data_4DJ9
# 
_entry.id   4DJ9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4DJ9         
RCSB  RCSB070398   
WWPDB D_1000070398 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1rkc . unspecified 
PDB 1syq . unspecified 
PDB 3s90 . unspecified 
PDB 3tj5 . unspecified 
PDB 3tj6 . unspecified 
PDB 1rke . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4DJ9 
_pdbx_database_status.recvd_initial_deposition_date   2012-02-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yogesha, S.D.'    1 
'Rangarajan, E.S.' 2 
'Vonrhein, C.'     3 
'Bricogne, G.'     4 
'Izard, T.'        5 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of vinculin in complex with vinculin binding site 50 (VBS50), the integrin binding site 2 (IBS2) of talin.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            21 
_citation.page_first                583 
_citation.page_last                 588 
_citation.year                      2012 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22334306 
_citation.pdbx_database_id_DOI      10.1002/pro.2041 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yogesha, S.D.'    1 
primary 'Rangarajan, E.S.' 2 
primary 'Vonrhein, C.'     3 
primary 'Bricogne, G.'     4 
primary 'Izard, T.'        5 
# 
_cell.entry_id           4DJ9 
_cell.length_a           33.540 
_cell.length_b           68.160 
_cell.length_c           137.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4DJ9 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Vinculin 28937.398 1  ? ? 'unp residues 1-258'     ? 
2 polymer man Talin-1  2870.322  1  ? ? 'unp residues 2075-2103' ? 
3 water   nat water    18.015    62 ? ? ?                        ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Metavinculin 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIK
VENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTY
TKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAE
INEIIRVLQLTSWDEDAW
;
;MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIK
VENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTY
TKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAE
INEIIRVLQLTSWDEDAW
;
A ? 
2 'polypeptide(L)' no no ETQVVLINAVKDVAKALGDLISATKAAAG ETQVVLINAVKDVAKALGDLISATKAAAG B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   VAL n 
1 4   PHE n 
1 5   HIS n 
1 6   THR n 
1 7   ARG n 
1 8   THR n 
1 9   ILE n 
1 10  GLU n 
1 11  SER n 
1 12  ILE n 
1 13  LEU n 
1 14  GLU n 
1 15  PRO n 
1 16  VAL n 
1 17  ALA n 
1 18  GLN n 
1 19  GLN n 
1 20  ILE n 
1 21  SER n 
1 22  HIS n 
1 23  LEU n 
1 24  VAL n 
1 25  ILE n 
1 26  MET n 
1 27  HIS n 
1 28  GLU n 
1 29  GLU n 
1 30  GLY n 
1 31  GLU n 
1 32  VAL n 
1 33  ASP n 
1 34  GLY n 
1 35  LYS n 
1 36  ALA n 
1 37  ILE n 
1 38  PRO n 
1 39  ASP n 
1 40  LEU n 
1 41  THR n 
1 42  ALA n 
1 43  PRO n 
1 44  VAL n 
1 45  ALA n 
1 46  ALA n 
1 47  VAL n 
1 48  GLN n 
1 49  ALA n 
1 50  ALA n 
1 51  VAL n 
1 52  SER n 
1 53  ASN n 
1 54  LEU n 
1 55  VAL n 
1 56  ARG n 
1 57  VAL n 
1 58  GLY n 
1 59  LYS n 
1 60  GLU n 
1 61  THR n 
1 62  VAL n 
1 63  GLN n 
1 64  THR n 
1 65  THR n 
1 66  GLU n 
1 67  ASP n 
1 68  GLN n 
1 69  ILE n 
1 70  LEU n 
1 71  LYS n 
1 72  ARG n 
1 73  ASP n 
1 74  MET n 
1 75  PRO n 
1 76  PRO n 
1 77  ALA n 
1 78  PHE n 
1 79  ILE n 
1 80  LYS n 
1 81  VAL n 
1 82  GLU n 
1 83  ASN n 
1 84  ALA n 
1 85  CYS n 
1 86  THR n 
1 87  LYS n 
1 88  LEU n 
1 89  VAL n 
1 90  GLN n 
1 91  ALA n 
1 92  ALA n 
1 93  GLN n 
1 94  MET n 
1 95  LEU n 
1 96  GLN n 
1 97  SER n 
1 98  ASP n 
1 99  PRO n 
1 100 TYR n 
1 101 SER n 
1 102 VAL n 
1 103 PRO n 
1 104 ALA n 
1 105 ARG n 
1 106 ASP n 
1 107 TYR n 
1 108 LEU n 
1 109 ILE n 
1 110 ASP n 
1 111 GLY n 
1 112 SER n 
1 113 ARG n 
1 114 GLY n 
1 115 ILE n 
1 116 LEU n 
1 117 SER n 
1 118 GLY n 
1 119 THR n 
1 120 SER n 
1 121 ASP n 
1 122 LEU n 
1 123 LEU n 
1 124 LEU n 
1 125 THR n 
1 126 PHE n 
1 127 ASP n 
1 128 GLU n 
1 129 ALA n 
1 130 GLU n 
1 131 VAL n 
1 132 ARG n 
1 133 LYS n 
1 134 ILE n 
1 135 ILE n 
1 136 ARG n 
1 137 VAL n 
1 138 CYS n 
1 139 LYS n 
1 140 GLY n 
1 141 ILE n 
1 142 LEU n 
1 143 GLU n 
1 144 TYR n 
1 145 LEU n 
1 146 THR n 
1 147 VAL n 
1 148 ALA n 
1 149 GLU n 
1 150 VAL n 
1 151 VAL n 
1 152 GLU n 
1 153 THR n 
1 154 MET n 
1 155 GLU n 
1 156 ASP n 
1 157 LEU n 
1 158 VAL n 
1 159 THR n 
1 160 TYR n 
1 161 THR n 
1 162 LYS n 
1 163 ASN n 
1 164 LEU n 
1 165 GLY n 
1 166 PRO n 
1 167 GLY n 
1 168 MET n 
1 169 THR n 
1 170 LYS n 
1 171 MET n 
1 172 ALA n 
1 173 LYS n 
1 174 MET n 
1 175 ILE n 
1 176 ASP n 
1 177 GLU n 
1 178 ARG n 
1 179 GLN n 
1 180 GLN n 
1 181 GLU n 
1 182 LEU n 
1 183 THR n 
1 184 HIS n 
1 185 GLN n 
1 186 GLU n 
1 187 HIS n 
1 188 ARG n 
1 189 VAL n 
1 190 MET n 
1 191 LEU n 
1 192 VAL n 
1 193 ASN n 
1 194 SER n 
1 195 MET n 
1 196 ASN n 
1 197 THR n 
1 198 VAL n 
1 199 LYS n 
1 200 GLU n 
1 201 LEU n 
1 202 LEU n 
1 203 PRO n 
1 204 VAL n 
1 205 LEU n 
1 206 ILE n 
1 207 SER n 
1 208 ALA n 
1 209 MET n 
1 210 LYS n 
1 211 ILE n 
1 212 PHE n 
1 213 VAL n 
1 214 THR n 
1 215 THR n 
1 216 LYS n 
1 217 ASN n 
1 218 SER n 
1 219 LYS n 
1 220 ASN n 
1 221 GLN n 
1 222 GLY n 
1 223 ILE n 
1 224 GLU n 
1 225 GLU n 
1 226 ALA n 
1 227 LEU n 
1 228 LYS n 
1 229 ASN n 
1 230 ARG n 
1 231 ASN n 
1 232 PHE n 
1 233 THR n 
1 234 VAL n 
1 235 GLU n 
1 236 LYS n 
1 237 MET n 
1 238 SER n 
1 239 ALA n 
1 240 GLU n 
1 241 ILE n 
1 242 ASN n 
1 243 GLU n 
1 244 ILE n 
1 245 ILE n 
1 246 ARG n 
1 247 VAL n 
1 248 LEU n 
1 249 GLN n 
1 250 LEU n 
1 251 THR n 
1 252 SER n 
1 253 TRP n 
1 254 ASP n 
1 255 GLU n 
1 256 ASP n 
1 257 ALA n 
1 258 TRP n 
2 1   GLU n 
2 2   THR n 
2 3   GLN n 
2 4   VAL n 
2 5   VAL n 
2 6   LEU n 
2 7   ILE n 
2 8   ASN n 
2 9   ALA n 
2 10  VAL n 
2 11  LYS n 
2 12  ASP n 
2 13  VAL n 
2 14  ALA n 
2 15  LYS n 
2 16  ALA n 
2 17  LEU n 
2 18  GLY n 
2 19  ASP n 
2 20  LEU n 
2 21  ILE n 
2 22  SER n 
2 23  ALA n 
2 24  THR n 
2 25  LYS n 
2 26  ALA n 
2 27  ALA n 
2 28  ALA n 
2 29  GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? VCL                   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? 
2 1 sample ? ? ? human ? 'TLN1, KIAA1027, TLN' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP VINC_HUMAN P18206 1 
;MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIK
VENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTY
TKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAE
INEIIRVLQLTSWDEDAW
;
1    ? 
2 UNP TLN1_HUMAN Q9Y490 2 ETQVVLINAVKDVAKALGDLISATKAAAG 2075 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4DJ9 A 1 ? 258 ? P18206 1    ? 258  ? 1    258  
2 2 4DJ9 B 1 ? 29  ? Q9Y490 2075 ? 2103 ? 2075 2103 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4DJ9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.47 
_exptl_crystal.density_percent_sol   50.25 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
;The human vinculin Vh1 domain (residues 1 - 258) was generated as described.9 Crystallization screens of Vh1 protein and VBS50 mixed in 1:5 molar ratio were performed at two temperatures. Co-crystals were obtained from Hampton crystal screen I with a reservoir of 0.1 M Hepes pH 7.5, 10% w/v polyethylene glycol 6,000, and 5% 2-Methyl-2,4-pentanediol. Crystals were transferred directly from the initial 96-well screening plate into Paratone-N oil and flash-frozen in liquid nitrogen. , VAPOR DIFFUSION
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX-300' 
_diffrn_detector.pdbx_collection_date   2009-08-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.000000 1.0 
2 1.0      1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             1.000000 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     4DJ9 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             68.80 
_reflns.d_resolution_high            2.25 
_reflns.number_obs                   15637 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.065 
_reflns.pdbx_Rsym_value              0.065 
_reflns.pdbx_netI_over_sigmaI        16.4 
_reflns.B_iso_Wilson_estimate        55.65 
_reflns.pdbx_redundancy              7.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.251 
_reflns_shell.d_res_low              2.258 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.592 
_reflns_shell.pdbx_Rsym_value        0.592 
_reflns_shell.meanI_over_sigI_obs    3.3 
_reflns_shell.pdbx_redundancy        7.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4DJ9 
_refine.ls_number_reflns_obs                     15586 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             68.80 
_refine.ls_d_res_high                            2.25 
_refine.ls_percent_reflns_obs                    99.32 
_refine.ls_R_factor_obs                          0.2095 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2076 
_refine.ls_R_factor_R_free                       0.2472 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.05 
_refine.ls_number_reflns_R_free                  787 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9429 
_refine.correlation_coeff_Fo_to_Fc_free          0.9345 
_refine.B_iso_mean                               70.73 
_refine.aniso_B[1][1]                            -15.5041 
_refine.aniso_B[2][2]                            -3.5916 
_refine.aniso_B[3][3]                            19.0957 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.253 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        4DJ9 
_refine_analyze.Luzzati_coordinate_error_obs    0.349 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2017 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             62 
_refine_hist.number_atoms_total               2079 
_refine_hist.d_res_high                       2.25 
_refine_hist.d_res_low                        68.80 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_bond_d                  0.010 ? 2.00  2066 HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               1.12  ? 2.00  2803 HARMONIC     'X-RAY DIFFRACTION' 
t_dihedral_angle_d        ?     ? 2.00  733  SINUSOIDAL   'X-RAY DIFFRACTION' 
t_incorr_chiral_ct        ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_pseud_angle             ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_trig_c_planes           ?     ? 2.00  51   HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              ?     ? 5.00  291  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      ?     ? 20.00 2066 HARMONIC     'X-RAY DIFFRACTION' 
t_nbd                     ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_omega_torsion           2.15  ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_other_torsion           17.64 ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_improper_torsion        ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion ?     ? 5.00  298  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_sum_occupancies         ?     ? 1.00  2    HARMONIC     'X-RAY DIFFRACTION' 
t_utility_distance        ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_utility_angle           ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_utility_torsion         ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_ideal_dist_contact      ?     ? 4.00  2482 SEMIHARMONIC 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.25 
_refine_ls_shell.d_res_low                        2.40 
_refine_ls_shell.number_reflns_R_work             2619 
_refine_ls_shell.R_factor_R_work                  0.2344 
_refine_ls_shell.percent_reflns_obs               99.32 
_refine_ls_shell.R_factor_R_free                  0.3231 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.31 
_refine_ls_shell.number_reflns_R_free             147 
_refine_ls_shell.number_reflns_all                2766 
_refine_ls_shell.R_factor_all                     0.2389 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4DJ9 
_struct.title                     
'Human vinculin head domain Vh1 (residues 1-258) in complex with the talin vinculin binding site 50 (VBS50, residues 2078-2099)' 
_struct.pdbx_descriptor           'Vinculin, Talin-1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4DJ9 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            
'cytoskeleton, focal adhesion, protein-protein interaction, four-helix bundle, cell adhesion, F-actin, cytosol' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 6   ? GLY A 30  ? THR A 6    GLY A 30   1 ? 25 
HELX_P HELX_P2 2 LEU A 40  ? THR A 65  ? LEU A 40   THR A 65   1 ? 26 
HELX_P HELX_P3 3 ASP A 67  ? ASP A 98  ? ASP A 67   ASP A 98   1 ? 32 
HELX_P HELX_P4 4 SER A 101 ? ALA A 148 ? SER A 101  ALA A 148  1 ? 48 
HELX_P HELX_P5 5 GLU A 149 ? VAL A 151 ? GLU A 149  VAL A 151  5 ? 3  
HELX_P HELX_P6 6 THR A 153 ? LEU A 182 ? THR A 153  LEU A 182  1 ? 30 
HELX_P HELX_P7 7 HIS A 184 ? THR A 215 ? HIS A 184  THR A 215  1 ? 32 
HELX_P HELX_P8 8 GLY A 222 ? GLN A 249 ? GLY A 222  GLN A 249  1 ? 28 
HELX_P HELX_P9 9 VAL B 5   ? LYS B 25  ? VAL B 2079 LYS B 2099 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           252 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            252 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   TRP 
_struct_mon_prot_cis.pdbx_label_seq_id_2    253 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    TRP 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     253 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       3.80 
# 
_database_PDB_matrix.entry_id          4DJ9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4DJ9 
_atom_sites.fract_transf_matrix[1][1]   0.029815 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014671 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007267 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 3   ? 18.798 10.416 -43.655 1.00 87.52  ? 3    VAL A N   1 
ATOM   2    C CA  . VAL A 1 3   ? 20.111 10.831 -44.147 1.00 86.60  ? 3    VAL A CA  1 
ATOM   3    C C   . VAL A 1 3   ? 20.737 11.934 -43.318 1.00 85.77  ? 3    VAL A C   1 
ATOM   4    O O   . VAL A 1 3   ? 21.957 11.971 -43.122 1.00 85.52  ? 3    VAL A O   1 
ATOM   5    N N   . PHE A 1 4   ? 19.888 12.837 -42.829 1.00 78.35  ? 4    PHE A N   1 
ATOM   6    C CA  . PHE A 1 4   ? 20.235 13.974 -41.986 1.00 75.20  ? 4    PHE A CA  1 
ATOM   7    C C   . PHE A 1 4   ? 19.411 13.785 -40.707 1.00 71.99  ? 4    PHE A C   1 
ATOM   8    O O   . PHE A 1 4   ? 18.203 13.530 -40.776 1.00 69.77  ? 4    PHE A O   1 
ATOM   9    C CB  . PHE A 1 4   ? 19.936 15.295 -42.735 1.00 77.54  ? 4    PHE A CB  1 
ATOM   10   C CG  . PHE A 1 4   ? 20.622 15.375 -44.089 1.00 81.00  ? 4    PHE A CG  1 
ATOM   11   C CD1 . PHE A 1 4   ? 20.024 14.837 -45.225 1.00 86.53  ? 4    PHE A CD1 1 
ATOM   12   C CD2 . PHE A 1 4   ? 21.890 15.932 -44.214 1.00 83.18  ? 4    PHE A CD2 1 
ATOM   13   C CE1 . PHE A 1 4   ? 20.687 14.850 -46.458 1.00 88.82  ? 4    PHE A CE1 1 
ATOM   14   C CE2 . PHE A 1 4   ? 22.536 15.980 -45.454 1.00 87.03  ? 4    PHE A CE2 1 
ATOM   15   C CZ  . PHE A 1 4   ? 21.933 15.434 -46.567 1.00 87.08  ? 4    PHE A CZ  1 
ATOM   16   N N   . HIS A 1 5   ? 20.090 13.788 -39.550 1.00 65.71  ? 5    HIS A N   1 
ATOM   17   C CA  . HIS A 1 5   ? 19.479 13.471 -38.250 1.00 62.89  ? 5    HIS A CA  1 
ATOM   18   C C   . HIS A 1 5   ? 18.444 14.425 -37.668 1.00 63.07  ? 5    HIS A C   1 
ATOM   19   O O   . HIS A 1 5   ? 17.683 14.009 -36.800 1.00 62.51  ? 5    HIS A O   1 
ATOM   20   C CB  . HIS A 1 5   ? 20.531 13.057 -37.224 1.00 62.67  ? 5    HIS A CB  1 
ATOM   21   C CG  . HIS A 1 5   ? 21.198 14.198 -36.540 1.00 64.19  ? 5    HIS A CG  1 
ATOM   22   N ND1 . HIS A 1 5   ? 22.042 15.046 -37.218 1.00 65.84  ? 5    HIS A ND1 1 
ATOM   23   C CD2 . HIS A 1 5   ? 21.154 14.565 -35.242 1.00 65.08  ? 5    HIS A CD2 1 
ATOM   24   C CE1 . HIS A 1 5   ? 22.466 15.919 -36.322 1.00 64.53  ? 5    HIS A CE1 1 
ATOM   25   N NE2 . HIS A 1 5   ? 21.966 15.658 -35.115 1.00 64.39  ? 5    HIS A NE2 1 
ATOM   26   N N   . THR A 1 6   ? 18.411 15.687 -38.111 1.00 58.09  ? 6    THR A N   1 
ATOM   27   C CA  . THR A 1 6   ? 17.403 16.644 -37.639 1.00 57.57  ? 6    THR A CA  1 
ATOM   28   C C   . THR A 1 6   ? 16.604 17.192 -38.840 1.00 63.55  ? 6    THR A C   1 
ATOM   29   O O   . THR A 1 6   ? 17.130 17.240 -39.953 1.00 63.04  ? 6    THR A O   1 
ATOM   30   C CB  . THR A 1 6   ? 18.025 17.801 -36.853 1.00 63.99  ? 6    THR A CB  1 
ATOM   31   O OG1 . THR A 1 6   ? 18.847 18.565 -37.730 1.00 62.73  ? 6    THR A OG1 1 
ATOM   32   C CG2 . THR A 1 6   ? 18.801 17.353 -35.608 1.00 61.21  ? 6    THR A CG2 1 
ATOM   33   N N   . ARG A 1 7   ? 15.348 17.608 -38.613 1.00 61.43  ? 7    ARG A N   1 
ATOM   34   C CA  . ARG A 1 7   ? 14.526 18.164 -39.672 1.00 63.35  ? 7    ARG A CA  1 
ATOM   35   C C   . ARG A 1 7   ? 14.994 19.533 -40.239 1.00 67.78  ? 7    ARG A C   1 
ATOM   36   O O   . ARG A 1 7   ? 14.730 19.834 -41.405 1.00 68.79  ? 7    ARG A O   1 
ATOM   37   C CB  . ARG A 1 7   ? 13.014 18.023 -39.416 1.00 66.09  ? 7    ARG A CB  1 
ATOM   38   C CG  . ARG A 1 7   ? 12.442 18.761 -38.226 1.00 77.56  ? 7    ARG A CG  1 
ATOM   39   C CD  . ARG A 1 7   ? 11.001 18.323 -38.010 1.00 88.06  ? 7    ARG A CD  1 
ATOM   40   N NE  . ARG A 1 7   ? 10.279 19.203 -37.088 1.00 104.22 ? 7    ARG A NE  1 
ATOM   41   C CZ  . ARG A 1 7   ? 9.562  20.261 -37.457 1.00 125.36 ? 7    ARG A CZ  1 
ATOM   42   N NH1 . ARG A 1 7   ? 9.467  20.595 -38.739 1.00 115.21 ? 7    ARG A NH1 1 
ATOM   43   N NH2 . ARG A 1 7   ? 8.938  20.996 -36.547 1.00 115.42 ? 7    ARG A NH2 1 
ATOM   44   N N   . THR A 1 8   ? 15.775 20.290 -39.454 1.00 62.16  ? 8    THR A N   1 
ATOM   45   C CA  . THR A 1 8   ? 16.378 21.543 -39.875 1.00 61.30  ? 8    THR A CA  1 
ATOM   46   C C   . THR A 1 8   ? 17.468 21.225 -40.901 1.00 64.59  ? 8    THR A C   1 
ATOM   47   O O   . THR A 1 8   ? 17.398 21.731 -42.017 1.00 64.78  ? 8    THR A O   1 
ATOM   48   C CB  . THR A 1 8   ? 16.811 22.353 -38.649 1.00 72.42  ? 8    THR A CB  1 
ATOM   49   O OG1 . THR A 1 8   ? 15.627 22.833 -38.011 1.00 76.45  ? 8    THR A OG1 1 
ATOM   50   C CG2 . THR A 1 8   ? 17.711 23.528 -38.992 1.00 71.81  ? 8    THR A CG2 1 
ATOM   51   N N   . ILE A 1 9   ? 18.421 20.341 -40.558 1.00 59.96  ? 9    ILE A N   1 
ATOM   52   C CA  . ILE A 1 9   ? 19.489 19.924 -41.477 1.00 60.59  ? 9    ILE A CA  1 
ATOM   53   C C   . ILE A 1 9   ? 18.890 19.300 -42.756 1.00 67.89  ? 9    ILE A C   1 
ATOM   54   O O   . ILE A 1 9   ? 19.337 19.614 -43.864 1.00 68.98  ? 9    ILE A O   1 
ATOM   55   C CB  . ILE A 1 9   ? 20.549 19.000 -40.797 1.00 63.19  ? 9    ILE A CB  1 
ATOM   56   C CG1 . ILE A 1 9   ? 21.235 19.700 -39.588 1.00 62.73  ? 9    ILE A CG1 1 
ATOM   57   C CG2 . ILE A 1 9   ? 21.610 18.550 -41.795 1.00 64.04  ? 9    ILE A CG2 1 
ATOM   58   C CD1 . ILE A 1 9   ? 22.139 18.740 -38.718 1.00 63.12  ? 9    ILE A CD1 1 
ATOM   59   N N   . GLU A 1 10  ? 17.878 18.425 -42.595 1.00 65.53  ? 10   GLU A N   1 
ATOM   60   C CA  . GLU A 1 10  ? 17.188 17.746 -43.698 1.00 66.17  ? 10   GLU A CA  1 
ATOM   61   C C   . GLU A 1 10  ? 16.575 18.761 -44.661 1.00 69.03  ? 10   GLU A C   1 
ATOM   62   O O   . GLU A 1 10  ? 16.920 18.751 -45.840 1.00 69.68  ? 10   GLU A O   1 
ATOM   63   C CB  . GLU A 1 10  ? 16.116 16.792 -43.157 1.00 68.20  ? 10   GLU A CB  1 
ATOM   64   C CG  . GLU A 1 10  ? 15.627 15.780 -44.173 1.00 82.16  ? 10   GLU A CG  1 
ATOM   65   C CD  . GLU A 1 10  ? 14.315 15.119 -43.805 1.00 112.01 ? 10   GLU A CD  1 
ATOM   66   O OE1 . GLU A 1 10  ? 13.349 15.847 -43.474 1.00 109.68 ? 10   GLU A OE1 1 
ATOM   67   O OE2 . GLU A 1 10  ? 14.247 13.870 -43.864 1.00 112.06 ? 10   GLU A OE2 1 
ATOM   68   N N   . SER A 1 11  ? 15.711 19.668 -44.154 1.00 64.96  ? 11   SER A N   1 
ATOM   69   C CA  . SER A 1 11  ? 15.060 20.693 -44.974 1.00 65.66  ? 11   SER A CA  1 
ATOM   70   C C   . SER A 1 11  ? 16.098 21.517 -45.766 1.00 70.69  ? 11   SER A C   1 
ATOM   71   O O   . SER A 1 11  ? 15.999 21.626 -46.988 1.00 72.07  ? 11   SER A O   1 
ATOM   72   C CB  . SER A 1 11  ? 14.173 21.593 -44.116 1.00 68.75  ? 11   SER A CB  1 
ATOM   73   O OG  . SER A 1 11  ? 14.919 22.548 -43.376 1.00 76.51  ? 11   SER A OG  1 
ATOM   74   N N   . ILE A 1 12  ? 17.136 21.999 -45.070 1.00 65.85  ? 12   ILE A N   1 
ATOM   75   C CA  . ILE A 1 12  ? 18.215 22.803 -45.636 1.00 65.23  ? 12   ILE A CA  1 
ATOM   76   C C   . ILE A 1 12  ? 19.066 22.070 -46.683 1.00 71.21  ? 12   ILE A C   1 
ATOM   77   O O   . ILE A 1 12  ? 19.194 22.576 -47.800 1.00 72.61  ? 12   ILE A O   1 
ATOM   78   C CB  . ILE A 1 12  ? 19.057 23.501 -44.515 1.00 66.49  ? 12   ILE A CB  1 
ATOM   79   C CG1 . ILE A 1 12  ? 18.176 24.506 -43.728 1.00 66.40  ? 12   ILE A CG1 1 
ATOM   80   C CG2 . ILE A 1 12  ? 20.314 24.193 -45.079 1.00 66.41  ? 12   ILE A CG2 1 
ATOM   81   C CD1 . ILE A 1 12  ? 18.763 25.083 -42.441 1.00 68.74  ? 12   ILE A CD1 1 
ATOM   82   N N   . LEU A 1 13  ? 19.602 20.880 -46.342 1.00 67.13  ? 13   LEU A N   1 
ATOM   83   C CA  . LEU A 1 13  ? 20.556 20.143 -47.166 1.00 67.70  ? 13   LEU A CA  1 
ATOM   84   C C   . LEU A 1 13  ? 20.120 19.030 -48.107 1.00 73.35  ? 13   LEU A C   1 
ATOM   85   O O   . LEU A 1 13  ? 20.810 18.810 -49.101 1.00 74.30  ? 13   LEU A O   1 
ATOM   86   C CB  . LEU A 1 13  ? 21.738 19.650 -46.308 1.00 67.32  ? 13   LEU A CB  1 
ATOM   87   C CG  . LEU A 1 13  ? 22.601 20.688 -45.574 1.00 71.28  ? 13   LEU A CG  1 
ATOM   88   C CD1 . LEU A 1 13  ? 23.773 20.011 -44.911 1.00 71.53  ? 13   LEU A CD1 1 
ATOM   89   C CD2 . LEU A 1 13  ? 23.123 21.765 -46.509 1.00 74.09  ? 13   LEU A CD2 1 
ATOM   90   N N   . GLU A 1 14  ? 19.080 18.254 -47.762 1.00 70.82  ? 14   GLU A N   1 
ATOM   91   C CA  . GLU A 1 14  ? 18.626 17.114 -48.573 1.00 71.96  ? 14   GLU A CA  1 
ATOM   92   C C   . GLU A 1 14  ? 18.236 17.453 -50.029 1.00 76.44  ? 14   GLU A C   1 
ATOM   93   O O   . GLU A 1 14  ? 18.678 16.720 -50.914 1.00 77.76  ? 14   GLU A O   1 
ATOM   94   C CB  . GLU A 1 14  ? 17.560 16.275 -47.857 1.00 73.91  ? 14   GLU A CB  1 
ATOM   95   C CG  . GLU A 1 14  ? 17.483 14.840 -48.356 1.00 89.16  ? 14   GLU A CG  1 
ATOM   96   C CD  . GLU A 1 14  ? 16.366 14.016 -47.749 1.00 116.97 ? 14   GLU A CD  1 
ATOM   97   O OE1 . GLU A 1 14  ? 15.184 14.295 -48.058 1.00 110.74 ? 14   GLU A OE1 1 
ATOM   98   O OE2 . GLU A 1 14  ? 16.674 13.085 -46.971 1.00 116.37 ? 14   GLU A OE2 1 
ATOM   99   N N   . PRO A 1 15  ? 17.469 18.538 -50.331 1.00 72.21  ? 15   PRO A N   1 
ATOM   100  C CA  . PRO A 1 15  ? 17.179 18.853 -51.749 1.00 73.21  ? 15   PRO A CA  1 
ATOM   101  C C   . PRO A 1 15  ? 18.447 19.060 -52.588 1.00 76.51  ? 15   PRO A C   1 
ATOM   102  O O   . PRO A 1 15  ? 18.562 18.479 -53.668 1.00 77.22  ? 15   PRO A O   1 
ATOM   103  C CB  . PRO A 1 15  ? 16.355 20.144 -51.669 1.00 74.39  ? 15   PRO A CB  1 
ATOM   104  C CG  . PRO A 1 15  ? 15.836 20.194 -50.263 1.00 77.52  ? 15   PRO A CG  1 
ATOM   105  C CD  . PRO A 1 15  ? 16.862 19.539 -49.427 1.00 71.99  ? 15   PRO A CD  1 
ATOM   106  N N   . VAL A 1 16  ? 19.410 19.859 -52.072 1.00 72.15  ? 16   VAL A N   1 
ATOM   107  C CA  . VAL A 1 16  ? 20.682 20.138 -52.750 1.00 72.17  ? 16   VAL A CA  1 
ATOM   108  C C   . VAL A 1 16  ? 21.613 18.909 -52.787 1.00 76.19  ? 16   VAL A C   1 
ATOM   109  O O   . VAL A 1 16  ? 22.241 18.660 -53.819 1.00 76.40  ? 16   VAL A O   1 
ATOM   110  C CB  . VAL A 1 16  ? 21.357 21.472 -52.307 1.00 74.79  ? 16   VAL A CB  1 
ATOM   111  C CG1 . VAL A 1 16  ? 21.758 21.459 -50.837 1.00 73.19  ? 16   VAL A CG1 1 
ATOM   112  C CG2 . VAL A 1 16  ? 22.540 21.833 -53.199 1.00 75.06  ? 16   VAL A CG2 1 
ATOM   113  N N   . ALA A 1 17  ? 21.637 18.103 -51.696 1.00 72.15  ? 17   ALA A N   1 
ATOM   114  C CA  . ALA A 1 17  ? 22.440 16.873 -51.616 1.00 72.79  ? 17   ALA A CA  1 
ATOM   115  C C   . ALA A 1 17  ? 21.983 15.838 -52.654 1.00 77.84  ? 17   ALA A C   1 
ATOM   116  O O   . ALA A 1 17  ? 22.820 15.110 -53.188 1.00 78.99  ? 17   ALA A O   1 
ATOM   117  C CB  . ALA A 1 17  ? 22.368 16.284 -50.216 1.00 73.04  ? 17   ALA A CB  1 
ATOM   118  N N   . GLN A 1 18  ? 20.665 15.805 -52.966 1.00 74.64  ? 18   GLN A N   1 
ATOM   119  C CA  . GLN A 1 18  ? 20.084 14.914 -53.974 1.00 77.38  ? 18   GLN A CA  1 
ATOM   120  C C   . GLN A 1 18  ? 20.460 15.357 -55.396 1.00 82.73  ? 18   GLN A C   1 
ATOM   121  O O   . GLN A 1 18  ? 20.816 14.505 -56.208 1.00 84.79  ? 18   GLN A O   1 
ATOM   122  C CB  . GLN A 1 18  ? 18.564 14.792 -53.797 1.00 79.53  ? 18   GLN A CB  1 
ATOM   123  C CG  . GLN A 1 18  ? 18.161 13.838 -52.667 1.00 94.50  ? 18   GLN A CG  1 
ATOM   124  C CD  . GLN A 1 18  ? 16.747 14.027 -52.153 1.00 112.05 ? 18   GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 18  ? 16.078 15.044 -52.405 1.00 105.32 ? 18   GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 18  ? 16.279 13.057 -51.373 1.00 103.21 ? 18   GLN A NE2 1 
ATOM   127  N N   . GLN A 1 19  ? 20.430 16.684 -55.683 1.00 77.52  ? 19   GLN A N   1 
ATOM   128  C CA  . GLN A 1 19  ? 20.832 17.249 -56.978 1.00 77.85  ? 19   GLN A CA  1 
ATOM   129  C C   . GLN A 1 19  ? 22.307 16.926 -57.278 1.00 82.49  ? 19   GLN A C   1 
ATOM   130  O O   . GLN A 1 19  ? 22.618 16.519 -58.399 1.00 84.00  ? 19   GLN A O   1 
ATOM   131  C CB  . GLN A 1 19  ? 20.646 18.780 -57.002 1.00 77.47  ? 19   GLN A CB  1 
ATOM   132  C CG  . GLN A 1 19  ? 19.211 19.277 -57.135 1.00 82.24  ? 19   GLN A CG  1 
ATOM   133  C CD  . GLN A 1 19  ? 19.147 20.783 -57.012 1.00 95.07  ? 19   GLN A CD  1 
ATOM   134  O OE1 . GLN A 1 19  ? 19.681 21.380 -56.075 1.00 88.99  ? 19   GLN A OE1 1 
ATOM   135  N NE2 . GLN A 1 19  ? 18.478 21.434 -57.946 1.00 86.47  ? 19   GLN A NE2 1 
ATOM   136  N N   . ILE A 1 20  ? 23.206 17.112 -56.278 1.00 77.79  ? 20   ILE A N   1 
ATOM   137  C CA  . ILE A 1 20  ? 24.649 16.842 -56.391 1.00 78.22  ? 20   ILE A CA  1 
ATOM   138  C C   . ILE A 1 20  ? 24.904 15.379 -56.718 1.00 85.61  ? 20   ILE A C   1 
ATOM   139  O O   . ILE A 1 20  ? 25.661 15.104 -57.642 1.00 87.62  ? 20   ILE A O   1 
ATOM   140  C CB  . ILE A 1 20  ? 25.468 17.358 -55.168 1.00 79.28  ? 20   ILE A CB  1 
ATOM   141  C CG1 . ILE A 1 20  ? 25.336 18.887 -55.044 1.00 77.62  ? 20   ILE A CG1 1 
ATOM   142  C CG2 . ILE A 1 20  ? 26.952 16.953 -55.275 1.00 81.02  ? 20   ILE A CG2 1 
ATOM   143  C CD1 . ILE A 1 20  ? 25.727 19.513 -53.716 1.00 79.21  ? 20   ILE A CD1 1 
ATOM   144  N N   . SER A 1 21  ? 24.237 14.447 -56.009 1.00 83.86  ? 21   SER A N   1 
ATOM   145  C CA  . SER A 1 21  ? 24.365 13.004 -56.259 1.00 86.84  ? 21   SER A CA  1 
ATOM   146  C C   . SER A 1 21  ? 23.992 12.687 -57.707 1.00 92.56  ? 21   SER A C   1 
ATOM   147  O O   . SER A 1 21  ? 24.760 12.022 -58.408 1.00 94.10  ? 21   SER A O   1 
ATOM   148  C CB  . SER A 1 21  ? 23.492 12.207 -55.290 1.00 92.25  ? 21   SER A CB  1 
ATOM   149  O OG  . SER A 1 21  ? 22.143 12.129 -55.726 1.00 104.95 ? 21   SER A OG  1 
ATOM   150  N N   . HIS A 1 22  ? 22.846 13.239 -58.165 1.00 89.48  ? 22   HIS A N   1 
ATOM   151  C CA  . HIS A 1 22  ? 22.316 13.096 -59.526 1.00 91.58  ? 22   HIS A CA  1 
ATOM   152  C C   . HIS A 1 22  ? 23.321 13.608 -60.555 1.00 95.20  ? 22   HIS A C   1 
ATOM   153  O O   . HIS A 1 22  ? 23.621 12.899 -61.507 1.00 97.85  ? 22   HIS A O   1 
ATOM   154  C CB  . HIS A 1 22  ? 20.978 13.838 -59.661 1.00 92.06  ? 22   HIS A CB  1 
ATOM   155  C CG  . HIS A 1 22  ? 19.909 13.012 -60.292 1.00 98.72  ? 22   HIS A CG  1 
ATOM   156  N ND1 . HIS A 1 22  ? 19.819 12.881 -61.670 1.00 103.35 ? 22   HIS A ND1 1 
ATOM   157  C CD2 . HIS A 1 22  ? 18.928 12.279 -59.715 1.00 101.59 ? 22   HIS A CD2 1 
ATOM   158  C CE1 . HIS A 1 22  ? 18.790 12.078 -61.887 1.00 105.13 ? 22   HIS A CE1 1 
ATOM   159  N NE2 . HIS A 1 22  ? 18.222 11.688 -60.739 1.00 104.66 ? 22   HIS A NE2 1 
ATOM   160  N N   . LEU A 1 23  ? 23.884 14.807 -60.319 1.00 89.08  ? 23   LEU A N   1 
ATOM   161  C CA  . LEU A 1 23  ? 24.888 15.467 -61.154 1.00 89.04  ? 23   LEU A CA  1 
ATOM   162  C C   . LEU A 1 23  ? 26.145 14.599 -61.321 1.00 95.47  ? 23   LEU A C   1 
ATOM   163  O O   . LEU A 1 23  ? 26.693 14.539 -62.420 1.00 96.72  ? 23   LEU A O   1 
ATOM   164  C CB  . LEU A 1 23  ? 25.244 16.821 -60.517 1.00 86.38  ? 23   LEU A CB  1 
ATOM   165  C CG  . LEU A 1 23  ? 25.657 17.961 -61.432 1.00 91.11  ? 23   LEU A CG  1 
ATOM   166  C CD1 . LEU A 1 23  ? 24.480 18.468 -62.251 1.00 92.03  ? 23   LEU A CD1 1 
ATOM   167  C CD2 . LEU A 1 23  ? 26.228 19.112 -60.613 1.00 91.12  ? 23   LEU A CD2 1 
ATOM   168  N N   . VAL A 1 24  ? 26.573 13.903 -60.239 1.00 93.22  ? 24   VAL A N   1 
ATOM   169  C CA  . VAL A 1 24  ? 27.735 12.996 -60.219 1.00 95.11  ? 24   VAL A CA  1 
ATOM   170  C C   . VAL A 1 24  ? 27.447 11.763 -61.093 1.00 104.39 ? 24   VAL A C   1 
ATOM   171  O O   . VAL A 1 24  ? 28.267 11.416 -61.957 1.00 106.96 ? 24   VAL A O   1 
ATOM   172  C CB  . VAL A 1 24  ? 28.158 12.623 -58.768 1.00 97.05  ? 24   VAL A CB  1 
ATOM   173  C CG1 . VAL A 1 24  ? 29.200 11.507 -58.751 1.00 99.05  ? 24   VAL A CG1 1 
ATOM   174  C CG2 . VAL A 1 24  ? 28.683 13.844 -58.025 1.00 93.90  ? 24   VAL A CG2 1 
ATOM   175  N N   . ILE A 1 25  ? 26.267 11.127 -60.882 1.00 101.54 ? 25   ILE A N   1 
ATOM   176  C CA  . ILE A 1 25  ? 25.812 9.966  -61.652 1.00 104.60 ? 25   ILE A CA  1 
ATOM   177  C C   . ILE A 1 25  ? 25.732 10.325 -63.145 1.00 111.64 ? 25   ILE A C   1 
ATOM   178  O O   . ILE A 1 25  ? 26.246 9.558  -63.964 1.00 115.07 ? 25   ILE A O   1 
ATOM   179  C CB  . ILE A 1 25  ? 24.505 9.333  -61.068 1.00 107.37 ? 25   ILE A CB  1 
ATOM   180  C CG1 . ILE A 1 25  ? 24.744 8.805  -59.631 1.00 106.09 ? 25   ILE A CG1 1 
ATOM   181  C CG2 . ILE A 1 25  ? 23.959 8.206  -61.964 1.00 111.49 ? 25   ILE A CG2 1 
ATOM   182  C CD1 . ILE A 1 25  ? 23.512 8.767  -58.733 1.00 108.45 ? 25   ILE A CD1 1 
ATOM   183  N N   . MET A 1 26  ? 25.171 11.520 -63.485 1.00 107.31 ? 26   MET A N   1 
ATOM   184  C CA  . MET A 1 26  ? 25.044 12.026 -64.871 1.00 109.03 ? 26   MET A CA  1 
ATOM   185  C C   . MET A 1 26  ? 26.400 12.217 -65.552 1.00 113.65 ? 26   MET A C   1 
ATOM   186  O O   . MET A 1 26  ? 26.551 11.866 -66.727 1.00 115.65 ? 26   MET A O   1 
ATOM   187  C CB  . MET A 1 26  ? 24.244 13.354 -64.947 1.00 109.33 ? 26   MET A CB  1 
ATOM   188  C CG  . MET A 1 26  ? 22.773 13.273 -64.522 1.00 113.05 ? 26   MET A CG  1 
ATOM   189  S SD  . MET A 1 26  ? 21.836 11.836 -65.097 1.00 121.51 ? 26   MET A SD  1 
ATOM   190  C CE  . MET A 1 26  ? 21.810 10.866 -63.605 1.00 117.64 ? 26   MET A CE  1 
ATOM   191  N N   . HIS A 1 27  ? 27.372 12.787 -64.812 1.00 108.33 ? 27   HIS A N   1 
ATOM   192  C CA  . HIS A 1 27  ? 28.729 13.063 -65.281 1.00 109.12 ? 27   HIS A CA  1 
ATOM   193  C C   . HIS A 1 27  ? 29.499 11.769 -65.545 1.00 117.03 ? 27   HIS A C   1 
ATOM   194  O O   . HIS A 1 27  ? 30.207 11.676 -66.555 1.00 118.89 ? 27   HIS A O   1 
ATOM   195  C CB  . HIS A 1 27  ? 29.473 13.950 -64.267 1.00 107.03 ? 27   HIS A CB  1 
ATOM   196  C CG  . HIS A 1 27  ? 30.786 14.477 -64.760 1.00 110.89 ? 27   HIS A CG  1 
ATOM   197  N ND1 . HIS A 1 27  ? 30.854 15.403 -65.785 1.00 112.63 ? 27   HIS A ND1 1 
ATOM   198  C CD2 . HIS A 1 27  ? 32.039 14.216 -64.323 1.00 113.24 ? 27   HIS A CD2 1 
ATOM   199  C CE1 . HIS A 1 27  ? 32.140 15.659 -65.951 1.00 112.61 ? 27   HIS A CE1 1 
ATOM   200  N NE2 . HIS A 1 27  ? 32.891 14.968 -65.094 1.00 113.39 ? 27   HIS A NE2 1 
ATOM   201  N N   . GLU A 1 28  ? 29.337 10.770 -64.646 1.00 114.31 ? 28   GLU A N   1 
ATOM   202  C CA  . GLU A 1 28  ? 29.978 9.457  -64.728 1.00 117.38 ? 28   GLU A CA  1 
ATOM   203  C C   . GLU A 1 28  ? 29.604 8.733  -66.027 1.00 124.69 ? 28   GLU A C   1 
ATOM   204  O O   . GLU A 1 28  ? 30.495 8.447  -66.831 1.00 127.25 ? 28   GLU A O   1 
ATOM   205  C CB  . GLU A 1 28  ? 29.639 8.607  -63.491 1.00 118.33 ? 28   GLU A CB  1 
ATOM   206  N N   . GLU A 1 29  ? 28.291 8.507  -66.260 1.00 121.06 ? 29   GLU A N   1 
ATOM   207  C CA  . GLU A 1 29  ? 27.760 7.842  -67.456 1.00 124.21 ? 29   GLU A CA  1 
ATOM   208  C C   . GLU A 1 29  ? 27.990 8.640  -68.750 1.00 128.06 ? 29   GLU A C   1 
ATOM   209  O O   . GLU A 1 29  ? 28.561 8.102  -69.701 1.00 130.59 ? 29   GLU A O   1 
ATOM   210  C CB  . GLU A 1 29  ? 26.272 7.499  -67.277 1.00 125.73 ? 29   GLU A CB  1 
ATOM   211  N N   . GLY A 1 30  ? 27.557 9.903  -68.760 1.00 121.31 ? 30   GLY A N   1 
ATOM   212  C CA  . GLY A 1 30  ? 27.687 10.799 -69.903 1.00 145.78 ? 30   GLY A CA  1 
ATOM   213  C C   . GLY A 1 30  ? 29.104 11.282 -70.124 1.00 173.76 ? 30   GLY A C   1 
ATOM   214  O O   . GLY A 1 30  ? 29.451 11.722 -71.221 1.00 137.33 ? 30   GLY A O   1 
ATOM   215  N N   . LYS A 1 35  ? 26.361 18.582 -75.541 1.00 104.25 ? 35   LYS A N   1 
ATOM   216  C CA  . LYS A 1 35  ? 25.502 19.549 -74.857 1.00 100.70 ? 35   LYS A CA  1 
ATOM   217  C C   . LYS A 1 35  ? 26.313 20.709 -74.281 1.00 100.88 ? 35   LYS A C   1 
ATOM   218  O O   . LYS A 1 35  ? 27.441 20.506 -73.831 1.00 100.93 ? 35   LYS A O   1 
ATOM   219  C CB  . LYS A 1 35  ? 24.677 18.866 -73.754 1.00 101.42 ? 35   LYS A CB  1 
ATOM   220  C CG  . LYS A 1 35  ? 23.383 19.603 -73.419 1.00 108.64 ? 35   LYS A CG  1 
ATOM   221  C CD  . LYS A 1 35  ? 22.710 19.052 -72.179 1.00 113.25 ? 35   LYS A CD  1 
ATOM   222  C CE  . LYS A 1 35  ? 21.392 19.728 -71.893 1.00 117.19 ? 35   LYS A CE  1 
ATOM   223  N NZ  . LYS A 1 35  ? 20.678 19.073 -70.763 1.00 124.34 ? 35   LYS A NZ  1 
ATOM   224  N N   . ALA A 1 36  ? 25.735 21.918 -74.295 1.00 94.02  ? 36   ALA A N   1 
ATOM   225  C CA  . ALA A 1 36  ? 26.373 23.118 -73.757 1.00 90.91  ? 36   ALA A CA  1 
ATOM   226  C C   . ALA A 1 36  ? 25.711 23.554 -72.454 1.00 90.58  ? 36   ALA A C   1 
ATOM   227  O O   . ALA A 1 36  ? 24.478 23.573 -72.373 1.00 90.25  ? 36   ALA A O   1 
ATOM   228  C CB  . ALA A 1 36  ? 26.296 24.253 -74.771 1.00 91.85  ? 36   ALA A CB  1 
ATOM   229  N N   . ILE A 1 37  ? 26.530 23.904 -71.434 1.00 83.20  ? 37   ILE A N   1 
ATOM   230  C CA  . ILE A 1 37  ? 26.042 24.444 -70.159 1.00 78.97  ? 37   ILE A CA  1 
ATOM   231  C C   . ILE A 1 37  ? 25.801 25.949 -70.415 1.00 80.33  ? 37   ILE A C   1 
ATOM   232  O O   . ILE A 1 37  ? 26.696 26.616 -70.949 1.00 78.59  ? 37   ILE A O   1 
ATOM   233  C CB  . ILE A 1 37  ? 27.001 24.169 -68.956 1.00 79.96  ? 37   ILE A CB  1 
ATOM   234  C CG1 . ILE A 1 37  ? 27.086 22.660 -68.652 1.00 80.76  ? 37   ILE A CG1 1 
ATOM   235  C CG2 . ILE A 1 37  ? 26.566 24.941 -67.684 1.00 77.69  ? 37   ILE A CG2 1 
ATOM   236  C CD1 . ILE A 1 37  ? 28.233 22.257 -67.777 1.00 84.06  ? 37   ILE A CD1 1 
ATOM   237  N N   . PRO A 1 38  ? 24.599 26.497 -70.106 1.00 77.07  ? 38   PRO A N   1 
ATOM   238  C CA  . PRO A 1 38  ? 24.363 27.935 -70.364 1.00 75.91  ? 38   PRO A CA  1 
ATOM   239  C C   . PRO A 1 38  ? 25.194 28.838 -69.443 1.00 75.40  ? 38   PRO A C   1 
ATOM   240  O O   . PRO A 1 38  ? 25.891 28.329 -68.551 1.00 72.56  ? 38   PRO A O   1 
ATOM   241  C CB  . PRO A 1 38  ? 22.850 28.105 -70.122 1.00 78.01  ? 38   PRO A CB  1 
ATOM   242  C CG  . PRO A 1 38  ? 22.287 26.707 -69.942 1.00 83.51  ? 38   PRO A CG  1 
ATOM   243  C CD  . PRO A 1 38  ? 23.422 25.862 -69.472 1.00 78.72  ? 38   PRO A CD  1 
ATOM   244  N N   . ASP A 1 39  ? 25.152 30.169 -69.677 1.00 71.00  ? 39   ASP A N   1 
ATOM   245  C CA  . ASP A 1 39  ? 25.892 31.151 -68.864 1.00 68.93  ? 39   ASP A CA  1 
ATOM   246  C C   . ASP A 1 39  ? 25.451 31.062 -67.396 1.00 71.36  ? 39   ASP A C   1 
ATOM   247  O O   . ASP A 1 39  ? 24.263 31.203 -67.089 1.00 72.46  ? 39   ASP A O   1 
ATOM   248  C CB  . ASP A 1 39  ? 25.727 32.586 -69.416 1.00 70.27  ? 39   ASP A CB  1 
ATOM   249  C CG  . ASP A 1 39  ? 26.653 33.641 -68.822 1.00 76.26  ? 39   ASP A CG  1 
ATOM   250  O OD1 . ASP A 1 39  ? 26.489 34.832 -69.156 1.00 78.42  ? 39   ASP A OD1 1 
ATOM   251  O OD2 . ASP A 1 39  ? 27.579 33.271 -68.077 1.00 79.52  ? 39   ASP A OD2 1 
ATOM   252  N N   . LEU A 1 40  ? 26.405 30.762 -66.509 1.00 65.70  ? 40   LEU A N   1 
ATOM   253  C CA  . LEU A 1 40  ? 26.155 30.602 -65.084 1.00 63.92  ? 40   LEU A CA  1 
ATOM   254  C C   . LEU A 1 40  ? 26.568 31.837 -64.267 1.00 68.05  ? 40   LEU A C   1 
ATOM   255  O O   . LEU A 1 40  ? 26.588 31.762 -63.037 1.00 67.87  ? 40   LEU A O   1 
ATOM   256  C CB  . LEU A 1 40  ? 26.851 29.328 -64.540 1.00 63.63  ? 40   LEU A CB  1 
ATOM   257  C CG  . LEU A 1 40  ? 26.611 27.973 -65.249 1.00 69.30  ? 40   LEU A CG  1 
ATOM   258  C CD1 . LEU A 1 40  ? 27.360 26.874 -64.538 1.00 68.91  ? 40   LEU A CD1 1 
ATOM   259  C CD2 . LEU A 1 40  ? 25.117 27.605 -65.329 1.00 71.61  ? 40   LEU A CD2 1 
ATOM   260  N N   . THR A 1 41  ? 26.852 32.978 -64.935 1.00 64.33  ? 41   THR A N   1 
ATOM   261  C CA  . THR A 1 41  ? 27.269 34.229 -64.282 1.00 62.99  ? 41   THR A CA  1 
ATOM   262  C C   . THR A 1 41  ? 26.318 34.690 -63.148 1.00 63.40  ? 41   THR A C   1 
ATOM   263  O O   . THR A 1 41  ? 26.763 34.814 -62.020 1.00 61.36  ? 41   THR A O   1 
ATOM   264  C CB  . THR A 1 41  ? 27.629 35.299 -65.348 1.00 72.69  ? 41   THR A CB  1 
ATOM   265  O OG1 . THR A 1 41  ? 28.767 34.834 -66.078 1.00 70.82  ? 41   THR A OG1 1 
ATOM   266  C CG2 . THR A 1 41  ? 27.966 36.658 -64.743 1.00 72.31  ? 41   THR A CG2 1 
ATOM   267  N N   . ALA A 1 42  ? 25.025 34.941 -63.462 1.00 60.62  ? 42   ALA A N   1 
ATOM   268  C CA  . ALA A 1 42  ? 24.003 35.383 -62.511 1.00 59.00  ? 42   ALA A CA  1 
ATOM   269  C C   . ALA A 1 42  ? 23.827 34.386 -61.338 1.00 60.37  ? 42   ALA A C   1 
ATOM   270  O O   . ALA A 1 42  ? 24.063 34.809 -60.204 1.00 57.69  ? 42   ALA A O   1 
ATOM   271  C CB  . ALA A 1 42  ? 22.684 35.648 -63.224 1.00 60.72  ? 42   ALA A CB  1 
ATOM   272  N N   . PRO A 1 43  ? 23.547 33.062 -61.554 1.00 57.06  ? 43   PRO A N   1 
ATOM   273  C CA  . PRO A 1 43  ? 23.426 32.157 -60.392 1.00 55.79  ? 43   PRO A CA  1 
ATOM   274  C C   . PRO A 1 43  ? 24.700 31.969 -59.572 1.00 60.43  ? 43   PRO A C   1 
ATOM   275  O O   . PRO A 1 43  ? 24.580 31.859 -58.356 1.00 59.60  ? 43   PRO A O   1 
ATOM   276  C CB  . PRO A 1 43  ? 22.875 30.861 -60.983 1.00 58.34  ? 43   PRO A CB  1 
ATOM   277  C CG  . PRO A 1 43  ? 23.164 30.928 -62.429 1.00 63.28  ? 43   PRO A CG  1 
ATOM   278  C CD  . PRO A 1 43  ? 23.209 32.363 -62.817 1.00 58.97  ? 43   PRO A CD  1 
ATOM   279  N N   . VAL A 1 44  ? 25.912 31.989 -60.201 1.00 58.36  ? 44   VAL A N   1 
ATOM   280  C CA  . VAL A 1 44  ? 27.173 31.895 -59.441 1.00 57.99  ? 44   VAL A CA  1 
ATOM   281  C C   . VAL A 1 44  ? 27.326 33.131 -58.544 1.00 59.76  ? 44   VAL A C   1 
ATOM   282  O O   . VAL A 1 44  ? 27.692 32.975 -57.386 1.00 59.22  ? 44   VAL A O   1 
ATOM   283  C CB  . VAL A 1 44  ? 28.456 31.613 -60.289 1.00 63.79  ? 44   VAL A CB  1 
ATOM   284  C CG1 . VAL A 1 44  ? 29.731 31.735 -59.443 1.00 63.50  ? 44   VAL A CG1 1 
ATOM   285  C CG2 . VAL A 1 44  ? 28.401 30.227 -60.894 1.00 64.95  ? 44   VAL A CG2 1 
ATOM   286  N N   . ALA A 1 45  ? 27.018 34.343 -59.061 1.00 55.59  ? 45   ALA A N   1 
ATOM   287  C CA  . ALA A 1 45  ? 27.079 35.587 -58.274 1.00 54.33  ? 45   ALA A CA  1 
ATOM   288  C C   . ALA A 1 45  ? 26.168 35.474 -57.044 1.00 57.63  ? 45   ALA A C   1 
ATOM   289  O O   . ALA A 1 45  ? 26.566 35.885 -55.954 1.00 58.10  ? 45   ALA A O   1 
ATOM   290  C CB  . ALA A 1 45  ? 26.657 36.777 -59.126 1.00 55.31  ? 45   ALA A CB  1 
ATOM   291  N N   . ALA A 1 46  ? 24.975 34.861 -57.203 1.00 53.53  ? 46   ALA A N   1 
ATOM   292  C CA  . ALA A 1 46  ? 24.056 34.650 -56.084 1.00 52.68  ? 46   ALA A CA  1 
ATOM   293  C C   . ALA A 1 46  ? 24.695 33.724 -55.040 1.00 57.55  ? 46   ALA A C   1 
ATOM   294  O O   . ALA A 1 46  ? 24.544 33.972 -53.839 1.00 56.47  ? 46   ALA A O   1 
ATOM   295  C CB  . ALA A 1 46  ? 22.734 34.086 -56.580 1.00 53.40  ? 46   ALA A CB  1 
ATOM   296  N N   . VAL A 1 47  ? 25.454 32.686 -55.497 1.00 55.11  ? 47   VAL A N   1 
ATOM   297  C CA  . VAL A 1 47  ? 26.180 31.764 -54.593 1.00 54.35  ? 47   VAL A CA  1 
ATOM   298  C C   . VAL A 1 47  ? 27.266 32.554 -53.850 1.00 57.12  ? 47   VAL A C   1 
ATOM   299  O O   . VAL A 1 47  ? 27.354 32.452 -52.626 1.00 55.10  ? 47   VAL A O   1 
ATOM   300  C CB  . VAL A 1 47  ? 26.743 30.511 -55.313 1.00 58.58  ? 47   VAL A CB  1 
ATOM   301  C CG1 . VAL A 1 47  ? 27.571 29.650 -54.369 1.00 58.29  ? 47   VAL A CG1 1 
ATOM   302  C CG2 . VAL A 1 47  ? 25.621 29.683 -55.934 1.00 59.12  ? 47   VAL A CG2 1 
ATOM   303  N N   . GLN A 1 48  ? 28.022 33.404 -54.583 1.00 54.93  ? 48   GLN A N   1 
ATOM   304  C CA  . GLN A 1 48  ? 29.104 34.247 -54.032 1.00 55.15  ? 48   GLN A CA  1 
ATOM   305  C C   . GLN A 1 48  ? 28.624 35.176 -52.924 1.00 58.07  ? 48   GLN A C   1 
ATOM   306  O O   . GLN A 1 48  ? 29.295 35.290 -51.899 1.00 57.73  ? 48   GLN A O   1 
ATOM   307  C CB  . GLN A 1 48  ? 29.732 35.112 -55.125 1.00 56.96  ? 48   GLN A CB  1 
ATOM   308  C CG  . GLN A 1 48  ? 30.591 34.371 -56.107 1.00 70.43  ? 48   GLN A CG  1 
ATOM   309  C CD  . GLN A 1 48  ? 31.205 35.371 -57.049 1.00 93.96  ? 48   GLN A CD  1 
ATOM   310  O OE1 . GLN A 1 48  ? 30.582 35.813 -58.028 1.00 93.78  ? 48   GLN A OE1 1 
ATOM   311  N NE2 . GLN A 1 48  ? 32.429 35.779 -56.742 1.00 79.77  ? 48   GLN A NE2 1 
ATOM   312  N N   . ALA A 1 49  ? 27.500 35.887 -53.174 1.00 54.07  ? 49   ALA A N   1 
ATOM   313  C CA  . ALA A 1 49  ? 26.846 36.816 -52.246 1.00 53.25  ? 49   ALA A CA  1 
ATOM   314  C C   . ALA A 1 49  ? 26.384 36.050 -50.983 1.00 57.67  ? 49   ALA A C   1 
ATOM   315  O O   . ALA A 1 49  ? 26.618 36.533 -49.873 1.00 58.96  ? 49   ALA A O   1 
ATOM   316  C CB  . ALA A 1 49  ? 25.664 37.489 -52.937 1.00 54.22  ? 49   ALA A CB  1 
ATOM   317  N N   . ALA A 1 50  ? 25.812 34.829 -51.132 1.00 52.77  ? 50   ALA A N   1 
ATOM   318  C CA  . ALA A 1 50  ? 25.416 34.027 -49.951 1.00 51.51  ? 50   ALA A CA  1 
ATOM   319  C C   . ALA A 1 50  ? 26.632 33.543 -49.118 1.00 54.05  ? 50   ALA A C   1 
ATOM   320  O O   . ALA A 1 50  ? 26.621 33.657 -47.886 1.00 52.98  ? 50   ALA A O   1 
ATOM   321  C CB  . ALA A 1 50  ? 24.548 32.849 -50.360 1.00 51.75  ? 50   ALA A CB  1 
ATOM   322  N N   . VAL A 1 51  ? 27.680 33.042 -49.791 1.00 50.86  ? 51   VAL A N   1 
ATOM   323  C CA  . VAL A 1 51  ? 28.923 32.565 -49.165 1.00 50.63  ? 51   VAL A CA  1 
ATOM   324  C C   . VAL A 1 51  ? 29.604 33.703 -48.382 1.00 59.03  ? 51   VAL A C   1 
ATOM   325  O O   . VAL A 1 51  ? 29.977 33.509 -47.223 1.00 59.47  ? 51   VAL A O   1 
ATOM   326  C CB  . VAL A 1 51  ? 29.864 31.871 -50.191 1.00 54.00  ? 51   VAL A CB  1 
ATOM   327  C CG1 . VAL A 1 51  ? 31.272 31.652 -49.628 1.00 54.23  ? 51   VAL A CG1 1 
ATOM   328  C CG2 . VAL A 1 51  ? 29.272 30.545 -50.663 1.00 53.30  ? 51   VAL A CG2 1 
ATOM   329  N N   . SER A 1 52  ? 29.708 34.889 -48.993 1.00 58.51  ? 52   SER A N   1 
ATOM   330  C CA  . SER A 1 52  ? 30.327 36.070 -48.373 1.00 60.11  ? 52   SER A CA  1 
ATOM   331  C C   . SER A 1 52  ? 29.647 36.456 -47.057 1.00 64.24  ? 52   SER A C   1 
ATOM   332  O O   . SER A 1 52  ? 30.336 36.727 -46.064 1.00 64.29  ? 52   SER A O   1 
ATOM   333  C CB  . SER A 1 52  ? 30.336 37.248 -49.343 1.00 63.71  ? 52   SER A CB  1 
ATOM   334  O OG  . SER A 1 52  ? 30.829 38.414 -48.708 1.00 74.11  ? 52   SER A OG  1 
ATOM   335  N N   . ASN A 1 53  ? 28.295 36.451 -47.054 1.00 60.18  ? 53   ASN A N   1 
ATOM   336  C CA  . ASN A 1 53  ? 27.472 36.715 -45.874 1.00 58.36  ? 53   ASN A CA  1 
ATOM   337  C C   . ASN A 1 53  ? 27.705 35.651 -44.806 1.00 59.99  ? 53   ASN A C   1 
ATOM   338  O O   . ASN A 1 53  ? 27.884 36.011 -43.645 1.00 60.77  ? 53   ASN A O   1 
ATOM   339  C CB  . ASN A 1 53  ? 25.993 36.771 -46.236 1.00 52.03  ? 53   ASN A CB  1 
ATOM   340  C CG  . ASN A 1 53  ? 25.586 37.997 -46.991 1.00 53.96  ? 53   ASN A CG  1 
ATOM   341  O OD1 . ASN A 1 53  ? 26.308 38.990 -47.047 1.00 50.27  ? 53   ASN A OD1 1 
ATOM   342  N ND2 . ASN A 1 53  ? 24.391 37.955 -47.577 1.00 41.65  ? 53   ASN A ND2 1 
ATOM   343  N N   . LEU A 1 54  ? 27.726 34.356 -45.190 1.00 54.99  ? 54   LEU A N   1 
ATOM   344  C CA  . LEU A 1 54  ? 27.947 33.240 -44.249 1.00 53.82  ? 54   LEU A CA  1 
