.1346 0.0710  573  LYS A O   
702  C CB  . LYS A 105 ? 1.3097 1.2106 1.2012 0.0523  -0.1867 0.0981  573  LYS A CB  
703  C CG  . LYS A 105 ? 1.2992 1.2438 1.2275 0.0254  -0.1955 0.1030  573  LYS A CG  
704  C CD  . LYS A 105 ? 1.3377 1.2991 1.2743 0.0049  -0.2352 0.1146  573  LYS A CD  
705  C CE  . LYS A 105 ? 1.3228 1.3444 1.3117 -0.0214 -0.2404 0.1252  573  LYS A CE  
706  N NZ  . LYS A 105 ? 1.3580 1.3861 1.3513 -0.0510 -0.2812 0.1362  573  LYS A NZ  
707  N N   . PHE A 106 ? 1.3084 1.0994 1.1198 0.0782  -0.1278 0.0758  574  PHE A N   
708  C CA  . PHE A 106 ? 1.2885 1.0586 1.0923 0.0827  -0.0976 0.0671  574  PHE A CA  
709  C C   . PHE A 106 ? 1.3011 1.0241 1.0591 0.0756  -0.0908 0.0618  574  PHE A C   
710  O O   . PHE A 106 ? 1.2790 1.0012 1.0393 0.0658  -0.0760 0.0543  574  PHE A O   
711  C CB  . PHE A 106 ? 1.3064 1.0621 1.1076 0.1047  -0.0863 0.0697  574  PHE A CB  
712  C CG  . PHE A 106 ? 1.3000 1.0217 1.0841 0.1061  -0.0603 0.0631  574  PHE A CG  
713  C CD1 . PHE A 106 ? 1.2682 1.0070 1.0795 0.1065  -0.0424 0.0553  574  PHE A CD1 
714  C CD2 . PHE A 106 ? 1.3270 1.0012 1.0674 0.1069  -0.0543 0.0659  574  PHE A CD2 
715  C CE1 . PHE A 106 ? 1.2634 0.9715 1.0613 0.1044  -0.0221 0.0499  574  PHE A CE1 
716  C CE2 . PHE A 106 ? 1.3252 0.9748 1.0561 0.1048  -0.0310 0.0629  574  PHE A CE2 
717  C CZ  . PHE A 106 ? 1.2879 0.9540 1.0490 0.1020  -0.0166 0.0547  574  PHE A CZ  
718  N N   . LEU A 107 ? 1.3381 1.0236 1.0531 0.0828  -0.1016 0.0662  575  LEU A N   
719  C CA  . LEU A 107 ? 1.3601 1.0026 1.0265 0.0811  -0.0945 0.0623  575  LEU A CA  
720  C C   . LEU A 107 ? 1.3445 0.9902 1.0100 0.0655  -0.0980 0.0543  575  LEU A C   
721  O O   . LEU A 107 ? 1.3426 0.9694 0.9885 0.0651  -0.0803 0.0484  575  LEU A O   
722  C CB  . LEU A 107 ? 1.4131 1.0197 1.0302 0.0905  -0.1133 0.0683  575  LEU A CB  
723  C CG  . LEU A 107 ? 1.4359 1.0228 1.0365 0.1079  -0.1060 0.0777  575  LEU A CG  
724  C CD1 . LEU A 107 ? 1.4927 1.0537 1.0504 0.1165  -0.1325 0.0843  575  LEU A CD1 
725  C CD2 . LEU A 107 ? 1.4367 0.9957 1.0145 0.1119  -0.0748 0.0786  575  LEU A CD2 
726  N N   . GLU A 108 ? 1.3342 1.0053 1.0224 0.0527  -0.1214 0.0556  576  GLU A N   
727  C CA  . GLU A 108 ? 1.3216 0.9959 1.0134 0.0358  -0.1271 0.0500  576  GLU A CA  
728  C C   . GLU A 108 ? 1.2733 0.9742 0.9993 0.0321  -0.1012 0.0454  576  GLU A C   
729  O O   . GLU A 108 ? 1.2745 0.9560 0.9823 0.0316  -0.0869 0.0384  576  GLU A O   
730  C CB  . GLU A 108 ? 1.3251 1.0255 1.0403 0.0189  -0.1580 0.0564  576  GLU A CB  
731  C CG  . GLU A 108 ? 1.3873 1.0467 1.0556 0.0146  -0.1894 0.0563  576  GLU A CG  
732  C CD  . GLU A 108 ? 1.4118 1.1014 1.1054 0.0063  -0.2209 0.0672  576  GLU A CD  
733  O OE1 . GLU A 108 ? 1.4519 1.1261 1.1223 0.0197  -0.2329 0.0708  576  GLU A OE1 
734  O OE2 . GLU A 108 ? 1.3941 1.1262 1.1322 -0.0137 -0.2334 0.0739  576  GLU A OE2 
735  N N   . GLY A 109 ? 1.2366 0.9819 1.0097 0.0322  -0.0951 0.0490  577  GLY A N   
736  C CA  . GLY A 109 ? 1.1937 0.9640 0.9965 0.0301  -0.0724 0.0438  577  GLY A CA  
737  C C   . GLY A 109 ? 1.1909 0.9325 0.9720 0.0368  -0.0493 0.0365  577  GLY A C   
738  O O   . GLY A 109 ? 1.1680 0.9195 0.9612 0.0314  -0.0350 0.0306  577  GLY A O   
739  N N   . LEU A 110 ? 1.2160 0.9244 0.9652 0.0479  -0.0463 0.0386  578  LEU A N   
740  C CA  . LEU A 110 ? 1.2164 0.9027 0.9481 0.0529  -0.0240 0.0358  578  LEU A CA  
741  C C   . LEU A 110 ? 1.2242 0.8905 0.9266 0.0504  -0.0202 0.0315  578  LEU A C   
742  O O   . LEU A 110 ? 1.2050 0.8781 0.9162 0.0479  -0.0027 0.0271  578  LEU A O   
743  C CB  . LEU A 110 ? 1.2498 0.9104 0.9592 0.0653  -0.0202 0.0431  578  LEU A CB  
744  C CG  . LEU A 110 ? 1.2514 0.9052 0.9680 0.0670  0.0035  0.0437  578  LEU A CG  
745  C CD1 . LEU A 110 ? 1.2277 0.9092 0.9854 0.0629  0.0094  0.0374  578  LEU A CD1 
746  C CD2 . LEU A 110 ? 1.2861 0.9110 0.9798 0.0777  0.0056  0.0539  578  LEU A CD2 
747  N N   . GLN A 111 ? 1.2555 0.8961 0.9212 0.0526  -0.0375 0.0321  579  GLN A N   
748  C CA  . GLN A 111 ? 1.2707 0.8892 0.9049 0.0539  -0.0364 0.0262  579  GLN A CA  
749  C C   . GLN A 111 ? 1.2351 0.8703 0.8912 0.0403  -0.0456 0.0213  579  GLN A C   
750  O O   . GLN A 111 ? 1.2457 0.8676 0.8847 0.0421  -0.0413 0.0158  579  GLN A O   
751  C CB  . GLN A 111 ? 1.3309 0.9068 0.9088 0.0630  -0.0532 0.0261  579  GLN A CB  
752  C CG  . GLN A 111 ? 1.3848 0.9572 0.9602 0.0579  -0.0823 0.0306  579  GLN A CG  
753  C CD  . GLN A 111 ? 1.4634 1.0084 1.0085 0.0501  -0.1121 0.0260  579  GLN A CD  
754  O OE1 . GLN A 111 ? 1.4580 1.0182 1.0279 0.0340  -0.1229 0.0243  579  GLN A OE1 
755  N NE2 . GLN A 111 ? 1.5310 1.0320 1.0189 0.0608  -0.1272 0.0246  579  GLN A NE2 
756  N N   . LYS A 112 ? 1.1967 0.8620 0.8894 0.0284  -0.0575 0.0247  580  LYS A N   
757  C CA  . LYS A 112 ? 1.1584 0.8470 0.8779 0.0138  -0.0625 0.0236  580  LYS A CA  
758  C C   . LYS A 112 ? 1.1071 0.8175 0.8507 0.0157  -0.0374 0.0190  580  LYS A C   
759  O O   . LYS A 112 ? 1.0926 0.8057 0.8383 0.0104  -0.0346 0.0154  580  LYS A O   
760  C CB  . LYS A 112 ? 1.1469 0.8715 0.9030 0.0025  -0.0778 0.0314  580  LYS A CB  
761  C CG  . LYS A 112 ? 1.1554 0.9091 0.9403 -0.0151 -0.0834 0.0345  580  LYS A CG  
762  C CD  . LYS A 112 ? 1.1563 0.9513 0.9799 -0.0133 -0.0609 0.0330  580  LYS A CD  
763  C CE  . LYS A 112 ? 1.1547 0.9833 1.0057 -0.0300 -0.0654 0.0391  580  LYS A CE  
764  N NZ  . LYS A 112 ? 1.1342 0.9980 1.0134 -0.0253 -0.0433 0.0358  580  LYS A NZ  
765  N N   . CYS A 113 ? 1.0765 0.7985 0.8356 0.0232  -0.0214 0.0193  581  CYS A N   
766  C CA  . CYS A 113 ? 1.0326 0.7709 0.8120 0.0237  -0.0004 0.0146  581  CYS A CA  
767  C C   . CYS A 113 ? 1.0392 0.7601 0.7968 0.0283  0.0110  0.0113  581  CYS A C   
768  O O   . CYS A 113 ? 1.0229 0.7576 0.7928 0.0247  0.0184  0.0070  581  CYS A O   
769  C CB  . CYS A 113 ? 1.0274 0.7689 0.8195 0.0302  0.0105  0.0161  581  CYS A CB  
770  S SG  . CYS A 113 ? 0.9666 0.7207 0.7806 0.0276  0.0312  0.0097  581  CYS A SG  
771  N N   . GLN A 114 ? 1.0655 0.7586 0.7897 0.0382  0.0124  0.0142  582  GLN A N   
772  C CA  . GLN A 114 ? 1.0738 0.7541 0.7748 0.0473  0.0255  0.0130  582  GLN A CA  
773  C C   . GLN A 114 ? 1.0790 0.7507 0.7650 0.0483  0.0168  0.0075  582  GLN A C   
774  O O   . GLN A 114 ? 1.0683 0.7492 0.7577 0.0531  0.0291  0.0048  582  GLN A O   
775  C CB  . GLN A 114 ? 1.1140 0.7643 0.7748 0.0597  0.0262  0.0180  582  GLN A CB  
776  C CG  . GLN A 114 ? 1.1276 0.7759 0.7727 0.0709  0.0480  0.0210  582  GLN A CG  
777  C CD  . GLN A 114 ? 1.1746 0.7878 0.7652 0.0873  0.0444  0.0224  582  GLN A CD  
778  O OE1 . GLN A 114 ? 1.2058 0.7948 0.7670 0.0921  0.0270  0.0156  582  GLN A OE1 
779  N NE2 . GLN A 114 ? 1.1997 0.8054 0.7721 0.0957  0.0593  0.0316  582  GLN A NE2 
780  N N   . ARG A 115 ? 1.0991 0.7524 0.7689 0.0433  -0.0063 0.0068  583  ARG A N   
781  C CA  . ARG A 115 ? 1.1162 0.7540 0.7706 0.0405  -0.0195 0.0026  583  ARG A CA  
782  C C   . ARG A 115 ? 1.0777 0.7477 0.7691 0.0303  -0.0136 0.0016  583  ARG A C   
783  O O   . ARG A 115 ? 1.0813 0.7446 0.7632 0.0349  -0.0119 -0.0018 583  ARG A O   
784  C CB  . ARG A 115 ? 1.1429 0.7588 0.7817 0.0294  -0.0486 0.0047  583  ARG A CB  
785  C CG  . ARG A 115 ? 1.1892 0.7823 0.8107 0.0229  -0.0648 0.0021  583  ARG A CG  
786  C CD  . ARG A 115 ? 1.2385 0.8244 0.8634 0.0015  -0.0941 0.0079  583  ARG A CD  
787  N NE  . ARG A 115 ? 1.2259 0.8595 0.9021 -0.0167 -0.0916 0.0152  583  ARG A NE  
788  C CZ  . ARG A 115 ? 1.2259 0.8977 0.9386 -0.0260 -0.0930 0.0223  583  ARG A CZ  
789  N NH1 . ARG A 115 ? 1.2635 0.9292 0.9678 -0.0200 -0.0991 0.0234  583  ARG A NH1 
790  N NH2 . ARG A 115 ? 1.1801 0.8964 0.9352 -0.0386 -0.0879 0.0286  583  ARG A NH2 
791  N N   . ASP A 116 ? 1.0493 0.7527 0.7794 0.0190  -0.0111 0.0045  584  ASP A N   
792  C CA  . ASP A 116 ? 1.0199 0.7545 0.7819 0.0095  -0.0063 0.0036  584  ASP A CA  
793  C C   . ASP A 116 ? 1.0029 0.7490 0.7725 0.0169  0.0118  -0.0011 584  ASP A C   
794  O O   . ASP A 116 ? 1.0026 0.7528 0.7728 0.0160  0.0109  -0.0030 584  ASP A O   
795  C CB  . ASP A 116 ? 0.9972 0.7641 0.7937 0.0018  -0.0044 0.0063  584  ASP A CB  
796  C CG  . ASP A 116 ? 1.0160 0.7901 0.8192 -0.0099 -0.0234 0.0138  584  ASP A CG  
797  O OD1 . ASP A 116 ? 1.0459 0.7943 0.8254 -0.0155 -0.0408 0.0166  584  ASP A OD1 
798  O OD2 . ASP A 116 ? 1.0108 0.8169 0.8431 -0.0131 -0.0215 0.0173  584  ASP A OD2 
799  N N   . LEU A 117 ? 0.9985 0.7494 0.7735 0.0232  0.0266  -0.0014 585  LEU A N   
800  C CA  . LEU A 117 ? 0.9880 0.7550 0.7755 0.0273  0.0433  -0.0035 585  LEU A CA  
801  C C   . LEU A 117 ? 1.0101 0.7659 0.7747 0.0406  0.0471  -0.0040 585  LEU A C   
802  O O   . LEU A 117 ? 0.9995 0.7760 0.7787 0.0432  0.0556  -0.0055 585  LEU A O   
803  C CB  . LEU A 117 ? 0.9901 0.7595 0.7857 0.0281  0.0564  -0.0003 585  LEU A CB  
804  C CG  . LEU A 117 ? 0.9754 0.7513 0.7909 0.0202  0.0549  -0.0007 585  LEU A CG  
805  C CD1 . LEU A 117 ? 0.9802 0.7418 0.7892 0.0232  0.0633  0.0052  585  LEU A CD1 
806  C CD2 . LEU A 117 ? 0.9517 0.7521 0.7955 0.0119  0.0588  -0.0067 585  LEU A CD2 
807  N N   . ILE A 118 ? 1.0476 0.7704 0.7744 0.0510  0.0401  -0.0030 586  ILE A N   
808  C CA  . ILE A 118 ? 1.0840 0.7887 0.7797 0.0689  0.0421  -0.0050 586  ILE A CA  
809  C C   . ILE A 118 ? 1.0890 0.7930 0.7864 0.0672  0.0314  -0.0086 586  ILE A C   
810  O O   . ILE A 118 ? 1.0887 0.8049 0.7886 0.0791  0.0398  -0.0099 586  ILE A O   
811  C CB  . ILE A 118 ? 1.1309 0.7896 0.7759 0.0805  0.0309  -0.0057 586  ILE A CB  
812  C CG1 . ILE A 118 ? 1.1279 0.7847 0.7634 0.0864  0.0433  -0.0005 586  ILE A CG1 
813  C CG2 . ILE A 118 ? 1.1715 0.8011 0.7759 0.1018  0.0281  -0.0108 586  ILE A CG2 
814  C CD1 . ILE A 118 ? 1.1233 0.7722 0.7281 0.1097  0.0603  0.0012  586  ILE A CD1 
815  N N   . ASP A 119 ? 1.0992 0.7918 0.7970 0.0520  0.0130  -0.0082 587  ASP A N   
816  C CA  . ASP A 119 ? 1.1162 0.7983 0.8079 0.0471  -0.0009 -0.0086 587  ASP A CA  
817  C C   . ASP A 119 ? 1.0777 0.7989 0.8088 0.0333  0.0031  -0.0071 587  ASP A C   
818  O O   . ASP A 119 ? 1.0828 0.7996 0.8125 0.0245  -0.0085 -0.0045 587  ASP A O   
819  C CB  . ASP A 119 ? 1.1475 0.7936 0.8146 0.0356  -0.0250 -0.0061 587  ASP A CB  
820  C CG  . ASP A 119 ? 1.2247 0.8195 0.8398 0.0512  -0.0347 -0.0100 587  ASP A CG  
821  O OD1 . ASP A 119 ? 1.2571 0.8378 0.8474 0.0746  -0.0246 -0.0149 587  ASP A OD1 
822  O OD2 . ASP A 119 ? 1.2784 0.8480 0.8763 0.0411  -0.0532 -0.0082 587  ASP A OD2 
823  N N   . LEU A 120 ? 1.0513 0.8072 0.8136 0.0312  0.0188  -0.0084 588  LEU A N   
824  C CA  . LEU A 120 ? 1.0266 0.8157 0.8205 0.0199  0.0220  -0.0092 588  LEU A CA  
825  C C   . LEU A 120 ? 1.0315 0.8373 0.8330 0.0268  0.0271  -0.0116 588  LEU A C   
826  O O   . LEU A 120 ? 1.0329 0.8509 0.8411 0.0369  0.0385  -0.0130 588  LEU A O   
827  C CB  . LEU A 120 ? 1.0009 0.8115 0.8201 0.0143  0.0329  -0.0109 588  LEU A CB  
828  C CG  . LEU A 120 ? 0.9729 0.8116 0.8170 0.0049  0.0348  -0.0140 588  LEU A CG  
829  C CD1 . LEU A 120 ? 0.9719 0.8144 0.8202 -0.0038 0.0277  -0.0109 588  LEU A CD1 
830  C CD2 . LEU A 120 ? 0.9645 0.8187 0.8286 0.0037  0.0462  -0.0185 588  LEU A CD2 
831  N N   . CYS A 121 ? 1.0393 0.8492 0.8414 0.0206  0.0183  -0.0102 589  CYS A N   
832  C CA  . CYS A 121 ? 1.0411 0.8695 0.8514 0.0256  0.0194  -0.0118 589  CYS A CA  
833  C C   . CYS A 121 ? 1.0380 0.8756 0.8524 0.0126  0.0116  -0.0089 589  CYS A C   
834  O O   . CYS A 121 ? 1.0603 0.8767 0.8574 0.0059  0.0006  -0.0023 589  CYS A O   
835  C CB  . CYS A 121 ? 1.0733 0.8788 0.8579 0.0438  0.0148  -0.0106 589  CYS A CB  
836  S SG  . CYS A 121 ? 1.0828 0.9036 0.8700 0.0525  0.0098  -0.0098 589  CYS A SG  
837  N N   . CYS A 122 ? 1.0192 0.8876 0.8547 0.0082  0.0168  -0.0131 590  CYS A N   
838  C CA  . CYS A 122 ? 1.0118 0.8936 0.8496 -0.0022 0.0133  -0.0110 590  CYS A CA  
839  C C   . CYS A 122 ? 0.9986 0.9089 0.8543 -0.0033 0.0187  -0.0195 590  CYS A C   
840  O O   . CYS A 122 ? 0.9875 0.9073 0.8573 0.0005  0.0234  -0.0254 590  CYS A O   
841  C CB  . CYS A 122 ? 1.0093 0.8902 0.8500 -0.0126 0.0138  -0.0069 590  CYS A CB  
842  S SG  . CYS A 122 ? 0.9823 0.8736 0.8428 -0.0122 0.0249  -0.0148 590  CYS A SG  
843  N N   . LEU A 123 ? 1.0043 0.9278 0.8579 -0.0094 0.0174  -0.0193 591  LEU A N   
844  C CA  . LEU A 123 ? 1.0006 0.9447 0.8629 -0.0104 0.0197  -0.0292 591  LEU A CA  
845  C C   . LEU A 123 ? 0.9952 0.9405 0.8705 -0.0128 0.0275  -0.0374 591  LEU A C   
846  O O   . LEU A 123 ? 0.9957 0.9371 0.8708 -0.0142 0.0318  -0.0341 591  LEU A O   
847  C CB  . LEU A 123 ? 1.0074 0.9623 0.8562 -0.0133 0.0180  -0.0264 591  LEU A CB  
848  C CG  . LEU A 123 ? 1.0231 0.9734 0.8528 -0.0138 0.0104  -0.0144 591  LEU A CG  
849  C CD1 . LEU A 123 ? 1.0429 1.0103 0.8610 -0.0165 0.0133  -0.0128 591  LEU A CD1 
850  C CD2 . LEU A 123 ? 1.0310 0.9783 0.8564 -0.0059 0.0013  -0.0152 591  LEU A CD2 
851  N N   . MET A 124 ? 0.9978 0.9486 0.8850 -0.0138 0.0278  -0.0469 592  MET A N   
852  C CA  . MET A 124 ? 1.0010 0.9453 0.8968 -0.0166 0.0331  -0.0548 592  MET A CA  
853  C C   . MET A 124 ? 1.0211 0.9701 0.9136 -0.0190 0.0290  -0.0674 592  MET A C   
854  O O   . MET A 124 ? 1.0269 0.9842 0.9259 -0.0233 0.0215  -0.0720 592  MET A O   
855  C CB  . MET A 124 ? 0.9922 0.9312 0.9033 -0.0189 0.0362  -0.0535 592  MET A CB  
856  C CG  . MET A 124 ? 0.9888 0.9165 0.8964 -0.0141 0.0406  -0.0437 592  MET A CG  
857  S SD  . MET A 124 ? 0.9908 0.9178 0.9127 -0.0144 0.0474  -0.0400 592  MET A SD  
858  C CE  . MET A 124 ? 0.9911 0.9022 0.8942 -0.0030 0.0487  -0.0303 592  MET A CE  
859  N N   . THR A 125 ? 1.0398 0.9842 0.9211 -0.0150 0.0328  -0.0731 593  THR A N   
860  C CA  . THR A 125 ? 1.0737 1.0108 0.9459 -0.0150 0.0286  -0.0882 593  THR A CA  
861  C C   . THR A 125 ? 1.0835 1.0023 0.9701 -0.0227 0.0272  -0.0930 593  THR A C   
862  O O   . THR A 125 ? 1.0818 0.9863 0.9731 -0.0205 0.0342  -0.0898 593  THR A O   
863  C CB  . THR A 125 ? 1.0905 1.0267 0.9440 -0.0038 0.0351  -0.0936 593  THR A CB  
864  O OG1 . THR A 125 ? 1.1047 1.0614 0.9445 -0.0002 0.0358  -0.0874 593  THR A OG1 
865  C CG2 . THR A 125 ? 1.1297 1.0460 0.9670 -0.0007 0.0299  -0.1122 593  THR A CG2 
866  N N   . ILE A 126 ? 1.0966 1.0181 0.9913 -0.0330 0.0170  -0.0985 594  ILE A N   
867  C CA  . ILE A 126 ? 1.1104 1.0190 1.0222 -0.0456 0.0141  -0.0999 594  ILE A CA  
868  C C   . ILE A 126 ? 1.1527 1.0417 1.0531 -0.0536 0.0009  -0.1162 594  ILE A C   
869  O O   . ILE A 126 ? 1.1671 1.0659 1.0569 -0.0543 -0.0104 -0.1242 594  ILE A O   
870  C CB  . ILE A 126 ? 1.0898 1.0242 1.0281 -0.0538 0.0127  -0.0887 594  ILE A CB  
871  C CG1 . ILE A 126 ? 1.0687 1.0064 1.0133 -0.0463 0.0258  -0.0747 594  ILE A CG1 
872  C CG2 . ILE A 126 ? 1.1103 1.0423 1.0697 -0.0720 0.0060  -0.0897 594  ILE A CG2 
873  C CD1 . ILE A 126 ? 1.0624 1.0261 1.0278 -0.0471 0.0275  -0.0636 594  ILE A CD1 
874  N N   . SER A 127 ? 1.1807 1.0375 1.0795 -0.0593 0.0005  -0.1209 595  SER A N   
875  C CA  . SER A 127 ? 1.2304 1.0564 1.1148 -0.0688 -0.0149 -0.1370 595  SER A CA  
876  C C   . SER A 127 ? 1.2450 1.0697 1.1573 -0.0944 -0.0244 -0.1311 595  SER A C   
877  O O   . SER A 127 ? 1.2534 1.0583 1.1757 -0.1021 -0.0186 -0.1234 595  SER A O   
878  C CB  . SER A 127 ? 1.2622 1.0448 1.1193 -0.0558 -0.0108 -0.1473 595  SER A CB  
879  O OG  . SER A 127 ? 1.3167 1.0594 1.1516 -0.0631 -0.0279 -0.1650 595  SER A OG  
880  N N   . PHE A 128 ? 1.2576 1.1057 1.1829 -0.1082 -0.0395 -0.1333 596  PHE A N   
881  C CA  . PHE A 128 ? 1.2734 1.1350 1.2335 -0.1348 -0.0492 -0.1244 596  PHE A CA  
882  C C   . PHE A 128 ? 1.3353 1.1521 1.2828 -0.1550 -0.0698 -0.1378 596  PHE A C   
883  O O   . PHE A 128 ? 1.3707 1.1688 1.2904 -0.1541 -0.0880 -0.1564 596  PHE A O   
884  C CB  . PHE A 128 ? 1.2529 1.1677 1.2381 -0.1394 -0.0576 -0.1186 596  PHE A CB  
885  C CG  . PHE A 128 ? 1.2675 1.2140 1.2987 -0.1647 -0.0640 -0.1046 596  PHE A CG  
886  C CD1 . PHE A 128 ? 1.2427 1.2232 1.3065 -0.1633 -0.0449 -0.0836 596  PHE A CD1 
887  C CD2 . PHE A 128 ? 1.3160 1.2602 1.3574 -0.1902 -0.0897 -0.1118 596  PHE A CD2 
888  C CE1 . PHE A 128 ? 1.2556 1.2740 1.3649 -0.1855 -0.0477 -0.0681 596  PHE A CE1 
889  C CE2 . PHE A 128 ? 1.3166 1.2986 1.4072 -0.2165 -0.0958 -0.0958 596  PHE A CE2 
890  C CZ  . PHE A 128 ? 1.2928 1.3152 1.4192 -0.2136 -0.0731 -0.0729 596  PHE A CZ  
891  N N   . ASN A 129 ? 1.3586 1.1540 1.3223 -0.1732 -0.0679 -0.1280 597  ASN A N   
892  C CA  . ASN A 129 ? 1.4225 1.1786 1.3832 -0.2011 -0.0911 -0.1357 597  ASN A CA  
893  C C   . ASN A 129 ? 1.4188 1.2232 1.4305 -0.2325 -0.1016 -0.1198 597  ASN A C   
894  O O   . ASN A 129 ? 1.3881 1.2275 1.4375 -0.2402 -0.0849 -0.0969 597  ASN A O   
895  C CB  . ASN A 129 ? 1.4571 1.1545 1.4026 -0.2055 -0.0861 -0.1333 597  ASN A CB  
896  C CG  . ASN A 129 ? 1.5303 1.1739 1.4646 -0.2349 -0.1134 -0.1427 597  ASN A CG  
897  O OD1 . ASN A 129 ? 1.5387 1.2030 1.5104 -0.2693 -0.1257 -0.1297 597  ASN A OD1 
898  N ND2 . ASN A 129 ? 1.5844 1.1586 1.4667 -0.2210 -0.1238 -0.1650 597  ASN A ND2 
899  N N   . PRO A 130 ? 1.4535 1.2635 1.4664 -0.2492 -0.1292 -0.1313 598  PRO A N   
900  C CA  . PRO A 130 ? 1.4520 1.3180 1.5183 -0.2786 -0.1420 -0.1159 598  PRO A CA  
901  C C   . PRO A 130 ? 1.4969 1.3445 1.5908 -0.3175 -0.1511 -0.1022 598  PRO A C   
902  O O   . PRO A 130 ? 1.4724 1.3784 1.6218 -0.3377 -0.1454 -0.0780 598  PRO A O   
903  C CB  . PRO A 130 ? 1.4809 1.3478 1.5293 -0.2822 -0.1725 -0.1358 598  PRO A CB  