ATOM   345  C C   . LEU A 1 54  ? 29.312 33.311 -43.558 1.00 60.06  ? 54   LEU A C   1 
ATOM   346  O O   . LEU A 1 54  ? 29.366 33.211 -42.337 1.00 59.38  ? 54   LEU A O   1 
ATOM   347  C CB  . LEU A 1 54  ? 27.698 31.861 -44.898 1.00 52.83  ? 54   LEU A CB  1 
ATOM   348  C CG  . LEU A 1 54  ? 28.169 30.604 -44.121 1.00 57.16  ? 54   LEU A CG  1 
ATOM   349  C CD1 . LEU A 1 54  ? 27.451 30.448 -42.771 1.00 56.14  ? 54   LEU A CD1 1 
ATOM   350  C CD2 . LEU A 1 54  ? 27.983 29.357 -44.959 1.00 59.84  ? 54   LEU A CD2 1 
ATOM   351  N N   . VAL A 1 55  ? 30.384 33.548 -44.328 1.00 59.97  ? 55   VAL A N   1 
ATOM   352  C CA  . VAL A 1 55  ? 31.765 33.665 -43.829 1.00 61.87  ? 55   VAL A CA  1 
ATOM   353  C C   . VAL A 1 55  ? 31.935 34.879 -42.883 1.00 70.41  ? 55   VAL A C   1 
ATOM   354  O O   . VAL A 1 55  ? 32.552 34.718 -41.824 1.00 72.42  ? 55   VAL A O   1 
ATOM   355  C CB  . VAL A 1 55  ? 32.785 33.629 -45.011 1.00 66.96  ? 55   VAL A CB  1 
ATOM   356  C CG1 . VAL A 1 55  ? 34.216 33.893 -44.555 1.00 68.09  ? 55   VAL A CG1 1 
ATOM   357  C CG2 . VAL A 1 55  ? 32.709 32.298 -45.745 1.00 66.28  ? 55   VAL A CG2 1 
ATOM   358  N N   . ARG A 1 56  ? 31.356 36.069 -43.236 1.00 67.90  ? 56   ARG A N   1 
ATOM   359  C CA  . ARG A 1 56  ? 31.428 37.312 -42.430 1.00 68.39  ? 56   ARG A CA  1 
ATOM   360  C C   . ARG A 1 56  ? 30.758 37.154 -41.072 1.00 72.78  ? 56   ARG A C   1 
ATOM   361  O O   . ARG A 1 56  ? 31.350 37.522 -40.063 1.00 73.64  ? 56   ARG A O   1 
ATOM   362  C CB  . ARG A 1 56  ? 30.828 38.527 -43.170 1.00 67.72  ? 56   ARG A CB  1 
ATOM   363  C CG  . ARG A 1 56  ? 30.764 39.799 -42.288 1.00 66.10  ? 56   ARG A CG  1 
ATOM   364  C CD  . ARG A 1 56  ? 29.905 40.929 -42.798 1.00 66.01  ? 56   ARG A CD  1 
ATOM   365  N NE  . ARG A 1 56  ? 28.874 40.516 -43.753 1.00 79.90  ? 56   ARG A NE  1 
ATOM   366  C CZ  . ARG A 1 56  ? 27.608 40.265 -43.437 1.00 92.81  ? 56   ARG A CZ  1 
ATOM   367  N NH1 . ARG A 1 56  ? 27.193 40.380 -42.180 1.00 74.37  ? 56   ARG A NH1 1 
ATOM   368  N NH2 . ARG A 1 56  ? 26.742 39.919 -44.378 1.00 79.63  ? 56   ARG A NH2 1 
ATOM   369  N N   . VAL A 1 57  ? 29.515 36.653 -41.061 1.00 69.28  ? 57   VAL A N   1 
ATOM   370  C CA  . VAL A 1 57  ? 28.730 36.381 -39.858 1.00 69.46  ? 57   VAL A CA  1 
ATOM   371  C C   . VAL A 1 57  ? 29.430 35.274 -39.038 1.00 72.37  ? 57   VAL A C   1 
ATOM   372  O O   . VAL A 1 57  ? 29.529 35.388 -37.816 1.00 71.89  ? 57   VAL A O   1 
ATOM   373  C CB  . VAL A 1 57  ? 27.284 35.998 -40.261 1.00 73.55  ? 57   VAL A CB  1 
ATOM   374  C CG1 . VAL A 1 57  ? 26.508 35.357 -39.109 1.00 73.12  ? 57   VAL A CG1 1 
ATOM   375  C CG2 . VAL A 1 57  ? 26.544 37.213 -40.802 1.00 74.42  ? 57   VAL A CG2 1 
ATOM   376  N N   . GLY A 1 58  ? 29.923 34.245 -39.733 1.00 67.73  ? 58   GLY A N   1 
ATOM   377  C CA  . GLY A 1 58  ? 30.627 33.122 -39.129 1.00 67.27  ? 58   GLY A CA  1 
ATOM   378  C C   . GLY A 1 58  ? 31.898 33.530 -38.405 1.00 72.10  ? 58   GLY A C   1 
ATOM   379  O O   . GLY A 1 58  ? 32.161 33.053 -37.292 1.00 69.76  ? 58   GLY A O   1 
ATOM   380  N N   . LYS A 1 59  ? 32.686 34.436 -39.038 1.00 70.41  ? 59   LYS A N   1 
ATOM   381  C CA  . LYS A 1 59  ? 33.917 34.983 -38.465 1.00 71.73  ? 59   LYS A CA  1 
ATOM   382  C C   . LYS A 1 59  ? 33.615 35.808 -37.208 1.00 76.88  ? 59   LYS A C   1 
ATOM   383  O O   . LYS A 1 59  ? 34.390 35.756 -36.250 1.00 77.30  ? 59   LYS A O   1 
ATOM   384  C CB  . LYS A 1 59  ? 34.706 35.798 -39.500 1.00 74.37  ? 59   LYS A CB  1 
ATOM   385  C CG  . LYS A 1 59  ? 35.611 34.918 -40.350 1.00 79.72  ? 59   LYS A CG  1 
ATOM   386  C CD  . LYS A 1 59  ? 36.301 35.668 -41.476 1.00 85.35  ? 59   LYS A CD  1 
ATOM   387  C CE  . LYS A 1 59  ? 37.111 34.716 -42.331 1.00 90.13  ? 59   LYS A CE  1 
ATOM   388  N NZ  . LYS A 1 59  ? 37.336 35.249 -43.704 1.00 100.37 ? 59   LYS A NZ  1 
ATOM   389  N N   . GLU A 1 60  ? 32.463 36.521 -37.203 1.00 73.11  ? 60   GLU A N   1 
ATOM   390  C CA  . GLU A 1 60  ? 31.989 37.339 -36.084 1.00 73.70  ? 60   GLU A CA  1 
ATOM   391  C C   . GLU A 1 60  ? 31.623 36.437 -34.910 1.00 77.06  ? 60   GLU A C   1 
ATOM   392  O O   . GLU A 1 60  ? 31.905 36.796 -33.762 1.00 78.59  ? 60   GLU A O   1 
ATOM   393  C CB  . GLU A 1 60  ? 30.783 38.210 -36.492 1.00 75.00  ? 60   GLU A CB  1 
ATOM   394  C CG  . GLU A 1 60  ? 31.147 39.451 -37.302 1.00 90.94  ? 60   GLU A CG  1 
ATOM   395  C CD  . GLU A 1 60  ? 30.046 40.147 -38.097 1.00 116.92 ? 60   GLU A CD  1 
ATOM   396  O OE1 . GLU A 1 60  ? 28.848 39.847 -37.879 1.00 111.73 ? 60   GLU A OE1 1 
ATOM   397  O OE2 . GLU A 1 60  ? 30.389 41.018 -38.931 1.00 108.38 ? 60   GLU A OE2 1 
ATOM   398  N N   . THR A 1 61  ? 31.013 35.260 -35.197 1.00 70.39  ? 61   THR A N   1 
ATOM   399  C CA  . THR A 1 61  ? 30.620 34.282 -34.180 1.00 69.22  ? 61   THR A CA  1 
ATOM   400  C C   . THR A 1 61  ? 31.866 33.697 -33.514 1.00 74.03  ? 61   THR A C   1 
ATOM   401  O O   . THR A 1 61  ? 31.931 33.684 -32.292 1.00 73.91  ? 61   THR A O   1 
ATOM   402  C CB  . THR A 1 61  ? 29.674 33.239 -34.765 1.00 75.78  ? 61   THR A CB  1 
ATOM   403  O OG1 . THR A 1 61  ? 28.503 33.908 -35.241 1.00 78.44  ? 61   THR A OG1 1 
ATOM   404  C CG2 . THR A 1 61  ? 29.288 32.166 -33.755 1.00 70.98  ? 61   THR A CG2 1 
ATOM   405  N N   . VAL A 1 62  ? 32.865 33.280 -34.325 1.00 72.13  ? 62   VAL A N   1 
ATOM   406  C CA  . VAL A 1 62  ? 34.166 32.742 -33.913 1.00 73.43  ? 62   VAL A CA  1 
ATOM   407  C C   . VAL A 1 62  ? 34.840 33.677 -32.888 1.00 79.60  ? 62   VAL A C   1 
ATOM   408  O O   . VAL A 1 62  ? 35.223 33.210 -31.815 1.00 80.23  ? 62   VAL A O   1 
ATOM   409  C CB  . VAL A 1 62  ? 35.069 32.433 -35.151 1.00 77.84  ? 62   VAL A CB  1 
ATOM   410  C CG1 . VAL A 1 62  ? 36.555 32.346 -34.776 1.00 79.42  ? 62   VAL A CG1 1 
ATOM   411  C CG2 . VAL A 1 62  ? 34.615 31.150 -35.843 1.00 76.10  ? 62   VAL A CG2 1 
ATOM   412  N N   . GLN A 1 63  ? 34.901 34.992 -33.186 1.00 76.43  ? 63   GLN A N   1 
ATOM   413  C CA  . GLN A 1 63  ? 35.501 36.001 -32.308 1.00 78.39  ? 63   GLN A CA  1 
ATOM   414  C C   . GLN A 1 63  ? 34.747 36.230 -30.996 1.00 83.78  ? 63   GLN A C   1 
ATOM   415  O O   . GLN A 1 63  ? 35.390 36.396 -29.957 1.00 86.10  ? 63   GLN A O   1 
ATOM   416  C CB  . GLN A 1 63  ? 35.708 37.339 -33.042 1.00 80.95  ? 63   GLN A CB  1 
ATOM   417  C CG  . GLN A 1 63  ? 36.689 37.283 -34.216 1.00 96.88  ? 63   GLN A CG  1 
ATOM   418  C CD  . GLN A 1 63  ? 38.131 37.156 -33.783 1.00 117.49 ? 63   GLN A CD  1 
ATOM   419  O OE1 . GLN A 1 63  ? 38.754 38.115 -33.303 1.00 117.21 ? 63   GLN A OE1 1 
ATOM   420  N NE2 . GLN A 1 63  ? 38.700 35.975 -33.977 1.00 102.78 ? 63   GLN A NE2 1 
ATOM   421  N N   . THR A 1 64  ? 33.404 36.240 -31.030 1.00 78.83  ? 64   THR A N   1 
ATOM   422  C CA  . THR A 1 64  ? 32.584 36.513 -29.841 1.00 78.75  ? 64   THR A CA  1 
ATOM   423  C C   . THR A 1 64  ? 32.299 35.337 -28.931 1.00 81.13  ? 64   THR A C   1 
ATOM   424  O O   . THR A 1 64  ? 32.159 35.555 -27.727 1.00 81.92  ? 64   THR A O   1 
ATOM   425  C CB  . THR A 1 64  ? 31.261 37.214 -30.201 1.00 87.04  ? 64   THR A CB  1 
ATOM   426  O OG1 . THR A 1 64  ? 30.421 36.314 -30.940 1.00 81.65  ? 64   THR A OG1 1 
ATOM   427  C CG2 . THR A 1 64  ? 31.469 38.557 -30.929 1.00 86.10  ? 64   THR A CG2 1 
ATOM   428  N N   . THR A 1 65  ? 32.127 34.119 -29.488 1.00 75.61  ? 65   THR A N   1 
ATOM   429  C CA  . THR A 1 65  ? 31.777 32.927 -28.703 1.00 74.10  ? 65   THR A CA  1 
ATOM   430  C C   . THR A 1 65  ? 32.771 32.549 -27.597 1.00 79.98  ? 65   THR A C   1 
ATOM   431  O O   . THR A 1 65  ? 33.970 32.818 -27.712 1.00 80.73  ? 65   THR A O   1 
ATOM   432  C CB  . THR A 1 65  ? 31.424 31.730 -29.594 1.00 76.08  ? 65   THR A CB  1 
ATOM   433  O OG1 . THR A 1 65  ? 30.784 30.739 -28.788 1.00 74.96  ? 65   THR A OG1 1 
ATOM   434  C CG2 . THR A 1 65  ? 32.642 31.123 -30.290 1.00 72.60  ? 65   THR A CG2 1 
ATOM   435  N N   . GLU A 1 66  ? 32.251 31.909 -26.542 1.00 76.85  ? 66   GLU A N   1 
ATOM   436  C CA  . GLU A 1 66  ? 33.032 31.399 -25.417 1.00 78.39  ? 66   GLU A CA  1 
ATOM   437  C C   . GLU A 1 66  ? 33.231 29.871 -25.581 1.00 81.61  ? 66   GLU A C   1 
ATOM   438  O O   . GLU A 1 66  ? 34.107 29.294 -24.935 1.00 82.16  ? 66   GLU A O   1 
ATOM   439  C CB  . GLU A 1 66  ? 32.353 31.752 -24.082 1.00 80.14  ? 66   GLU A CB  1 
ATOM   440  N N   . ASP A 1 67  ? 32.439 29.239 -26.488 1.00 76.12  ? 67   ASP A N   1 
ATOM   441  C CA  . ASP A 1 67  ? 32.492 27.808 -26.827 1.00 74.40  ? 67   ASP A CA  1 
ATOM   442  C C   . ASP A 1 67  ? 33.702 27.536 -27.730 1.00 77.25  ? 67   ASP A C   1 
ATOM   443  O O   . ASP A 1 67  ? 33.658 27.802 -28.935 1.00 76.13  ? 67   ASP A O   1 
ATOM   444  C CB  . ASP A 1 67  ? 31.174 27.372 -27.499 1.00 74.75  ? 67   ASP A CB  1 
ATOM   445  C CG  . ASP A 1 67  ? 30.967 25.880 -27.728 1.00 85.65  ? 67   ASP A CG  1 
ATOM   446  O OD1 . ASP A 1 67  ? 31.981 25.140 -27.843 1.00 87.40  ? 67   ASP A OD1 1 
ATOM   447  O OD2 . ASP A 1 67  ? 29.793 25.459 -27.859 1.00 87.73  ? 67   ASP A OD2 1 
ATOM   448  N N   . GLN A 1 68  ? 34.776 26.996 -27.119 1.00 74.66  ? 68   GLN A N   1 
ATOM   449  C CA  . GLN A 1 68  ? 36.080 26.674 -27.726 1.00 75.28  ? 68   GLN A CA  1 
ATOM   450  C C   . GLN A 1 68  ? 36.010 25.644 -28.852 1.00 77.19  ? 68   GLN A C   1 
ATOM   451  O O   . GLN A 1 68  ? 36.879 25.641 -29.728 1.00 78.27  ? 68   GLN A O   1 
ATOM   452  C CB  . GLN A 1 68  ? 37.118 26.273 -26.645 1.00 78.28  ? 68   GLN A CB  1 
ATOM   453  C CG  . GLN A 1 68  ? 37.592 27.429 -25.735 1.00 90.81  ? 68   GLN A CG  1 
ATOM   454  C CD  . GLN A 1 68  ? 38.380 28.517 -26.448 1.00 111.96 ? 68   GLN A CD  1 
ATOM   455  O OE1 . GLN A 1 68  ? 39.264 28.254 -27.275 1.00 110.61 ? 68   GLN A OE1 1 
ATOM   456  N NE2 . GLN A 1 68  ? 38.104 29.768 -26.101 1.00 100.12 ? 68   GLN A NE2 1 
ATOM   457  N N   . ILE A 1 69  ? 34.966 24.792 -28.844 1.00 71.39  ? 69   ILE A N   1 
ATOM   458  C CA  . ILE A 1 69  ? 34.719 23.798 -29.890 1.00 70.51  ? 69   ILE A CA  1 
ATOM   459  C C   . ILE A 1 69  ? 34.302 24.531 -31.191 1.00 73.17  ? 69   ILE A C   1 
ATOM   460  O O   . ILE A 1 69  ? 34.864 24.235 -32.251 1.00 73.00  ? 69   ILE A O   1 
ATOM   461  C CB  . ILE A 1 69  ? 33.746 22.681 -29.405 1.00 72.71  ? 69   ILE A CB  1 
ATOM   462  C CG1 . ILE A 1 69  ? 34.437 21.819 -28.309 1.00 74.04  ? 69   ILE A CG1 1 
ATOM   463  C CG2 . ILE A 1 69  ? 33.269 21.795 -30.561 1.00 73.05  ? 69   ILE A CG2 1 
ATOM   464  C CD1 . ILE A 1 69  ? 33.520 21.035 -27.377 1.00 79.78  ? 69   ILE A CD1 1 
ATOM   465  N N   . LEU A 1 70  ? 33.392 25.537 -31.087 1.00 68.30  ? 70   LEU A N   1 
ATOM   466  C CA  . LEU A 1 70  ? 32.972 26.361 -32.230 1.00 67.13  ? 70   LEU A CA  1 
ATOM   467  C C   . LEU A 1 70  ? 34.182 27.101 -32.817 1.00 70.63  ? 70   LEU A C   1 
ATOM   468  O O   . LEU A 1 70  ? 34.392 27.045 -34.027 1.00 69.34  ? 70   LEU A O   1 
ATOM   469  C CB  . LEU A 1 70  ? 31.878 27.373 -31.839 1.00 66.51  ? 70   LEU A CB  1 
ATOM   470  C CG  . LEU A 1 70  ? 30.519 26.825 -31.409 1.00 70.28  ? 70   LEU A CG  1 
ATOM   471  C CD1 . LEU A 1 70  ? 29.627 27.954 -30.915 1.00 70.59  ? 70   LEU A CD1 1 
ATOM   472  C CD2 . LEU A 1 70  ? 29.811 26.131 -32.549 1.00 71.35  ? 70   LEU A CD2 1 
ATOM   473  N N   . LYS A 1 71  ? 35.021 27.723 -31.943 1.00 68.01  ? 71   LYS A N   1 
ATOM   474  C CA  . LYS A 1 71  ? 36.245 28.452 -32.326 1.00 68.83  ? 71   LYS A CA  1 
ATOM   475  C C   . LYS A 1 71  ? 37.234 27.556 -33.081 1.00 72.74  ? 71   LYS A C   1 
ATOM   476  O O   . LYS A 1 71  ? 38.076 28.053 -33.829 1.00 73.94  ? 71   LYS A O   1 
ATOM   477  C CB  . LYS A 1 71  ? 36.948 29.046 -31.079 1.00 72.69  ? 71   LYS A CB  1 
ATOM   478  C CG  . LYS A 1 71  ? 36.106 30.053 -30.305 1.00 82.47  ? 71   LYS A CG  1 
ATOM   479  C CD  . LYS A 1 71  ? 36.853 30.678 -29.135 1.00 88.82  ? 71   LYS A CD  1 
ATOM   480  C CE  . LYS A 1 71  ? 37.359 32.071 -29.434 1.00 96.68  ? 71   LYS A CE  1 
ATOM   481  N NZ  . LYS A 1 71  ? 36.309 33.109 -29.220 1.00 100.04 ? 71   LYS A NZ  1 
ATOM   482  N N   . ARG A 1 72  ? 37.136 26.240 -32.851 1.00 68.42  ? 72   ARG A N   1 
ATOM   483  C CA  . ARG A 1 72  ? 37.985 25.207 -33.418 1.00 68.52  ? 72   ARG A CA  1 
ATOM   484  C C   . ARG A 1 72  ? 37.383 24.592 -34.673 1.00 69.09  ? 72   ARG A C   1 
ATOM   485  O O   . ARG A 1 72  ? 38.090 24.434 -35.652 1.00 67.90  ? 72   ARG A O   1 
ATOM   486  C CB  . ARG A 1 72  ? 38.258 24.122 -32.342 1.00 69.94  ? 72   ARG A CB  1 
ATOM   487  C CG  . ARG A 1 72  ? 39.196 22.980 -32.774 1.00 79.16  ? 72   ARG A CG  1 
ATOM   488  C CD  . ARG A 1 72  ? 39.348 21.887 -31.721 1.00 85.39  ? 72   ARG A CD  1 
ATOM   489  N NE  . ARG A 1 72  ? 38.074 21.309 -31.276 1.00 92.38  ? 72   ARG A NE  1 
ATOM   490  C CZ  . ARG A 1 72  ? 37.406 20.359 -31.925 1.00 109.95 ? 72   ARG A CZ  1 
ATOM   491  N NH1 . ARG A 1 72  ? 37.874 19.869 -33.067 1.00 104.60 ? 72   ARG A NH1 1 
ATOM   492  N NH2 . ARG A 1 72  ? 36.258 19.899 -31.443 1.00 91.66  ? 72   ARG A NH2 1 
ATOM   493  N N   . ASP A 1 73  ? 36.110 24.189 -34.632 1.00 65.73  ? 73   ASP A N   1 
ATOM   494  C CA  . ASP A 1 73  ? 35.482 23.501 -35.764 1.00 65.08  ? 73   ASP A CA  1 
ATOM   495  C C   . ASP A 1 73  ? 34.875 24.394 -36.848 1.00 68.61  ? 73   ASP A C   1 
ATOM   496  O O   . ASP A 1 73  ? 34.789 23.961 -38.004 1.00 69.45  ? 73   ASP A O   1 
ATOM   497  C CB  . ASP A 1 73  ? 34.493 22.426 -35.280 1.00 66.02  ? 73   ASP A CB  1 
ATOM   498  C CG  . ASP A 1 73  ? 35.124 21.295 -34.477 1.00 77.61  ? 73   ASP A CG  1 
ATOM   499  O OD1 . ASP A 1 73  ? 36.189 20.781 -34.898 1.00 80.32  ? 73   ASP A OD1 1 
ATOM   500  O OD2 . ASP A 1 73  ? 34.516 20.870 -33.481 1.00 81.80  ? 73   ASP A OD2 1 
ATOM   501  N N   . MET A 1 74  ? 34.442 25.616 -36.494 1.00 63.47  ? 74   MET A N   1 
ATOM   502  C CA  . MET A 1 74  ? 33.861 26.530 -37.479 1.00 62.56  ? 74   MET A CA  1 
ATOM   503  C C   . MET A 1 74  ? 34.886 27.071 -38.512 1.00 68.24  ? 74   MET A C   1 
ATOM   504  O O   . MET A 1 74  ? 34.605 26.923 -39.699 1.00 67.14  ? 74   MET A O   1 
ATOM   505  C CB  . MET A 1 74  ? 33.058 27.651 -36.820 1.00 64.08  ? 74   MET A CB  1 
ATOM   506  C CG  . MET A 1 74  ? 31.681 27.236 -36.355 1.00 66.13  ? 74   MET A CG  1 
ATOM   507  S SD  . MET A 1 74  ? 30.870 28.554 -35.388 1.00 70.55  ? 74   MET A SD  1 
ATOM   508  C CE  . MET A 1 74  ? 30.673 29.819 -36.597 1.00 67.24  ? 74   MET A CE  1 
ATOM   509  N N   . PRO A 1 75  ? 36.083 27.627 -38.134 1.00 67.08  ? 75   PRO A N   1 
ATOM   510  C CA  . PRO A 1 75  ? 37.025 28.124 -39.164 1.00 67.92  ? 75   PRO A CA  1 
ATOM   511  C C   . PRO A 1 75  ? 37.419 27.176 -40.313 1.00 70.84  ? 75   PRO A C   1 
ATOM   512  O O   . PRO A 1 75  ? 37.380 27.641 -41.453 1.00 70.11  ? 75   PRO A O   1 
ATOM   513  C CB  . PRO A 1 75  ? 38.216 28.627 -38.345 1.00 71.01  ? 75   PRO A CB  1 
ATOM   514  C CG  . PRO A 1 75  ? 37.620 28.994 -37.040 1.00 74.76  ? 75   PRO A CG  1 
ATOM   515  C CD  . PRO A 1 75  ? 36.608 27.916 -36.784 1.00 69.19  ? 75   PRO A CD  1 
ATOM   516  N N   . PRO A 1 76  ? 37.730 25.865 -40.100 1.00 67.66  ? 76   PRO A N   1 
ATOM   517  C CA  . PRO A 1 76  ? 38.058 24.996 -41.243 1.00 67.98  ? 76   PRO A CA  1 
ATOM   518  C C   . PRO A 1 76  ? 36.901 24.827 -42.225 1.00 71.18  ? 76   PRO A C   1 
ATOM   519  O O   . PRO A 1 76  ? 37.147 24.704 -43.423 1.00 72.02  ? 76   PRO A O   1 
ATOM   520  C CB  . PRO A 1 76  ? 38.423 23.660 -40.578 1.00 70.08  ? 76   PRO A CB  1 
ATOM   521  C CG  . PRO A 1 76  ? 38.778 24.002 -39.201 1.00 74.72  ? 76   PRO A CG  1 
ATOM   522  C CD  . PRO A 1 76  ? 37.841 25.105 -38.839 1.00 69.26  ? 76   PRO A CD  1 
ATOM   523  N N   . ALA A 1 77  ? 35.649 24.845 -41.723 1.00 66.83  ? 77   ALA A N   1 
ATOM   524  C CA  . ALA A 1 77  ? 34.438 24.730 -42.540 1.00 65.94  ? 77   ALA A CA  1 
ATOM   525  C C   . ALA A 1 77  ? 34.251 25.955 -43.434 1.00 70.50  ? 77   ALA A C   1 
ATOM   526  O O   . ALA A 1 77  ? 33.765 25.807 -44.554 1.00 69.70  ? 77   ALA A O   1 
ATOM   527  C CB  . ALA A 1 77  ? 33.214 24.512 -41.663 1.00 65.07  ? 77   ALA A CB  1 
ATOM   528  N N   . PHE A 1 78  ? 34.679 27.153 -42.962 1.00 68.54  ? 78   PHE A N   1 
ATOM   529  C CA  . PHE A 1 78  ? 34.619 28.391 -43.751 1.00 68.92  ? 78   PHE A CA  1 
ATOM   530  C C   . PHE A 1 78  ? 35.567 28.305 -44.911 1.00 73.74  ? 78   PHE A C   1 
ATOM   531  O O   . PHE A 1 78  ? 35.168 28.616 -46.022 1.00 73.28  ? 78   PHE A O   1 
ATOM   532  C CB  . PHE A 1 78  ? 34.949 29.634 -42.920 1.00 71.19  ? 78   PHE A CB  1 
ATOM   533  C CG  . PHE A 1 78  ? 33.994 29.891 -41.794 1.00 72.43  ? 78   PHE A CG  1 
ATOM   534  C CD1 . PHE A 1 78  ? 32.636 29.632 -41.940 1.00 74.85  ? 78   PHE A CD1 1 
ATOM   535  C CD2 . PHE A 1 78  ? 34.447 30.396 -40.581 1.00 76.39  ? 78   PHE A CD2 1 
ATOM   536  C CE1 . PHE A 1 78  ? 31.755 29.841 -40.881 1.00 75.70  ? 78   PHE A CE1 1 
ATOM   537  C CE2 . PHE A 1 78  ? 33.563 30.617 -39.529 1.00 78.77  ? 78   PHE A CE2 1 
ATOM   538  C CZ  . PHE A 1 78  ? 32.229 30.315 -39.681 1.00 75.60  ? 78   PHE A CZ  1 
ATOM   539  N N   . ILE A 1 79  ? 36.814 27.846 -44.655 1.00 72.22  ? 79   ILE A N   1 
ATOM   540  C CA  . ILE A 1 79  ? 37.853 27.640 -45.659 1.00 73.80  ? 79   ILE A CA  1 
ATOM   541  C C   . ILE A 1 79  ? 37.291 26.718 -46.745 1.00 75.40  ? 79   ILE A C   1 
ATOM   542  O O   . ILE A 1 79  ? 37.343 27.090 -47.910 1.00 76.18  ? 79   ILE A O   1 
ATOM   543  C CB  . ILE A 1 79  ? 39.170 27.110 -45.019 1.00 79.46  ? 79   ILE A CB  1 
ATOM   544  C CG1 . ILE A 1 79  ? 39.744 28.147 -44.010 1.00 80.96  ? 79   ILE A CG1 1 
ATOM   545  C CG2 . ILE A 1 79  ? 40.204 26.771 -46.109 1.00 82.59  ? 79   ILE A CG2 1 
ATOM   546  C CD1 . ILE A 1 79  ? 40.648 27.584 -42.904 1.00 90.07  ? 79   ILE A CD1 1 
ATOM   547  N N   . LYS A 1 80  ? 36.682 25.570 -46.341 1.00 69.24  ? 80   LYS A N   1 
ATOM   548  C CA  . LYS A 1 80  ? 36.011 24.577 -47.191 1.00 67.85  ? 80   LYS A CA  1 
ATOM   549  C C   . LYS A 1 80  ? 34.968 25.238 -48.130 1.00 69.33  ? 80   LYS A C   1 
ATOM   550  O O   . LYS A 1 80  ? 35.041 25.050 -49.341 1.00 69.91  ? 80   LYS A O   1 
ATOM   551  C CB  . LYS A 1 80  ? 35.300 23.549 -46.301 1.00 69.33  ? 80   LYS A CB  1 
ATOM   552  C CG  . LYS A 1 80  ? 36.009 22.227 -46.122 1.00 78.41  ? 80   LYS A CG  1 
ATOM   553  C CD  . LYS A 1 80  ? 35.114 21.280 -45.336 1.00 84.08  ? 80   LYS A CD  1 
ATOM   554  C CE  . LYS A 1 80  ? 35.733 19.918 -45.147 1.00 90.72  ? 80   LYS A CE  1 
ATOM   555  N NZ  . LYS A 1 80  ? 34.732 18.912 -44.699 1.00 94.87  ? 80   LYS A NZ  1 
ATOM   556  N N   . VAL A 1 81  ? 34.028 26.032 -47.573 1.00 63.72  ? 81   VAL A N   1 
ATOM   557  C CA  . VAL A 1 81  ? 32.981 26.717 -48.347 1.00 63.09  ? 81   VAL A CA  1 
ATOM   558  C C   . VAL A 1 81  ? 33.574 27.814 -49.263 1.00 65.09  ? 81   VAL A C   1 
ATOM   559  O O   . VAL A 1 81  ? 33.124 27.952 -50.401 1.00 64.14  ? 81   VAL A O   1 
ATOM   560  C CB  . VAL A 1 81  ? 31.829 27.229 -47.438 1.00 66.58  ? 81   VAL A CB  1 
ATOM   561  C CG1 . VAL A 1 81  ? 30.764 27.985 -48.233 1.00 66.18  ? 81   VAL A CG1 1 
ATOM   562  C CG2 . VAL A 1 81  ? 31.189 26.075 -46.680 1.00 66.00  ? 81   VAL A CG2 1 
ATOM   563  N N   . GLU A 1 82  ? 34.606 28.545 -48.779 1.00 61.75  ? 82   GLU A N   1 
ATOM   564  C CA  . GLU A 1 82  ? 35.281 29.601 -49.535 1.00 63.12  ? 82   GLU A CA  1 
ATOM   565  C C   . GLU A 1 82  ? 36.011 29.018 -50.729 1.00 66.02  ? 82   GLU A C   1 
ATOM   566  O O   . GLU A 1 82  ? 35.831 29.502 -51.838 1.00 64.85  ? 82   GLU A O   1 
ATOM   567  C CB  . GLU A 1 82  ? 36.275 30.376 -48.657 1.00 65.98  ? 82   GLU A CB  1 
ATOM   568  C CG  . GLU A 1 82  ? 35.637 31.407 -47.746 1.00 81.74  ? 82   GLU A CG  1 
ATOM   569  C CD  . GLU A 1 82  ? 36.624 32.141 -46.857 1.00 110.17 ? 82   GLU A CD  1 
ATOM   570  O OE1 . GLU A 1 82  ? 37.027 31.573 -45.816 1.00 101.01 ? 82   GLU A OE1 1 
ATOM   571  O OE2 . GLU A 1 82  ? 36.993 33.287 -47.201 1.00 109.66 ? 82   GLU A OE2 1 
ATOM   572  N N   . ASN A 1 83  ? 36.817 27.966 -50.506 1.00 63.65  ? 83   ASN A N   1 
ATOM   573  C CA  . ASN A 1 83  ? 37.587 27.317 -51.566 1.00 65.13  ? 83   ASN A CA  1 
ATOM   574  C C   . ASN A 1 83  ? 36.678 26.709 -52.643 1.00 67.22  ? 83   ASN A C   1 
ATOM   575  O O   . ASN A 1 83  ? 36.961 26.836 -53.832 1.00 66.72  ? 83   ASN A O   1 
ATOM   576  C CB  . ASN A 1 83  ? 38.549 26.268 -50.976 1.00 64.87  ? 83   ASN A CB  1 
ATOM   577  C CG  . ASN A 1 83  ? 39.709 26.849 -50.196 1.00 87.04  ? 83   ASN A CG  1 
ATOM   578  O OD1 . ASN A 1 83  ? 39.921 28.065 -50.133 1.00 74.78  ? 83   ASN A OD1 1 
ATOM   579  N ND2 . ASN A 1 83  ? 40.498 25.981 -49.580 1.00 86.26  ? 83   ASN A ND2 1 
ATOM   580  N N   . ALA A 1 84  ? 35.577 26.073 -52.210 1.00 63.26  ? 84   ALA A N   1 
ATOM   581  C CA  . ALA A 1 84  ? 34.595 25.444 -53.088 1.00 63.20  ? 84   ALA A CA  1 
ATOM   582  C C   . ALA A 1 84  ? 33.923 26.503 -53.952 1.00 67.26  ? 84   ALA A C   1 
ATOM   583  O O   . ALA A 1 84  ? 33.727 26.273 -55.135 1.00 68.35  ? 84   ALA A O   1 
ATOM   584  C CB  . ALA A 1 84  ? 33.566 24.703 -52.258 1.00 62.80  ? 84   ALA A CB  1 
ATOM   585  N N   . CYS A 1 85  ? 33.624 27.681 -53.371 1.00 62.99  ? 85   CYS A N   1 
ATOM   586  C CA  . CYS A 1 85  ? 33.034 28.817 -54.084 1.00 62.18  ? 85   CYS A CA  1 
ATOM   587  C C   . CYS A 1 85  ? 34.015 29.344 -55.142 1.00 66.84  ? 85   CYS A C   1 
ATOM   588  O O   . CYS A 1 85  ? 33.590 29.675 -56.249 1.00 65.82  ? 85   CYS A O   1 
ATOM   589  C CB  . CYS A 1 85  ? 32.620 29.911 -53.106 1.00 61.29  ? 85   CYS A CB  1 
ATOM   590  S SG  . CYS A 1 85  ? 31.647 31.233 -53.855 1.00 64.85  ? 85   CYS A SG  1 
ATOM   591  N N   . THR A 1 86  ? 35.326 29.375 -54.819 1.00 65.23  ? 86   THR A N   1 
ATOM   592  C CA  . THR A 1 86  ? 36.385 29.790 -55.754 1.00 67.20  ? 86   THR A CA  1 
ATOM   593  C C   . THR A 1 86  ? 36.368 28.873 -57.002 1.00 71.43  ? 86   THR A C   1 
ATOM   594  O O   . THR A 1 86  ? 36.415 29.377 -58.125 1.00 72.92  ? 86   THR A O   1 
ATOM   595  C CB  . THR A 1 86  ? 37.750 29.850 -55.027 1.00 77.97  ? 86   THR A CB  1 
ATOM   596  O OG1 . THR A 1 86  ? 37.647 30.759 -53.925 1.00 76.75  ? 86   THR A OG1 1 
ATOM   597  C CG2 . THR A 1 86  ? 38.899 30.275 -55.948 1.00 75.59  ? 86   THR A CG2 1 
ATOM   598  N N   . LYS A 1 87  ? 36.238 27.542 -56.794 1.00 66.79  ? 87   LYS A N   1 
ATOM   599  C CA  . LYS A 1 87  ? 36.140 26.541 -57.858 1.00 67.38  ? 87   LYS A CA  1 
ATOM   600  C C   . LYS A 1 87  ? 34.879 26.791 -58.713 1.00 71.31  ? 87   LYS A C   1 
ATOM   601  O O   . LYS A 1 87  ? 34.943 26.677 -59.940 1.00 72.82  ? 87   LYS A O   1 
ATOM   602  C CB  . LYS A 1 87  ? 36.148 25.120 -57.278 1.00 70.17  ? 87   LYS A CB  1 
ATOM   603  N N   . LEU A 1 88  ? 33.759 27.198 -58.076 1.00 65.15  ? 88   LEU A N   1 
ATOM   604  C CA  . LEU A 1 88  ? 32.515 27.518 -58.787 1.00 63.91  ? 88   LEU A CA  1 
ATOM   605  C C   . LEU A 1 88  ? 32.650 28.765 -59.672 1.00 66.11  ? 88   LEU A C   1 
ATOM   606  O O   . LEU A 1 88  ? 32.122 28.771 -60.781 1.00 64.04  ? 88   LEU A O   1 
ATOM   607  C CB  . LEU A 1 88  ? 31.327 27.691 -57.811 1.00 62.30  ? 88   LEU A CB  1 
ATOM   608  C CG  . LEU A 1 88  ? 30.753 26.437 -57.143 1.00 66.79  ? 88   LEU A CG  1 
ATOM   609  C CD1 . LEU A 1 88  ? 29.553 26.801 -56.299 1.00 65.81  ? 88   LEU A CD1 1 
ATOM   610  C CD2 . LEU A 1 88  ? 30.338 25.363 -58.173 1.00 68.70  ? 88   LEU A CD2 1 
ATOM   611  N N   . VAL A 1 89  ? 33.337 29.821 -59.161 1.00 64.11  ? 89   VAL A N   1 
ATOM   612  C CA  . VAL A 1 89  ? 33.600 31.093 -59.858 1.00 65.21  ? 89   VAL A CA  1 
ATOM   613  C C   . VAL A 1 89  ? 34.508 30.823 -61.054 1.00 70.48  ? 89   VAL A C   1 
ATOM   614  O O   . VAL A 1 89  ? 34.317 31.430 -62.096 1.00 71.09  ? 89   VAL A O   1 
ATOM   615  C CB  . VAL A 1 89  ? 34.155 32.204 -58.907 1.00 69.11  ? 89   VAL A CB  1 
ATOM   616  C CG1 . VAL A 1 89  ? 34.510 33.492 -59.663 1.00 69.28  ? 89   VAL A CG1 1 
ATOM   617  C CG2 . VAL A 1 89  ? 33.156 32.516 -57.800 1.00 67.51  ? 89   VAL A CG2 1 
ATOM   618  N N   . GLN A 1 90  ? 35.447 29.873 -60.922 1.00 69.47  ? 90   GLN A N   1 
ATOM   619  C CA  . GLN A 1 90  ? 36.340 29.466 -62.017 1.00 71.37  ? 90   GLN A CA  1 
ATOM   620  C C   . GLN A 1 90  ? 35.574 28.742 -63.129 1.00 75.23  ? 90   GLN A C   1 
ATOM   621  O O   . GLN A 1 90  ? 35.794 29.050 -64.297 1.00 78.81  ? 90   GLN A O   1 
ATOM   622  C CB  . GLN A 1 90  ? 37.488 28.598 -61.500 1.00 73.85  ? 90   GLN A CB  1 
ATOM   623  C CG  . GLN A 1 90  ? 38.633 29.410 -60.933 1.00 95.44  ? 90   GLN A CG  1 
ATOM   624  C CD  . GLN A 1 90  ? 39.793 28.524 -60.570 1.00 122.87 ? 90   GLN A CD  1 
ATOM   625  O OE1 . GLN A 1 90  ? 39.919 28.063 -59.429 1.00 118.19 ? 90   GLN A OE1 1 
ATOM   626  N NE2 . GLN A 1 90  ? 40.666 28.263 -61.539 1.00 120.48 ? 90   GLN A NE2 1 
ATOM   627  N N   . ALA A 1 91  ? 34.655 27.824 -62.770 1.00 69.26  ? 91   ALA A N   1 
ATOM   628  C CA  . ALA A 1 91  ? 33.813 27.071 -63.706 1.00 69.64  ? 91   ALA A CA  1 
ATOM   629  C C   . ALA A 1 91  ? 32.908 27.989 -64.540 1.00 75.40  ? 91   ALA A C   1 
ATOM   630  O O   . ALA A 1 91  ? 32.761 27.751 -65.741 1.00 77.50  ? 91   ALA A O   1 
ATOM   631  C CB  . ALA A 1 91  ? 32.975 26.057 -62.952 1.00 69.60  ? 91   ALA A CB  1 
ATOM   632  N N   . ALA A 1 92  ? 32.341 29.058 -63.927 1.00 71.31  ? 92   ALA A N   1 
ATOM   633  C CA  . ALA A 1 92  ? 31.469 30.018 -64.625 1.00 71.80  ? 92   ALA A CA  1 
ATOM   634  C C   . ALA A 1 92  ? 32.259 30.886 -65.595 1.00 78.69  ? 92   ALA A C   1 
ATOM   635  O O   . ALA A 1 92  ? 31.748 31.238 -66.664 1.00 78.53  ? 92   ALA A O   1 
ATOM   636  C CB  . ALA A 1 92  ? 30.731 30.892 -63.629 1.00 71.01  ? 92   ALA A CB  1 
ATOM   637  N N   . GLN A 1 93  ? 33.511 31.227 -65.215 1.00 77.86  ? 93   GLN A N   1 
ATOM   638  C CA  . GLN A 1 93  ? 34.431 32.015 -66.041 1.00 79.37  ? 93   GLN A CA  1 
ATOM   639  C C   . GLN A 1 93  ? 34.903 31.160 -67.218 1.00 84.97  ? 93   GLN A C   1 
ATOM   640  O O   . GLN A 1 93  ? 35.064 31.695 -68.306 1.00 85.41  ? 93   GLN A O   1 
ATOM   641  C CB  . GLN A 1 93  ? 35.612 32.554 -65.211 1.00 80.64  ? 93   GLN A CB  1 
ATOM   642  C CG  . GLN A 1 93  ? 35.248 33.826 -64.430 1.00 93.86  ? 93   GLN A CG  1 
ATOM   643  C CD  . GLN A 1 93  ? 36.115 34.131 -63.217 1.00 111.24 ? 93   GLN A CD  1 
ATOM   644  O OE1 . GLN A 1 93  ? 37.169 33.520 -62.971 1.00 110.17 ? 93   GLN A OE1 1 
ATOM   645  N NE2 . GLN A 1 93  ? 35.690 35.113 -62.431 1.00 94.41  ? 93   GLN A NE2 1 
ATOM   646  N N   . MET A 1 94  ? 35.062 29.828 -67.012 1.00 82.36  ? 94   MET A N   1 
ATOM   647  C CA  . MET A 1 94  ? 35.443 28.874 -68.061 1.00 84.27  ? 94   MET A CA  1 
ATOM   648  C C   . MET A 1 94  ? 34.320 28.681 -69.076 1.00 88.84  ? 94   MET A C   1 
ATOM   649  O O   . MET A 1 94  ? 34.577 28.749 -70.276 1.00 89.74  ? 94   MET A O   1 
ATOM   650  C CB  . MET A 1 94  ? 35.832 27.515 -67.468 1.00 87.28  ? 94   MET A CB  1 
ATOM   651  C CG  . MET A 1 94  ? 37.233 27.472 -66.934 1.00 92.06  ? 94   MET A CG  1 
ATOM   652  S SD  . MET A 1 94  ? 37.571 25.927 -66.057 1.00 97.64  ? 94   MET A SD  1 
ATOM   653  C CE  . MET A 1 94  ? 39.061 26.379 -65.212 1.00 94.87  ? 94   MET A CE  1 
ATOM   654  N N   . LEU A 1 95  ? 33.081 28.441 -68.594 1.00 85.23  ? 95   LEU A N   1 
ATOM   655  C CA  . LEU A 1 95  ? 31.891 28.225 -69.432 1.00 85.89  ? 95   LEU A CA  1 
ATOM   656  C C   . LEU A 1 95  ? 31.449 29.439 -70.256 1.00 90.40  ? 95   LEU A C   1 
ATOM   657  O O   . LEU A 1 95  ? 30.833 29.265 -71.309 1.00 90.20  ? 95   LEU A O   1 
ATOM   658  C CB  . LEU A 1 95  ? 30.719 27.614 -68.641 1.00 84.81  ? 95   LEU A CB  1 
ATOM   659  C CG  . LEU A 1 95  ? 30.923 26.166 -68.204 1.00 89.84  ? 95   LEU A CG  1 
ATOM   660  C CD1 . LEU A 1 95  ? 30.178 25.865 -66.923 1.00 88.94  ? 95   LEU A CD1 1 
ATOM   661  C CD2 . LEU A 1 95  ? 30.568 25.189 -69.297 1.00 91.30  ? 95   LEU A CD2 1 
ATOM   662  N N   . GLN A 1 96  ? 31.776 30.659 -69.783 1.00 87.16  ? 96   GLN A N   1 
ATOM   663  C CA  . GLN A 1 96  ? 31.479 31.919 -70.466 1.00 87.48  ? 96   GLN A CA  1 
ATOM   664  C C   . GLN A 1 96  ? 32.346 31.995 -71.728 1.00 93.70  ? 96   GLN A C   1 
ATOM   665  O O   . GLN A 1 96  ? 31.879 32.459 -72.769 1.00 94.41  ? 96   GLN A O   1 
ATOM   666  C CB  . GLN A 1 96  ? 31.777 33.101 -69.535 1.00 87.74  ? 96   GLN A CB  1 
ATOM   667  C CG  . GLN A 1 96  ? 30.862 34.300 -69.738 1.00 105.38 ? 96   GLN A CG  1 
ATOM   668  C CD  . GLN A 1 96  ? 30.949 35.319 -68.619 1.00 127.73 ? 96   GLN A CD  1 
ATOM   669  O OE1 . GLN A 1 96  ? 31.900 35.355 -67.818 1.00 123.29 ? 96   GLN A OE1 1 
ATOM   670  N NE2 . GLN A 1 96  ? 29.950 36.186 -68.548 1.00 121.44 ? 96   GLN A NE2 1 
ATOM   671  N N   . SER A 1 97  ? 33.590 31.477 -71.635 1.00 90.84  ? 97   SER A N   1 
ATOM   672  C CA  . SER A 1 97  ? 34.576 31.410 -72.721 1.00 92.18  ? 97   SER A CA  1 
ATOM   673  C C   . SER A 1 97  ? 34.358 30.155 -73.582 1.00 95.76  ? 97   SER A C   1 
ATOM   674  O O   . SER A 1 97  ? 34.566 30.207 -74.794 1.00 97.33  ? 97   SER A O   1 
ATOM   675  C CB  . SER A 1 97  ? 35.996 31.396 -72.153 1.00 96.77  ? 97   SER A CB  1 
ATOM   676  O OG  . SER A 1 97  ? 36.174 32.298 -71.070 1.00 103.12 ? 97   SER A OG  1 
ATOM   677  N N   . ASP A 1 98  ? 33.961 29.030 -72.952 1.00 89.92  ? 98   ASP A N   1 
ATOM   678  C CA  . ASP A 1 98  ? 33.719 27.753 -73.625 1.00 90.46  ? 98   ASP A CA  1 
ATOM   679  C C   . ASP A 1 98  ? 32.534 27.019 -72.973 1.00 92.52  ? 98   ASP A C   1 
ATOM   680  O O   . ASP A 1 98  ? 32.710 26.435 -71.902 1.00 91.69  ? 98   ASP A O   1 
ATOM   681  C CB  . ASP A 1 98  ? 34.998 26.884 -73.620 1.00 93.08  ? 98   ASP A CB  1 
ATOM   682  C CG  . ASP A 1 98  ? 34.896 25.500 -74.261 1.00 96.71  ? 98   ASP A CG  1 
ATOM   683  O OD1 . ASP A 1 98  ? 33.899 25.235 -74.971 1.00 96.82  ? 98   ASP A OD1 1 
ATOM   684  O OD2 . ASP A 1 98  ? 35.820 24.698 -74.073 1.00 100.56 ? 98   ASP A OD2 1 
ATOM   685  N N   . PRO A 1 99  ? 31.339 26.991 -73.620 1.00 87.91  ? 99   PRO A N   1 
ATOM   686  C CA  . PRO A 1 99  ? 30.179 26.310 -73.003 1.00 86.80  ? 99   PRO A CA  1 
ATOM   687  C C   . PRO A 1 99  ? 30.258 24.782 -72.951 1.00 90.94  ? 99   PRO A C   1 
ATOM   688  O O   . PRO A 1 99  ? 29.448 24.151 -72.267 1.00 89.04  ? 99   PRO A O   1 
ATOM   689  C CB  . PRO A 1 99  ? 28.987 26.782 -73.854 1.00 89.19  ? 99   PRO A CB  1 
ATOM   690  C CG  . PRO A 1 99  ? 29.514 27.895 -74.728 1.00 93.69  ? 99   PRO A CG  1 
ATOM   691  C CD  . PRO A 1 99  ? 30.967 27.628 -74.899 1.00 90.00  ? 99   PRO A CD  1 
ATOM   692  N N   . TYR A 1 100 ? 31.224 24.195 -73.681 1.00 89.28  ? 100  TYR A N   1 
ATOM   693  C CA  . TYR A 1 100 ? 31.448 22.752 -73.800 1.00 90.83  ? 100  TYR A CA  1 
ATOM   694  C C   . TYR A 1 100 ? 32.669 22.285 -72.991 1.00 95.08  ? 100  TYR A C   1 
ATOM   695  O O   . TYR A 1 100 ? 33.017 21.103 -73.048 1.00 96.99  ? 100  TYR A O   1 
ATOM   696  C CB  . TYR A 1 100 ? 31.605 22.377 -75.294 1.00 94.78  ? 100  TYR A CB  1 
ATOM   697  C CG  . TYR A 1 100 ? 30.417 22.764 -76.149 1.00 96.36  ? 100  TYR A CG  1 
ATOM   698  C CD1 . TYR A 1 100 ? 30.382 23.987 -76.817 1.00 97.21  ? 100  TYR A CD1 1 
ATOM   699  C CD2 . TYR A 1 100 ? 29.321 21.915 -76.282 1.00 98.38  ? 100  TYR A CD2 1 
ATOM   700  C CE1 . TYR A 1 100 ? 29.280 24.360 -77.585 1.00 97.82  ? 100  TYR A CE1 1 
ATOM   701  C CE2 . TYR A 1 100 ? 28.223 22.269 -77.064 1.00 99.80  ? 100  TYR A CE2 1 
ATOM   702  C CZ  . TYR A 1 100 ? 28.202 23.497 -77.705 1.00 105.96 ? 100  TYR A CZ  1 
ATOM   703  O OH  . TYR A 1 100 ? 27.107 23.860 -78.450 1.00 109.42 ? 100  TYR A OH  1 
ATOM   704  N N   . SER A 1 101 ? 33.303 23.211 -72.228 1.00 90.24  ? 101  SER A N   1 
ATOM   705  C CA  . SER A 1 101 ? 34.496 22.984 -71.396 1.00 90.23  ? 101  SER A CA  1 
ATOM   706  C C   . SER A 1 101 ? 34.370 21.798 -70.441 1.00 95.00  ? 101  SER A C   1 
ATOM   707  O O   . SER A 1 101 ? 33.367 21.665 -69.737 1.00 93.06  ? 101  SER A O   1 
ATOM   708  C CB  . SER A 1 101 ? 34.871 24.250 -70.629 1.00 91.56  ? 101  SER A CB  1 
ATOM   709  O OG  . SER A 1 101 ? 36.010 24.066 -69.804 1.00 98.39  ? 101  SER A OG  1 
ATOM   710  N N   . VAL A 1 102 ? 35.406 20.948 -70.431 1.00 94.34  ? 102  VAL A N   1 
ATOM   711  C CA  . VAL A 1 102 ? 35.513 19.728 -69.618 1.00 95.15  ? 102  VAL A CA  1 
ATOM   712  C C   . VAL A 1 102 ? 35.934 19.978 -68.138 1.00 96.83  ? 102  VAL A C   1 
ATOM   713  O O   . VAL A 1 102 ? 35.286 19.396 -67.259 1.00 94.28  ? 102  VAL A O   1 
ATOM   714  C CB  . VAL A 1 102 ? 36.374 18.633 -70.310 1.00 102.35 ? 102  VAL A CB  1 
ATOM   715  C CG1 . VAL A 1 102 ? 36.138 17.264 -69.679 1.00 103.10 ? 102  VAL A CG1 1 
ATOM   716  C CG2 . VAL A 1 102 ? 36.101 18.582 -71.814 1.00 104.34 ? 102  VAL A CG2 1 
ATOM   717  N N   . PRO A 1 103 ? 36.996 20.785 -67.815 1.00 93.99  ? 103  PRO A N   1 
ATOM   718  C CA  . PRO A 1 103 ? 37.354 20.976 -66.393 1.00 92.36  ? 103  PRO A CA  1 
ATOM   719  C C   . PRO A 1 103 ? 36.292 21.763 -65.638 1.00 92.80  ? 103  PRO A C   1 
ATOM   720  O O   . PRO A 1 103 ? 36.168 21.596 -64.427 1.00 90.92  ? 103  PRO A O   1 
ATOM   721  C CB  . PRO A 1 103 ? 38.690 21.736 -66.440 1.00 94.82  ? 103  PRO A CB  1 
ATOM   722  C CG  . PRO A 1 103 ? 39.138 21.696 -67.870 1.00 101.54 ? 103  PRO A CG  1 
ATOM   723  C CD  . PRO A 1 103 ? 37.901 21.564 -68.689 1.00 96.85  ? 103  PRO A CD  1 
ATOM   724  N N   . ALA A 1 104 ? 35.516 22.601 -66.367 1.00 88.00  ? 104  ALA A N   1 
ATOM   725  C CA  . ALA A 1 104 ? 34.415 23.396 -65.831 1.00 85.13  ? 104  ALA A CA  1 
ATOM   726  C C   . ALA A 1 104 ? 33.352 22.484 -65.200 1.00 87.46  ? 104  ALA A C   1 
ATOM   727  O O   . ALA A 1 104 ? 32.893 22.770 -64.090 1.00 85.69  ? 104  ALA A O   1 
ATOM   728  C CB  . ALA A 1 104 ? 33.804 24.252 -66.929 1.00 85.89  ? 104  ALA A CB  1 
ATOM   729  N N   . ARG A 1 105 ? 33.011 21.363 -65.879 1.00 84.33  ? 105  ARG A N   1 
ATOM   730  C CA  . ARG A 1 105 ? 32.043 20.365 -65.410 1.00 83.53  ? 105  ARG A CA  1 
ATOM   731  C C   . ARG A 1 105 ? 32.556 19.636 -64.150 1.00 84.61  ? 105  ARG A C   1 
ATOM   732  O O   . ARG A 1 105 ? 31.757 19.263 -63.288 1.00 81.83  ? 105  ARG A O   1 
ATOM   733  C CB  . ARG A 1 105 ? 31.688 19.378 -66.539 1.00 86.85  ? 105  ARG A CB  1 
ATOM   734  N N   . ASP A 1 106 ? 33.889 19.482 -64.030 1.00 81.50  ? 106  ASP A N   1 
ATOM   735  C CA  . ASP A 1 106 ? 34.541 18.874 -62.868 1.00 81.29  ? 106  ASP A CA  1 
ATOM   736  C C   . ASP A 1 106 ? 34.604 19.876 -61.711 1.00 82.07  ? 106  ASP A C   1 
ATOM   737  O O   . ASP A 1 106 ? 34.366 19.492 -60.567 1.00 79.02  ? 106  ASP A O   1 
ATOM   738  C CB  . ASP A 1 106 ? 35.955 18.384 -63.220 1.00 85.52  ? 106  ASP A CB  1 
ATOM   739  C CG  . ASP A 1 106 ? 35.973 17.135 -64.069 1.00 97.59  ? 106  ASP A CG  1 
ATOM   740  O OD1 . ASP A 1 106 ? 35.604 16.056 -63.545 1.00 98.87  ? 106  ASP A OD1 1 
ATOM   741  O OD2 . ASP A 1 106 ? 36.378 17.227 -65.251 1.00 102.74 ? 106  ASP A OD2 1 
ATOM   742  N N   . TYR A 1 107 ? 34.922 21.156 -62.023 1.00 78.98  ? 107  TYR A N   1 
ATOM   743  C CA  . TYR A 1 107 ? 35.004 22.279 -61.076 1.00 77.81  ? 107  TYR A CA  1 
ATOM   744  C C   . TYR A 1 107 ? 33.626 22.598 -60.470 1.00 78.06  ? 107  TYR A C   1 
ATOM   745  O O   . TYR A 1 107 ? 33.563 23.107 -59.355 1.00 75.08  ? 107  TYR A O   1 
ATOM   746  C CB  . TYR A 1 107 ? 35.587 23.536 -61.765 1.00 80.26  ? 107  TYR A CB  1 
ATOM   747  C CG  . TYR A 1 107 ? 37.099 23.651 -61.751 1.00 85.28  ? 107  TYR A CG  1 
ATOM   748  C CD1 . TYR A 1 107 ? 37.908 22.517 -61.773 1.00 89.96  ? 107  TYR A CD1 1 
ATOM   749  C CD2 . TYR A 1 107 ? 37.722 24.895 -61.784 1.00 86.17  ? 107  TYR A CD2 1 
ATOM   750  C CE1 . TYR A 1 107 ? 39.298 22.617 -61.795 1.00 93.55  ? 107  TYR A CE1 1 
ATOM   751  C CE2 . TYR A 1 107 ? 39.114 25.009 -61.805 1.00 89.03  ? 107  TYR A CE2 1 
ATOM   752  C CZ  . TYR A 1 107 ? 39.898 23.866 -61.811 1.00 100.73 ? 107  TYR A CZ  1 
ATOM   753  O OH  . TYR A 1 107 ? 41.271 23.962 -61.839 1.00 105.42 ? 107  TYR A OH  1 
ATOM   754  N N   . LEU A 1 108 ? 32.537 22.305 -61.215 1.00 75.27  ? 108  LEU A N   1 
ATOM   755  C CA  . LEU A 1 108 ? 31.158 22.488 -60.773 1.00 74.18  ? 108  LEU A CA  1 
ATOM   756  C C   . LEU A 1 108 ? 30.842 21.409 -59.756 1.00 78.19  ? 108  LEU A C   1 
ATOM   757  O O   . LEU A 1 108 ? 30.329 21.727 -58.688 1.00 76.71  ? 108  LEU A O   1 
ATOM   758  C CB  . LEU A 1 108 ? 30.175 22.405 -61.955 1.00 75.37  ? 108  LEU A CB  1 
ATOM   759  C CG  . LEU A 1 108 ? 29.917 23.703 -62.710 1.00 79.97  ? 108  LEU A CG  1 
ATOM   760  C CD1 . LEU A 1 108 ? 29.380 23.417 -64.093 1.00 82.02  ? 108  LEU A CD1 1 
ATOM   761  C CD2 . LEU A 1 108 ? 28.957 24.598 -61.957 1.00 80.51  ? 108  LEU A CD2 1 
ATOM   762  N N   . ILE A 1 109 ? 31.187 20.140 -60.075 1.00 76.37  ? 109  ILE A N   1 
ATOM   763  C CA  . ILE A 1 109 ? 31.015 18.978 -59.200 1.00 76.64  ? 109  ILE A CA  1 
ATOM   764  C C   . ILE A 1 109 ? 31.825 19.186 -57.912 1.00 78.41  ? 109  ILE A C   1 
ATOM   765  O O   . ILE A 1 109 ? 31.276 19.025 -56.824 1.00 77.21  ? 109  ILE A O   1 
ATOM   766  C CB  . ILE A 1 109 ? 31.410 17.661 -59.942 1.00 82.83  ? 109  ILE A CB  1 
ATOM   767  C CG1 . ILE A 1 109 ? 30.391 17.276 -61.048 1.00 85.21  ? 109  ILE A CG1 1 
ATOM   768  C CG2 . ILE A 1 109 ? 31.720 16.487 -58.979 1.00 84.01  ? 109  ILE A CG2 1 
ATOM   769  C CD1 . ILE A 1 109 ? 29.053 16.688 -60.586 1.00 94.96  ? 109  ILE A CD1 1 
ATOM   770  N N   . ASP A 1 110 ? 33.119 19.549 -58.045 1.00 74.93  ? 110  ASP A N   1 
ATOM   771  C CA  . ASP A 1 110 ? 34.025 19.780 -56.916 1.00 74.36  ? 110  ASP A CA  1 
ATOM   772  C C   . ASP A 1 110 ? 33.586 20.957 -56.025 1.00 73.80  ? 110  ASP A C   1 
ATOM   773  O O   . ASP A 1 110 ? 33.670 20.861 -54.796 1.00 71.02  ? 110  ASP A O   1 
ATOM   774  C CB  . ASP A 1 110 ? 35.488 19.907 -57.381 1.00 78.33  ? 110  ASP A CB  1 
ATOM   775  C CG  . ASP A 1 110 ? 36.174 18.557 -57.578 1.00 98.89  ? 110  ASP A CG  1 
ATOM   776  O OD1 . ASP A 1 110 ? 36.647 17.976 -56.570 1.00 101.61 ? 110  ASP A OD1 1 
ATOM   777  O OD2 . ASP A 1 110 ? 36.234 18.079 -58.739 1.00 105.78 ? 110  ASP A OD2 1 
ATOM   778  N N   . GLY A 1 111 ? 33.099 22.024 -56.661 1.00 68.49  ? 111  GLY A N   1 
ATOM   779  C CA  . GLY A 1 111 ? 32.592 23.209 -55.981 1.00 66.09  ? 111  GLY A CA  1 
ATOM   780  C C   . GLY A 1 111 ? 31.297 22.927 -55.245 1.00 68.12  ? 111  GLY A C   1 
ATOM   781  O O   . GLY A 1 111 ? 31.136 23.352 -54.098 1.00 66.96  ? 111  GLY A O   1 
ATOM   782  N N   . SER A 1 112 ? 30.385 22.157 -55.878 1.00 63.83  ? 112  SER A N   1 
ATOM   783  C CA  . SER A 1 112 ? 29.102 21.764 -55.280 1.00 61.93  ? 112  SER A CA  1 
ATOM   784  C C   . SER A 1 112 ? 29.330 20.867 -54.065 1.00 65.25  ? 112  SER A C   1 
ATOM   785  O O   . SER A 1 112 ? 28.795 21.159 -52.985 1.00 63.16  ? 112  SER A O   1 
ATOM   786  C CB  . SER A 1 112 ? 28.217 21.068 -56.310 1.00 63.95  ? 112  SER A CB  1 
ATOM   787  O OG  . SER A 1 112 ? 28.009 21.921 -57.424 1.00 66.34  ? 112  SER A OG  1 
ATOM   788  N N   . ARG A 1 113 ? 30.176 19.816 -54.230 1.00 62.63  ? 113  ARG A N   1 
ATOM   789  C CA  . ARG A 1 113 ? 30.535 18.873 -53.159 1.00 62.63  ? 113  ARG A CA  1 
ATOM   790  C C   . ARG A 1 113 ? 31.144 19.572 -51.943 1.00 65.43  ? 113  ARG A C   1 
ATOM   791  O O   . ARG A 1 113 ? 30.750 19.278 -50.810 1.00 63.82  ? 113  ARG A O   1 
ATOM   792  C CB  . ARG A 1 113 ? 31.491 17.782 -53.676 1.00 62.86  ? 113  ARG A CB  1 
ATOM   793  C CG  . ARG A 1 113 ? 30.795 16.680 -54.471 1.00 72.93  ? 113  ARG A CG  1 
ATOM   794  C CD  . ARG A 1 113 ? 31.798 15.719 -55.079 1.00 79.94  ? 113  ARG A CD  1 
ATOM   795  N NE  . ARG A 1 113 ? 31.277 14.352 -55.119 1.00 88.99  ? 113  ARG A NE  1 
ATOM   796  C CZ  . ARG A 1 113 ? 31.675 13.422 -55.984 1.00 103.26 ? 113  ARG A CZ  1 
ATOM   797  N NH1 . ARG A 1 113 ? 32.597 13.705 -56.898 1.00 86.03  ? 113  ARG A NH1 1 
ATOM   798  N NH2 . ARG A 1 113 ? 31.140 12.208 -55.955 1.00 89.18  ? 113  ARG A NH2 1 
ATOM   799  N N   . GLY A 1 114 ? 32.078 20.492 -52.193 1.00 61.88  ? 114  GLY A N   1 
ATOM   800  C CA  . GLY A 1 114 ? 32.761 21.239 -51.143 1.00 60.92  ? 114  GLY A CA  1 
ATOM   801  C C   . GLY A 1 114 ? 31.851 22.175 -50.370 1.00 63.74  ? 114  GLY A C   1 
ATOM   802  O O   . GLY A 1 114 ? 31.985 22.282 -49.144 1.00 63.80  ? 114  GLY A O   1 
ATOM   803  N N   . ILE A 1 115 ? 30.928 22.879 -51.073 1.00 58.50  ? 115  ILE A N   1 
ATOM   804  C CA  . ILE A 1 115 ? 29.983 23.780 -50.411 1.00 56.84  ? 115  ILE A CA  1 
ATOM   805  C C   . ILE A 1 115 ? 29.055 22.955 -49.515 1.00 62.63  ? 115  ILE A C   1 
ATOM   806  O O   . ILE A 1 115 ? 28.895 23.291 -48.340 1.00 61.53  ? 115  ILE A O   1 
ATOM   807  C CB  . ILE A 1 115 ? 29.226 24.720 -51.383 1.00 59.31  ? 115  ILE A CB  1 
ATOM   808  C CG1 . ILE A 1 115 ? 30.176 25.817 -51.922 1.00 60.15  ? 115  ILE A CG1 1 
ATOM   809  C CG2 . ILE A 1 115 ? 28.011 25.352 -50.691 1.00 58.24  ? 115  ILE A CG2 1 
ATOM   810  C CD1 . ILE A 1 115 ? 29.560 26.898 -52.725 1.00 61.17  ? 115  ILE A CD1 1 
ATOM   811  N N   . LEU A 1 116 ? 28.487 21.854 -50.061 1.00 61.44  ? 116  LEU A N   1 
ATOM   812  C CA  . LEU A 1 116 ? 27.635 20.945 -49.304 1.00 61.14  ? 116  LEU A CA  1 
ATOM   813  C C   . LEU A 1 116 ? 28.415 20.348 -48.116 1.00 64.33  ? 116  LEU A C   1 
ATOM   814  O O   . LEU A 1 116 ? 27.883 20.302 -47.018 1.00 62.44  ? 116  LEU A O   1 
ATOM   815  C CB  . LEU A 1 116 ? 27.043 19.844 -50.208 1.00 62.49  ? 116  LEU A CB  1 
ATOM   816  C CG  . LEU A 1 116 ? 26.140 18.803 -49.516 1.00 68.31  ? 116  LEU A CG  1 
ATOM   817  C CD1 . LEU A 1 116 ? 24.768 19.378 -49.193 1.00 68.08  ? 116  LEU A CD1 1 
ATOM   818  C CD2 . LEU A 1 116 ? 25.997 17.546 -50.369 1.00 71.65  ? 116  LEU A CD2 1 
ATOM   819  N N   . SER A 1 117 ? 29.686 19.975 -48.323 1.00 62.57  ? 117  SER A N   1 
ATOM   820  C CA  . SER A 1 117 ? 30.554 19.406 -47.282 1.00 62.14  ? 117  SER A CA  1 
ATOM   821  C C   . SER A 1 117 ? 30.772 20.380 -46.121 1.00 64.25  ? 117  SER A C   1 
ATOM   822  O O   . SER A 1 117 ? 30.718 19.979 -44.952 1.00 62.20  ? 117  SER A O   1 
ATOM   823  C CB  . SER A 1 117 ? 31.903 18.995 -47.871 1.00 65.81  ? 117  SER A CB  1 
ATOM   824  O OG  . SER A 1 117 ? 32.774 18.493 -46.873 1.00 78.60  ? 117  SER A OG  1 
ATOM   825  N N   . GLY A 1 118 ? 31.026 21.638 -46.469 1.00 60.35  ? 118  GLY A N   1 
ATOM   826  C CA  . GLY A 1 118 ? 31.289 22.705 -45.518 1.00 59.01  ? 118  GLY A CA  1 
ATOM   827  C C   . GLY A 1 118 ? 30.061 23.193 -44.790 1.00 60.69  ? 118  GLY A C   1 
ATOM   828  O O   . GLY A 1 118 ? 30.155 23.525 -43.611 1.00 59.73  ? 118  GLY A O   1 
ATOM   829  N N   . THR A 1 119 ? 28.904 23.264 -45.487 1.00 57.29  ? 119  THR A N   1 
ATOM   830  C CA  . THR A 1 119 ? 27.639 23.681 -44.865 1.00 55.89  ? 119  THR A CA  1 
ATOM   831  C C   . THR A 1 119 ? 27.123 22.567 -43.939 1.00 59.21  ? 119  THR A C   1 
ATOM   832  O O   . THR A 1 119 ? 26.495 22.867 -42.930 1.00 58.45  ? 119  THR A O   1 
ATOM   833  C CB  . THR A 1 119 ? 26.590 24.122 -45.901 1.00 57.99  ? 119  THR A CB  1 
ATOM   834  O OG1 . THR A 1 119 ? 26.394 23.081 -46.840 1.00 54.43  ? 119  THR A OG1 1 
ATOM   835  C CG2 . THR A 1 119 ? 26.941 25.445 -46.594 1.00 53.15  ? 119  THR A CG2 1 
ATOM   836  N N   . SER A 1 120 ? 27.405 21.295 -44.285 1.00 55.97  ? 120  SER A N   1 
ATOM   837  C CA  . SER A 1 120 ? 27.085 20.109 -43.488 1.00 55.81  ? 120  SER A CA  1 
ATOM   838  C C   . SER A 1 120 ? 27.885 20.172 -42.182 1.00 61.76  ? 120  SER A C   1 
ATOM   839  O O   . SER A 1 120 ? 27.292 20.089 -41.100 1.00 61.88  ? 120  SER A O   1 
ATOM   840  C CB  . SER A 1 120 ? 27.392 18.835 -44.275 1.00 59.09  ? 120  SER A CB  1 
ATOM   841  O OG  . SER A 1 120 ? 27.343 17.656 -43.487 1.00 68.36  ? 120  SER A OG  1 
ATOM   842  N N   . ASP A 1 121 ? 29.205 20.432 -42.281 1.00 59.23  ? 121  ASP A N   1 
ATOM   843  C CA  . ASP A 1 121 ? 30.085 20.574 -41.120 1.00 58.98  ? 121  ASP A CA  1 
ATOM   844  C C   . ASP A 1 121 ? 29.577 21.664 -40.214 1.00 60.38  ? 121  ASP A C   1 