904  C CG  . PRO A 130 ? 1.5280 1.3172 1.5106 -0.2674 -0.1811 -0.1625 598  PRO A CG  
905  C CD  . PRO A 130 ? 1.4968 1.2657 1.4591 -0.2381 -0.1495 -0.1592 598  PRO A CD  
906  N N   . SER A 131 ? 1.5679 1.3346 1.6219 -0.3266 -0.1644 -0.1166 599  SER A N   
907  C CA  . SER A 131 ? 1.6293 1.3632 1.7010 -0.3664 -0.1771 -0.1044 599  SER A CA  
908  C C   . SER A 131 ? 1.6072 1.3537 1.7035 -0.3666 -0.1461 -0.0771 599  SER A C   
909  O O   . SER A 131 ? 1.5863 1.3926 1.7381 -0.3895 -0.1380 -0.0501 599  SER A O   
910  C CB  . SER A 131 ? 1.7138 1.3468 1.7271 -0.3724 -0.2026 -0.1296 599  SER A CB  
911  O OG  . SER A 131 ? 1.7160 1.3040 1.6735 -0.3296 -0.1878 -0.1488 599  SER A OG  
912  N N   . LEU A 132 ? 1.6161 1.3111 1.6715 -0.3394 -0.1284 -0.0831 600  LEU A N   
913  C CA  . LEU A 132 ? 1.5993 1.3016 1.6694 -0.3353 -0.0995 -0.0585 600  LEU A CA  
914  C C   . LEU A 132 ? 1.5223 1.2993 1.6172 -0.3086 -0.0706 -0.0454 600  LEU A C   
915  O O   . LEU A 132 ? 1.4991 1.2797 1.5929 -0.2935 -0.0453 -0.0308 600  LEU A O   
916  C CB  . LEU A 132 ? 1.6417 1.2592 1.6612 -0.3195 -0.0954 -0.0675 600  LEU A CB  
917  C CG  . LEU A 132 ? 1.6427 1.2263 1.6116 -0.2759 -0.0892 -0.0917 600  LEU A CG  
918  C CD1 . LEU A 132 ? 1.6000 1.2070 1.5707 -0.2473 -0.0577 -0.0777 600  LEU A CD1 
919  C CD2 . LEU A 132 ? 1.7171 1.2052 1.6334 -0.2728 -0.1075 -0.1119 600  LEU A CD2 
920  N N   . SER A 133 ? 1.4920 1.3230 1.6042 -0.3021 -0.0772 -0.0521 601  SER A N   
921  C CA  . SER A 133 ? 1.4343 1.3462 1.5847 -0.2897 -0.0583 -0.0355 601  SER A CA  
922  C C   . SER A 133 ? 1.3868 1.3104 1.5180 -0.2502 -0.0323 -0.0352 601  SER A C   
923  O O   . SER A 133 ? 1.3450 1.3236 1.4936 -0.2342 -0.0248 -0.0311 601  SER A O   
924  C CB  . SER A 133 ? 1.4332 1.3919 1.6361 -0.3170 -0.0484 -0.0053 601  SER A CB  
925  O OG  . SER A 133 ? 1.3866 1.4210 1.6210 -0.2986 -0.0292 0.0088  601  SER A OG  
926  N N   . LYS A 134 ? 1.3971 1.2694 1.4933 -0.2349 -0.0206 -0.0386 602  LYS A N   
927  C CA  . LYS A 134 ? 1.3547 1.2355 1.4328 -0.2008 0.0008  -0.0377 602  LYS A CA  
928  C C   . LYS A 134 ? 1.3478 1.1916 1.3826 -0.1758 -0.0035 -0.0598 602  LYS A C   
929  O O   . LYS A 134 ? 1.3876 1.1802 1.3952 -0.1790 -0.0168 -0.0753 602  LYS A O   
930  C CB  . LYS A 134 ? 1.3554 1.2286 1.4352 -0.1981 0.0225  -0.0177 602  LYS A CB  
931  C CG  . LYS A 134 ? 1.4076 1.2127 1.4580 -0.2017 0.0211  -0.0198 602  LYS A CG  
932  C CD  . LYS A 134 ? 1.4276 1.2323 1.4811 -0.2002 0.0425  0.0035  602  LYS A CD  
933  C CE  . LYS A 134 ? 1.3858 1.2165 1.4291 -0.1689 0.0615  0.0073  602  LYS A CE  
934  N NZ  . LYS A 134 ? 1.3762 1.2255 1.4278 -0.1680 0.0827  0.0316  602  LYS A NZ  
935  N N   . ALA A 135 ? 1.2975 1.1677 1.3258 -0.1508 0.0080  -0.0601 603  ALA A N   
936  C CA  . ALA A 135 ? 1.2854 1.1386 1.2809 -0.1285 0.0055  -0.0770 603  ALA A CA  
937  C C   . ALA A 135 ? 1.2737 1.1000 1.2466 -0.1090 0.0193  -0.0752 603  ALA A C   
938  O O   . ALA A 135 ? 1.2790 1.0960 1.2576 -0.1115 0.0300  -0.0618 603  ALA A O   
939  C CB  . ALA A 135 ? 1.2547 1.1517 1.2566 -0.1165 0.0057  -0.0773 603  ALA A CB  
940  N N   . MET A 136 ? 1.2592 1.0773 1.2073 -0.0896 0.0190  -0.0872 604  MET A N   
941  C CA  . MET A 136 ? 1.2499 1.0459 1.1788 -0.0712 0.0286  -0.0869 604  MET A CA  
942  C C   . MET A 136 ? 1.2142 1.0319 1.1316 -0.0524 0.0323  -0.0908 604  MET A C   
943  O O   . MET A 136 ? 1.2256 1.0435 1.1282 -0.0468 0.0255  -0.1038 604  MET A O   
944  C CB  . MET A 136 ? 1.3007 1.0474 1.2076 -0.0701 0.0214  -0.0991 604  MET A CB  
945  C CG  . MET A 136 ? 1.3257 1.0516 1.2121 -0.0469 0.0289  -0.1015 604  MET A CG  
946  S SD  . MET A 136 ? 1.4211 1.0835 1.2767 -0.0415 0.0182  -0.1185 604  MET A SD  
947  C CE  . MET A 136 ? 1.4459 1.0725 1.3117 -0.0626 0.0176  -0.1030 604  MET A CE  
948  N N   . VAL A 137 ? 1.1721 1.0060 1.0940 -0.0435 0.0422  -0.0787 605  VAL A N   
949  C CA  . VAL A 137 ? 1.1360 0.9918 1.0508 -0.0309 0.0447  -0.0777 605  VAL A CA  
950  C C   . VAL A 137 ? 1.1400 0.9854 1.0384 -0.0165 0.0467  -0.0843 605  VAL A C   
951  O O   . VAL A 137 ? 1.1438 0.9706 1.0390 -0.0097 0.0506  -0.0818 605  VAL A O   
952  C CB  . VAL A 137 ? 1.1118 0.9795 1.0325 -0.0274 0.0514  -0.0633 605  VAL A CB  
953  C CG1 . VAL A 137 ? 1.0973 0.9814 1.0100 -0.0186 0.0510  -0.0607 605  VAL A CG1 
954  C CG2 . VAL A 137 ? 1.1035 0.9871 1.0392 -0.0357 0.0521  -0.0564 605  VAL A CG2 
955  N N   . LEU A 138 ? 1.1382 0.9989 1.0263 -0.0102 0.0447  -0.0913 606  LEU A N   
956  C CA  . LEU A 138 ? 1.1527 1.0108 1.0252 0.0060  0.0485  -0.0983 606  LEU A CA  
957  C C   . LEU A 138 ? 1.1284 1.0171 1.0038 0.0142  0.0550  -0.0874 606  LEU A C   
958  O O   . LEU A 138 ? 1.1342 1.0282 1.0084 0.0274  0.0610  -0.0854 606  LEU A O   
959  C CB  . LEU A 138 ? 1.1822 1.0333 1.0347 0.0093  0.0426  -0.1149 606  LEU A CB  
960  C CG  . LEU A 138 ? 1.2124 1.0287 1.0577 -0.0009 0.0316  -0.1280 606  LEU A CG  
961  C CD1 . LEU A 138 ? 1.2303 1.0487 1.0569 -0.0021 0.0216  -0.1418 606  LEU A CD1 
962  C CD2 . LEU A 138 ? 1.2477 1.0247 1.0788 0.0102  0.0327  -0.1358 606  LEU A CD2 
963  N N   . ALA A 139 ? 1.1009 1.0104 0.9807 0.0063  0.0529  -0.0796 607  ALA A N   
964  C CA  . ALA A 139 ? 1.0777 1.0114 0.9607 0.0083  0.0562  -0.0666 607  ALA A CA  
965  C C   . ALA A 139 ? 1.0554 0.9909 0.9444 -0.0021 0.0513  -0.0560 607  ALA A C   
966  O O   . ALA A 139 ? 1.0531 0.9796 0.9448 -0.0078 0.0474  -0.0590 607  ALA A O   
967  C CB  . ALA A 139 ? 1.0899 1.0451 0.9601 0.0140  0.0590  -0.0688 607  ALA A CB  
968  N N   . LEU A 140 ? 1.0410 0.9880 0.9318 -0.0039 0.0508  -0.0430 608  LEU A N   
969  C CA  . LEU A 140 ? 1.0310 0.9727 0.9199 -0.0109 0.0446  -0.0336 608  LEU A CA  
970  C C   . LEU A 140 ? 1.0398 0.9984 0.9235 -0.0150 0.0425  -0.0228 608  LEU A C   
971  O O   . LEU A 140 ? 1.0405 1.0115 0.9306 -0.0166 0.0437  -0.0137 608  LEU A O   
972  C CB  . LEU A 140 ? 1.0220 0.9475 0.9143 -0.0114 0.0427  -0.0273 608  LEU A CB  
973  C CG  . LEU A 140 ? 1.0118 0.9192 0.9074 -0.0088 0.0460  -0.0333 608  LEU A CG  
974  C CD1 . LEU A 140 ? 0.9994 0.8929 0.8937 -0.0068 0.0449  -0.0265 608  LEU A CD1 
975  C CD2 . LEU A 140 ? 1.0088 0.9116 0.9027 -0.0106 0.0447  -0.0343 608  LEU A CD2 
976  N N   . GLN A 141 ? 1.0555 1.0173 0.9289 -0.0173 0.0388  -0.0221 609  GLN A N   
977  C CA  . GLN A 141 ? 1.0756 1.0494 0.9408 -0.0234 0.0362  -0.0089 609  GLN A CA  
978  C C   . GLN A 141 ? 1.0809 1.0317 0.9384 -0.0296 0.0255  0.0009  609  GLN A C   
979  O O   . GLN A 141 ? 1.0810 1.0150 0.9331 -0.0250 0.0213  -0.0046 609  GLN A O   
980  C CB  . GLN A 141 ? 1.0927 1.0783 0.9442 -0.0206 0.0371  -0.0132 609  GLN A CB  
981  C CG  . GLN A 141 ? 1.1262 1.1361 0.9698 -0.0235 0.0423  -0.0013 609  GLN A CG  
982  C CD  . GLN A 141 ? 1.1804 1.2033 1.0073 -0.0148 0.0471  -0.0112 609  GLN A CD  
983  O OE1 . GLN A 141 ? 1.1918 1.2126 1.0182 -0.0055 0.0506  -0.0284 609  GLN A OE1 
984  N NE2 . GLN A 141 ? 1.2197 1.2520 1.0287 -0.0181 0.0458  -0.0003 609  GLN A NE2 
985  N N   . ASP A 142 ? 1.0918 1.0418 0.9486 -0.0396 0.0204  0.0155  610  ASP A N   
986  C CA  . ASP A 142 ? 1.1148 1.0337 0.9567 -0.0457 0.0072  0.0243  610  ASP A CA  
987  C C   . ASP A 142 ? 1.1324 1.0458 0.9562 -0.0491 0.0014  0.0324  610  ASP A C   
988  O O   . ASP A 142 ? 1.1440 1.0793 0.9683 -0.0574 0.0045  0.0431  610  ASP A O   
989  C CB  . ASP A 142 ? 1.1256 1.0424 0.9737 -0.0585 0.0001  0.0371  610  ASP A CB  
990  C CG  . ASP A 142 ? 1.1645 1.0383 0.9950 -0.0602 -0.0144 0.0385  610  ASP A CG  
991  O OD1 . ASP A 142 ? 1.1919 1.0381 1.0030 -0.0503 -0.0180 0.0323  610  ASP A OD1 
992  O OD2 . ASP A 142 ? 1.1800 1.0485 1.0150 -0.0700 -0.0230 0.0457  610  ASP A OD2 
993  N N   . VAL A 143 ? 1.1421 1.0280 0.9492 -0.0411 -0.0063 0.0289  611  VAL A N   
994  C CA  . VAL A 143 ? 1.1591 1.0381 0.9471 -0.0394 -0.0125 0.0349  611  VAL A CA  
995  C C   . VAL A 143 ? 1.1875 1.0495 0.9580 -0.0549 -0.0229 0.0550  611  VAL A C   
996  O O   . VAL A 143 ? 1.2123 1.0373 0.9688 -0.0606 -0.0356 0.0618  611  VAL A O   
997  C CB  . VAL A 143 ? 1.1669 1.0246 0.9437 -0.0226 -0.0182 0.0265  611  VAL A CB  
998  C CG1 . VAL A 143 ? 1.1365 1.0166 0.9344 -0.0121 -0.0083 0.0105  611  VAL A CG1 
999  C CG2 . VAL A 143 ? 1.1956 1.0105 0.9546 -0.0191 -0.0285 0.0296  611  VAL A CG2 
1000 N N   . ASN A 144 ? 1.1891 1.0752 0.9571 -0.0621 -0.0182 0.0649  612  ASN A N   
1001 C CA  . ASN A 144 ? 1.2166 1.0936 0.9717 -0.0811 -0.0258 0.0881  612  ASN A CA  
1002 C C   . ASN A 144 ? 1.2456 1.1040 0.9717 -0.0792 -0.0335 0.0980  612  ASN A C   
1003 O O   . ASN A 144 ? 1.2462 1.1010 0.9631 -0.0613 -0.0342 0.0859  612  ASN A O   
1004 C CB  . ASN A 144 ? 1.2063 1.1303 0.9826 -0.0940 -0.0126 0.0988  612  ASN A CB  
1005 C CG  . ASN A 144 ? 1.2083 1.1692 0.9822 -0.0840 0.0022  0.0945  612  ASN A CG  
1006 O OD1 . ASN A 144 ? 1.2358 1.1865 0.9864 -0.0783 -0.0015 0.0958  612  ASN A OD1 
1007 N ND2 . ASN A 144 ? 1.1974 1.1992 0.9918 -0.0801 0.0179  0.0890  612  ASN A ND2 
1008 N N   . MET A 145 ? 1.2770 1.1255 0.9897 -0.0986 -0.0399 0.1215  613  MET A N   
1009 C CA  . MET A 145 ? 1.3191 1.1369 0.9979 -0.0979 -0.0509 0.1343  613  MET A CA  
1010 C C   . MET A 145 ? 1.3130 1.1643 0.9841 -0.0876 -0.0401 0.1329  613  MET A C   
1011 O O   . MET A 145 ? 1.3392 1.1685 0.9830 -0.0779 -0.0491 0.1362  613  MET A O   
1012 C CB  . MET A 145 ? 1.3648 1.1602 1.0311 -0.1259 -0.0616 0.1630  613  MET A CB  
1013 C CG  . MET A 145 ? 1.4232 1.1568 1.0486 -0.1257 -0.0816 0.1747  613  MET A CG  
1014 S SD  . MET A 145 ? 1.5094 1.2257 1.1232 -0.1656 -0.0919 0.2131  613  MET A SD  
1015 C CE  . MET A 145 ? 1.4804 1.1874 1.1200 -0.1879 -0.1017 0.2135  613  MET A CE  
1016 N N   . GLU A 146 ? 1.2824 1.1847 0.9744 -0.0880 -0.0219 0.1279  614  GLU A N   
1017 C CA  . GLU A 146 ? 1.2788 1.2124 0.9605 -0.0758 -0.0114 0.1219  614  GLU A CA  
1018 C C   . GLU A 146 ? 1.2569 1.1839 0.9382 -0.0536 -0.0164 0.0965  614  GLU A C   
1019 O O   . GLU A 146 ? 1.2723 1.2010 0.9332 -0.0428 -0.0206 0.0935  614  GLU A O   
1020 C CB  . GLU A 146 ? 1.2589 1.2433 0.9607 -0.0781 0.0091  0.1202  614  GLU A CB  
1021 C CG  . GLU A 146 ? 1.2913 1.3059 0.9720 -0.0696 0.0210  0.1217  614  GLU A CG  
1022 C CD  . GLU A 146 ? 1.2881 1.3109 0.9655 -0.0479 0.0230  0.0925  614  GLU A CD  
1023 O OE1 . GLU A 146 ? 1.3205 1.3531 0.9701 -0.0383 0.0249  0.0900  614  GLU A OE1 
1024 O OE2 . GLU A 146 ? 1.2577 1.2755 0.9583 -0.0418 0.0215  0.0728  614  GLU A OE2 
1025 N N   . HIS A 147 ? 1.2246 1.1460 0.9291 -0.0480 -0.0169 0.0799  615  HIS A N   
1026 C CA  . HIS A 147 ? 1.2070 1.1245 0.9173 -0.0303 -0.0220 0.0595  615  HIS A CA  
1027 C C   . HIS A 147 ? 1.2389 1.1223 0.9280 -0.0213 -0.0382 0.0656  615  HIS A C   
1028 O O   . HIS A 147 ? 1.2422 1.1321 0.9266 -0.0068 -0.0443 0.0570  615  HIS A O   
1029 C CB  . HIS A 147 ? 1.1705 1.0877 0.9083 -0.0279 -0.0175 0.0453  615  HIS A CB  
1030 C CG  . HIS A 147 ? 1.1416 1.0892 0.8994 -0.0314 -0.0030 0.0364  615  HIS A CG  
1031 N ND1 . HIS A 147 ? 1.1261 1.0767 0.8999 -0.0409 0.0031  0.0413  615  HIS A ND1 
1032 C CD2 . HIS A 147 ? 1.1369 1.1099 0.8985 -0.0249 0.0049  0.0226  615  HIS A CD2 
1033 C CE1 . HIS A 147 ? 1.1109 1.0891 0.8986 -0.0377 0.0155  0.0314  615  HIS A CE1 
1034 N NE2 . HIS A 147 ? 1.1205 1.1093 0.8989 -0.0281 0.0168  0.0193  615  HIS A NE2 
1035 N N   . LEU A 148 ? 1.2686 1.1145 0.9439 -0.0295 -0.0469 0.0806  616  LEU A N   
1036 C CA  . LEU A 148 ? 1.3108 1.1145 0.9597 -0.0184 -0.0634 0.0871  616  LEU A CA  
1037 C C   . LEU A 148 ? 1.3483 1.1544 0.9717 -0.0131 -0.0696 0.0968  616  LEU A C   
1038 O O   . LEU A 148 ? 1.3651 1.1599 0.9777 0.0066  -0.0802 0.0922  616  LEU A O   
1039 C CB  . LEU A 148 ? 1.3417 1.0961 0.9730 -0.0315 -0.0741 0.1022  616  LEU A CB  
1040 C CG  . LEU A 148 ? 1.3969 1.0925 0.9886 -0.0255 -0.0935 0.1155  616  LEU A CG  
1041 C CD1 . LEU A 148 ? 1.3955 1.0760 0.9785 0.0066  -0.1011 0.1020  616  LEU A CD1 
1042 C CD2 . LEU A 148 ? 1.4243 1.0692 1.0014 -0.0427 -0.1052 0.1265  616  LEU A CD2 
1043 N N   . GLU A 149 ? 1.3687 1.1931 0.9828 -0.0287 -0.0625 0.1108  617  GLU A N   
1044 C CA  . GLU A 149 ? 1.4165 1.2423 1.0001 -0.0245 -0.0676 0.1224  617  GLU A CA  
1045 C C   . GLU A 149 ? 1.4027 1.2658 0.9920 -0.0080 -0.0651 0.1036  617  GLU A C   
1046 O O   . GLU A 149 ? 1.4301 1.2899 0.9948 0.0033  -0.0755 0.1073  617  GLU A O   
1047 C CB  . GLU A 149 ? 1.4412 1.2765 1.0102 -0.0466 -0.0589 0.1465  617  GLU A CB  
1048 C CG  . GLU A 149 ? 1.4753 1.2827 1.0468 -0.0707 -0.0617 0.1665  617  GLU A CG  
1049 C CD  . GLU A 149 ? 1.5477 1.2892 1.0865 -0.0726 -0.0835 0.1826  617  GLU A CD  
1050 O OE1 . GLU A 149 ? 1.5822 1.3015 1.0931 -0.0546 -0.0950 0.1832  617  GLU A OE1 
1051 O OE2 . GLU A 149 ? 1.5734 1.2822 1.1125 -0.0918 -0.0910 0.1949  617  GLU A OE2 
1052 N N   . ASN A 150 ? 1.3679 1.2630 0.9878 -0.0074 -0.0534 0.0837  618  ASN A N   
1053 C CA  . ASN A 150 ? 1.3587 1.2843 0.9876 0.0048  -0.0536 0.0630  618  ASN A CA  
1054 C C   . ASN A 150 ? 1.3590 1.2791 0.9959 0.0221  -0.0690 0.0533  618  ASN A C   
1055 O O   . ASN A 150 ? 1.3627 1.3026 0.9972 0.0318  -0.0775 0.0435  618  ASN A O   
1056 C CB  . ASN A 150 ? 1.3201 1.2697 0.9803 0.0002  -0.0397 0.0451  618  ASN A CB  
1057 C CG  . ASN A 150 ? 1.3279 1.3014 0.9789 -0.0065 -0.0248 0.0456  618  ASN A CG  
1058 O OD1 . ASN A 150 ? 1.3113 1.2993 0.9833 -0.0100 -0.0124 0.0358  618  ASN A OD1 
1059 N ND2 . ASN A 150 ? 1.3612 1.3392 0.9786 -0.0056 -0.0254 0.0573  618  ASN A ND2 
1060 N N   . LEU A 151 ? 1.3585 1.2534 1.0051 0.0267  -0.0728 0.0562  619  LEU A N   
1061 C CA  . LEU A 151 ? 1.3644 1.2576 1.0216 0.0463  -0.0840 0.0491  619  LEU A CA  
1062 C C   . LEU A 151 ? 1.4181 1.2831 1.0417 0.0598  -0.1004 0.0642  619  LEU A C   
1063 O O   . LEU A 151 ? 1.4298 1.3022 1.0582 0.0803  -0.1119 0.0601  619  LEU A O   
1064 C CB  . LEU A 151 ? 1.3430 1.2207 1.0205 0.0493  -0.0785 0.0442  619  LEU A CB  
1065 C CG  . LEU A 151 ? 1.3132 1.2151 1.0227 0.0650  -0.0783 0.0299  619  LEU A CG  
1066 C CD1 . LEU A 151 ? 1.2863 1.2348 1.0211 0.0610  -0.0772 0.0162  619  LEU A CD1 
1067 C CD2 . LEU A 151 ? 1.2855 1.1759 1.0115 0.0619  -0.0670 0.0249  619  LEU A CD2 
1068 N N   . LYS A 152 ? 1.4560 1.2900 1.0464 0.0482  -0.1019 0.0834  620  LYS A N   
1069 C CA  . LYS A 152 ? 1.5152 1.3162 1.0681 0.0594  -0.1181 0.0999  620  LYS A CA  
1070 C C   . LYS A 152 ? 1.5336 1.3646 1.0746 0.0679  -0.1256 0.0982  620  LYS A C   
1071 O O   . LYS A 152 ? 1.5579 1.3845 1.0887 0.0893  -0.1418 0.0995  620  LYS A O   
1072 C CB  . LYS A 152 ? 1.5543 1.3133 1.0755 0.0396  -0.1179 0.1237  620  LYS A CB  
1073 C CG  . LYS A 152 ? 1.5680 1.2812 1.0890 0.0348  -0.1206 0.1274  620  LYS A CG  
1074 C CD  . LYS A 152 ? 1.6387 1.2946 1.1188 0.0201  -0.1316 0.1541  620  LYS A CD  
1075 C CE  . LYS A 152 ? 1.6668 1.2636 1.1367 0.0209  -0.1418 0.1550  620  LYS A CE  
1076 N NZ  . LYS A 152 ? 1.7362 1.2663 1.1625 0.0056  -0.1577 0.1810  620  LYS A NZ  
1077 N N   . LYS A 153 ? 1.5260 1.3879 1.0677 0.0533  -0.1143 0.0941  621  LYS A N   
1078 C CA  . LYS A 153 ? 1.5492 1.4368 1.0720 0.0589  -0.1209 0.0909  621  LYS A CA  
1079 C C   . LYS A 153 ? 1.5282 1.4503 1.0796 0.0732  -0.1312 0.0690  621  LYS A C   
1080 O O   . LYS A 153 ? 1.5573 1.4895 1.0934 0.0864  -0.1483 0.0690  621  LYS A O   
1081 C CB  . LYS A 153 ? 1.5424 1.4518 1.0565 0.0422  -0.1036 0.0895  621  LYS A CB  
1082 C CG  . LYS A 153 ? 1.5760 1.4647 1.0672 0.0250  -0.0918 0.1144  621  LYS A CG  
1083 C CD  . LYS A 153 ? 1.5861 1.5040 1.0632 0.0152  -0.0743 0.1158  621  LYS A CD  
1084 C CE  . LYS A 153 ? 1.6181 1.5230 1.0758 -0.0033 -0.0630 0.1458  621  LYS A CE  
1085 N NZ  . LYS A 153 ? 1.6292 1.5703 1.0769 -0.0100 -0.0416 0.1486  621  LYS A NZ  
1086 N N   . ARG A 154 ? 1.4836 1.4246 1.0769 0.0687  -0.1218 0.0521  622  ARG A N   
1087 C CA  . ARG A 154 ? 1.4602 1.4362 1.0897 0.0767  -0.1297 0.0334  622  ARG A CA  
1088 C C   . ARG A 154 ? 1.4771 1.4534 1.1155 0.0990  -0.1458 0.0384  622  ARG A C   
1089 O O   . ARG A 154 ? 1.4786 1.4883 1.1348 0.1085  -0.1602 0.0303  622  ARG A O   
1090 C CB  . ARG A 154 ? 1.4142 1.4005 1.0824 0.0661  -0.1137 0.0204  622  ARG A CB  
1091 C CG  . ARG A 154 ? 1.3861 1.4094 1.0943 0.0654  -0.1176 0.0018  622  ARG A CG  
1092 C CD  . ARG A 154 ? 1.3498 1.3724 1.0832 0.0520  -0.0989 -0.0071 622  ARG A CD  
1093 N NE  . ARG A 154 ? 1.3166 1.3674 1.0927 0.0496  -0.0996 -0.0202 622  ARG A NE  
1094 C CZ  . ARG A 154 ? 1.2807 1.3323 1.0794 0.0382  -0.0858 -0.0287 622  ARG A CZ  
1095 N NH1 . ARG A 154 ? 1.2631 1.2923 1.0475 0.0302  -0.0710 -0.0266 622  ARG A NH1 
1096 N NH2 . ARG A 154 ? 1.2710 1.3480 1.1076 0.0343  -0.0872 -0.0374 622  ARG A NH2 
1097 N N   . LEU A 155 ? 1.4977 1.4364 1.1230 0.1080  -0.1446 0.0520  623  LEU A N   
1098 C CA  . LEU A 155 ? 1.5281 1.4584 1.1519 0.1350  -0.1593 0.0587  623  LEU A CA  
1099 C C   . LEU A 155 ? 1.5901 1.4925 1.1660 0.1448  -0.1757 0.0760  623  LEU A C   
1100 O O   . LEU A 155 ? 1.6265 1.4932 1.1813 0.1645  -0.1855 0.0881  623  LEU A O   
1101 C CB  . LEU A 155 ? 1.5269 1.4231 1.1548 0.1439  -0.1515 0.0620  623  LEU A CB  
1102 C CG  . LEU A 155 ? 1.4791 1.3960 1.1487 0.1375  -0.1349 0.0479  623  LEU A CG  
1103 C CD1 . LEU A 155 ? 1.4967 1.3706 1.1557 0.1506  -0.1307 0.0523  623  LEU A CD1 
1104 C CD2 . LEU A 155 ? 1.4535 1.4298 1.1699 0.1463  -0.1369 0.0351  623  LEU A CD2 
1105 N N   . ASN A 156 ? 1.6111 1.5267 1.1660 0.1321  -0.1783 0.0767  624  ASN A N   
1106 C CA  . ASN A 156 ? 1.6747 1.5725 1.1819 0.1398  -0.1939 0.0926  624  ASN A CA  