ATOM   845  O O   . ASP A 1 121 ? 29.504 21.451 -39.002 1.00 58.64  ? 121  ASP A O   1 
ATOM   846  C CB  . ASP A 1 121 ? 31.526 20.912 -41.537 1.00 62.65  ? 121  ASP A CB  1 
ATOM   847  C CG  . ASP A 1 121 ? 32.316 19.791 -42.181 1.00 79.34  ? 121  ASP A CG  1 
ATOM   848  O OD1 . ASP A 1 121 ? 33.476 20.043 -42.585 1.00 82.29  ? 121  ASP A OD1 1 
ATOM   849  O OD2 . ASP A 1 121 ? 31.762 18.669 -42.319 1.00 85.56  ? 121  ASP A OD2 1 
ATOM   850  N N   . LEU A 1 122 ? 29.209 22.829 -40.799 1.00 55.23  ? 122  LEU A N   1 
ATOM   851  C CA  . LEU A 1 122 ? 28.704 23.943 -40.005 1.00 53.69  ? 122  LEU A CA  1 
ATOM   852  C C   . LEU A 1 122 ? 27.449 23.569 -39.251 1.00 58.50  ? 122  LEU A C   1 
ATOM   853  O O   . LEU A 1 122 ? 27.399 23.782 -38.036 1.00 57.74  ? 122  LEU A O   1 
ATOM   854  C CB  . LEU A 1 122 ? 28.495 25.212 -40.847 1.00 53.10  ? 122  LEU A CB  1 
ATOM   855  C CG  . LEU A 1 122 ? 29.774 26.000 -41.178 1.00 58.39  ? 122  LEU A CG  1 
ATOM   856  C CD1 . LEU A 1 122 ? 29.500 27.112 -42.201 1.00 58.39  ? 122  LEU A CD1 1 
ATOM   857  C CD2 . LEU A 1 122 ? 30.464 26.549 -39.916 1.00 57.20  ? 122  LEU A CD2 1 
ATOM   858  N N   . LEU A 1 123 ? 26.458 22.973 -39.958 1.00 55.84  ? 123  LEU A N   1 
ATOM   859  C CA  . LEU A 1 123 ? 25.177 22.570 -39.374 1.00 56.32  ? 123  LEU A CA  1 
ATOM   860  C C   . LEU A 1 123 ? 25.322 21.499 -38.277 1.00 60.78  ? 123  LEU A C   1 
ATOM   861  O O   . LEU A 1 123 ? 24.660 21.593 -37.245 1.00 59.33  ? 123  LEU A O   1 
ATOM   862  C CB  . LEU A 1 123 ? 24.159 22.150 -40.457 1.00 56.59  ? 123  LEU A CB  1 
ATOM   863  C CG  . LEU A 1 123 ? 23.617 23.269 -41.383 1.00 59.97  ? 123  LEU A CG  1 
ATOM   864  C CD1 . LEU A 1 123 ? 22.538 22.744 -42.305 1.00 61.07  ? 123  LEU A CD1 1 
ATOM   865  C CD2 . LEU A 1 123 ? 23.053 24.447 -40.604 1.00 58.56  ? 123  LEU A CD2 1 
ATOM   866  N N   . LEU A 1 124 ? 26.217 20.519 -38.489 1.00 58.24  ? 124  LEU A N   1 
ATOM   867  C CA  . LEU A 1 124 ? 26.496 19.458 -37.524 1.00 57.95  ? 124  LEU A CA  1 
ATOM   868  C C   . LEU A 1 124 ? 27.187 20.036 -36.271 1.00 61.24  ? 124  LEU A C   1 
ATOM   869  O O   . LEU A 1 124 ? 26.815 19.682 -35.147 1.00 60.73  ? 124  LEU A O   1 
ATOM   870  C CB  . LEU A 1 124 ? 27.321 18.332 -38.164 1.00 58.84  ? 124  LEU A CB  1 
ATOM   871  C CG  . LEU A 1 124 ? 26.571 17.417 -39.158 1.00 63.84  ? 124  LEU A CG  1 
ATOM   872  C CD1 . LEU A 1 124 ? 27.553 16.534 -39.939 1.00 64.56  ? 124  LEU A CD1 1 
ATOM   873  C CD2 . LEU A 1 124 ? 25.474 16.575 -38.462 1.00 63.79  ? 124  LEU A CD2 1 
ATOM   874  N N   . THR A 1 125 ? 28.118 20.994 -36.473 1.00 55.64  ? 125  THR A N   1 
ATOM   875  C CA  . THR A 1 125 ? 28.795 21.693 -35.388 1.00 54.43  ? 125  THR A CA  1 
ATOM   876  C C   . THR A 1 125 ? 27.779 22.458 -34.541 1.00 59.40  ? 125  THR A C   1 
ATOM   877  O O   . THR A 1 125 ? 27.866 22.397 -33.313 1.00 60.04  ? 125  THR A O   1 
ATOM   878  C CB  . THR A 1 125 ? 29.917 22.574 -35.935 1.00 53.56  ? 125  THR A CB  1 
ATOM   879  O OG1 . THR A 1 125 ? 30.945 21.743 -36.470 1.00 54.02  ? 125  THR A OG1 1 
ATOM   880  C CG2 . THR A 1 125 ? 30.512 23.482 -34.891 1.00 48.48  ? 125  THR A CG2 1 
ATOM   881  N N   . PHE A 1 126 ? 26.808 23.154 -35.182 1.00 55.77  ? 126  PHE A N   1 
ATOM   882  C CA  . PHE A 1 126 ? 25.788 23.910 -34.446 1.00 55.13  ? 126  PHE A CA  1 
ATOM   883  C C   . PHE A 1 126 ? 24.884 22.970 -33.667 1.00 59.22  ? 126  PHE A C   1 
ATOM   884  O O   . PHE A 1 126 ? 24.479 23.307 -32.556 1.00 60.41  ? 126  PHE A O   1 
ATOM   885  C CB  . PHE A 1 126 ? 24.955 24.837 -35.350 1.00 57.20  ? 126  PHE A CB  1 
ATOM   886  C CG  . PHE A 1 126 ? 25.720 25.780 -36.259 1.00 60.16  ? 126  PHE A CG  1 
ATOM   887  C CD1 . PHE A 1 126 ? 26.952 26.303 -35.875 1.00 63.86  ? 126  PHE A CD1 1 
ATOM   888  C CD2 . PHE A 1 126 ? 25.194 26.166 -37.488 1.00 62.84  ? 126  PHE A CD2 1 
ATOM   889  C CE1 . PHE A 1 126 ? 27.661 27.152 -36.723 1.00 65.46  ? 126  PHE A CE1 1 
ATOM   890  C CE2 . PHE A 1 126 ? 25.911 27.007 -38.340 1.00 65.88  ? 126  PHE A CE2 1 
ATOM   891  C CZ  . PHE A 1 126 ? 27.130 27.507 -37.944 1.00 64.50  ? 126  PHE A CZ  1 
ATOM   892  N N   . ASP A 1 127 ? 24.609 21.777 -34.226 1.00 55.01  ? 127  ASP A N   1 
ATOM   893  C CA  . ASP A 1 127 ? 23.781 20.766 -33.587 1.00 54.15  ? 127  ASP A CA  1 
ATOM   894  C C   . ASP A 1 127 ? 24.475 20.121 -32.396 1.00 58.00  ? 127  ASP A C   1 
ATOM   895  O O   . ASP A 1 127 ? 23.843 20.002 -31.362 1.00 57.89  ? 127  ASP A O   1 
ATOM   896  C CB  . ASP A 1 127 ? 23.298 19.719 -34.578 1.00 55.93  ? 127  ASP A CB  1 
ATOM   897  C CG  . ASP A 1 127 ? 22.112 18.953 -34.041 1.00 62.51  ? 127  ASP A CG  1 
ATOM   898  O OD1 . ASP A 1 127 ? 21.006 19.551 -33.965 1.00 61.87  ? 127  ASP A OD1 1 
ATOM   899  O OD2 . ASP A 1 127 ? 22.292 17.758 -33.665 1.00 62.76  ? 127  ASP A OD2 1 
ATOM   900  N N   . GLU A 1 128 ? 25.769 19.742 -32.520 1.00 55.58  ? 128  GLU A N   1 
ATOM   901  C CA  . GLU A 1 128 ? 26.568 19.185 -31.409 1.00 55.77  ? 128  GLU A CA  1 
ATOM   902  C C   . GLU A 1 128 ? 26.561 20.183 -30.218 1.00 61.24  ? 128  GLU A C   1 
ATOM   903  O O   . GLU A 1 128 ? 26.446 19.765 -29.067 1.00 62.66  ? 128  GLU A O   1 
ATOM   904  C CB  . GLU A 1 128 ? 28.019 18.918 -31.850 1.00 57.32  ? 128  GLU A CB  1 
ATOM   905  C CG  . GLU A 1 128 ? 28.212 17.672 -32.689 1.00 66.17  ? 128  GLU A CG  1 
ATOM   906  C CD  . GLU A 1 128 ? 29.644 17.384 -33.108 1.00 87.67  ? 128  GLU A CD  1 
ATOM   907  O OE1 . GLU A 1 128 ? 30.141 16.279 -32.790 1.00 95.36  ? 128  GLU A OE1 1 
ATOM   908  O OE2 . GLU A 1 128 ? 30.261 18.243 -33.780 1.00 78.47  ? 128  GLU A OE2 1 
ATOM   909  N N   . ALA A 1 129 ? 26.638 21.496 -30.517 1.00 56.77  ? 129  ALA A N   1 
ATOM   910  C CA  . ALA A 1 129 ? 26.625 22.582 -29.543 1.00 56.89  ? 129  ALA A CA  1 
ATOM   911  C C   . ALA A 1 129 ? 25.287 22.639 -28.800 1.00 61.79  ? 129  ALA A C   1 
ATOM   912  O O   . ALA A 1 129 ? 25.283 22.811 -27.570 1.00 62.08  ? 129  ALA A O   1 
ATOM   913  C CB  . ALA A 1 129 ? 26.906 23.907 -30.241 1.00 57.64  ? 129  ALA A CB  1 
ATOM   914  N N   . GLU A 1 130 ? 24.152 22.472 -29.538 1.00 57.42  ? 130  GLU A N   1 
ATOM   915  C CA  . GLU A 1 130 ? 22.817 22.460 -28.920 1.00 56.93  ? 130  GLU A CA  1 
ATOM   916  C C   . GLU A 1 130 ? 22.635 21.216 -28.057 1.00 58.59  ? 130  GLU A C   1 
ATOM   917  O O   . GLU A 1 130 ? 22.078 21.310 -26.971 1.00 58.46  ? 130  GLU A O   1 
ATOM   918  C CB  . GLU A 1 130 ? 21.683 22.597 -29.952 1.00 58.37  ? 130  GLU A CB  1 
ATOM   919  C CG  . GLU A 1 130 ? 21.567 23.998 -30.555 1.00 75.31  ? 130  GLU A CG  1 
ATOM   920  C CD  . GLU A 1 130 ? 21.740 25.195 -29.625 1.00 102.72 ? 130  GLU A CD  1 
ATOM   921  O OE1 . GLU A 1 130 ? 20.780 25.525 -28.890 1.00 95.16  ? 130  GLU A OE1 1 
ATOM   922  O OE2 . GLU A 1 130 ? 22.833 25.812 -29.644 1.00 96.04  ? 130  GLU A OE2 1 
ATOM   923  N N   . VAL A 1 131 ? 23.183 20.080 -28.509 1.00 53.51  ? 131  VAL A N   1 
ATOM   924  C CA  . VAL A 1 131 ? 23.135 18.816 -27.784 1.00 53.15  ? 131  VAL A CA  1 
ATOM   925  C C   . VAL A 1 131 ? 23.969 18.930 -26.502 1.00 56.36  ? 131  VAL A C   1 
ATOM   926  O O   . VAL A 1 131 ? 23.506 18.454 -25.471 1.00 55.88  ? 131  VAL A O   1 
ATOM   927  C CB  . VAL A 1 131 ? 23.510 17.608 -28.677 1.00 57.42  ? 131  VAL A CB  1 
ATOM   928  C CG1 . VAL A 1 131 ? 23.586 16.310 -27.878 1.00 57.23  ? 131  VAL A CG1 1 
ATOM   929  C CG2 . VAL A 1 131 ? 22.518 17.464 -29.828 1.00 57.34  ? 131  VAL A CG2 1 
ATOM   930  N N   . ARG A 1 132 ? 25.147 19.621 -26.545 1.00 52.62  ? 132  ARG A N   1 
ATOM   931  C CA  . ARG A 1 132 ? 25.985 19.842 -25.351 1.00 51.83  ? 132  ARG A CA  1 
ATOM   932  C C   . ARG A 1 132 ? 25.207 20.565 -24.258 1.00 54.09  ? 132  ARG A C   1 
ATOM   933  O O   . ARG A 1 132 ? 25.338 20.186 -23.109 1.00 54.77  ? 132  ARG A O   1 
ATOM   934  C CB  . ARG A 1 132 ? 27.301 20.567 -25.665 1.00 50.79  ? 132  ARG A CB  1 
ATOM   935  C CG  . ARG A 1 132 ? 28.334 19.670 -26.350 1.00 60.27  ? 132  ARG A CG  1 
ATOM   936  C CD  . ARG A 1 132 ? 29.740 20.266 -26.376 1.00 66.41  ? 132  ARG A CD  1 
ATOM   937  N NE  . ARG A 1 132 ? 29.802 21.565 -27.060 1.00 63.25  ? 132  ARG A NE  1 
ATOM   938  C CZ  . ARG A 1 132 ? 30.008 21.728 -28.365 1.00 77.70  ? 132  ARG A CZ  1 
ATOM   939  N NH1 . ARG A 1 132 ? 30.174 20.670 -29.161 1.00 56.76  ? 132  ARG A NH1 1 
ATOM   940  N NH2 . ARG A 1 132 ? 30.049 22.947 -28.887 1.00 65.09  ? 132  ARG A NH2 1 
ATOM   941  N N   . LYS A 1 133 ? 24.357 21.549 -24.628 1.00 50.94  ? 133  LYS A N   1 
ATOM   942  C CA  . LYS A 1 133 ? 23.485 22.328 -23.741 1.00 50.69  ? 133  LYS A CA  1 
ATOM   943  C C   . LYS A 1 133 ? 22.472 21.418 -23.063 1.00 55.27  ? 133  LYS A C   1 
ATOM   944  O O   . LYS A 1 133 ? 22.192 21.614 -21.886 1.00 56.66  ? 133  LYS A O   1 
ATOM   945  C CB  . LYS A 1 133 ? 22.691 23.392 -24.520 1.00 53.04  ? 133  LYS A CB  1 
ATOM   946  C CG  . LYS A 1 133 ? 23.437 24.665 -24.863 1.00 72.58  ? 133  LYS A CG  1 
ATOM   947  C CD  . LYS A 1 133 ? 22.422 25.759 -25.199 1.00 83.43  ? 133  LYS A CD  1 
ATOM   948  C CE  . LYS A 1 133 ? 22.988 26.880 -26.041 1.00 97.01  ? 133  LYS A CE  1 
ATOM   949  N NZ  . LYS A 1 133 ? 21.946 27.892 -26.377 1.00 104.14 ? 133  LYS A NZ  1 
ATOM   950  N N   . ILE A 1 134 ? 21.880 20.453 -23.812 1.00 49.67  ? 134  ILE A N   1 
ATOM   951  C CA  . ILE A 1 134 ? 20.900 19.520 -23.234 1.00 47.98  ? 134  ILE A CA  1 
ATOM   952  C C   . ILE A 1 134 ? 21.633 18.577 -22.262 1.00 49.91  ? 134  ILE A C   1 
ATOM   953  O O   . ILE A 1 134 ? 21.143 18.331 -21.160 1.00 49.04  ? 134  ILE A O   1 
ATOM   954  C CB  . ILE A 1 134 ? 20.093 18.747 -24.326 1.00 49.97  ? 134  ILE A CB  1 
ATOM   955  C CG1 . ILE A 1 134 ? 19.356 19.736 -25.277 1.00 50.48  ? 134  ILE A CG1 1 
ATOM   956  C CG2 . ILE A 1 134 ? 19.076 17.780 -23.669 1.00 47.04  ? 134  ILE A CG2 1 
ATOM   957  C CD1 . ILE A 1 134 ? 18.742 19.075 -26.584 1.00 51.82  ? 134  ILE A CD1 1 
ATOM   958  N N   . ILE A 1 135 ? 22.821 18.082 -22.668 1.00 46.57  ? 135  ILE A N   1 
ATOM   959  C CA  . ILE A 1 135 ? 23.637 17.169 -21.858 1.00 46.87  ? 135  ILE A CA  1 
ATOM   960  C C   . ILE A 1 135 ? 23.993 17.765 -20.490 1.00 51.21  ? 135  ILE A C   1 
ATOM   961  O O   . ILE A 1 135 ? 23.909 17.057 -19.488 1.00 50.36  ? 135  ILE A O   1 
ATOM   962  C CB  . ILE A 1 135 ? 24.840 16.583 -22.634 1.00 49.46  ? 135  ILE A CB  1 
ATOM   963  C CG1 . ILE A 1 135 ? 24.320 15.642 -23.734 1.00 50.04  ? 135  ILE A CG1 1 
ATOM   964  C CG2 . ILE A 1 135 ? 25.835 15.828 -21.687 1.00 48.79  ? 135  ILE A CG2 1 
ATOM   965  C CD1 . ILE A 1 135 ? 25.359 15.308 -24.813 1.00 57.36  ? 135  ILE A CD1 1 
ATOM   966  N N   . ARG A 1 136 ? 24.310 19.078 -20.457 1.00 49.36  ? 136  ARG A N   1 
ATOM   967  C CA  . ARG A 1 136 ? 24.633 19.808 -19.243 1.00 50.19  ? 136  ARG A CA  1 
ATOM   968  C C   . ARG A 1 136 ? 23.443 19.782 -18.272 1.00 51.68  ? 136  ARG A C   1 
ATOM   969  O O   . ARG A 1 136 ? 23.651 19.614 -17.076 1.00 49.76  ? 136  ARG A O   1 
ATOM   970  C CB  . ARG A 1 136 ? 25.023 21.258 -19.569 1.00 52.77  ? 136  ARG A CB  1 
ATOM   971  C CG  . ARG A 1 136 ? 26.481 21.416 -19.947 1.00 68.03  ? 136  ARG A CG  1 
ATOM   972  C CD  . ARG A 1 136 ? 26.836 22.858 -20.277 1.00 76.10  ? 136  ARG A CD  1 
ATOM   973  N NE  . ARG A 1 136 ? 27.763 22.918 -21.411 1.00 88.21  ? 136  ARG A NE  1 
ATOM   974  C CZ  . ARG A 1 136 ? 27.521 23.550 -22.557 1.00 98.20  ? 136  ARG A CZ  1 
ATOM   975  N NH1 . ARG A 1 136 ? 26.387 24.222 -22.727 1.00 74.89  ? 136  ARG A NH1 1 
ATOM   976  N NH2 . ARG A 1 136 ? 28.419 23.533 -23.532 1.00 90.76  ? 136  ARG A NH2 1 
ATOM   977  N N   . VAL A 1 137 ? 22.203 19.957 -18.795 1.00 47.60  ? 137  VAL A N   1 
ATOM   978  C CA  . VAL A 1 137 ? 20.980 19.920 -17.983 1.00 47.39  ? 137  VAL A CA  1 
ATOM   979  C C   . VAL A 1 137 ? 20.786 18.481 -17.446 1.00 52.53  ? 137  VAL A C   1 
ATOM   980  O O   . VAL A 1 137 ? 20.455 18.322 -16.264 1.00 54.28  ? 137  VAL A O   1 
ATOM   981  C CB  . VAL A 1 137 ? 19.744 20.478 -18.759 1.00 50.59  ? 137  VAL A CB  1 
ATOM   982  C CG1 . VAL A 1 137 ? 18.427 20.022 -18.136 1.00 50.56  ? 137  VAL A CG1 1 
ATOM   983  C CG2 . VAL A 1 137 ? 19.789 22.008 -18.814 1.00 50.41  ? 137  VAL A CG2 1 
ATOM   984  N N   . CYS A 1 138 ? 21.036 17.445 -18.303 1.00 47.37  ? 138  CYS A N   1 
ATOM   985  C CA  . CYS A 1 138 ? 20.920 16.031 -17.926 1.00 47.54  ? 138  CYS A CA  1 
ATOM   986  C C   . CYS A 1 138 ? 21.897 15.671 -16.827 1.00 50.17  ? 138  CYS A C   1 
ATOM   987  O O   . CYS A 1 138 ? 21.511 14.995 -15.887 1.00 49.64  ? 138  CYS A O   1 
ATOM   988  C CB  . CYS A 1 138 ? 21.100 15.115 -19.130 1.00 48.02  ? 138  CYS A CB  1 
ATOM   989  S SG  . CYS A 1 138 ? 19.812 15.285 -20.390 1.00 51.81  ? 138  CYS A SG  1 
ATOM   990  N N   . LYS A 1 139 ? 23.164 16.111 -16.955 1.00 46.39  ? 139  LYS A N   1 
ATOM   991  C CA  . LYS A 1 139 ? 24.218 15.881 -15.974 1.00 46.47  ? 139  LYS A CA  1 
ATOM   992  C C   . LYS A 1 139 ? 23.898 16.571 -14.661 1.00 50.62  ? 139  LYS A C   1 
ATOM   993  O O   . LYS A 1 139 ? 24.185 16.019 -13.595 1.00 51.24  ? 139  LYS A O   1 
ATOM   994  C CB  . LYS A 1 139 ? 25.592 16.294 -16.523 1.00 48.61  ? 139  LYS A CB  1 
ATOM   995  C CG  . LYS A 1 139 ? 26.061 15.266 -17.562 1.00 59.34  ? 139  LYS A CG  1 
ATOM   996  C CD  . LYS A 1 139 ? 27.505 15.382 -17.956 1.00 64.27  ? 139  LYS A CD  1 
ATOM   997  C CE  . LYS A 1 139 ? 27.880 14.237 -18.865 1.00 68.14  ? 139  LYS A CE  1 
ATOM   998  N NZ  . LYS A 1 139 ? 29.227 14.444 -19.460 1.00 82.71  ? 139  LYS A NZ  1 
ATOM   999  N N   . GLY A 1 140 ? 23.248 17.733 -14.747 1.00 45.75  ? 140  GLY A N   1 
ATOM   1000 C CA  . GLY A 1 140 ? 22.820 18.472 -13.566 1.00 45.50  ? 140  GLY A CA  1 
ATOM   1001 C C   . GLY A 1 140 ? 21.876 17.611 -12.743 1.00 49.39  ? 140  GLY A C   1 
ATOM   1002 O O   . GLY A 1 140 ? 22.045 17.512 -11.530 1.00 49.61  ? 140  GLY A O   1 
ATOM   1003 N N   . ILE A 1 141 ? 20.900 16.935 -13.414 1.00 45.46  ? 141  ILE A N   1 
ATOM   1004 C CA  . ILE A 1 141 ? 19.907 16.060 -12.774 1.00 44.96  ? 141  ILE A CA  1 
ATOM   1005 C C   . ILE A 1 141 ? 20.583 14.849 -12.194 1.00 49.81  ? 141  ILE A C   1 
ATOM   1006 O O   . ILE A 1 141 ? 20.301 14.493 -11.053 1.00 51.08  ? 141  ILE A O   1 
ATOM   1007 C CB  . ILE A 1 141 ? 18.697 15.682 -13.696 1.00 46.82  ? 141  ILE A CB  1 
ATOM   1008 C CG1 . ILE A 1 141 ? 18.024 16.942 -14.307 1.00 46.87  ? 141  ILE A CG1 1 
ATOM   1009 C CG2 . ILE A 1 141 ? 17.660 14.828 -12.951 1.00 45.16  ? 141  ILE A CG2 1 
ATOM   1010 C CD1 . ILE A 1 141 ? 17.649 18.006 -13.343 1.00 44.73  ? 141  ILE A CD1 1 
ATOM   1011 N N   . LEU A 1 142 ? 21.522 14.263 -12.942 1.00 46.48  ? 142  LEU A N   1 
ATOM   1012 C CA  . LEU A 1 142 ? 22.265 13.086 -12.503 1.00 47.12  ? 142  LEU A CA  1 
ATOM   1013 C C   . LEU A 1 142 ? 22.967 13.350 -11.207 1.00 50.31  ? 142  LEU A C   1 
ATOM   1014 O O   . LEU A 1 142 ? 22.920 12.511 -10.306 1.00 48.58  ? 142  LEU A O   1 
ATOM   1015 C CB  . LEU A 1 142 ? 23.303 12.632 -13.540 1.00 47.13  ? 142  LEU A CB  1 
ATOM   1016 C CG  . LEU A 1 142 ? 22.855 11.546 -14.489 1.00 52.07  ? 142  LEU A CG  1 
ATOM   1017 C CD1 . LEU A 1 142 ? 23.830 11.423 -15.654 1.00 53.05  ? 142  LEU A CD1 1 
ATOM   1018 C CD2 . LEU A 1 142 ? 22.698 10.197 -13.787 1.00 52.84  ? 142  LEU A CD2 1 
ATOM   1019 N N   . GLU A 1 143 ? 23.613 14.516 -11.125 1.00 47.12  ? 143  GLU A N   1 
ATOM   1020 C CA  . GLU A 1 143 ? 24.335 14.940 -9.945  1.00 49.40  ? 143  GLU A CA  1 
ATOM   1021 C C   . GLU A 1 143 ? 23.400 15.190 -8.794  1.00 51.55  ? 143  GLU A C   1 
ATOM   1022 O O   . GLU A 1 143 ? 23.706 14.775 -7.677  1.00 51.52  ? 143  GLU A O   1 
ATOM   1023 C CB  . GLU A 1 143 ? 25.261 16.127 -10.252 1.00 51.97  ? 143  GLU A CB  1 
ATOM   1024 C CG  . GLU A 1 143 ? 26.453 15.641 -11.068 1.00 67.29  ? 143  GLU A CG  1 
ATOM   1025 C CD  . GLU A 1 143 ? 27.446 16.673 -11.562 1.00 97.95  ? 143  GLU A CD  1 
ATOM   1026 O OE1 . GLU A 1 143 ? 27.408 17.826 -11.071 1.00 78.05  ? 143  GLU A OE1 1 
ATOM   1027 O OE2 . GLU A 1 143 ? 28.290 16.312 -12.418 1.00 95.98  ? 143  GLU A OE2 1 
ATOM   1028 N N   . TYR A 1 144 ? 22.220 15.778 -9.070  1.00 46.66  ? 144  TYR A N   1 
ATOM   1029 C CA  . TYR A 1 144 ? 21.234 15.991 -8.013  1.00 46.64  ? 144  TYR A CA  1 
ATOM   1030 C C   . TYR A 1 144 ? 20.618 14.699 -7.510  1.00 48.28  ? 144  TYR A C   1 
ATOM   1031 O O   . TYR A 1 144 ? 20.258 14.597 -6.343  1.00 47.83  ? 144  TYR A O   1 
ATOM   1032 C CB  . TYR A 1 144 ? 20.166 17.009 -8.415  1.00 48.73  ? 144  TYR A CB  1 
ATOM   1033 C CG  . TYR A 1 144 ? 19.780 17.859 -7.223  1.00 50.95  ? 144  TYR A CG  1 
ATOM   1034 C CD1 . TYR A 1 144 ? 20.738 18.605 -6.532  1.00 52.86  ? 144  TYR A CD1 1 
ATOM   1035 C CD2 . TYR A 1 144 ? 18.480 17.854 -6.734  1.00 52.38  ? 144  TYR A CD2 1 
ATOM   1036 C CE1 . TYR A 1 144 ? 20.398 19.347 -5.395  1.00 55.20  ? 144  TYR A CE1 1 
ATOM   1037 C CE2 . TYR A 1 144 ? 18.127 18.595 -5.599  1.00 53.94  ? 144  TYR A CE2 1 
ATOM   1038 C CZ  . TYR A 1 144 ? 19.090 19.338 -4.935  1.00 61.27  ? 144  TYR A CZ  1 
ATOM   1039 O OH  . TYR A 1 144 ? 18.743 20.024 -3.799  1.00 69.90  ? 144  TYR A OH  1 
ATOM   1040 N N   . LEU A 1 145 ? 20.541 13.674 -8.374  1.00 43.96  ? 145  LEU A N   1 
ATOM   1041 C CA  . LEU A 1 145 ? 20.069 12.375 -7.914  1.00 42.01  ? 145  LEU A CA  1 
ATOM   1042 C C   . LEU A 1 145 ? 21.051 11.774 -6.895  1.00 45.36  ? 145  LEU A C   1 
ATOM   1043 O O   . LEU A 1 145 ? 20.601 11.150 -5.929  1.00 42.16  ? 145  LEU A O   1 
ATOM   1044 C CB  . LEU A 1 145 ? 19.792 11.441 -9.092  1.00 41.16  ? 145  LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 145 ? 18.540 11.847 -9.901  1.00 44.31  ? 145  LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 145 ? 18.406 11.014 -11.144 1.00 44.27  ? 145  LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 145 ? 17.287 11.710 -9.076  1.00 44.69  ? 145  LEU A CD2 1 
ATOM   1048 N N   . THR A 1 146 ? 22.389 12.033 -7.057  1.00 43.70  ? 146  THR A N   1 
ATOM   1049 C CA  . THR A 1 146 ? 23.397 11.538 -6.105  1.00 45.25  ? 146  THR A CA  1 
ATOM   1050 C C   . THR A 1 146 ? 23.280 12.191 -4.714  1.00 51.82  ? 146  THR A C   1 
ATOM   1051 O O   . THR A 1 146 ? 23.777 11.634 -3.732  1.00 53.93  ? 146  THR A O   1 
ATOM   1052 C CB  . THR A 1 146 ? 24.830 11.592 -6.673  1.00 47.63  ? 146  THR A CB  1 
ATOM   1053 O OG1 . THR A 1 146 ? 25.287 12.939 -6.718  1.00 45.20  ? 146  THR A OG1 1 
ATOM   1054 C CG2 . THR A 1 146 ? 24.972 10.956 -8.054  1.00 41.31  ? 146  THR A CG2 1 
ATOM   1055 N N   . VAL A 1 147 ? 22.648 13.378 -4.632  1.00 48.13  ? 147  VAL A N   1 
ATOM   1056 C CA  . VAL A 1 147 ? 22.431 14.122 -3.372  1.00 48.15  ? 147  VAL A CA  1 
ATOM   1057 C C   . VAL A 1 147 ? 21.330 13.444 -2.534  1.00 53.21  ? 147  VAL A C   1 
ATOM   1058 O O   . VAL A 1 147 ? 21.313 13.596 -1.312  1.00 54.93  ? 147  VAL A O   1 
ATOM   1059 C CB  . VAL A 1 147 ? 22.105 15.627 -3.650  1.00 52.05  ? 147  VAL A CB  1 
ATOM   1060 C CG1 . VAL A 1 147 ? 21.799 16.411 -2.357  1.00 53.40  ? 147  VAL A CG1 1 
ATOM   1061 C CG2 . VAL A 1 147 ? 23.237 16.303 -4.405  1.00 51.74  ? 147  VAL A CG2 1 
ATOM   1062 N N   . ALA A 1 148 ? 20.410 12.703 -3.173  1.00 49.72  ? 148  ALA A N   1 
ATOM   1063 C CA  . ALA A 1 148 ? 19.290 12.059 -2.462  1.00 50.13  ? 148  ALA A CA  1 
ATOM   1064 C C   . ALA A 1 148 ? 19.732 11.291 -1.224  1.00 55.72  ? 148  ALA A C   1 
ATOM   1065 O O   . ALA A 1 148 ? 19.057 11.341 -0.199  1.00 57.81  ? 148  ALA A O   1 
ATOM   1066 C CB  . ALA A 1 148 ? 18.509 11.140 -3.397  1.00 49.63  ? 148  ALA A CB  1 
ATOM   1067 N N   . GLU A 1 149 ? 20.882 10.615 -1.307  1.00 51.80  ? 149  GLU A N   1 
ATOM   1068 C CA  . GLU A 1 149 ? 21.380 9.790  -0.223  1.00 53.09  ? 149  GLU A CA  1 
ATOM   1069 C C   . GLU A 1 149 ? 21.867 10.536 1.027   1.00 58.20  ? 149  GLU A C   1 
ATOM   1070 O O   . GLU A 1 149 ? 22.143 9.893  2.034   1.00 59.97  ? 149  GLU A O   1 
ATOM   1071 C CB  . GLU A 1 149 ? 22.389 8.757  -0.734  1.00 54.96  ? 149  GLU A CB  1 
ATOM   1072 C CG  . GLU A 1 149 ? 23.812 9.265  -0.866  1.00 64.84  ? 149  GLU A CG  1 
ATOM   1073 C CD  . GLU A 1 149 ? 24.848 8.164  -0.784  1.00 79.21  ? 149  GLU A CD  1 
ATOM   1074 O OE1 . GLU A 1 149 ? 24.752 7.310  0.127   1.00 74.37  ? 149  GLU A OE1 1 
ATOM   1075 O OE2 . GLU A 1 149 ? 25.766 8.165  -1.632  1.00 73.71  ? 149  GLU A OE2 1 
ATOM   1076 N N   . VAL A 1 150 ? 21.977 11.867 0.971   1.00 54.49  ? 150  VAL A N   1 
ATOM   1077 C CA  . VAL A 1 150 ? 22.401 12.648 2.141   1.00 56.08  ? 150  VAL A CA  1 
ATOM   1078 C C   . VAL A 1 150 ? 21.219 13.382 2.815   1.00 60.47  ? 150  VAL A C   1 
ATOM   1079 O O   . VAL A 1 150 ? 21.410 14.082 3.805   1.00 61.03  ? 150  VAL A O   1 
ATOM   1080 C CB  . VAL A 1 150 ? 23.636 13.545 1.872   1.00 61.50  ? 150  VAL A CB  1 
ATOM   1081 C CG1 . VAL A 1 150 ? 24.854 12.694 1.519   1.00 61.24  ? 150  VAL A CG1 1 
ATOM   1082 C CG2 . VAL A 1 150 ? 23.362 14.588 0.781   1.00 60.93  ? 150  VAL A CG2 1 
ATOM   1083 N N   . VAL A 1 151 ? 19.991 13.195 2.280   1.00 57.40  ? 151  VAL A N   1 
ATOM   1084 C CA  . VAL A 1 151 ? 18.772 13.799 2.828   1.00 57.84  ? 151  VAL A CA  1 
ATOM   1085 C C   . VAL A 1 151 ? 18.339 12.951 4.038   1.00 64.07  ? 151  VAL A C   1 
ATOM   1086 O O   . VAL A 1 151 ? 18.035 11.767 3.887   1.00 62.53  ? 151  VAL A O   1 
ATOM   1087 C CB  . VAL A 1 151 ? 17.687 13.974 1.728   1.00 59.29  ? 151  VAL A CB  1 
ATOM   1088 C CG1 . VAL A 1 151 ? 16.353 14.438 2.313   1.00 59.54  ? 151  VAL A CG1 1 
ATOM   1089 C CG2 . VAL A 1 151 ? 18.168 14.952 0.669   1.00 58.18  ? 151  VAL A CG2 1 
ATOM   1090 N N   . GLU A 1 152 ? 18.413 13.550 5.240   1.00 64.60  ? 152  GLU A N   1 
ATOM   1091 C CA  . GLU A 1 152 ? 18.148 12.910 6.537   1.00 66.43  ? 152  GLU A CA  1 
ATOM   1092 C C   . GLU A 1 152 ? 16.914 13.482 7.262   1.00 71.54  ? 152  GLU A C   1 
ATOM   1093 O O   . GLU A 1 152 ? 16.299 12.778 8.079   1.00 70.16  ? 152  GLU A O   1 
ATOM   1094 C CB  . GLU A 1 152 ? 19.370 13.078 7.480   1.00 69.40  ? 152  GLU A CB  1 
ATOM   1095 C CG  . GLU A 1 152 ? 20.704 12.585 6.944   1.00 83.17  ? 152  GLU A CG  1 
ATOM   1096 C CD  . GLU A 1 152 ? 20.886 11.084 6.835   1.00 107.83 ? 152  GLU A CD  1 
ATOM   1097 O OE1 . GLU A 1 152 ? 21.400 10.630 5.787   1.00 102.32 ? 152  GLU A OE1 1 
ATOM   1098 O OE2 . GLU A 1 152 ? 20.538 10.364 7.800   1.00 105.64 ? 152  GLU A OE2 1 
ATOM   1099 N N   . THR A 1 153 ? 16.608 14.775 7.018   1.00 69.19  ? 153  THR A N   1 
ATOM   1100 C CA  . THR A 1 153 ? 15.508 15.494 7.674   1.00 70.65  ? 153  THR A CA  1 
ATOM   1101 C C   . THR A 1 153 ? 14.427 15.978 6.693   1.00 75.26  ? 153  THR A C   1 
ATOM   1102 O O   . THR A 1 153 ? 14.683 16.060 5.485   1.00 73.50  ? 153  THR A O   1 
ATOM   1103 C CB  . THR A 1 153 ? 16.073 16.709 8.398   1.00 76.73  ? 153  THR A CB  1 
ATOM   1104 O OG1 . THR A 1 153 ? 16.574 17.607 7.413   1.00 74.58  ? 153  THR A OG1 1 
ATOM   1105 C CG2 . THR A 1 153 ? 17.160 16.345 9.420   1.00 74.90  ? 153  THR A CG2 1 
ATOM   1106 N N   . MET A 1 154 ? 13.245 16.370 7.232   1.00 72.16  ? 154  MET A N   1 
ATOM   1107 C CA  . MET A 1 154 ? 12.135 16.902 6.441   1.00 71.62  ? 154  MET A CA  1 
ATOM   1108 C C   . MET A 1 154 ? 12.475 18.261 5.835   1.00 75.93  ? 154  MET A C   1 
ATOM   1109 O O   . MET A 1 154 ? 12.015 18.543 4.729   1.00 76.26  ? 154  MET A O   1 
ATOM   1110 C CB  . MET A 1 154 ? 10.837 16.953 7.254   1.00 75.58  ? 154  MET A CB  1 
ATOM   1111 C CG  . MET A 1 154 ? 9.581  17.060 6.403   1.00 79.72  ? 154  MET A CG  1 
ATOM   1112 S SD  . MET A 1 154 ? 9.369  15.753 5.156   1.00 82.74  ? 154  MET A SD  1 
ATOM   1113 C CE  . MET A 1 154 ? 9.112  14.306 6.221   1.00 79.29  ? 154  MET A CE  1 
ATOM   1114 N N   . GLU A 1 155 ? 13.314 19.079 6.519   1.00 72.55  ? 155  GLU A N   1 
ATOM   1115 C CA  . GLU A 1 155 ? 13.769 20.387 6.015   1.00 72.38  ? 155  GLU A CA  1 
ATOM   1116 C C   . GLU A 1 155 ? 14.544 20.192 4.717   1.00 72.60  ? 155  GLU A C   1 
ATOM   1117 O O   . GLU A 1 155 ? 14.321 20.927 3.753   1.00 71.98  ? 155  GLU A O   1 
ATOM   1118 C CB  . GLU A 1 155 ? 14.661 21.085 7.046   1.00 75.78  ? 155  GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 155 ? 15.072 22.501 6.669   1.00 90.71  ? 155  GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 155 ? 16.080 23.145 7.606   1.00 122.12 ? 155  GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 155 ? 15.780 23.272 8.816   1.00 115.72 ? 155  GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 155 ? 17.161 23.555 7.120   1.00 120.30 ? 155  GLU A OE2 1 
ATOM   1123 N N   . ASP A 1 156 ? 15.459 19.196 4.714   1.00 66.37  ? 156  ASP A N   1 
ATOM   1124 C CA  . ASP A 1 156 ? 16.295 18.849 3.573   1.00 63.62  ? 156  ASP A CA  1 
ATOM   1125 C C   . ASP A 1 156 ? 15.422 18.290 2.454   1.00 64.22  ? 156  ASP A C   1 
ATOM   1126 O O   . ASP A 1 156 ? 15.593 18.700 1.304   1.00 61.80  ? 156  ASP A O   1 
ATOM   1127 C CB  . ASP A 1 156 ? 17.391 17.850 3.989   1.00 64.55  ? 156  ASP A CB  1 
ATOM   1128 C CG  . ASP A 1 156 ? 18.448 18.424 4.922   1.00 73.78  ? 156  ASP A CG  1 
ATOM   1129 O OD1 . ASP A 1 156 ? 19.116 17.626 5.623   1.00 74.50  ? 156  ASP A OD1 1 
ATOM   1130 O OD2 . ASP A 1 156 ? 18.628 19.670 4.930   1.00 78.66  ? 156  ASP A OD2 1 
ATOM   1131 N N   . LEU A 1 157 ? 14.439 17.416 2.797   1.00 59.82  ? 157  LEU A N   1 
ATOM   1132 C CA  . LEU A 1 157 ? 13.543 16.874 1.790   1.00 58.72  ? 157  LEU A CA  1 
ATOM   1133 C C   . LEU A 1 157 ? 12.773 17.973 1.062   1.00 63.17  ? 157  LEU A C   1 
ATOM   1134 O O   . LEU A 1 157 ? 12.722 17.953 -0.161  1.00 63.40  ? 157  LEU A O   1 
ATOM   1135 C CB  . LEU A 1 157 ? 12.636 15.743 2.317   1.00 58.91  ? 157  LEU A CB  1 
ATOM   1136 C CG  . LEU A 1 157 ? 11.745 15.035 1.255   1.00 62.32  ? 157  LEU A CG  1 
ATOM   1137 C CD1 . LEU A 1 157 ? 12.579 14.308 0.193   1.00 59.94  ? 157  LEU A CD1 1 
ATOM   1138 C CD2 . LEU A 1 157 ? 10.757 14.091 1.905   1.00 66.80  ? 157  LEU A CD2 1 
ATOM   1139 N N   . VAL A 1 158 ? 12.284 18.979 1.790   1.00 60.94  ? 158  VAL A N   1 
ATOM   1140 C CA  . VAL A 1 158 ? 11.548 20.103 1.198   1.00 61.11  ? 158  VAL A CA  1 
ATOM   1141 C C   . VAL A 1 158 ? 12.468 20.879 0.248   1.00 64.27  ? 158  VAL A C   1 
ATOM   1142 O O   . VAL A 1 158 ? 12.091 21.122 -0.899  1.00 62.57  ? 158  VAL A O   1 
ATOM   1143 C CB  . VAL A 1 158 ? 10.811 20.981 2.267   1.00 66.37  ? 158  VAL A CB  1 
ATOM   1144 C CG1 . VAL A 1 158 ? 10.097 22.173 1.632   1.00 67.13  ? 158  VAL A CG1 1 
ATOM   1145 C CG2 . VAL A 1 158 ? 9.811  20.148 3.056   1.00 66.27  ? 158  VAL A CG2 1 
ATOM   1146 N N   . THR A 1 159 ? 13.705 21.177 0.691   1.00 61.68  ? 159  THR A N   1 
ATOM   1147 C CA  . THR A 1 159 ? 14.708 21.875 -0.131  1.00 61.03  ? 159  THR A CA  1 
ATOM   1148 C C   . THR A 1 159 ? 15.027 21.063 -1.402  1.00 61.51  ? 159  THR A C   1 
ATOM   1149 O O   . THR A 1 159 ? 15.028 21.625 -2.503  1.00 60.59  ? 159  THR A O   1 
ATOM   1150 C CB  . THR A 1 159 ? 15.967 22.173 0.709   1.00 67.99  ? 159  THR A CB  1 
ATOM   1151 O OG1 . THR A 1 159 ? 15.575 22.892 1.880   1.00 75.06  ? 159  THR A OG1 1 
ATOM   1152 C CG2 . THR A 1 159 ? 17.017 22.971 -0.054  1.00 61.58  ? 159  THR A CG2 1 
ATOM   1153 N N   . TYR A 1 160 ? 15.262 19.735 -1.236  1.00 55.17  ? 160  TYR A N   1 
ATOM   1154 C CA  . TYR A 1 160 ? 15.568 18.803 -2.323  1.00 51.85  ? 160  TYR A CA  1 
ATOM   1155 C C   . TYR A 1 160 ? 14.428 18.757 -3.345  1.00 54.88  ? 160  TYR A C   1 
ATOM   1156 O O   . TYR A 1 160 ? 14.685 18.909 -4.534  1.00 53.77  ? 160  TYR A O   1 
ATOM   1157 C CB  . TYR A 1 160 ? 15.824 17.401 -1.760  1.00 51.66  ? 160  TYR A CB  1 
ATOM   1158 C CG  . TYR A 1 160 ? 16.367 16.428 -2.787  1.00 51.29  ? 160  TYR A CG  1 
ATOM   1159 C CD1 . TYR A 1 160 ? 17.727 16.391 -3.089  1.00 52.11  ? 160  TYR A CD1 1 
ATOM   1160 C CD2 . TYR A 1 160 ? 15.531 15.504 -3.414  1.00 50.21  ? 160  TYR A CD2 1 
ATOM   1161 C CE1 . TYR A 1 160 ? 18.240 15.475 -4.004  1.00 50.32  ? 160  TYR A CE1 1 
ATOM   1162 C CE2 . TYR A 1 160 ? 16.035 14.578 -4.328  1.00 50.00  ? 160  TYR A CE2 1 
ATOM   1163 C CZ  . TYR A 1 160 ? 17.391 14.570 -4.621  1.00 54.45  ? 160  TYR A CZ  1 
ATOM   1164 O OH  . TYR A 1 160 ? 17.902 13.710 -5.556  1.00 49.10  ? 160  TYR A OH  1 
ATOM   1165 N N   . THR A 1 161 ? 13.172 18.585 -2.878  1.00 52.23  ? 161  THR A N   1 
ATOM   1166 C CA  . THR A 1 161 ? 11.972 18.537 -3.735  1.00 52.07  ? 161  THR A CA  1 
ATOM   1167 C C   . THR A 1 161 ? 11.767 19.829 -4.519  1.00 54.78  ? 161  THR A C   1 
ATOM   1168 O O   . THR A 1 161 ? 11.401 19.770 -5.680  1.00 51.96  ? 161  THR A O   1 
ATOM   1169 C CB  . THR A 1 161 ? 10.732 18.134 -2.924  1.00 62.43  ? 161  THR A CB  1 
ATOM   1170 O OG1 . THR A 1 161 ? 11.090 17.065 -2.042  1.00 65.86  ? 161  THR A OG1 1 
ATOM   1171 C CG2 . THR A 1 161 ? 9.563  17.705 -3.808  1.00 59.02  ? 161  THR A CG2 1 
ATOM   1172 N N   . LYS A 1 162 ? 12.008 20.989 -3.890  1.00 54.90  ? 162  LYS A N   1 
ATOM   1173 C CA  . LYS A 1 162 ? 11.862 22.310 -4.521  1.00 55.83  ? 162  LYS A CA  1 
ATOM   1174 C C   . LYS A 1 162 ? 12.898 22.527 -5.605  1.00 60.60  ? 162  LYS A C   1 
ATOM   1175 O O   . LYS A 1 162 ? 12.669 23.305 -6.526  1.00 60.49  ? 162  LYS A O   1 
ATOM   1176 C CB  . LYS A 1 162 ? 11.989 23.432 -3.471  1.00 59.77  ? 162  LYS A CB  1 
ATOM   1177 C CG  . LYS A 1 162 ? 10.747 23.649 -2.616  1.00 67.66  ? 162  LYS A CG  1 
ATOM   1178 C CD  . LYS A 1 162 ? 10.626 25.095 -2.075  1.00 81.86  ? 162  LYS A CD  1 
ATOM   1179 C CE  . LYS A 1 162 ? 11.586 25.467 -0.964  1.00 90.11  ? 162  LYS A CE  1 
ATOM   1180 N NZ  . LYS A 1 162 ? 11.252 26.794 -0.368  1.00 100.16 ? 162  LYS A NZ  1 
ATOM   1181 N N   . ASN A 1 163 ? 14.060 21.888 -5.476  1.00 58.15  ? 163  ASN A N   1 
ATOM   1182 C CA  . ASN A 1 163 ? 15.126 21.999 -6.473  1.00 57.31  ? 163  ASN A CA  1 
ATOM   1183 C C   . ASN A 1 163 ? 14.920 21.033 -7.640  1.00 61.45  ? 163  ASN A C   1 
ATOM   1184 O O   . ASN A 1 163 ? 14.916 21.466 -8.791  1.00 61.75  ? 163  ASN A O   1 
ATOM   1185 C CB  . ASN A 1 163 ? 16.490 21.791 -5.818  1.00 54.55  ? 163  ASN A CB  1 
ATOM   1186 C CG  . ASN A 1 163 ? 16.928 22.964 -4.965  1.00 82.81  ? 163  ASN A CG  1 
ATOM   1187 O OD1 . ASN A 1 163 ? 16.747 24.145 -5.317  1.00 83.77  ? 163  ASN A OD1 1 
ATOM   1188 N ND2 . ASN A 1 163 ? 17.532 22.667 -3.825  1.00 68.70  ? 163  ASN A ND2 1 
ATOM   1189 N N   . LEU A 1 164 ? 14.750 19.728 -7.336  1.00 57.39  ? 164  LEU A N   1 
ATOM   1190 C CA  . LEU A 1 164 ? 14.584 18.642 -8.306  1.00 54.85  ? 164  LEU A CA  1 
ATOM   1191 C C   . LEU A 1 164 ? 13.313 18.768 -9.167  1.00 60.68  ? 164  LEU A C   1 
ATOM   1192 O O   . LEU A 1 164 ? 13.356 18.431 -10.353 1.00 60.14  ? 164  LEU A O   1 
ATOM   1193 C CB  . LEU A 1 164 ? 14.660 17.262 -7.601  1.00 53.79  ? 164  LEU A CB  1 
ATOM   1194 C CG  . LEU A 1 164 ? 14.843 15.997 -8.498  1.00 56.55  ? 164  LEU A CG  1 
ATOM   1195 C CD1 . LEU A 1 164 ? 16.032 16.125 -9.477  1.00 55.14  ? 164  LEU A CD1 1 
ATOM   1196 C CD2 . LEU A 1 164 ? 15.037 14.743 -7.652  1.00 55.96  ? 164  LEU A CD2 1 
ATOM   1197 N N   . GLY A 1 165 ? 12.202 19.203 -8.562  1.00 58.13  ? 165  GLY A N   1 
ATOM   1198 C CA  . GLY A 1 165 ? 10.928 19.389 -9.259  1.00 58.79  ? 165  GLY A CA  1 
ATOM   1199 C C   . GLY A 1 165 ? 11.065 20.265 -10.498 1.00 63.25  ? 165  GLY A C   1 
ATOM   1200 O O   . GLY A 1 165 ? 10.902 19.764 -11.616 1.00 63.31  ? 165  GLY A O   1 
ATOM   1201 N N   . PRO A 1 166 ? 11.493 21.546 -10.348 1.00 59.82  ? 166  PRO A N   1 
ATOM   1202 C CA  . PRO A 1 166 ? 11.683 22.413 -11.531 1.00 59.38  ? 166  PRO A CA  1 
ATOM   1203 C C   . PRO A 1 166 ? 12.766 21.948 -12.488 1.00 61.05  ? 166  PRO A C   1 
ATOM   1204 O O   . PRO A 1 166 ? 12.623 22.150 -13.688 1.00 60.65  ? 166  PRO A O   1 
ATOM   1205 C CB  . PRO A 1 166 ? 12.067 23.767 -10.926 1.00 62.41  ? 166  PRO A CB  1 
ATOM   1206 C CG  . PRO A 1 166 ? 11.514 23.726 -9.538  1.00 67.70  ? 166  PRO A CG  1 
ATOM   1207 C CD  . PRO A 1 166 ? 11.703 22.306 -9.101  1.00 62.01  ? 166  PRO A CD  1 
ATOM   1208 N N   . GLY A 1 167 ? 13.837 21.359 -11.954 1.00 57.59  ? 167  GLY A N   1 
ATOM   1209 C CA  . GLY A 1 167 ? 14.942 20.845 -12.756 1.00 55.79  ? 167  GLY A CA  1 
ATOM   1210 C C   . GLY A 1 167 ? 14.465 19.759 -13.710 1.00 57.81  ? 167  GLY A C   1 
ATOM   1211 O O   . GLY A 1 167 ? 14.834 19.744 -14.892 1.00 54.38  ? 167  GLY A O   1 
ATOM   1212 N N   . MET A 1 168 ? 13.595 18.868 -13.199 1.00 55.21  ? 168  MET A N   1 
ATOM   1213 C CA  . MET A 1 168 ? 13.027 17.775 -13.989 1.00 54.09  ? 168  MET A CA  1 
ATOM   1214 C C   . MET A 1 168 ? 12.095 18.325 -15.084 1.00 57.68  ? 168  MET A C   1 
ATOM   1215 O O   . MET A 1 168 ? 12.117 17.814 -16.196 1.00 56.16  ? 168  MET A O   1 
ATOM   1216 C CB  . MET A 1 168 ? 12.310 16.752 -13.090 1.00 56.24  ? 168  MET A CB  1 
ATOM   1217 C CG  . MET A 1 168 ? 12.114 15.390 -13.771 1.00 60.18  ? 168  MET A CG  1 
ATOM   1218 S SD  . MET A 1 168 ? 13.714 14.585 -14.087 1.00 63.77  ? 168  MET A SD  1 
ATOM   1219 C CE  . MET A 1 168 ? 14.119 14.013 -12.410 1.00 59.70  ? 168  MET A CE  1 
ATOM   1220 N N   . THR A 1 169 ? 11.303 19.377 -14.772 1.00 56.29  ? 169  THR A N   1 
ATOM   1221 C CA  . THR A 1 169 ? 10.393 20.028 -15.733 1.00 56.51  ? 169  THR A CA  1 
ATOM   1222 C C   . THR A 1 169 ? 11.169 20.627 -16.918 1.00 56.74  ? 169  THR A C   1 
ATOM   1223 O O   . THR A 1 169 ? 10.787 20.414 -18.058 1.00 55.42  ? 169  THR A O   1 
ATOM   1224 C CB  . THR A 1 169 ? 9.442  20.993 -15.005 1.00 64.36  ? 169  THR A CB  1 
ATOM   1225 O OG1 . THR A 1 169 ? 8.602  20.214 -14.161 1.00 69.13  ? 169  THR A OG1 1 
ATOM   1226 C CG2 . THR A 1 169 ? 8.551  21.792 -15.957 1.00 61.77  ? 169  THR A CG2 1 
ATOM   1227 N N   . LYS A 1 170 ? 12.284 21.305 -16.643 1.00 53.22  ? 170  LYS A N   1 
ATOM   1228 C CA  . LYS A 1 170 ? 13.157 21.897 -17.663 1.00 52.62  ? 170  LYS A CA  1 
ATOM   1229 C C   . LYS A 1 170 ? 13.786 20.806 -18.541 1.00 55.30  ? 170  LYS A C   1 
ATOM   1230 O O   . LYS A 1 170 ? 13.849 20.962 -19.756 1.00 56.39  ? 170  LYS A O   1 
ATOM   1231 C CB  . LYS A 1 170 ? 14.249 22.744 -16.980 1.00 55.44  ? 170  LYS A CB  1 
ATOM   1232 C CG  . LYS A 1 170 ? 15.242 23.408 -17.942 1.00 64.77  ? 170  LYS A CG  1 
ATOM   1233 C CD  . LYS A 1 170 ? 16.605 23.589 -17.259 1.00 75.97  ? 170  LYS A CD  1 
ATOM   1234 C CE  . LYS A 1 170 ? 17.231 24.943 -17.483 1.00 84.05  ? 170  LYS A CE  1 
ATOM   1235 N NZ  . LYS A 1 170 ? 17.604 25.153 -18.909 1.00 93.00  ? 170  LYS A NZ  1 
ATOM   1236 N N   . MET A 1 171 ? 14.259 19.706 -17.927 1.00 49.61  ? 171  MET A N   1 
ATOM   1237 C CA  . MET A 1 171 ? 14.840 18.592 -18.669 1.00 47.20  ? 171  MET A CA  1 
ATOM   1238 C C   . MET A 1 171 ? 13.744 17.950 -19.521 1.00 49.37  ? 171  MET A C   1 
ATOM   1239 O O   . MET A 1 171 ? 13.963 17.732 -20.701 1.00 47.37  ? 171  MET A O   1 
ATOM   1240 C CB  . MET A 1 171 ? 15.487 17.564 -17.710 1.00 48.69  ? 171  MET A CB  1 
ATOM   1241 C CG  . MET A 1 171 ? 16.257 16.447 -18.434 1.00 51.64  ? 171  MET A CG  1 
ATOM   1242 S SD  . MET A 1 171 ? 16.669 15.091 -17.308 1.00 55.26  ? 171  MET A SD  1 
ATOM   1243 C CE  . MET A 1 171 ? 17.190 13.914 -18.388 1.00 52.66  ? 171  MET A CE  1 
ATOM   1244 N N   . ALA A 1 172 ? 12.555 17.696 -18.944 1.00 48.90  ? 172  ALA A N   1 
ATOM   1245 C CA  . ALA A 1 172 ? 11.443 17.090 -19.697 1.00 50.47  ? 172  ALA A CA  1 
ATOM   1246 C C   . ALA A 1 172 ? 11.056 17.933 -20.905 1.00 55.98  ? 172  ALA A C   1 
ATOM   1247 O O   . ALA A 1 172 ? 10.795 17.371 -21.962 1.00 57.10  ? 172  ALA A O   1 
ATOM   1248 C CB  . ALA A 1 172 ? 10.235 16.870 -18.801 1.00 51.98  ? 172  ALA A CB  1 
ATOM   1249 N N   . LYS A 1 173 ? 11.071 19.276 -20.766 1.00 54.13  ? 173  LYS A N   1 
ATOM   1250 C CA  . LYS A 1 173 ? 10.737 20.215 -21.850 1.00 54.33  ? 173  LYS A CA  1 
ATOM   1251 C C   . LYS A 1 173 ? 11.827 20.207 -22.937 1.00 55.31  ? 173  LYS A C   1 
ATOM   1252 O O   . LYS A 1 173 ? 11.506 20.238 -24.113 1.00 55.71  ? 173  LYS A O   1 
ATOM   1253 C CB  . LYS A 1 173 ? 10.513 21.630 -21.283 1.00 58.38  ? 173  LYS A CB  1 
ATOM   1254 C CG  . LYS A 1 173 ? 9.948  22.639 -22.298 1.00 76.77  ? 173  LYS A CG  1 
ATOM   1255 C CD  . LYS A 1 173 ? 10.017 24.080 -21.793 1.00 86.77  ? 173  LYS A CD  1 
ATOM   1256 C CE  . LYS A 1 173 ? 9.595  25.090 -22.838 1.00 98.98  ? 173  LYS A CE  1 
ATOM   1257 N NZ  . LYS A 1 173 ? 8.117  25.258 -22.889 1.00 109.71 ? 173  LYS A NZ  1 
ATOM   1258 N N   . MET A 1 174 ? 13.108 20.126 -22.546 1.00 51.46  ? 174  MET A N   1 
ATOM   1259 C CA  . MET A 1 174 ? 14.224 20.099 -23.505 1.00 50.72  ? 174  MET A CA  1 
ATOM   1260 C C   . MET A 1 174 ? 14.211 18.834 -24.348 1.00 52.56  ? 174  MET A C   1 
ATOM   1261 O O   . MET A 1 174 ? 14.567 18.890 -25.525 1.00 51.59  ? 174  MET A O   1 
ATOM   1262 C CB  . MET A 1 174 ? 15.571 20.191 -22.785 1.00 53.09  ? 174  MET A CB  1 
ATOM   1263 C CG  . MET A 1 174 ? 15.867 21.541 -22.223 1.00 58.93  ? 174  MET A CG  1 
ATOM   1264 S SD  . MET A 1 174 ? 17.562 21.506 -21.623 1.00 64.02  ? 174  MET A SD  1 
ATOM   1265 C CE  . MET A 1 174 ? 18.266 22.817 -22.603 1.00 60.98  ? 174  MET A CE  1 
ATOM   1266 N N   . ILE A 1 175 ? 13.848 17.680 -23.730 1.00 48.36  ? 175  ILE A N   1 
ATOM   1267 C CA  . ILE A 1 175 ? 13.806 16.382 -24.408 1.00 47.69  ? 175  ILE A CA  1 
ATOM   1268 C C   . ILE A 1 175 ? 12.634 16.346 -25.331 1.00 53.28  ? 175  ILE A C   1 
ATOM   1269 O O   . ILE A 1 175 ? 12.815 15.984 -26.488 1.00 53.07  ? 175  ILE A O   1 
ATOM   1270 C CB  . ILE A 1 175 ? 13.840 15.174 -23.425 1.00 50.68  ? 175  ILE A CB  1 
ATOM   1271 C CG1 . ILE A 1 175 ? 15.103 15.223 -22.491 1.00 50.23  ? 175  ILE A CG1 1 
ATOM   1272 C CG2 . ILE A 1 175 ? 13.710 13.813 -24.160 1.00 51.48  ? 175  ILE A CG2 1 
ATOM   1273 C CD1 . ILE A 1 175 ? 16.509 15.352 -23.148 1.00 54.50  ? 175  ILE A CD1 1 
ATOM   1274 N N   . ASP A 1 176 ? 11.442 16.779 -24.853 1.00 51.96  ? 176  ASP A N   1 
ATOM   1275 C CA  . ASP A 1 176 ? 10.236 16.824 -25.679 1.00 53.31  ? 176  ASP A CA  1 
ATOM   1276 C C   . ASP A 1 176 ? 10.488 17.650 -26.953 1.00 56.47  ? 176  ASP A C   1 
ATOM   1277 O O   . ASP A 1 176 ? 10.185 17.185 -28.047 1.00 55.77  ? 176  ASP A O   1 
ATOM   1278 C CB  . ASP A 1 176 ? 9.031  17.381 -24.896 1.00 56.77  ? 176  ASP A CB  1 
ATOM   1279 C CG  . ASP A 1 176 ? 7.746  17.394 -25.732 1.00 75.66  ? 176  ASP A CG  1 
ATOM   1280 O OD1 . ASP A 1 176 ? 7.479  16.385 -26.435 1.00 76.78  ? 176  ASP A OD1 1 
ATOM   1281 O OD2 . ASP A 1 176 ? 7.024  18.426 -25.707 1.00 84.57  ? 176  ASP A OD2 1 
ATOM   1282 N N   . GLU A 1 177 ? 11.121 18.822 -26.809 1.00 54.19  ? 177  GLU A N   1 
ATOM   1283 C CA  . GLU A 1 177 ? 11.450 19.685 -27.947 1.00 55.16  ? 177  GLU A CA  1 
ATOM   1284 C C   . GLU A 1 177 ? 12.566 19.130 -28.824 1.00 59.58  ? 177  GLU A C   1 
ATOM   1285 O O   . GLU A 1 177 ? 12.522 19.339 -30.041 1.00 60.77  ? 177  GLU A O   1 
ATOM   1286 C CB  . GLU A 1 177 ? 11.705 21.121 -27.514 1.00 56.47  ? 177  GLU A CB  1 
ATOM   1287 C CG  . GLU A 1 177 ? 10.403 21.813 -27.135 1.00 73.40  ? 177  GLU A CG  1 
ATOM   1288 C CD  . GLU A 1 177 ? 10.467 23.216 -26.553 1.00 99.60  ? 177  GLU A CD  1 
ATOM   1289 O OE1 . GLU A 1 177 ? 9.384  23.781 -26.275 1.00 98.22  ? 177  GLU A OE1 1 
ATOM   1290 O OE2 . GLU A 1 177 ? 11.586 23.744 -26.357 1.00 90.87  ? 177  GLU A OE2 1 
ATOM   1291 N N   . ARG A 1 178 ? 13.531 18.374 -28.240 1.00 54.08  ? 178  ARG A N   1 
ATOM   1292 C CA  . ARG A 1 178 ? 14.589 17.777 -29.060 1.00 52.69  ? 178  ARG A CA  1 
ATOM   1293 C C   . ARG A 1 178 ? 14.062 16.622 -29.890 1.00 57.36  ? 178  ARG A C   1 
ATOM   1294 O O   . ARG A 1 178 ? 14.436 16.512 -31.065 1.00 57.34  ? 178  ARG A O   1 
ATOM   1295 C CB  . ARG A 1 178 ? 15.798 17.328 -28.225 1.00 51.07  ? 178  ARG A CB  1 
ATOM   1296 C CG  . ARG A 1 178 ? 16.885 16.580 -29.017 1.00 50.78  ? 178  ARG A CG  1 
ATOM   1297 C CD  . ARG A 1 178 ? 17.544 17.432 -30.102 1.00 46.12  ? 178  ARG A CD  1 
ATOM   1298 N NE  . ARG A 1 178 ? 18.554 16.649 -30.811 1.00 51.32  ? 178  ARG A NE  1 
ATOM   1299 C CZ  . ARG A 1 178 ? 19.440 17.155 -31.663 1.00 64.64  ? 178  ARG A CZ  1 
ATOM   1300 N NH1 . ARG A 1 178 ? 19.466 18.460 -31.908 1.00 52.73  ? 178  ARG A NH1 1 
ATOM   1301 N NH2 . ARG A 1 178 ? 20.329 16.362 -32.255 1.00 51.73  ? 178  ARG A NH2 1 
ATOM   1302 N N   . GLN A 1 179 ? 13.215 15.745 -29.295 1.00 52.58  ? 179  GLN A N   1 
ATOM   1303 C CA  . GLN A 1 179 ? 12.704 14.592 -30.041 1.00 52.41  ? 179  GLN A CA  1 
ATOM   1304 C C   . GLN A 1 179 ? 11.809 14.963 -31.246 1.00 60.07  ? 179  GLN A C   1 
ATOM   1305 O O   . GLN A 1 179 ? 11.863 14.283 -32.267 1.00 60.50  ? 179  GLN A O   1 
ATOM   1306 C CB  . GLN A 1 179 ? 12.073 13.548 -29.127 1.00 53.30  ? 179  GLN A CB  1 
ATOM   1307 C CG  . GLN A 1 179 ? 10.851 14.036 -28.358 1.00 51.83  ? 179  GLN A CG  1 
ATOM   1308 C CD  . GLN A 1 179 ? 9.573  13.923 -29.136 1.00 61.78  ? 179  GLN A CD  1 
ATOM   1309 O OE1 . GLN A 1 179 ? 9.458  13.140 -30.084 1.00 56.53  ? 179  GLN A OE1 1 
ATOM   1310 N NE2 . GLN A 1 179 ? 8.591  14.727 -28.767 1.00 54.76  ? 179  GLN A NE2 1 
ATOM   1311 N N   . GLN A 1 180 ? 11.023 16.055 -31.141 1.00 58.17  ? 180  GLN A N   1 
ATOM   1312 C CA  . GLN A 1 180 ? 10.171 16.561 -32.229 1.00 59.25  ? 180  GLN A CA  1 
ATOM   1313 C C   . GLN A 1 180 ? 11.045 16.900 -33.445 1.00 64.12  ? 180  GLN A C   1 
ATOM   1314 O O   . GLN A 1 180 ? 10.623 16.713 -34.580 1.00 66.21  ? 180  GLN A O   1 
ATOM   1315 C CB  . GLN A 1 180 ? 9.460  17.856 -31.791 1.00 60.51  ? 180  GLN A CB  1 
ATOM   1316 C CG  . GLN A 1 180 ? 8.194  17.647 -30.969 1.00 81.59  ? 180  GLN A CG  1 
ATOM   1317 C CD  . GLN A 1 180 ? 7.797  18.876 -30.170 1.00 105.75 ? 180  GLN A CD  1 
ATOM   1318 O OE1 . GLN A 1 180 ? 8.234  20.009 -30.433 1.00 103.18 ? 180  GLN A OE1 1 
ATOM   1319 N NE2 . GLN A 1 180 ? 6.973  18.674 -29.148 1.00 96.13  ? 180  GLN A NE2 1 
ATOM   1320 N N   . GLU A 1 181 ? 12.259 17.411 -33.185 1.00 58.98  ? 181  GLU A N   1 
ATOM   1321 C CA  . GLU A 1 181 ? 13.221 17.848 -34.185 1.00 58.47  ? 181  GLU A CA  1 
ATOM   1322 C C   . GLU A 1 181 ? 13.934 16.706 -34.892 1.00 62.40  ? 181  GLU A C   1 
ATOM   1323 O O   . GLU A 1 181 ? 14.503 16.934 -35.949 1.00 62.24  ? 181  GLU A O   1 
ATOM   1324 C CB  . GLU A 1 181 ? 14.240 18.827 -33.552 1.00 58.61  ? 181  GLU A CB  1 
ATOM   1325 N N   . LEU A 1 182 ? 13.921 15.489 -34.326 1.00 58.98  ? 182  LEU A N   1 
ATOM   1326 C CA  . LEU A 1 182 ? 14.655 14.372 -34.917 1.00 58.69  ? 182  LEU A CA  1 
ATOM   1327 C C   . LEU A 1 182 ? 13.917 13.663 -36.035 1.00 64.01  ? 182  LEU A C   1 
ATOM   1328 O O   . LEU A 1 182 ? 12.701 13.487 -35.963 1.00 64.72  ? 182  LEU A O   1 
ATOM   1329 C CB  . LEU A 1 182 ? 15.124 13.360 -33.854 1.00 57.95  ? 182  LEU A CB  1 
ATOM   1330 C CG  . LEU A 1 182 ? 16.038 13.854 -32.715 1.00 59.00  ? 182  LEU A CG  1 
ATOM   1331 C CD1 . LEU A 1 182 ? 16.136 12.792 -31.628 1.00 58.15  ? 182  LEU A CD1 1 
ATOM   1332 C CD2 . LEU A 1 182 ? 17.428 14.239 -33.218 1.00 57.05  ? 182  LEU A CD2 1 
ATOM   1333 N N   . THR A 1 183 ? 14.667 13.207 -37.045 1.00 61.18  ? 183  THR A N   1 
ATOM   1334 C CA  . THR A 1 183 ? 14.093 12.510 -38.206 1.00 62.57  ? 183  THR A CA  1 
ATOM   1335 C C   . THR A 1 183 ? 13.960 10.999 -37.996 1.00 68.30  ? 183  THR A C   1 
ATOM   1336 O O   . THR A 1 183 ? 12.972 10.413 -38.449 1.00 68.91  ? 183  THR A O   1 
ATOM   1337 C CB  . THR A 1 183 ? 14.791 12.885 -39.514 1.00 63.15  ? 183  THR A CB  1 
ATOM   1338 O OG1 . THR A 1 183 ? 16.112 12.363 -39.520 1.00 61.66  ? 183  THR A OG1 1 
ATOM   1339 C CG2 . THR A 1 183 ? 14.804 14.380 -39.766 1.00 59.61  ? 183  THR A CG2 1 
ATOM   1340 N N   A HIS A 1 184 ? 14.942 10.368 -37.318 0.59 64.16  ? 184  HIS A N   1 
ATOM   1341 N N   B HIS A 1 184 ? 14.930 10.388 -37.294 0.41 64.92  ? 184  HIS A N   1 
ATOM   1342 C CA  A HIS A 1 184 ? 14.892 8.932  -37.057 0.59 64.91  ? 184  HIS A CA  1 
ATOM   1343 C CA  B HIS A 1 184 ? 14.951 8.957  -37.000 0.41 66.11  ? 184  HIS A CA  1 