1107 C C   . ASN A 156 ? 1.7289 1.5661 1.1948 0.1464  -0.1985 0.1164  624  ASN A C   
1108 O O   . ASN A 156 ? 1.7739 1.5924 1.2161 0.1692  -0.2175 0.1274  624  ASN A O   
1109 C CB  . ASN A 156 ? 1.6873 1.6229 1.2051 0.1599  -0.2162 0.0854  624  ASN A CB  
1110 C CG  . ASN A 156 ? 1.6555 1.6437 1.2061 0.1473  -0.2158 0.0631  624  ASN A CG  
1111 O OD1 . ASN A 156 ? 1.6432 1.6333 1.1833 0.1268  -0.2031 0.0561  624  ASN A OD1 
1112 N ND2 . ASN A 156 ? 1.6439 1.6747 1.2344 0.1600  -0.2305 0.0526  624  ASN A ND2 
1113 N N   . LYS A 157 ? 1.7277 1.5334 1.1854 0.1256  -0.1826 0.1245  625  LYS A N   
1114 C CA  . LYS A 157 ? 1.7812 1.5238 1.1974 0.1216  -0.1868 0.1489  625  LYS A CA  
1115 C C   . LYS A 157 ? 1.8089 1.5447 1.1904 0.0967  -0.1785 0.1674  625  LYS A C   
1116 O O   . LYS A 157 ? 1.8582 1.5823 1.1991 0.1022  -0.1895 0.1833  625  LYS A O   
1117 C CB  . LYS A 157 ? 1.7642 1.4741 1.1957 0.1143  -0.1781 0.1471  625  LYS A CB  
1118 C CG  . LYS A 157 ? 1.7347 1.4541 1.1990 0.1396  -0.1812 0.1293  625  LYS A CG  
1119 C CD  . LYS A 157 ? 1.7291 1.4042 1.1939 0.1349  -0.1754 0.1293  625  LYS A CD  
1120 C CE  . LYS A 157 ? 1.6818 1.3843 1.1878 0.1536  -0.1688 0.1084  625  LYS A CE  
1121 N NZ  . LYS A 157 ? 1.6939 1.4029 1.2022 0.1926  -0.1816 0.1047  625  LYS A NZ  
1122 N N   . ALA B 16  ? 1.6407 1.2527 1.6172 -0.0932 0.2948  0.2193  13   ALA B N   
1123 C CA  . ALA B 16  ? 1.6828 1.2956 1.6690 -0.0839 0.3198  0.2769  13   ALA B CA  
1124 C C   . ALA B 16  ? 1.6540 1.3456 1.6115 -0.0671 0.3126  0.2993  13   ALA B C   
1125 O O   . ALA B 16  ? 1.6615 1.3910 1.6342 -0.0849 0.3240  0.3065  13   ALA B O   
1126 C CB  . ALA B 16  ? 1.7166 1.2752 1.7014 -0.0573 0.3316  0.3082  13   ALA B CB  
1127 N N   . GLY B 17  ? 1.6278 1.3440 1.5449 -0.0342 0.2950  0.3091  14   GLY B N   
1128 C CA  . GLY B 17  ? 1.6057 1.3909 1.4829 -0.0176 0.2848  0.3202  14   GLY B CA  
1129 C C   . GLY B 17  ? 1.5498 1.3776 1.4078 -0.0173 0.2595  0.2724  14   GLY B C   
1130 O O   . GLY B 17  ? 1.5296 1.3971 1.3463 0.0033  0.2429  0.2695  14   GLY B O   
1131 N N   . VAL B 18  ? 1.5302 1.3485 1.4185 -0.0411 0.2563  0.2356  15   VAL B N   
1132 C CA  . VAL B 18  ? 1.4767 1.3235 1.3554 -0.0407 0.2310  0.1905  15   VAL B CA  
1133 C C   . VAL B 18  ? 1.4685 1.3521 1.3800 -0.0653 0.2353  0.1723  15   VAL B C   
1134 O O   . VAL B 18  ? 1.5000 1.3735 1.4507 -0.0912 0.2554  0.1859  15   VAL B O   
1135 C CB  . VAL B 18  ? 1.4596 1.2600 1.3381 -0.0403 0.2139  0.1609  15   VAL B CB  
1136 C CG1 . VAL B 18  ? 1.5046 1.2390 1.4001 -0.0439 0.2319  0.1802  15   VAL B CG1 
1137 C CG2 . VAL B 18  ? 1.4321 1.2380 1.3280 -0.0621 0.2010  0.1196  15   VAL B CG2 
1138 N N   . ARG B 19  ? 1.4270 1.3537 1.3279 -0.0571 0.2165  0.1441  16   ARG B N   
1139 C CA  . ARG B 19  ? 1.4111 1.3799 1.3497 -0.0767 0.2148  0.1254  16   ARG B CA  
1140 C C   . ARG B 19  ? 1.3620 1.3602 1.2893 -0.0639 0.1882  0.0912  16   ARG B C   
1141 O O   . ARG B 19  ? 1.3456 1.3661 1.2394 -0.0368 0.1826  0.0887  16   ARG B O   
1142 C CB  . ARG B 19  ? 1.4328 1.4510 1.3904 -0.0796 0.2415  0.1528  16   ARG B CB  
1143 C CG  . ARG B 19  ? 1.4538 1.5007 1.3622 -0.0474 0.2498  0.1691  16   ARG B CG  
1144 C CD  . ARG B 19  ? 1.5087 1.6096 1.4360 -0.0499 0.2801  0.1919  16   ARG B CD  
1145 N NE  . ARG B 19  ? 1.5148 1.6527 1.5073 -0.0740 0.2819  0.1786  16   ARG B NE  
1146 C CZ  . ARG B 19  ? 1.4900 1.6663 1.4965 -0.0667 0.2649  0.1493  16   ARG B CZ  
1147 N NH1 . ARG B 19  ? 1.4765 1.6525 1.4354 -0.0366 0.2476  0.1279  16   ARG B NH1 
1148 N NH2 . ARG B 19  ? 1.4833 1.6994 1.5557 -0.0905 0.2643  0.1431  16   ARG B NH2 
1149 N N   . LEU B 20  ? 1.3458 1.3415 1.2998 -0.0843 0.1716  0.0654  17   LEU B N   
1150 C CA  . LEU B 20  ? 1.3042 1.3216 1.2500 -0.0734 0.1448  0.0365  17   LEU B CA  
1151 C C   . LEU B 20  ? 1.2976 1.3548 1.2896 -0.0977 0.1322  0.0208  17   LEU B C   
1152 O O   . LEU B 20  ? 1.3236 1.3759 1.3518 -0.1304 0.1387  0.0239  17   LEU B O   
1153 C CB  . LEU B 20  ? 1.2943 1.2592 1.2048 -0.0649 0.1277  0.0201  17   LEU B CB  
1154 C CG  . LEU B 20  ? 1.3268 1.2286 1.2362 -0.0827 0.1357  0.0213  17   LEU B CG  
1155 C CD1 . LEU B 20  ? 1.3351 1.2093 1.2338 -0.0928 0.1165  -0.0087 17   LEU B CD1 
1156 C CD2 . LEU B 20  ? 1.3379 1.2042 1.2196 -0.0611 0.1467  0.0423  17   LEU B CD2 
1157 N N   . PRO B 21  ? 1.2675 1.3643 1.2614 -0.0827 0.1126  0.0052  18   PRO B N   
1158 C CA  . PRO B 21  ? 1.2610 1.4114 1.3034 -0.1005 0.0972  -0.0042 18   PRO B CA  
1159 C C   . PRO B 21  ? 1.2823 1.4061 1.3339 -0.1362 0.0777  -0.0225 18   PRO B C   
1160 O O   . PRO B 21  ? 1.2967 1.3587 1.3064 -0.1370 0.0716  -0.0356 18   PRO B O   
1161 C CB  . PRO B 21  ? 1.2304 1.4066 1.2577 -0.0698 0.0785  -0.0158 18   PRO B CB  
1162 C CG  . PRO B 21  ? 1.2232 1.3423 1.1919 -0.0481 0.0763  -0.0214 18   PRO B CG  
1163 C CD  . PRO B 21  ? 1.2424 1.3334 1.1956 -0.0482 0.1018  -0.0032 18   PRO B CD  
1164 N N   . ARG B 22  ? 1.2893 1.4617 1.3957 -0.1654 0.0681  -0.0244 19   ARG B N   
1165 C CA  . ARG B 22  ? 1.3226 1.4715 1.4400 -0.2077 0.0493  -0.0444 19   ARG B CA  
1166 C C   . ARG B 22  ? 1.3205 1.4487 1.3956 -0.2072 0.0157  -0.0728 19   ARG B C   
1167 O O   . ARG B 22  ? 1.3591 1.4347 1.4099 -0.2340 0.0068  -0.0945 19   ARG B O   
1168 C CB  . ARG B 22  ? 1.3375 1.5550 1.5315 -0.2418 0.0433  -0.0380 19   ARG B CB  
1169 C CG  . ARG B 22  ? 1.3512 1.5911 1.5940 -0.2506 0.0792  -0.0080 19   ARG B CG  
1170 C CD  . ARG B 22  ? 1.3876 1.6995 1.7162 -0.2897 0.0703  -0.0023 19   ARG B CD  
1171 N NE  . ARG B 22  ? 1.3751 1.7704 1.7361 -0.2771 0.0424  -0.0057 19   ARG B NE  
1172 C CZ  . ARG B 22  ? 1.3918 1.8090 1.7608 -0.2991 -0.0003 -0.0281 19   ARG B CZ  
1173 N NH1 . ARG B 22  ? 1.4429 1.8013 1.7840 -0.3373 -0.0199 -0.0552 19   ARG B NH1 
1174 N NH2 . ARG B 22  ? 1.3625 1.8601 1.7651 -0.2816 -0.0231 -0.0230 19   ARG B NH2 
1175 N N   . SER B 23  ? 1.2787 1.4456 1.3432 -0.1765 -0.0007 -0.0723 20   SER B N   
1176 C CA  . SER B 23  ? 1.2825 1.4374 1.3071 -0.1736 -0.0314 -0.0928 20   SER B CA  
1177 C C   . SER B 23  ? 1.2553 1.3649 1.2219 -0.1353 -0.0253 -0.0928 20   SER B C   
1178 O O   . SER B 23  ? 1.2227 1.3412 1.1909 -0.1044 -0.0088 -0.0769 20   SER B O   
1179 C CB  . SER B 23  ? 1.2745 1.5124 1.3397 -0.1751 -0.0619 -0.0904 20   SER B CB  
1180 O OG  . SER B 23  ? 1.2365 1.5280 1.3356 -0.1409 -0.0505 -0.0687 20   SER B OG  
1181 N N   . PRO B 24  ? 1.2736 1.3351 1.1883 -0.1386 -0.0380 -0.1115 21   PRO B N   
1182 C CA  . PRO B 24  ? 1.2578 1.2673 1.1216 -0.1097 -0.0280 -0.1111 21   PRO B CA  
1183 C C   . PRO B 24  ? 1.2129 1.2536 1.0749 -0.0731 -0.0352 -0.0987 21   PRO B C   
1184 O O   . PRO B 24  ? 1.2098 1.3035 1.0924 -0.0691 -0.0563 -0.0962 21   PRO B O   
1185 C CB  . PRO B 24  ? 1.3027 1.2709 1.1184 -0.1252 -0.0420 -0.1345 21   PRO B CB  
1186 C CG  . PRO B 24  ? 1.3470 1.3263 1.1833 -0.1672 -0.0542 -0.1507 21   PRO B CG  
1187 C CD  . PRO B 24  ? 1.3192 1.3780 1.2197 -0.1711 -0.0639 -0.1347 21   PRO B CD  
1188 N N   . PRO B 25  ? 1.1846 1.1921 1.0253 -0.0471 -0.0187 -0.0901 22   PRO B N   
1189 C CA  . PRO B 25  ? 1.1533 1.1736 0.9878 -0.0144 -0.0234 -0.0817 22   PRO B CA  
1190 C C   . PRO B 25  ? 1.1631 1.1891 0.9771 -0.0086 -0.0460 -0.0863 22   PRO B C   
1191 O O   . PRO B 25  ? 1.1943 1.1823 0.9705 -0.0177 -0.0487 -0.0960 22   PRO B O   
1192 C CB  . PRO B 25  ? 1.1432 1.1122 0.9500 -0.0003 -0.0064 -0.0773 22   PRO B CB  
1193 C CG  . PRO B 25  ? 1.1730 1.0987 0.9655 -0.0222 0.0053  -0.0836 22   PRO B CG  
1194 C CD  . PRO B 25  ? 1.1910 1.1439 1.0140 -0.0490 0.0044  -0.0875 22   PRO B CD  
1195 N N   . LEU B 26  ? 1.1460 1.2182 0.9833 0.0083  -0.0597 -0.0778 23   LEU B N   
1196 C CA  . LEU B 26  ? 1.1565 1.2384 0.9750 0.0157  -0.0820 -0.0758 23   LEU B CA  
1197 C C   . LEU B 26  ? 1.1412 1.1921 0.9385 0.0450  -0.0765 -0.0665 23   LEU B C   
1198 O O   . LEU B 26  ? 1.1215 1.1736 0.9384 0.0654  -0.0656 -0.0600 23   LEU B O   
1199 C CB  . LEU B 26  ? 1.1543 1.3068 1.0162 0.0187  -0.1024 -0.0665 23   LEU B CB  
1200 C CG  . LEU B 26  ? 1.1903 1.3613 1.0296 0.0040  -0.1323 -0.0695 23   LEU B CG  
1201 C CD1 . LEU B 26  ? 1.2164 1.4064 1.0659 -0.0368 -0.1435 -0.0857 23   LEU B CD1 
1202 C CD2 . LEU B 26  ? 1.1824 1.4103 1.0517 0.0272  -0.1532 -0.0491 23   LEU B CD2 
1203 N N   . LYS B 27  ? 1.1573 1.1790 0.9134 0.0458  -0.0828 -0.0668 24   LYS B N   
1204 C CA  . LYS B 27  ? 1.1481 1.1452 0.8910 0.0711  -0.0789 -0.0539 24   LYS B CA  
1205 C C   . LYS B 27  ? 1.1435 1.1813 0.9143 0.0921  -0.0942 -0.0383 24   LYS B C   
1206 O O   . LYS B 27  ? 1.1685 1.2387 0.9343 0.0894  -0.1150 -0.0317 24   LYS B O   
1207 C CB  . LYS B 27  ? 1.1810 1.1429 0.8741 0.0672  -0.0786 -0.0541 24   LYS B CB  
1208 C CG  . LYS B 27  ? 1.2018 1.1213 0.8679 0.0491  -0.0611 -0.0695 24   LYS B CG  
1209 C CD  . LYS B 27  ? 1.2471 1.1327 0.8619 0.0487  -0.0557 -0.0706 24   LYS B CD  
1210 C CE  . LYS B 27  ? 1.2602 1.0965 0.8607 0.0423  -0.0292 -0.0798 24   LYS B CE  
1211 N NZ  . LYS B 27  ? 1.3083 1.1118 0.8725 0.0541  -0.0145 -0.0718 24   LYS B NZ  
1212 N N   . VAL B 28  ? 1.1192 1.1558 0.9191 0.1134  -0.0842 -0.0327 25   VAL B N   
1213 C CA  . VAL B 28  ? 1.1192 1.1863 0.9511 0.1386  -0.0929 -0.0173 25   VAL B CA  
1214 C C   . VAL B 28  ? 1.1196 1.1472 0.9552 0.1626  -0.0809 -0.0116 25   VAL B C   
1215 O O   . VAL B 28  ? 1.1102 1.1000 0.9350 0.1591  -0.0664 -0.0224 25   VAL B O   
1216 C CB  . VAL B 28  ? 1.1043 1.2252 0.9841 0.1415  -0.0926 -0.0188 25   VAL B CB  
1217 C CG1 . VAL B 28  ? 1.1212 1.2963 1.0128 0.1225  -0.1147 -0.0157 25   VAL B CG1 
1218 C CG2 . VAL B 28  ? 1.0770 1.1857 0.9608 0.1315  -0.0720 -0.0343 25   VAL B CG2 
1219 N N   . LEU B 29  ? 1.1368 1.1739 0.9899 0.1860  -0.0886 0.0068  26   LEU B N   
1220 C CA  . LEU B 29  ? 1.1492 1.1460 1.0125 0.2084  -0.0780 0.0123  26   LEU B CA  
1221 C C   . LEU B 29  ? 1.1537 1.1672 1.0577 0.2300  -0.0687 0.0071  26   LEU B C   
1222 O O   . LEU B 29  ? 1.1554 1.2229 1.0880 0.2335  -0.0733 0.0102  26   LEU B O   
1223 C CB  . LEU B 29  ? 1.1747 1.1624 1.0321 0.2229  -0.0878 0.0392  26   LEU B CB  
1224 C CG  . LEU B 29  ? 1.1853 1.1548 0.9961 0.2046  -0.0918 0.0446  26   LEU B CG  
1225 C CD1 . LEU B 29  ? 1.2245 1.2058 1.0237 0.2179  -0.1050 0.0749  26   LEU B CD1 
1226 C CD2 . LEU B 29  ? 1.1874 1.1011 0.9846 0.1979  -0.0749 0.0374  26   LEU B CD2 
1227 N N   . ALA B 30  ? 1.1669 1.1349 1.0747 0.2435  -0.0549 -0.0018 27   ALA B N   
1228 C CA  . ALA B 30  ? 1.1843 1.1569 1.1229 0.2673  -0.0411 -0.0109 27   ALA B CA  
1229 C C   . ALA B 30  ? 1.2027 1.2222 1.1838 0.2922  -0.0473 0.0121  27   ALA B C   
1230 O O   . ALA B 30  ? 1.1937 1.2645 1.2053 0.2991  -0.0426 0.0106  27   ALA B O   
1231 C CB  . ALA B 30  ? 1.2101 1.1176 1.1434 0.2787  -0.0301 -0.0220 27   ALA B CB  
1232 N N   . GLU B 31  ? 1.2343 1.2409 1.2201 0.3055  -0.0580 0.0376  28   GLU B N   
1233 C CA  . GLU B 31  ? 1.2643 1.3156 1.2910 0.3319  -0.0678 0.0674  28   GLU B CA  
1234 C C   . GLU B 31  ? 1.2442 1.3774 1.2877 0.3198  -0.0852 0.0749  28   GLU B C   
1235 O O   . GLU B 31  ? 1.2542 1.4402 1.3489 0.3413  -0.0855 0.0882  28   GLU B O   
1236 C CB  . GLU B 31  ? 1.2944 1.3223 1.3089 0.3402  -0.0805 0.0986  28   GLU B CB  
1237 C CG  . GLU B 31  ? 1.3553 1.4147 1.4166 0.3764  -0.0871 0.1344  28   GLU B CG  
1238 C CD  . GLU B 31  ? 1.4106 1.4931 1.4524 0.3756  -0.1119 0.1720  28   GLU B CD  
1239 O OE1 . GLU B 31  ? 1.4140 1.4752 1.4021 0.3484  -0.1185 0.1674  28   GLU B OE1 
1240 O OE2 . GLU B 31  ? 1.4439 1.5673 1.5235 0.4040  -0.1235 0.2074  28   GLU B OE2 
1241 N N   . GLN B 32  ? 1.2264 1.3700 1.2310 0.2852  -0.0990 0.0664  29   GLN B N   
1242 C CA  . GLN B 32  ? 1.2157 1.4311 1.2329 0.2665  -0.1194 0.0707  29   GLN B CA  
1243 C C   . GLN B 32  ? 1.1991 1.4588 1.2613 0.2667  -0.1060 0.0580  29   GLN B C   
1244 O O   . GLN B 32  ? 1.1996 1.5325 1.3079 0.2687  -0.1194 0.0723  29   GLN B O   
1245 C CB  . GLN B 32  ? 1.2072 1.4093 1.1690 0.2286  -0.1315 0.0576  29   GLN B CB  
1246 C CG  . GLN B 32  ? 1.2265 1.4160 1.1489 0.2287  -0.1501 0.0777  29   GLN B CG  
1247 C CD  . GLN B 32  ? 1.2225 1.3985 1.0874 0.1938  -0.1587 0.0621  29   GLN B CD  
1248 O OE1 . GLN B 32  ? 1.2434 1.3925 1.0622 0.1923  -0.1639 0.0724  29   GLN B OE1 
1249 N NE2 . GLN B 32  ? 1.2067 1.3982 1.0736 0.1666  -0.1570 0.0380  29   GLN B NE2 
1250 N N   . LEU B 33  ? 1.1876 1.4065 1.2375 0.2648  -0.0797 0.0335  30   LEU B N   
1251 C CA  . LEU B 33  ? 1.1808 1.4340 1.2664 0.2692  -0.0594 0.0225  30   LEU B CA  
1252 C C   . LEU B 33  ? 1.2077 1.4753 1.3428 0.3114  -0.0436 0.0336  30   LEU B C   
1253 O O   . LEU B 33  ? 1.2086 1.5424 1.3993 0.3229  -0.0383 0.0440  30   LEU B O   
1254 C CB  . LEU B 33  ? 1.1693 1.3715 1.2156 0.2562  -0.0374 -0.0048 30   LEU B CB  
1255 C CG  . LEU B 33  ? 1.1472 1.3606 1.1710 0.2176  -0.0421 -0.0148 30   LEU B CG  
1256 C CD1 . LEU B 33  ? 1.1431 1.2898 1.1126 0.2037  -0.0341 -0.0320 30   LEU B CD1 
1257 C CD2 . LEU B 33  ? 1.1391 1.4060 1.2013 0.2138  -0.0255 -0.0171 30   LEU B CD2 
1258 N N   . ARG B 34  ? 1.2397 1.4435 1.3585 0.3345  -0.0344 0.0318  31   ARG B N   
1259 C CA  . ARG B 34  ? 1.2806 1.4766 1.4404 0.3774  -0.0141 0.0377  31   ARG B CA  
1260 C C   . ARG B 34  ? 1.2951 1.5598 1.5180 0.4020  -0.0285 0.0744  31   ARG B C   
1261 O O   . ARG B 34  ? 1.3143 1.6108 1.5923 0.4349  -0.0090 0.0818  31   ARG B O   
1262 C CB  . ARG B 34  ? 1.3112 1.4190 1.4418 0.3912  -0.0066 0.0305  31   ARG B CB  
1263 C CG  . ARG B 34  ? 1.3626 1.4346 1.5148 0.4271  0.0249  0.0158  31   ARG B CG  
1264 C CD  . ARG B 34  ? 1.4170 1.4094 1.5609 0.4447  0.0280  0.0182  31   ARG B CD  
1265 N NE  . ARG B 34  ? 1.4440 1.4569 1.6357 0.4748  0.0185  0.0590  31   ARG B NE  
1266 C CZ  . ARG B 34  ? 1.4471 1.4506 1.6282 0.4672  -0.0051 0.0879  31   ARG B CZ  
1267 N NH1 . ARG B 34  ? 1.4259 1.3991 1.5534 0.4311  -0.0189 0.0786  31   ARG B NH1 
1268 N NH2 . ARG B 34  ? 1.4632 1.4887 1.6873 0.4980  -0.0131 0.1289  31   ARG B NH2 
1269 N N   . ARG B 35  ? 1.2967 1.5868 1.5108 0.3875  -0.0620 0.0984  32   ARG B N   
1270 C CA  . ARG B 35  ? 1.3165 1.6823 1.5874 0.4071  -0.0833 0.1364  32   ARG B CA  
1271 C C   . ARG B 35  ? 1.2933 1.7504 1.5968 0.3812  -0.0985 0.1372  32   ARG B C   
1272 O O   . ARG B 35  ? 1.2979 1.8253 1.6742 0.4028  -0.0930 0.1542  32   ARG B O   
1273 C CB  . ARG B 35  ? 1.3388 1.6910 1.5829 0.4085  -0.1125 0.1659  32   ARG B CB  
1274 C CG  . ARG B 35  ? 1.3700 1.6231 1.5750 0.4214  -0.0966 0.1619  32   ARG B CG  
1275 C CD  . ARG B 35  ? 1.4362 1.6777 1.6699 0.4606  -0.1012 0.2035  32   ARG B CD  
1276 N NE  . ARG B 35  ? 1.4783 1.6987 1.7683 0.5043  -0.0707 0.2048  32   ARG B NE  
1277 C CZ  . ARG B 35  ? 1.5227 1.6856 1.8301 0.5388  -0.0573 0.2247  32   ARG B CZ  
1278 N NH1 . ARG B 35  ? 1.5438 1.6664 1.8186 0.5346  -0.0712 0.2490  32   ARG B NH1 
1279 N NH2 . ARG B 35  ? 1.5538 1.6948 1.9110 0.5781  -0.0264 0.2200  32   ARG B NH2 
1280 N N   . ASP B 36  ? 1.2755 1.7296 1.5306 0.3354  -0.1144 0.1186  33   ASP B N   
1281 C CA  . ASP B 36  ? 1.2588 1.7885 1.5424 0.3031  -0.1283 0.1151  33   ASP B CA  
1282 C C   . ASP B 36  ? 1.2359 1.7406 1.5011 0.2797  -0.1003 0.0828  33   ASP B C   
1283 O O   . ASP B 36  ? 1.2213 1.7831 1.5209 0.2567  -0.1007 0.0800  33   ASP B O   
1284 C CB  . ASP B 36  ? 1.2658 1.8174 1.5124 0.2664  -0.1704 0.1199  33   ASP B CB  
1285 C CG  . ASP B 36  ? 1.2998 1.8678 1.5445 0.2879  -0.1995 0.1536  33   ASP B CG  
1286 O OD1 . ASP B 36  ? 1.3100 1.9402 1.6226 0.3194  -0.2069 0.1850  33   ASP B OD1 
1287 O OD2 . ASP B 36  ? 1.3205 1.8409 1.4962 0.2747  -0.2136 0.1515  33   ASP B OD2 
1288 N N   . ALA B 59  ? 1.0255 1.4186 1.1511 0.0267  -0.0366 -0.0266 56   ALA B N   
1289 C CA  . ALA B 59  ? 1.0207 1.4123 1.1521 0.0483  -0.0006 -0.0218 56   ALA B CA  
1290 C C   . ALA B 59  ? 1.0215 1.3368 1.0879 0.0493  0.0146  -0.0320 56   ALA B C   
1291 O O   . ALA B 59  ? 1.0218 1.3203 1.0690 0.0739  0.0372  -0.0326 56   ALA B O   
1292 C CB  . ALA B 59  ? 1.0247 1.4743 1.2153 0.0297  0.0180  -0.0097 56   ALA B CB  
1293 N N   . ALA B 60  ? 1.0252 1.2966 1.0586 0.0228  0.0018  -0.0405 57   ALA B N   
1294 C CA  . ALA B 60  ? 1.0218 1.2228 0.9989 0.0234  0.0109  -0.0472 57   ALA B CA  
1295 C C   . ALA B 60  ? 1.0167 1.1762 0.9549 0.0275  -0.0100 -0.0563 57   ALA B C   
1296 O O   . ALA B 60  ? 1.0264 1.1860 0.9615 0.0072  -0.0288 -0.0622 57   ALA B O   
1297 C CB  . ALA B 60  ? 1.0377 1.2179 1.0135 -0.0074 0.0226  -0.0457 57   ALA B CB  
1298 N N   . VAL B 61  ? 1.0049 1.1291 0.9121 0.0520  -0.0059 -0.0577 58   VAL B N   
1299 C CA  . VAL B 61  ? 1.0040 1.0982 0.8836 0.0615  -0.0226 -0.0610 58   VAL B CA  
1300 C C   . VAL B 61  ? 1.0037 1.0384 0.8423 0.0645  -0.0170 -0.0638 58   VAL B C   
1301 O O   . VAL B 61  ? 1.0023 1.0162 0.8304 0.0628  -0.0023 -0.0628 58   VAL B O   
1302 C CB  . VAL B 61  ? 0.9984 1.1144 0.8943 0.0907  -0.0302 -0.0559 58   VAL B CB  
1303 C CG1 . VAL B 61  ? 1.0088 1.1857 0.9460 0.0880  -0.0452 -0.0486 58   VAL B CG1 
1304 C CG2 . VAL B 61  ? 0.9908 1.1042 0.8914 0.1131  -0.0112 -0.0575 58   VAL B CG2 
1305 N N   . TRP B 62  ? 1.0079 1.0209 0.8265 0.0702  -0.0294 -0.0639 59   TRP B N   
1306 C CA  . TRP B 62  ? 1.0099 0.9743 0.7988 0.0737  -0.0251 -0.0633 59   TRP B CA  
1307 C C   . TRP B 62  ? 1.0154 0.9724 0.8027 0.0957  -0.0332 -0.0576 59   TRP B C   
1308 O O   . TRP B 62  ? 1.0299 0.9963 0.8138 0.0992  -0.0456 -0.0527 59   TRP B O   