ATOM   1344 C C   A HIS A 1 184 ? 13.987 8.609  -35.872 0.59 68.50  ? 184  HIS A C   1 
ATOM   1345 C C   B HIS A 1 184 ? 13.996 8.611  -35.847 0.41 69.24  ? 184  HIS A C   1 
ATOM   1346 O O   A HIS A 1 184 ? 14.207 9.087  -34.755 0.59 65.58  ? 184  HIS A O   1 
ATOM   1347 O O   B HIS A 1 184 ? 14.187 9.084  -34.721 0.41 66.61  ? 184  HIS A O   1 
ATOM   1348 C CB  A HIS A 1 184 ? 16.288 8.330  -36.884 0.59 65.39  ? 184  HIS A CB  1 
ATOM   1349 C CB  B HIS A 1 184 ? 16.389 8.495  -36.705 0.41 66.77  ? 184  HIS A CB  1 
ATOM   1350 C CG  A HIS A 1 184 ? 16.308 6.838  -37.017 0.59 70.85  ? 184  HIS A CG  1 
ATOM   1351 C CG  B HIS A 1 184 ? 17.354 8.742  -37.827 0.41 70.83  ? 184  HIS A CG  1 
ATOM   1352 N ND1 A HIS A 1 184 ? 15.966 6.209  -38.209 0.59 74.58  ? 184  HIS A ND1 1 
ATOM   1353 N ND1 B HIS A 1 184 ? 17.141 8.223  -39.095 0.41 74.78  ? 184  HIS A ND1 1 
ATOM   1354 C CD2 A HIS A 1 184 ? 16.641 5.895  -36.107 0.59 72.92  ? 184  HIS A CD2 1 
ATOM   1355 C CD2 B HIS A 1 184 ? 18.528 9.416  -37.824 0.41 71.61  ? 184  HIS A CD2 1 
ATOM   1356 C CE1 A HIS A 1 184 ? 16.075 4.912  -37.972 0.59 75.62  ? 184  HIS A CE1 1 
ATOM   1357 C CE1 B HIS A 1 184 ? 18.171 8.624  -39.823 0.41 74.04  ? 184  HIS A CE1 1 
ATOM   1358 N NE2 A HIS A 1 184 ? 16.486 4.674  -36.726 0.59 74.92  ? 184  HIS A NE2 1 
ATOM   1359 N NE2 B HIS A 1 184 ? 19.030 9.345  -39.102 0.41 72.52  ? 184  HIS A NE2 1 
ATOM   1360 N N   . GLN A 1 185 ? 12.953 7.807  -36.145 1.00 67.86  ? 185  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 185 ? 11.926 7.372  -35.185 1.00 68.26  ? 185  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 185 ? 12.432 6.546  -34.027 1.00 71.34  ? 185  GLN A C   1 
ATOM   1363 O O   . GLN A 1 185 ? 11.995 6.778  -32.899 1.00 70.91  ? 185  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 185 ? 10.734 6.697  -35.889 1.00 71.92  ? 185  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 185 ? 9.977  7.641  -36.846 1.00 96.26  ? 185  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 185 ? 9.715  9.019  -36.269 1.00 116.66 ? 185  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 185 ? 8.982  9.186  -35.288 1.00 114.92 ? 185  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 185 ? 10.334 10.034 -36.853 1.00 106.41 ? 185  GLN A NE2 1 
ATOM   1369 N N   . GLU A 1 186 ? 13.372 5.622  -34.285 1.00 67.77  ? 186  GLU A N   1 
ATOM   1370 C CA  . GLU A 1 186 ? 13.981 4.771  -33.258 1.00 67.28  ? 186  GLU A CA  1 
ATOM   1371 C C   . GLU A 1 186 ? 14.619 5.628  -32.144 1.00 67.02  ? 186  GLU A C   1 
ATOM   1372 O O   . GLU A 1 186 ? 14.475 5.290  -30.967 1.00 65.22  ? 186  GLU A O   1 
ATOM   1373 C CB  . GLU A 1 186 ? 14.995 3.794  -33.893 1.00 70.69  ? 186  GLU A CB  1 
ATOM   1374 C CG  . GLU A 1 186 ? 15.696 2.841  -32.927 1.00 89.96  ? 186  GLU A CG  1 
ATOM   1375 C CD  . GLU A 1 186 ? 16.425 1.651  -33.531 1.00 125.99 ? 186  GLU A CD  1 
ATOM   1376 O OE1 . GLU A 1 186 ? 15.804 0.895  -34.315 1.00 128.63 ? 186  GLU A OE1 1 
ATOM   1377 O OE2 . GLU A 1 186 ? 17.613 1.455  -33.188 1.00 122.13 ? 186  GLU A OE2 1 
ATOM   1378 N N   . HIS A 1 187 ? 15.260 6.762  -32.522 1.00 61.46  ? 187  HIS A N   1 
ATOM   1379 C CA  . HIS A 1 187 ? 15.889 7.686  -31.583 1.00 59.70  ? 187  HIS A CA  1 
ATOM   1380 C C   . HIS A 1 187 ? 14.844 8.444  -30.777 1.00 61.61  ? 187  HIS A C   1 
ATOM   1381 O O   . HIS A 1 187 ? 15.024 8.605  -29.570 1.00 59.29  ? 187  HIS A O   1 
ATOM   1382 C CB  . HIS A 1 187 ? 16.839 8.649  -32.308 1.00 59.98  ? 187  HIS A CB  1 
ATOM   1383 C CG  . HIS A 1 187 ? 18.007 7.972  -32.967 1.00 64.73  ? 187  HIS A CG  1 
ATOM   1384 N ND1 . HIS A 1 187 ? 18.830 8.657  -33.847 1.00 66.55  ? 187  HIS A ND1 1 
ATOM   1385 C CD2 . HIS A 1 187 ? 18.460 6.697  -32.844 1.00 67.28  ? 187  HIS A CD2 1 
ATOM   1386 C CE1 . HIS A 1 187 ? 19.742 7.774  -34.235 1.00 66.93  ? 187  HIS A CE1 1 
ATOM   1387 N NE2 . HIS A 1 187 ? 19.563 6.588  -33.649 1.00 67.84  ? 187  HIS A NE2 1 
ATOM   1388 N N   . ARG A 1 188 ? 13.739 8.889  -31.441 1.00 56.98  ? 188  ARG A N   1 
ATOM   1389 C CA  . ARG A 1 188 ? 12.651 9.605  -30.774 1.00 55.55  ? 188  ARG A CA  1 
ATOM   1390 C C   . ARG A 1 188 ? 12.004 8.701  -29.716 1.00 58.66  ? 188  ARG A C   1 
ATOM   1391 O O   . ARG A 1 188 ? 11.829 9.128  -28.585 1.00 56.01  ? 188  ARG A O   1 
ATOM   1392 C CB  . ARG A 1 188 ? 11.592 10.085 -31.781 1.00 54.60  ? 188  ARG A CB  1 
ATOM   1393 C CG  . ARG A 1 188 ? 12.100 11.089 -32.804 1.00 61.73  ? 188  ARG A CG  1 
ATOM   1394 C CD  . ARG A 1 188 ? 11.006 11.497 -33.775 1.00 70.35  ? 188  ARG A CD  1 
ATOM   1395 N NE  . ARG A 1 188 ? 9.928  12.225 -33.106 1.00 83.92  ? 188  ARG A NE  1 
ATOM   1396 C CZ  . ARG A 1 188 ? 8.790  12.596 -33.686 1.00 107.79 ? 188  ARG A CZ  1 
ATOM   1397 N NH1 . ARG A 1 188 ? 8.558  12.301 -34.961 1.00 104.73 ? 188  ARG A NH1 1 
ATOM   1398 N NH2 . ARG A 1 188 ? 7.870  13.259 -32.994 1.00 91.82  ? 188  ARG A NH2 1 
ATOM   1399 N N   . VAL A 1 189 ? 11.700 7.440  -30.080 1.00 57.86  ? 189  VAL A N   1 
ATOM   1400 C CA  . VAL A 1 189 ? 11.082 6.465  -29.181 1.00 57.93  ? 189  VAL A CA  1 
ATOM   1401 C C   . VAL A 1 189 ? 11.940 6.266  -27.931 1.00 59.03  ? 189  VAL A C   1 
ATOM   1402 O O   . VAL A 1 189 ? 11.417 6.332  -26.822 1.00 57.65  ? 189  VAL A O   1 
ATOM   1403 C CB  . VAL A 1 189 ? 10.784 5.140  -29.918 1.00 64.06  ? 189  VAL A CB  1 
ATOM   1404 C CG1 . VAL A 1 189 ? 10.356 4.030  -28.949 1.00 64.49  ? 189  VAL A CG1 1 
ATOM   1405 C CG2 . VAL A 1 189 ? 9.738  5.348  -31.006 1.00 65.51  ? 189  VAL A CG2 1 
ATOM   1406 N N   . MET A 1 190 ? 13.254 6.082  -28.109 1.00 54.93  ? 190  MET A N   1 
ATOM   1407 C CA  . MET A 1 190 ? 14.161 5.885  -26.988 1.00 54.52  ? 190  MET A CA  1 
ATOM   1408 C C   . MET A 1 190 ? 14.229 7.097  -26.069 1.00 56.05  ? 190  MET A C   1 
ATOM   1409 O O   . MET A 1 190 ? 14.293 6.927  -24.855 1.00 56.00  ? 190  MET A O   1 
ATOM   1410 C CB  . MET A 1 190 ? 15.539 5.477  -27.474 1.00 57.76  ? 190  MET A CB  1 
ATOM   1411 C CG  . MET A 1 190 ? 15.580 4.076  -27.985 1.00 64.63  ? 190  MET A CG  1 
ATOM   1412 S SD  . MET A 1 190 ? 17.059 3.837  -28.983 1.00 70.99  ? 190  MET A SD  1 
ATOM   1413 C CE  . MET A 1 190 ? 18.099 3.175  -27.781 1.00 67.45  ? 190  MET A CE  1 
ATOM   1414 N N   . LEU A 1 191 ? 14.189 8.316  -26.637 1.00 50.74  ? 191  LEU A N   1 
ATOM   1415 C CA  . LEU A 1 191 ? 14.189 9.533  -25.831 1.00 49.13  ? 191  LEU A CA  1 
ATOM   1416 C C   . LEU A 1 191 ? 12.898 9.649  -25.015 1.00 53.13  ? 191  LEU A C   1 
ATOM   1417 O O   . LEU A 1 191 ? 12.977 9.813  -23.793 1.00 51.73  ? 191  LEU A O   1 
ATOM   1418 C CB  . LEU A 1 191 ? 14.429 10.787 -26.696 1.00 48.07  ? 191  LEU A CB  1 
ATOM   1419 C CG  . LEU A 1 191 ? 15.868 11.002 -27.215 1.00 50.79  ? 191  LEU A CG  1 
ATOM   1420 C CD1 . LEU A 1 191 ? 15.944 12.241 -28.083 1.00 50.12  ? 191  LEU A CD1 1 
ATOM   1421 C CD2 . LEU A 1 191 ? 16.876 11.148 -26.063 1.00 48.96  ? 191  LEU A CD2 1 
ATOM   1422 N N   . VAL A 1 192 ? 11.721 9.488  -25.684 1.00 50.66  ? 192  VAL A N   1 
ATOM   1423 C CA  . VAL A 1 192 ? 10.380 9.574  -25.080 1.00 50.30  ? 192  VAL A CA  1 
ATOM   1424 C C   . VAL A 1 192 ? 10.226 8.517  -23.958 1.00 52.87  ? 192  VAL A C   1 
ATOM   1425 O O   . VAL A 1 192 ? 9.833  8.860  -22.848 1.00 51.02  ? 192  VAL A O   1 
ATOM   1426 C CB  . VAL A 1 192 ? 9.263  9.488  -26.176 1.00 55.34  ? 192  VAL A CB  1 
ATOM   1427 C CG1 . VAL A 1 192 ? 7.858  9.417  -25.562 1.00 56.26  ? 192  VAL A CG1 1 
ATOM   1428 C CG2 . VAL A 1 192 ? 9.354  10.664 -27.141 1.00 54.66  ? 192  VAL A CG2 1 
ATOM   1429 N N   . ASN A 1 193 ? 10.567 7.254  -24.251 1.00 50.64  ? 193  ASN A N   1 
ATOM   1430 C CA  . ASN A 1 193 ? 10.478 6.143  -23.297 1.00 51.69  ? 193  ASN A CA  1 
ATOM   1431 C C   . ASN A 1 193 ? 11.268 6.406  -22.040 1.00 51.57  ? 193  ASN A C   1 
ATOM   1432 O O   . ASN A 1 193 ? 10.735 6.218  -20.945 1.00 51.78  ? 193  ASN A O   1 
ATOM   1433 C CB  . ASN A 1 193 ? 10.986 4.827  -23.911 1.00 50.96  ? 193  ASN A CB  1 
ATOM   1434 C CG  . ASN A 1 193 ? 10.049 4.149  -24.859 1.00 67.19  ? 193  ASN A CG  1 
ATOM   1435 O OD1 . ASN A 1 193 ? 8.895  4.555  -25.044 1.00 58.45  ? 193  ASN A OD1 1 
ATOM   1436 N ND2 . ASN A 1 193 ? 10.563 3.105  -25.504 1.00 56.24  ? 193  ASN A ND2 1 
ATOM   1437 N N   . SER A 1 194 ? 12.542 6.796  -22.201 1.00 46.00  ? 194  SER A N   1 
ATOM   1438 C CA  . SER A 1 194 ? 13.447 7.069  -21.082 1.00 45.98  ? 194  SER A CA  1 
ATOM   1439 C C   . SER A 1 194 ? 12.982 8.257  -20.267 1.00 48.34  ? 194  SER A C   1 
ATOM   1440 O O   . SER A 1 194 ? 13.014 8.190  -19.058 1.00 48.36  ? 194  SER A O   1 
ATOM   1441 C CB  . SER A 1 194 ? 14.871 7.311  -21.580 1.00 48.02  ? 194  SER A CB  1 
ATOM   1442 O OG  . SER A 1 194 ? 15.524 6.091  -21.868 1.00 49.84  ? 194  SER A OG  1 
ATOM   1443 N N   . MET A 1 195 ? 12.537 9.325  -20.923 1.00 47.43  ? 195  MET A N   1 
ATOM   1444 C CA  . MET A 1 195 ? 12.045 10.529 -20.261 1.00 47.83  ? 195  MET A CA  1 
ATOM   1445 C C   . MET A 1 195 ? 10.791 10.227 -19.447 1.00 52.40  ? 195  MET A C   1 
ATOM   1446 O O   . MET A 1 195 ? 10.690 10.691 -18.318 1.00 51.24  ? 195  MET A O   1 
ATOM   1447 C CB  . MET A 1 195 ? 11.827 11.660 -21.283 1.00 50.31  ? 195  MET A CB  1 
ATOM   1448 C CG  . MET A 1 195 ? 11.642 13.048 -20.669 1.00 54.58  ? 195  MET A CG  1 
ATOM   1449 S SD  . MET A 1 195 ? 12.717 13.543 -19.282 1.00 59.19  ? 195  MET A SD  1 
ATOM   1450 C CE  . MET A 1 195 ? 14.101 13.653 -19.999 1.00 54.73  ? 195  MET A CE  1 
ATOM   1451 N N   . ASN A 1 196 ? 9.861  9.421  -20.001 1.00 50.86  ? 196  ASN A N   1 
ATOM   1452 C CA  . ASN A 1 196 ? 8.634  9.024  -19.307 1.00 52.53  ? 196  ASN A CA  1 
ATOM   1453 C C   . ASN A 1 196 ? 8.936  8.253  -18.029 1.00 57.77  ? 196  ASN A C   1 
ATOM   1454 O O   . ASN A 1 196 ? 8.345  8.548  -16.990 1.00 58.27  ? 196  ASN A O   1 
ATOM   1455 C CB  . ASN A 1 196 ? 7.695  8.221  -20.217 1.00 54.34  ? 196  ASN A CB  1 
ATOM   1456 C CG  . ASN A 1 196 ? 6.995  9.071  -21.260 1.00 86.32  ? 196  ASN A CG  1 
ATOM   1457 O OD1 . ASN A 1 196 ? 6.898  10.305 -21.153 1.00 83.23  ? 196  ASN A OD1 1 
ATOM   1458 N ND2 . ASN A 1 196 ? 6.474  8.432  -22.292 1.00 78.18  ? 196  ASN A ND2 1 
ATOM   1459 N N   . THR A 1 197 ? 9.883  7.307  -18.092 1.00 54.13  ? 197  THR A N   1 
ATOM   1460 C CA  . THR A 1 197 ? 10.287 6.514  -16.924 1.00 53.71  ? 197  THR A CA  1 
ATOM   1461 C C   . THR A 1 197 ? 10.830 7.449  -15.820 1.00 55.29  ? 197  THR A C   1 
ATOM   1462 O O   . THR A 1 197 ? 10.378 7.360  -14.689 1.00 55.22  ? 197  THR A O   1 
ATOM   1463 C CB  . THR A 1 197 ? 11.278 5.428  -17.342 1.00 53.28  ? 197  THR A CB  1 
ATOM   1464 O OG1 . THR A 1 197 ? 10.681 4.678  -18.386 1.00 56.86  ? 197  THR A OG1 1 
ATOM   1465 C CG2 . THR A 1 197 ? 11.664 4.501  -16.184 1.00 47.52  ? 197  THR A CG2 1 
ATOM   1466 N N   . VAL A 1 198 ? 11.709 8.381  -16.180 1.00 51.40  ? 198  VAL A N   1 
ATOM   1467 C CA  . VAL A 1 198 ? 12.305 9.362  -15.253 1.00 51.50  ? 198  VAL A CA  1 
ATOM   1468 C C   . VAL A 1 198 ? 11.210 10.180 -14.537 1.00 57.34  ? 198  VAL A C   1 
ATOM   1469 O O   . VAL A 1 198 ? 11.181 10.196 -13.313 1.00 56.42  ? 198  VAL A O   1 
ATOM   1470 C CB  . VAL A 1 198 ? 13.371 10.245 -15.963 1.00 53.94  ? 198  VAL A CB  1 
ATOM   1471 C CG1 . VAL A 1 198 ? 13.971 11.280 -15.011 1.00 52.58  ? 198  VAL A CG1 1 
ATOM   1472 C CG2 . VAL A 1 198 ? 14.481 9.376  -16.528 1.00 53.79  ? 198  VAL A CG2 1 
ATOM   1473 N N   . LYS A 1 199 ? 10.275 10.776 -15.303 1.00 55.98  ? 199  LYS A N   1 
ATOM   1474 C CA  . LYS A 1 199 ? 9.135  11.548 -14.783 1.00 56.30  ? 199  LYS A CA  1 
ATOM   1475 C C   . LYS A 1 199 ? 8.264  10.673 -13.879 1.00 61.15  ? 199  LYS A C   1 
ATOM   1476 O O   . LYS A 1 199 ? 7.820  11.132 -12.826 1.00 62.71  ? 199  LYS A O   1 
ATOM   1477 C CB  . LYS A 1 199 ? 8.255  12.062 -15.936 1.00 59.18  ? 199  LYS A CB  1 
ATOM   1478 C CG  . LYS A 1 199 ? 8.882  13.152 -16.785 1.00 67.93  ? 199  LYS A CG  1 
ATOM   1479 C CD  . LYS A 1 199 ? 8.326  13.126 -18.225 1.00 78.87  ? 199  LYS A CD  1 
ATOM   1480 C CE  . LYS A 1 199 ? 7.093  13.960 -18.458 1.00 80.83  ? 199  LYS A CE  1 
ATOM   1481 N NZ  . LYS A 1 199 ? 6.959  14.327 -19.891 1.00 88.08  ? 199  LYS A NZ  1 
ATOM   1482 N N   . GLU A 1 200 ? 7.997  9.428  -14.294 1.00 56.35  ? 200  GLU A N   1 
ATOM   1483 C CA  . GLU A 1 200 ? 7.159  8.518  -13.513 1.00 56.76  ? 200  GLU A CA  1 
ATOM   1484 C C   . GLU A 1 200 ? 7.813  8.107  -12.195 1.00 58.00  ? 200  GLU A C   1 
ATOM   1485 O O   . GLU A 1 200 ? 7.120  7.950  -11.198 1.00 59.44  ? 200  GLU A O   1 
ATOM   1486 C CB  . GLU A 1 200 ? 6.792  7.276  -14.336 1.00 59.33  ? 200  GLU A CB  1 
ATOM   1487 C CG  . GLU A 1 200 ? 5.305  7.179  -14.625 1.00 77.31  ? 200  GLU A CG  1 
ATOM   1488 C CD  . GLU A 1 200 ? 4.929  6.094  -15.615 1.00 108.86 ? 200  GLU A CD  1 
ATOM   1489 O OE1 . GLU A 1 200 ? 4.404  5.042  -15.178 1.00 99.24  ? 200  GLU A OE1 1 
ATOM   1490 O OE2 . GLU A 1 200 ? 5.158  6.298  -16.831 1.00 103.44 ? 200  GLU A OE2 1 
ATOM   1491 N N   . LEU A 1 201 ? 9.135  7.923  -12.197 1.00 50.52  ? 201  LEU A N   1 
ATOM   1492 C CA  . LEU A 1 201 ? 9.865  7.500  -11.017 1.00 49.23  ? 201  LEU A CA  1 
ATOM   1493 C C   . LEU A 1 201 ? 10.181 8.616  -10.031 1.00 51.71  ? 201  LEU A C   1 
ATOM   1494 O O   . LEU A 1 201 ? 10.544 8.310  -8.891  1.00 49.46  ? 201  LEU A O   1 
ATOM   1495 C CB  . LEU A 1 201 ? 11.136 6.724  -11.398 1.00 48.55  ? 201  LEU A CB  1 
ATOM   1496 C CG  . LEU A 1 201 ? 10.933 5.320  -11.994 1.00 54.15  ? 201  LEU A CG  1 
ATOM   1497 C CD1 . LEU A 1 201 ? 12.248 4.627  -12.161 1.00 53.46  ? 201  LEU A CD1 1 
ATOM   1498 C CD2 . LEU A 1 201 ? 9.994  4.467  -11.143 1.00 56.56  ? 201  LEU A CD2 1 
ATOM   1499 N N   . LEU A 1 202 ? 10.059 9.898  -10.456 1.00 48.75  ? 202  LEU A N   1 
ATOM   1500 C CA  . LEU A 1 202 ? 10.345 11.045 -9.573  1.00 49.02  ? 202  LEU A CA  1 
ATOM   1501 C C   . LEU A 1 202 ? 9.438  11.062 -8.323  1.00 53.12  ? 202  LEU A C   1 
ATOM   1502 O O   . LEU A 1 202 ? 9.995  10.973 -7.229  1.00 53.08  ? 202  LEU A O   1 
ATOM   1503 C CB  . LEU A 1 202 ? 10.361 12.390 -10.342 1.00 48.86  ? 202  LEU A CB  1 
ATOM   1504 C CG  . LEU A 1 202 ? 10.418 13.698 -9.517  1.00 53.41  ? 202  LEU A CG  1 
ATOM   1505 C CD1 . LEU A 1 202 ? 11.680 13.797 -8.710  1.00 52.89  ? 202  LEU A CD1 1 
ATOM   1506 C CD2 . LEU A 1 202 ? 10.307 14.916 -10.431 1.00 53.68  ? 202  LEU A CD2 1 
ATOM   1507 N N   . PRO A 1 203 ? 8.077  11.044 -8.416  1.00 51.23  ? 203  PRO A N   1 
ATOM   1508 C CA  . PRO A 1 203 ? 7.261  10.988 -7.174  1.00 51.96  ? 203  PRO A CA  1 
ATOM   1509 C C   . PRO A 1 203 ? 7.552  9.750  -6.319  1.00 56.39  ? 203  PRO A C   1 
ATOM   1510 O O   . PRO A 1 203 ? 7.512  9.834  -5.097  1.00 57.76  ? 203  PRO A O   1 
ATOM   1511 C CB  . PRO A 1 203 ? 5.813  10.995 -7.689  1.00 54.57  ? 203  PRO A CB  1 
ATOM   1512 C CG  . PRO A 1 203 ? 5.909  10.558 -9.124  1.00 59.09  ? 203  PRO A CG  1 
ATOM   1513 C CD  . PRO A 1 203 ? 7.207  11.143 -9.608  1.00 53.30  ? 203  PRO A CD  1 
ATOM   1514 N N   . VAL A 1 204 ? 7.899  8.616  -6.963  1.00 51.03  ? 204  VAL A N   1 
ATOM   1515 C CA  . VAL A 1 204 ? 8.268  7.374  -6.279  1.00 49.75  ? 204  VAL A CA  1 
ATOM   1516 C C   . VAL A 1 204 ? 9.547  7.615  -5.486  1.00 52.30  ? 204  VAL A C   1 
ATOM   1517 O O   . VAL A 1 204 ? 9.649  7.119  -4.367  1.00 52.22  ? 204  VAL A O   1 
ATOM   1518 C CB  . VAL A 1 204 ? 8.377  6.170  -7.265  1.00 53.27  ? 204  VAL A CB  1 
ATOM   1519 C CG1 . VAL A 1 204 ? 8.930  4.919  -6.581  1.00 52.98  ? 204  VAL A CG1 1 
ATOM   1520 C CG2 . VAL A 1 204 ? 7.017  5.874  -7.893  1.00 54.05  ? 204  VAL A CG2 1 
ATOM   1521 N N   . LEU A 1 205 ? 10.502 8.410  -6.028  1.00 48.66  ? 205  LEU A N   1 
ATOM   1522 C CA  . LEU A 1 205 ? 11.745 8.725  -5.290  1.00 47.50  ? 205  LEU A CA  1 
ATOM   1523 C C   . LEU A 1 205 ? 11.417 9.579  -4.059  1.00 55.07  ? 205  LEU A C   1 
ATOM   1524 O O   . LEU A 1 205 ? 11.837 9.234  -2.943  1.00 54.89  ? 205  LEU A O   1 
ATOM   1525 C CB  . LEU A 1 205 ? 12.793 9.426  -6.164  1.00 45.49  ? 205  LEU A CB  1 
ATOM   1526 C CG  . LEU A 1 205 ? 14.032 9.981  -5.426  1.00 49.35  ? 205  LEU A CG  1 
ATOM   1527 C CD1 . LEU A 1 205 ? 14.826 8.862  -4.724  1.00 48.50  ? 205  LEU A CD1 1 
ATOM   1528 C CD2 . LEU A 1 205 ? 14.936 10.805 -6.374  1.00 46.60  ? 205  LEU A CD2 1 
ATOM   1529 N N   . ILE A 1 206 ? 10.630 10.662 -4.258  1.00 53.19  ? 206  ILE A N   1 
ATOM   1530 C CA  . ILE A 1 206 ? 10.243 11.546 -3.155  1.00 54.03  ? 206  ILE A CA  1 
ATOM   1531 C C   . ILE A 1 206 ? 9.529  10.765 -2.021  1.00 59.64  ? 206  ILE A C   1 
ATOM   1532 O O   . ILE A 1 206 ? 9.805  11.014 -0.842  1.00 60.04  ? 206  ILE A O   1 
ATOM   1533 C CB  . ILE A 1 206 ? 9.503  12.839 -3.648  1.00 56.66  ? 206  ILE A CB  1 
ATOM   1534 C CG1 . ILE A 1 206 ? 10.328 13.603 -4.726  1.00 55.71  ? 206  ILE A CG1 1 
ATOM   1535 C CG2 . ILE A 1 206 ? 9.131  13.784 -2.502  1.00 56.83  ? 206  ILE A CG2 1 
ATOM   1536 C CD1 . ILE A 1 206 ? 11.859 13.978 -4.367  1.00 52.18  ? 206  ILE A CD1 1 
ATOM   1537 N N   . SER A 1 207 ? 8.710  9.765  -2.387  1.00 56.28  ? 207  SER A N   1 
ATOM   1538 C CA  . SER A 1 207 ? 7.980  8.937  -1.420  1.00 57.49  ? 207  SER A CA  1 
ATOM   1539 C C   . SER A 1 207 ? 8.897  8.028  -0.650  1.00 62.55  ? 207  SER A C   1 
ATOM   1540 O O   . SER A 1 207 ? 8.680  7.825  0.547   1.00 62.44  ? 207  SER A O   1 
ATOM   1541 C CB  . SER A 1 207 ? 6.885  8.123  -2.101  1.00 58.79  ? 207  SER A CB  1 
ATOM   1542 O OG  . SER A 1 207 ? 5.925  9.011  -2.638  1.00 64.48  ? 207  SER A OG  1 
ATOM   1543 N N   . ALA A 1 208 ? 9.908  7.464  -1.339  1.00 59.70  ? 208  ALA A N   1 
ATOM   1544 C CA  . ALA A 1 208 ? 10.910 6.572  -0.746  1.00 59.78  ? 208  ALA A CA  1 
ATOM   1545 C C   . ALA A 1 208 ? 11.777 7.336  0.233   1.00 64.06  ? 208  ALA A C   1 
ATOM   1546 O O   . ALA A 1 208 ? 12.129 6.802  1.282   1.00 66.54  ? 208  ALA A O   1 
ATOM   1547 C CB  . ALA A 1 208 ? 11.773 5.943  -1.835  1.00 59.91  ? 208  ALA A CB  1 
ATOM   1548 N N   . MET A 1 209 ? 12.093 8.592  -0.092  1.00 58.50  ? 209  MET A N   1 
ATOM   1549 C CA  . MET A 1 209 ? 12.902 9.470  0.755   1.00 57.75  ? 209  MET A CA  1 
ATOM   1550 C C   . MET A 1 209 ? 12.106 9.944  1.968   1.00 65.99  ? 209  MET A C   1 
ATOM   1551 O O   . MET A 1 209 ? 12.703 10.250 2.996   1.00 66.42  ? 209  MET A O   1 
ATOM   1552 C CB  . MET A 1 209 ? 13.390 10.694 -0.038  1.00 58.52  ? 209  MET A CB  1 
ATOM   1553 C CG  . MET A 1 209 ? 14.374 10.360 -1.150  1.00 59.24  ? 209  MET A CG  1 
ATOM   1554 S SD  . MET A 1 209 ? 14.743 11.758 -2.227  1.00 60.62  ? 209  MET A SD  1 
ATOM   1555 C CE  . MET A 1 209 ? 15.781 12.675 -1.196  1.00 57.76  ? 209  MET A CE  1 
ATOM   1556 N N   . LYS A 1 210 ? 10.772 10.062 1.840   1.00 64.80  ? 210  LYS A N   1 
ATOM   1557 C CA  . LYS A 1 210 ? 9.938  10.491 2.953   1.00 66.60  ? 210  LYS A CA  1 
ATOM   1558 C C   . LYS A 1 210 ? 9.946  9.389  4.031   1.00 74.50  ? 210  LYS A C   1 
ATOM   1559 O O   . LYS A 1 210 ? 10.094 9.700  5.209   1.00 75.79  ? 210  LYS A O   1 
ATOM   1560 C CB  . LYS A 1 210 ? 8.519  10.829 2.480   1.00 68.95  ? 210  LYS A CB  1 
ATOM   1561 C CG  . LYS A 1 210 ? 7.629  11.392 3.576   1.00 80.81  ? 210  LYS A CG  1 
ATOM   1562 C CD  . LYS A 1 210 ? 6.174  11.328 3.190   1.00 89.36  ? 210  LYS A CD  1 
ATOM   1563 C CE  . LYS A 1 210 ? 5.254  11.429 4.379   1.00 94.03  ? 210  LYS A CE  1 
ATOM   1564 N NZ  . LYS A 1 210 ? 3.836  11.494 3.942   1.00 106.36 ? 210  LYS A NZ  1 
ATOM   1565 N N   . ILE A 1 211 ? 9.845  8.113  3.610   1.00 72.12  ? 211  ILE A N   1 
ATOM   1566 C CA  . ILE A 1 211 ? 9.883  6.931  4.473   1.00 73.40  ? 211  ILE A CA  1 
ATOM   1567 C C   . ILE A 1 211 ? 11.256 6.871  5.176   1.00 79.18  ? 211  ILE A C   1 
ATOM   1568 O O   . ILE A 1 211 ? 11.305 6.640  6.387   1.00 80.59  ? 211  ILE A O   1 
ATOM   1569 C CB  . ILE A 1 211 ? 9.515  5.633  3.682   1.00 76.72  ? 211  ILE A CB  1 
ATOM   1570 C CG1 . ILE A 1 211 ? 8.053  5.701  3.157   1.00 77.69  ? 211  ILE A CG1 1 
ATOM   1571 C CG2 . ILE A 1 211 ? 9.739  4.352  4.528   1.00 78.93  ? 211  ILE A CG2 1 
ATOM   1572 C CD1 . ILE A 1 211 ? 7.628  4.590  2.126   1.00 86.17  ? 211  ILE A CD1 1 
ATOM   1573 N N   . PHE A 1 212 ? 12.355 7.153  4.437   1.00 74.43  ? 212  PHE A N   1 
ATOM   1574 C CA  . PHE A 1 212 ? 13.708 7.186  5.011   1.00 73.22  ? 212  PHE A CA  1 
ATOM   1575 C C   . PHE A 1 212 ? 13.847 8.275  6.082   1.00 80.06  ? 212  PHE A C   1 
ATOM   1576 O O   . PHE A 1 212 ? 14.458 8.035  7.123   1.00 81.05  ? 212  PHE A O   1 
ATOM   1577 C CB  . PHE A 1 212 ? 14.780 7.336  3.924   1.00 72.70  ? 212  PHE A CB  1 
ATOM   1578 C CG  . PHE A 1 212 ? 16.179 7.430  4.478   1.00 73.02  ? 212  PHE A CG  1 
ATOM   1579 C CD1 . PHE A 1 212 ? 16.841 6.296  4.937   1.00 75.72  ? 212  PHE A CD1 1 
ATOM   1580 C CD2 . PHE A 1 212 ? 16.833 8.654  4.554   1.00 73.47  ? 212  PHE A CD2 1 
ATOM   1581 C CE1 . PHE A 1 212 ? 18.139 6.384  5.442   1.00 76.56  ? 212  PHE A CE1 1 
ATOM   1582 C CE2 . PHE A 1 212 ? 18.124 8.742  5.075   1.00 76.27  ? 212  PHE A CE2 1 
ATOM   1583 C CZ  . PHE A 1 212 ? 18.767 7.609  5.519   1.00 74.94  ? 212  PHE A CZ  1 
ATOM   1584 N N   . VAL A 1 213 ? 13.265 9.453  5.842   1.00 78.12  ? 213  VAL A N   1 
ATOM   1585 C CA  . VAL A 1 213 ? 13.293 10.553 6.802   1.00 80.01  ? 213  VAL A CA  1 
ATOM   1586 C C   . VAL A 1 213 ? 12.441 10.182 8.051   1.00 88.01  ? 213  VAL A C   1 
ATOM   1587 O O   . VAL A 1 213 ? 12.752 10.619 9.165   1.00 89.29  ? 213  VAL A O   1 
ATOM   1588 C CB  . VAL A 1 213 ? 12.888 11.891 6.128   1.00 83.93  ? 213  VAL A CB  1 
ATOM   1589 C CG1 . VAL A 1 213 ? 12.600 12.980 7.158   1.00 85.70  ? 213  VAL A CG1 1 
ATOM   1590 C CG2 . VAL A 1 213 ? 13.975 12.357 5.165   1.00 82.70  ? 213  VAL A CG2 1 
ATOM   1591 N N   . THR A 1 214 ? 11.422 9.317  7.859   1.00 85.19  ? 214  THR A N   1 
ATOM   1592 C CA  . THR A 1 214 ? 10.516 8.829  8.904   1.00 86.58  ? 214  THR A CA  1 
ATOM   1593 C C   . THR A 1 214 ? 11.157 7.715  9.775   1.00 92.18  ? 214  THR A C   1 
ATOM   1594 O O   . THR A 1 214 ? 11.003 7.750  11.001  1.00 92.61  ? 214  THR A O   1 
ATOM   1595 C CB  . THR A 1 214 ? 9.149  8.503  8.276   1.00 92.53  ? 214  THR A CB  1 
ATOM   1596 O OG1 . THR A 1 214 ? 8.560  9.732  7.835   1.00 88.23  ? 214  THR A OG1 1 
ATOM   1597 C CG2 . THR A 1 214 ? 8.197  7.782  9.233   1.00 94.69  ? 214  THR A CG2 1 
ATOM   1598 N N   . THR A 1 215 ? 11.892 6.755  9.145   1.00 88.61  ? 215  THR A N   1 
ATOM   1599 C CA  . THR A 1 215 ? 12.572 5.647  9.842   1.00 113.98 ? 215  THR A CA  1 
ATOM   1600 C C   . THR A 1 215 ? 13.891 6.116  10.469  1.00 145.20 ? 215  THR A C   1 
ATOM   1601 O O   . THR A 1 215 ? 13.893 6.966  11.359  1.00 111.68 ? 215  THR A O   1 
ATOM   1602 C CB  . THR A 1 215 ? 12.784 4.407  8.929   1.00 119.53 ? 215  THR A CB  1 
ATOM   1603 O OG1 . THR A 1 215 ? 13.769 4.685  7.935   1.00 119.20 ? 215  THR A OG1 1 
ATOM   1604 C CG2 . THR A 1 215 ? 11.493 3.894  8.283   1.00 116.38 ? 215  THR A CG2 1 
ATOM   1605 N N   . GLN A 1 221 ? 17.543 -1.807 10.868  1.00 114.79 ? 221  GLN A N   1 
ATOM   1606 C CA  . GLN A 1 221 ? 16.716 -2.870 10.297  1.00 114.68 ? 221  GLN A CA  1 
ATOM   1607 C C   . GLN A 1 221 ? 15.635 -2.296 9.374   1.00 117.51 ? 221  GLN A C   1 
ATOM   1608 O O   . GLN A 1 221 ? 15.603 -2.645 8.188   1.00 116.95 ? 221  GLN A O   1 
ATOM   1609 C CB  . GLN A 1 221 ? 16.089 -3.709 11.406  1.00 116.45 ? 221  GLN A CB  1 
ATOM   1610 N N   . GLY A 1 222 ? 14.782 -1.415 9.922   1.00 112.89 ? 222  GLY A N   1 
ATOM   1611 C CA  . GLY A 1 222 ? 13.719 -0.733 9.184   1.00 111.00 ? 222  GLY A CA  1 
ATOM   1612 C C   . GLY A 1 222 ? 14.281 0.290  8.217   1.00 111.20 ? 222  GLY A C   1 
ATOM   1613 O O   . GLY A 1 222 ? 13.706 0.536  7.152   1.00 109.63 ? 222  GLY A O   1 
ATOM   1614 N N   . ILE A 1 223 ? 15.437 0.871  8.591   1.00 106.53 ? 223  ILE A N   1 
ATOM   1615 C CA  . ILE A 1 223 ? 16.183 1.852  7.810   1.00 104.93 ? 223  ILE A CA  1 
ATOM   1616 C C   . ILE A 1 223 ? 16.758 1.227  6.527   1.00 106.49 ? 223  ILE A C   1 
ATOM   1617 O O   . ILE A 1 223 ? 16.696 1.864  5.478   1.00 105.87 ? 223  ILE A O   1 
ATOM   1618 C CB  . ILE A 1 223 ? 17.239 2.601  8.681   1.00 108.39 ? 223  ILE A CB  1 
ATOM   1619 C CG1 . ILE A 1 223 ? 17.624 3.957  8.057   1.00 108.23 ? 223  ILE A CG1 1 
ATOM   1620 C CG2 . ILE A 1 223 ? 18.471 1.731  9.022   1.00 109.99 ? 223  ILE A CG2 1 
ATOM   1621 C CD1 . ILE A 1 223 ? 18.117 5.060  9.048   1.00 116.64 ? 223  ILE A CD1 1 
ATOM   1622 N N   . GLU A 1 224 ? 17.266 -0.030 6.614   1.00 101.41 ? 224  GLU A N   1 
ATOM   1623 C CA  . GLU A 1 224 ? 17.871 -0.799 5.518   1.00 100.36 ? 224  GLU A CA  1 
ATOM   1624 C C   . GLU A 1 224 ? 16.926 -1.054 4.336   1.00 100.68 ? 224  GLU A C   1 
ATOM   1625 O O   . GLU A 1 224 ? 17.394 -1.157 3.205   1.00 99.26  ? 224  GLU A O   1 
ATOM   1626 C CB  . GLU A 1 224 ? 18.451 -2.120 6.046   1.00 103.16 ? 224  GLU A CB  1 
ATOM   1627 C CG  . GLU A 1 224 ? 19.607 -2.672 5.222   1.00 117.15 ? 224  GLU A CG  1 
ATOM   1628 C CD  . GLU A 1 224 ? 20.966 -2.001 5.341   1.00 144.69 ? 224  GLU A CD  1 
ATOM   1629 O OE1 . GLU A 1 224 ? 21.141 -1.117 6.212   1.00 143.10 ? 224  GLU A OE1 1 
ATOM   1630 O OE2 . GLU A 1 224 ? 21.873 -2.386 4.567   1.00 140.26 ? 224  GLU A OE2 1 
ATOM   1631 N N   . GLU A 1 225 ? 15.608 -1.146 4.602   1.00 96.00  ? 225  GLU A N   1 
ATOM   1632 C CA  . GLU A 1 225 ? 14.576 -1.365 3.586   1.00 94.98  ? 225  GLU A CA  1 
ATOM   1633 C C   . GLU A 1 225 ? 14.234 -0.058 2.839   1.00 95.10  ? 225  GLU A C   1 
ATOM   1634 O O   . GLU A 1 225 ? 14.199 -0.063 1.603   1.00 94.46  ? 225  GLU A O   1 
ATOM   1635 C CB  . GLU A 1 225 ? 13.321 -2.008 4.214   1.00 97.17  ? 225  GLU A CB  1 
ATOM   1636 C CG  . GLU A 1 225 ? 12.395 -2.683 3.214   1.00 108.72 ? 225  GLU A CG  1 
ATOM   1637 C CD  . GLU A 1 225 ? 11.233 -3.438 3.830   1.00 127.09 ? 225  GLU A CD  1 
ATOM   1638 O OE1 . GLU A 1 225 ? 11.467 -4.534 4.388   1.00 120.72 ? 225  GLU A OE1 1 
ATOM   1639 O OE2 . GLU A 1 225 ? 10.082 -2.954 3.720   1.00 118.53 ? 225  GLU A OE2 1 
ATOM   1640 N N   . ALA A 1 226 ? 13.992 1.052  3.588   1.00 88.73  ? 226  ALA A N   1 
ATOM   1641 C CA  . ALA A 1 226 ? 13.662 2.377  3.037   1.00 86.73  ? 226  ALA A CA  1 
ATOM   1642 C C   . ALA A 1 226 ? 14.824 2.931  2.217   1.00 86.53  ? 226  ALA A C   1 
ATOM   1643 O O   . ALA A 1 226 ? 14.598 3.588  1.202   1.00 85.63  ? 226  ALA A O   1 
ATOM   1644 C CB  . ALA A 1 226 ? 13.313 3.344  4.153   1.00 87.86  ? 226  ALA A CB  1 
ATOM   1645 N N   . LEU A 1 227 ? 16.062 2.641  2.662   1.00 80.09  ? 227  LEU A N   1 
ATOM   1646 C CA  . LEU A 1 227 ? 17.306 3.022  2.007   1.00 78.22  ? 227  LEU A CA  1 
ATOM   1647 C C   . LEU A 1 227 ? 17.449 2.244  0.690   1.00 77.55  ? 227  LEU A C   1 
ATOM   1648 O O   . LEU A 1 227 ? 17.844 2.832  -0.315  1.00 74.76  ? 227  LEU A O   1 
ATOM   1649 C CB  . LEU A 1 227 ? 18.487 2.724  2.941   1.00 79.12  ? 227  LEU A CB  1 
ATOM   1650 C CG  . LEU A 1 227 ? 19.873 3.091  2.450   1.00 84.66  ? 227  LEU A CG  1 
ATOM   1651 C CD1 . LEU A 1 227 ? 20.611 3.901  3.492   1.00 85.99  ? 227  LEU A CD1 1 
ATOM   1652 C CD2 . LEU A 1 227 ? 20.668 1.846  2.102   1.00 88.31  ? 227  LEU A CD2 1 
ATOM   1653 N N   . LYS A 1 228 ? 17.142 0.923  0.707   1.00 72.71  ? 228  LYS A N   1 
ATOM   1654 C CA  . LYS A 1 228 ? 17.240 0.055  -0.470  1.00 71.51  ? 228  LYS A CA  1 
ATOM   1655 C C   . LYS A 1 228 ? 16.344 0.534  -1.608  1.00 69.42  ? 228  LYS A C   1 
ATOM   1656 O O   . LYS A 1 228 ? 16.786 0.571  -2.760  1.00 67.61  ? 228  LYS A O   1 
ATOM   1657 C CB  . LYS A 1 228 ? 16.927 -1.406 -0.117  1.00 75.60  ? 228  LYS A CB  1 
ATOM   1658 N N   . ASN A 1 229 ? 15.110 0.934  -1.270  1.00 62.16  ? 229  ASN A N   1 
ATOM   1659 C CA  . ASN A 1 229 ? 14.123 1.403  -2.230  1.00 60.52  ? 229  ASN A CA  1 
ATOM   1660 C C   . ASN A 1 229 ? 14.451 2.762  -2.795  1.00 61.65  ? 229  ASN A C   1 
ATOM   1661 O O   . ASN A 1 229 ? 14.192 3.007  -3.969  1.00 62.36  ? 229  ASN A O   1 
ATOM   1662 C CB  . ASN A 1 229 ? 12.714 1.345  -1.639  1.00 59.77  ? 229  ASN A CB  1 
ATOM   1663 C CG  . ASN A 1 229 ? 12.221 -0.084 -1.465  1.00 90.77  ? 229  ASN A CG  1 
ATOM   1664 O OD1 . ASN A 1 229 ? 12.392 -0.948 -2.345  1.00 78.18  ? 229  ASN A OD1 1 
ATOM   1665 N ND2 . ASN A 1 229 ? 11.632 -0.379 -0.304  1.00 87.63  ? 229  ASN A ND2 1 
ATOM   1666 N N   . ARG A 1 230 ? 15.020 3.642  -1.976  1.00 55.32  ? 230  ARG A N   1 
ATOM   1667 C CA  . ARG A 1 230 ? 15.433 4.964  -2.400  1.00 53.54  ? 230  ARG A CA  1 
ATOM   1668 C C   . ARG A 1 230 ? 16.630 4.798  -3.344  1.00 56.12  ? 230  ARG A C   1 
ATOM   1669 O O   . ARG A 1 230 ? 16.633 5.406  -4.407  1.00 56.00  ? 230  ARG A O   1 
ATOM   1670 C CB  . ARG A 1 230 ? 15.793 5.821  -1.183  1.00 51.54  ? 230  ARG A CB  1 
ATOM   1671 C CG  . ARG A 1 230 ? 16.166 7.260  -1.538  1.00 49.34  ? 230  ARG A CG  1 
ATOM   1672 C CD  . ARG A 1 230 ? 17.041 7.875  -0.477  1.00 56.21  ? 230  ARG A CD  1 
ATOM   1673 N NE  . ARG A 1 230 ? 18.338 7.197  -0.391  1.00 66.48  ? 230  ARG A NE  1 
ATOM   1674 C CZ  . ARG A 1 230 ? 19.085 7.121  0.705   1.00 69.69  ? 230  ARG A CZ  1 
ATOM   1675 N NH1 . ARG A 1 230 ? 18.682 7.695  1.835   1.00 52.55  ? 230  ARG A NH1 1 
ATOM   1676 N NH2 . ARG A 1 230 ? 20.245 6.480  0.678   1.00 54.26  ? 230  ARG A NH2 1 
ATOM   1677 N N   . ASN A 1 231 ? 17.621 3.958  -2.969  1.00 51.37  ? 231  ASN A N   1 
ATOM   1678 C CA  . ASN A 1 231 ? 18.796 3.682  -3.792  1.00 51.04  ? 231  ASN A CA  1 
ATOM   1679 C C   . ASN A 1 231 ? 18.432 3.001  -5.111  1.00 53.73  ? 231  ASN A C   1 
ATOM   1680 O O   . ASN A 1 231 ? 19.106 3.238  -6.109  1.00 54.50  ? 231  ASN A O   1 
ATOM   1681 C CB  . ASN A 1 231 ? 19.827 2.836  -3.031  1.00 51.95  ? 231  ASN A CB  1 
ATOM   1682 C CG  . ASN A 1 231 ? 20.496 3.522  -1.857  1.00 68.72  ? 231  ASN A CG  1 
ATOM   1683 O OD1 . ASN A 1 231 ? 20.380 4.733  -1.633  1.00 55.20  ? 231  ASN A OD1 1 
ATOM   1684 N ND2 . ASN A 1 231 ? 21.206 2.744  -1.066  1.00 60.85  ? 231  ASN A ND2 1 
ATOM   1685 N N   . PHE A 1 232 ? 17.387 2.149  -5.107  1.00 49.09  ? 232  PHE A N   1 
ATOM   1686 C CA  . PHE A 1 232 ? 16.887 1.419  -6.286  1.00 48.59  ? 232  PHE A CA  1 
ATOM   1687 C C   . PHE A 1 232 ? 16.335 2.417  -7.301  1.00 51.43  ? 232  PHE A C   1 
ATOM   1688 O O   . PHE A 1 232 ? 16.647 2.302  -8.479  1.00 51.78  ? 232  PHE A O   1 
ATOM   1689 C CB  . PHE A 1 232 ? 15.768 0.414  -5.880  1.00 51.05  ? 232  PHE A CB  1 
ATOM   1690 C CG  . PHE A 1 232 ? 14.988 -0.181 -7.034  1.00 53.02  ? 232  PHE A CG  1 
ATOM   1691 C CD1 . PHE A 1 232 ? 15.411 -1.352 -7.652  1.00 56.46  ? 232  PHE A CD1 1 
ATOM   1692 C CD2 . PHE A 1 232 ? 13.853 0.452  -7.529  1.00 53.25  ? 232  PHE A CD2 1 
ATOM   1693 C CE1 . PHE A 1 232 ? 14.692 -1.895 -8.716  1.00 57.88  ? 232  PHE A CE1 1 
ATOM   1694 C CE2 . PHE A 1 232 ? 13.168 -0.066 -8.625  1.00 55.80  ? 232  PHE A CE2 1 
ATOM   1695 C CZ  . PHE A 1 232 ? 13.588 -1.237 -9.210  1.00 55.29  ? 232  PHE A CZ  1 
ATOM   1696 N N   . THR A 1 233 ? 15.493 3.374  -6.835  1.00 47.89  ? 233  THR A N   1 
ATOM   1697 C CA  . THR A 1 233 ? 14.848 4.407  -7.650  1.00 47.34  ? 233  THR A CA  1 
ATOM   1698 C C   . THR A 1 233 ? 15.872 5.324  -8.275  1.00 51.06  ? 233  THR A C   1 
ATOM   1699 O O   . THR A 1 233 ? 15.749 5.636  -9.457  1.00 51.16  ? 233  THR A O   1 
ATOM   1700 C CB  . THR A 1 233 ? 13.793 5.198  -6.851  1.00 54.81  ? 233  THR A CB  1 
ATOM   1701 O OG1 . THR A 1 233 ? 12.956 4.291  -6.119  1.00 53.88  ? 233  THR A OG1 1 
ATOM   1702 C CG2 . THR A 1 233 ? 12.931 6.092  -7.766  1.00 50.66  ? 233  THR A CG2 1 
ATOM   1703 N N   . VAL A 1 234 ? 16.891 5.740  -7.494  1.00 47.58  ? 234  VAL A N   1 
ATOM   1704 C CA  . VAL A 1 234 ? 17.970 6.611  -7.979  1.00 46.40  ? 234  VAL A CA  1 
ATOM   1705 C C   . VAL A 1 234 ? 18.718 5.890  -9.099  1.00 50.47  ? 234  VAL A C   1 
ATOM   1706 O O   . VAL A 1 234 ? 18.949 6.485  -10.139 1.00 51.07  ? 234  VAL A O   1 
ATOM   1707 C CB  . VAL A 1 234 ? 18.911 7.063  -6.827  1.00 49.56  ? 234  VAL A CB  1 
ATOM   1708 C CG1 . VAL A 1 234 ? 20.200 7.691  -7.361  1.00 49.39  ? 234  VAL A CG1 1 
ATOM   1709 C CG2 . VAL A 1 234 ? 18.194 8.033  -5.894  1.00 48.37  ? 234  VAL A CG2 1 
ATOM   1710 N N   . GLU A 1 235 ? 19.035 4.598  -8.898  1.00 47.48  ? 235  GLU A N   1 
ATOM   1711 C CA  . GLU A 1 235 ? 19.715 3.716  -9.853  1.00 47.66  ? 235  GLU A CA  1 
ATOM   1712 C C   . GLU A 1 235 ? 18.932 3.612  -11.176 1.00 49.65  ? 235  GLU A C   1 
ATOM   1713 O O   . GLU A 1 235 ? 19.520 3.798  -12.242 1.00 48.08  ? 235  GLU A O   1 
ATOM   1714 C CB  . GLU A 1 235 ? 19.924 2.325  -9.225  1.00 50.27  ? 235  GLU A CB  1 
ATOM   1715 C CG  . GLU A 1 235 ? 20.591 1.327  -10.154 1.00 62.72  ? 235  GLU A CG  1 
ATOM   1716 C CD  . GLU A 1 235 ? 20.687 -0.100 -9.651  1.00 89.33  ? 235  GLU A CD  1 
ATOM   1717 O OE1 . GLU A 1 235 ? 21.635 -0.802 -10.074 1.00 101.81 ? 235  GLU A OE1 1 
ATOM   1718 O OE2 . GLU A 1 235 ? 19.814 -0.527 -8.859  1.00 74.52  ? 235  GLU A OE2 1 
ATOM   1719 N N   . LYS A 1 236 ? 17.611 3.324  -11.096 1.00 46.20  ? 236  LYS A N   1 
ATOM   1720 C CA  . LYS A 1 236 ? 16.744 3.218  -12.276 1.00 46.10  ? 236  LYS A CA  1 
ATOM   1721 C C   . LYS A 1 236 ? 16.616 4.568  -12.985 1.00 48.10  ? 236  LYS A C   1 
ATOM   1722 O O   . LYS A 1 236 ? 16.700 4.616  -14.205 1.00 47.66  ? 236  LYS A O   1 
ATOM   1723 C CB  . LYS A 1 236 ? 15.357 2.626  -11.925 1.00 48.63  ? 236  LYS A CB  1 
ATOM   1724 C CG  . LYS A 1 236 ? 15.405 1.199  -11.329 1.00 57.69  ? 236  LYS A CG  1 
ATOM   1725 C CD  . LYS A 1 236 ? 16.204 0.198  -12.199 1.00 57.10  ? 236  LYS A CD  1 
ATOM   1726 C CE  . LYS A 1 236 ? 16.914 -0.827 -11.353 1.00 67.89  ? 236  LYS A CE  1 
ATOM   1727 N NZ  . LYS A 1 236 ? 17.767 -1.714 -12.182 1.00 83.21  ? 236  LYS A NZ  1 
ATOM   1728 N N   . MET A 1 237 ? 16.473 5.661  -12.227 1.00 43.67  ? 237  MET A N   1 
ATOM   1729 C CA  . MET A 1 237 ? 16.375 6.996  -12.842 1.00 42.69  ? 237  MET A CA  1 
ATOM   1730 C C   . MET A 1 237 ? 17.694 7.387  -13.485 1.00 44.94  ? 237  MET A C   1 
ATOM   1731 O O   . MET A 1 237 ? 17.681 7.870  -14.598 1.00 43.64  ? 237  MET A O   1 
ATOM   1732 C CB  . MET A 1 237 ? 15.942 8.060  -11.817 1.00 43.92  ? 237  MET A CB  1 
ATOM   1733 C CG  . MET A 1 237 ? 14.466 7.993  -11.461 1.00 47.37  ? 237  MET A CG  1 
ATOM   1734 S SD  . MET A 1 237 ? 14.109 9.014  -10.006 1.00 50.98  ? 237  MET A SD  1 
ATOM   1735 C CE  . MET A 1 237 ? 13.904 10.606 -10.807 1.00 47.63  ? 237  MET A CE  1 
ATOM   1736 N N   . SER A 1 238 ? 18.827 7.121  -12.814 1.00 42.64  ? 238  SER A N   1 
ATOM   1737 C CA  . SER A 1 238 ? 20.167 7.423  -13.337 1.00 42.12  ? 238  SER A CA  1 
ATOM   1738 C C   . SER A 1 238 ? 20.488 6.678  -14.619 1.00 47.90  ? 238  SER A C   1 
ATOM   1739 O O   . SER A 1 238 ? 21.076 7.277  -15.514 1.00 49.41  ? 238  SER A O   1 
ATOM   1740 C CB  . SER A 1 238 ? 21.235 7.163  -12.280 1.00 44.51  ? 238  SER A CB  1 
ATOM   1741 O OG  . SER A 1 238 ? 20.972 7.945  -11.125 1.00 48.05  ? 238  SER A OG  1 
ATOM   1742 N N   . ALA A 1 239 ? 20.080 5.385  -14.733 1.00 45.08  ? 239  ALA A N   1 
ATOM   1743 C CA  . ALA A 1 239 ? 20.306 4.566  -15.929 1.00 44.75  ? 239  ALA A CA  1 
ATOM   1744 C C   . ALA A 1 239 ? 19.543 5.136  -17.141 1.00 50.44  ? 239  ALA A C   1 
ATOM   1745 O O   . ALA A 1 239 ? 20.055 5.124  -18.261 1.00 51.27  ? 239  ALA A O   1 
ATOM   1746 C CB  . ALA A 1 239 ? 19.879 3.139  -15.673 1.00 45.76  ? 239  ALA A CB  1 
ATOM   1747 N N   . GLU A 1 240 ? 18.328 5.656  -16.910 1.00 46.23  ? 240  GLU A N   1 
ATOM   1748 C CA  . GLU A 1 240 ? 17.523 6.242  -17.979 1.00 44.92  ? 240  GLU A CA  1 
ATOM   1749 C C   . GLU A 1 240 ? 18.141 7.538  -18.424 1.00 48.15  ? 240  GLU A C   1 
ATOM   1750 O O   . GLU A 1 240 ? 18.234 7.787  -19.628 1.00 49.62  ? 240  GLU A O   1 
ATOM   1751 C CB  . GLU A 1 240 ? 16.056 6.443  -17.533 1.00 45.66  ? 240  GLU A CB  1 
ATOM   1752 C CG  . GLU A 1 240 ? 15.297 5.151  -17.243 1.00 53.71  ? 240  GLU A CG  1 
ATOM   1753 C CD  . GLU A 1 240 ? 15.164 4.151  -18.386 1.00 76.99  ? 240  GLU A CD  1 
ATOM   1754 O OE1 . GLU A 1 240 ? 15.208 4.566  -19.567 1.00 80.70  ? 240  GLU A OE1 1 
ATOM   1755 O OE2 . GLU A 1 240 ? 15.015 2.942  -18.096 1.00 73.39  ? 240  GLU A OE2 1 
ATOM   1756 N N   . ILE A 1 241 ? 18.603 8.358  -17.469 1.00 43.57  ? 241  ILE A N   1 
ATOM   1757 C CA  . ILE A 1 241 ? 19.256 9.634  -17.809 1.00 43.24  ? 241  ILE A CA  1 
ATOM   1758 C C   . ILE A 1 241 ? 20.535 9.402  -18.635 1.00 48.10  ? 241  ILE A C   1 
ATOM   1759 O O   . ILE A 1 241 ? 20.737 10.079 -19.640 1.00 48.63  ? 241  ILE A O   1 
ATOM   1760 C CB  . ILE A 1 241 ? 19.475 10.561 -16.590 1.00 45.23  ? 241  ILE A CB  1 
ATOM   1761 C CG1 . ILE A 1 241 ? 18.107 11.024 -16.052 1.00 45.46  ? 241  ILE A CG1 1 
ATOM   1762 C CG2 . ILE A 1 241 ? 20.346 11.785 -16.989 1.00 44.67  ? 241  ILE A CG2 1 
ATOM   1763 C CD1 . ILE A 1 241 ? 18.189 11.751 -14.703 1.00 48.01  ? 241  ILE A CD1 1 
ATOM   1764 N N   . ASN A 1 242 ? 21.363 8.429  -18.236 1.00 45.14  ? 242  ASN A N   1 
ATOM   1765 C CA  . ASN A 1 242 ? 22.582 8.085  -18.978 1.00 45.89  ? 242  ASN A CA  1 
ATOM   1766 C C   . ASN A 1 242 ? 22.248 7.544  -20.375 1.00 50.96  ? 242  ASN A C   1 
ATOM   1767 O O   . ASN A 1 242 ? 23.017 7.764  -21.316 1.00 51.44  ? 242  ASN A O   1 
ATOM   1768 C CB  . ASN A 1 242 ? 23.432 7.096  -18.188 1.00 46.78  ? 242  ASN A CB  1 
ATOM   1769 C CG  . ASN A 1 242 ? 24.216 7.758  -17.088 1.00 61.56  ? 242  ASN A CG  1 
ATOM   1770 O OD1 . ASN A 1 242 ? 25.024 8.662  -17.310 1.00 61.40  ? 242  ASN A OD1 1 
ATOM   1771 N ND2 . ASN A 1 242 ? 23.992 7.333  -15.873 1.00 54.48  ? 242  ASN A ND2 1 
ATOM   1772 N N   . GLU A 1 243 ? 21.074 6.898  -20.527 1.00 46.59  ? 243  GLU A N   1 
ATOM   1773 C CA  . GLU A 1 243 ? 20.625 6.431  -21.842 1.00 46.72  ? 243  GLU A CA  1 
ATOM   1774 C C   . GLU A 1 243 ? 20.218 7.641  -22.706 1.00 49.92  ? 243  GLU A C   1 
ATOM   1775 O O   . GLU A 1 243 ? 20.430 7.626  -23.912 1.00 50.60  ? 243  GLU A O   1 
ATOM   1776 C CB  . GLU A 1 243 ? 19.486 5.389  -21.703 1.00 48.50  ? 243  GLU A CB  1 
ATOM   1777 C CG  . GLU A 1 243 ? 18.932 4.832  -23.011 1.00 57.29  ? 243  GLU A CG  1 
ATOM   1778 C CD  . GLU A 1 243 ? 19.807 3.926  -23.871 1.00 81.11  ? 243  GLU A CD  1 
ATOM   1779 O OE1 . GLU A 1 243 ? 21.028 3.794  -23.611 1.00 60.11  ? 243  GLU A OE1 1 
ATOM   1780 O OE2 . GLU A 1 243 ? 19.249 3.337  -24.824 1.00 77.76  ? 243  GLU A OE2 1 
ATOM   1781 N N   . ILE A 1 244 ? 19.631 8.675  -22.089 1.00 46.49  ? 244  ILE A N   1 
ATOM   1782 C CA  . ILE A 1 244 ? 19.209 9.891  -22.796 1.00 45.14  ? 244  ILE A CA  1 
ATOM   1783 C C   . ILE A 1 244 ? 20.462 10.593 -23.314 1.00 49.95  ? 244  ILE A C   1 
ATOM   1784 O O   . ILE A 1 244 ? 20.521 10.905 -24.489 1.00 50.33  ? 244  ILE A O   1 
ATOM   1785 C CB  . ILE A 1 244 ? 18.318 10.801 -21.903 1.00 46.77  ? 244  ILE A CB  1 
ATOM   1786 C CG1 . ILE A 1 244 ? 16.924 10.167 -21.711 1.00 46.89  ? 244  ILE A CG1 1 
ATOM   1787 C CG2 . ILE A 1 244 ? 18.182 12.215 -22.524 1.00 45.36  ? 244  ILE A CG2 1 
ATOM   1788 C CD1 . ILE A 1 244 ? 16.032 10.830 -20.567 1.00 44.94  ? 244  ILE A CD1 1 
ATOM   1789 N N   . ILE A 1 245 ? 21.486 10.774 -22.451 1.00 47.02  ? 245  ILE A N   1 
ATOM   1790 C CA  . ILE A 1 245 ? 22.767 11.375 -22.836 1.00 46.22  ? 245  ILE A CA  1 
ATOM   1791 C C   . ILE A 1 245 ? 23.357 10.618 -24.055 1.00 50.95  ? 245  ILE A C   1 
ATOM   1792 O O   . ILE A 1 245 ? 23.827 11.254 -24.984 1.00 51.03  ? 245  ILE A O   1 
ATOM   1793 C CB  . ILE A 1 245 ? 23.739 11.437 -21.624 1.00 48.11  ? 245  ILE A CB  1 
ATOM   1794 C CG1 . ILE A 1 245 ? 23.295 12.542 -20.645 1.00 46.68  ? 245  ILE A CG1 1 
ATOM   1795 C CG2 . ILE A 1 245 ? 25.213 11.652 -22.058 1.00 48.57  ? 245  ILE A CG2 1 
ATOM   1796 C CD1 . ILE A 1 245 ? 23.937 12.449 -19.262 1.00 48.14  ? 245  ILE A CD1 1 
ATOM   1797 N N   . ARG A 1 246 ? 23.281 9.283  -24.058 1.00 49.05  ? 246  ARG A N   1 
ATOM   1798 C CA  . ARG A 1 246 ? 23.791 8.450  -25.153 1.00 50.63  ? 246  ARG A CA  1 
ATOM   1799 C C   . ARG A 1 246 ? 22.999 8.654  -26.456 1.00 56.21  ? 246  ARG A C   1 
ATOM   1800 O O   . ARG A 1 246 ? 23.611 8.797  -27.500 1.00 57.21  ? 246  ARG A O   1 
ATOM   1801 C CB  . ARG A 1 246 ? 23.782 6.962  -24.743 1.00 50.51  ? 246  ARG A CB  1 
ATOM   1802 C CG  . ARG A 1 246 ? 24.553 6.032  -25.711 1.00 50.98  ? 246  ARG A CG  1 
ATOM   1803 C CD  . ARG A 1 246 ? 24.299 4.553  -25.412 1.00 57.73  ? 246  ARG A CD  1 
ATOM   1804 N NE  . ARG A 1 246 ? 22.951 4.115  -25.800 1.00 63.86  ? 246  ARG A NE  1 
ATOM   1805 C CZ  . ARG A 1 246 ? 22.566 3.867  -27.051 1.00 77.67  ? 246  ARG A CZ  1 
ATOM   1806 N NH1 . ARG A 1 246 ? 23.417 4.019  -28.060 1.00 69.60  ? 246  ARG A NH1 1 
ATOM   1807 N NH2 . ARG A 1 246 ? 21.324 3.477  -27.303 1.00 57.63  ? 246  ARG A NH2 1 
ATOM   1808 N N   . VAL A 1 247 ? 21.647 8.656  -26.386 1.00 52.89  ? 247  VAL A N   1 
ATOM   1809 C CA  . VAL A 1 247 ? 20.760 8.771  -27.548 1.00 51.75  ? 247  VAL A CA  1 
ATOM   1810 C C   . VAL A 1 247 ? 20.809 10.173 -28.164 1.00 56.27  ? 247  VAL A C   1 
ATOM   1811 O O   . VAL A 1 247 ? 20.769 10.306 -29.388 1.00 57.20  ? 247  VAL A O   1 
ATOM   1812 C CB  . VAL A 1 247 ? 19.319 8.230  -27.281 1.00 53.77  ? 247  VAL A CB  1 
ATOM   1813 C CG1 . VAL A 1 247 ? 18.416 8.358  -28.521 1.00 53.27  ? 247  VAL A CG1 1 
ATOM   1814 C CG2 . VAL A 1 247 ? 19.354 6.773  -26.809 1.00 53.55  ? 247  VAL A CG2 1 
ATOM   1815 N N   . LEU A 1 248 ? 20.979 11.201 -27.331 1.00 51.45  ? 248  LEU A N   1 
ATOM   1816 C CA  . LEU A 1 248 ? 21.053 12.591 -27.789 1.00 50.08  ? 248  LEU A CA  1 
ATOM   1817 C C   . LEU A 1 248 ? 22.228 12.861 -28.740 1.00 56.08  ? 248  LEU A C   1 
ATOM   1818 O O   . LEU A 1 248 ? 22.123 13.734 -29.604 1.00 54.98  ? 248  LEU A O   1 
ATOM   1819 C CB  . LEU A 1 248 ? 21.145 13.540 -26.593 1.00 48.06  ? 248  LEU A CB  1 
ATOM   1820 C CG  . LEU A 1 248 ? 19.894 13.787 -25.763 1.00 50.78  ? 248  LEU A CG  1 
ATOM   1821 C CD1 . LEU A 1 248 ? 20.253 14.571 -24.512 1.00 49.05  ? 248  LEU A CD1 1 
ATOM   1822 C CD2 . LEU A 1 248 ? 18.787 14.505 -26.564 1.00 52.12  ? 248  LEU A CD2 1 
ATOM   1823 N N   . GLN A 1 249 ? 23.331 12.098 -28.571 1.00 55.24  ? 249  GLN A N   1 
ATOM   1824 C CA  . GLN A 1 249 ? 24.578 12.186 -29.340 1.00 56.66  ? 249  GLN A CA  1 
ATOM   1825 C C   . GLN A 1 249 ? 24.595 11.377 -30.652 1.00 63.27  ? 249  GLN A C   1 
ATOM   1826 O O   . GLN A 1 249 ? 25.580 11.455 -31.395 1.00 63.93  ? 249  GLN A O   1 
ATOM   1827 C CB  . GLN A 1 249 ? 25.761 11.774 -28.453 1.00 58.41  ? 249  GLN A CB  1 
ATOM   1828 C CG  . GLN A 1 249 ? 26.063 12.802 -27.363 1.00 62.16  ? 249  GLN A CG  1 
ATOM   1829 C CD  . GLN A 1 249 ? 27.116 12.304 -26.414 1.00 68.99  ? 249  GLN A CD  1 
ATOM   1830 O OE1 . GLN A 1 249 ? 28.313 12.577 -26.583 1.00 61.47  ? 249  GLN A OE1 1 
ATOM   1831 N NE2 . GLN A 1 249 ? 26.698 11.533 -25.412 1.00 54.10  ? 249  GLN A NE2 1 
ATOM   1832 N N   . LEU A 1 250 ? 23.517 10.614 -30.939 1.00 60.51  ? 250  LEU A N   1 
ATOM   1833 C CA  . LEU A 1 250 ? 23.407 9.801  -32.164 1.00 61.49  ? 250  LEU A CA  1 
ATOM   1834 C C   . LEU A 1 250 ? 23.003 10.639 -33.382 1.00 67.73  ? 250  LEU A C   1 
ATOM   1835 O O   . LEU A 1 250 ? 22.063 11.437 -33.297 1.00 65.78  ? 250  LEU A O   1 
ATOM   1836 C CB  . LEU A 1 250 ? 22.431 8.623  -31.972 1.00 61.47  ? 250  LEU A CB  1 
ATOM   1837 C CG  . LEU A 1 250 ? 22.825 7.568  -30.929 1.00 65.12  ? 250  LEU A CG  1 
ATOM   1838 C CD1 . LEU A 1 250 ? 21.734 6.533  -30.761 1.00 65.49  ? 250  LEU A CD1 1 
ATOM   1839 C CD2 . LEU A 1 250 ? 24.143 6.890  -31.277 1.00 66.07  ? 250  LEU A CD2 1 
ATOM   1840 N N   . THR A 1 251 ? 23.738 10.471 -34.505 1.00 68.95  ? 251  THR A N   1 
ATOM   1841 C CA  . THR A 1 251 ? 23.505 11.179 -35.788 1.00 70.11  ? 251  THR A CA  1 
ATOM   1842 C C   . THR A 1 251 ? 23.132 10.194 -36.932 1.00 79.96  ? 251  THR A C   1 
ATOM   1843 O O   . THR A 1 251 ? 22.575 10.610 -37.948 1.00 80.63  ? 251  THR A O   1 
ATOM   1844 C CB  . THR A 1 251 ? 24.651 12.161 -36.124 1.00 73.72  ? 251  THR A CB  1 
ATOM   1845 O OG1 . THR A 1 251 ? 25.887 11.456 -36.171 1.00 75.94  ? 251  THR A OG1 1 
ATOM   1846 C CG2 . THR A 1 251 ? 24.769 13.315 -35.107 1.00 70.73  ? 251  THR A CG2 1 
ATOM   1847 N N   . SER A 1 252 ? 23.441 8.899  -36.744 1.00 79.92  ? 252  SER A N   1 
ATOM   1848 C CA  . SER A 1 252 ? 23.137 7.761  -37.626 1.00 82.94  ? 252  SER A CA  1 
ATOM   1849 C C   . SER A 1 252 ? 22.644 6.613  -36.682 1.00 90.23  ? 252  SER A C   1 
ATOM   1850 O O   . SER A 1 252 ? 22.797 6.759  -35.470 1.00 88.26  ? 252  SER A O   1 
ATOM   1851 C CB  . SER A 1 252 ? 24.362 7.369  -38.449 1.00 87.66  ? 252  SER A CB  1 
ATOM   1852 O OG  . SER A 1 252 ? 25.455 6.989  -37.632 1.00 98.51  ? 252  SER A OG  1 
ATOM   1853 N N   A TRP A 1 253 ? 22.055 5.563  -37.258 0.42 88.54  ? 253  TRP A N   1 
ATOM   1854 N N   B TRP A 1 253 ? 22.020 5.488  -37.133 0.58 91.40  ? 253  TRP A N   1 
ATOM   1855 C CA  A TRP A 1 253 ? 21.421 4.445  -36.573 0.42 89.40  ? 253  TRP A CA  1 
ATOM   1856 C CA  B TRP A 1 253 ? 21.674 4.927  -38.445 0.58 94.64  ? 253  TRP A CA  1 
ATOM   1857 C C   A TRP A 1 253 ? 21.977 3.104  -37.040 0.42 96.29  ? 253  TRP A C   1 
ATOM   1858 C C   B TRP A 1 253 ? 20.137 4.902  -38.586 0.58 100.99 ? 253  TRP A C   1 
ATOM   1859 O O   A TRP A 1 253 ? 22.187 2.903  -38.234 0.42 97.96  ? 253  TRP A O   1 
ATOM   1860 O O   B TRP A 1 253 ? 19.601 5.444  -39.558 0.58 101.20 ? 253  TRP A O   1 
ATOM   1861 C CB  A TRP A 1 253 ? 19.896 4.515  -36.802 0.42 87.98  ? 253  TRP A CB  1 
ATOM   1862 C CB  B TRP A 1 253 ? 22.214 3.470  -38.483 0.58 96.18  ? 253  TRP A CB  1 
ATOM   1863 C CG  A TRP A 1 253 ? 19.501 5.018  -38.168 0.42 89.27  ? 253  TRP A CG  1 
ATOM   1864 C CG  B TRP A 1 253 ? 21.991 2.665  -39.738 0.58 99.95  ? 253  TRP A CG  1 
ATOM   1865 C CD1 A TRP A 1 253 ? 19.215 4.261  -39.267 0.42 94.41  ? 253  TRP A CD1 1 
ATOM   1866 C CD1 B TRP A 1 253 ? 22.905 2.434  -40.723 0.58 104.57 ? 253  TRP A CD1 1 
ATOM   1867 C CD2 A TRP A 1 253 ? 19.397 6.390  -38.588 0.42 87.28  ? 253  TRP A CD2 1 
ATOM   1868 C CD2 B TRP A 1 253 ? 20.862 1.822  -40.038 0.58 101.62 ? 253  TRP A CD2 1 
ATOM   1869 N NE1 A TRP A 1 253 ? 18.927 5.073  -40.341 0.42 93.49  ? 253  TRP A NE1 1 
ATOM   1870 N NE1 B TRP A 1 253 ? 22.387 1.567  -41.660 0.58 106.61 ? 253  TRP A NE1 1 
ATOM   1871 C CE2 A TRP A 1 253 ? 19.042 6.384  -39.955 0.42 92.44  ? 253  TRP A CE2 1 
ATOM   1872 C CE2 B TRP A 1 253 ? 21.130 1.186  -41.271 0.58 108.19 ? 253  TRP A CE2 1 
ATOM   1873 C CE3 A TRP A 1 253 ? 19.588 7.626  -37.945 0.42 86.17  ? 253  TRP A CE3 1 
ATOM   1874 C CE3 B TRP A 1 253 ? 19.632 1.573  -39.407 0.58 102.69 ? 253  TRP A CE3 1 
ATOM   1875 C CZ2 A TRP A 1 253 ? 18.851 7.564  -40.684 0.42 90.74  ? 253  TRP A CZ2 1 
ATOM   1876 C CZ2 B TRP A 1 253 ? 20.211 0.325  -41.886 0.58 110.11 ? 253  TRP A CZ2 1 
ATOM   1877 C CZ3 A TRP A 1 253 ? 19.414 8.794  -38.671 0.42 86.79  ? 253  TRP A CZ3 1 
ATOM   1878 C CZ3 B TRP A 1 253 ? 18.712 0.744  -40.029 0.58 106.59 ? 253  TRP A CZ3 1 
ATOM   1879 C CH2 A TRP A 1 253 ? 19.038 8.758  -40.021 0.42 88.76  ? 253  TRP A CH2 1 
ATOM   1880 C CH2 B TRP A 1 253 ? 19.008 0.122  -41.248 0.58 109.96 ? 253  TRP A CH2 1 
ATOM   1881 N N   B ASP A 1 254 ? 19.444 4.261  -37.605 0.58 98.33  ? 254  ASP A N   1 
ATOM   1882 C CA  B ASP A 1 254 ? 17.993 4.039  -37.564 0.58 134.19 ? 254  ASP A CA  1 
ATOM   1883 C C   B ASP A 1 254 ? 17.162 5.283  -37.316 0.58 169.26 ? 254  ASP A C   1 
ATOM   1884 O O   B ASP A 1 254 ? 15.965 5.288  -37.609 0.58 134.13 ? 254  ASP A O   1 
ATOM   1885 C CB  B ASP A 1 254 ? 17.646 2.939  -36.552 0.58 136.83 ? 254  ASP A CB  1 
ATOM   1886 N N   . VAL B 2 4   ? 17.497 31.598 -36.077 1.00 79.58  ? 2078 VAL B N   1 
ATOM   1887 C CA  . VAL B 2 4   ? 18.947 31.545 -35.834 1.00 78.13  ? 2078 VAL B CA  1 
ATOM   1888 C C   . VAL B 2 4   ? 19.667 32.045 -37.083 1.00 78.68  ? 2078 VAL B C   1 
ATOM   1889 O O   . VAL B 2 4   ? 19.527 31.437 -38.142 1.00 77.33  ? 2078 VAL B O   1 
ATOM   1890 C CB  . VAL B 2 4   ? 19.479 30.147 -35.399 1.00 80.96  ? 2078 VAL B CB  1 
ATOM   1891 C CG1 . VAL B 2 4   ? 20.722 30.285 -34.521 1.00 81.00  ? 2078 VAL B CG1 1 
ATOM   1892 C CG2 . VAL B 2 4   ? 18.404 29.314 -34.699 1.00 82.35  ? 2078 VAL B CG2 1 
ATOM   1893 N N   . VAL B 2 5   ? 20.434 33.144 -36.951 1.00 74.39  ? 2079 VAL B N   1 
ATOM   1894 C CA  . VAL B 2 5   ? 21.147 33.805 -38.050 1.00 71.97  ? 2079 VAL B CA  1 
ATOM   1895 C C   . VAL B 2 5   ? 22.174 33.004 -38.800 1.00 72.85  ? 2079 VAL B C   1 
ATOM   1896 O O   . VAL B 2 5   ? 22.231 33.130 -40.027 1.00 70.47  ? 2079 VAL B O   1 
ATOM   1897 C CB  . VAL B 2 5   ? 21.622 35.244 -37.786 1.00 76.71  ? 2079 VAL B CB  1 
ATOM   1898 C CG1 . VAL B 2 5   ? 20.490 36.226 -38.028 1.00 77.69  ? 2079 VAL B CG1 1 
ATOM   1899 C CG2 . VAL B 2 5   ? 22.235 35.403 -36.395 1.00 78.57  ? 2079 VAL B CG2 1 
ATOM   1900 N N   . LEU B 2 6   ? 22.985 32.195 -38.095 1.00 69.41  ? 2080 LEU B N   1 
ATOM   1901 C CA  . LEU B 2 6   ? 23.980 31.368 -38.777 1.00 67.78  ? 2080 LEU B CA  1 
ATOM   1902 C C   . LEU B 2 6   ? 23.333 30.285 -39.619 1.00 67.81  ? 2080 LEU B C   1 
ATOM   1903 O O   . LEU B 2 6   ? 23.742 30.083 -40.750 1.00 65.01  ? 2080 LEU B O   1 
ATOM   1904 C CB  . LEU B 2 6   ? 24.996 30.768 -37.808 1.00 69.22  ? 2080 LEU B CB  1 
ATOM   1905 C CG  . LEU B 2 6   ? 26.291 31.552 -37.655 1.00 75.28  ? 2080 LEU B CG  1 
ATOM   1906 C CD1 . LEU B 2 6   ? 27.079 31.026 -36.475 1.00 78.05  ? 2080 LEU B CD1 1 
ATOM   1907 C CD2 . LEU B 2 6   ? 27.130 31.506 -38.937 1.00 75.27  ? 2080 LEU B CD2 1 
ATOM   1908 N N   . ILE B 2 7   ? 22.289 29.638 -39.080 1.00 65.55  ? 2081 ILE B N   1 
ATOM   1909 C CA  . ILE B 2 7   ? 21.500 28.595 -39.731 1.00 64.12  ? 2081 ILE B CA  1 
ATOM   1910 C C   . ILE B 2 7   ? 20.808 29.182 -40.963 1.00 66.81  ? 2081 ILE B C   1 
ATOM   1911 O O   . ILE B 2 7   ? 20.841 28.563 -42.019 1.00 65.12  ? 2081 ILE B O   1 
ATOM   1912 C CB  . ILE B 2 7   ? 20.553 27.935 -38.687 1.00 68.70  ? 2081 ILE B CB  1 
ATOM   1913 C CG1 . ILE B 2 7   ? 21.368 27.000 -37.765 1.00 69.51  ? 2081 ILE B CG1 1 
ATOM   1914 C CG2 . ILE B 2 7   ? 19.368 27.189 -39.324 1.00 69.33  ? 2081 ILE B CG2 1 
ATOM   1915 C CD1 . ILE B 2 7   ? 20.760 26.708 -36.387 1.00 74.28  ? 2081 ILE B CD1 1 
ATOM   1916 N N   . ASN B 2 8   ? 20.286 30.414 -40.854 1.00 65.09  ? 2082 ASN B N   1 
ATOM   1917 C CA  . ASN B 2 8   ? 19.627 31.105 -41.963 1.00 64.24  ? 2082 ASN B CA  1 
ATOM   1918 C C   . ASN B 2 8   ? 20.605 31.463 -43.082 1.00 64.28  ? 2082 ASN B C   1 
ATOM   1919 O O   . ASN B 2 8   ? 20.252 31.374 -44.269 1.00 62.66  ? 2082 ASN B O   1 
ATOM   1920 C CB  . ASN B 2 8   ? 18.885 32.341 -41.467 1.00 71.36  ? 2082 ASN B CB  1 
ATOM   1921 C CG  . ASN B 2 8   ? 17.565 32.073 -40.777 1.00 108.13 ? 2082 ASN B CG  1 
ATOM   1922 O OD1 . ASN B 2 8   ? 17.053 32.921 -40.033 1.00 106.27 ? 2082 ASN B OD1 1 
ATOM   1923 N ND2 . ASN B 2 8   ? 16.960 30.911 -41.030 1.00 102.20 ? 2082 ASN B ND2 1 
ATOM   1924 N N   . ALA B 2 9   ? 21.838 31.857 -42.706 1.00 58.48  ? 2083 ALA B N   1 
ATOM   1925 C CA  . ALA B 2 9   ? 22.894 32.167 -43.661 1.00 55.51  ? 2083 ALA B CA  1 
ATOM   1926 C C   . ALA B 2 9   ? 23.319 30.883 -44.385 1.00 57.77  ? 2083 ALA B C   1 
ATOM   1927 O O   . ALA B 2 9   ? 23.624 30.940 -45.566 1.00 55.59  ? 2083 ALA B O   1 
ATOM   1928 C CB  . ALA B 2 9   ? 24.072 32.803 -42.959 1.00 56.16  ? 2083 ALA B CB  1 
ATOM   1929 N N   . VAL B 2 10  ? 23.290 29.718 -43.693 1.00 56.16  ? 2084 VAL B N   1 
ATOM   1930 C CA  . VAL B 2 10  ? 23.617 28.417 -44.299 1.00 55.24  ? 2084 VAL B CA  1 
ATOM   1931 C C   . VAL B 2 10  ? 22.513 28.074 -45.328 1.00 59.50  ? 2084 VAL B C   1 
ATOM   1932 O O   . VAL B 2 10  ? 22.822 27.609 -46.424 1.00 59.62  ? 2084 VAL B O   1 
ATOM   1933 C CB  . VAL B 2 10  ? 23.811 27.288 -43.241 1.00 58.65  ? 2084 VAL B CB  1 
ATOM   1934 C CG1 . VAL B 2 10  ? 23.934 25.922 -43.919 1.00 58.61  ? 2084 VAL B CG1 1 
ATOM   1935 C CG2 . VAL B 2 10  ? 25.038 27.551 -42.369 1.00 58.13  ? 2084 VAL B CG2 1 
ATOM   1936 N N   . LYS B 2 11  ? 21.244 28.355 -44.970 1.00 56.44  ? 2085 LYS B N   1 
ATOM   1937 C CA  . LYS B 2 11  ? 20.052 28.119 -45.786 1.00 57.10  ? 2085 LYS B CA  1 
ATOM   1938 C C   . LYS B 2 11  ? 20.136 28.902 -47.079 1.00 60.50  ? 2085 LYS B C   1 
ATOM   1939 O O   . LYS B 2 11  ? 19.798 28.352 -48.118 1.00 61.15  ? 2085 LYS B O   1 
ATOM   1940 C CB  . LYS B 2 11  ? 18.777 28.507 -45.010 1.00 61.10  ? 2085 LYS B CB  1 
ATOM   1941 C CG  . LYS B 2 11  ? 17.477 28.024 -45.655 1.00 83.28  ? 2085 LYS B CG  1 
ATOM   1942 C CD  . LYS B 2 11  ? 16.257 28.836 -45.203 1.00 99.97  ? 2085 LYS B CD  1 
ATOM   1943 C CE  . LYS B 2 11  ? 15.645 28.355 -43.903 1.00 119.28 ? 2085 LYS B CE  1 
ATOM   1944 N NZ  . LYS B 2 11  ? 14.393 29.090 -43.577 1.00 130.35 ? 2085 LYS B NZ  1 
ATOM   1945 N N   . ASP B 2 12  ? 20.580 30.188 -47.013 1.00 55.67  ? 2086 ASP B N   1 
ATOM   1946 C CA  . ASP B 2 12  ? 20.735 31.057 -48.176 1.00 54.25  ? 2086 ASP B CA  1 
ATOM   1947 C C   . ASP B 2 12  ? 21.758 30.461 -49.138 1.00 55.69  ? 2086 ASP B C   1 
ATOM   1948 O O   . ASP B 2 12  ? 21.527 30.487 -50.342 1.00 53.97  ? 2086 ASP B O   1 
ATOM   1949 C CB  . ASP B 2 12  ? 21.166 32.478 -47.762 1.00 56.03  ? 2086 ASP B CB  1 
ATOM   1950 C CG  . ASP B 2 12  ? 20.116 33.347 -47.079 1.00 70.48  ? 2086 ASP B CG  1 
ATOM   1951 O OD1 . ASP B 2 12  ? 18.946 32.887 -46.942 1.00 73.51  ? 2086 ASP B OD1 1 
ATOM   1952 O OD2 . ASP B 2 12  ? 20.458 34.496 -46.686 1.00 74.69  ? 2086 ASP B OD2 1 
ATOM   1953 N N   . VAL B 2 13  ? 22.871 29.899 -48.594 1.00 52.27  ? 2087 VAL B N   1 
ATOM   1954 C CA  . VAL B 2 13  ? 23.950 29.269 -49.366 1.00 52.14  ? 2087 VAL B CA  1 
ATOM   1955 C C   . VAL B 2 13  ? 23.402 28.044 -50.121 1.00 58.93  ? 2087 VAL B C   1 
ATOM   1956 O O   . VAL B 2 13  ? 23.586 27.951 -51.326 1.00 59.73  ? 2087 VAL B O   1 
ATOM   1957 C CB  . VAL B 2 13  ? 25.217 28.964 -48.496 1.00 54.97  ? 2087 VAL B CB  1 
ATOM   1958 C CG1 . VAL B 2 13  ? 26.244 28.132 -49.254 1.00 54.05  ? 2087 VAL B CG1 1 
ATOM   1959 C CG2 . VAL B 2 13  ? 25.865 30.250 -47.990 1.00 54.22  ? 2087 VAL B CG2 1 
ATOM   1960 N N   . ALA B 2 14  ? 22.694 27.151 -49.423 1.00 56.96  ? 2088 ALA B N   1 
ATOM   1961 C CA  . ALA B 2 14  ? 22.104 25.936 -49.998 1.00 57.99  ? 2088 ALA B CA  1 
ATOM   1962 C C   . ALA B 2 14  ? 21.072 26.236 -51.096 1.00 60.90  ? 2088 ALA B C   1 
ATOM   1963 O O   . ALA B 2 14  ? 21.037 25.538 -52.106 1.00 60.25  ? 2088 ALA B O   1 
ATOM   1964 C CB  . ALA B 2 14  ? 21.468 25.097 -48.897 1.00 59.17  ? 2088 ALA B CB  1 
ATOM   1965 N N   . LYS B 2 15  ? 20.252 27.279 -50.892 1.00 57.34  ? 2089 LYS B N   1 
ATOM   1966 C CA  . LYS B 2 15  ? 19.200 27.717 -51.813 1.00 57.88  ? 2089 LYS B CA  1 
ATOM   1967 C C   . LYS B 2 15  ? 19.840 28.242 -53.100 1.00 59.83  ? 2089 LYS B C   1 
ATOM   1968 O O   . LYS B 2 15  ? 19.389 27.899 -54.195 1.00 59.83  ? 2089 LYS B O   1 
ATOM   1969 C CB  . LYS B 2 15  ? 18.331 28.808 -51.143 1.00 61.01  ? 2089 LYS B CB  1 
ATOM   1970 C CG  . LYS B 2 15  ? 16.918 28.940 -51.695 1.00 83.70  ? 2089 LYS B CG  1 
ATOM   1971 C CD  . LYS B 2 15  ? 15.940 27.965 -51.038 1.00 99.54  ? 2089 LYS B CD  1 
ATOM   1972 C CE  . LYS B 2 15  ? 14.646 27.869 -51.819 1.00 114.61 ? 2089 LYS B CE  1 
ATOM   1973 N NZ  . LYS B 2 15  ? 13.709 26.868 -51.239 1.00 123.50 ? 2089 LYS B NZ  1 
ATOM   1974 N N   . ALA B 2 16  ? 20.921 29.031 -52.959 1.00 54.33  ? 2090 ALA B N   1 
ATOM   1975 C CA  . ALA B 2 16  ? 21.647 29.603 -54.086 1.00 53.27  ? 2090 ALA B CA  1 
ATOM   1976 C C   . ALA B 2 16  ? 22.349 28.517 -54.869 1.00 57.41  ? 2090 ALA B C   1 
ATOM   1977 O O   . ALA B 2 16  ? 22.340 28.578 -56.096 1.00 57.33  ? 2090 ALA B O   1 
ATOM   1978 C CB  . ALA B 2 16  ? 22.642 30.650 -53.618 1.00 52.76  ? 2090 ALA B CB  1 
ATOM   1979 N N   . LEU B 2 17  ? 22.905 27.500 -54.173 1.00 54.32  ? 2091 LEU B N   1 
ATOM   1980 C CA  . LEU B 2 17  ? 23.596 26.371 -54.816 1.00 54.97  ? 2091 LEU B CA  1 
ATOM   1981 C C   . LEU B 2 17  ? 22.612 25.510 -55.628 1.00 58.38  ? 2091 LEU B C   1 
ATOM   1982 O O   . LEU B 2 17  ? 22.925 25.097 -56.751 1.00 58.92  ? 2091 LEU B O   1 
ATOM   1983 C CB  . LEU B 2 17  ? 24.359 25.528 -53.772 1.00 54.69  ? 2091 LEU B CB  1 
ATOM   1984 C CG  . LEU B 2 17  ? 25.323 24.454 -54.321 1.00 60.87  ? 2091 LEU B CG  1 
ATOM   1985 C CD1 . LEU B 2 17  ? 26.443 25.074 -55.192 1.00 61.96  ? 2091 LEU B CD1 1 
ATOM   1986 C CD2 . LEU B 2 17  ? 25.928 23.630 -53.200 1.00 59.74  ? 2091 LEU B CD2 1 
ATOM   1987 N N   . GLY B 2 18  ? 21.433 25.281 -55.048 1.00 53.81  ? 2092 GLY B N   1 
ATOM   1988 C CA  . GLY B 2 18  ? 20.333 24.570 -55.682 1.00 54.21  ? 2092 GLY B CA  1 
ATOM   1989 C C   . GLY B 2 18  ? 19.943 25.267 -56.971 1.00 57.81  ? 2092 GLY B C   1 
ATOM   1990 O O   . GLY B 2 18  ? 19.824 24.618 -58.005 1.00 56.99  ? 2092 GLY B O   1 
ATOM   1991 N N   . ASP B 2 19  ? 19.840 26.614 -56.937 1.00 56.24  ? 2093 ASP B N   1 
ATOM   1992 C CA  . ASP B 2 19  ? 19.505 27.431 -58.113 1.00 57.47  ? 2093 ASP B CA  1 
ATOM   1993 C C   . ASP B 2 19  ? 20.576 27.309 -59.177 1.00 62.64  ? 2093 ASP B C   1 
ATOM   1994 O O   . ASP B 2 19  ? 20.239 27.258 -60.361 1.00 64.22  ? 2093 ASP B O   1 
ATOM   1995 C CB  . ASP B 2 19  ? 19.334 28.908 -57.741 1.00 58.24  ? 2093 ASP B CB  1 
ATOM   1996 C CG  . ASP B 2 19  ? 18.088 29.237 -56.950 1.00 72.89  ? 2093 ASP B CG  1 
ATOM   1997 O OD1 . ASP B 2 19  ? 17.188 28.370 -56.865 1.00 76.24  ? 2093 ASP B OD1 1 
ATOM   1998 O OD2 . ASP B 2 19  ? 17.999 30.371 -56.432 1.00 77.69  ? 2093 ASP B OD2 1 
ATOM   1999 N N   . LEU B 2 20  ? 21.865 27.249 -58.757 1.00 57.98  ? 2094 LEU B N   1 
ATOM   2000 C CA  . LEU B 2 20  ? 22.978 27.115 -59.693 1.00 59.10  ? 2094 LEU B CA  1 
ATOM   2001 C C   . LEU B 2 20  ? 22.923 25.781 -60.437 1.00 65.06  ? 2094 LEU B C   1 
ATOM   2002 O O   . LEU B 2 20  ? 23.008 25.765 -61.666 1.00 66.52  ? 2094 LEU B O   1 
ATOM   2003 C CB  . LEU B 2 20  ? 24.345 27.319 -59.012 1.00 58.04  ? 2094 LEU B CB  1 
ATOM   2004 C CG  . LEU B 2 20  ? 25.565 27.202 -59.938 1.00 64.07  ? 2094 LEU B CG  1 
ATOM   2005 C CD1 . LEU B 2 20  ? 25.541 28.262 -61.002 1.00 64.19  ? 2094 LEU B CD1 1 
ATOM   2006 C CD2 . LEU B 2 20  ? 26.858 27.243 -59.163 1.00 65.81  ? 2094 LEU B CD2 1 
ATOM   2007 N N   . ILE B 2 21  ? 22.760 24.672 -59.692 1.00 62.14  ? 2095 ILE B N   1 
ATOM   2008 C CA  . ILE B 2 21  ? 22.700 23.322 -60.254 1.00 63.05  ? 2095 ILE B CA  1 
ATOM   2009 C C   . ILE B 2 21  ? 21.543 23.157 -61.244 1.00 70.42  ? 2095 ILE B C   1 
ATOM   2010 O O   . ILE B 2 21  ? 21.755 22.615 -62.332 1.00 72.26  ? 2095 ILE B O   1 
ATOM   2011 C CB  . ILE B 2 21  ? 22.804 22.242 -59.157 1.00 64.50  ? 2095 ILE B CB  1 
ATOM   2012 C CG1 . ILE B 2 21  ? 24.209 22.286 -58.506 1.00 63.88  ? 2095 ILE B CG1 1 
ATOM   2013 C CG2 . ILE B 2 21  ? 22.469 20.840 -59.682 1.00 65.73  ? 2095 ILE B CG2 1 
ATOM   2014 C CD1 . ILE B 2 21  ? 24.256 21.774 -57.042 1.00 72.26  ? 2095 ILE B CD1 1 
ATOM   2015 N N   . SER B 2 22  ? 20.353 23.698 -60.912 1.00 67.92  ? 2096 SER B N   1 
ATOM   2016 C CA  . SER B 2 22  ? 19.206 23.625 -61.825 1.00 69.93  ? 2096 SER B CA  1 
ATOM   2017 C C   . SER B 2 22  ? 19.439 24.475 -63.098 1.00 73.46  ? 2096 SER B C   1 
ATOM   2018 O O   . SER B 2 22  ? 18.905 24.142 -64.157 1.00 75.23  ? 2096 SER B O   1 
ATOM   2019 C CB  . SER B 2 22  ? 17.914 24.011 -61.113 1.00 73.22  ? 2096 SER B CB  1 
ATOM   2020 O OG  . SER B 2 22  ? 17.956 25.370 -60.722 1.00 85.89  ? 2096 SER B OG  1 
ATOM   2021 N N   . ALA B 2 23  ? 20.273 25.540 -62.996 1.00 66.65  ? 2097 ALA B N   1 
ATOM   2022 C CA  . ALA B 2 23  ? 20.627 26.409 -64.124 1.00 66.07  ? 2097 ALA B CA  1 
ATOM   2023 C C   . ALA B 2 23  ? 21.583 25.697 -65.101 1.00 71.65  ? 2097 ALA B C   1 
ATOM   2024 O O   . ALA B 2 23  ? 21.629 26.067 -66.275 1.00 71.83  ? 2097 ALA B O   1 
ATOM   2025 C CB  . ALA B 2 23  ? 21.254 27.712 -63.619 1.00 63.97  ? 2097 ALA B CB  1 
ATOM   2026 N N   . THR B 2 24  ? 22.326 24.664 -64.622 1.00 68.95  ? 2098 THR B N   1 
ATOM   2027 C CA  . THR B 2 24  ? 23.286 23.919 -65.453 1.00 71.20  ? 2098 THR B CA  1 
ATOM   2028 C C   . THR B 2 24  ? 22.643 23.095 -66.565 1.00 78.82  ? 2098 THR B C   1 
ATOM   2029 O O   . THR B 2 24  ? 23.204 23.031 -67.659 1.00 81.64  ? 2098 THR B O   1 
ATOM   2030 C CB  . THR B 2 24  ? 24.300 23.113 -64.629 1.00 74.76  ? 2098 THR B CB  1 
ATOM   2031 O OG1 . THR B 2 24  ? 23.646 22.007 -64.010 1.00 75.69  ? 2098 THR B OG1 1 
ATOM   2032 C CG2 . THR B 2 24  ? 25.047 23.966 -63.603 1.00 71.17  ? 2098 THR B CG2 1 
ATOM   2033 N N   . LYS B 2 25  ? 21.486 22.462 -66.291 1.00 75.11  ? 2099 LYS B N   1 
ATOM   2034 C CA  . LYS B 2 25  ? 20.760 21.652 -67.279 1.00 100.65 ? 2099 LYS B CA  1 
ATOM   2035 C C   . LYS B 2 25  ? 19.276 21.997 -67.327 1.00 135.10 ? 2099 LYS B C   1 
ATOM   2036 O O   . LYS B 2 25  ? 18.919 23.113 -67.706 1.00 96.15  ? 2099 LYS B O   1 
ATOM   2037 C CB  . LYS B 2 25  ? 20.990 20.140 -67.086 1.00 104.57 ? 2099 LYS B CB  1 
ATOM   2038 C CG  . LYS B 2 25  ? 21.345 19.712 -65.657 1.00 113.32 ? 2099 LYS B CG  1 
ATOM   2039 C CD  . LYS B 2 25  ? 22.424 18.625 -65.613 1.00 119.27 ? 2099 LYS B CD  1 
ATOM   2040 C CE  . LYS B 2 25  ? 23.818 19.144 -65.881 1.00 120.83 ? 2099 LYS B CE  1 
ATOM   2041 N NZ  . LYS B 2 25  ? 24.836 18.076 -65.713 1.00 130.97 ? 2099 LYS B NZ  1 
HETATM 2042 O O   . HOH C 3 .   ? 30.133 21.888 -31.740 1.00 60.35  ? 301  HOH A O   1 
HETATM 2043 O O   . HOH C 3 .   ? 15.252 20.397 -36.402 1.00 57.37  ? 302  HOH A O   1 
HETATM 2044 O O   . HOH C 3 .   ? 25.944 5.863  -13.168 1.00 68.70  ? 303  HOH A O   1 
HETATM 2045 O O   . HOH C 3 .   ? 27.982 7.812  -26.185 1.00 67.30  ? 304  HOH A O   1 
HETATM 2046 O O   . HOH C 3 .   ? 27.289 17.109 -28.641 1.00 62.68  ? 305  HOH A O   1 
HETATM 2047 O O   . HOH C 3 .   ? 21.201 -0.213 -1.915  1.00 66.45  ? 306  HOH A O   1 
HETATM 2048 O O   . HOH C 3 .   ? 21.410 9.326  -4.082  1.00 51.90  ? 307  HOH A O   1 
HETATM 2049 O O   . HOH C 3 .   ? 22.344 14.303 -32.270 1.00 54.70  ? 308  HOH A O   1 
HETATM 2050 O O   . HOH C 3 .   ? 25.427 9.346  -4.017  1.00 56.69  ? 309  HOH A O   1 
HETATM 2051 O O   . HOH C 3 .   ? 22.320 35.022 -52.816 1.00 48.66  ? 310  HOH A O   1 
HETATM 2052 O O   . HOH C 3 .   ? 17.334 10.196 1.583   1.00 48.49  ? 311  HOH A O   1 
HETATM 2053 O O   . HOH C 3 .   ? 25.746 19.508 -10.548 1.00 61.80  ? 312  HOH A O   1 
HETATM 2054 O O   . HOH C 3 .   ? 22.881 9.552  -10.136 1.00 54.54  ? 313  HOH A O   1 
HETATM 2055 O O   . HOH C 3 .   ? 21.951 22.537 -37.144 1.00 53.76  ? 314  HOH A O   1 
HETATM 2056 O O   . HOH C 3 .   ? 20.126 7.083  -3.048  1.00 58.09  ? 315  HOH A O   1 
HETATM 2057 O O   . HOH C 3 .   ? 24.499 16.411 -32.932 1.00 64.95  ? 316  HOH A O   1 
HETATM 2058 O O   . HOH C 3 .   ? 7.056  13.560 -12.452 1.00 61.67  ? 317  HOH A O   1 
HETATM 2059 O O   . HOH C 3 .   ? 20.094 0.010  -13.412 1.00 71.81  ? 318  HOH A O   1 
HETATM 2060 O O   . HOH C 3 .   ? 33.259 36.480 -61.062 1.00 80.47  ? 319  HOH A O   1 
HETATM 2061 O O   . HOH C 3 .   ? 19.568 14.240 -30.302 1.00 47.61  ? 320  HOH A O   1 
HETATM 2062 O O   . HOH C 3 .   ? 25.922 15.536 -30.234 1.00 60.56  ? 321  HOH A O   1 
HETATM 2063 O O   . HOH C 3 .   ? 25.474 9.508  -11.274 1.00 55.85  ? 322  HOH A O   1 
HETATM 2064 O O   . HOH C 3 .   ? 26.069 8.272  -13.558 1.00 61.98  ? 323  HOH A O   1 
HETATM 2065 O O   . HOH C 3 .   ? 22.256 5.594  -4.251  1.00 49.07  ? 324  HOH A O   1 
HETATM 2066 O O   . HOH C 3 .   ? 26.557 11.974 -11.495 1.00 58.30  ? 325  HOH A O   1 
HETATM 2067 O O   . HOH C 3 .   ? 22.115 3.525  -12.700 1.00 52.56  ? 326  HOH A O   1 
HETATM 2068 O O   . HOH C 3 .   ? 19.717 20.659 -36.290 1.00 56.11  ? 327  HOH A O   1 
HETATM 2069 O O   . HOH C 3 .   ? 23.534 4.777  -14.538 1.00 56.79  ? 328  HOH A O   1 
HETATM 2070 O O   . HOH C 3 .   ? 22.600 5.304  -8.388  1.00 56.01  ? 329  HOH A O   1 
HETATM 2071 O O   . HOH C 3 .   ? 4.261  7.864  -10.713 1.00 64.98  ? 330  HOH A O   1 
HETATM 2072 O O   . HOH C 3 .   ? 21.682 22.402 -15.272 1.00 64.26  ? 331  HOH A O   1 
HETATM 2073 O O   . HOH C 3 .   ? 20.239 20.466 -14.533 1.00 53.92  ? 332  HOH A O   1 
HETATM 2074 O O   . HOH C 3 .   ? 25.427 5.145  -21.560 1.00 66.50  ? 333  HOH A O   1 
HETATM 2075 O O   . HOH C 3 .   ? 23.837 7.799  -7.906  1.00 60.37  ? 334  HOH A O   1 
HETATM 2076 O O   . HOH C 3 .   ? 21.316 23.859 -34.622 1.00 61.20  ? 335  HOH A O   1 
HETATM 2077 O O   . HOH C 3 .   ? 21.351 1.078  -24.761 1.00 69.27  ? 336  HOH A O   1 
HETATM 2078 O O   . HOH C 3 .   ? 23.685 3.938  -10.421 1.00 62.13  ? 337  HOH A O   1 
HETATM 2079 O O   . HOH C 3 .   ? 28.163 28.798 -70.783 1.00 78.10  ? 338  HOH A O   1 
HETATM 2080 O O   . HOH C 3 .   ? 21.576 4.211  -6.106  1.00 51.30  ? 339  HOH A O   1 
HETATM 2081 O O   . HOH C 3 .   ? 18.852 20.653 -9.936  1.00 66.41  ? 340  HOH A O   1 
HETATM 2082 O O   . HOH C 3 .   ? 23.563 7.757  -5.209  1.00 53.07  ? 341  HOH A O   1 
HETATM 2083 O O   . HOH C 3 .   ? 29.823 16.762 -43.287 1.00 79.31  ? 342  HOH A O   1 
HETATM 2084 O O   . HOH C 3 .   ? 17.488 11.605 -35.907 1.00 48.47  ? 343  HOH A O   1 
HETATM 2085 O O   . HOH C 3 .   ? 21.360 21.031 -10.805 1.00 90.74  ? 344  HOH A O   1 
HETATM 2086 O O   . HOH C 3 .   ? 22.121 3.653  -18.961 1.00 46.47  ? 345  HOH A O   1 
HETATM 2087 O O   . HOH C 3 .   ? 30.154 21.213 -21.953 1.00 76.85  ? 346  HOH A O   1 
HETATM 2088 O O   . HOH C 3 .   ? 7.509  19.019 -21.455 1.00 67.03  ? 347  HOH A O   1 
HETATM 2089 O O   . HOH C 3 .   ? 28.982 13.767 -22.187 1.00 64.31  ? 348  HOH A O   1 
HETATM 2090 O O   . HOH C 3 .   ? 21.714 2.614  -30.717 1.00 68.36  ? 349  HOH A O   1 
HETATM 2091 O O   . HOH C 3 .   ? 24.508 25.902 -21.319 1.00 73.67  ? 350  HOH A O   1 
HETATM 2092 O O   . HOH C 3 .   ? 23.267 19.404 -9.790  1.00 64.19  ? 351  HOH A O   1 
HETATM 2093 O O   . HOH C 3 .   ? 27.955 12.286 -54.325 1.00 74.67  ? 352  HOH A O   1 
HETATM 2094 O O   . HOH C 3 .   ? 18.496 20.360 -60.919 1.00 75.44  ? 353  HOH A O   1 
HETATM 2095 O O   . HOH C 3 .   ? 28.699 11.331 -23.106 1.00 73.50  ? 354  HOH A O   1 
HETATM 2096 O O   . HOH C 3 .   ? 27.665 8.979  -23.713 1.00 70.52  ? 355  HOH A O   1 
HETATM 2097 O O   . HOH C 3 .   ? 4.563  9.951  -24.077 1.00 69.53  ? 356  HOH A O   1 
HETATM 2098 O O   . HOH C 3 .   ? 27.815 12.654 -6.864  1.00 64.71  ? 357  HOH A O   1 
HETATM 2099 O O   . HOH C 3 .   ? 17.142 21.071 -34.572 1.00 69.88  ? 358  HOH A O   1 
HETATM 2100 O O   . HOH D 3 .   ? 22.126 30.880 -57.494 1.00 56.85  ? 2201 HOH B O   1 
HETATM 2101 O O   . HOH D 3 .   ? 20.080 32.119 -56.318 1.00 57.11  ? 2202 HOH B O   1 
HETATM 2102 O O   . HOH D 3 .   ? 19.930 32.342 -51.326 1.00 56.33  ? 2203 HOH B O   1 
HETATM 2103 O O   . HOH D 3 .   ? 20.390 35.248 -41.298 1.00 76.89  ? 2204 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 3   ? 1.4620 0.9509 0.9125 -0.0420 -0.0318 -0.0787 3    VAL A N   
2    C CA  . VAL A 3   ? 1.4495 0.9357 0.9054 -0.0130 -0.0157 -0.0778 3    VAL A CA  
3    C C   . VAL A 3   ? 1.3942 0.9428 0.9219 0.0104  -0.0161 -0.0724 3    VAL A C   
4    O O   . VAL A 3   ? 1.3878 0.9372 0.9244 0.0378  -0.0002 -0.0698 3    VAL A O   
5    N N   . PHE A 4   ? 1.2665 0.8673 0.8431 -0.0010 -0.0338 -0.0694 4    PHE A N   
6    C CA  . PHE A 4   ? 1.1869 0.8432 0.8272 0.0148  -0.0370 -0.0652 4    PHE A CA  
7    C C   . PHE A 4   ? 1.1319 0.8083 0.7950 0.0072  -0.0452 -0.0659 4    PHE A C   
8    O O   . PHE A 4   ? 1.1066 0.7841 0.7602 -0.0158 -0.0576 -0.0654 4    PHE A O   
9    C CB  . PHE A 4   ? 1.1946 0.8870 0.8646 0.0095  -0.0484 -0.0604 4    PHE A CB  
10   C CG  . PHE A 4   ? 1.2554 0.9253 0.8971 0.0132  -0.0414 -0.0596 4    PHE A CG  
11   C CD1 . PHE A 4   ? 1.3523 0.9889 0.9467 -0.0071 -0.0453 -0.0612 4    PHE A CD1 
12   C CD2 . PHE A 4   ? 1.2734 0.9549 0.9322 0.0356  -0.0304 -0.0564 4    PHE A CD2 
13   C CE1 . PHE A 4   ? 1.3998 1.0116 0.9633 -0.0030 -0.0371 -0.0611 4    PHE A CE1 
14   C CE2 . PHE A 4   ? 1.3375 0.9997 0.9697 0.0401  -0.0227 -0.0547 4    PHE A CE2 
15   C CZ  . PHE A 4   ? 1.3662 0.9920 0.9504 0.0219  -0.0254 -0.0578 4    PHE A CZ  
16   N N   . HIS A 5   ? 1.0391 0.7298 0.7276 0.0253  -0.0376 -0.0660 5    HIS A N   
17   C CA  . HIS A 5   ? 0.9930 0.6979 0.6987 0.0210  -0.0422 -0.0670 5    HIS A CA  
18   C C   . HIS A 5   ? 0.9654 0.7169 0.7140 0.0117  -0.0568 -0.0643 5    HIS A C   
19   O O   . HIS A 5   ? 0.9540 0.7131 0.7080 0.0032  -0.0617 -0.0646 5    HIS A O   
20   C CB  . HIS A 5   ? 0.9880 0.6912 0.7018 0.0420  -0.0290 -0.0668 5    HIS A CB  
21   C CG  . HIS A 5   ? 0.9763 0.7240 0.7385 0.0561  -0.0294 -0.0634 5    HIS A CG  
22   N ND1 . HIS A 5   ? 0.9888 0.7496 0.7632 0.0660  -0.0263 -0.0597 5    HIS A ND1 
23   C CD2 . HIS A 5   ? 0.9665 0.7441 0.7620 0.0597  -0.0323 -0.0630 5    HIS A CD2 
24   C CE1 . HIS A 5   ? 0.9474 0.7441 0.7603 0.0731  -0.0283 -0.0572 5    HIS A CE1 
25   N NE2 . HIS A 5   ? 0.9381 0.7447 0.7635 0.0699  -0.0315 -0.0595 5    HIS A NE2 
26   N N   . THR A 6   ? 0.8826 0.6640 0.6604 0.0146  -0.0625 -0.0608 6    THR A N   
27   C CA  . THR A 6   ? 0.8502 0.6719 0.6652 0.0094  -0.0736 -0.0565 6    THR A CA  
28   C C   . THR A 6   ? 0.9233 0.7555 0.7359 -0.0037 -0.0837 -0.0501 6    THR A C   
29   O O   . THR A 6   ? 0.9294 0.7437 0.7222 -0.0041 -0.0814 -0.0503 6    THR A O   
30   C CB  . THR A 6   ? 0.9096 0.7582 0.7634 0.0263  -0.0703 -0.0564 6    THR A CB  
31   O OG1 . THR A 6   ? 0.8932 0.7409 0.7493 0.0337  -0.0676 -0.0549 6    THR A OG1 
32   C CG2 . THR A 6   ? 0.8735 0.7194 0.7328 0.0372  -0.0620 -0.0605 6    THR A CG2 
33   N N   . ARG A 7   ? 0.8790 0.7429 0.7124 -0.0135 -0.0941 -0.0428 7    ARG A N   
34   C CA  . ARG A 7   ? 0.8963 0.7786 0.7321 -0.0253 -0.1042 -0.0330 7    ARG A CA  
35   C C   . ARG A 7   ? 0.9394 0.8369 0.7990 -0.0113 -0.1028 -0.0295 7    ARG A C   
36   O O   . ARG A 7   ? 0.9541 0.8546 0.8051 -0.0199 -0.1086 -0.0231 7    ARG A O   
37   C CB  . ARG A 7   ? 0.9168 0.8312 0.7631 -0.0416 -0.1156 -0.0219 7    ARG A CB  
38   C CG  . ARG A 7   ? 1.0355 0.9876 0.9237 -0.0285 -0.1148 -0.0168 7    ARG A CG  
39   C CD  . ARG A 7   ? 1.1567 1.1399 1.0492 -0.0464 -0.1251 -0.0041 7    ARG A CD  
40   N NE  . ARG A 7   ? 1.3335 1.3589 1.2673 -0.0317 -0.1234 0.0051  7    ARG A NE  
41   C CZ  . ARG A 7   ? 1.5801 1.6423 1.5407 -0.0243 -0.1261 0.0201  7    ARG A CZ  
42   N NH1 . ARG A 7   ? 1.4526 1.5188 1.4062 -0.0321 -0.1324 0.0280  7    ARG A NH1 
43   N NH2 . ARG A 7   ? 1.4328 1.5268 1.4257 -0.0077 -0.1212 0.0282  7    ARG A NH2 
44   N N   . THR A 8   ? 0.8585 0.7609 0.7423 0.0079  -0.0951 -0.0340 8    THR A N   
45   C CA  . THR A 8   ? 0.8395 0.7490 0.7407 0.0199  -0.0927 -0.0318 8    THR A CA  
46   C C   . THR A 8   ? 0.8983 0.7818 0.7738 0.0198  -0.0882 -0.0356 8    THR A C   
47   O O   . THR A 8   ? 0.9013 0.7871 0.7729 0.0160  -0.0920 -0.0302 8    THR A O   
48   C CB  . THR A 8   ? 0.9686 0.8872 0.8958 0.0350  -0.0867 -0.0353 8    THR A CB  
49   O OG1 . THR A 8   ? 1.0044 0.9474 0.9530 0.0365  -0.0901 -0.0290 8    THR A OG1 
50   C CG2 . THR A 8   ? 0.9583 0.8749 0.8953 0.0448  -0.0833 -0.0349 8    THR A CG2 
51   N N   . ILE A 9   ? 0.8537 0.7137 0.7106 0.0245  -0.0794 -0.0432 9    ILE A N   
52   C CA  . ILE A 9   ? 0.8790 0.7139 0.7091 0.0281  -0.0718 -0.0452 9    ILE A CA  
53   C C   . ILE A 9   ? 0.9900 0.8049 0.7848 0.0119  -0.0766 -0.0437 9    ILE A C   
54   O O   . ILE A 9   ? 1.0103 0.8176 0.7929 0.0121  -0.0753 -0.0414 9    ILE A O   
55   C CB  . ILE A 9   ? 0.9231 0.7385 0.7393 0.0393  -0.0594 -0.0504 9    ILE A CB  
56   C CG1 . ILE A 9   ? 0.8983 0.7370 0.7480 0.0519  -0.0562 -0.0502 9    ILE A CG1 
57   C CG2 . ILE A 9   ? 0.9520 0.7423 0.7389 0.0464  -0.0489 -0.0499 9    ILE A CG2 
58   C CD1 . ILE A 9   ? 0.9096 0.7379 0.7506 0.0624  -0.0451 -0.0521 9    ILE A CD1 
59   N N   . GLU A 10  ? 0.9688 0.7756 0.7453 -0.0043 -0.0827 -0.0442 10   GLU A N   
60   C CA  . GLU A 10  ? 0.9969 0.7832 0.7341 -0.0261 -0.0892 -0.0423 10   GLU A CA  
61   C C   . GLU A 10  ? 1.0186 0.8327 0.7714 -0.0342 -0.1001 -0.0324 10   GLU A C   
62   O O   . GLU A 10  ? 1.0413 0.8378 0.7685 -0.0392 -0.0993 -0.0319 10   GLU A O   
63   C CB  . GLU A 10  ? 1.0294 0.8111 0.7508 -0.0452 -0.0964 -0.0421 10   GLU A CB  
64   C CG  . GLU A 10  ? 1.2368 0.9825 0.9025 -0.0712 -0.1010 -0.0425 10   GLU A CG  
65   C CD  . GLU A 10  ? 1.6153 1.3699 1.2708 -0.0972 -0.1135 -0.0374 10   GLU A CD  
66   O OE1 . GLU A 10  ? 1.5550 1.3613 1.2509 -0.1018 -0.1250 -0.0261 10   GLU A OE1 
67   O OE2 . GLU A 10  ? 1.6478 1.3570 1.2529 -0.1131 -0.1111 -0.0433 10   GLU A OE2 
68   N N   . SER A 11  ? 0.9389 0.7961 0.7331 -0.0329 -0.1086 -0.0236 11   SER A N   
69   C CA  . SER A 11  ? 0.9313 0.8191 0.7444 -0.0372 -0.1180 -0.0111 11   SER A CA  
70   C C   . SER A 11  ? 0.9966 0.8767 0.8124 -0.0246 -0.1123 -0.0122 11   SER A C   
71   O O   . SER A 11  ? 1.0213 0.8979 0.8194 -0.0350 -0.1170 -0.0071 11   SER A O   
72   C CB  . SER A 11  ? 0.9411 0.8719 0.7992 -0.0290 -0.1224 -0.0014 11   SER A CB  
73   O OG  . SER A 11  ? 1.0287 0.9631 0.9152 -0.0060 -0.1137 -0.0057 11   SER A OG  
74   N N   . ILE A 12  ? 0.9306 0.8069 0.7646 -0.0046 -0.1023 -0.0186 12   ILE A N   
75   C CA  . ILE A 12  ? 0.9223 0.7947 0.7616 0.0071  -0.0966 -0.0186 12   ILE A CA  
76   C C   . ILE A 12  ? 1.0214 0.8627 0.8217 0.0040  -0.0903 -0.0229 12   ILE A C   
77   O O   . ILE A 12  ? 1.0407 0.8834 0.8345 0.0007  -0.0928 -0.0177 12   ILE A O   
78   C CB  . ILE A 12  ? 0.9264 0.8062 0.7937 0.0248  -0.0892 -0.0224 12   ILE A CB  
79   C CG1 . ILE A 12  ? 0.9054 0.8110 0.8065 0.0293  -0.0941 -0.0170 12   ILE A CG1 
80   C CG2 . ILE A 12  ? 0.9263 0.8019 0.7950 0.0337  -0.0834 -0.0215 12   ILE A CG2 
81   C CD1 . ILE A 12  ? 0.9275 0.8354 0.8490 0.0418  -0.0879 -0.0219 12   ILE A CD1 
82   N N   . LEU A 13  ? 0.9889 0.8008 0.7610 0.0059  -0.0810 -0.0313 13   LEU A N   
83   C CA  . LEU A 13  ? 1.0207 0.7981 0.7534 0.0094  -0.0699 -0.0353 13   LEU A CA  
84   C C   . LEU A 13  ? 1.1232 0.8623 0.8014 -0.0078 -0.0699 -0.0385 13   LEU A C   
85   O O   . LEU A 13  ? 1.1539 0.8682 0.8009 -0.0050 -0.0617 -0.0393 13   LEU A O   
86   C CB  . LEU A 13  ? 1.0193 0.7858 0.7526 0.0287  -0.0550 -0.0398 13   LEU A CB  
87   C CG  . LEU A 13  ? 1.0450 0.8426 0.8207 0.0445  -0.0523 -0.0362 13   LEU A CG  
88   C CD1 . LEU A 13  ? 1.0531 0.8419 0.8230 0.0609  -0.0378 -0.0373 13   LEU A CD1 
89   C CD2 . LEU A 13  ? 1.0721 0.8841 0.8588 0.0470  -0.0538 -0.0296 13   LEU A CD2 
90   N N   . GLU A 14  ? 1.0999 0.8296 0.7613 -0.0256 -0.0773 -0.0404 14   GLU A N   
91   C CA  . GLU A 14  ? 1.1489 0.8351 0.7501 -0.0471 -0.0781 -0.0440 14   GLU A CA  
92   C C   . GLU A 14  ? 1.2137 0.8983 0.7925 -0.0650 -0.0866 -0.0385 14   GLU A C   
93   O O   . GLU A 14  ? 1.2641 0.9019 0.7883 -0.0702 -0.0780 -0.0437 14   GLU A O   
94   C CB  . GLU A 14  ? 1.1796 0.8602 0.7686 -0.0663 -0.0864 -0.0453 14   GLU A CB  
95   C CG  . GLU A 14  ? 1.4179 1.0356 0.9343 -0.0840 -0.0809 -0.0528 14   GLU A CG  
96   C CD  . GLU A 14  ? 1.7775 1.3894 1.2776 -0.1087 -0.0913 -0.0525 14   GLU A CD  
97   O OE1 . GLU A 14  ? 1.6854 1.3284 1.1937 -0.1346 -0.1096 -0.0431 14   GLU A OE1 
98   O OE2 . GLU A 14  ? 1.7879 1.3663 1.2672 -0.1024 -0.0811 -0.0600 14   GLU A OE2 
99   N N   . PRO A 15  ? 1.1318 0.8638 0.7481 -0.0730 -0.1016 -0.0272 15   PRO A N   
100  C CA  . PRO A 15  ? 1.1517 0.8836 0.7463 -0.0895 -0.1094 -0.0205 15   PRO A CA  
101  C C   . PRO A 15  ? 1.2074 0.9155 0.7840 -0.0735 -0.0957 -0.0246 15   PRO A C   
102  O O   . PRO A 15  ? 1.2462 0.9175 0.7701 -0.0867 -0.0929 -0.0273 15   PRO A O   
103  C CB  . PRO A 15  ? 1.1280 0.9204 0.7781 -0.0900 -0.1237 -0.0059 15   PRO A CB  
104  C CG  . PRO A 15  ? 1.1470 0.9645 0.8341 -0.0829 -0.1259 -0.0053 15   PRO A CG  
105  C CD  . PRO A 15  ? 1.0911 0.8761 0.7682 -0.0654 -0.1104 -0.0191 15   PRO A CD  
106  N N   . VAL A 16  ? 1.1320 0.8601 0.7494 -0.0464 -0.0869 -0.0244 16   VAL A N   
107  C CA  . VAL A 16  ? 1.1394 0.8549 0.7478 -0.0294 -0.0737 -0.0253 16   VAL A CA  
108  C C   . VAL A 16  ? 1.2239 0.8879 0.7833 -0.0187 -0.0541 -0.0348 16   VAL A C   
109  O O   . VAL A 16  ? 1.2483 0.8844 0.7701 -0.0160 -0.0441 -0.0356 16   VAL A O   
110  C CB  . VAL A 16  ? 1.1403 0.8965 0.8049 -0.0095 -0.0730 -0.0192 16   VAL A CB  
111  C CG1 . VAL A 16  ? 1.1059 0.8736 0.8016 0.0065  -0.0673 -0.0229 16   VAL A CG1 
112  C CG2 . VAL A 16  ? 1.1489 0.8990 0.8039 0.0027  -0.0623 -0.0166 16   VAL A CG2 
113  N N   . ALA A 17  ? 1.1788 0.8279 0.7349 -0.0125 -0.0479 -0.0410 17   ALA A N   
114  C CA  . ALA A 17  ? 1.2197 0.8176 0.7284 0.0002  -0.0278 -0.0482 17   ALA A CA  
115  C C   . ALA A 17  ? 1.3282 0.8673 0.7621 -0.0206 -0.0253 -0.0542 17   ALA A C   
116  O O   . ALA A 17  ? 1.3748 0.8665 0.7601 -0.0078 -0.0058 -0.0580 17   ALA A O   
117  C CB  . ALA A 17  ? 1.2184 0.8156 0.7411 0.0076  -0.0246 -0.0522 17   ALA A CB  
118  N N   . GLN A 18  ? 1.2902 0.8331 0.7129 -0.0529 -0.0447 -0.0533 18   GLN A N   
119  C CA  . GLN A 18  ? 1.3669 0.8570 0.7162 -0.0811 -0.0469 -0.0577 18   GLN A CA  
120  C C   . GLN A 18  ? 1.4454 0.9273 0.7708 -0.0841 -0.0446 -0.0548 18   GLN A C   
121  O O   . GLN A 18  ? 1.5157 0.9354 0.7704 -0.0884 -0.0313 -0.0616 18   GLN A O   
122  C CB  . GLN A 18  ? 1.3876 0.8959 0.7381 -0.1169 -0.0701 -0.0539 18   GLN A CB  
123  C CG  . GLN A 18  ? 1.5876 1.0756 0.9272 -0.1218 -0.0690 -0.0596 18   GLN A CG  
124  C CD  . GLN A 18  ? 1.7857 1.3174 1.1542 -0.1489 -0.0922 -0.0514 18   GLN A CD  
125  O OE1 . GLN A 18  ? 1.6665 1.2559 1.0794 -0.1573 -0.1086 -0.0395 18   GLN A OE1 
126  N NE2 . GLN A 18  ? 1.6896 1.1966 1.0353 -0.1609 -0.0928 -0.0559 18   GLN A NE2 
127  N N   . GLN A 19  ? 1.3413 0.8817 0.7223 -0.0801 -0.0558 -0.0448 19   GLN A N   
128  C CA  . GLN A 19  ? 1.3500 0.8909 0.7172 -0.0809 -0.0544 -0.0404 19   GLN A CA  
129  C C   . GLN A 19  ? 1.4284 0.9353 0.7704 -0.0509 -0.0282 -0.0448 19   GLN A C   
130  O O   . GLN A 19  ? 1.4803 0.9455 0.7657 -0.0558 -0.0188 -0.0475 19   GLN A O   
131  C CB  . GLN A 19  ? 1.2985 0.9087 0.7363 -0.0765 -0.0688 -0.0280 19   GLN A CB  
132  C CG  . GLN A 19  ? 1.3391 0.9876 0.7982 -0.1044 -0.0932 -0.0182 19   GLN A CG  
133  C CD  . GLN A 19  ? 1.4583 1.1681 0.9860 -0.0926 -0.1026 -0.0060 19   GLN A CD  
134  O OE1 . GLN A 19  ? 1.3578 1.0909 0.9326 -0.0691 -0.0972 -0.0061 19   GLN A OE1 
135  N NE2 . GLN A 19  ? 1.3395 1.0745 0.8714 -0.1097 -0.1167 0.0056  19   GLN A NE2 
136  N N   . ILE A 20  ? 1.3484 0.8756 0.7317 -0.0204 -0.0162 -0.0439 20   ILE A N   
137  C CA  . ILE A 20  ? 1.3644 0.8730 0.7345 0.0115  0.0092  -0.0435 20   ILE A CA  
138  C C   . ILE A 20  ? 1.5106 0.9418 0.8002 0.0145  0.0296  -0.0526 20   ILE A C   
139  O O   . ILE A 20  ? 1.5613 0.9596 0.8083 0.0266  0.0474  -0.0523 20   ILE A O   
140  C CB  . ILE A 20  ? 1.3417 0.8956 0.7750 0.0388  0.0146  -0.0378 20   ILE A CB  
141  C CG1 . ILE A 20  ? 1.2763 0.8955 0.7773 0.0358  -0.0028 -0.0288 20   ILE A CG1 
142  C CG2 . ILE A 20  ? 1.3739 0.9131 0.7916 0.0716  0.0416  -0.0334 20   ILE A CG2 
143  C CD1 . ILE A 20  ? 1.2612 0.9250 0.8235 0.0506  -0.0051 -0.0247 20   ILE A CD1 
144  N N   . SER A 21  ? 1.5078 0.9064 0.7722 0.0027  0.0275  -0.0604 21   SER A N   
145  C CA  . SER A 21  ? 1.6016 0.9163 0.7817 0.0026  0.0468  -0.0699 21   SER A CA  
146  C C   . SER A 21  ? 1.7151 0.9793 0.8227 -0.0219 0.0463  -0.0746 21   SER A C   
147  O O   . SER A 21  ? 1.7748 0.9804 0.8202 -0.0063 0.0708  -0.0781 21   SER A O   
148  C CB  . SER A 21  ? 1.6809 0.9749 0.8494 -0.0144 0.0385  -0.0766 21   SER A CB  
149  O OG  . SER A 21  ? 1.8521 1.1390 0.9966 -0.0576 0.0153  -0.0795 21   SER A OG  
150  N N   . HIS A 22  ? 1.6634 0.9550 0.7816 -0.0586 0.0191  -0.0727 22   HIS A N   
151  C CA  . HIS A 22  ? 1.7218 0.9788 0.7789 -0.0895 0.0122  -0.0748 22   HIS A CA  
152  C C   . HIS A 22  ? 1.7701 1.0273 0.8198 -0.0688 0.0270  -0.0709 22   HIS A C   
153  O O   . HIS A 22  ? 1.8526 1.0425 0.8228 -0.0723 0.0429  -0.0772 22   HIS A O   
154  C CB  . HIS A 22  ? 1.6977 1.0092 0.7910 -0.1268 -0.0212 -0.0673 22   HIS A CB  
155  C CG  . HIS A 22  ? 1.8227 1.0860 0.8422 -0.1722 -0.0335 -0.0718 22   HIS A CG  
156  N ND1 . HIS A 22  ? 1.9147 1.1412 0.8709 -0.1944 -0.0339 -0.0729 22   HIS A ND1 
157  C CD2 . HIS A 22  ? 1.8720 1.1185 0.8695 -0.2008 -0.0459 -0.0746 22   HIS A CD2 
158  C CE1 . HIS A 22  ? 1.9703 1.1580 0.8663 -0.2375 -0.0472 -0.0763 22   HIS A CE1 
159  N NE2 . HIS A 22  ? 1.9530 1.1520 0.8718 -0.2431 -0.0549 -0.0770 22   HIS A NE2 
160  N N   . LEU A 23  ? 1.6422 0.9713 0.7711 -0.0466 0.0235  -0.0604 23   LEU A N   
161  C CA  . LEU A 23  ? 1.6335 0.9785 0.7710 -0.0255 0.0356  -0.0536 23   LEU A CA  
162  C C   . LEU A 23  ? 1.7497 1.0403 0.8373 0.0084  0.0706  -0.0567 23   LEU A C   
163  O O   . LEU A 23  ? 1.7893 1.0519 0.8336 0.0144  0.0847  -0.0559 23   LEU A O   
164  C CB  . LEU A 23  ? 1.5394 0.9692 0.7732 -0.0087 0.0251  -0.0419 23   LEU A CB  
165  C CG  . LEU A 23  ? 1.5767 1.0468 0.8383 -0.0058 0.0206  -0.0317 23   LEU A CG  
166  C CD1 . LEU A 23  ? 1.5857 1.0692 0.8419 -0.0420 -0.0041 -0.0292 23   LEU A CD1 
167  C CD2 . LEU A 23  ? 1.5254 1.0650 0.8717 0.0145  0.0158  -0.0214 23   LEU A CD2 
168  N N   . VAL A 24  ? 1.7249 1.0002 0.8167 0.0311  0.0854  -0.0591 24   VAL A N   
169  C CA  . VAL A 24  ? 1.7802 1.0060 0.8276 0.0678  0.1206  -0.0592 24   VAL A CA  
170  C C   . VAL A 24  ? 1.9687 1.0925 0.9051 0.0541  0.1361  -0.0716 24   VAL A C   
171  O O   . VAL A 24  ? 2.0327 1.1142 0.9170 0.0745  0.1619  -0.0705 24   VAL A O   
172  C CB  . VAL A 24  ? 1.7866 1.0288 0.8721 0.0932  0.1295  -0.0564 24   VAL A CB  
173  C CG1 . VAL A 24  ? 1.8504 1.0328 0.8801 0.1301  0.1671  -0.0552 24   VAL A CG1 
174  C CG2 . VAL A 24  ? 1.6826 1.0184 0.8668 0.1089  0.1189  -0.0432 24   VAL A CG2 
175  N N   . ILE A 25  ? 1.9585 1.0429 0.8567 0.0180  0.1202  -0.0826 25   ILE A N   
176  C CA  . ILE A 25  ? 2.0681 1.0512 0.8552 -0.0053 0.1299  -0.0954 25   ILE A CA  
177  C C   . ILE A 25  ? 2.1771 1.1438 0.9210 -0.0241 0.1272  -0.0959 25   ILE A C   
178  O O   . ILE A 25  ? 2.2762 1.1629 0.9330 -0.0147 0.1534  -0.1021 25   ILE A O   
179  C CB  . ILE A 25  ? 2.1197 1.0767 0.8830 -0.0460 0.1086  -0.1043 25   ILE A CB  
180  C CG1 . ILE A 25  ? 2.0928 1.0524 0.8856 -0.0224 0.1176  -0.1044 25   ILE A CG1 
181  C CG2 . ILE A 25  ? 2.2481 1.0985 0.8896 -0.0791 0.1149  -0.1172 25   ILE A CG2 
182  C CD1 . ILE A 25  ? 2.1035 1.0904 0.9268 -0.0562 0.0889  -0.1066 25   ILE A CD1 
183  N N   . MET A 26  ? 2.0764 1.1190 0.8819 -0.0465 0.0981  -0.0883 26   MET A N   
184  C CA  . MET A 26  ? 2.1079 1.1496 0.8852 -0.0660 0.0914  -0.0862 26   MET A CA  
185  C C   . MET A 26  ? 2.1724 1.2066 0.9391 -0.0264 0.1205  -0.0810 26   MET A C   
186  O O   . MET A 26  ? 2.2419 1.2196 0.9325 -0.0345 0.1327  -0.0856 26   MET A O   
187  C CB  . MET A 26  ? 2.0543 1.1879 0.9119 -0.0908 0.0559  -0.0754 26   MET A CB  
188  C CG  . MET A 26  ? 2.0932 1.2428 0.9594 -0.1343 0.0249  -0.0764 26   MET A CG  
189  S SD  . MET A 26  ? 2.2751 1.3233 1.0186 -0.1816 0.0228  -0.0899 26   MET A SD  
190  C CE  . MET A 26  ? 2.2361 1.2540 0.9798 -0.1678 0.0326  -0.0978 26   MET A CE  
191  N N   . HIS A 27  ? 2.0600 1.1536 0.9024 0.0145  0.1310  -0.0703 27   HIS A N   
192  C CA  . HIS A 27  ? 2.0639 1.1692 0.9128 0.0550  0.1576  -0.0606 27   HIS A CA  
193  C C   . HIS A 27  ? 2.2246 1.2383 0.9838 0.0834  0.1974  -0.0664 27   HIS A C   
194  O O   . HIS A 27  ? 2.2736 1.2574 0.9865 0.0998  0.2195  -0.0637 27   HIS A O   
195  C CB  . HIS A 27  ? 1.9732 1.1678 0.9256 0.0854  0.1554  -0.0462 27   HIS A CB  
196  C CG  . HIS A 27  ? 2.0036 1.2317 0.9778 0.1204  0.1759  -0.0318 27   HIS A CG  
197  N ND1 . HIS A 27  ? 2.0104 1.2713 0.9978 0.1096  0.1661  -0.0254 27   HIS A ND1 
198  C CD2 . HIS A 27  ? 2.0252 1.2643 1.0132 0.1647  0.2042  -0.0206 27   HIS A CD2 
199  C CE1 . HIS A 27  ? 1.9944 1.2831 1.0012 0.1463  0.1887  -0.0114 27   HIS A CE1 
200  N NE2 . HIS A 27  ? 2.0067 1.2860 1.0155 0.1805  0.2121  -0.0070 27   HIS A NE2 
201  N N   . GLU A 28  ? 2.2148 1.1817 0.9467 0.0897  0.2072  -0.0738 28   GLU A N   
202  C CA  . GLU A 28  ? 2.3144 1.1869 0.9585 0.1181  0.2460  -0.0791 28   GLU A CA  
203  C C   . GLU A 28  ? 2.4800 1.2518 1.0060 0.0941  0.2566  -0.0925 28   GLU A C   
204  O O   . GLU A 28  ? 2.5437 1.2738 1.0175 0.1230  0.2883  -0.0895 28   GLU A O   
205  C CB  . GLU A 28  ? 2.3375 1.1812 0.9775 0.1204  0.2476  -0.0850 28   GLU A CB  
206  N N   . GLU A 29  ? 2.4584 1.1970 0.9443 0.0399  0.2293  -0.1055 29   GLU A N   
207  C CA  . GLU A 29  ? 2.5685 1.2121 0.9389 0.0055  0.2330  -0.1188 29   GLU A CA  
208  C C   . GLU A 29  ? 2.6102 1.2785 0.9772 -0.0014 0.2298  -0.1137 29   GLU A C   
209  O O   . GLU A 29  ? 2.6962 1.2895 0.9763 0.0119  0.2589  -0.1182 29   GLU A O   
210  C CB  . GLU A 29  ? 2.6052 1.2255 0.9465 -0.0546 0.1999  -0.1296 29   GLU A CB  
211  N N   . GLY A 30  ? 2.4601 1.2301 0.9190 -0.0201 0.1962  -0.1040 30   GLY A N   
212  C CA  . GLY A 30  ? 2.7543 1.5610 1.2237 -0.0293 0.1881  -0.0971 30   GLY A CA  
213  C C   . GLY A 30  ? 3.0851 1.9268 1.5901 0.0229  0.2156  -0.0844 30   GLY A C   
214  O O   . GLY A 30  ? 2.6291 1.4741 1.1147 0.0229  0.2208  -0.0802 30   GLY A O   
215  N N   . LYS A 35  ? 1.9968 1.2256 0.7386 -0.1415 0.0490  -0.0203 35   LYS A N   
216  C CA  . LYS A 35  ? 1.8948 1.2042 0.7272 -0.1569 0.0160  -0.0091 35   LYS A CA  
217  C C   . LYS A 35  ? 1.8390 1.2244 0.7697 -0.1216 0.0173  0.0042  35   LYS A C   
218  O O   . LYS A 35  ? 1.8386 1.2170 0.7791 -0.0834 0.0425  0.0028  35   LYS A O   
219  C CB  . LYS A 35  ? 1.9083 1.2025 0.7428 -0.1703 0.0058  -0.0175 35   LYS A CB  
220  C CG  . LYS A 35  ? 1.9583 1.3172 0.8522 -0.2016 -0.0308 -0.0065 35   LYS A CG  
221  C CD  . LYS A 35  ? 2.0120 1.3681 0.9230 -0.2076 -0.0389 -0.0125 35   LYS A CD  
222  C CE  . LYS A 35  ? 2.0224 1.4428 0.9876 -0.2375 -0.0730 0.0006  35   LYS A CE  
223  N NZ  . LYS A 35  ? 2.1132 1.5262 1.0848 -0.2469 -0.0803 -0.0052 35   LYS A NZ  
224  N N   . ALA A 36  ? 1.7048 1.1619 0.7055 -0.1350 -0.0096 0.0184  36   ALA A N   
225  C CA  . ALA A 36  ? 1.6124 1.1388 0.7030 -0.1083 -0.0120 0.0315  36   ALA A CA  
226  C C   . ALA A 36  ? 1.5701 1.1401 0.7316 -0.1087 -0.0301 0.0343  36   ALA A C   
227  O O   . ALA A 36  ? 1.5612 1.1418 0.7260 -0.1378 -0.0527 0.0360  36   ALA A O   
228  C CB  . ALA A 36  ? 1.6018 1.1719 0.7162 -0.1197 -0.0259 0.0466  36   ALA A CB  
229  N N   . ILE A 37  ? 1.4489 1.0462 0.6659 -0.0771 -0.0201 0.0362  37   ILE A N   
230  C CA  . ILE A 37  ? 1.3582 0.9978 0.6447 -0.0739 -0.0350 0.0392  37   ILE A CA  
231  C C   . ILE A 37  ? 1.3343 1.0351 0.6827 -0.0787 -0.0540 0.0558  37   ILE A C   
232  O O   . ILE A 37  ? 1.3016 1.0206 0.6636 -0.0652 -0.0464 0.0642  37   ILE A O   
233  C CB  . ILE A 37  ? 1.3609 1.0017 0.6754 -0.0415 -0.0171 0.0348  37   ILE A CB  
234  C CG1 . ILE A 37  ? 1.4129 0.9903 0.6652 -0.0369 0.0009  0.0195  37   ILE A CG1 
235  C CG2 . ILE A 37  ? 1.2916 0.9798 0.6806 -0.0384 -0.0331 0.0392  37   ILE A CG2 
236  C CD1 . ILE A 37  ? 1.4514 1.0250 0.7173 -0.0020 0.0240  0.0178  37   ILE A CD1 
237  N N   . PRO A 38  ? 1.2710 1.0031 0.6541 -0.0975 -0.0777 0.0625  38   PRO A N   
238  C CA  . PRO A 38  ? 1.2206 1.0052 0.6584 -0.0992 -0.0932 0.0796  38   PRO A CA  
239  C C   . PRO A 38  ? 1.1836 0.9989 0.6825 -0.0730 -0.0879 0.0841  38   PRO A C   
240  O O   . PRO A 38  ? 1.1507 0.9529 0.6536 -0.0547 -0.0739 0.0749  38   PRO A O   
241  C CB  . PRO A 38  ? 1.2339 1.0408 0.6893 -0.1218 -0.1161 0.0863  38   PRO A CB  
242  C CG  . PRO A 38  ? 1.3354 1.1004 0.7374 -0.1385 -0.1144 0.0726  38   PRO A CG  
243  C CD  . PRO A 38  ? 1.2973 1.0207 0.6730 -0.1160 -0.0901 0.0570  38   PRO A CD  
244  N N   . ASP A 39  ? 1.1003 0.9544 0.6431 -0.0722 -0.0987 0.0991  39   ASP A N   