1309 C CB  . TRP B 62  ? 1.0243 0.9667 0.7892 0.0552  -0.0274 -0.0679 59   TRP B CB  
1310 C CG  . TRP B 62  ? 1.0207 0.9190 0.7590 0.0609  -0.0207 -0.0646 59   TRP B CG  
1311 C CD1 . TRP B 62  ? 1.0078 0.8913 0.7448 0.0790  -0.0211 -0.0558 59   TRP B CD1 
1312 C CD2 . TRP B 62  ? 1.0287 0.8919 0.7423 0.0484  -0.0104 -0.0695 59   TRP B CD2 
1313 N NE1 . TRP B 62  ? 1.0132 0.8619 0.7312 0.0782  -0.0114 -0.0518 59   TRP B NE1 
1314 C CE2 . TRP B 62  ? 1.0290 0.8637 0.7305 0.0618  -0.0031 -0.0605 59   TRP B CE2 
1315 C CE3 . TRP B 62  ? 1.0494 0.8995 0.7523 0.0268  -0.0046 -0.0814 59   TRP B CE3 
1316 C CZ2 . TRP B 62  ? 1.0520 0.8499 0.7317 0.0582  0.0125  -0.0614 59   TRP B CZ2 
1317 C CZ3 . TRP B 62  ? 1.0825 0.8875 0.7585 0.0230  0.0106  -0.0859 59   TRP B CZ3 
1318 C CH2 . TRP B 62  ? 1.0792 0.8606 0.7440 0.0405  0.0204  -0.0752 59   TRP B CH2 
1319 N N   . MET B 63  ? 1.0159 0.9551 0.8046 0.1093  -0.0271 -0.0576 60   MET B N   
1320 C CA  . MET B 63  ? 1.0270 0.9498 0.8183 0.1276  -0.0329 -0.0528 60   MET B CA  
1321 C C   . MET B 63  ? 1.0309 0.9147 0.8111 0.1275  -0.0291 -0.0518 60   MET B C   
1322 O O   . MET B 63  ? 1.0265 0.9026 0.8001 0.1190  -0.0229 -0.0553 60   MET B O   
1323 C CB  . MET B 63  ? 1.0323 0.9728 0.8450 0.1462  -0.0316 -0.0570 60   MET B CB  
1324 C CG  . MET B 63  ? 1.0410 1.0304 0.8781 0.1489  -0.0331 -0.0554 60   MET B CG  
1325 S SD  . MET B 63  ? 1.0817 1.0855 0.9462 0.1780  -0.0235 -0.0601 60   MET B SD  
1326 C CE  . MET B 63  ? 1.0770 1.0578 0.9511 0.1998  -0.0343 -0.0474 60   MET B CE  
1327 N N   . GLN B 64  ? 1.0424 0.9050 0.8252 0.1368  -0.0335 -0.0437 61   GLN B N   
1328 C CA  . GLN B 64  ? 1.0462 0.8773 0.8288 0.1343  -0.0318 -0.0401 61   GLN B CA  
1329 C C   . GLN B 64  ? 1.0629 0.8751 0.8609 0.1470  -0.0366 -0.0408 61   GLN B C   
1330 O O   . GLN B 64  ? 1.0736 0.8941 0.8810 0.1613  -0.0388 -0.0409 61   GLN B O   
1331 C CB  . GLN B 64  ? 1.0501 0.8672 0.8228 0.1279  -0.0272 -0.0260 61   GLN B CB  
1332 C CG  . GLN B 64  ? 1.0594 0.8841 0.8145 0.1154  -0.0198 -0.0290 61   GLN B CG  
1333 C CD  . GLN B 64  ? 1.0941 0.8988 0.8350 0.1116  -0.0093 -0.0187 61   GLN B CD  
1334 O OE1 . GLN B 64  ? 1.1233 0.9242 0.8466 0.1023  -0.0006 -0.0236 61   GLN B OE1 
1335 N NE2 . GLN B 64  ? 1.1004 0.8896 0.8493 0.1188  -0.0072 -0.0046 61   GLN B NE2 
1336 N N   . GLY B 65  ? 1.0723 0.8589 0.8771 0.1415  -0.0385 -0.0406 62   GLY B N   
1337 C CA  . GLY B 65  ? 1.0971 0.8562 0.9183 0.1490  -0.0432 -0.0441 62   GLY B CA  
1338 C C   . GLY B 65  ? 1.1059 0.8447 0.9335 0.1366  -0.0502 -0.0531 62   GLY B C   
1339 O O   . GLY B 65  ? 1.0934 0.8457 0.9092 0.1265  -0.0530 -0.0602 62   GLY B O   
1340 N N   . ARG B 66  ? 1.1330 0.8402 0.9815 0.1363  -0.0544 -0.0506 63   ARG B N   
1341 C CA  . ARG B 66  ? 1.1550 0.8417 1.0152 0.1210  -0.0660 -0.0612 63   ARG B CA  
1342 C C   . ARG B 66  ? 1.1811 0.8631 1.0178 0.1228  -0.0722 -0.0929 63   ARG B C   
1343 O O   . ARG B 66  ? 1.1915 0.8722 1.0165 0.1401  -0.0640 -0.1049 63   ARG B O   
1344 C CB  . ARG B 66  ? 1.1848 0.8339 1.0764 0.1195  -0.0673 -0.0524 63   ARG B CB  
1345 C CG  . ARG B 66  ? 1.1835 0.8355 1.1013 0.1105  -0.0620 -0.0213 63   ARG B CG  
1346 C CD  . ARG B 66  ? 1.2232 0.8699 1.1693 0.0874  -0.0750 -0.0224 63   ARG B CD  
1347 N NE  . ARG B 66  ? 1.2246 0.8910 1.1958 0.0796  -0.0663 0.0080  63   ARG B NE  
1348 C CZ  . ARG B 66  ? 1.2460 0.8995 1.2483 0.0786  -0.0546 0.0353  63   ARG B CZ  
1349 N NH1 . ARG B 66  ? 1.2866 0.9049 1.3003 0.0843  -0.0519 0.0388  63   ARG B NH1 
1350 N NH2 . ARG B 66  ? 1.2255 0.9005 1.2484 0.0738  -0.0423 0.0617  63   ARG B NH2 
1351 N N   . VAL B 67  ? 1.1985 0.8816 1.0276 0.1060  -0.0863 -0.1049 64   VAL B N   
1352 C CA  . VAL B 67  ? 1.2419 0.9190 1.0374 0.1064  -0.0926 -0.1367 64   VAL B CA  
1353 C C   . VAL B 67  ? 1.3052 0.9328 1.1086 0.1045  -0.0992 -0.1596 64   VAL B C   
1354 O O   . VAL B 67  ? 1.3216 0.9286 1.1528 0.0859  -0.1133 -0.1558 64   VAL B O   
1355 C CB  . VAL B 67  ? 1.2406 0.9423 1.0171 0.0892  -0.1084 -0.1392 64   VAL B CB  
1356 C CG1 . VAL B 67  ? 1.2828 0.9818 1.0108 0.0921  -0.1117 -0.1711 64   VAL B CG1 
1357 C CG2 . VAL B 67  ? 1.1949 0.9359 0.9724 0.0909  -0.0993 -0.1130 64   VAL B CG2 
1358 N N   . VAL B 68  ? 1.3462 0.9544 1.1301 0.1241  -0.0868 -0.1823 65   VAL B N   
1359 C CA  . VAL B 68  ? 1.4186 0.9699 1.2051 0.1272  -0.0873 -0.2096 65   VAL B CA  
1360 C C   . VAL B 68  ? 1.4813 1.0174 1.2208 0.1167  -0.0984 -0.2505 65   VAL B C   
1361 O O   . VAL B 68  ? 1.5352 1.0306 1.2755 0.0973  -0.1156 -0.2726 65   VAL B O   
1362 C CB  . VAL B 68  ? 1.4324 0.9686 1.2261 0.1595  -0.0639 -0.2114 65   VAL B CB  
1363 C CG1 . VAL B 68  ? 1.5008 0.9682 1.3091 0.1638  -0.0615 -0.2326 65   VAL B CG1 
1364 C CG2 . VAL B 68  ? 1.3816 0.9476 1.2078 0.1717  -0.0551 -0.1706 65   VAL B CG2 
1365 N N   . MET B 69  ? 1.4822 1.0511 1.1793 0.1282  -0.0885 -0.2601 66   MET B N   
1366 C CA  . MET B 69  ? 1.5489 1.1130 1.1883 0.1198  -0.0974 -0.2950 66   MET B CA  
1367 C C   . MET B 69  ? 1.5167 1.1391 1.1245 0.1196  -0.0954 -0.2801 66   MET B C   
1368 O O   . MET B 69  ? 1.4718 1.1276 1.0897 0.1367  -0.0748 -0.2594 66   MET B O   
1369 C CB  . MET B 69  ? 1.6211 1.1439 1.2298 0.1424  -0.0764 -0.3331 66   MET B CB  
1370 C CG  . MET B 69  ? 1.7092 1.1610 1.3178 0.1307  -0.0879 -0.3674 66   MET B CG  
1371 S SD  . MET B 69  ? 1.8183 1.2128 1.3953 0.1637  -0.0553 -0.4121 66   MET B SD  
1372 C CE  . MET B 69  ? 1.9130 1.2185 1.4821 0.1358  -0.0785 -0.4572 66   MET B CE  
1373 N N   . ALA B 70  ? 1.5470 1.1820 1.1191 0.0990  -0.1184 -0.2891 67   ALA B N   
1374 C CA  . ALA B 70  ? 1.5322 1.2177 1.0698 0.0991  -0.1166 -0.2736 67   ALA B CA  
1375 C C   . ALA B 70  ? 1.6187 1.2966 1.0835 0.0926  -0.1279 -0.3077 67   ALA B C   
1376 O O   . ALA B 70  ? 1.6745 1.3290 1.1258 0.0710  -0.1572 -0.3292 67   ALA B O   
1377 C CB  . ALA B 70  ? 1.4743 1.1952 1.0465 0.0816  -0.1353 -0.2357 67   ALA B CB  
1378 N N   . ASP B 71  ? 1.6402 1.3392 1.0571 0.1099  -0.1047 -0.3128 68   ASP B N   
1379 C CA  . ASP B 71  ? 1.7278 1.4234 1.0630 0.1066  -0.1110 -0.3432 68   ASP B CA  
1380 C C   . ASP B 71  ? 1.7112 1.4547 1.0137 0.1209  -0.0870 -0.3211 68   ASP B C   
1381 O O   . ASP B 71  ? 1.6793 1.4352 1.0046 0.1424  -0.0528 -0.3102 68   ASP B O   
1382 C CB  . ASP B 71  ? 1.8160 1.4545 1.1158 0.1197  -0.0955 -0.3945 68   ASP B CB  
1383 C CG  . ASP B 71  ? 1.9053 1.4934 1.1910 0.0942  -0.1303 -0.4311 68   ASP B CG  
1384 O OD1 . ASP B 71  ? 1.9120 1.5192 1.2141 0.0654  -0.1687 -0.4152 68   ASP B OD1 
1385 O OD2 . ASP B 71  ? 1.9991 1.5278 1.2604 0.1025  -0.1188 -0.4760 68   ASP B OD2 
1386 N N   . ARG B 72  ? 1.7374 1.5108 0.9910 0.1080  -0.1061 -0.3110 69   ARG B N   
1387 C CA  . ARG B 72  ? 1.7274 1.5464 0.9488 0.1190  -0.0843 -0.2836 69   ARG B CA  
1388 C C   . ARG B 72  ? 1.6337 1.4795 0.9226 0.1302  -0.0571 -0.2447 69   ARG B C   
1389 O O   . ARG B 72  ? 1.5674 1.4147 0.9210 0.1211  -0.0696 -0.2218 69   ARG B O   
1390 C CB  . ARG B 72  ? 1.8147 1.6239 0.9559 0.1365  -0.0573 -0.3170 69   ARG B CB  
1391 C CG  . ARG B 72  ? 1.8457 1.7001 0.9284 0.1406  -0.0453 -0.2920 69   ARG B CG  
1392 C CD  . ARG B 72  ? 1.8676 1.7408 0.9052 0.1183  -0.0889 -0.2806 69   ARG B CD  
1393 N NE  . ARG B 72  ? 1.9042 1.8158 0.8721 0.1260  -0.0742 -0.2585 69   ARG B NE  
1394 C CZ  . ARG B 72  ? 1.9139 1.8580 0.8456 0.1127  -0.1046 -0.2311 69   ARG B CZ  
1395 N NH1 . ARG B 72  ? 1.9571 1.9344 0.8241 0.1223  -0.0866 -0.2075 69   ARG B NH1 
1396 N NH2 . ARG B 72  ? 1.8832 1.8298 0.8474 0.0908  -0.1521 -0.2237 69   ARG B NH2 
1397 N N   . GLY B 73  ? 1.6347 1.5016 0.9090 0.1487  -0.0198 -0.2383 70   GLY B N   
1398 C CA  . GLY B 73  ? 1.5561 1.4534 0.8898 0.1540  0.0029  -0.2017 70   GLY B CA  
1399 C C   . GLY B 73  ? 1.4953 1.3789 0.8985 0.1611  0.0113  -0.2039 70   GLY B C   
1400 O O   . GLY B 73  ? 1.4341 1.3421 0.8844 0.1625  0.0258  -0.1776 70   GLY B O   
1401 N N   . GLU B 74  ? 1.5205 1.3636 0.9281 0.1643  0.0007  -0.2348 71   GLU B N   
1402 C CA  . GLU B 74  ? 1.4839 1.3118 0.9498 0.1755  0.0097  -0.2373 71   GLU B CA  
1403 C C   . GLU B 74  ? 1.4639 1.2553 0.9603 0.1628  -0.0184 -0.2425 71   GLU B C   
1404 O O   . GLU B 74  ? 1.4880 1.2617 0.9606 0.1455  -0.0450 -0.2525 71   GLU B O   
1405 C CB  . GLU B 74  ? 1.5369 1.3514 0.9904 0.2019  0.0392  -0.2654 71   GLU B CB  
1406 C CG  . GLU B 74  ? 1.6555 1.4242 1.0463 0.2059  0.0361  -0.3105 71   GLU B CG  
1407 C CD  . GLU B 74  ? 1.7076 1.4188 1.1234 0.2043  0.0197  -0.3342 71   GLU B CD  
1408 O OE1 . GLU B 74  ? 1.7877 1.4541 1.1549 0.1978  0.0076  -0.3722 71   GLU B OE1 
1409 O OE2 . GLU B 74  ? 1.6671 1.3767 1.1489 0.2086  0.0189  -0.3146 71   GLU B OE2 
1410 N N   . ALA B 75  ? 1.4219 1.2065 0.9731 0.1712  -0.0123 -0.2328 72   ALA B N   
1411 C CA  . ALA B 75  ? 1.4038 1.1559 0.9920 0.1624  -0.0319 -0.2308 72   ALA B CA  
1412 C C   . ALA B 75  ? 1.3745 1.1221 1.0104 0.1805  -0.0175 -0.2220 72   ALA B C   
1413 O O   . ALA B 75  ? 1.3420 1.1256 0.9958 0.1922  -0.0001 -0.2063 72   ALA B O   
1414 C CB  . ALA B 75  ? 1.3564 1.1258 0.9652 0.1411  -0.0516 -0.2018 72   ALA B CB  
1415 N N   . ARG B 76  ? 1.3889 1.0938 1.0476 0.1814  -0.0265 -0.2298 73   ARG B N   
1416 C CA  . ARG B 76  ? 1.3689 1.0665 1.0727 0.1992  -0.0167 -0.2166 73   ARG B CA  
1417 C C   . ARG B 76  ? 1.3263 1.0163 1.0644 0.1847  -0.0332 -0.1907 73   ARG B C   
1418 O O   . ARG B 76  ? 1.3429 1.0026 1.0818 0.1670  -0.0499 -0.1957 73   ARG B O   
1419 C CB  . ARG B 76  ? 1.4366 1.0842 1.1395 0.2179  -0.0065 -0.2444 73   ARG B CB  
1420 C CG  . ARG B 76  ? 1.4413 1.0943 1.1855 0.2474  0.0119  -0.2309 73   ARG B CG  
1421 C CD  . ARG B 76  ? 1.5300 1.1340 1.2683 0.2715  0.0300  -0.2617 73   ARG B CD  
1422 N NE  . ARG B 76  ? 1.5937 1.1295 1.3410 0.2626  0.0176  -0.2740 73   ARG B NE  
1423 C CZ  . ARG B 76  ? 1.6679 1.1563 1.3780 0.2433  0.0059  -0.3090 73   ARG B CZ  
1424 N NH1 . ARG B 76  ? 1.6975 1.2002 1.3508 0.2330  0.0041  -0.3347 73   ARG B NH1 
1425 N NH2 . ARG B 76  ? 1.7128 1.1396 1.4426 0.2328  -0.0052 -0.3171 73   ARG B NH2 
1426 N N   . LEU B 77  ? 1.2752 0.9950 1.0409 0.1912  -0.0281 -0.1630 74   LEU B N   
1427 C CA  . LEU B 77  ? 1.2386 0.9580 1.0272 0.1787  -0.0387 -0.1366 74   LEU B CA  
1428 C C   . LEU B 77  ? 1.2484 0.9499 1.0687 0.1942  -0.0356 -0.1210 74   LEU B C   
1429 O O   . LEU B 77  ? 1.2647 0.9684 1.0962 0.2172  -0.0249 -0.1242 74   LEU B O   
1430 C CB  . LEU B 77  ? 1.1880 0.9518 0.9734 0.1702  -0.0370 -0.1173 74   LEU B CB  
1431 C CG  . LEU B 77  ? 1.1731 0.9540 0.9332 0.1541  -0.0401 -0.1213 74   LEU B CG  
1432 C CD1 . LEU B 77  ? 1.1252 0.9448 0.8843 0.1510  -0.0315 -0.1071 74   LEU B CD1 
1433 C CD2 . LEU B 77  ? 1.1695 0.9340 0.9345 0.1361  -0.0541 -0.1131 74   LEU B CD2 
1434 N N   . ARG B 78  ? 1.2394 0.9256 1.0763 0.1834  -0.0434 -0.1006 75   ARG B N   
1435 C CA  . ARG B 78  ? 1.2463 0.9178 1.1096 0.1969  -0.0405 -0.0777 75   ARG B CA  
1436 C C   . ARG B 78  ? 1.2080 0.9035 1.0728 0.1896  -0.0423 -0.0471 75   ARG B C   
1437 O O   . ARG B 78  ? 1.1995 0.8856 1.0662 0.1724  -0.0455 -0.0374 75   ARG B O   
1438 C CB  . ARG B 78  ? 1.2913 0.9061 1.1744 0.1943  -0.0429 -0.0820 75   ARG B CB  
1439 C CG  . ARG B 78  ? 1.3309 0.9244 1.2416 0.2168  -0.0354 -0.0604 75   ARG B CG  
1440 C CD  . ARG B 78  ? 1.3790 0.9250 1.3161 0.2066  -0.0373 -0.0450 75   ARG B CD  
1441 N NE  . ARG B 78  ? 1.3497 0.9153 1.2883 0.1885  -0.0407 -0.0183 75   ARG B NE  
1442 C CZ  . ARG B 78  ? 1.3548 0.9064 1.3042 0.1631  -0.0471 -0.0202 75   ARG B CZ  
1443 N NH1 . ARG B 78  ? 1.3269 0.9000 1.2805 0.1517  -0.0445 0.0066  75   ARG B NH1 
1444 N NH2 . ARG B 78  ? 1.3847 0.9021 1.3409 0.1491  -0.0559 -0.0494 75   ARG B NH2 
1445 N N   . ASP B 79  ? 1.1892 0.9176 1.0531 0.2030  -0.0400 -0.0328 76   ASP B N   
1446 C CA  . ASP B 79  ? 1.1676 0.9125 1.0254 0.1999  -0.0417 -0.0054 76   ASP B CA  
1447 C C   . ASP B 79  ? 1.1924 0.9247 1.0682 0.2199  -0.0414 0.0203  76   ASP B C   
1448 O O   . ASP B 79  ? 1.2159 0.9262 1.1141 0.2370  -0.0385 0.0155  76   ASP B O   
1449 C CB  . ASP B 79  ? 1.1392 0.9306 0.9769 0.1936  -0.0438 -0.0076 76   ASP B CB  
1450 C CG  . ASP B 79  ? 1.1286 0.9563 0.9775 0.2104  -0.0470 -0.0062 76   ASP B CG  
1451 O OD1 . ASP B 79  ? 1.1369 0.9563 1.0088 0.2320  -0.0463 0.0019  76   ASP B OD1 
1452 O OD2 . ASP B 79  ? 1.0996 0.9656 0.9392 0.2015  -0.0497 -0.0115 76   ASP B OD2 
1453 N N   . PRO B 80  ? 1.1897 0.9330 1.0532 0.2192  -0.0426 0.0482  77   PRO B N   
1454 C CA  . PRO B 80  ? 1.2217 0.9468 1.0999 0.2365  -0.0411 0.0797  77   PRO B CA  
1455 C C   . PRO B 80  ? 1.2355 0.9795 1.1336 0.2635  -0.0459 0.0875  77   PRO B C   
1456 O O   . PRO B 80  ? 1.2692 0.9872 1.1917 0.2830  -0.0424 0.1093  77   PRO B O   
1457 C CB  . PRO B 80  ? 1.2222 0.9671 1.0681 0.2297  -0.0415 0.1040  77   PRO B CB  
1458 C CG  . PRO B 80  ? 1.1877 0.9432 1.0100 0.2070  -0.0388 0.0829  77   PRO B CG  
1459 C CD  . PRO B 80  ? 1.1672 0.9386 0.9981 0.2047  -0.0439 0.0523  77   PRO B CD  
1460 N N   . SER B 81  ? 1.2073 0.9971 1.1002 0.2647  -0.0523 0.0721  78   SER B N   
1461 C CA  . SER B 81  ? 1.2122 1.0317 1.1327 0.2897  -0.0554 0.0767  78   SER B CA  
1462 C C   . SER B 81  ? 1.2320 1.0147 1.1809 0.3048  -0.0420 0.0553  78   SER B C   
1463 O O   . SER B 81  ? 1.2665 1.0331 1.2468 0.3322  -0.0367 0.0699  78   SER B O   
1464 C CB  . SER B 81  ? 1.1779 1.0596 1.0889 0.2802  -0.0647 0.0656  78   SER B CB  
1465 O OG  . SER B 81  ? 1.1711 1.0714 1.1101 0.2931  -0.0575 0.0476  78   SER B OG  
1466 N N   . GLY B 82  ? 1.2187 0.9861 1.1537 0.2879  -0.0360 0.0209  79   GLY B N   
1467 C CA  . GLY B 82  ? 1.2468 0.9773 1.1944 0.2991  -0.0234 -0.0070 79   GLY B CA  
1468 C C   . GLY B 82  ? 1.2285 0.9589 1.1497 0.2797  -0.0203 -0.0427 79   GLY B C   
1469 O O   . GLY B 82  ? 1.2003 0.9390 1.0978 0.2540  -0.0276 -0.0452 79   GLY B O   
1470 N N   . ASP B 83  ? 1.2538 0.9747 1.1780 0.2944  -0.0074 -0.0685 80   ASP B N   
1471 C CA  . ASP B 83  ? 1.2519 0.9680 1.1444 0.2794  -0.0031 -0.1024 80   ASP B CA  
1472 C C   . ASP B 83  ? 1.2204 0.9950 1.1065 0.2822  0.0049  -0.1079 80   ASP B C   
1473 O O   . ASP B 83  ? 1.2144 1.0280 1.1288 0.3028  0.0119  -0.0949 80   ASP B O   
1474 C CB  . ASP B 83  ? 1.3164 0.9746 1.2035 0.2910  0.0083  -0.1335 80   ASP B CB  
1475 C CG  . ASP B 83  ? 1.3592 0.9540 1.2491 0.2765  -0.0015 -0.1361 80   ASP B CG  
1476 O OD1 . ASP B 83  ? 1.3447 0.9410 1.2493 0.2652  -0.0124 -0.1068 80   ASP B OD1 
1477 O OD2 . ASP B 83  ? 1.4227 0.9654 1.2994 0.2753  0.0028  -0.1684 80   ASP B OD2 
1478 N N   . PHE B 84  ? 1.2024 0.9853 1.0553 0.2609  0.0036  -0.1242 81   PHE B N   
1479 C CA  . PHE B 84  ? 1.1836 1.0156 1.0288 0.2608  0.0147  -0.1295 81   PHE B CA  
1480 C C   . PHE B 84  ? 1.1958 1.0160 0.9971 0.2452  0.0178  -0.1529 81   PHE B C   
1481 O O   . PHE B 84  ? 1.1927 0.9873 0.9727 0.2245  0.0036  -0.1562 81   PHE B O   
1482 C CB  . PHE B 84  ? 1.1332 1.0187 0.9941 0.2486  0.0062  -0.1045 81   PHE B CB  
1483 C CG  . PHE B 84  ? 1.1022 0.9786 0.9426 0.2208  -0.0085 -0.0961 81   PHE B CG  
1484 C CD1 . PHE B 84  ? 1.1121 0.9550 0.9537 0.2161  -0.0201 -0.0851 81   PHE B CD1 
1485 C CD2 . PHE B 84  ? 1.0731 0.9744 0.8970 0.2012  -0.0072 -0.0964 81   PHE B CD2 
1486 C CE1 . PHE B 84  ? 1.0929 0.9295 0.9192 0.1941  -0.0284 -0.0764 81   PHE B CE1 
1487 C CE2 . PHE B 84  ? 1.0584 0.9486 0.8673 0.1798  -0.0166 -0.0882 81   PHE B CE2 
1488 C CZ  . PHE B 84  ? 1.0651 0.9243 0.8752 0.1771  -0.0265 -0.0790 81   PHE B CZ  
1489 N N   . SER B 85  ? 1.2135 1.0559 1.0033 0.2569  0.0373  -0.1666 82   SER B N   
1490 C CA  . SER B 85  ? 1.2362 1.0732 0.9783 0.2463  0.0426  -0.1864 82   SER B CA  
1491 C C   . SER B 85  ? 1.1926 1.0777 0.9305 0.2283  0.0432  -0.1680 82   SER B C   
1492 O O   . SER B 85  ? 1.1577 1.0857 0.9304 0.2300  0.0484  -0.1488 82   SER B O   
1493 C CB  . SER B 85  ? 1.2966 1.1278 1.0234 0.2720  0.0692  -0.2110 82   SER B CB  
1494 O OG  . SER B 85  ? 1.3189 1.1802 1.0102 0.2679  0.0846  -0.2166 82   SER B OG  
1495 N N   . VAL B 86  ? 1.2001 1.0770 0.8979 0.2101  0.0362  -0.1729 83   VAL B N   
1496 C CA  . VAL B 86  ? 1.1788 1.0928 0.8674 0.1951  0.0413  -0.1560 83   VAL B CA  
1497 C C   . VAL B 86  ? 1.2291 1.1418 0.8645 0.1949  0.0507  -0.1699 83   VAL B C   
1498 O O   . VAL B 86  ? 1.2719 1.1501 0.8704 0.1917  0.0378  -0.1891 83   VAL B O   
1499 C CB  . VAL B 86  ? 1.1390 1.0467 0.8322 0.1718  0.0214  -0.1374 83   VAL B CB  
1500 C CG1 . VAL B 86  ? 1.1047 1.0135 0.8380 0.1700  0.0126  -0.1235 83   VAL B CG1 
1501 C CG2 . VAL B 86  ? 1.1640 1.0357 0.8293 0.1626  0.0027  -0.1478 83   VAL B CG2 
1502 N N   . ARG B 87  ? 1.2332 1.1849 0.8638 0.1967  0.0723  -0.1592 84   ARG B N   
1503 C CA  . ARG B 87  ? 1.2798 1.2361 0.8537 0.1960  0.0831  -0.1653 84   ARG B CA  
1504 C C   . ARG B 87  ? 1.2519 1.2341 0.8269 0.1766  0.0822  -0.1346 84   ARG B C   
1505 O O   . ARG B 87  ? 1.1990 1.1906 0.8173 0.1644  0.0754  -0.1149 84   ARG B O   
1506 C CB  . ARG B 87  ? 1.3212 1.2992 0.8849 0.2190  0.1176  -0.1770 84   ARG B CB  
1507 C CG  . ARG B 87  ? 1.3592 1.3122 0.9360 0.2432  0.1254  -0.2036 84   ARG B CG  
1508 C CD  . ARG B 87  ? 1.4278 1.4074 1.0014 0.2697  0.1659  -0.2120 84   ARG B CD  
1509 N NE  . ARG B 87  ? 1.5299 1.4746 1.0301 0.2833  0.1791  -0.2470 84   ARG B NE  
1510 C CZ  . ARG B 87  ? 1.5837 1.5342 1.0145 0.2766  0.1866  -0.2508 84   ARG B CZ  
1511 N NH1 . ARG B 87  ? 1.5575 1.5453 0.9868 0.2575  0.1839  -0.2180 84   ARG B NH1 