245  C CA  . ASP A 39  ? 1.0476 0.9279 0.6434 -0.0529 -0.0959 0.1046  39   ASP A CA  
246  C C   . ASP A 39  ? 1.0663 0.9510 0.6943 -0.0460 -0.0992 0.0983  39   ASP A C   
247  O O   . ASP A 39  ? 1.0719 0.9669 0.7142 -0.0566 -0.1131 0.1011  39   ASP A O   
248  C CB  . ASP A 39  ? 1.0427 0.9554 0.6719 -0.0569 -0.1082 0.1221  39   ASP A CB  
249  C CG  . ASP A 39  ? 1.0980 1.0303 0.7693 -0.0415 -0.1044 0.1287  39   ASP A CG  
250  O OD1 . ASP A 39  ? 1.1100 1.0627 0.8070 -0.0445 -0.1139 0.1425  39   ASP A OD1 
251  O OD2 . ASP A 39  ? 1.1399 1.0664 0.8151 -0.0277 -0.0917 0.1214  39   ASP A OD2 
252  N N   . LEU A 40  ? 0.9934 0.8720 0.6307 -0.0284 -0.0856 0.0909  40   LEU A N   
253  C CA  . LEU A 40  ? 0.9613 0.8419 0.6255 -0.0209 -0.0864 0.0838  40   LEU A CA  
254  C C   . LEU A 40  ? 0.9881 0.8949 0.7026 -0.0113 -0.0899 0.0913  40   LEU A C   
255  O O   . LEU A 40  ? 0.9783 0.8863 0.7142 -0.0037 -0.0884 0.0855  40   LEU A O   
256  C CB  . LEU A 40  ? 0.9755 0.8295 0.6127 -0.0092 -0.0692 0.0709  40   LEU A CB  
257  C CG  . LEU A 40  ? 1.0813 0.8949 0.6570 -0.0170 -0.0612 0.0610  40   LEU A CG  
258  C CD1 . LEU A 40  ? 1.0917 0.8794 0.6472 -0.0001 -0.0423 0.0505  40   LEU A CD1 
259  C CD2 . LEU A 40  ? 1.1182 0.9233 0.6795 -0.0397 -0.0771 0.0579  40   LEU A CD2 
260  N N   . THR A 41  ? 0.9299 0.8544 0.6600 -0.0135 -0.0949 0.1043  41   THR A N   
261  C CA  . THR A 41  ? 0.8942 0.8360 0.6632 -0.0081 -0.0983 0.1121  41   THR A CA  
262  C C   . THR A 41  ? 0.8890 0.8328 0.6870 -0.0070 -0.1070 0.1104  41   THR A C   
263  O O   . THR A 41  ? 0.8576 0.8007 0.6729 0.0003  -0.1031 0.1055  41   THR A O   
264  C CB  . THR A 41  ? 1.0113 0.9663 0.7842 -0.0132 -0.1025 0.1268  41   THR A CB  
265  O OG1 . THR A 41  ? 0.9952 0.9505 0.7452 -0.0098 -0.0906 0.1278  41   THR A OG1 
266  C CG2 . THR A 41  ? 0.9922 0.9572 0.7982 -0.0112 -0.1069 0.1356  41   THR A CG2 
267  N N   . ALA A 42  ? 0.8509 0.7993 0.6530 -0.0141 -0.1183 0.1160  42   ALA A N   
268  C CA  . ALA A 42  ? 0.8203 0.7732 0.6483 -0.0107 -0.1251 0.1175  42   ALA A CA  
269  C C   . ALA A 42  ? 0.8412 0.7846 0.6682 -0.0065 -0.1205 0.1029  42   ALA A C   
270  O O   . ALA A 42  ? 0.8009 0.7420 0.6490 0.0020  -0.1177 0.0994  42   ALA A O   
271  C CB  . ALA A 42  ? 0.8367 0.8038 0.6666 -0.0187 -0.1366 0.1298  42   ALA A CB  
272  N N   . PRO A 43  ? 0.8118 0.7454 0.6109 -0.0130 -0.1187 0.0939  43   PRO A N   
273  C CA  . PRO A 43  ? 0.7994 0.7225 0.5980 -0.0085 -0.1140 0.0808  43   PRO A CA  
274  C C   . PRO A 43  ? 0.8593 0.7747 0.6623 0.0035  -0.1019 0.0726  43   PRO A C   
275  O O   . PRO A 43  ? 0.8435 0.7580 0.6628 0.0094  -0.1006 0.0664  43   PRO A O   
276  C CB  . PRO A 43  ? 0.8490 0.7579 0.6096 -0.0210 -0.1149 0.0747  43   PRO A CB  
277  C CG  . PRO A 43  ? 0.9212 0.8274 0.6557 -0.0295 -0.1153 0.0810  43   PRO A CG  
278  C CD  . PRO A 43  ? 0.8496 0.7779 0.6133 -0.0267 -0.1216 0.0954  43   PRO A CD  
279  N N   . VAL A 44  ? 0.8375 0.7518 0.6282 0.0071  -0.0933 0.0749  44   VAL A N   
280  C CA  . VAL A 44  ? 0.8292 0.7462 0.6281 0.0180  -0.0824 0.0721  44   VAL A CA  
281  C C   . VAL A 44  ? 0.8360 0.7652 0.6694 0.0193  -0.0878 0.0770  44   VAL A C   
282  O O   . VAL A 44  ? 0.8250 0.7548 0.6704 0.0245  -0.0841 0.0717  44   VAL A O   
283  C CB  . VAL A 44  ? 0.9083 0.8276 0.6878 0.0232  -0.0705 0.0768  44   VAL A CB  
284  C CG1 . VAL A 44  ? 0.8941 0.8283 0.6905 0.0332  -0.0616 0.0797  44   VAL A CG1 
285  C CG2 . VAL A 44  ? 0.9447 0.8406 0.6824 0.0252  -0.0607 0.0689  44   VAL A CG2 
286  N N   . ALA A 45  ? 0.7771 0.7124 0.6228 0.0139  -0.0962 0.0874  45   ALA A N   
287  C CA  . ALA A 45  ? 0.7528 0.6891 0.6226 0.0139  -0.1004 0.0919  45   ALA A CA  
288  C C   . ALA A 45  ? 0.7929 0.7212 0.6754 0.0180  -0.1027 0.0840  45   ALA A C   
289  O O   . ALA A 45  ? 0.7966 0.7205 0.6906 0.0199  -0.1008 0.0809  45   ALA A O   
290  C CB  . ALA A 45  ? 0.7631 0.7006 0.6380 0.0093  -0.1080 0.1046  45   ALA A CB  
291  N N   . ALA A 46  ? 0.7425 0.6704 0.6209 0.0179  -0.1067 0.0814  46   ALA A N   
292  C CA  . ALA A 46  ? 0.7289 0.6535 0.6193 0.0221  -0.1083 0.0753  46   ALA A CA  
293  C C   . ALA A 46  ? 0.7933 0.7127 0.6806 0.0258  -0.1010 0.0627  46   ALA A C   
294  O O   . ALA A 46  ? 0.7764 0.6918 0.6775 0.0299  -0.1001 0.0581  46   ALA A O   
295  C CB  . ALA A 46  ? 0.7374 0.6692 0.6225 0.0179  -0.1149 0.0779  46   ALA A CB  
296  N N   . VAL A 47  ? 0.7695 0.6876 0.6368 0.0254  -0.0943 0.0582  47   VAL A N   
297  C CA  . VAL A 47  ? 0.7624 0.6771 0.6256 0.0313  -0.0855 0.0492  47   VAL A CA  
298  C C   . VAL A 47  ? 0.7890 0.7125 0.6690 0.0333  -0.0827 0.0527  47   VAL A C   
299  O O   . VAL A 47  ? 0.7601 0.6829 0.6505 0.0357  -0.0812 0.0471  47   VAL A O   
300  C CB  . VAL A 47  ? 0.8284 0.7353 0.6621 0.0339  -0.0761 0.0458  47   VAL A CB  
301  C CG1 . VAL A 47  ? 0.8258 0.7314 0.6575 0.0435  -0.0652 0.0399  47   VAL A CG1 
302  C CG2 . VAL A 47  ? 0.8477 0.7404 0.6581 0.0267  -0.0800 0.0412  47   VAL A CG2 
303  N N   . GLN A 48  ? 0.7581 0.6897 0.6393 0.0295  -0.0834 0.0628  48   GLN A N   
304  C CA  . GLN A 48  ? 0.7536 0.6950 0.6467 0.0258  -0.0827 0.0691  48   GLN A CA  
305  C C   . GLN A 48  ? 0.7900 0.7198 0.6966 0.0218  -0.0884 0.0664  48   GLN A C   
306  O O   . GLN A 48  ? 0.7826 0.7159 0.6949 0.0187  -0.0868 0.0650  48   GLN A O   
307  C CB  . GLN A 48  ? 0.7746 0.7243 0.6651 0.0195  -0.0847 0.0816  48   GLN A CB  
308  C CG  . GLN A 48  ? 0.9452 0.9090 0.8217 0.0239  -0.0764 0.0868  48   GLN A CG  
309  C CD  . GLN A 48  ? 1.2396 1.2139 1.1166 0.0163  -0.0794 0.1002  48   GLN A CD  
310  O OE1 . GLN A 48  ? 1.2417 1.2087 1.1129 0.0130  -0.0846 0.1035  48   GLN A OE1 
311  N NE2 . GLN A 48  ? 1.0506 1.0449 0.9353 0.0117  -0.0770 0.1098  48   GLN A NE2 
312  N N   . ALA A 49  ? 0.7428 0.6589 0.6525 0.0218  -0.0944 0.0675  49   ALA A N   
313  C CA  . ALA A 49  ? 0.7358 0.6339 0.6534 0.0220  -0.0973 0.0658  49   ALA A CA  
314  C C   . ALA A 49  ? 0.7912 0.6863 0.7136 0.0275  -0.0945 0.0543  49   ALA A C   
315  O O   . ALA A 49  ? 0.8106 0.6946 0.7351 0.0249  -0.0935 0.0506  49   ALA A O   
316  C CB  . ALA A 49  ? 0.7500 0.6401 0.6700 0.0261  -0.1016 0.0725  49   ALA A CB  
317  N N   . ALA A 50  ? 0.7271 0.6304 0.6476 0.0328  -0.0933 0.0485  50   ALA A N   
318  C CA  . ALA A 50  ? 0.7105 0.6119 0.6348 0.0371  -0.0907 0.0382  50   ALA A CA  
319  C C   . ALA A 50  ? 0.7408 0.6487 0.6643 0.0355  -0.0854 0.0341  50   ALA A C   
320  O O   . ALA A 50  ? 0.7269 0.6297 0.6562 0.0353  -0.0846 0.0287  50   ALA A O   
321  C CB  . ALA A 50  ? 0.7142 0.6199 0.6320 0.0398  -0.0914 0.0343  50   ALA A CB  
322  N N   . VAL A 51  ? 0.6984 0.6194 0.6147 0.0350  -0.0813 0.0386  51   VAL A N   
323  C CA  . VAL A 51  ? 0.6901 0.6260 0.6075 0.0354  -0.0753 0.0401  51   VAL A CA  
324  C C   . VAL A 51  ? 0.7931 0.7314 0.7183 0.0245  -0.0790 0.0449  51   VAL A C   
325  O O   . VAL A 51  ? 0.7955 0.7387 0.7252 0.0221  -0.0778 0.0419  51   VAL A O   
326  C CB  . VAL A 51  ? 0.7314 0.6821 0.6382 0.0404  -0.0678 0.0474  51   VAL A CB  
327  C CG1 . VAL A 51  ? 0.7243 0.6996 0.6368 0.0413  -0.0615 0.0556  51   VAL A CG1 
328  C CG2 . VAL A 51  ? 0.7320 0.6712 0.6220 0.0496  -0.0621 0.0401  51   VAL A CG2 
329  N N   . SER A 52  ? 0.7892 0.7211 0.7129 0.0161  -0.0840 0.0521  52   SER A N   
330  C CA  . SER A 52  ? 0.8117 0.7375 0.7345 0.0016  -0.0883 0.0570  52   SER A CA  
331  C C   . SER A 52  ? 0.8725 0.7742 0.7941 -0.0004 -0.0897 0.0473  52   SER A C   
332  O O   . SER A 52  ? 0.8738 0.7766 0.7925 -0.0119 -0.0908 0.0475  52   SER A O   
333  C CB  . SER A 52  ? 0.8631 0.7777 0.7801 -0.0058 -0.0928 0.0657  52   SER A CB  
334  O OG  . SER A 52  ? 1.0025 0.9015 0.9116 -0.0222 -0.0969 0.0693  52   SER A OG  
335  N N   . ASN A 53  ? 0.8270 0.7096 0.7501 0.0104  -0.0895 0.0401  53   ASN A N   
336  C CA  . ASN A 53  ? 0.8117 0.6719 0.7336 0.0134  -0.0884 0.0312  53   ASN A CA  
337  C C   . ASN A 53  ? 0.8261 0.7000 0.7531 0.0150  -0.0856 0.0235  53   ASN A C   
338  O O   . ASN A 53  ? 0.8417 0.7038 0.7636 0.0081  -0.0854 0.0190  53   ASN A O   
339  C CB  . ASN A 53  ? 0.7338 0.5827 0.6603 0.0269  -0.0879 0.0296  53   ASN A CB  
340  C CG  . ASN A 53  ? 0.7663 0.5964 0.6876 0.0276  -0.0894 0.0380  53   ASN A CG  
341  O OD1 . ASN A 53  ? 0.7287 0.5429 0.6386 0.0169  -0.0905 0.0427  53   ASN A OD1 
342  N ND2 . ASN A 53  ? 0.6073 0.4393 0.5358 0.0396  -0.0896 0.0416  53   ASN A ND2 
343  N N   . LEU A 54  ? 0.7536 0.6489 0.6867 0.0234  -0.0830 0.0221  54   LEU A N   
344  C CA  . LEU A 54  ? 0.7335 0.6411 0.6704 0.0270  -0.0793 0.0160  54   LEU A CA  
345  C C   . LEU A 54  ? 0.8068 0.7314 0.7439 0.0167  -0.0788 0.0215  54   LEU A C   
346  O O   . LEU A 54  ? 0.7983 0.7214 0.7363 0.0129  -0.0787 0.0167  54   LEU A O   
347  C CB  . LEU A 54  ? 0.7177 0.6360 0.6537 0.0378  -0.0752 0.0141  54   LEU A CB  
348  C CG  . LEU A 54  ? 0.7682 0.6988 0.7047 0.0431  -0.0693 0.0107  54   LEU A CG  
349  C CD1 . LEU A 54  ? 0.7565 0.6785 0.6980 0.0435  -0.0703 0.0013  54   LEU A CD1 
350  C CD2 . LEU A 54  ? 0.8058 0.7361 0.7318 0.0527  -0.0639 0.0094  54   LEU A CD2 
351  N N   . VAL A 55  ? 0.7997 0.7428 0.7361 0.0109  -0.0790 0.0333  55   VAL A N   
352  C CA  . VAL A 55  ? 0.8142 0.7836 0.7529 -0.0009 -0.0795 0.0440  55   VAL A CA  
353  C C   . VAL A 55  ? 0.9309 0.8834 0.8611 -0.0212 -0.0864 0.0433  55   VAL A C   
354  O O   . VAL A 55  ? 0.9515 0.9180 0.8823 -0.0308 -0.0875 0.0454  55   VAL A O   
355  C CB  . VAL A 55  ? 0.8691 0.8656 0.8095 -0.0008 -0.0772 0.0590  55   VAL A CB  
356  C CG1 . VAL A 55  ? 0.8703 0.9016 0.8152 -0.0153 -0.0789 0.0747  55   VAL A CG1 
357  C CG2 . VAL A 55  ? 0.8567 0.8638 0.7977 0.0195  -0.0677 0.0585  55   VAL A CG2 
358  N N   . ARG A 56  ? 0.9140 0.8330 0.8329 -0.0276 -0.0903 0.0408  56   ARG A N   
359  C CA  . ARG A 56  ? 0.9364 0.8249 0.8371 -0.0468 -0.0950 0.0390  56   ARG A CA  
360  C C   . ARG A 56  ? 1.0009 0.8684 0.8959 -0.0449 -0.0930 0.0262  56   ARG A C   
361  O O   . ARG A 56  ? 1.0174 0.8806 0.8999 -0.0632 -0.0960 0.0265  56   ARG A O   
362  C CB  . ARG A 56  ? 0.9450 0.7961 0.8320 -0.0482 -0.0965 0.0393  56   ARG A CB  
363  C CG  . ARG A 56  ? 0.9490 0.7542 0.8082 -0.0657 -0.0985 0.0354  56   ARG A CG  
364  C CD  . ARG A 56  ? 0.9688 0.7272 0.8118 -0.0603 -0.0963 0.0341  56   ARG A CD  
365  N NE  . ARG A 56  ? 1.1363 0.9019 0.9977 -0.0356 -0.0927 0.0338  56   ARG A NE  
366  C CZ  . ARG A 56  ? 1.3025 1.0543 1.1696 -0.0160 -0.0871 0.0260  56   ARG A CZ  
367  N NH1 . ARG A 56  ? 1.0809 0.8083 0.9367 -0.0151 -0.0829 0.0165  56   ARG A NH1 
368  N NH2 . ARG A 56  ? 1.1262 0.8902 1.0091 0.0017  -0.0859 0.0289  56   ARG A NH2 
369  N N   . VAL A 57  ? 0.9583 0.8133 0.8607 -0.0248 -0.0883 0.0161  57   VAL A N   
370  C CA  . VAL A 57  ? 0.9668 0.8054 0.8668 -0.0189 -0.0850 0.0044  57   VAL A CA  
371  C C   . VAL A 57  ? 0.9894 0.8609 0.8993 -0.0216 -0.0848 0.0044  57   VAL A C   
372  O O   . VAL A 57  ? 0.9893 0.8520 0.8903 -0.0309 -0.0852 -0.0006 57   VAL A O   
373  C CB  . VAL A 57  ? 1.0184 0.8479 0.9283 0.0030  -0.0808 -0.0017 57   VAL A CB  
374  C CG1 . VAL A 57  ? 1.0130 0.8389 0.9264 0.0115  -0.0770 -0.0119 57   VAL A CG1 
375  C CG2 . VAL A 57  ? 1.0442 0.8402 0.9433 0.0068  -0.0797 0.0002  57   VAL A CG2 
376  N N   . GLY A 58  ? 0.9138 0.8203 0.8392 -0.0131 -0.0832 0.0110  58   GLY A N   
377  C CA  . GLY A 58  ? 0.8939 0.8331 0.8292 -0.0110 -0.0808 0.0143  58   GLY A CA  
378  C C   . GLY A 58  ? 0.9494 0.9092 0.8806 -0.0319 -0.0853 0.0246  58   GLY A C   
379  O O   . GLY A 58  ? 0.9150 0.8875 0.8482 -0.0360 -0.0851 0.0237  58   GLY A O   
380  N N   . LYS A 59  ? 0.9284 0.8934 0.8533 -0.0472 -0.0900 0.0358  59   LYS A N   
381  C CA  . LYS A 59  ? 0.9401 0.9267 0.8584 -0.0730 -0.0965 0.0487  59   LYS A CA  
382  C C   . LYS A 59  ? 1.0249 0.9759 0.9203 -0.0927 -0.1013 0.0390  59   LYS A C   
383  O O   . LYS A 59  ? 1.0246 0.9964 0.9160 -0.1112 -0.1057 0.0457  59   LYS A O   
384  C CB  . LYS A 59  ? 0.9713 0.9685 0.8858 -0.0861 -0.1009 0.0630  59   LYS A CB  
385  C CG  . LYS A 59  ? 1.0147 1.0645 0.9499 -0.0740 -0.0962 0.0797  59   LYS A CG  
386  C CD  . LYS A 59  ? 1.0826 1.1446 1.0156 -0.0843 -0.0995 0.0940  59   LYS A CD  
387  C CE  . LYS A 59  ? 1.1203 1.2321 1.0721 -0.0670 -0.0915 0.1101  59   LYS A CE  
388  N NZ  . LYS A 59  ? 1.2501 1.3635 1.2001 -0.0668 -0.0915 0.1183  59   LYS A NZ  
389  N N   . GLU A 60  ? 1.0002 0.8982 0.8796 -0.0874 -0.0993 0.0244  60   GLU A N   
390  C CA  . GLU A 60  ? 1.0323 0.8843 0.8837 -0.1008 -0.1000 0.0131  60   GLU A CA  
391  C C   . GLU A 60  ? 1.0694 0.9305 0.9279 -0.0931 -0.0968 0.0045  60   GLU A C   
392  O O   . GLU A 60  ? 1.1000 0.9480 0.9382 -0.1127 -0.0997 0.0017  60   GLU A O   
393  C CB  . GLU A 60  ? 1.0723 0.8692 0.9081 -0.0887 -0.0949 0.0025  60   GLU A CB  
394  C CG  . GLU A 60  ? 1.2895 1.0606 1.1052 -0.1034 -0.0985 0.0097  60   GLU A CG  
395  C CD  . GLU A 60  ? 1.6341 1.3646 1.4436 -0.0852 -0.0927 0.0052  60   GLU A CD  
396  O OE1 . GLU A 60  ? 1.5711 1.2865 1.3875 -0.0621 -0.0853 -0.0043 60   GLU A OE1 
397  O OE2 . GLU A 60  ? 1.5348 1.2507 1.3325 -0.0947 -0.0956 0.0130  60   GLU A OE2 
398  N N   . THR A 61  ? 0.9695 0.8513 0.8535 -0.0668 -0.0911 0.0008  61   THR A N   
399  C CA  . THR A 61  ? 0.9482 0.8406 0.8411 -0.0576 -0.0876 -0.0065 61   THR A CA  
400  C C   . THR A 61  ? 0.9921 0.9285 0.8922 -0.0715 -0.0916 0.0054  61   THR A C   
401  O O   . THR A 61  ? 0.9951 0.9280 0.8852 -0.0831 -0.0932 0.0015  61   THR A O   
402  C CB  . THR A 61  ? 1.0222 0.9216 0.9354 -0.0299 -0.0815 -0.0121 61   THR A CB  
403  O OG1 . THR A 61  ? 1.0703 0.9334 0.9766 -0.0198 -0.0789 -0.0201 61   THR A OG1 
404  C CG2 . THR A 61  ? 0.9548 0.8655 0.8766 -0.0210 -0.0781 -0.0185 61   THR A CG2 
405  N N   . VAL A 62  ? 0.9488 0.9273 0.8648 -0.0707 -0.0925 0.0216  62   VAL A N   
406  C CA  . VAL A 62  ? 0.9440 0.9749 0.8711 -0.0809 -0.0951 0.0395  62   VAL A CA  
407  C C   . VAL A 62  ? 1.0301 1.0586 0.9359 -0.1157 -0.1048 0.0443  62   VAL A C   
408  O O   . VAL A 62  ? 1.0297 1.0812 0.9376 -0.1240 -0.1067 0.0483  62   VAL A O   
409  C CB  . VAL A 62  ? 0.9812 1.0518 0.9247 -0.0733 -0.0929 0.0577  62   VAL A CB  
410  C CG1 . VAL A 62  ? 0.9795 1.1068 0.9312 -0.0906 -0.0973 0.0819  62   VAL A CG1 
411  C CG2 . VAL A 62  ? 0.9510 1.0295 0.9110 -0.0406 -0.0820 0.0548  62   VAL A CG2 
412  N N   . GLN A 63  ? 1.0091 1.0044 0.8906 -0.1368 -0.1106 0.0430  63   GLN A N   
413  C CA  . GLN A 63  ? 1.0488 1.0300 0.8997 -0.1746 -0.1203 0.0464  63   GLN A CA  
414  C C   . GLN A 63  ? 1.1402 1.0773 0.9656 -0.1815 -0.1192 0.0286  63   GLN A C   
415  O O   . GLN A 63  ? 1.1715 1.1193 0.9807 -0.2090 -0.1262 0.0341  63   GLN A O   
416  C CB  . GLN A 63  ? 1.1006 1.0487 0.9264 -0.1946 -0.1255 0.0490  63   GLN A CB  
417  C CG  . GLN A 63  ? 1.2795 1.2759 1.1257 -0.1964 -0.1287 0.0701  63   GLN A CG  
418  C CD  . GLN A 63  ? 1.5179 1.5761 1.3702 -0.2238 -0.1378 0.0946  63   GLN A CD  
419  O OE1 . GLN A 63  ? 1.5271 1.5759 1.3503 -0.2628 -0.1487 0.1017  63   GLN A OE1 
420  N NE2 . GLN A 63  ? 1.2979 1.4208 1.1863 -0.2042 -0.1331 0.1099  63   GLN A NE2 
421  N N   . THR A 64  ? 1.0943 0.9851 0.9157 -0.1577 -0.1103 0.0092  64   THR A N   
422  C CA  . THR A 64  ? 1.1171 0.9622 0.9127 -0.1603 -0.1066 -0.0078 64   THR A CA  
423  C C   . THR A 64  ? 1.1319 1.0039 0.9467 -0.1469 -0.1033 -0.0118 64   THR A C   
424  O O   . THR A 64  ? 1.1570 1.0075 0.9481 -0.1611 -0.1039 -0.0195 64   THR A O   
425  C CB  . THR A 64  ? 1.2482 1.0313 1.0276 -0.1416 -0.0976 -0.0238 64   THR A CB  
426  O OG1 . THR A 64  ? 1.1624 0.9637 0.9764 -0.1070 -0.0908 -0.0268 64   THR A OG1 
427  C CG2 . THR A 64  ? 1.2592 1.0019 1.0102 -0.1568 -0.0999 -0.0211 64   THR A CG2 
428  N N   . THR A 65  ? 1.0365 0.9477 0.8888 -0.1196 -0.0988 -0.0080 65   THR A N   
429  C CA  . THR A 65  ? 1.0042 0.9373 0.8741 -0.1045 -0.0947 -0.0118 65   THR A CA  
430  C C   . THR A 65  ? 1.0664 1.0368 0.9356 -0.1251 -0.1007 -0.0008 65   THR A C   
431  O O   . THR A 65  ? 1.0649 1.0686 0.9338 -0.1465 -0.1083 0.0166  65   THR A O   
432  C CB  . THR A 65  ? 1.0098 0.9689 0.9120 -0.0737 -0.0883 -0.0096 65   THR A CB  
433  O OG1 . THR A 65  ? 0.9910 0.9545 0.9025 -0.0597 -0.0835 -0.0173 65   THR A OG1 
434  C CG2 . THR A 65  ? 0.9415 0.9530 0.8641 -0.0727 -0.0898 0.0105  65   THR A CG2 
435  N N   . GLU A 66  ? 1.0270 0.9957 0.8973 -0.1188 -0.0975 -0.0092 66   GLU A N   
436  C CA  . GLU A 66  ? 1.0335 1.0394 0.9056 -0.1348 -0.1024 0.0009  66   GLU A CA  
437  C C   . GLU A 66  ? 1.0458 1.1008 0.9543 -0.1093 -0.0971 0.0112  66   GLU A C   
438  O O   . GLU A 66  ? 1.0341 1.1347 0.9528 -0.1176 -0.1003 0.0268  66   GLU A O   
439  C CB  . GLU A 66  ? 1.0777 1.0453 0.9218 -0.1461 -0.1018 -0.0150 66   GLU A CB  
440  N N   . ASP A 67  ? 0.9743 1.0186 0.8993 -0.0792 -0.0887 0.0038  67   ASP A N   
441  C CA  . ASP A 67  ? 0.9336 1.0088 0.8845 -0.0532 -0.0814 0.0109  67   ASP A CA  
442  C C   . ASP A 67  ? 0.9501 1.0687 0.9165 -0.0500 -0.0808 0.0329  67   ASP A C   
443  O O   . ASP A 67  ? 0.9383 1.0478 0.9066 -0.0418 -0.0787 0.0332  67   ASP A O   
444  C CB  . ASP A 67  ? 0.9479 0.9896 0.9025 -0.0286 -0.0742 -0.0051 67   ASP A CB  
445  C CG  . ASP A 67  ? 1.0756 1.1325 1.0462 -0.0041 -0.0661 -0.0025 67   ASP A CG  
446  O OD1 . ASP A 67  ? 1.0814 1.1757 1.0636 0.0019  -0.0629 0.0146  67   ASP A OD1 
447  O OD2 . ASP A 67  ? 1.1110 1.1415 1.0807 0.0094  -0.0622 -0.0161 67   ASP A OD2 
448  N N   . GLN A 68  ? 0.8968 1.0653 0.8745 -0.0556 -0.0820 0.0528  68   GLN A N   
449  C CA  . GLN A 68  ? 0.8810 1.1035 0.8756 -0.0522 -0.0802 0.0796  68   GLN A CA  
450  C C   . GLN A 68  ? 0.8995 1.1256 0.9078 -0.0178 -0.0668 0.0835  68   GLN A C   
451  O O   . GLN A 68  ? 0.9000 1.1564 0.9175 -0.0122 -0.0635 0.1015  68   GLN A O   
452  C CB  . GLN A 68  ? 0.8973 1.1754 0.9017 -0.0645 -0.0838 0.1019  68   GLN A CB  
453  C CG  . GLN A 68  ? 1.0599 1.3443 1.0462 -0.1065 -0.0989 0.1054  68   GLN A CG  
454  C CD  . GLN A 68  ? 1.3260 1.6230 1.3051 -0.1299 -0.1072 0.1178  68   GLN A CD  
455  O OE1 . GLN A 68  ? 1.2874 1.6296 1.2857 -0.1206 -0.1039 0.1402  68   GLN A OE1 
456  N NE2 . GLN A 68  ? 1.1996 1.4560 1.1484 -0.1613 -0.1176 0.1046  68   GLN A NE2 
457  N N   . ILE A 69  ? 0.8375 1.0309 0.8440 0.0036  -0.0591 0.0668  69   ILE A N   
458  C CA  . ILE A 69  ? 0.8290 1.0116 0.8385 0.0332  -0.0464 0.0664  69   ILE A CA  
459  C C   . ILE A 69  ? 0.8748 1.0289 0.8765 0.0331  -0.0478 0.0573  69   ILE A C   
460  O O   . ILE A 69  ? 0.8674 1.0343 0.8721 0.0468  -0.0404 0.0686  69   ILE A O   
461  C CB  . ILE A 69  ? 0.8672 1.0230 0.8726 0.0501  -0.0396 0.0527  69   ILE A CB  
462  C CG1 . ILE A 69  ? 0.8685 1.0608 0.8838 0.0547  -0.0357 0.0683  69   ILE A CG1 
463  C CG2 . ILE A 69  ? 0.8830 1.0118 0.8808 0.0747  -0.0282 0.0475  69   ILE A CG2 
464  C CD1 . ILE A 69  ? 0.9502 1.1201 0.9610 0.0603  -0.0339 0.0548  69   ILE A CD1 
465  N N   . LEU A 70  ? 0.8287 0.9467 0.8198 0.0179  -0.0565 0.0391  70   LEU A N   
466  C CA  . LEU A 70  ? 0.8247 0.9170 0.8088 0.0160  -0.0588 0.0319  70   LEU A CA  
467  C C   . LEU A 70  ? 0.8580 0.9804 0.8454 0.0038  -0.0624 0.0500  70   LEU A C   
468  O O   . LEU A 70  ? 0.8405 0.9648 0.8294 0.0144  -0.0579 0.0553  70   LEU A O   
469  C CB  . LEU A 70  ? 0.8346 0.8861 0.8063 0.0031  -0.0659 0.0132  70   LEU A CB  
470  C CG  . LEU A 70  ? 0.8929 0.9153 0.8621 0.0145  -0.0629 -0.0040 70   LEU A CG  
471  C CD1 . LEU A 70  ? 0.9124 0.9006 0.8692 0.0029  -0.0679 -0.0177 70   LEU A CD1 
472  C CD2 . LEU A 70  ? 0.9110 0.9187 0.8813 0.0334  -0.0572 -0.0087 70   LEU A CD2 
473  N N   . LYS A 71  ? 0.8158 0.9649 0.8032 -0.0198 -0.0705 0.0613  71   LYS A N   
474  C CA  . LYS A 71  ? 0.8134 0.9982 0.8036 -0.0375 -0.0761 0.0818  71   LYS A CA  
475  C C   . LYS A 71  ? 0.8412 1.0734 0.8491 -0.0171 -0.0660 0.1046  71   LYS A C   
476  O O   . LYS A 71  ? 0.8462 1.1052 0.8583 -0.0238 -0.0675 0.1210  71   LYS A O   
477  C CB  . LYS A 71  ? 0.8561 1.0649 0.8407 -0.0687 -0.0870 0.0914  71   LYS A CB  
478  C CG  . LYS A 71  ? 1.0055 1.1630 0.9649 -0.0907 -0.0953 0.0704  71   LYS A CG  
479  C CD  . LYS A 71  ? 1.0844 1.2602 1.0301 -0.1258 -0.1065 0.0798  71   LYS A CD  
480  C CE  . LYS A 71  ? 1.1955 1.3587 1.1192 -0.1582 -0.1170 0.0847  71   LYS A CE  
481  N NZ  . LYS A 71  ? 1.2735 1.3630 1.1645 -0.1684 -0.1188 0.0599  71   LYS A NZ  
482  N N   . ARG A 72  ? 0.7809 1.0217 0.7971 0.0083  -0.0546 0.1064  72   ARG A N   
483  C CA  . ARG A 72  ? 0.7657 1.0437 0.7939 0.0340  -0.0406 0.1275  72   ARG A CA  
484  C C   . ARG A 72  ? 0.7880 1.0303 0.8069 0.0604  -0.0285 0.1168  72   ARG A C   
485  O O   . ARG A 72  ? 0.7652 1.0277 0.7869 0.0733  -0.0199 0.1320  72   ARG A O   
486  C CB  . ARG A 72  ? 0.7723 1.0755 0.8096 0.0460  -0.0340 0.1370  72   ARG A CB  
487  C CG  . ARG A 72  ? 0.8726 1.2145 0.9206 0.0767  -0.0163 0.1622  72   ARG A CG  
488  C CD  . ARG A 72  ? 0.9432 1.3031 0.9979 0.0909  -0.0087 0.1708  72   ARG A CD  
489  N NE  . ARG A 72  ? 1.0548 1.3597 1.0955 0.0973  -0.0077 0.1436  72   ARG A NE  
490  C CZ  . ARG A 72  ? 1.2968 1.5585 1.3223 0.1228  0.0056  0.1314  72   ARG A CZ  
491  N NH1 . ARG A 72  ? 1.2314 1.4924 1.2505 0.1463  0.0205  0.1420  72   ARG A NH1 
492  N NH2 . ARG A 72  ? 1.0837 1.3013 1.0974 0.1236  0.0042  0.1090  72   ARG A NH2 
493  N N   . ASP A 73  ? 0.7662 0.9583 0.7729 0.0680  -0.0273 0.0926  73   ASP A N   
494  C CA  . ASP A 73  ? 0.7745 0.9308 0.7675 0.0895  -0.0168 0.0825  73   ASP A CA  
495  C C   . ASP A 73  ? 0.8317 0.9592 0.8159 0.0811  -0.0231 0.0707  73   ASP A C   
496  O O   . ASP A 73  ? 0.8512 0.9632 0.8245 0.0962  -0.0143 0.0703  73   ASP A O   
497  C CB  . ASP A 73  ? 0.8014 0.9233 0.7838 0.1022  -0.0113 0.0669  73   ASP A CB  
498  C CG  . ASP A 73  ? 0.9387 1.0841 0.9259 0.1181  -0.0005 0.0806  73   ASP A CG  
499  O OD1 . ASP A 73  ? 0.9623 1.1370 0.9526 0.1355  0.0120  0.1018  73   ASP A OD1 
500  O OD2 . ASP A 73  ? 0.9961 1.1293 0.9827 0.1157  -0.0031 0.0709  73   ASP A OD2 
501  N N   . MET A 74  ? 0.7696 0.8867 0.7553 0.0578  -0.0371 0.0615  74   MET A N   
502  C CA  . MET A 74  ? 0.7695 0.8600 0.7476 0.0506  -0.0428 0.0524  74   MET A CA  
503  C C   . MET A 74  ? 0.8319 0.9479 0.8130 0.0481  -0.0418 0.0694  74   MET A C   
504  O O   . MET A 74  ? 0.8260 0.9257 0.7991 0.0589  -0.0370 0.0665  74   MET A O   
505  C CB  . MET A 74  ? 0.7983 0.8636 0.7728 0.0307  -0.0549 0.0385  74   MET A CB  
506  C CG  . MET A 74  ? 0.8373 0.8687 0.8067 0.0373  -0.0548 0.0196  74   MET A CG  
507  S SD  . MET A 74  ? 0.9045 0.9085 0.8677 0.0179  -0.0649 0.0065  74   MET A SD  
508  C CE  . MET A 74  ? 0.8714 0.8557 0.8276 0.0113  -0.0694 0.0067  74   MET A CE  
509  N N   . PRO A 75  ? 0.7996 0.9580 0.7910 0.0336  -0.0461 0.0885  75   PRO A N   
510  C CA  . PRO A 75  ? 0.8001 0.9857 0.7948 0.0310  -0.0450 0.1062  75   PRO A CA  
511  C C   . PRO A 75  ? 0.8344 1.0297 0.8274 0.0585  -0.0292 0.1158  75   PRO A C   
512  O O   . PRO A 75  ? 0.8305 1.0160 0.8174 0.0586  -0.0291 0.1158  75   PRO A O   
513  C CB  . PRO A 75  ? 0.8186 1.0543 0.8250 0.0103  -0.0521 0.1274  75   PRO A CB  
514  C CG  . PRO A 75  ? 0.8750 1.0897 0.8760 -0.0078 -0.0620 0.1134  75   PRO A CG  
515  C CD  . PRO A 75  ? 0.8155 0.9996 0.8138 0.0151  -0.0536 0.0959  75   PRO A CD  
516  N N   . PRO A 76  ? 0.7898 0.9974 0.7836 0.0829  -0.0146 0.1229  76   PRO A N   
517  C CA  . PRO A 76  ? 0.7981 1.0034 0.7815 0.1102  0.0030  0.1305  76   PRO A CA  
518  C C   . PRO A 76  ? 0.8648 1.0138 0.8258 0.1162  0.0044  0.1085  76   PRO A C   
519  O O   . PRO A 76  ? 0.8809 1.0250 0.8303 0.1274  0.0131  0.1133  76   PRO A O   
520  C CB  . PRO A 76  ? 0.8206 1.0380 0.8042 0.1338  0.0181  0.1393  76   PRO A CB  
521  C CG  . PRO A 76  ? 0.8614 1.1130 0.8645 0.1165  0.0075  0.1469  76   PRO A CG  
522  C CD  . PRO A 76  ? 0.8029 1.0246 0.8040 0.0879  -0.0117 0.1257  76   PRO A CD  
523  N N   . ALA A 77  ? 0.8248 0.9349 0.7795 0.1078  -0.0043 0.0860  77   ALA A N   
524  C CA  . ALA A 77  ? 0.8359 0.8981 0.7714 0.1091  -0.0058 0.0668  77   ALA A CA  
525  C C   . ALA A 77  ? 0.8945 0.9527 0.8313 0.0944  -0.0159 0.0655  77   ALA A C   
526  O O   . ALA A 77  ? 0.8979 0.9318 0.8185 0.0996  -0.0131 0.0596  77   ALA A O   
527  C CB  . ALA A 77  ? 0.8353 0.8684 0.7687 0.1029  -0.0130 0.0480  77   ALA A CB  
528  N N   . PHE A 78  ? 0.8569 0.9375 0.8098 0.0750  -0.0274 0.0721  78   PHE A N   
529  C CA  . PHE A 78  ? 0.8631 0.9395 0.8161 0.0604  -0.0366 0.0732  78   PHE A CA  
530  C C   . PHE A 78  ? 0.9174 1.0166 0.8678 0.0689  -0.0283 0.0893  78   PHE A C   
531  O O   . PHE A 78  ? 0.9211 1.0019 0.8615 0.0693  -0.0291 0.0854  78   PHE A O   
532  C CB  . PHE A 78  ? 0.8843 0.9733 0.8475 0.0361  -0.0494 0.0772  78   PHE A CB  
533  C CG  . PHE A 78  ? 0.9091 0.9717 0.8713 0.0274  -0.0568 0.0610  78   PHE A CG  
534  C CD1 . PHE A 78  ? 0.9544 0.9801 0.9094 0.0352  -0.0571 0.0436  78   PHE A CD1 
535  C CD2 . PHE A 78  ? 0.9532 1.0292 0.9200 0.0102  -0.0634 0.0647  78   PHE A CD2 
536  C CE1 . PHE A 78  ? 0.9722 0.9771 0.9271 0.0296  -0.0621 0.0306  78   PHE A CE1 
537  C CE2 . PHE A 78  ? 0.9937 1.0427 0.9564 0.0037  -0.0684 0.0496  78   PHE A CE2 
538  C CZ  . PHE A 78  ? 0.9665 0.9814 0.9246 0.0153  -0.0668 0.0329  78   PHE A CZ  
539  N N   . ILE A 79  ? 0.8808 1.0227 0.8406 0.0770  -0.0194 0.1091  79   ILE A N   
540  C CA  . ILE A 79  ? 0.8914 1.0627 0.8502 0.0895  -0.0079 0.1286  79   ILE A CA  
541  C C   . ILE A 79  ? 0.9320 1.0666 0.8662 0.1112  0.0052  0.1186  79   ILE A C   
542  O O   . ILE A 79  ? 0.9468 1.0758 0.8718 0.1112  0.0064  0.1210  79   ILE A O   
543  C CB  . ILE A 79  ? 0.9395 1.1658 0.9139 0.0992  0.0016  0.1535  79   ILE A CB  
544  C CG1 . ILE A 79  ? 0.9394 1.2028 0.9338 0.0702  -0.0144 0.1646  79   ILE A CG1 
545  C CG2 . ILE A 79  ? 0.9695 1.2268 0.9417 0.1182  0.0175  0.1754  79   ILE A CG2 
546  C CD1 . ILE A 79  ? 1.0330 1.3452 1.0439 0.0738  -0.0101 0.1839  79   ILE A CD1 
547  N N   . LYS A 80  ? 0.8684 0.9739 0.7887 0.1261  0.0137  0.1065  80   LYS A N   
548  C CA  . LYS A 80  ? 0.8763 0.9368 0.7649 0.1423  0.0252  0.0943  80   LYS A CA  
549  C C   . LYS A 80  ? 0.9099 0.9377 0.7867 0.1280  0.0137  0.0795  80   LYS A C   
550  O O   . LYS A 80  ? 0.9288 0.9429 0.7848 0.1351  0.0213  0.0810  80   LYS A O   
551  C CB  . LYS A 80  ? 0.9078 0.9402 0.7864 0.1493  0.0286  0.0810  80   LYS A CB  
552  C CG  . LYS A 80  ? 1.0272 1.0606 0.8915 0.1762  0.0501  0.0912  80   LYS A CG  
553  C CD  . LYS A 80  ? 1.1159 1.1127 0.9660 0.1790  0.0511  0.0753  80   LYS A CD  
554  C CE  . LYS A 80  ? 1.2095 1.1976 1.0399 0.2070  0.0738  0.0846  80   LYS A CE  
555  N NZ  . LYS A 80  ? 1.2870 1.2257 1.0920 0.2085  0.0758  0.0670  80   LYS A NZ  
556  N N   . VAL A 81  ? 0.8382 0.8553 0.7275 0.1088  -0.0036 0.0671  81   VAL A N   
557  C CA  . VAL A 81  ? 0.8411 0.8327 0.7234 0.0962  -0.0148 0.0561  81   VAL A CA  
558  C C   . VAL A 81  ? 0.8579 0.8684 0.7470 0.0880  -0.0191 0.0677  81   VAL A C   
559  O O   . VAL A 81  ? 0.8566 0.8498 0.7308 0.0868  -0.0201 0.0648  81   VAL A O   
560  C CB  . VAL A 81  ? 0.8863 0.8632 0.7804 0.0828  -0.0288 0.0427  81   VAL A CB  
561  C CG1 . VAL A 81  ? 0.8892 0.8462 0.7792 0.0724  -0.0394 0.0358  81   VAL A CG1 
562  C CG2 . VAL A 81  ? 0.8882 0.8461 0.7732 0.0903  -0.0244 0.0318  81   VAL A CG2 
563  N N   . GLU A 82  ? 0.7966 0.8436 0.7060 0.0809  -0.0219 0.0821  82   GLU A N   
564  C CA  . GLU A 82  ? 0.8048 0.8729 0.7208 0.0705  -0.0266 0.0953  82   GLU A CA  
565  C C   . GLU A 82  ? 0.8424 0.9215 0.7445 0.0864  -0.0122 0.1067  82   GLU A C   
566  O O   . GLU A 82  ? 0.8336 0.9038 0.7266 0.0824  -0.0146 0.1074  82   GLU A O   
567  C CB  . GLU A 82  ? 0.8214 0.9274 0.7581 0.0562  -0.0328 0.1098  82   GLU A CB  
568  C CG  . GLU A 82  ? 1.0243 1.1135 0.9681 0.0351  -0.0483 0.1001  82   GLU A CG  
569  C CD  . GLU A 82  ? 1.3695 1.4907 1.3258 0.0162  -0.0552 0.1139  82   GLU A CD  
570  O OE1 . GLU A 82  ? 1.2443 1.3852 1.2085 0.0183  -0.0525 0.1173  82   GLU A OE1 
571  O OE2 . GLU A 82  ? 1.3614 1.4876 1.3176 -0.0024 -0.0638 0.1220  82   GLU A OE2 
572  N N   . ASN A 83  ? 0.8077 0.9046 0.7063 0.1060  0.0040  0.1164  83   ASN A N   
573  C CA  . ASN A 83  ? 0.8291 0.9347 0.7108 0.1260  0.0221  0.1288  83   ASN A CA  
574  C C   . ASN A 83  ? 0.8838 0.9395 0.7307 0.1332  0.0277  0.1131  83   ASN A C   
575  O O   . ASN A 83  ? 0.8830 0.9374 0.7149 0.1371  0.0337  0.1191  83   ASN A O   
576  C CB  . ASN A 83  ? 0.8166 0.9480 0.7003 0.1491  0.0404  0.1433  83   ASN A CB  
577  C CG  . ASN A 83  ? 1.0657 1.2593 0.9822 0.1417  0.0366  0.1665  83   ASN A CG  
578  O OD1 . ASN A 83  ? 0.8967 1.1132 0.8312 0.1177  0.0207  0.1725  83   ASN A OD1 
579  N ND2 . ASN A 83  ? 1.0444 1.2663 0.9668 0.1615  0.0513  0.1815  83   ASN A ND2 
580  N N   . ALA A 84  ? 0.8516 0.8676 0.6844 0.1325  0.0248  0.0939  84   ALA A N   
581  C CA  . ALA A 84  ? 0.8789 0.8465 0.6759 0.1336  0.0274  0.0787  84   ALA A CA  
582  C C   . ALA A 84  ? 0.9313 0.8935 0.7308 0.1149  0.0120  0.0750  84   ALA A C   
583  O O   . ALA A 84  ? 0.9613 0.9027 0.7329 0.1163  0.0167  0.0732  84   ALA A O   
584  C CB  . ALA A 84  ? 0.8873 0.8234 0.6756 0.1314  0.0238  0.0620  84   ALA A CB  
585  N N   . CYS A 85  ? 0.8611 0.8408 0.6914 0.0978  -0.0053 0.0751  85   CYS A N   
586  C CA  . CYS A 85  ? 0.8500 0.8266 0.6860 0.0816  -0.0195 0.0744  85   CYS A CA  
587  C C   . CYS A 85  ? 0.9022 0.9009 0.7366 0.0828  -0.0147 0.0898  85   CYS A C   
588  O O   . CYS A 85  ? 0.8979 0.8841 0.7188 0.0772  -0.0184 0.0890  85   CYS A O   
589  C CB  . CYS A 85  ? 0.8265 0.8113 0.6908 0.0669  -0.0350 0.0722  85   CYS A CB  
590  S SG  . CYS A 85  ? 0.8742 0.8467 0.7430 0.0510  -0.0507 0.0709  85   CYS A SG  
591  N N   . THR A 86  ? 0.8653 0.9000 0.7131 0.0899  -0.0063 0.1056  86   THR A N   
592  C CA  . THR A 86  ? 0.8807 0.9440 0.7286 0.0925  0.0001  0.1236  86   THR A CA  
593  C C   . THR A 86  ? 0.9540 0.9942 0.7658 0.1085  0.0158  0.1217  86   THR A C   
594  O O   . THR A 86  ? 0.9759 1.0163 0.7784 0.1035  0.0142  0.1264  86   THR A O   
595  C CB  . THR A 86  ? 0.9933 1.1056 0.8637 0.0973  0.0064  0.1433  86   THR A CB  
596  O OG1 . THR A 86  ? 0.9652 1.0899 0.8610 0.0773  -0.0099 0.1427  86   THR A OG1 
597  C CG2 . THR A 86  ? 0.9495 1.0995 0.8229 0.0998  0.0133  0.1654  86   THR A CG2 
598  N N   . LYS A 87  ? 0.9118 0.9267 0.6991 0.1263  0.0307  0.1138  87   LYS A N   
599  C CA  . LYS A 87  ? 0.9461 0.9256 0.6884 0.1407  0.0474  0.1090  87   LYS A CA  
600  C C   . LYS A 87  ? 1.0152 0.9580 0.7361 0.1230  0.0343  0.0942  87   LYS A C   
601  O O   . LYS A 87  ? 1.0490 0.9771 0.7408 0.1246  0.0409  0.0959  87   LYS A O   
602  C CB  . LYS A 87  ? 0.9989 0.9508 0.7166 0.1604  0.0645  0.1023  87   LYS A CB  
603  N N   . LEU A 88  ? 0.9353 0.8679 0.6721 0.1059  0.0156  0.0821  88   LEU A N   
604  C CA  . LEU A 88  ? 0.9323 0.8403 0.6557 0.0884  0.0014  0.0722  88   LEU A CA  
605  C C   . LEU A 88  ? 0.9485 0.8775 0.6859 0.0771  -0.0086 0.0826  88   LEU A C   
606  O O   . LEU A 88  ? 0.9362 0.8478 0.6494 0.0696  -0.0114 0.0805  88   LEU A O   
607  C CB  . LEU A 88  ? 0.9087 0.8083 0.6503 0.0762  -0.0143 0.0608  88   LEU A CB  
608  C CG  . LEU A 88  ? 0.9824 0.8524 0.7031 0.0809  -0.0088 0.0478  88   LEU A CG  
609  C CD1 . LEU A 88  ? 0.9629 0.8322 0.7053 0.0676  -0.0255 0.0396  88   LEU A CD1 
610  C CD2 . LEU A 88  ? 1.0384 0.8664 0.7054 0.0803  0.0000  0.0402  88   LEU A CD2 
611  N N   . VAL A 89  ? 0.8990 0.8638 0.6731 0.0736  -0.0147 0.0941  89   VAL A N   
612  C CA  . VAL A 89  ? 0.9011 0.8863 0.6902 0.0622  -0.0240 0.1057  89   VAL A CA  
613  C C   . VAL A 89  ? 0.9721 0.9661 0.7396 0.0713  -0.0102 0.1166  89   VAL A C   
614  O O   . VAL A 89  ? 0.9824 0.9758 0.7429 0.0625  -0.0159 0.1210  89   VAL A O   
615  C CB  . VAL A 89  ? 0.9284 0.9429 0.7544 0.0535  -0.0332 0.1148  89   VAL A CB  
616  C CG1 . VAL A 89  ? 0.9217 0.9529 0.7578 0.0408  -0.0417 0.1279  89   VAL A CG1 
617  C CG2 . VAL A 89  ? 0.9080 0.9074 0.7497 0.0454  -0.0455 0.1031  89   VAL A CG2 
618  N N   . GLN A 90  ? 0.9612 0.9621 0.7163 0.0907  0.0092  0.1216  90   GLN A N   
619  C CA  . GLN A 90  ? 0.9915 0.9986 0.7218 0.1047  0.0271  0.1326  90   GLN A CA  
620  C C   . GLN A 90  ? 1.0717 1.0328 0.7539 0.1049  0.0324  0.1204  90   GLN A C   
621  O O   . GLN A 90  ? 1.1219 1.0847 0.7879 0.1025  0.0350  0.1271  90   GLN A O   
622  C CB  . GLN A 90  ? 1.0171 1.0429 0.7461 0.1291  0.0487  0.1431  90   GLN A CB  
623  C CG  . GLN A 90  ? 1.2572 1.3419 1.0273 0.1275  0.0462  0.1644  90   GLN A CG  
624  C CD  . GLN A 90  ? 1.5963 1.7069 1.3652 0.1539  0.0692  0.1795  90   GLN A CD  
625  O OE1 . GLN A 90  ? 1.5298 1.6482 1.3127 0.1606  0.0714  0.1789  90   GLN A OE1 
626  N NE2 . GLN A 90  ? 1.5665 1.6926 1.3185 0.1710  0.0879  0.1950  90   GLN A NE2 
627  N N   . ALA A 91  ? 1.0176 0.9381 0.6758 0.1045  0.0327  0.1032  91   ALA A N   
628  C CA  . ALA A 91  ? 1.0554 0.9278 0.6627 0.0988  0.0354  0.0905  91   ALA A CA  
629  C C   . ALA A 91  ? 1.1270 1.0003 0.7377 0.0752  0.0153  0.0899  91   ALA A C   
630  O O   . ALA A 91  ? 1.1734 1.0256 0.7456 0.0708  0.0195  0.0891  91   ALA A O   
631  C CB  . ALA A 91  ? 1.0738 0.9090 0.6617 0.0979  0.0356  0.0742  91   ALA A CB  
632  N N   . ALA A 92  ? 1.0525 0.9497 0.7071 0.0612  -0.0053 0.0916  92   ALA A N   
633  C CA  . ALA A 92  ? 1.0543 0.9564 0.7174 0.0418  -0.0239 0.0942  92   ALA A CA  
634  C C   . ALA A 92  ? 1.1317 1.0577 0.8004 0.0410  -0.0227 0.1092  92   ALA A C   
635  O O   . ALA A 92  ? 1.1366 1.0570 0.7900 0.0290  -0.0302 0.1118  92   ALA A O   
636  C CB  . ALA A 92  ? 1.0254 0.9423 0.7306 0.0325  -0.0417 0.0934  92   ALA A CB  
637  N N   . GLN A 93  ? 1.1038 1.0597 0.7949 0.0523  -0.0139 0.1206  93   GLN A N   
638  C CA  . GLN A 93  ? 1.1111 1.0951 0.8093 0.0520  -0.0114 0.1372  93   GLN A CA  
639  C C   . GLN A 93  ? 1.2025 1.1707 0.8553 0.0631  0.0071  0.1385  93   GLN A C   
640  O O   . GLN A 93  ? 1.2084 1.1844 0.8524 0.0567  0.0054  0.1472  93   GLN A O   
641  C CB  . GLN A 93  ? 1.1021 1.1259 0.8359 0.0578  -0.0082 0.1509  93   GLN A CB  
642  C CG  . GLN A 93  ? 1.2522 1.2895 1.0244 0.0410  -0.0281 0.1533  93   GLN A CG  
643  C CD  . GLN A 93  ? 1.4529 1.5187 1.2549 0.0422  -0.0276 0.1610  93   GLN A CD  
644  O OE1 . GLN A 93  ? 1.4317 1.5204 1.2338 0.0559  -0.0129 0.1696  93   GLN A OE1 
645  N NE2 . GLN A 93  ? 1.2319 1.2970 1.0581 0.0275  -0.0433 0.1596  93   GLN A NE2 
646  N N   . MET A 94  ? 1.1895 1.1302 0.8095 0.0795  0.0254  0.1295  94   MET A N   
647  C CA  . MET A 94  ? 1.2411 1.1534 0.8072 0.0923  0.0465  0.1283  94   MET A CA  
648  C C   . MET A 94  ? 1.3258 1.1990 0.8508 0.0737  0.0375  0.1170  94   MET A C   
649  O O   . MET A 94  ? 1.3488 1.2163 0.8447 0.0723  0.0439  0.1223  94   MET A O   
650  C CB  . MET A 94  ? 1.2974 1.1829 0.8358 0.1152  0.0689  0.1214  94   MET A CB  
651  C CG  . MET A 94  ? 1.3363 1.2621 0.8994 0.1394  0.0863  0.1386  94   MET A CG  
652  S SD  . MET A 94  ? 1.4260 1.3214 0.9625 0.1677  0.1112  0.1320  94   MET A SD  
653  C CE  . MET A 94  ? 1.3486 1.3167 0.9394 0.1866  0.1199  0.1580  94   MET A CE  
654  N N   . LEU A 95  ? 1.2887 1.1383 0.8113 0.0582  0.0225  0.1030  95   LEU A N   
655  C CA  . LEU A 95  ? 1.3199 1.1378 0.8058 0.0362  0.0108  0.0941  95   LEU A CA  
656  C C   . LEU A 95  ? 1.3614 1.2056 0.8676 0.0175  -0.0082 0.1045  95   LEU A C   
657  O O   . LEU A 95  ? 1.3783 1.2021 0.8467 0.0019  -0.0129 0.1025  95   LEU A O   
658  C CB  . LEU A 95  ? 1.3164 1.1093 0.7967 0.0246  0.0001  0.0798  95   LEU A CB  
659  C CG  . LEU A 95  ? 1.4094 1.1580 0.8463 0.0380  0.0195  0.0671  95   LEU A CG  
660  C CD1 . LEU A 95  ? 1.3914 1.1371 0.8507 0.0338  0.0096  0.0579  95   LEU A CD1 
661  C CD2 . LEU A 95  ? 1.4715 1.1652 0.8323 0.0283  0.0287  0.0579  95   LEU A CD2 
662  N N   . GLN A 96  ? 1.2877 1.1746 0.8496 0.0182  -0.0186 0.1164  96   GLN A N   
663  C CA  . GLN A 96  ? 1.2756 1.1878 0.8605 0.0038  -0.0349 0.1286  96   GLN A CA  
664  C C   . GLN A 96  ? 1.3615 1.2782 0.9202 0.0075  -0.0231 0.1383  96   GLN A C   
665  O O   . GLN A 96  ? 1.3744 1.2920 0.9205 -0.0071 -0.0326 0.1438  96   GLN A O   
666  C CB  . GLN A 96  ? 1.2483 1.1949 0.8906 0.0053  -0.0449 0.1379  96   GLN A CB  
667  C CG  . GLN A 96  ? 1.4586 1.4180 1.1273 -0.0107 -0.0659 0.1454  96   GLN A CG  
668  C CD  . GLN A 96  ? 1.7199 1.6976 1.4356 -0.0096 -0.0746 0.1503  96   GLN A CD  
669  O OE1 . GLN A 96  ? 1.6542 1.6437 1.3866 -0.0004 -0.0667 0.1515  96   GLN A OE1 
670  N NE2 . GLN A 96  ? 1.6329 1.6129 1.3685 -0.0193 -0.0904 0.1545  96   GLN A NE2 
671  N N   . SER A 97  ? 1.3274 1.2480 0.8763 0.0282  -0.0013 0.1415  97   SER A N   
672  C CA  . SER A 97  ? 1.3508 1.2777 0.8738 0.0376  0.0151  0.1519  97   SER A CA  
673  C C   . SER A 97  ? 1.4364 1.3130 0.8889 0.0408  0.0313  0.1402  97   SER A C   
674  O O   . SER A 97  ? 1.4693 1.3394 0.8893 0.0374  0.0371  0.1452  97   SER A O   
675  C CB  . SER A 97  ? 1.3907 1.3494 0.9367 0.0603  0.0325  0.1639  97   SER A CB  
676  O OG  . SER A 97  ? 1.4402 1.4350 1.0431 0.0561  0.0189  0.1710  97   SER A OG  
677  N N   . ASP A 98  ? 1.3844 1.2224 0.8097 0.0465  0.0391  0.1245  98   ASP A N   
678  C CA  . ASP A 98  ? 1.4359 1.2147 0.7864 0.0478  0.0553  0.1114  98   ASP A CA  
679  C C   . ASP A 98  ? 1.4804 1.2219 0.8133 0.0333  0.0447  0.0940  98   ASP A C   
680  O O   . ASP A 98  ? 1.4691 1.2027 0.8119 0.0476  0.0528  0.0878  98   ASP A O   
681  C CB  . ASP A 98  ? 1.4835 1.2482 0.8048 0.0810  0.0891  0.1145  98   ASP A CB  
682  C CG  . ASP A 98  ? 1.5823 1.2750 0.8173 0.0874  0.1117  0.1007  98   ASP A CG  
683  O OD1 . ASP A 98  ? 1.6121 1.2651 0.8015 0.0615  0.1008  0.0893  98   ASP A OD1 
684  O OD2 . ASP A 98  ? 1.6449 1.3204 0.8556 0.1179  0.1408  0.1027  98   ASP A OD2 
685  N N   . PRO A 99  ? 1.4385 1.1584 0.7433 0.0042  0.0272  0.0874  99   PRO A N   
686  C CA  . PRO A 99  ? 1.4394 1.1297 0.7288 -0.0126 0.0155  0.0735  99   PRO A CA  
687  C C   . PRO A 99  ? 1.5378 1.1614 0.7562 -0.0057 0.0367  0.0578  99   PRO A C   
688  O O   . PRO A 99  ? 1.5252 1.1249 0.7331 -0.0169 0.0294  0.0467  99   PRO A O   
689  C CB  . PRO A 99  ? 1.4715 1.1666 0.7508 -0.0464 -0.0088 0.0763  99   PRO A CB  
690  C CG  . PRO A 99  ? 1.5079 1.2410 0.8110 -0.0453 -0.0123 0.0922  99   PRO A CG  
691  C CD  . PRO A 99  ? 1.4671 1.1953 0.7571 -0.0164 0.0153  0.0950  99   PRO A CD  
692  N N   . TYR A 100 ? 1.5443 1.1362 0.7118 0.0131  0.0639  0.0577  100  TYR A N   
693  C CA  . TYR A 100 ? 1.6146 1.1333 0.7031 0.0240  0.0897  0.0441  100  TYR A CA  
694  C C   . TYR A 100 ? 1.6629 1.1845 0.7654 0.0654  0.1177  0.0480  100  TYR A C   
695  O O   . TYR A 100 ? 1.7287 1.1894 0.7671 0.0821  0.1440  0.0392  100  TYR A O   
696  C CB  . TYR A 100 ? 1.7060 1.1791 0.7163 0.0165  0.1031  0.0420  100  TYR A CB  
697  C CG  . TYR A 100 ? 1.7330 1.2040 0.7243 -0.0261 0.0758  0.0402  100  TYR A CG  
698  C CD1 . TYR A 100 ? 1.7113 1.2374 0.7448 -0.0370 0.0587  0.0548  100  TYR A CD1 
699  C CD2 . TYR A 100 ? 1.7968 1.2131 0.7279 -0.0570 0.0663  0.0260  100  TYR A CD2 
700  C CE1 . TYR A 100 ? 1.7223 1.2525 0.7418 -0.0751 0.0333  0.0563  100  TYR A CE1 
701  C CE2 . TYR A 100 ? 1.8182 1.2403 0.7335 -0.0980 0.0400  0.0279  100  TYR A CE2 
702  C CZ  . TYR A 100 ? 1.8610 1.3422 0.8227 -0.1056 0.0238  0.0437  100  TYR A CZ  
703  O OH  . TYR A 100 ? 1.9049 1.3976 0.8548 -0.1448 -0.0023 0.0486  100  TYR A OH  
704  N N   . SER A 101 ? 1.5512 1.1425 0.7349 0.0810  0.1121  0.0621  101  SER A N   
705  C CA  . SER A 101 ? 1.5342 1.1483 0.7460 0.1176  0.1341  0.0714  101  SER A CA  
706  C C   . SER A 101 ? 1.6176 1.1879 0.8039 0.1307  0.1475  0.0595  101  SER A C   
707  O O   . SER A 101 ? 1.5929 1.1529 0.7899 0.1107  0.1284  0.0481  101  SER A O   
708  C CB  . SER A 101 ? 1.4944 1.1881 0.7965 0.1189  0.1169  0.0865  101  SER A CB  
709  O OG  . SER A 101 ? 1.5613 1.2844 0.8928 0.1500  0.1355  0.0980  101  SER A OG  
710  N N   . VAL A 102 ? 1.6285 1.1747 0.7812 0.1659  0.1815  0.0642  102  VAL A N   
711  C CA  . VAL A 102 ? 1.6650 1.1647 0.7857 0.1860  0.2014  0.0559  102  VAL A CA  
712  C C   . VAL A 102 ? 1.6433 1.1982 0.8375 0.2019  0.1970  0.0650  102  VAL A C   
713  O O   . VAL A 102 ? 1.6210 1.1497 0.8115 0.1952  0.1908  0.0528  102  VAL A O   
714  C CB  . VAL A 102 ? 1.8018 1.2422 0.8447 0.2191  0.2428  0.0576  102  VAL A CB  
715  C CG1 . VAL A 102 ? 1.8539 1.2217 0.8419 0.2312  0.2610  0.0440  102  VAL A CG1 
716  C CG2 . VAL A 102 ? 1.8649 1.2598 0.8397 0.2030  0.2467  0.0512  102  VAL A CG2 
717  N N   . PRO A 103 ? 1.5613 1.1908 0.8190 0.2207  0.2000  0.0866  103  PRO A N   
718  C CA  . PRO A 103 ? 1.5034 1.1815 0.8243 0.2314  0.1947  0.0947  103  PRO A CA  
719  C C   . PRO A 103 ? 1.4846 1.1865 0.8549 0.1985  0.1588  0.0850  103  PRO A C   
720  O O   . PRO A 103 ? 1.4463 1.1606 0.8474 0.2012  0.1534  0.0828  103  PRO A O   
721  C CB  . PRO A 103 ? 1.4938 1.2458 0.8632 0.2517  0.2037  0.1215  103  PRO A CB  
722  C CG  . PRO A 103 ? 1.5997 1.3343 0.9239 0.2602  0.2210  0.1274  103  PRO A CG  
723  C CD  . PRO A 103 ? 1.5771 1.2515 0.8512 0.2299  0.2067  0.1053  103  PRO A CD  
724  N N   . ALA A 104 ? 1.4203 1.1275 0.7959 0.1688  0.1357  0.0803  104  ALA A N   
725  C CA  . ALA A 104 ? 1.3637 1.0902 0.7805 0.1389  0.1033  0.0727  104  ALA A CA  
726  C C   . ALA A 104 ? 1.4183 1.0969 0.8078 0.1278  0.0978  0.0542  104  ALA A C   
727  O O   . ALA A 104 ? 1.3741 1.0750 0.8069 0.1207  0.0825  0.0512  104  ALA A O   
728  C CB  . ALA A 104 ? 1.3724 1.1048 0.7861 0.1138  0.0852  0.0731  104  ALA A CB  
729  N N   . ARG A 105 ? 1.4262 1.0372 0.7408 0.1265  0.1118  0.0422  105  ARG A N   
730  C CA  . ARG A 105 ? 1.4466 1.0041 0.7228 0.1138  0.1087  0.0252  105  ARG A CA  
731  C C   . ARG A 105 ? 1.4574 1.0115 0.7460 0.1387  0.1238  0.0251  105  ARG A C   
732  O O   . ARG A 105 ? 1.4247 0.9655 0.7187 0.1266  0.1125  0.0149  105  ARG A O   
733  C CB  . ARG A 105 ? 1.5450 1.0258 0.7292 0.1044  0.1216  0.0137  105  ARG A CB  
734  N N   . ASP A 106 ? 1.4090 0.9817 0.7058 0.1732  0.1487  0.0389  106  ASP A N   
735  C CA  . ASP A 106 ? 1.3980 0.9786 0.7121 0.2002  0.1644  0.0440  106  ASP A CA  
736  C C   . ASP A 106 ? 1.3556 1.0086 0.7541 0.1944  0.1433  0.0523  106  ASP A C   
737  O O   . ASP A 106 ? 1.3111 0.9643 0.7271 0.1967  0.1402  0.0478  106  ASP A O   
738  C CB  . ASP A 106 ? 1.4581 1.0396 0.7517 0.2401  0.1993  0.0603  106  ASP A CB  
739  C CG  . ASP A 106 ? 1.6703 1.1662 0.8713 0.2535  0.2273  0.0511  106  ASP A CG  
740  O OD1 . ASP A 106 ? 1.7191 1.1582 0.8792 0.2583  0.2374  0.0396  106  ASP A OD1 
741  O OD2 . ASP A 106 ? 1.7519 1.2342 0.9178 0.2593  0.2402  0.0556  106  ASP A OD2 
742  N N   . TYR A 107 ? 1.2815 0.9917 0.7275 0.1860  0.1293  0.0641  107  TYR A N   
743  C CA  . TYR A 107 ? 1.2211 0.9950 0.7404 0.1766  0.1087  0.0722  107  TYR A CA  
744  C C   . TYR A 107 ? 1.2212 0.9866 0.7579 0.1487  0.0820  0.0570  107  TYR A C   
745  O O   . TYR A 107 ? 1.1564 0.9555 0.7408 0.1450  0.0698  0.0589  107  TYR A O   
746  C CB  . TYR A 107 ? 1.2249 1.0482 0.7765 0.1709  0.1008  0.0875  107  TYR A CB  
747  C CG  . TYR A 107 ? 1.2671 1.1354 0.8378 0.1963  0.1198  0.1101  107  TYR A CG  
748  C CD1 . TYR A 107 ? 1.3434 1.1937 0.8811 0.2281  0.1501  0.1168  107  TYR A CD1 
749  C CD2 . TYR A 107 ? 1.2425 1.1709 0.8608 0.1883  0.1084  0.1267  107  TYR A CD2 
750  C CE1 . TYR A 107 ? 1.3660 1.2652 0.9233 0.2531  0.1684  0.1417  107  TYR A CE1 
751  C CE2 . TYR A 107 ? 1.2566 1.2332 0.8931 0.2089  0.1246  0.1507  107  TYR A CE2 
752  C CZ  . TYR A 107 ? 1.4178 1.3835 1.0259 0.2420  0.1547  0.1591  107  TYR A CZ  
753  O OH  . TYR A 107 ? 1.4521 1.4727 1.0806 0.2642  0.1718  0.1866  107  TYR A OH  
754  N N   . LEU A 108 ? 1.2137 0.9358 0.7102 0.1289  0.0735  0.0435  108  LEU A N   
755  C CA  . LEU A 108 ? 1.1990 0.9133 0.7062 0.1031  0.0501  0.0316  108  LEU A CA  
756  C C   . LEU A 108 ? 1.2646 0.9493 0.7568 0.1088  0.0564  0.0214  108  LEU A C   
757  O O   . LEU A 108 ? 1.2256 0.9320 0.7570 0.1015  0.0423  0.0187  108  LEU A O   
758  C CB  . LEU A 108 ? 1.2391 0.9206 0.7039 0.0793  0.0403  0.0241  108  LEU A CB  
759  C CG  . LEU A 108 ? 1.2760 0.9932 0.7695 0.0638  0.0228  0.0326  108  LEU A CG  
760  C CD1 . LEU A 108 ? 1.3312 1.0142 0.7709 0.0468  0.0213  0.0289  108  LEU A CD1 
761  C CD2 . LEU A 108 ? 1.2553 1.0045 0.7993 0.0472  -0.0018 0.0327  108  LEU A CD2 
762  N N   . ILE A 109 ? 1.2787 0.9112 0.7117 0.1233  0.0793  0.0164  109  ILE A N   
763  C CA  . ILE A 109 ? 1.3025 0.8981 0.7114 0.1317  0.0897  0.0078  109  ILE A CA  
764  C C   . ILE A 109 ? 1.2916 0.9330 0.7546 0.1527  0.0944  0.0177  109  ILE A C   
765  O O   . ILE A 109 ? 1.2678 0.9135 0.7522 0.1463  0.0845  0.0116  109  ILE A O   
766  C CB  . ILE A 109 ? 1.4311 0.9565 0.7595 0.1470  0.1177  0.0029  109  ILE A CB  
767  C CG1 . ILE A 109 ? 1.5012 0.9706 0.7658 0.1183  0.1101  -0.0101 109  ILE A CG1 
768  C CG2 . ILE A 109 ? 1.4639 0.9565 0.7716 0.1683  0.1367  0.0000  109  ILE A CG2 
769  C CD1 . ILE A 109 ? 1.6435 1.0788 0.8859 0.0897  0.0936  -0.0244 109  ILE A CD1 
770  N N   . ASP A 110 ? 1.2282 0.9063 0.7124 0.1761  0.1089  0.0342  110  ASP A N   
771  C CA  . ASP A 110 ? 1.1878 0.9159 0.7216 0.1943  0.1136  0.0477  110  ASP A CA  
772  C C   . ASP A 110 ? 1.1430 0.9209 0.7401 0.1741  0.0867  0.0480  110  ASP A C   
773  O O   . ASP A 110 ? 1.0918 0.8889 0.7179 0.1779  0.0839  0.0490  110  ASP A O   
774  C CB  . ASP A 110 ? 1.2253 0.9858 0.7649 0.2211  0.1347  0.0687  110  ASP A CB  
775  C CG  . ASP A 110 ? 1.5166 1.2358 1.0050 0.2537  0.1680  0.0730  110  ASP A CG  
776  O OD1 . ASP A 110 ? 1.5434 1.2728 1.0444 0.2730  0.1793  0.0800  110  ASP A OD1 
777  O OD2 . ASP A 110 ? 1.6373 1.3116 1.0704 0.2606  0.1838  0.0699  110  ASP A OD2 
778  N N   . GLY A 111 ? 1.0651 0.8590 0.6784 0.1533  0.0683  0.0471  111  GLY A N   
779  C CA  . GLY A 111 ? 1.0054 0.8361 0.6696 0.1344  0.0444  0.0469  111  GLY A CA  
780  C C   . GLY A 111 ? 1.0384 0.8471 0.7029 0.1192  0.0305  0.0317  111  GLY A C   
781  O O   . GLY A 111 ? 1.0033 0.8360 0.7051 0.1155  0.0207  0.0312  111  GLY A O   
782  N N   . SER A 112 ? 1.0144 0.7769 0.6341 0.1096  0.0303  0.0199  112  SER A N   
783  C CA  . SER A 112 ? 0.9987 0.7408 0.6136 0.0934  0.0175  0.0073  112  SER A CA  
784  C C   . SER A 112 ? 1.0437 0.7763 0.6591 0.1064  0.0273  0.0036  112  SER A C   
785  O O   . SER A 112 ? 1.0000 0.7512 0.6486 0.0996  0.0152  0.0004  112  SER A O   
786  C CB  . SER A 112 ? 1.0579 0.7536 0.6185 0.0774  0.0159  -0.0017 112  SER A CB  
787  O OG  . SER A 112 ? 1.0834 0.7917 0.6454 0.0651  0.0063  0.0033  112  SER A OG  
788  N N   . ARG A 113 ? 1.0320 0.7368 0.6110 0.1275  0.0506  0.0057  113  ARG A N   
789  C CA  . ARG A 113 ? 1.0370 0.7307 0.6121 0.1441  0.0636  0.0049  113  ARG A CA  
790  C C   . ARG A 113 ? 1.0341 0.7835 0.6687 0.1516  0.0585  0.0145  113  ARG A C   
791  O O   . ARG A 113 ? 1.0079 0.7594 0.6575 0.1494  0.0535  0.0095  113  ARG A O   
792  C CB  . ARG A 113 ? 1.0679 0.7257 0.5947 0.1705  0.0928  0.0099  113  ARG A CB  
793  C CG  . ARG A 113 ? 1.2447 0.8281 0.6983 0.1626  0.1009  -0.0035 113  ARG A CG  
794  C CD  . ARG A 113 ? 1.3644 0.9073 0.7655 0.1918  0.1328  0.0023  113  ARG A CD  
795  N NE  . ARG A 113 ? 1.5279 0.9932 0.8600 0.1907  0.1452  -0.0104 113  ARG A NE  
796  C CZ  . ARG A 113 ? 1.7539 1.1553 1.0143 0.2057  0.1707  -0.0121 113  ARG A CZ  
797  N NH1 . ARG A 113 ? 1.5356 0.9462 0.7869 0.2248  0.1870  -0.0012 113  ARG A NH1 
798  N NH2 . ARG A 113 ? 1.6234 0.9483 0.8170 0.2008  0.1806  -0.0245 113  ARG A NH2 
799  N N   . GLY A 114 ? 0.9643 0.7575 0.6294 0.1580  0.0591  0.0285  114  GLY A N   
800  C CA  . GLY A 114 ? 0.9173 0.7638 0.6336 0.1609  0.0536  0.0395  114  GLY A CA  
801  C C   . GLY A 114 ? 0.9357 0.7989 0.6872 0.1387  0.0302  0.0317  114  GLY A C   
802  O O   . GLY A 114 ? 0.9201 0.8049 0.6990 0.1389  0.0262  0.0331  114  GLY A O   
803  N N   . ILE A 115 ? 0.8728 0.7270 0.6230 0.1204  0.0153  0.0248  115  ILE A N   
804  C CA  . ILE A 115 ? 0.8376 0.7042 0.6179 0.1028  -0.0043 0.0187  115  ILE A CA  
805  C C   . ILE A 115 ? 0.9205 0.7657 0.6934 0.0997  -0.0069 0.0069  115  ILE A C   
806  O O   . ILE A 115 ? 0.8915 0.7540 0.6924 0.0970  -0.0136 0.0054  115  ILE A O   
807  C CB  . ILE A 115 ? 0.8688 0.7343 0.6506 0.0872  -0.0178 0.0177  115  ILE A CB  
808  C CG1 . ILE A 115 ? 0.8635 0.7582 0.6638 0.0878  -0.0184 0.0306  115  ILE A CG1 
809  C CG2 . ILE A 115 ? 0.8465 0.7156 0.6507 0.0734  -0.0343 0.0111  115  ILE A CG2 
810  C CD1 . ILE A 115 ? 0.8729 0.7707 0.6804 0.0741  -0.0316 0.0322  115  ILE A CD1 
811  N N   . LEU A 116 ? 0.9324 0.7379 0.6641 0.0988  -0.0011 -0.0011 116  LEU A N   
812  C CA  . LEU A 116 ? 0.9409 0.7227 0.6593 0.0942  -0.0028 -0.0112 116  LEU A CA  
813  C C   . LEU A 116 ? 0.9750 0.7650 0.7041 0.1106  0.0085  -0.0085 116  LEU A C   
814  O O   . LEU A 116 ? 0.9426 0.7397 0.6901 0.1058  0.0013  -0.0133 116  LEU A O   
815  C CB  . LEU A 116 ? 0.9928 0.7253 0.6562 0.0878  0.0026  -0.0189 116  LEU A CB  
816  C CG  . LEU A 116 ? 1.0835 0.7866 0.7255 0.0795  0.0007  -0.0287 116  LEU A CG  
817  C CD1 . LEU A 116 ? 1.0670 0.7874 0.7322 0.0578  -0.0204 -0.0323 116  LEU A CD1 
818  C CD2 . LEU A 116 ? 1.1672 0.8121 0.7432 0.0767  0.0123  -0.0349 116  LEU A CD2 
819  N N   . SER A 117 ? 0.9541 0.7485 0.6746 0.1306  0.0260  0.0014  117  SER A N   
820  C CA  . SER A 117 ? 0.9403 0.7489 0.6717 0.1485  0.0382  0.0086  117  SER A CA  
821  C C   . SER A 117 ? 0.9346 0.7904 0.7162 0.1422  0.0260  0.0135  117  SER A C   
822  O O   . SER A 117 ? 0.9028 0.7645 0.6959 0.1447  0.0261  0.0121  117  SER A O   
823  C CB  . SER A 117 ? 0.9901 0.8038 0.7067 0.1724  0.0596  0.0231  117  SER A CB  
824  O OG  . SER A 117 ? 1.1401 0.9756 0.8710 0.1907  0.0714  0.0342  117  SER A OG  
825  N N   . GLY A 118 ? 0.8671 0.7523 0.6736 0.1330  0.0160  0.0194  118  GLY A N   
826  C CA  . GLY A 118 ? 0.8244 0.7475 0.6703 0.1237  0.0045  0.0242  118  GLY A CA  
827  C C   . GLY A 118 ? 0.8438 0.7591 0.7030 0.1077  -0.0110 0.0114  118  GLY A C   
828  O O   . GLY A 118 ? 0.8183 0.7517 0.6994 0.1037  -0.0160 0.0117  118  GLY A O   
829  N N   . THR A 119 ? 0.8136 0.7042 0.6592 0.0983  -0.0185 0.0018  119  THR A N   
830  C CA  . THR A 119 ? 0.7932 0.6791 0.6513 0.0859  -0.0317 -0.0076 119  THR A CA  
831  C C   . THR A 119 ? 0.8430 0.7143 0.6923 0.0886  -0.0285 -0.0153 119  THR A C   
832  O O   . THR A 119 ? 0.8250 0.7035 0.6922 0.0828  -0.0360 -0.0200 119  THR A O   
833  C CB  . THR A 119 ? 0.8268 0.7001 0.6764 0.0752  -0.0409 -0.0108 119  THR A CB  
834  O OG1 . THR A 119 ? 0.8024 0.6490 0.6166 0.0763  -0.0346 -0.0136 119  THR A OG1 
835  C CG2 . THR A 119 ? 0.7555 0.6446 0.6194 0.0709  -0.0464 -0.0033 119  THR A CG2 
836  N N   . SER A 120 ? 0.8200 0.6679 0.6389 0.0980  -0.0163 -0.0160 120  SER A N   
837  C CA  . SER A 120 ? 0.8292 0.6580 0.6335 0.1019  -0.0108 -0.0218 120  SER A CA  
838  C C   . SER A 120 ? 0.8869 0.7429 0.7169 0.1105  -0.0072 -0.0162 120  SER A C   
839  O O   . SER A 120 ? 0.8829 0.7427 0.7256 0.1052  -0.0131 -0.0218 120  SER A O   
840  C CB  . SER A 120 ? 0.8982 0.6892 0.6576 0.1118  0.0043  -0.0222 120  SER A CB  
841  O OG  . SER A 120 ? 1.0284 0.7983 0.7706 0.1189  0.0130  -0.0254 120  SER A OG  
842  N N   . ASP A 121 ? 0.8435 0.7236 0.6834 0.1218  0.0012  -0.0037 121  ASP A N   
843  C CA  . ASP A 121 ? 0.8210 0.7344 0.6857 0.1271  0.0034  0.0055  121  ASP A CA  
844  C C   . ASP A 121 ? 0.8233 0.7550 0.7158 0.1108  -0.0120 0.0005  121  ASP A C   
845  O O   . ASP A 121 ? 0.7947 0.7352 0.6983 0.1095  -0.0137 -0.0012 121  ASP A O   
846  C CB  . ASP A 121 ? 0.8539 0.7990 0.7276 0.1372  0.0118  0.0231  121  ASP A CB  
847  C CG  . ASP A 121 ? 1.0776 1.0112 0.9258 0.1601  0.0321  0.0327  121  ASP A CG  
848  O OD1 . ASP A 121 ? 1.1023 1.0658 0.9584 0.1703  0.0403  0.0496  121  ASP A OD1 
849  O OD2 . ASP A 121 ? 1.1804 1.0728 0.9975 0.1678  0.0406  0.0241  121  ASP A OD2 
850  N N   . LEU A 122 ? 0.7546 0.6886 0.6555 0.0990  -0.0223 -0.0017 122  LEU A N   
851  C CA  . LEU A 122 ? 0.7254 0.6683 0.6463 0.0854  -0.0345 -0.0063 122  LEU A CA  
852  C C   . LEU A 122 ? 0.7919 0.7185 0.7122 0.0819  -0.0390 -0.0182 122  LEU A C   
853  O O   . LEU A 122 ? 0.7751 0.7110 0.7078 0.0781  -0.0419 -0.0205 122  LEU A O   
854  C CB  . LEU A 122 ? 0.7167 0.6589 0.6422 0.0763  -0.0424 -0.0053 122  LEU A CB  
855  C CG  . LEU A 122 ? 0.7730 0.7390 0.7064 0.0733  -0.0418 0.0076  122  LEU A CG  
856  C CD1 . LEU A 122 ? 0.7754 0.7347 0.7084 0.0654  -0.0485 0.0086  122  LEU A CD1 
857  C CD2 . LEU A 122 ? 0.7457 0.7337 0.6938 0.0644  -0.0454 0.0126  122  LEU A CD2 
858  N N   . LEU A 123 ? 0.7714 0.6751 0.6752 0.0819  -0.0396 -0.0247 123  LEU A N   
859  C CA  . LEU A 123 ? 0.7817 0.6738 0.6844 0.0770  -0.0446 -0.0336 123  LEU A CA  
860  C C   . LEU A 123 ? 0.8399 0.7301 0.7392 0.0821  -0.0388 -0.0360 123  LEU A C   
861  O O   . LEU A 123 ? 0.8163 0.7110 0.7271 0.0778  -0.0434 -0.0409 123  LEU A O   
862  C CB  . LEU A 123 ? 0.7981 0.6706 0.6816 0.0716  -0.0479 -0.0369 123  LEU A CB  
863  C CG  . LEU A 123 ? 0.8368 0.7142 0.7276 0.0649  -0.0562 -0.0342 123  LEU A CG  
864  C CD1 . LEU A 123 ? 0.8618 0.7251 0.7335 0.0565  -0.0610 -0.0356 123  LEU A CD1 
865  C CD2 . LEU A 123 ? 0.8059 0.6971 0.7219 0.0622  -0.0630 -0.0345 123  LEU A CD2 
866  N N   . LEU A 124 ? 0.8153 0.6990 0.6985 0.0929  -0.0275 -0.0311 124  LEU A N   
867  C CA  . LEU A 124 ? 0.8142 0.6952 0.6923 0.1006  -0.0200 -0.0307 124  LEU A CA  
868  C C   . LEU A 124 ? 0.8364 0.7493 0.7412 0.1003  -0.0219 -0.0256 124  LEU A C   
869  O O   . LEU A 124 ? 0.8271 0.7424 0.7379 0.0984  -0.0235 -0.0294 124  LEU A O   
870  C CB  . LEU A 124 ? 0.8404 0.7036 0.6916 0.1158  -0.0047 -0.0244 124  LEU A CB  
871  C CG  . LEU A 124 ? 0.9312 0.7509 0.7436 0.1136  -0.0012 -0.0315 124  LEU A CG  
872  C CD1 . LEU A 124 ? 0.9580 0.7558 0.7393 0.1314  0.0169  -0.0244 124  LEU A CD1 
873  C CD2 . LEU A 124 ? 0.9418 0.7402 0.7417 0.1050  -0.0051 -0.0405 124  LEU A CD2 
874  N N   . THR A 125 ? 0.7528 0.6895 0.6718 0.0990  -0.0233 -0.0170 125  THR A N   
875  C CA  . THR A 125 ? 0.7208 0.6868 0.6603 0.0928  -0.0272 -0.0112 125  THR A CA  
876  C C   . THR A 125 ? 0.7827 0.7429 0.7314 0.0799  -0.0375 -0.0224 125  THR A C   
877  O O   . THR A 125 ? 0.7846 0.7556 0.7410 0.0763  -0.0388 -0.0230 125  THR A O   
878  C CB  . THR A 125 ? 0.6990 0.6890 0.6469 0.0900  -0.0278 0.0011  125  THR A CB  
879  O OG1 . THR A 125 ? 0.7032 0.7049 0.6445 0.1056  -0.0154 0.0144  125  THR A OG1 
880  C CG2 . THR A 125 ? 0.6208 0.6369 0.5844 0.0763  -0.0349 0.0064  125  THR A CG2 
881  N N   . PHE A 126 ? 0.7427 0.6865 0.6897 0.0744  -0.0437 -0.0299 126  PHE A N   
882  C CA  . PHE A 126 ? 0.7344 0.6715 0.6886 0.0666  -0.0506 -0.0384 126  PHE A CA  
883  C C   . PHE A 126 ? 0.7892 0.7195 0.7415 0.0690  -0.0496 -0.0453 126  PHE A C   
884  O O   . PHE A 126 ? 0.8011 0.7340 0.7603 0.0650  -0.0519 -0.0498 126  PHE A O   
885  C CB  . PHE A 126 ? 0.7648 0.6897 0.7189 0.0636  -0.0557 -0.0411 126  PHE A CB  
886  C CG  . PHE A 126 ? 0.8012 0.7295 0.7553 0.0604  -0.0572 -0.0344 126  PHE A CG  
887  C CD1 . PHE A 126 ? 0.8419 0.7851 0.7995 0.0546  -0.0570 -0.0275 126  PHE A CD1 
888  C CD2 . PHE A 126 ? 0.8394 0.7585 0.7898 0.0610  -0.0597 -0.0335 126  PHE A CD2 
889  C CE1 . PHE A 126 ? 0.8609 0.8087 0.8178 0.0498  -0.0589 -0.0200 126  PHE A CE1 
890  C CE2 . PHE A 126 ? 0.8770 0.7993 0.8269 0.0578  -0.0609 -0.0267 126  PHE A CE2 
891  C CZ  . PHE A 126 ? 0.8539 0.7898 0.8070 0.0521  -0.0605 -0.0203 126  PHE A CZ  
892  N N   . ASP A 127 ? 0.7440 0.6629 0.6831 0.0747  -0.0457 -0.0457 127  ASP A N   
893  C CA  . ASP A 127 ? 0.7380 0.6483 0.6712 0.0749  -0.0450 -0.0510 127  ASP A CA  
894  C C   . ASP A 127 ? 0.7823 0.7027 0.7187 0.0789  -0.0400 -0.0487 127  ASP A C   
895  O O   . ASP A 127 ? 0.7779 0.7011 0.7204 0.0754  -0.0424 -0.0534 127  ASP A O   
896  C CB  . ASP A 127 ? 0.7754 0.6638 0.6861 0.0759  -0.0426 -0.0521 127  ASP A CB  
897  C CG  . ASP A 127 ? 0.8637 0.7432 0.7683 0.0700  -0.0458 -0.0574 127  ASP A CG  
898  O OD1 . ASP A 127 ? 0.8495 0.7364 0.7649 0.0629  -0.0534 -0.0596 127  ASP A OD1 
899  O OD2 . ASP A 127 ? 0.8765 0.7429 0.7654 0.0730  -0.0399 -0.0578 127  ASP A OD2 
900  N N   . GLU A 128 ? 0.7494 0.6791 0.6832 0.0869  -0.0327 -0.0396 128  GLU A N   
901  C CA  . GLU A 128 ? 0.7443 0.6910 0.6838 0.0916  -0.0278 -0.0331 128  GLU A CA  
902  C C   . GLU A 128 ? 0.8014 0.7673 0.7581 0.0801  -0.0353 -0.0353 128  GLU A C   
903  O O   . GLU A 128 ? 0.8160 0.7886 0.7763 0.0788  -0.0351 -0.0364 128  GLU A O   
904  C CB  . GLU A 128 ? 0.7587 0.7218 0.6972 0.1026  -0.0189 -0.0184 128  GLU A CB  
905  C CG  . GLU A 128 ? 0.8863 0.8263 0.8015 0.1182  -0.0065 -0.0148 128  GLU A CG  
906  C CD  . GLU A 128 ? 1.1526 1.1113 1.0671 0.1337  0.0054  0.0024  128  GLU A CD  
907  O OE1 . GLU A 128 ? 1.2544 1.2101 1.1589 0.1494  0.0177  0.0109  128  GLU A OE1 
908  O OE2 . GLU A 128 ? 1.0273 1.0038 0.9503 0.1315  0.0034  0.0090  128  GLU A OE2 
909  N N   . ALA A 129 ? 0.7415 0.7111 0.7044 0.0713  -0.0413 -0.0363 129  ALA A N   
910  C CA  . ALA A 129 ? 0.7385 0.7150 0.7081 0.0588  -0.0474 -0.0395 129  ALA A CA  
911  C C   . ALA A 129 ? 0.8057 0.7673 0.7749 0.0568  -0.0497 -0.0512 129  ALA A C   
912  O O   . ALA A 129 ? 0.8069 0.7741 0.7777 0.0506  -0.0508 -0.0537 129  ALA A O   
913  C CB  . ALA A 129 ? 0.7492 0.7226 0.7184 0.0509  -0.0518 -0.0382 129  ALA A CB  
914  N N   . GLU A 130 ? 0.7565 0.7021 0.7232 0.0613  -0.0503 -0.0568 130  GLU A N   
915  C CA  . GLU A 130 ? 0.7520 0.6902 0.7207 0.0609  -0.0517 -0.0644 130  GLU A CA  
916  C C   . GLU A 130 ? 0.7720 0.7148 0.7395 0.0629  -0.0493 -0.0653 130  GLU A C   
917  O O   . GLU A 130 ? 0.7683 0.7137 0.7393 0.0605  -0.0497 -0.0697 130  GLU A O   
918  C CB  . GLU A 130 ? 0.7737 0.7022 0.7417 0.0633  -0.0541 -0.0659 130  GLU A CB  
919  C CG  . GLU A 130 ? 0.9894 0.9120 0.9600 0.0624  -0.0562 -0.0652 130  GLU A CG  
920  C CD  . GLU A 130 ? 1.3384 1.2556 1.3088 0.0588  -0.0553 -0.0683 130  GLU A CD  
921  O OE1 . GLU A 130 ? 1.2439 1.1563 1.2157 0.0616  -0.0535 -0.0723 130  GLU A OE1 
922  O OE2 . GLU A 130 ? 1.2555 1.1720 1.2214 0.0525  -0.0560 -0.0659 130  GLU A OE2 
923  N N   . VAL A 131 ? 0.7106 0.6519 0.6705 0.0682  -0.0454 -0.0606 131  VAL A N   
924  C CA  . VAL A 131 ? 0.7079 0.6488 0.6627 0.0713  -0.0417 -0.0599 131  VAL A CA  
925  C C   . VAL A 131 ? 0.7394 0.6996 0.7025 0.0696  -0.0405 -0.0562 131  VAL A C   
926  O O   . VAL A 131 ? 0.7320 0.6949 0.6964 0.0678  -0.0405 -0.0590 131  VAL A O   
927  C CB  . VAL A 131 ? 0.7730 0.6984 0.7105 0.0792  -0.0353 -0.0553 131  VAL A CB  
928  C CG1 . VAL A 131 ? 0.7752 0.6955 0.7039 0.0837  -0.0298 -0.0532 131  VAL A CG1 
929  C CG2 . VAL A 131 ? 0.7830 0.6879 0.7078 0.0755  -0.0384 -0.0597 131  VAL A CG2 
930  N N   . ARG A 132 ? 0.6850 0.6609 0.6533 0.0676  -0.0407 -0.0491 132  ARG A N   
931  C CA  . ARG A 132 ? 0.6654 0.6639 0.6400 0.0612  -0.0416 -0.0435 132  ARG A CA  
932  C C   . ARG A 132 ? 0.6954 0.6894 0.6705 0.0508  -0.0461 -0.0534 132  ARG A C   
933  O O   . ARG A 132 ? 0.6998 0.7050 0.6762 0.0474  -0.0459 -0.0523 132  ARG A O   
934  C CB  . ARG A 132 ? 0.6442 0.6629 0.6228 0.0562  -0.0429 -0.0324 132  ARG A CB  
935  C CG  . ARG A 132 ? 0.7591 0.7925 0.7386 0.0696  -0.0353 -0.0176 132  ARG A CG  
936  C CD  . ARG A 132 ? 0.8229 0.8897 0.8104 0.0636  -0.0367 -0.0017 132  ARG A CD  
937  N NE  . ARG A 132 ? 0.7852 0.8464 0.7714 0.0520  -0.0431 -0.0049 132  ARG A NE  
938  C CZ  . ARG A 132 ? 0.9708 1.0261 0.9551 0.0589  -0.0406 -0.0019 132  ARG A CZ  
939  N NH1 . ARG A 132 ? 0.7084 0.7595 0.6888 0.0774  -0.0309 0.0036  132  ARG A NH1 
940  N NH2 . ARG A 132 ? 0.8136 0.8633 0.7963 0.0471  -0.0468 -0.0043 132  ARG A NH2 
941  N N   . LYS A 133 ? 0.6620 0.6386 0.6348 0.0477  -0.0488 -0.0622 133  LYS A N   
942  C CA  . LYS A 133 ? 0.6636 0.6293 0.6329 0.0422  -0.0498 -0.0715 133  LYS A CA  
943  C C   . LYS A 133 ? 0.7206 0.6867 0.6928 0.0472  -0.0478 -0.0756 133  LYS A C   
944  O O   . LYS A 133 ? 0.7388 0.7060 0.7083 0.0427  -0.0471 -0.0798 133  LYS A O   
945  C CB  . LYS A 133 ? 0.7007 0.6473 0.6675 0.0443  -0.0502 -0.0766 133  LYS A CB  
946  C CG  . LYS A 133 ? 0.9536 0.8916 0.9125 0.0360  -0.0522 -0.0753 133  LYS A CG  
947  C CD  . LYS A 133 ? 1.1007 1.0150 1.0541 0.0401  -0.0502 -0.0812 133  LYS A CD  
948  C CE  . LYS A 133 ? 1.2797 1.1810 1.2254 0.0350  -0.0521 -0.0787 133  LYS A CE  
949  N NZ  . LYS A 133 ? 1.3801 1.2570 1.3200 0.0426  -0.0483 -0.0825 133  LYS A NZ  
950  N N   . ILE A 134 ? 0.6499 0.6130 0.6242 0.0546  -0.0470 -0.0745 134  ILE A N   
951  C CA  . ILE A 134 ? 0.6281 0.5919 0.6031 0.0564  -0.0462 -0.0769 134  ILE A CA  
952  C C   . ILE A 134 ? 0.6492 0.6239 0.6232 0.0557  -0.0441 -0.0728 134  ILE A C   
953  O O   . ILE A 134 ? 0.6360 0.6161 0.6112 0.0531  -0.0438 -0.0756 134  ILE A O   
954  C CB  . ILE A 134 ? 0.6575 0.6122 0.6290 0.0594  -0.0473 -0.0758 134  ILE A CB  
955  C CG1 . ILE A 134 ? 0.6644 0.6143 0.6394 0.0601  -0.0499 -0.0770 134  ILE A CG1 
956  C CG2 . ILE A 134 ? 0.6201 0.5769 0.5904 0.0573  -0.0477 -0.0768 134  ILE A CG2 
957  C CD1 . ILE A 134 ? 0.6862 0.6283 0.6544 0.0592  -0.0528 -0.0741 134  ILE A CD1 
958  N N   . ILE A 135 ? 0.6059 0.5859 0.5777 0.0593  -0.0419 -0.0646 135  ILE A N   
959  C CA  . ILE A 135 ? 0.6050 0.5988 0.5770 0.0617  -0.0385 -0.0566 135  ILE A CA  
960  C C   . ILE A 135 ? 0.6525 0.6643 0.6292 0.0520  -0.0412 -0.0566 135  ILE A C   
961  O O   . ILE A 135 ? 0.6387 0.6588 0.6159 0.0515  -0.0400 -0.0548 135  ILE A O   
962  C CB  . ILE A 135 ? 0.6372 0.6358 0.6063 0.0713  -0.0332 -0.0445 135  ILE A CB  
963  C CG1 . ILE A 135 ? 0.6581 0.6299 0.6132 0.0801  -0.0287 -0.0461 135  ILE A CG1 
964  C CG2 . ILE A 135 ? 0.6201 0.6411 0.5928 0.0754  -0.0289 -0.0319 135  ILE A CG2 
965  C CD1 . ILE A 135 ? 0.7544 0.7228 0.7021 0.0916  -0.0215 -0.0362 135  ILE A CD1 
966  N N   . ARG A 136 ? 0.6285 0.6420 0.6048 0.0427  -0.0449 -0.0593 136  ARG A N   
967  C CA  . ARG A 136 ? 0.6373 0.6600 0.6097 0.0294  -0.0478 -0.0607 136  ARG A CA  
968  C C   . ARG A 136 ? 0.6608 0.6733 0.6295 0.0282  -0.0466 -0.0712 136  ARG A C   
969  O O   . ARG A 136 ? 0.6338 0.6574 0.5995 0.0209  -0.0471 -0.0702 136  ARG A O   
970  C CB  . ARG A 136 ? 0.6755 0.6896 0.6400 0.0185  -0.0513 -0.0634 136  ARG A CB  
971  C CG  . ARG A 136 ? 0.8603 0.8967 0.8277 0.0121  -0.0541 -0.0497 136  ARG A CG  
972  C CD  . ARG A 136 ? 0.9703 0.9948 0.9263 -0.0019 -0.0584 -0.0521 136  ARG A CD  
973  N NE  . ARG A 136 ? 1.1165 1.1553 1.0799 0.0005  -0.0594 -0.0406 136  ARG A NE  
974  C CZ  . ARG A 136 ? 1.2496 1.2704 1.2112 0.0043  -0.0593 -0.0443 136  ARG A CZ  
975  N NH1 . ARG A 136 ? 0.9677 0.9566 0.9213 0.0066  -0.0582 -0.0579 136  ARG A NH1 
976  N NH2 . ARG A 136 ? 1.1479 1.1847 1.1160 0.0066  -0.0596 -0.0327 136  ARG A NH2 
977  N N   . VAL A 137 ? 0.6148 0.6096 0.5841 0.0352  -0.0449 -0.0793 137  VAL A N   
978  C CA  . VAL A 137 ? 0.6142 0.6039 0.5823 0.0367  -0.0425 -0.0865 137  VAL A CA  
979  C C   . VAL A 137 ? 0.6735 0.6756 0.6467 0.0394  -0.0419 -0.0823 137  VAL A C   
980  O O   . VAL A 137 ? 0.6943 0.7025 0.6655 0.0357  -0.0408 -0.0846 137  VAL A O   
981  C CB  . VAL A 137 ? 0.6586 0.6345 0.6290 0.0444  -0.0407 -0.0913 137  VAL A CB  
982  C CG1 . VAL A 137 ? 0.6552 0.6360 0.6299 0.0487  -0.0381 -0.0935 137  VAL A CG1 
983  C CG2 . VAL A 137 ? 0.6656 0.6240 0.6256 0.0422  -0.0387 -0.0964 137  VAL A CG2 
984  N N   . CYS A 138 ? 0.6072 0.6092 0.5832 0.0456  -0.0419 -0.0760 138  CYS A N   
985  C CA  . CYS A 138 ? 0.6087 0.6141 0.5837 0.0486  -0.0402 -0.0713 138  CYS A CA  
986  C C   . CYS A 138 ? 0.6358 0.6588 0.6116 0.0457  -0.0393 -0.0645 138  CYS A C   
987  O O   . CYS A 138 ? 0.6273 0.6558 0.6028 0.0442  -0.0385 -0.0640 138  CYS A O   
988  C CB  . CYS A 138 ? 0.6213 0.6130 0.5901 0.0557  -0.0383 -0.0664 138  CYS A CB  
989  S SG  . CYS A 138 ? 0.6763 0.6505 0.6417 0.0551  -0.0412 -0.0721 138  CYS A SG  
990  N N   . LYS A 139 ? 0.5833 0.6186 0.5608 0.0441  -0.0399 -0.0573 139  LYS A N   
991  C CA  . LYS A 139 ? 0.5751 0.6353 0.5551 0.0395  -0.0402 -0.0469 139  LYS A CA  
992  C C   . LYS A 139 ? 0.6270 0.6932 0.6029 0.0259  -0.0435 -0.0537 139  LYS A C   
993  O O   . LYS A 139 ? 0.6290 0.7123 0.6056 0.0221  -0.0436 -0.0478 139  LYS A O   
994  C CB  . LYS A 139 ? 0.5953 0.6727 0.5790 0.0388  -0.0410 -0.0350 139  LYS A CB  
995  C CG  . LYS A 139 ? 0.7319 0.8058 0.7169 0.0560  -0.0342 -0.0246 139  LYS A CG  
996  C CD  . LYS A 139 ? 0.7834 0.8835 0.7749 0.0595  -0.0325 -0.0075 139  LYS A CD  
997  C CE  . LYS A 139 ? 0.8368 0.9276 0.8245 0.0806  -0.0221 0.0028  139  LYS A CE  
998  N NZ  . LYS A 139 ? 1.0100 1.1276 1.0051 0.0871  -0.0187 0.0207  139  LYS A NZ  
999  N N   . GLY A 140 ? 0.5733 0.6226 0.5425 0.0201  -0.0448 -0.0658 140  GLY A N   
1000 C CA  . GLY A 140 ? 0.5753 0.6202 0.5333 0.0091  -0.0452 -0.0742 140  GLY A CA  
1001 C C   . GLY A 140 ? 0.6227 0.6704 0.5835 0.0134  -0.0424 -0.0769 140  GLY A C   
1002 O O   . GLY A 140 ? 0.6237 0.6823 0.5788 0.0049  -0.0429 -0.0761 140  GLY A O   
1003 N N   . ILE A 141 ? 0.5732 0.6126 0.5414 0.0246  -0.0402 -0.0787 141  ILE A N   
1004 C CA  . ILE A 141 ? 0.5648 0.6076 0.5358 0.0274  -0.0384 -0.0797 141  ILE A CA  
1005 C C   . ILE A 141 ? 0.6207 0.6781 0.5938 0.0270  -0.0388 -0.0697 141  ILE A C   
1006 O O   . ILE A 141 ? 0.6340 0.7011 0.6056 0.0227  -0.0382 -0.0696 141  ILE A O   
1007 C CB  . ILE A 141 ? 0.5902 0.6227 0.5660 0.0348  -0.0377 -0.0819 141  ILE A CB  
1008 C CG1 . ILE A 141 ? 0.5944 0.6161 0.5703 0.0378  -0.0363 -0.0888 141  ILE A CG1 
1009 C CG2 . ILE A 141 ? 0.5661 0.6059 0.5439 0.0340  -0.0368 -0.0812 141  ILE A CG2 
1010 C CD1 . ILE A 141 ? 0.5709 0.5894 0.5392 0.0359  -0.0321 -0.0958 141  ILE A CD1 
1011 N N   . LEU A 142 ? 0.5771 0.6363 0.5526 0.0328  -0.0385 -0.0602 142  LEU A N   
1012 C CA  . LEU A 142 ? 0.5807 0.6523 0.5574 0.0369  -0.0364 -0.0475 142  LEU A CA  
1013 C C   . LEU A 142 ? 0.6123 0.7091 0.5902 0.0273  -0.0386 -0.0421 142  LEU A C   
1014 O O   . LEU A 142 ? 0.5868 0.6940 0.5650 0.0271  -0.0376 -0.0363 142  LEU A O   
1015 C CB  . LEU A 142 ? 0.5810 0.6514 0.5584 0.0477  -0.0331 -0.0363 142  LEU A CB  
1016 C CG  . LEU A 142 ? 0.6553 0.6993 0.6239 0.0588  -0.0283 -0.0353 142  LEU A CG  
1017 C CD1 . LEU A 142 ? 0.6705 0.7088 0.6364 0.0703  -0.0235 -0.0268 142  LEU A CD1 
1018 C CD2 . LEU A 142 ? 0.6687 0.7086 0.6305 0.0630  -0.0242 -0.0283 142  LEU A CD2 
1019 N N   . GLU A 143 ? 0.5697 0.6750 0.5456 0.0172  -0.0423 -0.0434 143  GLU A N   
1020 C CA  . GLU A 143 ? 0.5923 0.7205 0.5641 0.0024  -0.0461 -0.0383 143  GLU A CA  
1021 C C   . GLU A 143 ? 0.6250 0.7465 0.5873 -0.0062 -0.0460 -0.0496 143  GLU A C   
1022 O O   . GLU A 143 ? 0.6187 0.7595 0.5793 -0.0135 -0.0475 -0.0430 143  GLU A O   
1023 C CB  . GLU A 143 ? 0.6245 0.7590 0.5911 -0.0099 -0.0508 -0.0363 143  GLU A CB  
1024 C CG  . GLU A 143 ? 0.8071 0.9634 0.7861 -0.0015 -0.0503 -0.0182 143  GLU A CG  
1025 C CD  . GLU A 143 ? 1.1923 1.3601 1.1693 -0.0130 -0.0553 -0.0123 143  GLU A CD  
1026 O OE1 . GLU A 143 ? 0.9482 1.1077 0.9098 -0.0328 -0.0606 -0.0213 143  GLU A OE1 
1027 O OE2 . GLU A 143 ? 1.1582 1.3424 1.1464 -0.0026 -0.0532 0.0022  143  GLU A OE2 
1028 N N   . TYR A 144 ? 0.5732 0.6695 0.5300 -0.0032 -0.0433 -0.0646 144  TYR A N   
1029 C CA  . TYR A 144 ? 0.5782 0.6684 0.5257 -0.0075 -0.0406 -0.0742 144  TYR A CA  
1030 C C   . TYR A 144 ? 0.5926 0.6929 0.5488 -0.0013 -0.0389 -0.0696 144  TYR A C   
1031 O O   . TYR A 144 ? 0.5865 0.6941 0.5366 -0.0074 -0.0379 -0.0716 144  TYR A O   
1032 C CB  . TYR A 144 ? 0.6156 0.6803 0.5556 -0.0030 -0.0361 -0.0878 144  TYR A CB  
1033 C CG  . TYR A 144 ? 0.6541 0.7086 0.5733 -0.0120 -0.0322 -0.0971 144  TYR A CG  
1034 C CD1 . TYR A 144 ? 0.6858 0.7381 0.5846 -0.0296 -0.0352 -0.0978 144  TYR A CD1 
1035 C CD2 . TYR A 144 ? 0.6748 0.7232 0.5922 -0.0041 -0.0252 -0.1035 144  TYR A CD2 
1036 C CE1 . TYR A 144 ? 0.7298 0.7659 0.6016 -0.0394 -0.0306 -0.1071 144  TYR A CE1 
1037 C CE2 . TYR A 144 ? 0.7065 0.7424 0.6007 -0.0101 -0.0190 -0.1118 144  TYR A CE2 
1038 C CZ  . TYR A 144 ? 0.8110 0.8370 0.6799 -0.0279 -0.0214 -0.1147 144  TYR A CZ  
1039 O OH  . TYR A 144 ? 0.9364 0.9438 0.7756 -0.0352 -0.0145 -0.1237 144  TYR A OH  
1040 N N   . LEU A 145 ? 0.5351 0.6335 0.5019 0.0097  -0.0385 -0.0630 145  LEU A N   
1041 C CA  . LEU A 145 ? 0.5075 0.6109 0.4776 0.0133  -0.0371 -0.0573 145  LEU A CA  
1042 C C   . LEU A 145 ? 0.5423 0.6683 0.5127 0.0088  -0.0382 -0.0451 145  LEU A C   
1043 O O   . LEU A 145 ? 0.4996 0.6335 0.4688 0.0059  -0.0376 -0.0433 145  LEU A O   
1044 C CB  . LEU A 145 ? 0.5013 0.5886 0.4738 0.0235  -0.0358 -0.0535 145  LEU A CB  
1045 C CG  . LEU A 145 ? 0.5463 0.6180 0.5193 0.0251  -0.0359 -0.0631 145  LEU A CG  
1046 C CD1 . LEU A 145 ? 0.5532 0.6062 0.5228 0.0309  -0.0358 -0.0595 145  LEU A CD1 
1047 C CD2 . LEU A 145 ? 0.5485 0.6269 0.5224 0.0209  -0.0353 -0.0670 145  LEU A CD2 
1048 N N   . THR A 146 ? 0.5157 0.6565 0.4883 0.0071  -0.0402 -0.0352 146  THR A N   
1049 C CA  . THR A 146 ? 0.5246 0.6950 0.4997 0.0023  -0.0419 -0.0197 146  THR A CA  
1050 C C   . THR A 146 ? 0.6066 0.7903 0.5721 -0.0156 -0.0456 -0.0248 146  THR A C   
1051 O O   . THR A 146 ? 0.6247 0.8330 0.5914 -0.0209 -0.0472 -0.0130 146  THR A O   
1052 C CB  . THR A 146 ? 0.5457 0.7361 0.5279 0.0056  -0.0428 -0.0035 146  THR A CB  
1053 O OG1 . THR A 146 ? 0.5151 0.7106 0.4917 -0.0093 -0.0482 -0.0087 146  THR A OG1 
1054 C CG2 . THR A 146 ? 0.4699 0.6430 0.4567 0.0247  -0.0370 0.0012  146  THR A CG2 
1055 N N   . VAL A 147 ? 0.5700 0.7355 0.5232 -0.0243 -0.0459 -0.0415 147  VAL A N   
1056 C CA  . VAL A 147 ? 0.5759 0.7425 0.5112 -0.0410 -0.0470 -0.0495 147  VAL A CA  
1057 C C   . VAL A 147 ? 0.6403 0.8059 0.5754 -0.0371 -0.0430 -0.0538 147  VAL A C   
1058 O O   . VAL A 147 ? 0.6633 0.8379 0.5859 -0.0494 -0.0436 -0.0550 147  VAL A O   
1059 C CB  . VAL A 147 ? 0.6411 0.7793 0.5574 -0.0480 -0.0455 -0.0656 147  VAL A CB  
1060 C CG1 . VAL A 147 ? 0.6706 0.7989 0.5595 -0.0640 -0.0438 -0.0757 147  VAL A CG1 
1061 C CG2 . VAL A 147 ? 0.6367 0.7777 0.5515 -0.0553 -0.0507 -0.0602 147  VAL A CG2 
1062 N N   . ALA A 148 ? 0.5956 0.7509 0.5425 -0.0225 -0.0394 -0.0555 148  ALA A N   
1063 C CA  . ALA A 148 ? 0.6002 0.7568 0.5478 -0.0201 -0.0361 -0.0581 148  ALA A CA  
1064 C C   . ALA A 148 ? 0.6637 0.8434 0.6101 -0.0278 -0.0381 -0.0477 148  ALA A C   
1065 O O   . ALA A 148 ? 0.6914 0.8752 0.6300 -0.0335 -0.0359 -0.0525 148  ALA A O   
1066 C CB  . ALA A 148 ? 0.5933 0.7398 0.5526 -0.0079 -0.0346 -0.0560 148  ALA A CB  
1067 N N   . GLU A 149 ? 0.6058 0.8025 0.5597 -0.0268 -0.0414 -0.0321 149  GLU A N   
1068 C CA  . GLU A 149 ? 0.6134 0.8353 0.5686 -0.0318 -0.0431 -0.0183 149  GLU A CA  
1069 C C   . GLU A 149 ? 0.6763 0.9172 0.6179 -0.0512 -0.0471 -0.0186 149  GLU A C   
1070 O O   . GLU A 149 ? 0.6910 0.9547 0.6329 -0.0570 -0.0489 -0.0077 149  GLU A O   
1071 C CB  . GLU A 149 ? 0.6289 0.8631 0.5962 -0.0203 -0.0428 0.0017  149  GLU A CB  
1072 C CG  . GLU A 149 ? 0.7448 1.0033 0.7156 -0.0253 -0.0468 0.0142  149  GLU A CG  
1073 C CD  . GLU A 149 ? 0.9144 1.1987 0.8967 -0.0145 -0.0449 0.0398  149  GLU A CD  
1074 O OE1 . GLU A 149 ? 0.8484 1.1457 0.8315 -0.0141 -0.0439 0.0494  149  GLU A OE1 
1075 O OE2 . GLU A 149 ? 0.8393 1.1317 0.8296 -0.0050 -0.0435 0.0516  149  GLU A OE2 
1076 N N   . VAL A 150 ? 0.6384 0.8673 0.5647 -0.0625 -0.0484 -0.0307 150  VAL A N   
1077 C CA  . VAL A 150 ? 0.6629 0.9010 0.5668 -0.0849 -0.0520 -0.0329 150  VAL A CA  
1078 C C   . VAL A 150 ? 0.7349 0.9466 0.6161 -0.0890 -0.0454 -0.0527 150  VAL A C   
1079 O O   . VAL A 150 ? 0.7518 0.9607 0.6063 -0.1076 -0.0463 -0.0579 150  VAL A O   
1080 C CB  . VAL A 150 ? 0.7320 0.9782 0.6265 -0.1008 -0.0590 -0.0277 150  VAL A CB  
1081 C CG1 . VAL A 150 ? 0.7083 0.9926 0.6261 -0.0961 -0.0642 -0.0027 150  VAL A CG1 
1082 C CG2 . VAL A 150 ? 0.7384 0.9509 0.6258 -0.0964 -0.0563 -0.0424 150  VAL A CG2 
1083 N N   . VAL A 151 ? 0.6992 0.8923 0.5895 -0.0715 -0.0381 -0.0620 151  VAL A N   
1084 C CA  . VAL A 151 ? 0.7171 0.8900 0.5905 -0.0693 -0.0292 -0.0770 151  VAL A CA  
1085 C C   . VAL A 151 ? 0.7892 0.9821 0.6629 -0.0727 -0.0281 -0.0718 151  VAL A C   
1086 O O   . VAL A 151 ? 0.7571 0.9659 0.6528 -0.0638 -0.0295 -0.0620 151  VAL A O   
1087 C CB  . VAL A 151 ? 0.7377 0.8917 0.6235 -0.0502 -0.0227 -0.0847 151  VAL A CB  
1088 C CG1 . VAL A 151 ? 0.7487 0.8909 0.6225 -0.0434 -0.0116 -0.0951 151  VAL A CG1 
1089 C CG2 . VAL A 151 ? 0.7322 0.8651 0.6132 -0.0489 -0.0235 -0.0904 151  VAL A CG2 
1090 N N   . GLU A 152 ? 0.8063 0.9963 0.6520 -0.0880 -0.0260 -0.0776 152  GLU A N   
1091 C CA  . GLU A 152 ? 0.8249 1.0342 0.6651 -0.0952 -0.0254 -0.0729 152  GLU A CA  
1092 C C   . GLU A 152 ? 0.9028 1.0935 0.7217 -0.0910 -0.0129 -0.0867 152  GLU A C   
1093 O O   . GLU A 152 ? 0.8783 1.0861 0.7014 -0.0897 -0.0102 -0.0826 152  GLU A O   
1094 C CB  . GLU A 152 ? 0.8633 1.0891 0.6845 -0.1198 -0.0339 -0.0654 152  GLU A CB  
1095 C CG  . GLU A 152 ? 1.0223 1.2746 0.8630 -0.1245 -0.0451 -0.0476 152  GLU A CG  
1096 C CD  . GLU A 152 ? 1.3138 1.5965 1.1867 -0.1124 -0.0483 -0.0287 152  GLU A CD  
1097 O OE1 . GLU A 152 ? 1.2352 1.5227 1.1297 -0.1004 -0.0507 -0.0190 152  GLU A OE1 
1098 O OE2 . GLU A 152 ? 1.2806 1.5793 1.1539 -0.1148 -0.0476 -0.0231 152  GLU A OE2 
1099 N N   . THR A 153 ? 0.8934 1.0487 0.6868 -0.0888 -0.0044 -0.1017 153  THR A N   
1100 C CA  . THR A 153 ? 0.9284 1.0605 0.6955 -0.0815 0.0111  -0.1143 153  THR A CA  
1101 C C   . THR A 153 ? 0.9889 1.1034 0.7671 -0.0571 0.0221  -0.1203 153  THR A C   
1102 O O   . THR A 153 ? 0.9617 1.0723 0.7585 -0.0505 0.0171  -0.1186 153  THR A O   
1103 C CB  . THR A 153 ? 1.0341 1.1314 0.7499 -0.1001 0.0149  -0.1264 153  THR A CB  
1104 O OG1 . THR A 153 ? 1.0190 1.0884 0.7262 -0.1007 0.0135  -0.1324 153  THR A OG1 
1105 C CG2 . THR A 153 ? 1.0090 1.1268 0.7101 -0.1282 0.0031  -0.1189 153  THR A CG2 
1106 N N   . MET A 154 ? 0.9575 1.0622 0.7220 -0.0435 0.0380  -0.1262 154  MET A N   
1107 C CA  . MET A 154 ? 0.9514 1.0447 0.7251 -0.0189 0.0507  -0.1288 154  MET A CA  
1108 C C   . MET A 154 ? 1.0304 1.0782 0.7762 -0.0161 0.0571  -0.1404 154  MET A C   
1109 O O   . MET A 154 ? 1.0298 1.0736 0.7941 0.0007  0.0600  -0.1389 154  MET A O   
1110 C CB  . MET A 154 ? 1.0017 1.1020 0.7682 -0.0037 0.0674  -0.1284 154  MET A CB  
1111 C CG  . MET A 154 ? 1.0415 1.1537 0.8339 0.0224  0.0772  -0.1221 154  MET A CG  
1112 S SD  . MET A 154 ? 1.0468 1.2017 0.8954 0.0236  0.0599  -0.1065 154  MET A SD  
1113 C CE  . MET A 154 ? 0.9845 1.1804 0.8479 0.0117  0.0530  -0.0954 154  MET A CE  
1114 N N   . GLU A 155 ? 1.0145 1.0277 0.7145 -0.0349 0.0581  -0.1509 155  GLU A N   
1115 C CA  . GLU A 155 ? 1.0403 1.0039 0.7059 -0.0376 0.0630  -0.1622 155  GLU A CA  
1116 C C   . GLU A 155 ? 1.0290 1.0043 0.7252 -0.0412 0.0477  -0.1564 155  GLU A C   
1117 O O   . GLU A 155 ? 1.0293 0.9806 0.7252 -0.0281 0.0531  -0.1602 155  GLU A O   
1118 C CB  . GLU A 155 ? 1.1136 1.0428 0.7230 -0.0657 0.0623  -0.1722 155  GLU A CB  
1119 C CG  . GLU A 155 ? 1.3384 1.2072 0.9011 -0.0719 0.0689  -0.1848 155  GLU A CG  
1120 C CD  . GLU A 155 ? 1.7670 1.6020 1.2708 -0.1072 0.0643  -0.1932 155  GLU A CD  
1121 O OE1 . GLU A 155 ? 1.7044 1.5227 1.1698 -0.1142 0.0740  -0.1996 155  GLU A OE1 
1122 O OE2 . GLU A 155 ? 1.7509 1.5756 1.2443 -0.1293 0.0512  -0.1929 155  GLU A OE2 
1123 N N   . ASP A 156 ? 0.9293 0.9417 0.6508 -0.0575 0.0298  -0.1459 156  ASP A N   
1124 C CA  . ASP A 156 ? 0.8796 0.9076 0.6302 -0.0607 0.0158  -0.1380 156  ASP A CA  
1125 C C   . ASP A 156 ? 0.8681 0.9125 0.6595 -0.0366 0.0174  -0.1322 156  ASP A C   
1126 O O   . ASP A 156 ? 0.8382 0.8710 0.6389 -0.0300 0.0155  -0.1330 156  ASP A O   
1127 C CB  . ASP A 156 ? 0.8739 0.9392 0.6396 -0.0797 0.0000  -0.1254 156  ASP A CB  
1128 C CG  . ASP A 156 ? 1.0066 1.0625 0.7340 -0.1088 -0.0057 -0.1275 156  ASP A CG  
1129 O OD1 . ASP A 156 ? 1.0018 1.0917 0.7372 -0.1234 -0.0155 -0.1160 156  ASP A OD1 
1130 O OD2 . ASP A 156 ? 1.0957 1.1096 0.7833 -0.1182 -0.0006 -0.1394 156  ASP A OD2 
1131 N N   . LEU A 157 ? 0.7967 0.8669 0.6092 -0.0252 0.0211  -0.1263 157  LEU A N   
1132 C CA  . LEU A 157 ? 0.7657 0.8528 0.6127 -0.0069 0.0216  -0.1194 157  LEU A CA  
1133 C C   . LEU A 157 ? 0.8326 0.8948 0.6729 0.0110  0.0336  -0.1256 157  LEU A C   
1134 O O   . LEU A 157 ? 0.8280 0.8919 0.6888 0.0186  0.0293  -0.1222 157  LEU A O   
1135 C CB  . LEU A 157 ? 0.7501 0.8704 0.6180 -0.0021 0.0222  -0.1103 157  LEU A CB  
1136 C CG  . LEU A 157 ? 0.7753 0.9159 0.6769 0.0104  0.0195  -0.1008 157  LEU A CG  
1137 C CD1 . LEU A 157 ? 0.7379 0.8816 0.6578 0.0047  0.0059  -0.0951 157  LEU A CD1 
1138 C CD2 . LEU A 157 ? 0.8173 0.9882 0.7327 0.0121  0.0212  -0.0917 157  LEU A CD2 
1139 N N   . VAL A 158 ? 0.8243 0.8594 0.6318 0.0173  0.0492  -0.1346 158  VAL A N   
1140 C CA  . VAL A 158 ? 0.8395 0.8468 0.6358 0.0376  0.0639  -0.1391 158  VAL A CA  
1141 C C   . VAL A 158 ? 0.8930 0.8700 0.6788 0.0312  0.0580  -0.1449 158  VAL A C   
1142 O O   . VAL A 158 ? 0.8651 0.8423 0.6699 0.0453  0.0588  -0.1412 158  VAL A O   
1143 C CB  . VAL A 158 ? 0.9283 0.9075 0.6857 0.0489  0.0855  -0.1466 158  VAL A CB  
1144 C CG1 . VAL A 158 ? 0.9535 0.9003 0.6969 0.0734  0.1032  -0.1492 158  VAL A CG1 
1145 C CG2 . VAL A 158 ? 0.9085 0.9260 0.6835 0.0574  0.0911  -0.1378 158  VAL A CG2 
1146 N N   . THR A 159 ? 0.8760 0.8331 0.6344 0.0077  0.0503  -0.1516 159  THR A N   
1147 C CA  . THR A 159 ? 0.8796 0.8121 0.6270 -0.0030 0.0428  -0.1555 159  THR A CA  
1148 C C   . THR A 159 ? 0.8601 0.8246 0.6525 0.0001  0.0289  -0.1451 159  THR A C   
1149 O O   . THR A 159 ? 0.8514 0.8013 0.6493 0.0084  0.0293  -0.1458 159  THR A O   
1150 C CB  . THR A 159 ? 0.9848 0.9019 0.6968 -0.0332 0.0349  -0.1605 159  THR A CB  
1151 O OG1 . THR A 159 ? 1.1016 0.9837 0.7665 -0.0363 0.0490  -0.1711 159  THR A OG1 
1152 C CG2 . THR A 159 ? 0.9168 0.8095 0.6135 -0.0475 0.0271  -0.1632 159  THR A CG2 
1153 N N   . TYR A 160 ? 0.7568 0.7615 0.5780 -0.0058 0.0179  -0.1354 160  TYR A N   
1154 C CA  . TYR A 160 ? 0.6940 0.7246 0.5515 -0.0030 0.0064  -0.1254 160  TYR A CA  
1155 C C   . TYR A 160 ? 0.7235 0.7582 0.6035 0.0173  0.0113  -0.1224 160  TYR A C   
1156 O O   . TYR A 160 ? 0.7071 0.7372 0.5988 0.0211  0.0067  -0.1207 160  TYR A O   
1157 C CB  . TYR A 160 ? 0.6741 0.7388 0.5500 -0.0102 -0.0019 -0.1156 160  TYR A CB  
1158 C CG  . TYR A 160 ? 0.6543 0.7366 0.5576 -0.0089 -0.0122 -0.1055 160  TYR A CG  
1159 C CD1 . TYR A 160 ? 0.6640 0.7493 0.5666 -0.0193 -0.0207 -0.1007 160  TYR A CD1 
1160 C CD2 . TYR A 160 ? 0.6284 0.7244 0.5552 0.0019  -0.0131 -0.0991 160  TYR A CD2 
1161 C CE1 . TYR A 160 ? 0.6298 0.7282 0.5539 -0.0149 -0.0272 -0.0907 160  TYR A CE1 
1162 C CE2 . TYR A 160 ? 0.6175 0.7210 0.5611 0.0029  -0.0208 -0.0907 160  TYR A CE2 
1163 C CZ  . TYR A 160 ? 0.6746 0.7778 0.6165 -0.0035 -0.0266 -0.0868 160  TYR A CZ  
1164 O OH  . TYR A 160 ? 0.6014 0.7079 0.5562 0.0009  -0.0312 -0.0782 160  TYR A OH  
1165 N N   . THR A 161 ? 0.6844 0.7305 0.5697 0.0295  0.0206  -0.1205 161  THR A N   
1166 C CA  . THR A 161 ? 0.6707 0.7295 0.5781 0.0473  0.0251  -0.1140 161  THR A CA  
1167 C C   . THR A 161 ? 0.7179 0.7489 0.6147 0.0600  0.0336  -0.1186 161  THR A C   
1168 O O   . THR A 161 ? 0.6724 0.7120 0.5897 0.0682  0.0304  -0.1125 161  THR A O   
1169 C CB  . THR A 161 ? 0.7917 0.8743 0.7059 0.0561  0.0337  -0.1082 161  THR A CB  
1170 O OG1 . THR A 161 ? 0.8280 0.9293 0.7450 0.0421  0.0264  -0.1055 161  THR A OG1 
1171 C CG2 . THR A 161 ? 0.7293 0.8402 0.6730 0.0681  0.0333  -0.0959 161  THR A CG2 
1172 N N   . LYS A 162 ? 0.7433 0.7380 0.6048 0.0608  0.0446  -0.1290 162  LYS A N   
1173 C CA  . LYS A 162 ? 0.7730 0.7319 0.6164 0.0731  0.0548  -0.1340 162  LYS A CA  
1174 C C   . LYS A 162 ? 0.8362 0.7831 0.6833 0.0628  0.0428  -0.1357 162  LYS A C   
1175 O O   . LYS A 162 ? 0.8407 0.7703 0.6874 0.0744  0.0473  -0.1354 162  LYS A O   
1176 C CB  . LYS A 162 ? 0.8547 0.7676 0.6487 0.0723  0.0698  -0.1461 162  LYS A CB  
1177 C CG  . LYS A 162 ? 0.9577 0.8713 0.7416 0.0923  0.0891  -0.1443 162  LYS A CG  
1178 C CD  . LYS A 162 ? 1.1759 1.0287 0.9060 0.1020  0.1100  -0.1555 162  LYS A CD  
1179 C CE  . LYS A 162 ? 1.3098 1.1237 0.9904 0.0772  0.1095  -0.1695 162  LYS A CE  
1180 N NZ  . LYS A 162 ? 1.4782 1.2274 1.0999 0.0885  0.1331  -0.1802 162  LYS A NZ  
1181 N N   . ASN A 163 ? 0.8010 0.7576 0.6507 0.0421  0.0286  -0.1360 163  ASN A N   
1182 C CA  . ASN A 163 ? 0.7903 0.7417 0.6454 0.0323  0.0173  -0.1352 163  ASN A CA  
1183 C C   . ASN A 163 ? 0.8204 0.8013 0.7132 0.0389  0.0083  -0.1253 163  ASN A C   
1184 O O   . ASN A 163 ? 0.8245 0.7971 0.7246 0.0455  0.0071  -0.1240 163  ASN A O   
1185 C CB  . ASN A 163 ? 0.7596 0.7125 0.6004 0.0084  0.0074  -0.1364 163  ASN A CB  
1186 C CG  . ASN A 163 ? 1.1457 1.0598 0.9407 -0.0047 0.0136  -0.1469 163  ASN A CG  
1187 O OD1 . ASN A 163 ? 1.1791 1.0541 0.9496 0.0003  0.0221  -0.1539 163  ASN A OD1 
1188 N ND2 . ASN A 163 ? 0.9700 0.8913 0.7489 -0.0234 0.0094  -0.1475 163  ASN A ND2 
1189 N N   . LEU A 164 ? 0.7520 0.7638 0.6647 0.0362  0.0023  -0.1184 164  LEU A N   
1190 C CA  . LEU A 164 ? 0.7035 0.7371 0.6434 0.0388  -0.0060 -0.1094 164  LEU A CA  
1191 C C   . LEU A 164 ? 0.7698 0.8106 0.7251 0.0531  -0.0021 -0.1047 164  LEU A C   
1192 O O   . LEU A 164 ? 0.7574 0.8019 0.7260 0.0541  -0.0086 -0.1001 164  LEU A O   
1193 C CB  . LEU A 164 ? 0.6791 0.7362 0.6283 0.0314  -0.0114 -0.1034 164  LEU A CB  
1194 C CG  . LEU A 164 ? 0.7044 0.7734 0.6709 0.0299  -0.0201 -0.0948 164  LEU A CG  
1195 C CD1 . LEU A 164 ? 0.6904 0.7483 0.6564 0.0277  -0.0255 -0.0940 164  LEU A CD1 
1196 C CD2 . LEU A 164 ? 0.6910 0.7754 0.6598 0.0229  -0.0235 -0.0890 164  LEU A CD2 
1197 N N   . GLY A 165 ? 0.7368 0.7822 0.6896 0.0639  0.0085  -0.1042 165  GLY A N   
1198 C CA  . GLY A 165 ? 0.7347 0.7953 0.7037 0.0784  0.0133  -0.0958 165  GLY A CA  
1199 C C   . GLY A 165 ? 0.7966 0.8404 0.7663 0.0858  0.0135  -0.0960 165  GLY A C   
1200 O O   . GLY A 165 ? 0.7870 0.8442 0.7741 0.0841  0.0050  -0.0890 165  GLY A O   
1201 N N   . PRO A 166 ? 0.7721 0.7820 0.7189 0.0911  0.0223  -0.1047 166  PRO A N   
1202 C CA  . PRO A 166 ? 0.7730 0.7644 0.7188 0.0975  0.0224  -0.1047 166  PRO A CA  
1203 C C   . PRO A 166 ? 0.7922 0.7823 0.7451 0.0840  0.0082  -0.1055 166  PRO A C   
1204 O O   . PRO A 166 ? 0.7831 0.7743 0.7469 0.0888  0.0050  -0.1008 166  PRO A O   
1205 C CB  . PRO A 166 ? 0.8373 0.7856 0.7485 0.1011  0.0345  -0.1152 166  PRO A CB  
1206 C CG  . PRO A 166 ? 0.9085 0.8576 0.8060 0.1052  0.0453  -0.1177 166  PRO A CG  
1207 C CD  . PRO A 166 ? 0.8187 0.8022 0.7351 0.0913  0.0335  -0.1144 166  PRO A CD  
1208 N N   . GLY A 167 ? 0.7509 0.7400 0.6972 0.0684  0.0009  -0.1099 167  GLY A N   
1209 C CA  . GLY A 167 ? 0.7257 0.7161 0.6781 0.0580  -0.0103 -0.1085 167  GLY A CA  
1210 C C   . GLY A 167 ? 0.7371 0.7484 0.7111 0.0598  -0.0173 -0.1000 167  GLY A C   
1211 O O   . GLY A 167 ? 0.6934 0.7004 0.6725 0.0596  -0.0224 -0.0977 167  GLY A O   
1212 N N   . MET A 168 ? 0.6941 0.7261 0.6774 0.0602  -0.0172 -0.0951 168  MET A N   
1213 C CA  . MET A 168 ? 0.6700 0.7183 0.6670 0.0576  -0.0242 -0.0868 168  MET A CA  
1214 C C   . MET A 168 ? 0.7102 0.7644 0.7170 0.0656  -0.0236 -0.0809 168  MET A C   
1215 O O   . MET A 168 ? 0.6893 0.7441 0.7003 0.0610  -0.0308 -0.0765 168  MET A O   
1216 C CB  . MET A 168 ? 0.6888 0.7574 0.6905 0.0531  -0.0246 -0.0821 168  MET A CB  
1217 C CG  . MET A 168 ? 0.7355 0.8103 0.7408 0.0436  -0.0334 -0.0750 168  MET A CG  
1218 S SD  . MET A 168 ? 0.7920 0.8452 0.7858 0.0374  -0.0381 -0.0778 168  MET A SD  
1219 C CE  . MET A 168 ? 0.7390 0.8006 0.7286 0.0333  -0.0355 -0.0787 168  MET A CE  
1220 N N   . THR A 169 ? 0.6912 0.7483 0.6994 0.0783  -0.0140 -0.0798 169  THR A N   
1221 C CA  . THR A 169 ? 0.6871 0.7538 0.7061 0.0891  -0.0116 -0.0712 169  THR A CA  
1222 C C   . THR A 169 ? 0.6985 0.7439 0.7134 0.0890  -0.0154 -0.0745 169  THR A C   
1223 O O   . THR A 169 ? 0.6750 0.7311 0.6998 0.0875  -0.0216 -0.0667 169  THR A O   
1224 C CB  . THR A 169 ? 0.7846 0.8571 0.8035 0.1068  0.0029  -0.0677 169  THR A CB  
1225 O OG1 . THR A 169 ? 0.8324 0.9342 0.8602 0.1053  0.0040  -0.0609 169  THR A OG1 
1226 C CG2 . THR A 169 ? 0.7441 0.8280 0.7747 0.1218  0.0075  -0.0560 169  THR A CG2 
1227 N N   . LYS A 170 ? 0.6688 0.6858 0.6677 0.0876  -0.0128 -0.0850 170  LYS A N   
1228 C CA  . LYS A 170 ? 0.6697 0.6665 0.6631 0.0858  -0.0164 -0.0880 170  LYS A CA  
1229 C C   . LYS A 170 ? 0.6998 0.7025 0.6988 0.0748  -0.0276 -0.0858 170  LYS A C   
1230 O O   . LYS A 170 ? 0.7133 0.7132 0.7159 0.0753  -0.0316 -0.0824 170  LYS A O   
1231 C CB  . LYS A 170 ? 0.7219 0.6905 0.6942 0.0817  -0.0124 -0.0984 170  LYS A CB  
1232 C CG  . LYS A 170 ? 0.8487 0.7980 0.8141 0.0776  -0.0163 -0.1006 170  LYS A CG  
1233 C CD  . LYS A 170 ? 1.0011 0.9363 0.9493 0.0638  -0.0187 -0.1073 170  LYS A CD  
1234 C CE  . LYS A 170 ? 1.1203 1.0251 1.0482 0.0607  -0.0159 -0.1119 170  LYS A CE  
1235 N NZ  . LYS A 170 ? 1.2311 1.1350 1.1675 0.0617  -0.0212 -0.1074 170  LYS A NZ  
1236 N N   . MET A 171 ? 0.6266 0.6349 0.6236 0.0658  -0.0314 -0.0871 171  MET A N   
1237 C CA  . MET A 171 ? 0.5964 0.6040 0.5930 0.0582  -0.0387 -0.0844 171  MET A CA  
1238 C C   . MET A 171 ? 0.6178 0.6371 0.6209 0.0560  -0.0433 -0.0768 171  MET A C   
1239 O O   . MET A 171 ? 0.5961 0.6075 0.5960 0.0532  -0.0478 -0.0745 171  MET A O   
1240 C CB  . MET A 171 ? 0.6162 0.6261 0.6076 0.0519  -0.0395 -0.0854 171  MET A CB  
1241 C CG  . MET A 171 ? 0.6583 0.6602 0.6437 0.0479  -0.0435 -0.0820 171  MET A CG  
1242 S SD  . MET A 171 ? 0.7046 0.7106 0.6845 0.0436  -0.0428 -0.0795 171  MET A SD  
1243 C CE  . MET A 171 ? 0.6818 0.6698 0.6493 0.0433  -0.0440 -0.0746 171  MET A CE  
1244 N N   . ALA A 172 ? 0.6026 0.6420 0.6134 0.0561  -0.0423 -0.0716 172  ALA A N   
1245 C CA  . ALA A 172 ? 0.6150 0.6714 0.6314 0.0497  -0.0483 -0.0614 172  ALA A CA  
1246 C C   . ALA A 172 ? 0.6814 0.7413 0.7043 0.0547  -0.0497 -0.0562 172  ALA A C   
1247 O O   . ALA A 172 ? 0.6965 0.7574 0.7156 0.0449  -0.0574 -0.0506 172  ALA A O   
1248 C CB  . ALA A 172 ? 0.6212 0.7060 0.6479 0.0498  -0.0462 -0.0541 172  ALA A CB  
1249 N N   . LYS A 173 ? 0.6571 0.7142 0.6854 0.0690  -0.0420 -0.0580 173  LYS A N   
1250 C CA  . LYS A 173 ? 0.6570 0.7159 0.6915 0.0765  -0.0417 -0.0521 173  LYS A CA  
1251 C C   . LYS A 173 ? 0.6805 0.7159 0.7050 0.0709  -0.0470 -0.0575 173  LYS A C   
1252 O O   . LYS A 173 ? 0.6831 0.7235 0.7100 0.0679  -0.0524 -0.0508 173  LYS A O   
1253 C CB  . LYS A 173 ? 0.7094 0.7628 0.7460 0.0947  -0.0294 -0.0531 173  LYS A CB  
1254 C CG  . LYS A 173 ? 0.9379 0.9965 0.9826 0.1062  -0.0269 -0.0435 173  LYS A CG  
1255 C CD  . LYS A 173 ? 1.0746 1.1111 1.1113 0.1246  -0.0128 -0.0472 173  LYS A CD  
1256 C CE  . LYS A 173 ? 1.2274 1.2638 1.2697 0.1373  -0.0096 -0.0373 173  LYS A CE  
1257 N NZ  . LYS A 173 ? 1.3443 1.4187 1.4056 0.1517  -0.0039 -0.0182 173  LYS A NZ  
1258 N N   . MET A 174 ? 0.6429 0.6562 0.6563 0.0687  -0.0457 -0.0679 174  MET A N   
1259 C CA  . MET A 174 ? 0.6426 0.6373 0.6472 0.0649  -0.0493 -0.0713 174  MET A CA  
1260 C C   . MET A 174 ? 0.6692 0.6619 0.6659 0.0545  -0.0561 -0.0680 174  MET A C   
1261 O O   . MET A 174 ? 0.6622 0.6450 0.6530 0.0526  -0.0592 -0.0667 174  MET A O   
1262 C CB  . MET A 174 ? 0.6802 0.6606 0.6765 0.0640  -0.0464 -0.0792 174  MET A CB  
1263 C CG  . MET A 174 ? 0.7581 0.7289 0.7520 0.0696  -0.0406 -0.0838 174  MET A CG  
1264 S SD  . MET A 174 ? 0.8295 0.7904 0.8127 0.0619  -0.0410 -0.0890 174  MET A SD  
1265 C CE  . MET A 174 ? 0.7983 0.7427 0.7759 0.0624  -0.0413 -0.0893 174  MET A CE  
1266 N N   . ILE A 175 ? 0.6158 0.6136 0.6081 0.0471  -0.0579 -0.0669 175  ILE A N   
1267 C CA  . ILE A 175 ? 0.6165 0.6029 0.5924 0.0355  -0.0631 -0.0644 175  ILE A CA  
1268 C C   . ILE A 175 ? 0.6826 0.6821 0.6597 0.0268  -0.0700 -0.0558 175  ILE A C   