1512 N NH2 . ARG B 87  ? 1.6724 1.5878 1.0311 0.2893  0.1971  -0.2878 84   ARG B NH2 
1513 N N   . GLY B 88  ? 1.2965 1.2868 0.8208 0.1742  0.0893  -0.1303 85   GLY B N   
1514 C CA  . GLY B 88  ? 1.2849 1.2975 0.8119 0.1590  0.0933  -0.0970 85   GLY B CA  
1515 C C   . GLY B 88  ? 1.2655 1.2589 0.7942 0.1422  0.0651  -0.0816 85   GLY B C   
1516 O O   . GLY B 88  ? 1.2575 1.2630 0.7927 0.1315  0.0693  -0.0523 85   GLY B O   
1517 N N   . LEU B 89  ? 1.2626 1.2261 0.7916 0.1405  0.0389  -0.0990 86   LEU B N   
1518 C CA  . LEU B 89  ? 1.2492 1.1988 0.7791 0.1271  0.0123  -0.0854 86   LEU B CA  
1519 C C   . LEU B 89  ? 1.2973 1.2614 0.7768 0.1247  0.0089  -0.0723 86   LEU B C   
1520 O O   . LEU B 89  ? 1.2894 1.2570 0.7729 0.1157  -0.0060 -0.0475 86   LEU B O   
1521 C CB  . LEU B 89  ? 1.2537 1.1733 0.7838 0.1257  -0.0131 -0.1093 86   LEU B CB  
1522 C CG  . LEU B 89  ? 1.2273 1.1285 0.7974 0.1320  -0.0107 -0.1238 86   LEU B CG  
1523 C CD1 . LEU B 89  ? 1.2474 1.1144 0.8125 0.1304  -0.0322 -0.1479 86   LEU B CD1 
1524 C CD2 . LEU B 89  ? 1.1765 1.0818 0.7947 0.1245  -0.0099 -0.1004 86   LEU B CD2 
1525 N N   . GLU B 90  ? 1.3559 1.3293 0.7866 0.1352  0.0241  -0.0886 87   GLU B N   
1526 C CA  . GLU B 90  ? 1.4175 1.4117 0.7901 0.1367  0.0305  -0.0742 87   GLU B CA  
1527 C C   . GLU B 90  ? 1.3916 1.4043 0.7876 0.1278  0.0346  -0.0268 87   GLU B C   
1528 O O   . GLU B 90  ? 1.4259 1.4494 0.7860 0.1247  0.0213  -0.0056 87   GLU B O   
1529 C CB  . GLU B 90  ? 1.4639 1.4733 0.8050 0.1526  0.0666  -0.0884 87   GLU B CB  
1530 C CG  . GLU B 90  ? 1.4748 1.4651 0.8319 0.1666  0.0768  -0.1283 87   GLU B CG  
1531 C CD  . GLU B 90  ? 1.5196 1.5322 0.8678 0.1863  0.1198  -0.1365 87   GLU B CD  
1532 O OE1 . GLU B 90  ? 1.5618 1.6022 0.8731 0.1901  0.1440  -0.1190 87   GLU B OE1 
1533 O OE2 . GLU B 90  ? 1.4930 1.4970 0.8744 0.1999  0.1310  -0.1583 87   GLU B OE2 
1534 N N   . ARG B 91  ? 1.3329 1.3465 0.7895 0.1233  0.0509  -0.0110 88   ARG B N   
1535 C CA  . ARG B 91  ? 1.3201 1.3446 0.8006 0.1158  0.0658  0.0299  88   ARG B CA  
1536 C C   . ARG B 91  ? 1.2606 1.2652 0.8016 0.1054  0.0586  0.0421  88   ARG B C   
1537 O O   . ARG B 91  ? 1.2489 1.2531 0.8203 0.0980  0.0763  0.0672  88   ARG B O   
1538 C CB  . ARG B 91  ? 1.3311 1.3786 0.8213 0.1176  0.1030  0.0390  88   ARG B CB  
1539 C CG  . ARG B 91  ? 1.3753 1.4357 0.8464 0.1307  0.1183  0.0073  88   ARG B CG  
1540 C CD  . ARG B 91  ? 1.3997 1.4853 0.9180 0.1295  0.1503  0.0141  88   ARG B CD  
1541 N NE  . ARG B 91  ? 1.5042 1.6209 0.9900 0.1381  0.1838  0.0272  88   ARG B NE  
1542 C CZ  . ARG B 91  ? 1.5641 1.6953 1.0166 0.1566  0.2026  0.0040  88   ARG B CZ  
1543 N NH1 . ARG B 91  ? 1.6149 1.7761 1.0372 0.1645  0.2377  0.0209  88   ARG B NH1 
1544 N NH2 . ARG B 91  ? 1.5645 1.6780 1.0136 0.1689  0.1902  -0.0348 88   ARG B NH2 
1545 N N   . VAL B 92  ? 1.2324 1.2173 0.7905 0.1042  0.0354  0.0241  89   VAL B N   
1546 C CA  . VAL B 92  ? 1.1893 1.1545 0.7964 0.0966  0.0327  0.0353  89   VAL B CA  
1547 C C   . VAL B 92  ? 1.1998 1.1587 0.8094 0.0961  0.0135  0.0569  89   VAL B C   
1548 O O   . VAL B 92  ? 1.2300 1.2004 0.8067 0.0992  -0.0069 0.0557  89   VAL B O   
1549 C CB  . VAL B 92  ? 1.1507 1.1006 0.7851 0.0960  0.0259  0.0079  89   VAL B CB  
1550 C CG1 . VAL B 92  ? 1.1403 1.1041 0.7837 0.0977  0.0438  -0.0071 89   VAL B CG1 
1551 C CG2 . VAL B 92  ? 1.1589 1.0997 0.7773 0.1007  0.0014  -0.0132 89   VAL B CG2 
1552 N N   . PRO B 93  ? 1.1819 1.1233 0.8311 0.0924  0.0197  0.0764  90   PRO B N   
1553 C CA  . PRO B 93  ? 1.1937 1.1344 0.8552 0.0957  0.0042  0.1009  90   PRO B CA  
1554 C C   . PRO B 93  ? 1.1840 1.1212 0.8567 0.0952  -0.0208 0.0817  90   PRO B C   
1555 O O   . PRO B 93  ? 1.1658 1.0893 0.8470 0.0930  -0.0199 0.0543  90   PRO B O   
1556 C CB  . PRO B 93  ? 1.1788 1.0944 0.8813 0.0941  0.0254  0.1212  90   PRO B CB  
1557 C CG  . PRO B 93  ? 1.1655 1.0724 0.8696 0.0857  0.0494  0.1093  90   PRO B CG  
1558 C CD  . PRO B 93  ? 1.1563 1.0782 0.8400 0.0853  0.0406  0.0761  90   PRO B CD  
1559 N N   . ARG B 94  ? 1.2039 1.1559 0.8805 0.0967  -0.0437 0.0986  91   ARG B N   
1560 C CA  . ARG B 94  ? 1.1948 1.1450 0.8933 0.0929  -0.0670 0.0848  91   ARG B CA  
1561 C C   . ARG B 94  ? 1.1857 1.1462 0.9301 0.0957  -0.0769 0.1172  91   ARG B C   
1562 O O   . ARG B 94  ? 1.2061 1.1898 0.9495 0.1001  -0.0852 0.1484  91   ARG B O   
1563 C CB  . ARG B 94  ? 1.2263 1.1874 0.8840 0.0872  -0.0929 0.0567  91   ARG B CB  
1564 C CG  . ARG B 94  ? 1.3023 1.2897 0.9069 0.0881  -0.1050 0.0658  91   ARG B CG  
1565 C CD  . ARG B 94  ? 1.3527 1.3700 0.9718 0.0879  -0.1284 0.1039  91   ARG B CD  
1566 N NE  . ARG B 94  ? 1.4333 1.4789 0.9915 0.0857  -0.1513 0.1062  91   ARG B NE  
1567 C CZ  . ARG B 94  ? 1.4676 1.5484 1.0252 0.0858  -0.1768 0.1405  91   ARG B CZ  
1568 N NH1 . ARG B 94  ? 1.4387 1.5315 1.0619 0.0904  -0.1802 0.1778  91   ARG B NH1 
1569 N NH2 . ARG B 94  ? 1.5283 1.6342 1.0179 0.0830  -0.1986 0.1385  91   ARG B NH2 
1570 N N   . GLY B 95  ? 1.1598 1.1056 0.9461 0.0949  -0.0739 0.1127  92   GLY B N   
1571 C CA  . GLY B 95  ? 1.1613 1.1205 0.9998 0.0990  -0.0802 0.1421  92   GLY B CA  
1572 C C   . GLY B 95  ? 1.1889 1.1826 1.0355 0.0901  -0.1195 0.1450  92   GLY B C   
1573 O O   . GLY B 95  ? 1.2071 1.2337 1.0748 0.0937  -0.1350 0.1781  92   GLY B O   
1574 N N   . ARG B 96  ? 1.1975 1.1833 1.0308 0.0777  -0.1366 0.1113  93   ARG B N   
1575 C CA  . ARG B 96  ? 1.2341 1.2452 1.0609 0.0630  -0.1773 0.1022  93   ARG B CA  
1576 C C   . ARG B 96  ? 1.2678 1.2761 1.0195 0.0590  -0.1880 0.0741  93   ARG B C   
1577 O O   . ARG B 96  ? 1.2608 1.2406 0.9801 0.0634  -0.1666 0.0480  93   ARG B O   
1578 C CB  . ARG B 96  ? 1.2309 1.2265 1.0895 0.0502  -0.1877 0.0801  93   ARG B CB  
1579 C CG  . ARG B 96  ? 1.2205 1.2071 1.1428 0.0562  -0.1649 0.0993  93   ARG B CG  
1580 C CD  . ARG B 96  ? 1.2722 1.2990 1.2558 0.0581  -0.1749 0.1404  93   ARG B CD  
1581 N NE  . ARG B 96  ? 1.2854 1.3004 1.3194 0.0710  -0.1409 0.1611  93   ARG B NE  
1582 C CZ  . ARG B 96  ? 1.3034 1.3451 1.3942 0.0826  -0.1317 0.2007  93   ARG B CZ  
1583 N NH1 . ARG B 96  ? 1.3230 1.4104 1.4336 0.0828  -0.1577 0.2290  93   ARG B NH1 
1584 N NH2 . ARG B 96  ? 1.2992 1.3223 1.4254 0.0958  -0.0952 0.2131  93   ARG B NH2 
1585 N N   . PRO B 97  ? 1.3092 1.3495 1.0324 0.0509  -0.2214 0.0790  94   PRO B N   
1586 C CA  . PRO B 97  ? 1.3580 1.3952 1.0004 0.0483  -0.2294 0.0509  94   PRO B CA  
1587 C C   . PRO B 97  ? 1.3724 1.3735 0.9860 0.0394  -0.2322 -0.0015 94   PRO B C   
1588 O O   . PRO B 97  ? 1.4116 1.4012 0.9597 0.0430  -0.2254 -0.0282 94   PRO B O   
1589 C CB  . PRO B 97  ? 1.4106 1.4919 1.0333 0.0383  -0.2717 0.0672  94   PRO B CB  
1590 C CG  . PRO B 97  ? 1.3868 1.4898 1.0894 0.0286  -0.2938 0.0886  94   PRO B CG  
1591 C CD  . PRO B 97  ? 1.3228 1.4072 1.0865 0.0439  -0.2543 0.1108  94   PRO B CD  
1592 N N   . CYS B 98  ? 1.3439 1.3257 1.0078 0.0301  -0.2379 -0.0136 95   CYS B N   
1593 C CA  . CYS B 98  ? 1.3676 1.3123 1.0114 0.0205  -0.2451 -0.0598 95   CYS B CA  
1594 C C   . CYS B 98  ? 1.3273 1.2325 1.0030 0.0280  -0.2174 -0.0731 95   CYS B C   
1595 O O   . CYS B 98  ? 1.2935 1.1944 1.0296 0.0234  -0.2164 -0.0583 95   CYS B O   
1596 C CB  . CYS B 98  ? 1.4027 1.3569 1.0654 -0.0044 -0.2883 -0.0698 95   CYS B CB  
1597 S SG  . CYS B 98  ? 1.4891 1.4543 1.0630 -0.0174 -0.3235 -0.1003 95   CYS B SG  
1598 N N   . LEU B 99  ? 1.3388 1.2185 0.9742 0.0403  -0.1948 -0.0991 96   LEU B N   
1599 C CA  . LEU B 99  ? 1.3122 1.1572 0.9732 0.0483  -0.1735 -0.1124 96   LEU B CA  
1600 C C   . LEU B 99  ? 1.3551 1.1624 1.0172 0.0377  -0.1890 -0.1464 96   LEU B C   
1601 O O   . LEU B 99  ? 1.4122 1.1971 1.0253 0.0395  -0.1909 -0.1822 96   LEU B O   
1602 C CB  . LEU B 99  ? 1.3010 1.1417 0.9345 0.0677  -0.1415 -0.1192 96   LEU B CB  
1603 C CG  . LEU B 99  ? 1.2730 1.0880 0.9356 0.0782  -0.1214 -0.1256 96   LEU B CG  
1604 C CD1 . LEU B 99  ? 1.2354 1.0476 0.9540 0.0728  -0.1222 -0.1009 96   LEU B CD1 
1605 C CD2 . LEU B 99  ? 1.2487 1.0759 0.8979 0.0943  -0.0932 -0.1219 96   LEU B CD2 
1606 N N   . VAL B 100 ? 1.3304 1.1279 1.0505 0.0275  -0.1961 -0.1338 97   VAL B N   
1607 C CA  . VAL B 100 ? 1.3627 1.1248 1.1018 0.0115  -0.2135 -0.1570 97   VAL B CA  
1608 C C   . VAL B 100 ? 1.3389 1.0629 1.1059 0.0244  -0.1889 -0.1589 97   VAL B C   
1609 O O   . VAL B 100 ? 1.2862 1.0220 1.0747 0.0388  -0.1660 -0.1330 97   VAL B O   
1610 C CB  . VAL B 100 ? 1.3569 1.1447 1.1492 -0.0125 -0.2419 -0.1342 97   VAL B CB  
1611 C CG1 . VAL B 100 ? 1.3628 1.1190 1.2126 -0.0268 -0.2458 -0.1352 97   VAL B CG1 
1612 C CG2 . VAL B 100 ? 1.4112 1.2222 1.1669 -0.0311 -0.2788 -0.1491 97   VAL B CG2 
1613 N N   . PRO B 101 ? 1.3848 1.0612 1.1482 0.0199  -0.1933 -0.1899 98   PRO B N   
1614 C CA  . PRO B 101 ? 1.3708 1.0108 1.1697 0.0308  -0.1738 -0.1845 98   PRO B CA  
1615 C C   . PRO B 101 ? 1.3304 0.9786 1.1948 0.0189  -0.1755 -0.1488 98   PRO B C   
1616 O O   . PRO B 101 ? 1.3413 1.0028 1.2352 -0.0056 -0.1990 -0.1423 98   PRO B O   
1617 C CB  . PRO B 101 ? 1.4475 1.0310 1.2316 0.0235  -0.1829 -0.2256 98   PRO B CB  
1618 C CG  . PRO B 101 ? 1.4976 1.0916 1.2520 -0.0020 -0.2158 -0.2485 98   PRO B CG  
1619 C CD  . PRO B 101 ? 1.4636 1.1128 1.1823 0.0072  -0.2137 -0.2331 98   PRO B CD  
1620 N N   . GLY B 102 ? 1.2865 0.9307 1.1731 0.0360  -0.1509 -0.1249 99   GLY B N   
1621 C CA  . GLY B 102 ? 1.2545 0.9073 1.1954 0.0291  -0.1449 -0.0887 99   GLY B CA  
1622 C C   . GLY B 102 ? 1.1974 0.8939 1.1411 0.0377  -0.1313 -0.0583 99   GLY B C   
1623 O O   . GLY B 102 ? 1.1739 0.8767 1.1512 0.0397  -0.1169 -0.0285 99   GLY B O   
1624 N N   . LYS B 103 ? 1.1809 0.9044 1.0874 0.0432  -0.1335 -0.0659 100  LYS B N   
1625 C CA  . LYS B 103 ? 1.1355 0.8893 1.0376 0.0539  -0.1168 -0.0428 100  LYS B CA  
1626 C C   . LYS B 103 ? 1.1175 0.8600 1.0027 0.0727  -0.0937 -0.0409 100  LYS B C   
1627 O O   . LYS B 103 ? 1.1387 0.8578 1.0113 0.0809  -0.0920 -0.0578 100  LYS B O   
1628 C CB  . LYS B 103 ? 1.1373 0.9173 1.0039 0.0543  -0.1245 -0.0509 100  LYS B CB  
1629 C CG  . LYS B 103 ? 1.1726 0.9709 1.0474 0.0362  -0.1528 -0.0523 100  LYS B CG  
1630 C CD  . LYS B 103 ? 1.1668 0.9894 1.0982 0.0275  -0.1558 -0.0190 100  LYS B CD  
1631 C CE  . LYS B 103 ? 1.2031 1.0542 1.1483 0.0085  -0.1892 -0.0172 100  LYS B CE  
1632 N NZ  . LYS B 103 ? 1.1941 1.0753 1.2072 0.0026  -0.1891 0.0198  100  LYS B NZ  
1633 N N   . TYR B 104 ? 1.0870 0.8461 0.9728 0.0797  -0.0765 -0.0205 101  TYR B N   
1634 C CA  . TYR B 104 ? 1.0726 0.8284 0.9388 0.0939  -0.0590 -0.0185 101  TYR B CA  
1635 C C   . TYR B 104 ? 1.0493 0.8269 0.8920 0.0963  -0.0513 -0.0187 101  TYR B C   
1636 O O   . TYR B 104 ? 1.0416 0.8311 0.8951 0.0915  -0.0480 -0.0046 101  TYR B O   
1637 C CB  . TYR B 104 ? 1.0692 0.8178 0.9547 0.0966  -0.0444 0.0056  101  TYR B CB  
1638 C CG  . TYR B 104 ? 1.0849 0.8308 0.9460 0.1094  -0.0322 0.0077  101  TYR B CG  
1639 C CD1 . TYR B 104 ? 1.1150 0.8452 0.9769 0.1184  -0.0347 0.0062  101  TYR B CD1 
1640 C CD2 . TYR B 104 ? 1.0837 0.8423 0.9222 0.1120  -0.0195 0.0115  101  TYR B CD2 
1641 C CE1 . TYR B 104 ? 1.1247 0.8607 0.9660 0.1301  -0.0281 0.0117  101  TYR B CE1 
1642 C CE2 . TYR B 104 ? 1.0879 0.8484 0.9019 0.1199  -0.0138 0.0116  101  TYR B CE2 
1643 C CZ  . TYR B 104 ? 1.1134 0.8670 0.9294 0.1291  -0.0198 0.0134  101  TYR B CZ  
1644 O OH  . TYR B 104 ? 1.1483 0.9116 0.9421 0.1372  -0.0186 0.0171  101  TYR B OH  
1645 N N   . VAL B 105 ? 1.0456 0.8293 0.8623 0.1037  -0.0473 -0.0325 102  VAL B N   
1646 C CA  . VAL B 105 ? 1.0369 0.8393 0.8356 0.1025  -0.0397 -0.0324 102  VAL B CA  
1647 C C   . VAL B 105 ? 1.0308 0.8408 0.8151 0.1080  -0.0298 -0.0373 102  VAL B C   
1648 O O   . VAL B 105 ? 1.0376 0.8459 0.8223 0.1161  -0.0323 -0.0441 102  VAL B O   
1649 C CB  . VAL B 105 ? 1.0513 0.8663 0.8329 0.0999  -0.0484 -0.0443 102  VAL B CB  
1650 C CG1 . VAL B 105 ? 1.0661 0.8822 0.8592 0.0910  -0.0640 -0.0386 102  VAL B CG1 
1651 C CG2 . VAL B 105 ? 1.0714 0.8837 0.8370 0.1079  -0.0512 -0.0666 102  VAL B CG2 
1652 N N   . MET B 106 ? 1.0266 0.8455 0.8023 0.1030  -0.0194 -0.0327 103  MET B N   
1653 C CA  . MET B 106 ? 1.0287 0.8611 0.7939 0.1024  -0.0137 -0.0396 103  MET B CA  
1654 C C   . MET B 106 ? 1.0345 0.8864 0.7936 0.1000  -0.0110 -0.0462 103  MET B C   
1655 O O   . MET B 106 ? 1.0382 0.8904 0.7936 0.0959  -0.0083 -0.0400 103  MET B O   
1656 C CB  . MET B 106 ? 1.0294 0.8530 0.7872 0.0952  -0.0030 -0.0341 103  MET B CB  
1657 C CG  . MET B 106 ? 1.0187 0.8377 0.7737 0.0859  0.0093  -0.0302 103  MET B CG  
1658 S SD  . MET B 106 ? 0.9850 0.8271 0.7381 0.0769  0.0124  -0.0382 103  MET B SD  
1659 C CE  . MET B 106 ? 0.9798 0.8255 0.7257 0.0659  0.0118  -0.0491 103  MET B CE  
1660 N N   . VAL B 107 ? 1.0419 0.9139 0.8023 0.1038  -0.0107 -0.0551 104  VAL B N   
1661 C CA  . VAL B 107 ? 1.0526 0.9478 0.8102 0.1025  -0.0033 -0.0592 104  VAL B CA  
1662 C C   . VAL B 107 ? 1.0558 0.9725 0.8241 0.0930  0.0028  -0.0584 104  VAL B C   
1663 O O   . VAL B 107 ? 1.0546 0.9834 0.8332 0.0949  -0.0037 -0.0613 104  VAL B O   
1664 C CB  . VAL B 107 ? 1.0628 0.9674 0.8186 0.1171  -0.0052 -0.0715 104  VAL B CB  
1665 C CG1 . VAL B 107 ? 1.0695 1.0063 0.8268 0.1188  0.0080  -0.0744 104  VAL B CG1 
1666 C CG2 . VAL B 107 ? 1.0844 0.9681 0.8241 0.1197  -0.0126 -0.0765 104  VAL B CG2 
1667 N N   . MET B 108 ? 1.0683 0.9904 0.8359 0.0812  0.0138  -0.0524 105  MET B N   
1668 C CA  . MET B 108 ? 1.0783 1.0260 0.8622 0.0690  0.0203  -0.0528 105  MET B CA  
1669 C C   . MET B 108 ? 1.0922 1.0717 0.8824 0.0772  0.0300  -0.0526 105  MET B C   
1670 O O   . MET B 108 ? 1.1060 1.0813 0.8802 0.0794  0.0394  -0.0463 105  MET B O   
1671 C CB  . MET B 108 ? 1.0861 1.0154 0.8696 0.0501  0.0307  -0.0453 105  MET B CB  
1672 C CG  . MET B 108 ? 1.0888 1.0390 0.8929 0.0310  0.0330  -0.0490 105  MET B CG  
1673 S SD  . MET B 108 ? 1.1040 1.0371 0.9163 0.0097  0.0528  -0.0375 105  MET B SD  
1674 C CE  . MET B 108 ? 1.1017 1.0832 0.9522 -0.0105 0.0535  -0.0408 105  MET B CE  
1675 N N   . GLY B 109 ? 1.0977 1.1110 0.9101 0.0838  0.0285  -0.0579 106  GLY B N   
1676 C CA  . GLY B 109 ? 1.1193 1.1639 0.9393 0.0968  0.0424  -0.0590 106  GLY B CA  
1677 C C   . GLY B 109 ? 1.1260 1.2204 0.9879 0.0922  0.0477  -0.0551 106  GLY B C   
1678 O O   . GLY B 109 ? 1.1156 1.2223 0.9994 0.0802  0.0336  -0.0545 106  GLY B O   
1679 N N   . VAL B 110 ? 1.1519 1.2782 1.0244 0.1009  0.0681  -0.0517 107  VAL B N   
1680 C CA  . VAL B 110 ? 1.1649 1.3484 1.0878 0.1015  0.0757  -0.0458 107  VAL B CA  
1681 C C   . VAL B 110 ? 1.1833 1.3796 1.1149 0.1339  0.0780  -0.0541 107  VAL B C   
1682 O O   . VAL B 110 ? 1.2047 1.3765 1.1019 0.1538  0.0898  -0.0644 107  VAL B O   
1683 C CB  . VAL B 110 ? 1.1782 1.3934 1.1151 0.0929  0.1035  -0.0329 107  VAL B CB  
1684 C CG1 . VAL B 110 ? 1.1796 1.4619 1.1823 0.0894  0.1104  -0.0234 107  VAL B CG1 
1685 C CG2 . VAL B 110 ? 1.1783 1.3675 1.1026 0.0642  0.1048  -0.0229 107  VAL B CG2 
1686 N N   . VAL B 111 ? 1.1871 1.4197 1.1636 0.1392  0.0656  -0.0497 108  VAL B N   
1687 C CA  . VAL B 111 ? 1.2142 1.4574 1.2081 0.1730  0.0684  -0.0535 108  VAL B CA  
1688 C C   . VAL B 111 ? 1.2527 1.5247 1.2594 0.1950  0.1024  -0.0547 108  VAL B C   
1689 O O   . VAL B 111 ? 1.2577 1.5730 1.2899 0.1829  0.1203  -0.0436 108  VAL B O   
1690 C CB  . VAL B 111 ? 1.1987 1.4861 1.2446 0.1747  0.0474  -0.0414 108  VAL B CB  
1691 C CG1 . VAL B 111 ? 1.2157 1.5093 1.2836 0.2138  0.0525  -0.0408 108  VAL B CG1 
1692 C CG2 . VAL B 111 ? 1.1883 1.4454 1.2102 0.1546  0.0171  -0.0418 108  VAL B CG2 
1693 N N   . GLN B 112 ? 1.2946 1.5398 1.2828 0.2270  0.1137  -0.0686 109  GLN B N   
1694 C CA  . GLN B 112 ? 1.3469 1.6090 1.3331 0.2510  0.1502  -0.0751 109  GLN B CA  
1695 C C   . GLN B 112 ? 1.3727 1.6727 1.4155 0.2856  0.1644  -0.0707 109  GLN B C   
1696 O O   . GLN B 112 ? 1.3762 1.7422 1.4723 0.2907  0.1851  -0.0552 109  GLN B O   
1697 C CB  . GLN B 112 ? 1.3863 1.5850 1.2972 0.2601  0.1592  -0.0996 109  GLN B CB  
1698 C CG  . GLN B 112 ? 1.3892 1.5729 1.2509 0.2335  0.1597  -0.0974 109  GLN B CG  
1699 C CD  . GLN B 112 ? 1.4019 1.6373 1.2791 0.2283  0.1902  -0.0814 109  GLN B CD  
1700 O OE1 . GLN B 112 ? 1.3790 1.6377 1.2775 0.2005  0.1854  -0.0617 109  GLN B OE1 
1701 N NE2 . GLN B 112 ? 1.4434 1.6942 1.3107 0.2551  0.2246  -0.0898 109  GLN B NE2 
1702 N N   . ALA B 113 ? 1.4005 1.6601 1.4379 0.3097  0.1548  -0.0812 110  ALA B N   
1703 C CA  . ALA B 113 ? 1.4342 1.7193 1.5250 0.3493  0.1709  -0.0761 110  ALA B CA  
1704 C C   . ALA B 113 ? 1.4400 1.6879 1.5410 0.3645  0.1460  -0.0736 110  ALA B C   
1705 O O   . ALA B 113 ? 1.4841 1.6721 1.5591 0.3894  0.1567  -0.0928 110  ALA B O   
1706 C CB  . ALA B 113 ? 1.4927 1.7583 1.5571 0.3813  0.2151  -0.0982 110  ALA B CB  
1707 N N   . CYS B 114 ? 1.4045 1.6869 1.5412 0.3481  0.1134  -0.0498 111  CYS B N   
1708 C CA  . CYS B 114 ? 1.4055 1.6643 1.5539 0.3593  0.0869  -0.0379 111  CYS B CA  
1709 C C   . CYS B 114 ? 1.4482 1.6667 1.6092 0.4034  0.1048  -0.0435 111  CYS B C   
1710 O O   . CYS B 114 ? 1.4616 1.6196 1.5994 0.4080  0.0909  -0.0461 111  CYS B O   
1711 C CB  . CYS B 114 ? 1.3795 1.7145 1.5882 0.3519  0.0608  -0.0060 111  CYS B CB  
1712 S SG  . CYS B 114 ? 1.3566 1.7480 1.5692 0.3009  0.0432  -0.0001 111  CYS B SG  
1713 N N   . SER B 115 ? 1.4710 1.7221 1.6722 0.4359  0.1382  -0.0438 112  SER B N   
1714 C CA  . SER B 115 ? 1.5214 1.7303 1.7369 0.4817  0.1635  -0.0526 112  SER B CA  
1715 C C   . SER B 115 ? 1.5674 1.6947 1.7102 0.4849  0.1892  -0.0960 112  SER B C   
1716 O O   . SER B 115 ? 1.5664 1.7033 1.6695 0.4669  0.2037  -0.1131 112  SER B O   
1717 C CB  . SER B 115 ? 1.5361 1.8206 1.8320 0.5183  0.1913  -0.0326 112  SER B CB  
1718 O OG  . SER B 115 ? 1.5996 1.8390 1.9094 0.5668  0.2240  -0.0439 112  SER B OG  
1719 N N   . PRO B 116 ? 1.6107 1.6562 1.7334 0.5052  0.1929  -0.1132 113  PRO B N   
1720 C CA  . PRO B 116 ? 1.6081 1.6248 1.7638 0.5200  0.1727  -0.0916 113  PRO B CA  
1721 C C   . PRO B 116 ? 1.5703 1.5411 1.6802 0.4820  0.1361  -0.0921 113  PRO B C   
1722 O O   . PRO B 116 ? 1.5689 1.5178 1.6980 0.4868  0.1166  -0.0702 113  PRO B O   
1723 C CB  . PRO B 116 ? 1.6920 1.6330 1.8445 0.5598  0.2051  -0.1169 113  PRO B CB  
1724 C CG  . PRO B 116 ? 1.7369 1.6677 1.8443 0.5641  0.2412  -0.1562 113  PRO B CG  
1725 C CD  . PRO B 116 ? 1.6833 1.6585 1.7518 0.5202  0.2245  -0.1568 113  PRO B CD  
1726 N N   . GLU B 117 ? 1.5397 1.4988 1.5916 0.4464  0.1295  -0.1140 114  GLU B N   
1727 C CA  . GLU B 117 ? 1.4984 1.4278 1.5119 0.4094  0.0986  -0.1128 114  GLU B CA  
1728 C C   . GLU B 117 ? 1.4448 1.4175 1.4306 0.3770  0.0938  -0.1162 114  GLU B C   
1729 O O   . GLU B 117 ? 1.4685 1.4407 1.4246 0.3765  0.1149  -0.1387 114  GLU B O   
1730 C CB  . GLU B 117 ? 1.5490 1.3879 1.5168 0.4052  0.1001  -0.1436 114  GLU B CB  
1731 C CG  . GLU B 117 ? 1.5385 1.3476 1.4712 0.3678  0.0717  -0.1428 114  GLU B CG  
1732 C CD  . GLU B 117 ? 1.6118 1.3367 1.5292 0.3671  0.0674  -0.1595 114  GLU B CD  
1733 O OE1 . GLU B 117 ? 1.6412 1.3386 1.5951 0.3899  0.0701  -0.1444 114  GLU B OE1 
1734 O OE2 . GLU B 117 ? 1.6346 1.3227 1.5070 0.3427  0.0601  -0.1853 114  GLU B OE2 
1735 N N   . PRO B 118 ? 1.3811 1.3891 1.3742 0.3507  0.0680  -0.0933 115  PRO B N   
1736 C CA  . PRO B 118 ? 1.3324 1.3865 1.3144 0.3211  0.0638  -0.0899 115  PRO B CA  
1737 C C   . PRO B 118 ? 1.3289 1.3492 1.2531 0.3007  0.0703  -0.1134 115  PRO B C   
1738 O O   . PRO B 118 ? 1.3342 1.3014 1.2223 0.2877  0.0570  -0.1235 115  PRO B O   
1739 C CB  . PRO B 118 ? 1.2946 1.3593 1.2799 0.2979  0.0330  -0.0688 115  PRO B CB  
1740 C CG  . PRO B 118 ? 1.3173 1.3257 1.2936 0.3083  0.0227  -0.0665 115  PRO B CG  
1741 C CD  . PRO B 118 ? 1.3665 1.3623 1.3721 0.3466  0.0422  -0.0706 115  PRO B CD  
1742 N N   . CYS B 119 ? 1.3181 1.3735 1.2367 0.2980  0.0905  -0.1184 116  CYS B N   
1743 C CA  . CYS B 119 ? 1.3118 1.3454 1.1750 0.2785  0.0952  -0.1337 116  CYS B CA  
1744 C C   . CYS B 119 ? 1.2552 1.3228 1.1216 0.2472  0.0845  -0.1156 116  CYS B C   
1745 O O   . CYS B 119 ? 1.2294 1.3483 1.1406 0.2419  0.0830  -0.0972 116  CYS B O   
1746 C CB  . CYS B 119 ? 1.3597 1.4004 1.2016 0.2971  0.1284  -0.1512 116  CYS B CB  
1747 S SG  . CYS B 119 ? 1.3943 1.3983 1.1534 0.2782  0.1297  -0.1717 116  CYS B SG  
1748 N N   . LEU B 120 ? 1.2365 1.2746 1.0584 0.2261  0.0763  -0.1208 117  LEU B N   
1749 C CA  . LEU B 120 ? 1.1933 1.2522 1.0152 0.1983  0.0706  -0.1049 117  LEU B CA  
1750 C C   . LEU B 120 ? 1.2046 1.2645 0.9884 0.1903  0.0863  -0.1070 117  LEU B C   
1751 O O   . LEU B 120 ? 1.2445 1.2795 0.9868 0.2016  0.0936  -0.1240 117  LEU B O   
1752 C CB  . LEU B 120 ? 1.1713 1.1962 0.9820 0.1806  0.0457  -0.1003 117  LEU B CB  
1753 C CG  . LEU B 120 ? 1.1472 1.1879 0.9918 0.1744  0.0300  -0.0872 117  LEU B CG  
1754 C CD1 . LEU B 120 ? 1.1402 1.1399 0.9649 0.1627  0.0119  -0.0851 117  LEU B CD1 
1755 C CD2 . LEU B 120 ? 1.1412 1.2246 1.0086 0.1549  0.0337  -0.0753 117  LEU B CD2 
1756 N N   . GLN B 121 ? 1.1724 1.2592 0.9681 0.1698  0.0908  -0.0893 118  GLN B N   
1757 C CA  . GLN B 121 ? 1.1821 1.2706 0.9437 0.1609  0.1053  -0.0827 118  GLN B CA  
1758 C C   . GLN B 121 ? 1.1527 1.2189 0.9067 0.1367  0.0892  -0.0695 118  GLN B C   
1759 O O   . GLN B 121 ? 1.1283 1.2103 0.9132 0.1185  0.0896  -0.0552 118  GLN B O   
1760 C CB  . GLN B 121 ? 1.1921 1.3327 0.9821 0.1607  0.1335  -0.0690 118  GLN B CB  
1761 C CG  . GLN B 121 ? 1.2194 1.3657 0.9713 0.1555  0.1549  -0.0575 118  GLN B CG  
1762 C CD  . GLN B 121 ? 1.2700 1.3933 0.9574 0.1754  0.1624  -0.0763 118  GLN B CD  
1763 O OE1 . GLN B 121 ? 1.3013 1.4181 0.9831 0.1979  0.1679  -0.0986 118  GLN B OE1 
1764 N NE2 . GLN B 121 ? 1.2963 1.4057 0.9335 0.1670  0.1620  -0.0675 118  GLN B NE2 
1765 N N   . ALA B 122 ? 1.1580 1.1869 0.8734 0.1364  0.0752  -0.0754 119  ALA B N   
1766 C CA  . ALA B 122 ? 1.1352 1.1393 0.8477 0.1193  0.0601  -0.0630 119  ALA B CA  
1767 C C   . ALA B 122 ? 1.1360 1.1522 0.8533 0.1033  0.0736  -0.0404 119  ALA B C   
1768 O O   . ALA B 122 ? 1.1658 1.1966 0.8605 0.1059  0.0893  -0.0312 119  ALA B O   
1769 C CB  . ALA B 122 ? 1.1481 1.1212 0.8246 0.1227  0.0437  -0.0700 119  ALA B CB  
1770 N N   . VAL B 123 ? 1.1111 1.1180 0.8554 0.0871  0.0691  -0.0317 120  VAL B N   
1771 C CA  . VAL B 123 ? 1.1118 1.1145 0.8646 0.0699  0.0810  -0.0108 120  VAL B CA  
1772 C C   . VAL B 123 ? 1.1114 1.0770 0.8492 0.0678  0.0706  -0.0017 120  VAL B C   
1773 O O   . VAL B 123 ? 1.1299 1.0893 0.8543 0.0664  0.0780  0.0184  120  VAL B O   
1774 C CB  . VAL B 123 ? 1.0957 1.1085 0.8886 0.0511  0.0845  -0.0109 120  VAL B CB  
1775 C CG1 . VAL B 123 ? 1.1068 1.0987 0.9085 0.0317  0.0961  0.0070  120  VAL B CG1 
1776 C CG2 . VAL B 123 ? 1.0937 1.1542 0.9127 0.0525  0.0965  -0.0126 120  VAL B CG2 
1777 N N   . LYS B 124 ? 1.0921 1.0364 0.8349 0.0693  0.0548  -0.0132 121  LYS B N   
1778 C CA  . LYS B 124 ? 1.0949 1.0105 0.8297 0.0714  0.0457  -0.0049 121  LYS B CA  
1779 C C   . LYS B 124 ? 1.0858 0.9893 0.8208 0.0790  0.0287  -0.0196 121  LYS B C   
1780 O O   . LYS B 124 ? 1.0759 0.9849 0.8201 0.0805  0.0248  -0.0336 121  LYS B O   
1781 C CB  . LYS B 124 ? 1.0949 0.9851 0.8458 0.0594  0.0557  0.0074  121  LYS B CB  
1782 C CG  . LYS B 124 ? 1.0870 0.9529 0.8372 0.0655  0.0515  0.0212  121  LYS B CG  
1783 C CD  . LYS B 124 ? 1.0829 0.9163 0.8471 0.0589  0.0601  0.0200  121  LYS B CD  
1784 C CE  . LYS B 124 ? 1.0972 0.9110 0.8693 0.0685  0.0607  0.0372  121  LYS B CE  
1785 N NZ  . LYS B 124 ? 1.0927 0.9081 0.8662 0.0768  0.0458  0.0295  121  LYS B NZ  
1786 N N   . MET B 125 ? 1.0944 0.9837 0.8237 0.0834  0.0186  -0.0123 122  MET B N   
1787 C CA  . MET B 125 ? 1.0903 0.9680 0.8235 0.0891  0.0035  -0.0222 122  MET B CA  
1788 C C   . MET B 125 ? 1.0827 0.9434 0.8297 0.0879  0.0003  -0.0060 122  MET B C   
1789 O O   . MET B 125 ? 1.0945 0.9581 0.8424 0.0874  0.0024  0.0124  122  MET B O   
1790 C CB  . MET B 125 ? 1.1087 0.9957 0.8228 0.0963  -0.0082 -0.0355 122  MET B CB  
1791 C CG  . MET B 125 ? 1.1347 1.0059 0.8554 0.0995  -0.0240 -0.0458 122  MET B CG  
1792 S SD  . MET B 125 ? 1.2335 1.1082 0.9309 0.0980  -0.0426 -0.0496 122  MET B SD  
1793 C CE  . MET B 125 ? 1.2170 1.0977 0.9328 0.0914  -0.0459 -0.0171 122  MET B CE  
1794 N N   . THR B 126 ? 1.0702 0.9159 0.8303 0.0894  -0.0029 -0.0096 123  THR B N   
1795 C CA  . THR B 126 ? 1.0670 0.8976 0.8461 0.0900  0.0018  0.0063  123  THR B CA  
1796 C C   . THR B 126 ? 1.0578 0.8851 0.8513 0.0927  -0.0116 0.0053  123  THR B C   
1797 O O   . THR B 126 ? 1.0571 0.8796 0.8464 0.0944  -0.0166 -0.0083 123  THR B O   
1798 C CB  . THR B 126 ? 1.0708 0.8819 0.8490 0.0874  0.0191  0.0036  123  THR B CB  
1799 O OG1 . THR B 126 ? 1.0810 0.8955 0.8476 0.0800  0.0275  -0.0033 123  THR B OG1 
1800 C CG2 . THR B 126 ? 1.0872 0.8795 0.8814 0.0907  0.0340  0.0208  123  THR B CG2 
1801 N N   . ASP B 127 ? 1.0505 0.8819 0.8669 0.0929  -0.0172 0.0223  124  ASP B N   
1802 C CA  . ASP B 127 ? 1.0467 0.8769 0.8841 0.0912  -0.0306 0.0225  124  ASP B CA  
1803 C C   . ASP B 127 ? 1.0387 0.8548 0.8981 0.0946  -0.0149 0.0344  124  ASP B C   
1804 O O   . ASP B 127 ? 1.0471 0.8625 0.9248 0.0987  0.0004  0.0529  124  ASP B O   
1805 C CB  . ASP B 127 ? 1.0578 0.9077 0.9137 0.0860  -0.0508 0.0337  124  ASP B CB  
1806 C CG  . ASP B 127 ? 1.0757 0.9233 0.9582 0.0788  -0.0670 0.0313  124  ASP B CG  
1807 O OD1 . ASP B 127 ? 1.0778 0.9062 0.9521 0.0790  -0.0665 0.0148  124  ASP B OD1 
1808 O OD2 . ASP B 127 ? 1.1025 0.9687 1.0192 0.0728  -0.0802 0.0483  124  ASP B OD2 
1809 N N   . LEU B 128 ? 1.0303 0.8345 0.8880 0.0951  -0.0165 0.0259  125  LEU B N   
1810 C CA  . LEU B 128 ? 1.0220 0.8131 0.8903 0.0995  0.0011  0.0380  125  LEU B CA  
1811 C C   . LEU B 128 ? 1.0280 0.8205 0.9351 0.0962  -0.0046 0.0523  125  LEU B C   
1812 O O   . LEU B 128 ? 1.0348 0.8182 0.9521 0.1005  0.0124  0.0659  125  LEU B O   
1813 C CB  . LEU B 128 ? 1.0204 0.7988 0.8563 0.1034  0.0075  0.0252  125  LEU B CB  
1814 C CG  . LEU B 128 ? 1.0048 0.7871 0.8100 0.1020  0.0089  0.0094  125  LEU B CG  
1815 C CD1 . LEU B 128 ? 1.0076 0.7890 0.7917 0.1047  0.0055  -0.0014 125  LEU B CD1 
1816 C CD2 . LEU B 128 ? 1.0071 0.7802 0.8035 0.1011  0.0283  0.0136  125  LEU B CD2 
1817 N N   . SER B 129 ? 1.0346 0.8390 0.9627 0.0871  -0.0279 0.0497  126  SER B N   
1818 C CA  . SER B 129 ? 1.0520 0.8570 1.0224 0.0780  -0.0383 0.0600  126  SER B CA  
1819 C C   . SER B 129 ? 1.0570 0.8756 1.0734 0.0795  -0.0215 0.0905  126  SER B C   
1820 O O   . SER B 129 ? 1.0668 0.8855 1.1232 0.0731  -0.0207 0.1050  126  SER B O   
1821 C CB  . SER B 129 ? 1.0625 0.8793 1.0421 0.0643  -0.0696 0.0479  126  SER B CB  
1822 O OG  . SER B 129 ? 1.0683 0.8784 1.0007 0.0671  -0.0783 0.0216  126  SER B OG  
1823 N N   . ASP B 130 ? 1.0605 0.8894 1.0743 0.0889  -0.0052 0.1014  127  ASP B N   
1824 C CA  . ASP B 130 ? 1.0692 0.9103 1.1245 0.0966  0.0185  0.1303  127  ASP B CA  
1825 C C   . ASP B 130 ? 1.0801 0.9026 1.1339 0.1030  0.0455  0.1391  127  ASP B C   
1826 O O   . ASP B 130 ? 1.0823 0.9178 1.1857 0.1027  0.0574  0.1639  127  ASP B O   
1827 C CB  . ASP B 130 ? 1.0740 0.9125 1.1107 0.1094  0.0374  0.1333  127  ASP B CB  
1828 C CG  . ASP B 130 ? 1.0953 0.9493 1.1203 0.1048  0.0131  0.1263  127  ASP B CG  
1829 O OD1 . ASP B 130 ? 1.1268 1.0126 1.1934 0.1014  -0.0036 0.1454  127  ASP B OD1 
1830 O OD2 . ASP B 130 ? 1.0933 0.9318 1.0690 0.1043  0.0105  0.1044  127  ASP B OD2 
1831 N N   . ASN B 131 ? 1.0916 0.8876 1.0891 0.1082  0.0538  0.1205  128  ASN B N   
1832 C CA  . ASN B 131 ? 1.1162 0.8936 1.0925 0.1167  0.0801  0.1277  128  ASN B CA  
1833 C C   . ASN B 131 ? 1.1271 0.8909 1.0861 0.1127  0.0674  0.1213  128  ASN B C   
1834 O O   . ASN B 131 ? 1.1293 0.8842 1.0486 0.1127  0.0530  0.0996  128  ASN B O   
1835 C CB  . ASN B 131 ? 1.1309 0.8897 1.0524 0.1266  0.1009  0.1138  128  ASN B CB  
1836 C CG  . ASN B 131 ? 1.1698 0.9135 1.0729 0.1381  0.1370  0.1262  128  ASN B CG  
1837 O OD1 . ASN B 131 ? 1.1921 0.9359 1.1046 0.1394  0.1448  0.1428  128  ASN B OD1 
1838 N ND2 . ASN B 131 ? 1.1883 0.9152 1.0618 0.1466  0.1614  0.1179  128  ASN B ND2 
1839 N N   . PRO B 132 ? 1.1398 0.9031 1.1340 0.1103  0.0749  0.1437  129  PRO B N   
1840 C CA  . PRO B 132 ? 1.1539 0.8999 1.1387 0.1085  0.0658  0.1438  129  PRO B CA  
1841 C C   . PRO B 132 ? 1.1746 0.9056 1.0960 0.1213  0.0773  0.1385  129  PRO B C   
1842 O O   . PRO B 132 ? 1.1913 0.9106 1.0987 0.1234  0.0655  0.1365  129  PRO B O   
1843 C CB  . PRO B 132 ? 1.1686 0.9176 1.2075 0.1039  0.0808  0.1763  129  PRO B CB  
1844 C CG  . PRO B 132 ? 1.1557 0.9316 1.2466 0.0980  0.0837  0.1875  129  PRO B CG  
1845 C CD  . PRO B 132 ? 1.1436 0.9243 1.1966 0.1092  0.0931  0.1735  129  PRO B CD  
1846 N N   . ILE B 133 ? 1.1842 0.9150 1.0681 0.1297  0.0991  0.1362  130  ILE B N   
1847 C CA  . ILE B 133 ? 1.2147 0.9344 1.0335 0.1384  0.1072  0.1299  130  ILE B CA  
1848 C C   . ILE B 133 ? 1.2033 0.9256 0.9892 0.1358  0.0812  0.1021  130  ILE B C   
1849 O O   . ILE B 133 ? 1.2201 0.9414 0.9765 0.1404  0.0716  0.1017  130  ILE B O   
1850 C CB  . ILE B 133 ? 1.2442 0.9558 1.0261 0.1466  0.1408  0.1314  130  ILE B CB  
1851 C CG1 . ILE B 133 ? 1.2729 0.9815 1.0644 0.1549  0.1716  0.1634  130  ILE B CG1 
1852 C CG2 . ILE B 133 ? 1.2696 0.9716 0.9775 0.1485  0.1381  0.1097  130  ILE B CG2 
1853 C CD1 . ILE B 133 ? 1.2603 0.9804 1.1156 0.1557  0.1931  0.1830  130  ILE B CD1 
1854 N N   . HIS B 134 ? 1.1791 0.9087 0.9748 0.1293  0.0704  0.0830  131  HIS B N   
1855 C CA  . HIS B 134 ? 1.1739 0.9102 0.9431 0.1262  0.0515  0.0589  131  HIS B CA  
1856 C C   . HIS B 134 ? 1.1781 0.9179 0.9481 0.1300  0.0323  0.0587  131  HIS B C   
1857 O O   . HIS B 134 ? 1.1861 0.9347 0.9267 0.1325  0.0227  0.0484  131  HIS B O   
1858 C CB  . HIS B 134 ? 1.1486 0.8939 0.9404 0.1191  0.0411  0.0461  131  HIS B CB  
1859 C CG  . HIS B 134 ? 1.1513 0.8924 0.9363 0.1176  0.0582  0.0434  131  HIS B CG  
1860 N ND1 . HIS B 134 ? 1.1772 0.9093 0.9216 0.1156  0.0667  0.0284  131  HIS B ND1 
1861 C CD2 . HIS B 134 ? 1.1459 0.8893 0.9629 0.1178  0.0679  0.0545  131  HIS B CD2 
1862 C CE1 . HIS B 134 ? 1.1906 0.9123 0.9410 0.1157  0.0842  0.0292  131  HIS B CE1 
1863 N NE2 . HIS B 134 ? 1.1721 0.9030 0.9677 0.1191  0.0856  0.0473  131  HIS B NE2 
1864 N N   . GLU B 135 ? 1.1806 0.9137 0.9894 0.1301  0.0268  0.0705  132  GLU B N   
1865 C CA  . GLU B 135 ? 1.1957 0.9227 1.0134 0.1361  0.0125  0.0721  132  GLU B CA  
1866 C C   . GLU B 135 ? 1.2245 0.9495 1.0145 0.1473  0.0188  0.0908  132  GLU B C   
1867 O O   . GLU B 135 ? 1.2334 0.9682 1.0055 0.1554  0.0063  0.0860  132  GLU B O   
1868 C CB  . GLU B 135 ? 1.2009 0.9121 1.0667 0.1302  0.0080  0.0804  132  GLU B CB  
1869 C CG  . GLU B 135 ? 1.2343 0.9296 1.1136 0.1360  -0.0063 0.0743  132  GLU B CG  
1870 C CD  . GLU B 135 ? 1.2724 0.9448 1.1979 0.1249  -0.0122 0.0766  132  GLU B CD  
1871 O OE1 . GLU B 135 ? 1.2669 0.9446 1.2188 0.1117  -0.0077 0.0862  132  GLU B OE1 
1872 O OE2 . GLU B 135 ? 1.3018 0.9506 1.2401 0.1292  -0.0214 0.0685  132  GLU B OE2 
1873 N N   . SER B 136 ? 1.2472 0.9634 1.0346 0.1486  0.0387  0.1147  133  SER B N   
1874 C CA  . SER B 136 ? 1.2880 1.0026 1.0398 0.1595  0.0477  0.1372  133  SER B CA  
1875 C C   . SER B 136 ? 1.3015 1.0333 0.9957 0.1614  0.0403  0.1206  133  SER B C   
1876 O O   . SER B 136 ? 1.3218 1.0654 0.9949 0.1698  0.0257  0.1264  133  SER B O   
1877 C CB  . SER B 136 ? 1.3104 1.0160 1.0618 0.1598  0.0773  0.1621  133  SER B CB  
1878 O OG  . SER B 136 ? 1.2830 0.9838 1.0929 0.1504  0.0841  0.1670  133  SER B OG  
1879 N N   . MET B 137 ? 1.2947 1.0280 0.9690 0.1526  0.0494  0.1007  134  MET B N   
1880 C CA  . MET B 137 ? 1.3122 1.0555 0.9336 0.1481  0.0444  0.0803  134  MET B CA  
1881 C C   . MET B 137 ? 1.2911 1.0575 0.9159 0.1451  0.0167  0.0630  134  MET B C   
1882 O O   . MET B 137 ? 1.3202 1.1033 0.9062 0.1433  0.0043  0.0567  134  MET B O   
1883 C CB  . MET B 137 ? 1.3081 1.0402 0.9249 0.1385  0.0605  0.0609  134  MET B CB  
1884 C CG  . MET B 137 ? 1.3617 1.0743 0.9454 0.1419  0.0915  0.0675  134  MET B CG  
1885 S SD  . MET B 137 ? 1.4104 1.1077 0.9569 0.1306  0.1011  0.0330  134  MET B SD  
1886 C CE  . MET B 137 ? 1.4837 1.1731 0.9405 0.1305  0.1053  0.0251  134  MET B CE  
1887 N N   . TRP B 138 ? 1.2480 1.0181 0.9183 0.1438  0.0072  0.0546  135  TRP B N   
1888 C CA  . TRP B 138 ? 1.2290 1.0229 0.9070 0.1408  -0.0120 0.0359  135  TRP B CA  
1889 C C   . TRP B 138 ? 1.2495 1.0692 0.9168 0.1499  -0.0305 0.0439  135  TRP B C   
1890 O O   . TRP B 138 ? 1.2484 1.0954 0.9040 0.1427  -0.0439 0.0298  135  TRP B O   
1891 C CB  . TRP B 138 ? 1.1985 0.9899 0.9204 0.1418  -0.0164 0.0281  135  TRP B CB  
1892 C CG  . TRP B 138 ? 1.1810 0.9988 0.9131 0.1431  -0.0309 0.0131  135  TRP B CG  
1893 C CD1 . TRP B 138 ? 1.1767 1.0018 0.9349 0.1563  -0.0399 0.0145  135  TRP B CD1 
1894 C CD2 . TRP B 138 ? 1.1697 1.0098 0.8900 0.1314  -0.0347 -0.0042 135  TRP B CD2 
1895 N NE1 . TRP B 138 ? 1.1690 1.0251 0.9336 0.1553  -0.0475 0.0004  135  TRP B NE1 
1896 C CE2 . TRP B 138 ? 1.1647 1.0318 0.9081 0.1382  -0.0455 -0.0101 135  TRP B CE2 
1897 C CE3 . TRP B 138 ? 1.1732 1.0100 0.8686 0.1156  -0.0277 -0.0151 135  TRP B CE3 
1898 C CZ2 . TRP B 138 ? 1.1674 1.0645 0.9140 0.1280  -0.0499 -0.0236 135  TRP B CZ2 
1899 C CZ3 . TRP B 138 ? 1.1678 1.0276 0.8646 0.1036  -0.0339 -0.0305 135  TRP B CZ3 
1900 C CH2 . TRP B 138 ? 1.1569 1.0495 0.8808 0.1088  -0.0452 -0.0332 135  TRP B CH2 
1901 N N   . GLU B 139 ? 1.2701 1.0835 0.9468 0.1652  -0.0318 0.0692  136  GLU B N   
1902 C CA  . GLU B 139 ? 1.2935 1.1348 0.9679 0.1783  -0.0503 0.0832  136  GLU B CA  
1903 C C   . GLU B 139 ? 1.3240 1.1902 0.9458 0.1703  -0.0608 0.0813  136  GLU B C   
1904 O O   . GLU B 139 ? 1.3273 1.2324 0.9501 0.1706  -0.0826 0.0783  136  GLU B O   
1905 C CB  . GLU B 139 ? 1.3218 1.1459 1.0127 0.1973  -0.0469 0.1163  136  GLU B CB  
1906 C CG  . GLU B 139 ? 1.3431 1.1864 1.0698 0.2162  -0.0625 0.1253  136  GLU B CG  
1907 C CD  . GLU B 139 ? 1.4222 1.2824 1.1350 0.2345  -0.0729 0.1615  136  GLU B CD  
1908 O OE1 . GLU B 139 ? 1.4591 1.3538 1.1290 0.2296  -0.0871 0.1650  136  GLU B OE1 
1909 O OE2 . GLU B 139 ? 1.4508 1.2891 1.1954 0.2535  -0.0681 0.1868  136  GLU B OE2 
1910 N N   . LEU B 140 ? 1.3516 1.1959 0.9286 0.1627  -0.0447 0.0822  137  LEU B N   
1911 C CA  . LEU B 140 ? 1.3970 1.2537 0.9101 0.1525  -0.0514 0.0744  137  LEU B CA  
1912 C C   . LEU B 140 ? 1.3870 1.2517 0.8913 0.1303  -0.0575 0.0380  137  LEU B C   
1913 O O   . LEU B 140 ? 1.4095 1.3064 0.8928 0.1198  -0.0810 0.0275  137  LEU B O   
1914 C CB  . LEU B 140 ? 1.4374 1.2620 0.9037 0.1545  -0.0249 0.0856  137  LEU B CB  
1915 C CG  . LEU B 140 ? 1.4537 1.2654 0.9320 0.1739  -0.0124 0.1258  137  LEU B CG  
1916 C CD1 . LEU B 140 ? 1.4917 1.2755 0.9261 0.1748  0.0196  0.1362  137  LEU B CD1 
1917 C CD2 . LEU B 140 ? 1.4983 1.3403 0.9644 0.1881  -0.0368 0.1530  137  LEU B CD2 
1918 N N   . GLU B 141 ? 1.3590 1.1965 0.8833 0.1222  -0.0377 0.0213  138  GLU B N   
1919 C CA  . GLU B 141 ? 1.3557 1.1946 0.8812 0.1019  -0.0395 -0.0093 138  GLU B CA  
1920 C C   . GLU B 141 ? 1.3468 1.2322 0.8892 0.0933  -0.0690 -0.0179 138  GLU B C   
1921 O O   . GLU B 141 ? 1.3624 1.2571 0.8860 0.0718  -0.0782 -0.0404 138  GLU B O   
1922 C CB  . GLU B 141 ? 1.3104 1.1299 0.8805 0.1016  -0.0227 -0.0148 138  GLU B CB  
1923 C CG  . GLU B 141 ? 1.3432 1.1231 0.9065 0.1045  0.0068  -0.0106 138  GLU B CG  
1924 C CD  . GLU B 141 ? 1.3381 1.1091 0.9484 0.1037  0.0161  -0.0129 138  GLU B CD  
1925 O OE1 . GLU B 141 ? 1.3331 1.1113 0.9545 0.0925  0.0114  -0.0292 138  GLU B OE1 
1926 O OE2 . GLU B 141 ? 1.3367 1.0957 0.9734 0.1131  0.0271  0.0034  138  GLU B OE2 
1927 N N   . VAL B 142 ? 1.3245 1.2381 0.9071 0.1102  -0.0822 0.0008  139  VAL B N   
1928 C CA  . VAL B 142 ? 1.3147 1.2788 0.9294 0.1083  -0.1061 -0.0010 139  VAL B CA  
1929 C C   . VAL B 142 ? 1.3710 1.3716 0.9524 0.1042  -0.1327 0.0066  139  VAL B C   
1930 O O   . VAL B 142 ? 1.3877 1.4217 0.9674 0.0836  -0.1519 -0.0095 139  VAL B O   
1931 C CB  . VAL B 142 ? 1.2770 1.2533 0.9466 0.1323  -0.1061 0.0158  139  VAL B CB  
1932 C CG1 . VAL B 142 ? 1.2663 1.3003 0.9743 0.1352  -0.1271 0.0182  139  VAL B CG1 
1933 C CG2 . VAL B 142 ? 1.2355 1.1811 0.9311 0.1321  -0.0853 0.0039  139  VAL B CG2 
1934 N N   . GLU B 143 ? 1.4108 1.4070 0.9661 0.1221  -0.1352 0.0328  140  GLU B N   
1935 C CA  . GLU B 143 ? 1.4731 1.5070 0.9893 0.1203  -0.1631 0.0447  140  GLU B CA  
1936 C C   . GLU B 143 ? 1.5180 1.5454 0.9750 0.0891  -0.1694 0.0128  140  GLU B C   
1937 O O   . GLU B 143 ? 1.5406 1.6133 0.9940 0.0712  -0.1999 0.0025  140  GLU B O   
1938 C CB  . GLU B 143 ? 1.5132 1.5316 0.9965 0.1431  -0.1574 0.0793  140  GLU B CB  
1939 C CG  . GLU B 143 ? 1.5104 1.5377 1.0534 0.1735  -0.1571 0.1131  140  GLU B CG  
1940 C CD  . GLU B 143 ? 1.5801 1.5856 1.0964 0.1950  -0.1475 0.1516  140  GLU B CD  
1941 O OE1 . GLU B 143 ? 1.5713 1.5362 1.1197 0.2086  -0.1231 0.1642  140  GLU B OE1 
1942 O OE2 . GLU B 143 ? 1.6381 1.6678 1.1014 0.1969  -0.1649 0.1702  140  GLU B OE2 
1943 N N   . ASP B 144 ? 1.5367 1.5073 0.9536 0.0819  -0.1399 -0.0038 141  ASP B N   
1944 C CA  . ASP B 144 ? 1.5989 1.5466 0.9507 0.0553  -0.1383 -0.0366 141  ASP B CA  
1945 C C   . ASP B 144 ? 1.5919 1.5568 0.9705 0.0259  -0.1529 -0.0680 141  ASP B C   
1946 O O   . ASP B 144 ? 1.6522 1.6253 0.9866 -0.0004 -0.1725 -0.0922 141  ASP B O   
1947 C CB  . ASP B 144 ? 1.6080 1.4899 0.9273 0.0585  -0.0967 -0.0462 141  ASP B CB  
1948 C CG  . ASP B 144 ? 1.6869 1.5370 0.9227 0.0381  -0.0905 -0.0775 141  ASP B CG  
1949 O OD1 . ASP B 144 ? 1.7646 1.6239 0.9320 0.0398  -0.1024 -0.0716 141  ASP B OD1 
1950 O OD2 . ASP B 144 ? 1.6762 1.4890 0.9112 0.0212  -0.0726 -0.1080 141  ASP B OD2 
1951 N N   . LEU B 145 ? 1.5302 1.4996 0.9792 0.0286  -0.1432 -0.0676 142  LEU B N   
1952 C CA  . LEU B 145 ? 1.5223 1.5121 1.0068 0.0022  -0.1537 -0.0903 142  LEU B CA  
1953 C C   . LEU B 145 ? 1.5381 1.6008 1.0460 -0.0066 -0.1943 -0.0832 142  LEU B C   
1954 O O   . LEU B 145 ? 1.5727 1.6551 1.0749 -0.0387 -0.2143 -0.1061 142  LEU B O   
1955 C CB  . LEU B 145 ? 1.4542 1.4382 1.0046 0.0115  -0.1332 -0.0855 142  LEU B CB  
1956 C CG  . LEU B 145 ? 1.4476 1.4448 1.0334 -0.0159 -0.1354 -0.1058 142  LEU B CG  
1957 C CD1 . LEU B 145 ? 1.4892 1.4262 1.0357 -0.0378 -0.1149 -0.1329 142  LEU B CD1 
1958 C CD2 . LEU B 145 ? 1.3879 1.4014 1.0393 -0.0028 -0.1223 -0.0940 142  LEU B CD2 
1959 N N   . HIS B 146 ? 1.5208 1.6232 1.0593 0.0219  -0.2062 -0.0502 143  HIS B N   
1960 C CA  . HIS B 146 ? 1.5294 1.7102 1.1068 0.0218  -0.2432 -0.0343 143  HIS B CA  
1961 C C   . HIS B 146 ? 1.6030 1.8133 1.1204 0.0075  -0.2789 -0.0344 143  HIS B C   
1962 O O   . HIS B 146 ? 1.6188 1.8966 1.1634 -0.0078 -0.3152 -0.0323 143  HIS B O   
1963 C CB  . HIS B 146 ? 1.4908 1.6977 1.1245 0.0610  -0.2400 0.0018  143  HIS B CB  
1964 C CG  . HIS B 146 ? 1.4398 1.6498 1.1444 0.0687  -0.2195 -0.0013 143  HIS B CG  
1965 N ND1 . HIS B 146 ? 1.4299 1.7033 1.2060 0.0796  -0.2315 0.0131  143  HIS B ND1 
1966 C CD2 . HIS B 146 ? 1.4066 1.5669 1.1185 0.0679  -0.1874 -0.0164 143  HIS B CD2 
1967 C CE1 . HIS B 146 ? 1.3870 1.6457 1.2046 0.0853  -0.2051 0.0050  143  HIS B CE1 
1968 N NE2 . HIS B 146 ? 1.3770 1.5684 1.1552 0.0775  -0.1805 -0.0124 143  HIS B NE2 
1969 N N   . ARG B 147 ? 1.6541 1.8180 1.0905 0.0122  -0.2686 -0.0357 144  ARG B N   
1970 C CA  . ARG B 147 ? 1.7432 1.9224 1.1009 -0.0066 -0.2984 -0.0451 144  ARG B CA  
1971 C C   . ARG B 147 ? 1.7836 1.9488 1.1183 -0.0523 -0.3072 -0.0931 144  ARG B C   
1972 O O   . ARG B 147 ? 1.8360 2.0496 1.1549 -0.0798 -0.3487 -0.1050 144  ARG B O   
1973 C CB  . ARG B 147 ? 1.7918 1.9165 1.0638 0.0100  -0.2754 -0.0374 144  ARG B CB  
1974 C CG  . ARG B 147 ? 1.7992 1.9492 1.0693 0.0468  -0.2818 0.0127  144  ARG B CG  
1975 C CD  . ARG B 147 ? 1.8914 1.9998 1.0582 0.0529  -0.2667 0.0168  144  ARG B CD  
1976 N NE  . ARG B 147 ? 1.9277 2.0610 1.0805 0.0850  -0.2749 0.0682  144  ARG B NE  
1977 C CZ  . ARG B 147 ? 2.0245 2.1509 1.0825 0.0899  -0.2774 0.0817  144  ARG B CZ  
1978 N NH1 . ARG B 147 ? 2.1007 2.1943 1.0644 0.0650  -0.2721 0.0427  144  ARG B NH1 
1979 N NH2 . ARG B 147 ? 2.0493 2.1991 1.1036 0.1207  -0.2835 0.1348  144  ARG B NH2 
1980 N N   . ASN B 148 ? 1.7640 1.8644 1.1030 -0.0610 -0.2692 -0.1188 145  ASN B N   
1981 C CA  . ASN B 148 ? 1.8145 1.8785 1.1252 -0.1021 -0.2671 -0.1652 145  ASN B CA  
1982 C C   . ASN B 148 ? 1.7850 1.8853 1.1730 -0.1320 -0.2819 -0.1792 145  ASN B C   
1983 O O   . ASN B 148 ? 1.8206 1.8822 1.1942 -0.1666 -0.2756 -0.2160 145  ASN B O   
1984 C CB  . ASN B 148 ? 1.8178 1.7908 1.0924 -0.0958 -0.2171 -0.1836 145  ASN B CB  
1985 C CG  . ASN B 148 ? 1.8977 1.8263 1.0699 -0.0879 -0.2050 -0.1913 145  ASN B CG  
1986 O OD1 . ASN B 148 ? 1.8996 1.8437 1.0489 -0.0589 -0.2053 -0.1592 145  ASN B OD1 
1987 N ND2 . ASN B 148 ? 1.9737 1.8431 1.0831 -0.1128 -0.1909 -0.2336 145  ASN B ND2 
1988 N N   . ILE B 149 ? 1.7273 1.8985 1.1987 -0.1183 -0.2979 -0.1493 146  ILE B N   
1989 C CA  . ILE B 149 ? 1.7053 1.9230 1.2547 -0.1459 -0.3114 -0.1572 146  ILE B CA  
1990 C C   . ILE B 149 ? 1.7022 2.0232 1.3082 -0.1443 -0.3552 -0.1310 146  ILE B C   
1991 O O   . ILE B 149 ? 1.6493 2.0090 1.3054 -0.1063 -0.3514 -0.0945 146  ILE B O   
1992 C CB  . ILE B 149 ? 1.6248 1.8234 1.2424 -0.1306 -0.2728 -0.1480 146  ILE B CB  
1993 C CG1 . ILE B 149 ? 1.6314 1.7352 1.2042 -0.1298 -0.2308 -0.1680 146  ILE B CG1 
1994 C CG2 . ILE B 149 ? 1.6080 1.8576 1.3044 -0.1605 -0.2839 -0.1533 146  ILE B CG2 
1995 C CD1 . ILE B 149 ? 1.5651 1.6500 1.1924 -0.1104 -0.1952 -0.1547 146  ILE B CD1 
1996 N N   . PRO B 150 ? 1.7640 2.1302 1.3660 -0.1859 -0.3971 -0.1498 147  PRO B N   
1997 C CA  . PRO B 150 ? 1.7618 2.2381 1.4293 -0.1878 -0.4427 -0.1230 147  PRO B CA  
1998 C C   . PRO B 150 ? 1.6856 2.2175 1.4735 -0.1815 -0.4301 -0.1032 147  PRO B C   
1999 O O   . PRO B 150 ? 1.6358 2.1212 1.4521 -0.1760 -0.3872 -0.1096 147  PRO B O   
2000 C CB  . PRO B 150 ? 1.8497 2.3481 1.4789 -0.2433 -0.4883 -0.1571 147  PRO B CB  
2001 C CG  . PRO B 150 ? 1.9142 2.3083 1.4296 -0.2573 -0.4675 -0.1972 147  PRO B CG  
2002 C CD  . PRO B 150 ? 1.8479 2.1638 1.3778 -0.2323 -0.4066 -0.1972 147  PRO B CD  
2003 O OXT . PRO B 150 ? 1.6750 2.3035 1.5348 -0.1799 -0.4618 -0.0777 147  PRO B OXT 
2004 N N   . ASP C 12  ? 1.5953 1.3973 1.2174 0.2250  -0.2166 0.1236  1226 ASP C N   
2005 C CA  . ASP C 12  ? 1.5690 1.3724 1.2517 0.1985  -0.1706 0.1613  1226 ASP C CA  
2006 C C   . ASP C 12  ? 1.4977 1.3240 1.2233 0.1670  -0.1421 0.1416  1226 ASP C C   
2007 O O   . ASP C 12  ? 1.4403 1.2723 1.2495 0.1378  -0.1328 0.1324  1226 ASP C O   
2008 C CB  . ASP C 12  ? 1.6562 1.4466 1.2850 0.2277  -0.1368 0.2252  1226 ASP C CB  
2009 C CG  . ASP C 12  ? 1.7362 1.5017 1.3231 0.2628  -0.1633 0.2529  1226 ASP C CG  
2010 O OD1 . ASP C 12  ? 1.8333 1.5899 1.3066 0.3122  -0.1699 0.2723  1226 ASP C OD1 
2011 O OD2 . ASP C 12  ? 1.7078 1.4626 1.3715 0.2455  -0.1800 0.2531  1226 ASP C OD2 
2012 N N   . LEU C 13  ? 1.5052 1.3445 1.1721 0.1777  -0.1324 0.1318  1227 LEU C N   
2013 C CA  . LEU C 13  ? 1.4402 1.3006 1.1412 0.1527  -0.1100 0.1130  1227 LEU C CA  
2014 C C   . LEU C 13  ? 1.3760 1.2476 1.1067 0.1379  -0.1368 0.0640  1227 LEU C C   
2015 O O   . LEU C 13  ? 1.3864 1.2536 1.0975 0.1525  -0.1698 0.0415  1227 LEU C O   
2016 C CB  . LEU C 13  ? 1.4800 1.3500 1.1145 0.1712  -0.0845 0.1253  1227 LEU C CB  
2017 C CG  . LEU C 13  ? 1.4442 1.3326 1.1175 0.1507  -0.0485 0.1270  1227 LEU C CG  
2018 C CD1 . LEU C 13  ? 1.4553 1.3395 1.1960 0.1399  -0.0095 0.1706  1227 LEU C CD1 
2019 C CD2 . LEU C 13  ? 1.4739 1.3732 1.0748 0.1726  -0.0348 0.1235  1227 LEU C CD2 
2020 N N   . PHE C 14  ? 1.3119 1.1973 1.0980 0.1130  -0.1227 0.0494  1228 PHE C N   
2021 C CA  . PHE C 14  ? 1.2526 1.1516 1.0600 0.1041  -0.1321 0.0150  1228 PHE C CA  
2022 C C   . PHE C 14  ? 1.2346 1.1509 1.0284 0.0990  -0.1123 0.0103  1228 PHE C C   
2023 O O   . PHE C 14  ? 1.2616 1.1810 1.0088 0.1114  -0.1087 0.0139  1228 PHE C O   
2024 C CB  . PHE C 14  ? 1.2113 1.1124 1.0778 0.0902  -0.1314 0.0023  1228 PHE C CB  
2025 C CG  . PHE C 14  ? 1.2096 1.0991 1.1033 0.0942  -0.1513 -0.0047 1228 PHE C CG  
2026 C CD1 . PHE C 14  ? 1.2281 1.1112 1.1103 0.1070  -0.1744 -0.0122 1228 PHE C CD1 
2027 C CD2 . PHE C 14  ? 1.1941 1.0797 1.1360 0.0877  -0.1504 -0.0097 1228 PHE C CD2 
2028 C CE1 . PHE C 14  ? 1.2304 1.1027 1.1565 0.1106  -0.1947 -0.0204 1228 PHE C CE1 
2029 C CE2 . PHE C 14  ? 1.1937 1.0693 1.1700 0.0917  -0.1659 -0.0163 1228 PHE C CE2 
2030 C CZ  . PHE C 14  ? 1.2096 1.0783 1.1818 0.1018  -0.1869 -0.0196 1228 PHE C CZ  
2031 N N   . SER C 15  ? 1.1979 1.1253 1.0308 0.0850  -0.1020 -0.0006 1229 SER C N   
2032 C CA  . SER C 15  ? 1.1781 1.1227 1.0096 0.0804  -0.0888 -0.0100 1229 SER C CA  
2033 C C   . SER C 15  ? 1.1677 1.1213 0.9738 0.0872  -0.0933 -0.0230 1229 SER C C   
2034 O O   . SER C 15  ? 1.1807 1.1394 0.9580 0.0924  -0.0860 -0.0197 1229 SER C O   
2035 C CB  . SER C 15  ? 1.2003 1.1465 1.0328 0.0780  -0.0680 0.0105  1229 SER C CB  
2036 O OG  . SER C 15  ? 1.2562 1.1934 1.0386 0.0929  -0.0617 0.0323  1229 SER C OG  
2037 N N   . VAL C 16  ? 1.1511 1.1068 0.9778 0.0895  -0.1026 -0.0366 1230 VAL C N   
2038 C CA  . VAL C 16  ? 1.1432 1.1091 0.9752 0.0946  -0.1044 -0.0480 1230 VAL C CA  
2039 C C   . VAL C 16  ? 1.1385 1.1185 0.9604 0.0893  -0.0879 -0.0472 1230 VAL C C   
2040 O O   . VAL C 16  ? 1.1331 1.1201 0.9682 0.0876  -0.0801 -0.0488 1230 VAL C O   
2041 C CB  . VAL C 16  ? 1.1176 1.0869 0.9969 0.0980  -0.1019 -0.0525 1230 VAL C CB  
2042 C CG1 . VAL C 16  ? 1.1238 1.0800 1.0344 0.1028  -0.1202 -0.0564 1230 VAL C CG1 
2043 C CG2 . VAL C 16  ? 1.0931 1.0680 0.9749 0.0990  -0.0848 -0.0478 1230 VAL C CG2 
2044 N N   . THR C 17  ? 1.1546 1.1382 0.9505 0.0913  -0.0838 -0.0461 1231 THR C N   
2045 C CA  . THR C 17  ? 1.1446 1.1408 0.9447 0.0850  -0.0679 -0.0448 1231 THR C CA  
2046 C C   . THR C 17  ? 1.1364 1.1453 0.9356 0.0890  -0.0657 -0.0554 1231 THR C C   
2047 O O   . THR C 17  ? 1.1682 1.1773 0.9411 0.0977  -0.0656 -0.0591 1231 THR C O   
2048 C CB  . THR C 17  ? 1.1735 1.1659 0.9663 0.0820  -0.0525 -0.0280 1231 THR C CB  
2049 O OG1 . THR C 17  ? 1.2197 1.2027 0.9672 0.0961  -0.0508 -0.0168 1231 THR C OG1 
2050 C CG2 . THR C 17  ? 1.1674 1.1520 0.9945 0.0740  -0.0545 -0.0218 1231 THR C CG2 
2051 N N   . PHE C 18  ? 1.1055 1.1247 0.9303 0.0875  -0.0637 -0.0602 1232 PHE C N   
2052 C CA  . PHE C 18  ? 1.0967 1.1296 0.9319 0.0884  -0.0580 -0.0667 1232 PHE C CA  
2053 C C   . PHE C 18  ? 1.0966 1.1372 0.9384 0.0822  -0.0491 -0.0647 1232 PHE C C   
2054 O O   . PHE C 18  ? 1.0973 1.1362 0.9473 0.0819  -0.0539 -0.0646 1232 PHE C O   
2055 C CB  . PHE C 18  ? 1.0758 1.1146 0.9441 0.0946  -0.0594 -0.0669 1232 PHE C CB  
2056 C CG  . PHE C 18  ? 1.0582 1.1059 0.9317 0.0993  -0.0518 -0.0593 1232 PHE C CG  
2057 C CD1 . PHE C 18  ? 1.0360 1.0954 0.9158 0.0982  -0.0495 -0.0638 1232 PHE C CD1 
2058 C CD2 . PHE C 18  ? 1.0463 1.0908 0.9148 0.1107  -0.0479 -0.0489 1232 PHE C CD2 
2059 C CE1 . PHE C 18  ? 1.0221 1.0885 0.9005 0.1092  -0.0501 -0.0597 1232 PHE C CE1 
2060 C CE2 . PHE C 18  ? 1.0456 1.0977 0.9007 0.1263  -0.0448 -0.0440 1232 PHE C CE2 
2061 C CZ  . PHE C 18  ? 1.0426 1.1051 0.9016 0.1260  -0.0493 -0.0502 1232 PHE C CZ  
2062 N N   . ASP C 19  ? 1.1057 1.1551 0.9513 0.0803  -0.0386 -0.0674 1233 ASP C N   
2063 C CA  . ASP C 19  ? 1.1111 1.1668 0.9842 0.0735  -0.0288 -0.0654 1233 ASP C CA  
2064 C C   . ASP C 19  ? 1.1165 1.1850 1.0018 0.0742  -0.0140 -0.0695 1233 ASP C C   
2065 O O   . ASP C 19  ? 1.1343 1.2042 0.9929 0.0821  -0.0096 -0.0742 1233 ASP C O   
2066 C CB  . ASP C 19  ? 1.1310 1.1760 1.0065 0.0693  -0.0172 -0.0502 1233 ASP C CB  
2067 C CG  . ASP C 19  ? 1.1689 1.2037 0.9937 0.0785  -0.0097 -0.0389 1233 ASP C CG  
2068 O OD1 . ASP C 19  ? 1.2467 1.2755 1.0644 0.0821  0.0119  -0.0178 1233 ASP C OD1 
2069 O OD2 . ASP C 19  ? 1.1487 1.1812 0.9459 0.0861  -0.0256 -0.0503 1233 ASP C OD2 
2070 N N   . LEU C 20  ? 1.1096 1.1876 1.0409 0.0688  -0.0095 -0.0727 1234 LEU C N   
2071 C CA  . LEU C 20  ? 1.1119 1.2036 1.0620 0.0703  0.0028  -0.0795 1234 LEU C CA  
2072 C C   . LEU C 20  ? 1.1183 1.2197 1.1323 0.0641  0.0188  -0.0784 1234 LEU C C   
2073 O O   . LEU C 20  ? 1.1125 1.2126 1.1779 0.0584  0.0080  -0.0808 1234 LEU C O   
2074 C CB  . LEU C 20  ? 1.0896 1.1885 1.0440 0.0749  -0.0168 -0.0913 1234 LEU C CB  
2075 C CG  . LEU C 20  ? 1.0816 1.1766 1.0355 0.0798  -0.0394 -0.0914 1234 LEU C CG  
2076 C CD1 . LEU C 20  ? 1.0830 1.1847 1.0786 0.0817  -0.0538 -0.1021 1234 LEU C CD1 
2077 C CD2 . LEU C 20  ? 1.0851 1.1827 1.0304 0.0899  -0.0455 -0.0879 1234 LEU C CD2 
2078 N N   . GLY C 21  ? 1.1329 1.2446 1.1529 0.0680  0.0426  -0.0790 1235 GLY C N   
2079 C CA  . GLY C 21  ? 1.1358 1.2592 1.2311 0.0631  0.0612  -0.0786 1235 GLY C CA  
2080 C C   . GLY C 21  ? 1.1255 1.2634 1.2383 0.0663  0.0573  -0.0964 1235 GLY C C   
2081 O O   . GLY C 21  ? 1.1181 1.2568 1.1889 0.0727  0.0422  -0.1075 1235 GLY C O   
2082 N N   . PHE C 22  ? 1.1249 1.2744 1.3170 0.0617  0.0702  -0.0992 1236 PHE C N   
2083 C CA  . PHE C 22  ? 1.1209 1.2853 1.3398 0.0655  0.0754  -0.1139 1236 PHE C CA  
2084 C C   . PHE C 22  ? 1.1446 1.3200 1.4273 0.0664  0.1221  -0.1045 1236 PHE C C   
2085 O O   . PHE C 22  ? 1.1631 1.3341 1.4774 0.0643  0.1531  -0.0813 1236 PHE C O   
2086 C CB  . PHE C 22  ? 1.0898 1.2589 1.3461 0.0636  0.0317  -0.1316 1236 PHE C CB  
2087 C CG  . PHE C 22  ? 1.0823 1.2561 1.4323 0.0585  0.0150  -0.1400 1236 PHE C CG  
2088 C CD1 . PHE C 22  ? 1.0762 1.2627 1.4941 0.0603  0.0021  -0.1553 1236 PHE C CD1 
2089 C CD2 . PHE C 22  ? 1.0819 1.2472 1.4644 0.0542  0.0057  -0.1374 1236 PHE C CD2 
2090 C CE1 . PHE C 22  ? 1.0681 1.2586 1.5843 0.0593  -0.0231 -0.1704 1236 PHE C CE1 
2091 C CE2 . PHE C 22  ? 1.0771 1.2470 1.5658 0.0530  -0.0199 -0.1553 1236 PHE C CE2 
2092 C CZ  . PHE C 22  ? 1.0672 1.2495 1.6217 0.0565  -0.0364 -0.1730 1236 PHE C CZ  
2093 N N   . CYS C 23  ? 1.1455 1.3352 1.4540 0.0715  0.1314  -0.1194 1237 CYS C N   
2094 C CA  . CYS C 23  ? 1.1705 1.3737 1.5418 0.0767  0.1817  -0.1118 1237 CYS C CA  
2095 C C   . CYS C 23  ? 1.2266 1.4309 1.5119 0.1010  0.2305  -0.1003 1237 CYS C C   
2096 O O   . CYS C 23  ? 1.2363 1.4426 1.4490 0.1157  0.2163  -0.1230 1237 CYS C O   
2097 C CB  . CYS C 23  ? 1.1708 1.3737 1.6523 0.0649  0.2008  -0.0924 1237 CYS C CB  
2098 S SG  . CYS C 23  ? 1.1432 1.3620 1.7800 0.0538  0.1830  -0.1147 1237 CYS C SG  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   469  ?    ?   ?   A . n 
A 1 2   SER 2   470  ?    ?   ?   A . n 
A 1 3   HIS 3   471  ?    ?   ?   A . n 
A 1 4   MET 4   472  ?    ?   ?   A . n 
A 1 5   SER 5   473  ?    ?   ?   A . n 
A 1 6   SER 6   474  ?    ?   ?   A . n 
A 1 7   GLU 7   475  ?    ?   ?   A . n 
A 1 8   ASN 8   476  ?    ?   ?   A . n 
A 1 9   SER 9   477  ?    ?   ?   A . n 
A 1 10  ILE 10  478  ?    ?   ?   A . n 
A 1 11  ASN 11  479  ?    ?   ?   A . n 
A 1 12  LEU 12  480  ?    ?   ?   A . n 
A 1 13  SER 13  481  ?    ?   ?   A . n 
A 1 14  ILE 14  482  482  ILE ILE A . n 
A 1 15  ALA 15  483  483  ALA ALA A . n 
A 1 16  MET 16  484  484  MET MET A . n 
A 1 17  ASP 17  485  485  ASP ASP A . n 
A 1 18  LEU 18  486  486  LEU LEU A . n 
A 1 19  TYR 19  487  487  TYR TYR A . n 
A 1 20  SER 20  488  488  SER SER A . n 
A 1 21  PRO 21  489  489  PRO PRO A . n 
A 1 22  PRO 22  490  490  PRO PRO A . n 
A 1 23  PHE 23  491  491  PHE PHE A . n 
A 1 24  VAL 24  492  492  VAL VAL A . n 
A 1 25  TYR 25  493  493  TYR TYR A . n 
A 1 26  LEU 26  494  494  LEU LEU A . n 
A 1 27  SER 27  495  495  SER SER A . n 
A 1 28  VAL 28  496  496  VAL VAL A . n 
A 1 29  LEU 29  497  497  LEU LEU A . n 
A 1 30  MET 30  498  498  MET MET A . n 
A 1 31  ALA 31  499  499  ALA ALA A . n 
A 1 32  SER 32  500  500  SER SER A . n 
A 1 33  LYS 33  501  501  LYS LYS A . n 
A 1 34  PRO 34  502  502  PRO PRO A . n 
A 1 35  LYS 35  503  503  LYS LYS A . n 
A 1 36  GLU 36  504  504  GLU GLU A . n 
A 1 37  VAL 37  505  505  VAL VAL A . n 
A 1 38  THR 38  506  506  THR THR A . n 
A 1 39  THR 39  507  507  THR THR A . n 
A 1 40  VAL 40  508  508  VAL VAL A . n 
A 1 41  LYS 41  509  509  LYS LYS A . n 
A 1 42  VAL 42  510  510  VAL VAL A . n 
A 1 43  LYS 43  511  511  LYS LYS A . n 
A 1 44  ALA 44  512  512  ALA ALA A . n 
A 1 45  PHE 45  513  513  PHE PHE A . n 
A 1 46  ILE 46  514  514  ILE ILE A . n 
A 1 47  VAL 47  515  515  VAL VAL A . n 
A 1 48  THR 48  516  516  THR THR A . n 
A 1 49  LEU 49  517  517  LEU LEU A . n 
A 1 50  THR 50  518  518  THR THR A . n 
A 1 51  GLY 51  519  519  GLY GLY A . n 
A 1 52  ASN 52  520  520  ASN ASN A . n 
A 1 53  LEU 53  521  521  LEU LEU A . n 
A 1 54  SER 54  522  522  SER SER A . n 
A 1 55  SER 55  523  523  SER SER A . n 
A 1 56  SER 56  524  524  SER SER A . n 
A 1 57  GLY 57  525  525  GLY GLY A . n 
A 1 58  GLY 58  526  526  GLY GLY A . n 
A 1 59  ILE 59  527  527  ILE ILE A . n 
A 1 60  TRP 60  528  528  TRP TRP A . n 
A 1 61  SER 61  529  529  SER SER A . n 
A 1 62  ILE 62  530  530  ILE ILE A . n 
A 1 63  THR 63  531  531  THR THR A . n 
A 1 64  ALA 64  532  532  ALA ALA A . n 
A 1 65  LYS 65  533  533  LYS LYS A . n 
A 1 66  VAL 66  534  534  VAL VAL A . n 
A 1 67  SER 67  535  535  SER SER A . n 
A 1 68  ASP 68  536  536  ASP ASP A . n 
A 1 69  GLY 69  537  537  GLY GLY A . n 
A 1 70  THR 70  538  538  THR THR A . n 
A 1 71  ALA 71  539  539  ALA ALA A . n 
A 1 72  TYR 72  540  540  TYR TYR A . n 
A 1 73  LEU 73  541  541  LEU LEU A . n 
A 1 74  ASP 74  542  542  ASP ASP A . n 
A 1 75  VAL 75  543  543  VAL VAL A . n 
A 1 76  ASP 76  544  544  ASP ASP A . n 
A 1 77  PHE 77  545  545  PHE PHE A . n 
A 1 78  VAL 78  546  546  VAL VAL A . n 
A 1 79  ASP 79  547  547  ASP ASP A . n 
A 1 80  GLU 80  548  548  GLU GLU A . n 
A 1 81  ILE 81  549  549  ILE ILE A . n 
A 1 82  LEU 82  550  550  LEU LEU A . n 
A 1 83  THR 83  551  551  THR THR A . n 
A 1 84  SER 84  552  552  SER SER A . n 
A 1 85  LEU 85  553  553  LEU LEU A . n 
A 1 86  ILE 86  554  554  ILE ILE A . n 
A 1 87  GLY 87  555  555  GLY GLY A . n 
A 1 88  PHE 88  556  556  PHE PHE A . n 
A 1 89  SER 89  557  557  SER SER A . n 
A 1 90  VAL 90  558  558  VAL VAL A . n 
A 1 91  PRO 91  559  559  PRO PRO A . n 
A 1 92  GLU 92  560  560  GLU GLU A . n 
A 1 93  MET 93  561  561  MET MET A . n 
A 1 94  LYS 94  562  562  LYS LYS A . n 
A 1 95  GLN 95  563  563  GLN GLN A . n 
A 1 96  SER 96  564  564  SER SER A . n 
A 1 97  LYS 97  565  565  LYS LYS A . n 
A 1 98  LYS 98  566  566  LYS LYS A . n 
A 1 99  ASP 99  567  567  ASP ASP A . n 
A 1 100 PRO 100 568  568  PRO PRO A . n 
A 1 101 LEU 101 569  569  LEU LEU A . n 
A 1 102 GLN 102 570  570  GLN GLN A . n 
A 1 103 TYR 103 571  571  TYR TYR A . n 
A 1 104 GLN 104 572  572  GLN GLN A . n 
A 1 105 LYS 105 573  573  LYS LYS A . n 
A 1 106 PHE 106 574  574  PHE PHE A . n 
A 1 107 LEU 107 575  575  LEU LEU A . n 
A 1 108 GLU 108 576  576  GLU GLU A . n 
A 1 109 GLY 109 577  577  GLY GLY A . n 
A 1 110 LEU 110 578  578  LEU LEU A . n 
A 1 111 GLN 111 579  579  GLN GLN A . n 
A 1 112 LYS 112 580  580  LYS LYS A . n 
A 1 113 CYS 113 581  581  CYS CYS A . n 
A 1 114 GLN 114 582  582  GLN GLN A . n 
A 1 115 ARG 115 583  583  ARG ARG A . n 
A 1 116 ASP 116 584  584  ASP ASP A . n 
A 1 117 LEU 117 585  585  LEU LEU A . n 
A 1 118 ILE 118 586  586  ILE ILE A . n 
A 1 119 ASP 119 587  587  ASP ASP A . n 
A 1 120 LEU 120 588  588  LEU LEU A . n 
A 1 121 CYS 121 589  589  CYS CYS A . n 
A 1 122 CYS 122 590  590  CYS CYS A . n 
A 1 123 LEU 123 591  591  LEU LEU A . n 
A 1 124 MET 124 592  592  MET MET A . n 
A 1 125 THR 125 593  593  THR THR A . n 
A 1 126 ILE 126 594  594  ILE ILE A . n 
A 1 127 SER 127 595  595  SER SER A . n 
A 1 128 PHE 128 596  596  PHE PHE A . n 
A 1 129 ASN 129 597  597  ASN ASN A . n 
A 1 130 PRO 130 598  598  PRO PRO A . n 
A 1 131 SER 131 599  599  SER SER A . n 
A 1 132 LEU 132 600  600  LEU LEU A . n 
A 1 133 SER 133 601  601  SER SER A . n 
A 1 134 LYS 134 602  602  LYS LYS A . n 
A 1 135 ALA 135 603  603  ALA ALA A . n 
A 1 136 MET 136 604  604  MET MET A . n 
A 1 137 VAL 137 605  605  VAL VAL A . n 
A 1 138 LEU 138 606  606  LEU LEU A . n 
A 1 139 ALA 139 607  607  ALA ALA A . n 
A 1 140 LEU 140 608  608  LEU LEU A . n 
A 1 141 GLN 141 609  609  GLN GLN A . n 
A 1 142 ASP 142 610  610  ASP ASP A . n 
A 1 143 VAL 143 611  611  VAL VAL A . n 
A 1 144 ASN 144 612  612  ASN ASN A . n 
A 1 145 MET 145 613  613  MET MET A . n 
A 1 146 GLU 146 614  614  GLU GLU A . n 
A 1 147 HIS 147 615  615  HIS HIS A . n 
A 1 148 LEU 148 616  616  LEU LEU A . n 
A 1 149 GLU 149 617  617  GLU GLU A . n 
A 1 150 ASN 150 618  618  ASN ASN A . n 
A 1 151 LEU 151 619  619  LEU LEU A . n 
A 1 152 LYS 152 620  620  LYS LYS A . n 
A 1 153 LYS 153 621  621  LYS LYS A . n 
A 1 154 ARG 154 622  622  ARG ARG A . n 
A 1 155 LEU 155 623  623  LEU LEU A . n 
A 1 156 ASN 156 624  624  ASN ASN A . n 
A 1 157 LYS 157 625  625  LYS LYS A . n 
B 2 1   GLY 1   -2   ?    ?   ?   B . n 
B 2 2   SER 2   -1   ?    ?   ?   B . n 
B 2 3   HIS 3   0    ?    ?   ?   B . n 
B 2 4   MET 4   1    ?    ?   ?   B . n 
B 2 5   ALA 5   2    ?    ?   ?   B . n 
B 2 6   ALA 6   3    ?    ?   ?   B . n 
B 2 7   ALA 7   4    ?    ?   ?   B . n 
B 2 8   ALA 8   5    ?    ?   ?   B . n 
B 2 9   ASP 9   6    ?    ?   ?   B . n 
B 2 10  SER 10  7    ?    ?   ?   B . n 
B 2 11  PHE 11  8    ?    ?   ?   B . n 
B 2 12  SER 12  9    ?    ?   ?   B . n 
B 2 13  GLY 13  10   ?    ?   ?   B . n 
B 2 14  GLY 14  11   ?    ?   ?   B . n 
B 2 15  PRO 15  12   ?    ?   ?   B . n 
B 2 16  ALA 16  13   13   ALA ALA B . n 
B 2 17  GLY 17  14   14   GLY GLY B . n 
B 2 18  VAL 18  15   15   VAL VAL B . n 
B 2 19  ARG 19  16   16   ARG ARG B . n 
B 2 20  LEU 20  17   17   LEU LEU B . n 
B 2 21  PRO 21  18   18   PRO PRO B . n 
B 2 22  ARG 22  19   19   ARG ARG B . n 
B 2 23  SER 23  20   20   SER SER B . n 
B 2 24  PRO 24  21   21   PRO PRO B . n 
B 2 25  PRO 25  22   22   PRO PRO B . n 
B 2 26  LEU 26  23   23   LEU LEU B . n 
B 2 27  LYS 27  24   24   LYS LYS B . n 
B 2 28  VAL 28  25   25   VAL VAL B . n 
B 2 29  LEU 29  26   26   LEU LEU B . n 
B 2 30  ALA 30  27   27   ALA ALA B . n 
B 2 31  GLU 31  28   28   GLU GLU B . n 
B 2 32  GLN 32  29   29   GLN GLN B . n 
B 2 33  LEU 33  30   30   LEU LEU B . n 
B 2 34  ARG 34  31   31   ARG ARG B . n 
B 2 35  ARG 35  32   32   ARG ARG B . n 
B 2 36  ASP 36  33   33   ASP ASP B . n 
B 2 37  ALA 37  34   ?    ?   ?   B . n 
B 2 38  GLU 38  35   ?    ?   ?   B . n 
B 2 39  GLY 39  36   ?    ?   ?   B . n 
B 2 40  GLY 40  37   ?    ?   ?   B . n 
B 2 41  PRO 41  38   ?    ?   ?   B . n 
B 2 42  GLY 42  39   ?    ?   ?   B . n 
B 2 43  ALA 43  40   ?    ?   ?   B . n 
B 2 44  TRP 44  41   ?    ?   ?   B . n 
B 2 45  ARG 45  42   ?    ?   ?   B . n 
B 2 46  LEU 46  43   ?    ?   ?   B . n 
B 2 47  SER 47  44   ?    ?   ?   B . n 
B 2 48  ARG 48  45   ?    ?   ?   B . n 
B 2 49  ALA 49  46   ?    ?   ?   B . n 
B 2 50  ALA 50  47   ?    ?   ?   B . n 
B 2 51  ALA 51  48   ?    ?   ?   B . n 
B 2 52  GLY 52  49   ?    ?   ?   B . n 
B 2 53  ARG 53  50   ?    ?   ?   B . n 
B 2 54  GLY 54  51   ?    ?   ?   B . n 
B 2 55  PRO 55  52   ?    ?   ?   B . n 
B 2 56  LEU 56  53   ?    ?   ?   B . n 
B 2 57  ASP 57  54   ?    ?   ?   B . n 
B 2 58  LEU 58  55   ?    ?   ?   B . n 
B 2 59  ALA 59  56   56   ALA ALA B . n 
B 2 60  ALA 60  57   57   ALA ALA B . n 
B 2 61  VAL 61  58   58   VAL VAL B . n 
B 2 62  TRP 62  59   59   TRP TRP B . n 
B 2 63  MET 63  60   60   MET MET B . n 
B 2 64  GLN 64  61   61   GLN GLN B . n 
B 2 65  GLY 65  62   62   GLY GLY B . n 
B 2 66  ARG 66  63   63   ARG ARG B . n 
B 2 67  VAL 67  64   64   VAL VAL B . n 
B 2 68  VAL 68  65   65   VAL VAL B . n 
B 2 69  MET 69  66   66   MET MET B . n 
B 2 70  ALA 70  67   67   ALA ALA B . n 
B 2 71  ASP 71  68   68   ASP ASP B . n 
B 2 72  ARG 72  69   69   ARG ARG B . n 
B 2 73  GLY 73  70   70   GLY GLY B . n 
B 2 74  GLU 74  71   71   GLU GLU B . n 
B 2 75  ALA 75  72   72   ALA ALA B . n 
B 2 76  ARG 76  73   73   ARG ARG B . n 
B 2 77  LEU 77  74   74   LEU LEU B . n 
B 2 78  ARG 78  75   75   ARG ARG B . n 
B 2 79  ASP 79  76   76   ASP ASP B . n 
B 2 80  PRO 80  77   77   PRO PRO B . n 
B 2 81  SER 81  78   78   SER SER B . n 
B 2 82  GLY 82  79   79   GLY GLY B . n 
B 2 83  ASP 83  80   80   ASP ASP B . n 
B 2 84  PHE 84  81   81   PHE PHE B . n 
B 2 85  SER 85  82   82   SER SER B . n 
B 2 86  VAL 86  83   83   VAL VAL B . n 
B 2 87  ARG 87  84   84   ARG ARG B . n 
B 2 88  GLY 88  85   85   GLY GLY B . n 
B 2 89  LEU 89  86   86   LEU LEU B . n 
B 2 90  GLU 90  87   87   GLU GLU B . n 
B 2 91  ARG 91  88   88   ARG ARG B . n 
B 2 92  VAL 92  89   89   VAL VAL B . n 
B 2 93  PRO 93  90   90   PRO PRO B . n 
B 2 94  ARG 94  91   91   ARG ARG B . n 
B 2 95  GLY 95  92   92   GLY GLY B . n 
B 2 96  ARG 96  93   93   ARG ARG B . n 
B 2 97  PRO 97  94   94   PRO PRO B . n 
B 2 98  CYS 98  95   95   CYS CYS B . n 
B 2 99  LEU 99  96   96   LEU LEU B . n 
B 2 100 VAL 100 97   97   VAL VAL B . n 
B 2 101 PRO 101 98   98   PRO PRO B . n 
B 2 102 GLY 102 99   99   GLY GLY B . n 
B 2 103 LYS 103 100  100  LYS LYS B . n 
B 2 104 TYR 104 101  101  TYR TYR B . n 
B 2 105 VAL 105 102  102  VAL VAL B . n 
B 2 106 MET 106 103  103  MET MET B . n 
B 2 107 VAL 107 104  104  VAL VAL B . n 
B 2 108 MET 108 105  105  MET MET B . n 
B 2 109 GLY 109 106  106  GLY GLY B . n 
B 2 110 VAL 110 107  107  VAL VAL B . n 
B 2 111 VAL 111 108  108  VAL VAL B . n 
B 2 112 GLN 112 109  109  GLN GLN B . n 
B 2 113 ALA 113 110  110  ALA ALA B . n 
B 2 114 CYS 114 111  111  CYS CYS B . n 
B 2 115 SER 115 112  112  SER SER B . n 
B 2 116 PRO 116 113  113  PRO PRO B . n 
B 2 117 GLU 117 114  114  GLU GLU B . n 
B 2 118 PRO 118 115  115  PRO PRO B . n 
B 2 119 CYS 119 116  116  CYS CYS B . n 
B 2 120 LEU 120 117  117  LEU LEU B . n 
B 2 121 GLN 121 118  118  GLN GLN B . n 
B 2 122 ALA 122 119  119  ALA ALA B . n 
B 2 123 VAL 123 120  120  VAL VAL B . n 
B 2 124 LYS 124 121  121  LYS LYS B . n 
B 2 125 MET 125 122  122  MET MET B . n 
B 2 126 THR 126 123  123  THR THR B . n 
B 2 127 ASP 127 124  124  ASP ASP B . n 
B 2 128 LEU 128 125  125  LEU LEU B . n 
B 2 129 SER 129 126  126  SER SER B . n 
B 2 130 ASP 130 127  127  ASP ASP B . n 
B 2 131 ASN 131 128  128  ASN ASN B . n 
B 2 132 PRO 132 129  129  PRO PRO B . n 
B 2 133 ILE 133 130  130  ILE ILE B . n 
B 2 134 HIS 134 131  131  HIS HIS B . n 
B 2 135 GLU 135 132  132  GLU GLU B . n 
B 2 136 SER 136 133  133  SER SER B . n 
B 2 137 MET 137 134  134  MET MET B . n 
B 2 138 TRP 138 135  135  TRP TRP B . n 
B 2 139 GLU 139 136  136  GLU GLU B . n 
B 2 140 LEU 140 137  137  LEU LEU B . n 
B 2 141 GLU 141 138  138  GLU GLU B . n 
B 2 142 VAL 142 139  139  VAL VAL B . n 
B 2 143 GLU 143 140  140  GLU GLU B . n 
B 2 144 ASP 144 141  141  ASP ASP B . n 
B 2 145 LEU 145 142  142  LEU LEU B . n 
B 2 146 HIS 146 143  143  HIS HIS B . n 
B 2 147 ARG 147 144  144  ARG ARG B . n 
B 2 148 ASN 148 145  145  ASN ASN B . n 
B 2 149 ILE 149 146  146  ILE ILE B . n 
B 2 150 PRO 150 147  147  PRO PRO B . n 
C 3 1   GLY 1   1215 ?    ?   ?   C . n 
C 3 2   HIS 2   1216 ?    ?   ?   C . n 
C 3 3   MET 3   1217 ?    ?   ?   C . n 
C 3 4   GLU 4   1218 ?    ?   ?   C . n 
C 3 5   ASP 5   1219 ?    ?   ?   C . n 
C 3 6   ILE 6   1220 ?    ?   ?   C . n 
C 3 7   PHE 7   1221 ?    ?   ?   C . n 
C 3 8   ASP 8   1222 ?    ?   ?   C . n 
C 3 9   CYS 9   1223 ?    ?   ?   C . n 
C 3 10  SER 10  1224 ?    ?   ?   C . n 
C 3 11  ARG 11  1225 ?    ?   ?   C . n 
C 3 12  ASP 12  1226 1226 ASP ASP C . n 
C 3 13  LEU 13  1227 1227 LEU LEU C . n 
C 3 14  PHE 14  1228 1228 PHE PHE C . n 
C 3 15  SER 15  1229 1229 SER SER C . n 
C 3 16  VAL 16  1230 1230 VAL VAL C . n 
C 3 17  THR 17  1231 1231 THR THR C . n 
C 3 18  PHE 18  1232 1232 PHE PHE C . n 
C 3 19  ASP 19  1233 1233 ASP ASP C . n 
C 3 20  LEU 20  1234 1234 LEU LEU C . n 
C 3 21  GLY 21  1235 1235 GLY GLY C . n 
C 3 22  PHE 22  1236 1236 PHE PHE C . n 
C 3 23  CYS 23  1237 1237 CYS CYS C . n 
C 3 24  SER 24  1238 ?    ?   ?   C . n 
C 3 25  PRO 25  1239 ?    ?   ?   C . n 
C 3 26  ASP 26  1240 ?    ?   ?   C . n 
C 3 27  SER 27  1241 ?    ?   ?   C . n 
C 3 28  ASP 28  1242 ?    ?   ?   C . n 
C 3 29  ASP 29  1243 ?    ?   ?   C . n 
C 3 30  GLU 30  1244 ?    ?   ?   C . n 
C 3 31  ILE 31  1245 ?    ?   ?   C . n 
C 3 32  LEU 32  1246 ?    ?   ?   C . n 
C 3 33  GLU 33  1247 ?    ?   ?   C . n 
C 3 34  HIS 34  1248 ?    ?   ?   C . n 
C 3 35  THR 35  1249 ?    ?   ?   C . n 
C 3 36  SER 36  1250 ?    ?   ?   C . n 
C 3 37  ASP 37  1251 ?    ?   ?   C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4720  ? 
1 MORE         -38   ? 
1 'SSA (A^2)'  13490 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-03-14 
2 'Structure model' 1 1 2012-05-16 
3 'Structure model' 1 2 2017-11-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 11.2933 -6.8114 3.7276  0.1566 0.0433 0.0687 -0.0154 0.0543  -0.0445 2.2813 3.2087  4.8267 -0.8922 
1.1733  -1.1525 -0.0631 0.0212  0.0419 0.2410  -0.3325 0.1827 0.0273 0.2217  -0.1336 
'X-RAY DIFFRACTION' 2 ? refined 1.2399  10.6626 9.6541  0.2777 0.1768 0.0618 0.1329  -0.0201 -0.0681 5.8793 5.4824  4.4032 -0.1754 
-1.2185 -1.7826 -0.0962 -0.0105 0.1067 -0.1563 0.3914  0.2627 0.1208 -0.2407 -0.6775 
'X-RAY DIFFRACTION' 3 ? refined 7.0805  -7.7052 20.0544 0.8099 0.8229 0.6122 0.0802  -0.0278 -0.0298 9.9876 10.0734 0.1701 -6.1070 
0.3984  0.4671  -0.2180 0.2111  0.0069 -0.6834 -0.5322 0.5222 0.7920 0.2195  -0.2112 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 482  A 625  ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 B 13   B 147  ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 C 1226 C 1237 ? . . . . ? 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .    ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 SCALEPACK   .    ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
3 REFMAC      .    ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.10 'June 10, 2010' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 HKL-2000    .    ?               ?       ?                    ?                        'data collection' ? ?          ? 
6 HKL-2000    .    ?               ?       ?                    ?                        'data reduction'  ? ?          ? 
7 HKL-2000    .    ?               ?       ?                    ?                        'data scaling'    ? ?          ? 
8 PHASER      .    ?               ?       ?                    ?                        phasing           ? ?          ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 485  ? ? -72.48  40.77   
2  1 LYS A 501  ? ? 57.00   75.63   
3  1 GLU A 504  ? ? -128.82 -168.60 
4  1 ASP A 547  ? ? -39.14  -39.86  
5  1 SER A 564  ? ? -62.90  5.52    
6  1 CYS A 590  ? ? 177.89  -178.56 
7  1 SER A 599  ? ? -70.93  -71.11  
8  1 SER A 601  ? ? 72.95   -28.41  
9  1 LEU A 623  ? ? -91.21  32.56   
10 1 ARG B 69   ? ? 41.96   -134.54 
11 1 GLU B 87   ? ? -30.98  -37.24  
12 1 ALA B 110  ? ? -153.83 75.53   
13 1 CYS B 111  ? ? -28.43  -40.42  
14 1 GLU B 138  ? ? -33.33  -37.11  
15 1 PHE C 1228 ? ? -112.94 -112.68 
16 1 VAL C 1230 ? ? -52.54  100.55  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 469  ? A GLY 1  
2  1 Y 1 A SER 470  ? A SER 2  
3  1 Y 1 A HIS 471  ? A HIS 3  
4  1 Y 1 A MET 472  ? A MET 4  
5  1 Y 1 A SER 473  ? A SER 5  
6  1 Y 1 A SER 474  ? A SER 6  
7  1 Y 1 A GLU 475  ? A GLU 7  
8  1 Y 1 A ASN 476  ? A ASN 8  
9  1 Y 1 A SER 477  ? A SER 9  
10 1 Y 1 A ILE 478  ? A ILE 10 
11 1 Y 1 A ASN 479  ? A ASN 11 
12 1 Y 1 A LEU 480  ? A LEU 12 
13 1 Y 1 A SER 481  ? A SER 13 
14 1 Y 1 B GLY -2   ? B GLY 1  
15 1 Y 1 B SER -1   ? B SER 2  
16 1 Y 1 B HIS 0    ? B HIS 3  
17 1 Y 1 B MET 1    ? B MET 4  
18 1 Y 1 B ALA 2    ? B ALA 5  
19 1 Y 1 B ALA 3    ? B ALA 6  
20 1 Y 1 B ALA 4    ? B ALA 7  
21 1 Y 1 B ALA 5    ? B ALA 8  
22 1 Y 1 B ASP 6    ? B ASP 9  
23 1 Y 1 B SER 7    ? B SER 10 
24 1 Y 1 B PHE 8    ? B PHE 11 
25 1 Y 1 B SER 9    ? B SER 12 
26 1 Y 1 B GLY 10   ? B GLY 13 
27 1 Y 1 B GLY 11   ? B GLY 14 
28 1 Y 1 B PRO 12   ? B PRO 15 
29 1 Y 1 B ALA 34   ? B ALA 37 
30 1 Y 1 B GLU 35   ? B GLU 38 
31 1 Y 1 B GLY 36   ? B GLY 39 
32 1 Y 1 B GLY 37   ? B GLY 40 
33 1 Y 1 B PRO 38   ? B PRO 41 
34 1 Y 1 B GLY 39   ? B GLY 42 
35 1 Y 1 B ALA 40   ? B ALA 43 
36 1 Y 1 B TRP 41   ? B TRP 44 
37 1 Y 1 B ARG 42   ? B ARG 45 
38 1 Y 1 B LEU 43   ? B LEU 46 
39 1 Y 1 B SER 44   ? B SER 47 
40 1 Y 1 B ARG 45   ? B ARG 48 
41 1 Y 1 B ALA 46   ? B ALA 49 
42 1 Y 1 B ALA 47   ? B ALA 50 
43 1 Y 1 B ALA 48   ? B ALA 51 
44 1 Y 1 B GLY 49   ? B GLY 52 
45 1 Y 1 B ARG 50   ? B ARG 53 
46 1 Y 1 B GLY 51   ? B GLY 54 
47 1 Y 1 B PRO 52   ? B PRO 55 
48 1 Y 1 B LEU 53   ? B LEU 56 
49 1 Y 1 B ASP 54   ? B ASP 57 
50 1 Y 1 B LEU 55   ? B LEU 58 
51 1 Y 1 C GLY 1215 ? C GLY 1  
52 1 Y 1 C HIS 1216 ? C HIS 2  
53 1 Y 1 C MET 1217 ? C MET 3  
54 1 Y 1 C GLU 1218 ? C GLU 4  
55 1 Y 1 C ASP 1219 ? C ASP 5  
56 1 Y 1 C ILE 1220 ? C ILE 6  
57 1 Y 1 C PHE 1221 ? C PHE 7  
58 1 Y 1 C ASP 1222 ? C ASP 8  
59 1 Y 1 C CYS 1223 ? C CYS 9  
60 1 Y 1 C SER 1224 ? C SER 10 
61 1 Y 1 C ARG 1225 ? C ARG 11 
62 1 Y 1 C SER 1238 ? C SER 24 
63 1 Y 1 C PRO 1239 ? C PRO 25 
64 1 Y 1 C ASP 1240 ? C ASP 26 
65 1 Y 1 C SER 1241 ? C SER 27 
66 1 Y 1 C ASP 1242 ? C ASP 28 
67 1 Y 1 C ASP 1243 ? C ASP 29 
68 1 Y 1 C GLU 1244 ? C GLU 30 
69 1 Y 1 C ILE 1245 ? C ILE 31 
70 1 Y 1 C LEU 1246 ? C LEU 32 
71 1 Y 1 C GLU 1247 ? C GLU 33 
72 1 Y 1 C HIS 1248 ? C HIS 34 
73 1 Y 1 C THR 1249 ? C THR 35 
74 1 Y 1 C SER 1250 ? C SER 36 
75 1 Y 1 C ASP 1251 ? C ASP 37 
#