1269 O O   . ILE A 175 ? 0.6902 0.6742 0.6520 0.0194  -0.0741 -0.0546 175  ILE A O   
1270 C CB  . ILE A 175 ? 0.6588 0.6413 0.6255 0.0295  -0.0623 -0.0655 175  ILE A CB  
1271 C CG1 . ILE A 175 ? 0.6556 0.6304 0.6225 0.0379  -0.0558 -0.0715 175  ILE A CG1 
1272 C CG2 . ILE A 175 ? 0.6846 0.6457 0.6259 0.0162  -0.0665 -0.0630 175  ILE A CG2 
1273 C CD1 . ILE A 175 ? 0.7184 0.6754 0.6771 0.0439  -0.0528 -0.0737 175  ILE A CD1 
1274 N N   . ASP A 176 ? 0.6498 0.6798 0.6446 0.0282  -0.0707 -0.0481 176  ASP A N   
1275 C CA  . ASP A 176 ? 0.6570 0.7108 0.6576 0.0196  -0.0778 -0.0352 176  ASP A CA  
1276 C C   . ASP A 176 ? 0.6987 0.7468 0.7001 0.0238  -0.0794 -0.0334 176  ASP A C   
1277 O O   . ASP A 176 ? 0.6945 0.7406 0.6838 0.0098  -0.0875 -0.0277 176  ASP A O   
1278 C CB  . ASP A 176 ? 0.6798 0.7731 0.7041 0.0271  -0.0749 -0.0246 176  ASP A CB  
1279 C CG  . ASP A 176 ? 0.9042 1.0325 0.9379 0.0176  -0.0830 -0.0064 176  ASP A CG  
1280 O OD1 . ASP A 176 ? 0.9253 1.0503 0.9418 -0.0048 -0.0936 -0.0020 176  ASP A OD1 
1281 O OD2 . ASP A 176 ? 1.0000 1.1577 1.0557 0.0324  -0.0781 0.0046  176  ASP A OD2 
1282 N N   . GLU A 177 ? 0.6691 0.7100 0.6801 0.0406  -0.0720 -0.0388 177  GLU A N   
1283 C CA  . GLU A 177 ? 0.6835 0.7170 0.6953 0.0456  -0.0728 -0.0374 177  GLU A CA  
1284 C C   . GLU A 177 ? 0.7564 0.7600 0.7473 0.0382  -0.0755 -0.0447 177  GLU A C   
1285 O O   . GLU A 177 ? 0.7740 0.7751 0.7599 0.0341  -0.0799 -0.0404 177  GLU A O   
1286 C CB  . GLU A 177 ? 0.6968 0.7280 0.7206 0.0639  -0.0638 -0.0398 177  GLU A CB  
1287 C CG  . GLU A 177 ? 0.8952 0.9562 0.9376 0.0748  -0.0596 -0.0276 177  GLU A CG  
1288 C CD  . GLU A 177 ? 1.2283 1.2801 1.2758 0.0949  -0.0475 -0.0296 177  GLU A CD  
1289 O OE1 . GLU A 177 ? 1.1988 1.2736 1.2597 0.1078  -0.0413 -0.0177 177  GLU A OE1 
1290 O OE2 . GLU A 177 ? 1.1319 1.1531 1.1677 0.0974  -0.0437 -0.0416 177  GLU A OE2 
1291 N N   . ARG A 178 ? 0.6980 0.6809 0.6759 0.0370  -0.0722 -0.0540 178  ARG A N   
1292 C CA  . ARG A 178 ? 0.6966 0.6519 0.6534 0.0336  -0.0720 -0.0585 178  ARG A CA  
1293 C C   . ARG A 178 ? 0.7675 0.7110 0.7008 0.0175  -0.0781 -0.0550 178  ARG A C   
1294 O O   . ARG A 178 ? 0.7788 0.7046 0.6953 0.0136  -0.0796 -0.0549 178  ARG A O   
1295 C CB  . ARG A 178 ? 0.6832 0.6236 0.6338 0.0396  -0.0653 -0.0656 178  ARG A CB  
1296 C CG  . ARG A 178 ? 0.6961 0.6096 0.6238 0.0399  -0.0621 -0.0674 178  ARG A CG  
1297 C CD  . ARG A 178 ? 0.6382 0.5473 0.5668 0.0449  -0.0616 -0.0667 178  ARG A CD  
1298 N NE  . ARG A 178 ? 0.7198 0.6046 0.6254 0.0475  -0.0563 -0.0670 178  ARG A NE  
1299 C CZ  . ARG A 178 ? 0.8911 0.7707 0.7944 0.0536  -0.0534 -0.0658 178  ARG A CZ  
1300 N NH1 . ARG A 178 ? 0.7289 0.6238 0.6508 0.0558  -0.0565 -0.0648 178  ARG A NH1 
1301 N NH2 . ARG A 178 ? 0.7424 0.6001 0.6231 0.0587  -0.0462 -0.0646 178  ARG A NH2 
1302 N N   . GLN A 179 ? 0.7065 0.6569 0.6347 0.0063  -0.0817 -0.0519 179  GLN A N   
1303 C CA  . GLN A 179 ? 0.7201 0.6531 0.6182 -0.0138 -0.0882 -0.0486 179  GLN A CA  
1304 C C   . GLN A 179 ? 0.8123 0.7606 0.7093 -0.0266 -0.0977 -0.0390 179  GLN A C   
1305 O O   . GLN A 179 ? 0.8372 0.7593 0.7021 -0.0415 -0.1016 -0.0391 179  GLN A O   
1306 C CB  . GLN A 179 ? 0.7337 0.6682 0.6233 -0.0256 -0.0904 -0.0469 179  GLN A CB  
1307 C CG  . GLN A 179 ? 0.6898 0.6703 0.6092 -0.0272 -0.0948 -0.0376 179  GLN A CG  
1308 C CD  . GLN A 179 ? 0.8084 0.8130 0.7258 -0.0469 -0.1062 -0.0240 179  GLN A CD  
1309 O OE1 . GLN A 179 ? 0.7605 0.7419 0.6456 -0.0671 -0.1129 -0.0225 179  GLN A OE1 
1310 N NE2 . GLN A 179 ? 0.6931 0.7450 0.6427 -0.0415 -0.1080 -0.0123 179  GLN A NE2 
1311 N N   . GLN A 180 ? 0.7640 0.7528 0.6935 -0.0200 -0.1003 -0.0300 180  GLN A N   
1312 C CA  . GLN A 180 ? 0.7680 0.7803 0.7030 -0.0289 -0.1088 -0.0173 180  GLN A CA  
1313 C C   . GLN A 180 ? 0.8434 0.8294 0.7634 -0.0263 -0.1078 -0.0224 180  GLN A C   
1314 O O   . GLN A 180 ? 0.8754 0.8610 0.7794 -0.0422 -0.1160 -0.0156 180  GLN A O   
1315 C CB  . GLN A 180 ? 0.7566 0.8118 0.7307 -0.0122 -0.1063 -0.0070 180  GLN A CB  
1316 C CG  . GLN A 180 ? 1.0042 1.1000 0.9960 -0.0169 -0.1092 0.0058  180  GLN A CG  
1317 C CD  . GLN A 180 ? 1.2892 1.4142 1.3146 0.0079  -0.0999 0.0116  180  GLN A CD  
1318 O OE1 . GLN A 180 ? 1.2554 1.3739 1.2910 0.0260  -0.0933 0.0094  180  GLN A OE1 
1319 N NE2 . GLN A 180 ? 1.1530 1.3069 1.1927 0.0096  -0.0980 0.0190  180  GLN A NE2 
1320 N N   . GLU A 181 ? 0.7832 0.7499 0.7079 -0.0077 -0.0983 -0.0332 181  GLU A N   
1321 C CA  . GLU A 181 ? 0.7871 0.7326 0.7019 -0.0018 -0.0955 -0.0375 181  GLU A CA  
1322 C C   . GLU A 181 ? 0.8639 0.7685 0.7387 -0.0115 -0.0939 -0.0440 181  GLU A C   
1323 O O   . GLU A 181 ? 0.8713 0.7603 0.7331 -0.0106 -0.0929 -0.0450 181  GLU A O   
1324 C CB  . GLU A 181 ? 0.7827 0.7270 0.7172 0.0191  -0.0864 -0.0442 181  GLU A CB  
1325 N N   . LEU A 182 ? 0.8347 0.7190 0.6874 -0.0196 -0.0922 -0.0481 182  LEU A N   
1326 C CA  . LEU A 182 ? 0.8615 0.6983 0.6703 -0.0249 -0.0869 -0.0543 182  LEU A CA  
1327 C C   . LEU A 182 ? 0.9481 0.7649 0.7190 -0.0499 -0.0952 -0.0506 182  LEU A C   
1328 O O   . LEU A 182 ? 0.9491 0.7878 0.7223 -0.0693 -0.1063 -0.0426 182  LEU A O   
1329 C CB  . LEU A 182 ? 0.8636 0.6788 0.6595 -0.0201 -0.0789 -0.0599 182  LEU A CB  
1330 C CG  . LEU A 182 ? 0.8621 0.6921 0.6875 0.0020  -0.0702 -0.0634 182  LEU A CG  
1331 C CD1 . LEU A 182 ? 0.8597 0.6760 0.6739 0.0021  -0.0654 -0.0658 182  LEU A CD1 
1332 C CD2 . LEU A 182 ? 0.8423 0.6595 0.6658 0.0189  -0.0608 -0.0658 182  LEU A CD2 
1333 N N   . THR A 183 ? 0.9391 0.7138 0.6718 -0.0506 -0.0893 -0.0554 183  THR A N   
1334 C CA  . THR A 183 ? 0.9819 0.7275 0.6680 -0.0766 -0.0963 -0.0534 183  THR A CA  
1335 C C   . THR A 183 ? 1.0885 0.7843 0.7225 -0.0928 -0.0933 -0.0581 183  THR A C   
1336 O O   . THR A 183 ? 1.1093 0.7959 0.7128 -0.1232 -0.1046 -0.0535 183  THR A O   
1337 C CB  . THR A 183 ? 1.0021 0.7276 0.6699 -0.0719 -0.0922 -0.0553 183  THR A CB  
1338 O OG1 . THR A 183 ? 1.0053 0.6885 0.6490 -0.0524 -0.0752 -0.0636 183  THR A OG1 
1339 C CG2 . THR A 183 ? 0.9255 0.6981 0.6415 -0.0594 -0.0965 -0.0494 183  THR A CG2 
1340 N N   A HIS A 184 ? 1.0506 0.7144 0.6726 -0.0737 -0.0783 -0.0655 184  HIS A N   
1341 N N   B HIS A 184 ? 1.0594 0.7246 0.6827 -0.0736 -0.0785 -0.0654 184  HIS A N   
1342 C CA  A HIS A 184 ? 1.0953 0.7055 0.6653 -0.0854 -0.0728 -0.0696 184  HIS A CA  
1343 C CA  B HIS A 184 ? 1.1094 0.7207 0.6817 -0.0834 -0.0721 -0.0698 184  HIS A CA  
1344 C C   A HIS A 184 ? 1.1259 0.7622 0.7148 -0.0975 -0.0814 -0.0658 184  HIS A C   
1345 C C   B HIS A 184 ? 1.1348 0.7715 0.7244 -0.0970 -0.0812 -0.0658 184  HIS A C   
1346 O O   A HIS A 184 ? 1.0614 0.7342 0.6960 -0.0789 -0.0787 -0.0652 184  HIS A O   
1347 O O   B HIS A 184 ? 1.0740 0.7476 0.7093 -0.0791 -0.0788 -0.0651 184  HIS A O   
1348 C CB  A HIS A 184 ? 1.1244 0.6894 0.6709 -0.0583 -0.0517 -0.0759 184  HIS A CB  
1349 C CB  B HIS A 184 ? 1.1349 0.7094 0.6929 -0.0535 -0.0512 -0.0756 184  HIS A CB  
1350 C CG  A HIS A 184 ? 1.2408 0.7334 0.7179 -0.0695 -0.0430 -0.0802 184  HIS A CG  
1351 C CG  B HIS A 184 ? 1.2010 0.7507 0.7394 -0.0391 -0.0404 -0.0777 184  HIS A CG  
1352 N ND1 A HIS A 184 ? 1.3273 0.7660 0.7404 -0.0929 -0.0444 -0.0829 184  HIS A ND1 
1353 N ND1 B HIS A 184 ? 1.2862 0.7877 0.7675 -0.0570 -0.0403 -0.0803 184  HIS A ND1 
1354 C CD2 A HIS A 184 ? 1.2827 0.7457 0.7421 -0.0604 -0.0323 -0.0817 184  HIS A CD2 
1355 C CD2 B HIS A 184 ? 1.1957 0.7628 0.7622 -0.0100 -0.0294 -0.0768 184  HIS A CD2 
1356 C CE1 A HIS A 184 ? 1.3811 0.7551 0.7370 -0.0978 -0.0341 -0.0868 184  HIS A CE1 
1357 C CE1 B HIS A 184 ? 1.2806 0.7731 0.7594 -0.0359 -0.0285 -0.0811 184  HIS A CE1 
1358 N NE2 A HIS A 184 ? 1.3591 0.7458 0.7417 -0.0776 -0.0262 -0.0857 184  HIS A NE2 
1359 N NE2 B HIS A 184 ? 1.2306 0.7637 0.7611 -0.0077 -0.0220 -0.0783 184  HIS A NE2 
1360 N N   . GLN A 185 ? 1.1365 0.7543 0.6876 -0.1310 -0.0922 -0.0625 185  GLN A N   
1361 C CA  . GLN A 185 ? 1.1302 0.7718 0.6913 -0.1496 -0.1024 -0.0564 185  GLN A CA  
1362 C C   . GLN A 185 ? 1.1806 0.7963 0.7335 -0.1367 -0.0910 -0.0616 185  GLN A C   
1363 O O   . GLN A 185 ? 1.1473 0.8064 0.7406 -0.1332 -0.0951 -0.0574 185  GLN A O   
1364 C CB  . GLN A 185 ? 1.1957 0.8237 0.7131 -0.1935 -0.1182 -0.0494 185  GLN A CB  
1365 C CG  . GLN A 185 ? 1.4809 1.1565 1.0202 -0.2084 -0.1331 -0.0389 185  GLN A CG  
1366 C CD  . GLN A 185 ? 1.6869 1.4415 1.3041 -0.1862 -0.1364 -0.0308 185  GLN A CD  
1367 O OE1 . GLN A 185 ? 1.6375 1.4384 1.2907 -0.1873 -0.1420 -0.0227 185  GLN A OE1 
1368 N NE2 . GLN A 185 ? 1.5447 1.3124 1.1861 -0.1648 -0.1317 -0.0329 185  GLN A NE2 
1369 N N   . GLU A 186 ? 1.1756 0.7220 0.6774 -0.1272 -0.0754 -0.0695 186  GLU A N   
1370 C CA  . GLU A 186 ? 1.1834 0.6999 0.6730 -0.1116 -0.0621 -0.0728 186  GLU A CA  
1371 C C   . GLU A 186 ? 1.1395 0.7110 0.6958 -0.0799 -0.0568 -0.0717 186  GLU A C   
1372 O O   . GLU A 186 ? 1.1070 0.6919 0.6791 -0.0770 -0.0562 -0.0701 186  GLU A O   
1373 C CB  . GLU A 186 ? 1.2758 0.7097 0.7002 -0.0998 -0.0427 -0.0792 186  GLU A CB  
1374 C CG  . GLU A 186 ? 1.5379 0.9355 0.9445 -0.0805 -0.0263 -0.0801 186  GLU A CG  
1375 C CD  . GLU A 186 ? 2.0509 1.3562 1.3799 -0.0728 -0.0063 -0.0841 186  GLU A CD  
1376 O OE1 . GLU A 186 ? 2.1261 1.3726 1.3888 -0.1027 -0.0099 -0.0875 186  GLU A OE1 
1377 O OE2 . GLU A 186 ? 2.0057 1.2968 1.3379 -0.0371 0.0138  -0.0826 186  GLU A OE2 
1378 N N   . HIS A 187 ? 1.0463 0.6496 0.6394 -0.0596 -0.0543 -0.0721 187  HIS A N   
1379 C CA  . HIS A 187 ? 0.9885 0.6407 0.6391 -0.0339 -0.0504 -0.0712 187  HIS A CA  
1380 C C   . HIS A 187 ? 0.9774 0.6888 0.6749 -0.0433 -0.0641 -0.0670 187  HIS A C   
1381 O O   . HIS A 187 ? 0.9294 0.6663 0.6568 -0.0315 -0.0614 -0.0667 187  HIS A O   
1382 C CB  . HIS A 187 ? 0.9821 0.6459 0.6509 -0.0141 -0.0446 -0.0720 187  HIS A CB  
1383 C CG  . HIS A 187 ? 1.0727 0.6855 0.7013 0.0019  -0.0278 -0.0738 187  HIS A CG  
1384 N ND1 . HIS A 187 ? 1.0928 0.7088 0.7272 0.0163  -0.0220 -0.0735 187  HIS A ND1 
1385 C CD2 . HIS A 187 ? 1.1385 0.6970 0.7209 0.0074  -0.0144 -0.0746 187  HIS A CD2 
1386 C CE1 . HIS A 187 ? 1.1279 0.6944 0.7205 0.0309  -0.0049 -0.0734 187  HIS A CE1 
1387 N NE2 . HIS A 187 ? 1.1630 0.6919 0.7226 0.0273  0.0011  -0.0741 187  HIS A NE2 
1388 N N   . ARG A 188 ? 0.9095 0.6435 0.6119 -0.0642 -0.0779 -0.0624 188  ARG A N   
1389 C CA  . ARG A 188 ? 0.8579 0.6497 0.6031 -0.0712 -0.0891 -0.0553 188  ARG A CA  
1390 C C   . ARG A 188 ? 0.8994 0.6920 0.6376 -0.0839 -0.0918 -0.0527 188  ARG A C   
1391 O O   . ARG A 188 ? 0.8413 0.6706 0.6163 -0.0735 -0.0912 -0.0511 188  ARG A O   
1392 C CB  . ARG A 188 ? 0.8372 0.6530 0.5843 -0.0916 -0.1026 -0.0468 188  ARG A CB  
1393 C CG  . ARG A 188 ? 0.9220 0.7433 0.6803 -0.0799 -0.1013 -0.0478 188  ARG A CG  
1394 C CD  . ARG A 188 ? 1.0219 0.8697 0.7815 -0.1009 -0.1151 -0.0369 188  ARG A CD  
1395 N NE  . ARG A 188 ? 1.1583 1.0674 0.9627 -0.1012 -0.1227 -0.0250 188  ARG A NE  
1396 C CZ  . ARG A 188 ? 1.4441 1.3920 1.2593 -0.1181 -0.1349 -0.0102 188  ARG A CZ  
1397 N NH1 . ARG A 188 ? 1.4215 1.3530 1.2046 -0.1400 -0.1432 -0.0062 188  ARG A NH1 
1398 N NH2 . ARG A 188 ? 1.2090 1.2137 1.0661 -0.1128 -0.1384 0.0023  188  ARG A NH2 
1399 N N   . VAL A 189 ? 0.9215 0.6687 0.6081 -0.1066 -0.0940 -0.0528 189  VAL A N   
1400 C CA  . VAL A 189 ? 0.9295 0.6702 0.6015 -0.1226 -0.0972 -0.0497 189  VAL A CA  
1401 C C   . VAL A 189 ? 0.9391 0.6766 0.6272 -0.0979 -0.0848 -0.0546 189  VAL A C   
1402 O O   . VAL A 189 ? 0.9006 0.6733 0.6164 -0.0987 -0.0881 -0.0507 189  VAL A O   
1403 C CB  . VAL A 189 ? 1.0512 0.7291 0.6538 -0.1519 -0.0999 -0.0503 189  VAL A CB  
1404 C CG1 . VAL A 189 ? 1.0699 0.7297 0.6508 -0.1667 -0.1007 -0.0481 189  VAL A CG1 
1405 C CG2 . VAL A 189 ? 1.0689 0.7618 0.6585 -0.1830 -0.1159 -0.0423 189  VAL A CG2 
1406 N N   . MET A 190 ? 0.9046 0.6051 0.5776 -0.0754 -0.0704 -0.0614 190  MET A N   
1407 C CA  . MET A 190 ? 0.8943 0.5950 0.5821 -0.0522 -0.0588 -0.0632 190  MET A CA  
1408 C C   . MET A 190 ? 0.8733 0.6354 0.6208 -0.0366 -0.0607 -0.0624 190  MET A C   
1409 O O   . MET A 190 ? 0.8616 0.6402 0.6260 -0.0305 -0.0583 -0.0613 190  MET A O   
1410 C CB  . MET A 190 ? 0.9595 0.6149 0.6201 -0.0307 -0.0427 -0.0665 190  MET A CB  
1411 C CG  . MET A 190 ? 1.0923 0.6764 0.6871 -0.0412 -0.0356 -0.0677 190  MET A CG  
1412 S SD  . MET A 190 ? 1.2009 0.7343 0.7620 -0.0145 -0.0156 -0.0698 190  MET A SD  
1413 C CE  . MET A 190 ? 1.1569 0.6829 0.7229 0.0131  0.0009  -0.0647 190  MET A CE  
1414 N N   . LEU A 191 ? 0.7866 0.5790 0.5622 -0.0311 -0.0648 -0.0627 191  LEU A N   
1415 C CA  . LEU A 191 ? 0.7334 0.5755 0.5577 -0.0180 -0.0659 -0.0624 191  LEU A CA  
1416 C C   . LEU A 191 ? 0.7651 0.6440 0.6098 -0.0303 -0.0743 -0.0573 191  LEU A C   
1417 O O   . LEU A 191 ? 0.7332 0.6331 0.5992 -0.0218 -0.0711 -0.0578 191  LEU A O   
1418 C CB  . LEU A 191 ? 0.7081 0.5666 0.5516 -0.0097 -0.0672 -0.0633 191  LEU A CB  
1419 C CG  . LEU A 191 ? 0.7517 0.5894 0.5886 0.0078  -0.0576 -0.0670 191  LEU A CG  
1420 C CD1 . LEU A 191 ? 0.7317 0.5862 0.5864 0.0122  -0.0607 -0.0670 191  LEU A CD1 
1421 C CD2 . LEU A 191 ? 0.7186 0.5679 0.5737 0.0248  -0.0495 -0.0680 191  LEU A CD2 
1422 N N   . VAL A 192 ? 0.7339 0.6213 0.5697 -0.0516 -0.0848 -0.0507 192  VAL A N   
1423 C CA  . VAL A 192 ? 0.7090 0.6380 0.5642 -0.0647 -0.0933 -0.0415 192  VAL A CA  
1424 C C   . VAL A 192 ? 0.7483 0.6687 0.5919 -0.0720 -0.0919 -0.0410 192  VAL A C   
1425 O O   . VAL A 192 ? 0.7037 0.6593 0.5756 -0.0657 -0.0910 -0.0383 192  VAL A O   
1426 C CB  . VAL A 192 ? 0.7730 0.7133 0.6163 -0.0893 -0.1058 -0.0312 192  VAL A CB  
1427 C CG1 . VAL A 192 ? 0.7626 0.7506 0.6244 -0.1048 -0.1147 -0.0175 192  VAL A CG1 
1428 C CG2 . VAL A 192 ? 0.7528 0.7096 0.6143 -0.0794 -0.1068 -0.0299 192  VAL A CG2 
1429 N N   . ASN A 193 ? 0.7516 0.6216 0.5509 -0.0841 -0.0905 -0.0437 193  ASN A N   
1430 C CA  . ASN A 193 ? 0.7766 0.6294 0.5579 -0.0919 -0.0887 -0.0427 193  ASN A CA  
1431 C C   . ASN A 193 ? 0.7620 0.6283 0.5692 -0.0683 -0.0790 -0.0470 193  ASN A C   
1432 O O   . ASN A 193 ? 0.7515 0.6427 0.5733 -0.0720 -0.0807 -0.0432 193  ASN A O   
1433 C CB  . ASN A 193 ? 0.8101 0.5932 0.5330 -0.1022 -0.0843 -0.0463 193  ASN A CB  
1434 C CG  . ASN A 193 ? 1.0370 0.7966 0.7193 -0.1357 -0.0953 -0.0414 193  ASN A CG  
1435 O OD1 . ASN A 193 ? 0.9060 0.7089 0.6059 -0.1549 -0.1084 -0.0323 193  ASN A OD1 
1436 N ND2 . ASN A 193 ? 0.9412 0.6304 0.5655 -0.1430 -0.0893 -0.0461 193  ASN A ND2 
1437 N N   . SER A 194 ? 0.6953 0.5464 0.5062 -0.0460 -0.0693 -0.0534 194  SER A N   
1438 C CA  . SER A 194 ? 0.6833 0.5477 0.5161 -0.0255 -0.0607 -0.0560 194  SER A CA  
1439 C C   . SER A 194 ? 0.6818 0.5979 0.5571 -0.0194 -0.0635 -0.0559 194  SER A C   
1440 O O   . SER A 194 ? 0.6719 0.6051 0.5604 -0.0153 -0.0611 -0.0554 194  SER A O   
1441 C CB  . SER A 194 ? 0.7173 0.5613 0.5457 -0.0057 -0.0511 -0.0596 194  SER A CB  
1442 O OG  . SER A 194 ? 0.7697 0.5649 0.5591 -0.0033 -0.0429 -0.0584 194  SER A OG  
1443 N N   . MET A 195 ? 0.6569 0.5948 0.5502 -0.0184 -0.0676 -0.0557 195  MET A N   
1444 C CA  . MET A 195 ? 0.6366 0.6163 0.5645 -0.0103 -0.0678 -0.0552 195  MET A CA  
1445 C C   . MET A 195 ? 0.6816 0.6903 0.6189 -0.0211 -0.0720 -0.0480 195  MET A C   
1446 O O   . MET A 195 ? 0.6529 0.6848 0.6093 -0.0125 -0.0678 -0.0489 195  MET A O   
1447 C CB  . MET A 195 ? 0.6600 0.6510 0.6004 -0.0058 -0.0700 -0.0546 195  MET A CB  
1448 C CG  . MET A 195 ? 0.6945 0.7152 0.6641 0.0085  -0.0659 -0.0557 195  MET A CG  
1449 S SD  . MET A 195 ? 0.7503 0.7703 0.7284 0.0227  -0.0570 -0.0642 195  MET A SD  
1450 C CE  . MET A 195 ? 0.7056 0.7004 0.6735 0.0285  -0.0548 -0.0690 195  MET A CE  
1451 N N   . ASN A 196 ? 0.6682 0.6749 0.5893 -0.0417 -0.0803 -0.0403 196  ASN A N   
1452 C CA  . ASN A 196 ? 0.6763 0.7144 0.6051 -0.0555 -0.0856 -0.0303 196  ASN A CA  
1453 C C   . ASN A 196 ? 0.7468 0.7778 0.6704 -0.0549 -0.0814 -0.0327 196  ASN A C   
1454 O O   . ASN A 196 ? 0.7344 0.8002 0.6793 -0.0515 -0.0798 -0.0287 196  ASN A O   
1455 C CB  . ASN A 196 ? 0.7081 0.7421 0.6143 -0.0831 -0.0971 -0.0204 196  ASN A CB  
1456 C CG  . ASN A 196 ? 1.0992 1.1609 1.0196 -0.0861 -0.1032 -0.0123 196  ASN A CG  
1457 O OD1 . ASN A 196 ? 1.0393 1.1318 0.9914 -0.0669 -0.0985 -0.0112 196  ASN A OD1 
1458 N ND2 . ASN A 196 ? 1.0088 1.0584 0.9032 -0.1112 -0.1135 -0.0054 196  ASN A ND2 
1459 N N   . THR A 197 ? 0.7252 0.7114 0.6202 -0.0558 -0.0781 -0.0383 197  THR A N   
1460 C CA  . THR A 197 ? 0.7253 0.7019 0.6135 -0.0539 -0.0735 -0.0391 197  THR A CA  
1461 C C   . THR A 197 ? 0.7262 0.7302 0.6444 -0.0339 -0.0663 -0.0439 197  THR A C   
1462 O O   . THR A 197 ? 0.7135 0.7412 0.6433 -0.0352 -0.0656 -0.0411 197  THR A O   
1463 C CB  . THR A 197 ? 0.7506 0.6722 0.6017 -0.0537 -0.0687 -0.0423 197  THR A CB  
1464 O OG1 . THR A 197 ? 0.8169 0.7089 0.6346 -0.0748 -0.0753 -0.0390 197  THR A OG1 
1465 C CG2 . THR A 197 ? 0.6846 0.5946 0.5263 -0.0517 -0.0636 -0.0405 197  THR A CG2 
1466 N N   . VAL A 198 ? 0.6745 0.6756 0.6028 -0.0180 -0.0617 -0.0504 198  VAL A N   
1467 C CA  . VAL A 198 ? 0.6621 0.6828 0.6118 -0.0028 -0.0556 -0.0554 198  VAL A CA  
1468 C C   . VAL A 198 ? 0.7162 0.7746 0.6879 -0.0019 -0.0556 -0.0533 198  VAL A C   
1469 O O   . VAL A 198 ? 0.6974 0.7704 0.6758 0.0007  -0.0520 -0.0539 198  VAL A O   
1470 C CB  . VAL A 198 ? 0.6958 0.7051 0.6486 0.0096  -0.0523 -0.0612 198  VAL A CB  
1471 C CG1 . VAL A 198 ? 0.6678 0.6937 0.6362 0.0201  -0.0474 -0.0661 198  VAL A CG1 
1472 C CG2 . VAL A 198 ? 0.7120 0.6882 0.6436 0.0123  -0.0496 -0.0608 198  VAL A CG2 
1473 N N   . LYS A 199 ? 0.6904 0.7651 0.6716 -0.0038 -0.0589 -0.0490 199  LYS A N   
1474 C CA  . LYS A 199 ? 0.6750 0.7872 0.6768 0.0006  -0.0567 -0.0432 199  LYS A CA  
1475 C C   . LYS A 199 ? 0.7292 0.8625 0.7317 -0.0107 -0.0590 -0.0351 199  LYS A C   
1476 O O   . LYS A 199 ? 0.7364 0.8943 0.7520 -0.0028 -0.0528 -0.0338 199  LYS A O   
1477 C CB  . LYS A 199 ? 0.7034 0.8317 0.7137 -0.0014 -0.0611 -0.0350 199  LYS A CB  
1478 C CG  . LYS A 199 ? 0.8176 0.9322 0.8312 0.0113  -0.0581 -0.0411 199  LYS A CG  
1479 C CD  . LYS A 199 ? 0.9556 1.0736 0.9675 0.0024  -0.0660 -0.0331 199  LYS A CD  
1480 C CE  . LYS A 199 ? 0.9599 1.1179 0.9934 0.0081  -0.0654 -0.0201 199  LYS A CE  
1481 N NZ  . LYS A 199 ? 1.0524 1.2090 1.0853 0.0049  -0.0711 -0.0151 199  LYS A NZ  
1482 N N   . GLU A 200 ? 0.6782 0.7994 0.6634 -0.0297 -0.0671 -0.0294 200  GLU A N   
1483 C CA  . GLU A 200 ? 0.6781 0.8175 0.6610 -0.0442 -0.0707 -0.0203 200  GLU A CA  
1484 C C   . GLU A 200 ? 0.6975 0.8291 0.6771 -0.0390 -0.0650 -0.0260 200  GLU A C   
1485 O O   . GLU A 200 ? 0.7034 0.8628 0.6924 -0.0418 -0.0637 -0.0201 200  GLU A O   
1486 C CB  . GLU A 200 ? 0.7265 0.8448 0.6830 -0.0693 -0.0812 -0.0136 200  GLU A CB  
1487 C CG  . GLU A 200 ? 0.9379 1.0966 0.9031 -0.0871 -0.0898 0.0028  200  GLU A CG  
1488 C CD  . GLU A 200 ? 1.3561 1.4906 1.2894 -0.1165 -0.1017 0.0094  200  GLU A CD  
1489 O OE1 . GLU A 200 ? 1.2404 1.3733 1.1570 -0.1380 -0.1076 0.0169  200  GLU A OE1 
1490 O OE2 . GLU A 200 ? 1.2981 1.4125 1.2198 -0.1195 -0.1052 0.0070  200  GLU A OE2 
1491 N N   . LEU A 201 ? 0.6183 0.7159 0.5854 -0.0315 -0.0614 -0.0353 201  LEU A N   
1492 C CA  . LEU A 201 ? 0.6050 0.6968 0.5686 -0.0271 -0.0566 -0.0385 201  LEU A CA  
1493 C C   . LEU A 201 ? 0.6239 0.7362 0.6048 -0.0125 -0.0493 -0.0446 201  LEU A C   
1494 O O   . LEU A 201 ? 0.5942 0.7109 0.5740 -0.0118 -0.0462 -0.0453 201  LEU A O   
1495 C CB  . LEU A 201 ? 0.6170 0.6683 0.5593 -0.0249 -0.0552 -0.0415 201  LEU A CB  
1496 C CG  . LEU A 201 ? 0.7087 0.7270 0.6217 -0.0400 -0.0595 -0.0360 201  LEU A CG  
1497 C CD1 . LEU A 201 ? 0.7199 0.6993 0.6123 -0.0311 -0.0535 -0.0375 201  LEU A CD1 
1498 C CD2 . LEU A 201 ? 0.7365 0.7676 0.6449 -0.0557 -0.0633 -0.0281 201  LEU A CD2 
1499 N N   . LEU A 202 ? 0.5792 0.7006 0.5723 -0.0019 -0.0461 -0.0488 202  LEU A N   
1500 C CA  . LEU A 202 ? 0.5768 0.7080 0.5778 0.0105  -0.0380 -0.0557 202  LEU A CA  
1501 C C   . LEU A 202 ? 0.6173 0.7761 0.6250 0.0105  -0.0334 -0.0518 202  LEU A C   
1502 O O   . LEU A 202 ? 0.6190 0.7765 0.6213 0.0108  -0.0300 -0.0559 202  LEU A O   
1503 C CB  . LEU A 202 ? 0.5740 0.7016 0.5810 0.0218  -0.0344 -0.0604 202  LEU A CB  
1504 C CG  . LEU A 202 ? 0.6303 0.7608 0.6381 0.0338  -0.0244 -0.0674 202  LEU A CG  
1505 C CD1 . LEU A 202 ? 0.6328 0.7480 0.6288 0.0318  -0.0229 -0.0755 202  LEU A CD1 
1506 C CD2 . LEU A 202 ? 0.6354 0.7580 0.6464 0.0445  -0.0209 -0.0699 202  LEU A CD2 
1507 N N   . PRO A 203 ? 0.5802 0.7672 0.5991 0.0088  -0.0336 -0.0420 203  PRO A N   
1508 C CA  . PRO A 203 ? 0.5779 0.7935 0.6029 0.0099  -0.0280 -0.0367 203  PRO A CA  
1509 C C   . PRO A 203 ? 0.6377 0.8508 0.6538 -0.0031 -0.0323 -0.0348 203  PRO A C   
1510 O O   . PRO A 203 ? 0.6515 0.8761 0.6671 -0.0004 -0.0264 -0.0363 203  PRO A O   
1511 C CB  . PRO A 203 ? 0.5942 0.8448 0.6343 0.0080  -0.0297 -0.0219 203  PRO A CB  
1512 C CG  . PRO A 203 ? 0.6574 0.8938 0.6938 -0.0029 -0.0404 -0.0189 203  PRO A CG  
1513 C CD  . PRO A 203 ? 0.5995 0.7989 0.6268 0.0060  -0.0384 -0.0331 203  PRO A CD  
1514 N N   . VAL A 204 ? 0.5799 0.7735 0.5854 -0.0166 -0.0415 -0.0318 204  VAL A N   
1515 C CA  . VAL A 204 ? 0.5713 0.7546 0.5644 -0.0277 -0.0448 -0.0290 204  VAL A CA  
1516 C C   . VAL A 204 ? 0.6099 0.7794 0.5979 -0.0191 -0.0398 -0.0376 204  VAL A C   
1517 O O   . VAL A 204 ? 0.6071 0.7848 0.5924 -0.0226 -0.0383 -0.0354 204  VAL A O   
1518 C CB  . VAL A 204 ? 0.6314 0.7862 0.6065 -0.0421 -0.0534 -0.0241 204  VAL A CB  
1519 C CG1 . VAL A 204 ? 0.6400 0.7751 0.5980 -0.0497 -0.0543 -0.0213 204  VAL A CG1 
1520 C CG2 . VAL A 204 ? 0.6339 0.8082 0.6115 -0.0571 -0.0604 -0.0131 204  VAL A CG2 
1521 N N   . LEU A 205 ? 0.5698 0.7221 0.5569 -0.0094 -0.0376 -0.0460 205  LEU A N   
1522 C CA  . LEU A 205 ? 0.5591 0.7043 0.5415 -0.0044 -0.0342 -0.0517 205  LEU A CA  
1523 C C   . LEU A 205 ? 0.6476 0.8122 0.6328 -0.0010 -0.0276 -0.0562 205  LEU A C   
1524 O O   . LEU A 205 ? 0.6448 0.8159 0.6250 -0.0049 -0.0265 -0.0553 205  LEU A O   
1525 C CB  . LEU A 205 ? 0.5405 0.6669 0.5210 0.0026  -0.0341 -0.0577 205  LEU A CB  
1526 C CG  . LEU A 205 ? 0.5909 0.7169 0.5672 0.0048  -0.0316 -0.0618 205  LEU A CG  
1527 C CD1 . LEU A 205 ? 0.5812 0.7090 0.5525 0.0008  -0.0333 -0.0537 205  LEU A CD1 
1528 C CD2 . LEU A 205 ? 0.5612 0.6728 0.5367 0.0100  -0.0320 -0.0663 205  LEU A CD2 
1529 N N   . ILE A 206 ? 0.6191 0.7917 0.6101 0.0068  -0.0221 -0.0599 206  ILE A N   
1530 C CA  . ILE A 206 ? 0.6274 0.8109 0.6147 0.0127  -0.0126 -0.0646 206  ILE A CA  
1531 C C   . ILE A 206 ? 0.6899 0.8969 0.6790 0.0069  -0.0114 -0.0577 206  ILE A C   
1532 O O   . ILE A 206 ? 0.6975 0.9071 0.6767 0.0061  -0.0062 -0.0618 206  ILE A O   
1533 C CB  . ILE A 206 ? 0.6596 0.8430 0.6501 0.0264  -0.0041 -0.0678 206  ILE A CB  
1534 C CG1 . ILE A 206 ? 0.6574 0.8153 0.6442 0.0304  -0.0060 -0.0748 206  ILE A CG1 
1535 C CG2 . ILE A 206 ? 0.6652 0.8503 0.6440 0.0350  0.0091  -0.0733 206  ILE A CG2 
1536 C CD1 . ILE A 206 ? 0.6256 0.7608 0.5962 0.0248  -0.0077 -0.0839 206  ILE A CD1 
1537 N N   . SER A 207 ? 0.6393 0.8614 0.6378 -0.0002 -0.0172 -0.0468 207  SER A N   
1538 C CA  . SER A 207 ? 0.6459 0.8917 0.6467 -0.0080 -0.0173 -0.0382 207  SER A CA  
1539 C C   . SER A 207 ? 0.7166 0.9528 0.7073 -0.0171 -0.0214 -0.0380 207  SER A C   
1540 O O   . SER A 207 ? 0.7107 0.9628 0.6989 -0.0200 -0.0180 -0.0360 207  SER A O   
1541 C CB  . SER A 207 ? 0.6534 0.9166 0.6636 -0.0173 -0.0241 -0.0252 207  SER A CB  
1542 O OG  . SER A 207 ? 0.7147 0.9978 0.7376 -0.0076 -0.0192 -0.0215 207  SER A OG  
1543 N N   . ALA A 208 ? 0.6907 0.9021 0.6755 -0.0203 -0.0277 -0.0385 208  ALA A N   
1544 C CA  . ALA A 208 ? 0.6980 0.8997 0.6738 -0.0255 -0.0306 -0.0352 208  ALA A CA  
1545 C C   . ALA A 208 ? 0.7521 0.9585 0.7234 -0.0223 -0.0263 -0.0416 208  ALA A C   
1546 O O   . ALA A 208 ? 0.7818 0.9976 0.7487 -0.0277 -0.0266 -0.0372 208  ALA A O   
1547 C CB  . ALA A 208 ? 0.7111 0.8845 0.6806 -0.0248 -0.0351 -0.0329 208  ALA A CB  
1548 N N   . MET A 209 ? 0.6845 0.8838 0.6545 -0.0156 -0.0227 -0.0513 209  MET A N   
1549 C CA  . MET A 209 ? 0.6788 0.8775 0.6379 -0.0167 -0.0192 -0.0584 209  MET A CA  
1550 C C   . MET A 209 ? 0.7809 0.9936 0.7329 -0.0174 -0.0116 -0.0620 209  MET A C   
1551 O O   . MET A 209 ? 0.7904 1.0048 0.7286 -0.0236 -0.0099 -0.0651 209  MET A O   
1552 C CB  . MET A 209 ? 0.6959 0.8768 0.6508 -0.0111 -0.0174 -0.0677 209  MET A CB  
1553 C CG  . MET A 209 ? 0.7077 0.8758 0.6675 -0.0100 -0.0237 -0.0642 209  MET A CG  
1554 S SD  . MET A 209 ? 0.7327 0.8811 0.6893 -0.0039 -0.0221 -0.0739 209  MET A SD  
1555 C CE  . MET A 209 ? 0.7033 0.8500 0.6414 -0.0134 -0.0210 -0.0794 209  MET A CE  
1556 N N   . LYS A 210 ? 0.7596 0.9834 0.7192 -0.0110 -0.0063 -0.0606 210  LYS A N   
1557 C CA  . LYS A 210 ? 0.7798 1.0182 0.7325 -0.0082 0.0035  -0.0623 210  LYS A CA  
1558 C C   . LYS A 210 ? 0.8738 1.1307 0.8262 -0.0190 -0.0002 -0.0542 210  LYS A C   
1559 O O   . LYS A 210 ? 0.8936 1.1546 0.8316 -0.0223 0.0051  -0.0580 210  LYS A O   
1560 C CB  . LYS A 210 ? 0.8005 1.0538 0.7654 0.0032  0.0104  -0.0581 210  LYS A CB  
1561 C CG  . LYS A 210 ? 0.9484 1.2166 0.9053 0.0112  0.0242  -0.0586 210  LYS A CG  
1562 C CD  . LYS A 210 ? 1.0406 1.3383 1.0163 0.0209  0.0292  -0.0468 210  LYS A CD  
1563 C CE  . LYS A 210 ? 1.0926 1.4153 1.0646 0.0270  0.0416  -0.0418 210  LYS A CE  
1564 N NZ  . LYS A 210 ? 1.2301 1.5883 1.2230 0.0384  0.0475  -0.0269 210  LYS A NZ  
1565 N N   . ILE A 211 ? 0.8375 1.1010 0.8017 -0.0256 -0.0091 -0.0434 211  ILE A N   
1566 C CA  . ILE A 211 ? 0.8495 1.1262 0.8131 -0.0359 -0.0133 -0.0339 211  ILE A CA  
1567 C C   . ILE A 211 ? 0.9286 1.1986 0.8811 -0.0412 -0.0159 -0.0353 211  ILE A C   
1568 O O   . ILE A 211 ? 0.9441 1.2285 0.8896 -0.0475 -0.0144 -0.0327 211  ILE A O   
1569 C CB  . ILE A 211 ? 0.8900 1.1637 0.8615 -0.0423 -0.0216 -0.0226 211  ILE A CB  
1570 C CG1 . ILE A 211 ? 0.8928 1.1837 0.8752 -0.0419 -0.0205 -0.0178 211  ILE A CG1 
1571 C CG2 . ILE A 211 ? 0.9178 1.1967 0.8843 -0.0527 -0.0258 -0.0122 211  ILE A CG2 
1572 C CD1 . ILE A 211 ? 1.0029 1.2845 0.9868 -0.0524 -0.0298 -0.0080 211  ILE A CD1 
1573 N N   . PHE A 212 ? 0.8750 1.1270 0.8259 -0.0389 -0.0196 -0.0383 212  PHE A N   
1574 C CA  . PHE A 212 ? 0.8622 1.1150 0.8049 -0.0446 -0.0227 -0.0363 212  PHE A CA  
1575 C C   . PHE A 212 ? 0.9529 1.2104 0.8785 -0.0503 -0.0177 -0.0456 212  PHE A C   
1576 O O   . PHE A 212 ? 0.9641 1.2345 0.8811 -0.0601 -0.0199 -0.0408 212  PHE A O   
1577 C CB  . PHE A 212 ? 0.8598 1.0969 0.8057 -0.0403 -0.0269 -0.0356 212  PHE A CB  
1578 C CG  . PHE A 212 ? 0.8627 1.1090 0.8028 -0.0467 -0.0305 -0.0299 212  PHE A CG  
1579 C CD1 . PHE A 212 ? 0.8913 1.1506 0.8353 -0.0485 -0.0340 -0.0143 212  PHE A CD1 
1580 C CD2 . PHE A 212 ? 0.8732 1.1159 0.8023 -0.0520 -0.0305 -0.0382 212  PHE A CD2 
1581 C CE1 . PHE A 212 ? 0.8972 1.1732 0.8387 -0.0545 -0.0377 -0.0050 212  PHE A CE1 
1582 C CE2 . PHE A 212 ? 0.9056 1.1630 0.8291 -0.0619 -0.0355 -0.0300 212  PHE A CE2 
1583 C CZ  . PHE A 212 ? 0.8793 1.1570 0.8111 -0.0627 -0.0393 -0.0125 212  PHE A CZ  
1584 N N   . VAL A 213 ? 0.9353 1.1801 0.8528 -0.0444 -0.0103 -0.0580 213  VAL A N   
1585 C CA  . VAL A 213 ? 0.9699 1.2077 0.8623 -0.0491 -0.0028 -0.0686 213  VAL A CA  
1586 C C   . VAL A 213 ? 1.0672 1.3231 0.9537 -0.0515 0.0032  -0.0662 213  VAL A C   
1587 O O   . VAL A 213 ? 1.0916 1.3465 0.9544 -0.0611 0.0065  -0.0708 213  VAL A O   
1588 C CB  . VAL A 213 ? 1.0316 1.2441 0.9135 -0.0388 0.0059  -0.0815 213  VAL A CB  
1589 C CG1 . VAL A 213 ? 1.0701 1.2670 0.9191 -0.0406 0.0179  -0.0930 213  VAL A CG1 
1590 C CG2 . VAL A 213 ? 1.0217 1.2170 0.9033 -0.0414 -0.0008 -0.0841 213  VAL A CG2 
1591 N N   . THR A 214 ? 1.0191 1.2924 0.9254 -0.0453 0.0036  -0.0578 214  THR A N   
1592 C CA  . THR A 214 ? 1.0295 1.3250 0.9352 -0.0471 0.0086  -0.0525 214  THR A CA  
1593 C C   . THR A 214 ? 1.0948 1.4066 1.0010 -0.0606 0.0002  -0.0419 214  THR A C   
1594 O O   . THR A 214 ? 1.1009 1.4246 0.9933 -0.0670 0.0045  -0.0421 214  THR A O   
1595 C CB  . THR A 214 ? 1.0935 1.4033 1.0190 -0.0371 0.0119  -0.0462 214  THR A CB  
1596 O OG1 . THR A 214 ? 1.0445 1.3431 0.9648 -0.0229 0.0232  -0.0550 214  THR A OG1 
1597 C CG2 . THR A 214 ? 1.1096 1.4487 1.0395 -0.0406 0.0150  -0.0366 214  THR A CG2 
1598 N N   . THR A 215 ? 1.0455 1.3560 0.9651 -0.0636 -0.0103 -0.0321 215  THR A N   
1599 C CA  . THR A 215 ? 1.3620 1.6859 1.2830 -0.0729 -0.0172 -0.0191 215  THR A CA  
1600 C C   . THR A 215 ? 1.7612 2.0874 1.6685 -0.0818 -0.0205 -0.0196 215  THR A C   
1601 O O   . THR A 215 ? 1.3426 1.6706 1.2302 -0.0889 -0.0160 -0.0281 215  THR A O   
1602 C CB  . THR A 215 ? 1.4298 1.7462 1.3654 -0.0698 -0.0241 -0.0069 215  THR A CB  
1603 O OG1 . THR A 215 ? 1.4306 1.7299 1.3687 -0.0643 -0.0273 -0.0083 215  THR A OG1 
1604 C CG2 . THR A 215 ? 1.3876 1.7016 1.3326 -0.0669 -0.0233 -0.0048 215  THR A CG2 
1605 N N   . GLN A 221 ? 1.3614 1.7010 1.2991 -0.0618 -0.0371 0.0972  221  GLN A N   
1606 C CA  . GLN A 221 ? 1.3746 1.6790 1.3038 -0.0582 -0.0344 0.0993  221  GLN A CA  
1607 C C   . GLN A 221 ? 1.4174 1.7015 1.3458 -0.0617 -0.0349 0.0799  221  GLN A C   
1608 O O   . GLN A 221 ? 1.4237 1.6736 1.3465 -0.0540 -0.0331 0.0787  221  GLN A O   
1609 C CB  . GLN A 221 ? 1.3953 1.7101 1.3189 -0.0681 -0.0353 0.1083  221  GLN A CB  
1610 N N   . GLY A 222 ? 1.3505 1.6560 1.2830 -0.0723 -0.0364 0.0664  222  GLY A N   
1611 C CA  . GLY A 222 ? 1.3287 1.6251 1.2636 -0.0742 -0.0360 0.0506  222  GLY A CA  
1612 C C   . GLY A 222 ? 1.3330 1.6198 1.2724 -0.0659 -0.0354 0.0397  222  GLY A C   
1613 O O   . GLY A 222 ? 1.3188 1.5870 1.2595 -0.0629 -0.0351 0.0315  222  GLY A O   
1614 N N   . ILE A 223 ? 1.2683 1.5697 1.2094 -0.0639 -0.0359 0.0414  223  ILE A N   
1615 C CA  . ILE A 223 ? 1.2489 1.5447 1.1931 -0.0581 -0.0360 0.0336  223  ILE A CA  
1616 C C   . ILE A 223 ? 1.2772 1.5461 1.2229 -0.0454 -0.0352 0.0406  223  ILE A C   
1617 O O   . ILE A 223 ? 1.2739 1.5269 1.2217 -0.0405 -0.0347 0.0304  223  ILE A O   
1618 C CB  . ILE A 223 ? 1.2845 1.6071 1.2267 -0.0649 -0.0383 0.0360  223  ILE A CB  
1619 C CG1 . ILE A 223 ? 1.2850 1.6018 1.2255 -0.0652 -0.0387 0.0225  223  ILE A CG1 
1620 C CG2 . ILE A 223 ? 1.2984 1.6364 1.2444 -0.0612 -0.0402 0.0582  223  ILE A CG2 
1621 C CD1 . ILE A 223 ? 1.3894 1.7252 1.3173 -0.0800 -0.0406 0.0166  223  ILE A CD1 
1622 N N   . GLU A 224 ? 1.2169 1.4776 1.1588 -0.0391 -0.0336 0.0582  224  GLU A N   
1623 C CA  . GLU A 224 ? 1.2157 1.4453 1.1524 -0.0244 -0.0296 0.0675  224  GLU A CA  
1624 C C   . GLU A 224 ? 1.2358 1.4265 1.1630 -0.0241 -0.0288 0.0573  224  GLU A C   
1625 O O   . GLU A 224 ? 1.2284 1.3926 1.1505 -0.0132 -0.0257 0.0577  224  GLU A O   
1626 C CB  . GLU A 224 ? 1.2548 1.4803 1.1843 -0.0169 -0.0256 0.0892  224  GLU A CB  
1627 C CG  . GLU A 224 ? 1.4396 1.6462 1.3653 0.0034  -0.0185 0.1041  224  GLU A CG  
1628 C CD  . GLU A 224 ? 1.7711 2.0140 1.7124 0.0111  -0.0187 0.1145  224  GLU A CD  
1629 O OE1 . GLU A 224 ? 1.7336 2.0173 1.6862 -0.0023 -0.0254 0.1111  224  GLU A OE1 
1630 O OE2 . GLU A 224 ? 1.7198 1.9498 1.6597 0.0299  -0.0115 0.1274  224  GLU A OE2 
1631 N N   . GLU A 225 ? 1.1777 1.3680 1.1020 -0.0370 -0.0317 0.0497  225  GLU A N   
1632 C CA  . GLU A 225 ? 1.1772 1.3391 1.0927 -0.0421 -0.0331 0.0423  225  GLU A CA  
1633 C C   . GLU A 225 ? 1.1723 1.3417 1.0993 -0.0414 -0.0347 0.0266  225  GLU A C   
1634 O O   . GLU A 225 ? 1.1752 1.3175 1.0963 -0.0375 -0.0346 0.0228  225  GLU A O   
1635 C CB  . GLU A 225 ? 1.2051 1.3720 1.1149 -0.0575 -0.0361 0.0449  225  GLU A CB  
1636 C CG  . GLU A 225 ? 1.3681 1.5013 1.2615 -0.0668 -0.0387 0.0444  225  GLU A CG  
1637 C CD  . GLU A 225 ? 1.6011 1.7407 1.4870 -0.0848 -0.0427 0.0507  225  GLU A CD  
1638 O OE1 . GLU A 225 ? 1.5310 1.6545 1.4013 -0.0876 -0.0413 0.0625  225  GLU A OE1 
1639 O OE2 . GLU A 225 ? 1.4824 1.6436 1.3775 -0.0958 -0.0468 0.0457  225  GLU A OE2 
1640 N N   . ALA A 226 ? 1.0764 1.2788 1.0162 -0.0448 -0.0353 0.0180  226  ALA A N   
1641 C CA  . ALA A 226 ? 1.0462 1.2546 0.9945 -0.0426 -0.0349 0.0039  226  ALA A CA  
1642 C C   . ALA A 226 ? 1.0472 1.2435 0.9969 -0.0326 -0.0343 0.0013  226  ALA A C   
1643 O O   . ALA A 226 ? 1.0388 1.2235 0.9912 -0.0290 -0.0344 -0.0073 226  ALA A O   
1644 C CB  . ALA A 226 ? 1.0492 1.2868 1.0022 -0.0468 -0.0329 -0.0033 226  ALA A CB  
1645 N N   . LEU A 227 ? 0.9637 1.1665 0.9127 -0.0284 -0.0336 0.0111  227  LEU A N   
1646 C CA  . LEU A 227 ? 0.9404 1.1393 0.8921 -0.0192 -0.0329 0.0139  227  LEU A CA  
1647 C C   . LEU A 227 ? 0.9461 1.1101 0.8905 -0.0089 -0.0303 0.0182  227  LEU A C   
1648 O O   . LEU A 227 ? 0.9135 1.0669 0.8601 -0.0025 -0.0298 0.0130  227  LEU A O   
1649 C CB  . LEU A 227 ? 0.9432 1.1661 0.8971 -0.0183 -0.0329 0.0287  227  LEU A CB  
1650 C CG  . LEU A 227 ? 1.0088 1.2399 0.9680 -0.0101 -0.0325 0.0369  227  LEU A CG  
1651 C CD1 . LEU A 227 ? 1.0121 1.2802 0.9751 -0.0213 -0.0368 0.0399  227  LEU A CD1 
1652 C CD2 . LEU A 227 ? 1.0595 1.2798 1.0162 0.0052  -0.0271 0.0567  227  LEU A CD2 
1653 N N   . LYS A 228 ? 0.8962 1.0387 0.8279 -0.0082 -0.0282 0.0276  228  LYS A N   
1654 C CA  . LYS A 228 ? 0.9010 1.0004 0.8156 0.0000  -0.0242 0.0318  228  LYS A CA  
1655 C C   . LYS A 228 ? 0.8819 0.9624 0.7933 -0.0056 -0.0273 0.0181  228  LYS A C   
1656 O O   . LYS A 228 ? 0.8698 0.9252 0.7739 0.0030  -0.0246 0.0167  228  LYS A O   
1657 C CB  . LYS A 228 ? 0.9679 1.0420 0.8625 -0.0021 -0.0213 0.0432  228  LYS A CB  
1658 N N   . ASN A 229 ? 0.7826 0.8789 0.7004 -0.0191 -0.0324 0.0099  229  ASN A N   
1659 C CA  . ASN A 229 ? 0.7644 0.8525 0.6825 -0.0257 -0.0360 0.0003  229  ASN A CA  
1660 C C   . ASN A 229 ? 0.7700 0.8697 0.7025 -0.0185 -0.0359 -0.0099 229  ASN A C   
1661 O O   . ASN A 229 ? 0.7860 0.8682 0.7152 -0.0178 -0.0372 -0.0148 229  ASN A O   
1662 C CB  . ASN A 229 ? 0.7469 0.8550 0.6691 -0.0403 -0.0402 -0.0006 229  ASN A CB  
1663 C CG  . ASN A 229 ? 1.1534 1.2400 1.0553 -0.0518 -0.0419 0.0095  229  ASN A CG  
1664 O OD1 . ASN A 229 ? 1.0160 1.0604 0.8942 -0.0532 -0.0413 0.0131  229  ASN A OD1 
1665 N ND2 . ASN A 229 ? 1.1039 1.2150 1.0105 -0.0606 -0.0433 0.0143  229  ASN A ND2 
1666 N N   . ARG A 230 ? 0.6767 0.8034 0.6219 -0.0151 -0.0348 -0.0128 230  ARG A N   
1667 C CA  . ARG A 230 ? 0.6485 0.7827 0.6029 -0.0101 -0.0345 -0.0221 230  ARG A CA  
1668 C C   . ARG A 230 ? 0.6887 0.8044 0.6393 0.0002  -0.0327 -0.0176 230  ARG A C   
1669 O O   . ARG A 230 ? 0.6906 0.7945 0.6425 0.0039  -0.0331 -0.0241 230  ARG A O   
1670 C CB  . ARG A 230 ? 0.6122 0.7737 0.5724 -0.0131 -0.0337 -0.0253 230  ARG A CB  
1671 C CG  . ARG A 230 ? 0.5826 0.7462 0.5461 -0.0109 -0.0332 -0.0356 230  ARG A CG  
1672 C CD  . ARG A 230 ? 0.6645 0.8464 0.6250 -0.0164 -0.0334 -0.0352 230  ARG A CD  
1673 N NE  . ARG A 230 ? 0.7917 0.9809 0.7535 -0.0142 -0.0351 -0.0213 230  ARG A NE  
1674 C CZ  . ARG A 230 ? 0.8253 1.0374 0.7854 -0.0210 -0.0367 -0.0131 230  ARG A CZ  
1675 N NH1 . ARG A 230 ? 0.6062 0.8311 0.5593 -0.0320 -0.0369 -0.0198 230  ARG A NH1 
1676 N NH2 . ARG A 230 ? 0.6247 0.8479 0.5888 -0.0161 -0.0373 0.0032  230  ARG A NH2 
1677 N N   . ASN A 231 ? 0.6305 0.7450 0.5763 0.0062  -0.0299 -0.0048 231  ASN A N   
1678 C CA  . ASN A 231 ? 0.6323 0.7327 0.5743 0.0193  -0.0257 0.0035  231  ASN A CA  
1679 C C   . ASN A 231 ? 0.6858 0.7445 0.6112 0.0240  -0.0230 0.0022  231  ASN A C   
1680 O O   . ASN A 231 ? 0.7005 0.7463 0.6238 0.0338  -0.0200 0.0026  231  ASN A O   
1681 C CB  . ASN A 231 ? 0.6405 0.7519 0.5812 0.0272  -0.0214 0.0213  231  ASN A CB  
1682 C CG  . ASN A 231 ? 0.8340 0.9883 0.7887 0.0214  -0.0248 0.0258  231  ASN A CG  
1683 O OD1 . ASN A 231 ? 0.6545 0.8263 0.6166 0.0120  -0.0294 0.0147  231  ASN A OD1 
1684 N ND2 . ASN A 231 ? 0.7290 0.8988 0.6842 0.0261  -0.0221 0.0430  231  ASN A ND2 
1685 N N   . PHE A 232 ? 0.6388 0.6766 0.5497 0.0152  -0.0243 0.0014  232  PHE A N   
1686 C CA  . PHE A 232 ? 0.6551 0.6487 0.5423 0.0133  -0.0231 -0.0001 232  PHE A CA  
1687 C C   . PHE A 232 ? 0.6882 0.6830 0.5828 0.0089  -0.0279 -0.0121 232  PHE A C   
1688 O O   . PHE A 232 ? 0.7069 0.6726 0.5880 0.0145  -0.0253 -0.0133 232  PHE A O   
1689 C CB  . PHE A 232 ? 0.6970 0.6753 0.5673 -0.0020 -0.0262 0.0023  232  PHE A CB  
1690 C CG  . PHE A 232 ? 0.7450 0.6814 0.5882 -0.0128 -0.0283 -0.0007 232  PHE A CG  
1691 C CD1 . PHE A 232 ? 0.8187 0.7010 0.6255 -0.0083 -0.0212 0.0057  232  PHE A CD1 
1692 C CD2 . PHE A 232 ? 0.7408 0.6907 0.5920 -0.0273 -0.0367 -0.0086 232  PHE A CD2 
1693 C CE1 . PHE A 232 ? 0.8619 0.7007 0.6366 -0.0224 -0.0239 0.0023  232  PHE A CE1 
1694 C CE2 . PHE A 232 ? 0.7935 0.7083 0.6185 -0.0406 -0.0403 -0.0098 232  PHE A CE2 
1695 C CZ  . PHE A 232 ? 0.8194 0.6770 0.6043 -0.0400 -0.0345 -0.0052 232  PHE A CZ  
1696 N N   . THR A 233 ? 0.6262 0.6532 0.5402 0.0001  -0.0336 -0.0200 233  THR A N   
1697 C CA  . THR A 233 ? 0.6138 0.6474 0.5375 -0.0029 -0.0375 -0.0295 233  THR A CA  
1698 C C   . THR A 233 ? 0.6581 0.6923 0.5898 0.0088  -0.0350 -0.0334 233  THR A C   
1699 O O   . THR A 233 ? 0.6659 0.6844 0.5938 0.0101  -0.0361 -0.0374 233  THR A O   
1700 C CB  . THR A 233 ? 0.6911 0.7591 0.6323 -0.0101 -0.0405 -0.0342 233  THR A CB  
1701 O OG1 . THR A 233 ? 0.6795 0.7528 0.6149 -0.0212 -0.0426 -0.0281 233  THR A OG1 
1702 C CG2 . THR A 233 ? 0.6339 0.7077 0.5834 -0.0120 -0.0434 -0.0401 233  THR A CG2 
1703 N N   . VAL A 234 ? 0.6042 0.6578 0.5457 0.0154  -0.0325 -0.0308 234  VAL A N   
1704 C CA  . VAL A 234 ? 0.5852 0.6439 0.5339 0.0237  -0.0311 -0.0320 234  VAL A CA  
1705 C C   . VAL A 234 ? 0.6506 0.6809 0.5861 0.0343  -0.0265 -0.0253 234  VAL A C   
1706 O O   . VAL A 234 ? 0.6609 0.6825 0.5972 0.0383  -0.0265 -0.0296 234  VAL A O   
1707 C CB  . VAL A 234 ? 0.6123 0.7002 0.5705 0.0237  -0.0308 -0.0274 234  VAL A CB  
1708 C CG1 . VAL A 234 ? 0.6063 0.7009 0.5694 0.0305  -0.0297 -0.0233 234  VAL A CG1 
1709 C CG2 . VAL A 234 ? 0.5883 0.6962 0.5534 0.0139  -0.0336 -0.0370 234  VAL A CG2 
1710 N N   . GLU A 235 ? 0.6236 0.6364 0.5441 0.0395  -0.0214 -0.0147 235  GLU A N   
1711 C CA  . GLU A 235 ? 0.6444 0.6219 0.5445 0.0524  -0.0133 -0.0069 235  GLU A CA  
1712 C C   . GLU A 235 ? 0.6876 0.6293 0.5696 0.0469  -0.0149 -0.0157 235  GLU A C   
1713 O O   . GLU A 235 ? 0.6755 0.6005 0.5506 0.0562  -0.0109 -0.0157 235  GLU A O   
1714 C CB  . GLU A 235 ? 0.6893 0.6490 0.5717 0.0577  -0.0066 0.0055  235  GLU A CB  
1715 C CG  . GLU A 235 ? 0.8716 0.7861 0.7255 0.0738  0.0052  0.0144  235  GLU A CG  
1716 C CD  . GLU A 235 ? 1.2271 1.1115 1.0556 0.0801  0.0138  0.0264  235  GLU A CD  
1717 O OE1 . GLU A 235 ? 1.3998 1.2584 1.2102 0.1010  0.0273  0.0390  235  GLU A OE1 
1718 O OE2 . GLU A 235 ? 1.0405 0.9255 0.8655 0.0653  0.0082  0.0243  235  GLU A OE2 
1719 N N   . LYS A 236 ? 0.6494 0.5826 0.5235 0.0304  -0.0213 -0.0215 236  LYS A N   
1720 C CA  . LYS A 236 ? 0.6633 0.5685 0.5198 0.0200  -0.0252 -0.0279 236  LYS A CA  
1721 C C   . LYS A 236 ? 0.6752 0.6006 0.5518 0.0203  -0.0299 -0.0362 236  LYS A C   
1722 O O   . LYS A 236 ? 0.6821 0.5833 0.5454 0.0216  -0.0292 -0.0388 236  LYS A O   
1723 C CB  . LYS A 236 ? 0.6997 0.6017 0.5463 -0.0004 -0.0323 -0.0284 236  LYS A CB  
1724 C CG  . LYS A 236 ? 0.8330 0.7060 0.6529 -0.0033 -0.0279 -0.0200 236  LYS A CG  
1725 C CD  . LYS A 236 ? 0.8579 0.6728 0.6387 0.0072  -0.0175 -0.0154 236  LYS A CD  
1726 C CE  . LYS A 236 ? 1.0046 0.8032 0.7716 0.0189  -0.0077 -0.0042 236  LYS A CE  
1727 N NZ  . LYS A 236 ? 1.2306 0.9719 0.9590 0.0349  0.0061  0.0017  236  LYS A NZ  
1728 N N   . MET A 237 ? 0.5962 0.5617 0.5013 0.0199  -0.0335 -0.0403 237  MET A N   
1729 C CA  . MET A 237 ? 0.5733 0.5539 0.4948 0.0215  -0.0365 -0.0477 237  MET A CA  
1730 C C   . MET A 237 ? 0.6038 0.5778 0.5259 0.0345  -0.0319 -0.0463 237  MET A C   
1731 O O   . MET A 237 ? 0.5916 0.5549 0.5115 0.0359  -0.0329 -0.0500 237  MET A O   
1732 C CB  . MET A 237 ? 0.5694 0.5857 0.5134 0.0191  -0.0388 -0.0524 237  MET A CB  
1733 C CG  . MET A 237 ? 0.6074 0.6370 0.5555 0.0084  -0.0429 -0.0531 237  MET A CG  
1734 S SD  . MET A 237 ? 0.6352 0.7000 0.6019 0.0095  -0.0410 -0.0571 237  MET A SD  
1735 C CE  . MET A 237 ? 0.5877 0.6568 0.5651 0.0162  -0.0403 -0.0646 237  MET A CE  
1736 N N   . SER A 238 ? 0.5710 0.5537 0.4957 0.0435  -0.0268 -0.0387 238  SER A N   
1737 C CA  . SER A 238 ? 0.5628 0.5473 0.4901 0.0560  -0.0219 -0.0330 238  SER A CA  
1738 C C   . SER A 238 ? 0.6559 0.6033 0.5609 0.0651  -0.0156 -0.0296 238  SER A C   
1739 O O   . SER A 238 ? 0.6744 0.6208 0.5821 0.0715  -0.0141 -0.0301 238  SER A O   
1740 C CB  . SER A 238 ? 0.5826 0.5908 0.5177 0.0626  -0.0181 -0.0213 238  SER A CB  
1741 O OG  . SER A 238 ? 0.6120 0.6510 0.5628 0.0520  -0.0240 -0.0257 238  SER A OG  
1742 N N   . ALA A 239 ? 0.6402 0.5534 0.5192 0.0645  -0.0115 -0.0265 239  ALA A N   
1743 C CA  . ALA A 239 ? 0.6622 0.5286 0.5094 0.0717  -0.0037 -0.0243 239  ALA A CA  
1744 C C   . ALA A 239 ? 0.7410 0.5933 0.5820 0.0612  -0.0102 -0.0348 239  ALA A C   
1745 O O   . ALA A 239 ? 0.7644 0.5931 0.5903 0.0694  -0.0048 -0.0345 239  ALA A O   
1746 C CB  . ALA A 239 ? 0.6987 0.5263 0.5138 0.0685  0.0011  -0.0202 239  ALA A CB  
1747 N N   . GLU A 240 ? 0.6778 0.5476 0.5312 0.0441  -0.0211 -0.0425 240  GLU A N   
1748 C CA  . GLU A 240 ? 0.6635 0.5283 0.5151 0.0336  -0.0282 -0.0496 240  GLU A CA  
1749 C C   . GLU A 240 ? 0.6892 0.5766 0.5638 0.0425  -0.0287 -0.0526 240  GLU A C   
1750 O O   . GLU A 240 ? 0.7166 0.5874 0.5814 0.0435  -0.0286 -0.0548 240  GLU A O   
1751 C CB  . GLU A 240 ? 0.6625 0.5478 0.5245 0.0155  -0.0384 -0.0527 240  GLU A CB  
1752 C CG  . GLU A 240 ? 0.7811 0.6429 0.6168 0.0011  -0.0401 -0.0490 240  GLU A CG  
1753 C CD  . GLU A 240 ? 1.1082 0.9170 0.8999 -0.0078 -0.0386 -0.0484 240  GLU A CD  
1754 O OE1 . GLU A 240 ? 1.1618 0.9585 0.9460 -0.0085 -0.0399 -0.0516 240  GLU A OE1 
1755 O OE2 . GLU A 240 ? 1.0838 0.8597 0.8449 -0.0151 -0.0358 -0.0447 240  GLU A OE2 
1756 N N   . ILE A 241 ? 0.6106 0.5331 0.5119 0.0475  -0.0292 -0.0523 241  ILE A N   
1757 C CA  . ILE A 241 ? 0.5940 0.5355 0.5136 0.0533  -0.0300 -0.0546 241  ILE A CA  
1758 C C   . ILE A 241 ? 0.6634 0.5909 0.5732 0.0666  -0.0224 -0.0481 241  ILE A C   
1759 O O   . ILE A 241 ? 0.6709 0.5949 0.5820 0.0686  -0.0233 -0.0507 241  ILE A O   
1760 C CB  . ILE A 241 ? 0.6003 0.5758 0.5423 0.0518  -0.0322 -0.0561 241  ILE A CB  
1761 C CG1 . ILE A 241 ? 0.5965 0.5838 0.5471 0.0419  -0.0376 -0.0629 241  ILE A CG1 
1762 C CG2 . ILE A 241 ? 0.5854 0.5734 0.5386 0.0556  -0.0326 -0.0570 241  ILE A CG2 
1763 C CD1 . ILE A 241 ? 0.6160 0.6283 0.5798 0.0398  -0.0378 -0.0652 241  ILE A CD1 
1764 N N   . ASN A 242 ? 0.6318 0.5519 0.5314 0.0770  -0.0141 -0.0383 242  ASN A N   
1765 C CA  . ASN A 242 ? 0.6485 0.5571 0.5378 0.0936  -0.0039 -0.0287 242  ASN A CA  
1766 C C   . ASN A 242 ? 0.7378 0.6016 0.5970 0.0951  0.0001  -0.0325 242  ASN A C   
1767 O O   . ASN A 242 ? 0.7478 0.6047 0.6020 0.1059  0.0061  -0.0289 242  ASN A O   
1768 C CB  . ASN A 242 ? 0.6608 0.5718 0.5449 0.1069  0.0058  -0.0146 242  ASN A CB  
1769 C CG  . ASN A 242 ? 0.8219 0.7821 0.7348 0.1073  0.0029  -0.0066 242  ASN A CG  
1770 O OD1 . ASN A 242 ? 0.8057 0.7926 0.7348 0.1093  0.0014  -0.0024 242  ASN A OD1 
1771 N ND2 . ASN A 242 ? 0.7263 0.6994 0.6440 0.1028  0.0012  -0.0038 242  ASN A ND2 
1772 N N   . GLU A 243 ? 0.6989 0.5340 0.5371 0.0817  -0.0039 -0.0394 243  GLU A N   
1773 C CA  . GLU A 243 ? 0.7264 0.5175 0.5313 0.0767  -0.0024 -0.0438 243  GLU A CA  
1774 C C   . GLU A 243 ? 0.7561 0.5637 0.5770 0.0688  -0.0115 -0.0510 243  GLU A C   
1775 O O   . GLU A 243 ? 0.7793 0.5622 0.5810 0.0713  -0.0083 -0.0522 243  GLU A O   
1776 C CB  . GLU A 243 ? 0.7696 0.5280 0.5451 0.0597  -0.0060 -0.0470 243  GLU A CB  
1777 C CG  . GLU A 243 ? 0.9113 0.6205 0.6448 0.0482  -0.0062 -0.0514 243  GLU A CG  
1778 C CD  . GLU A 243 ? 1.2463 0.9001 0.9354 0.0631  0.0098  -0.0478 243  GLU A CD  
1779 O OE1 . GLU A 243 ? 0.9770 0.6349 0.6719 0.0879  0.0231  -0.0393 243  GLU A OE1 
1780 O OE2 . GLU A 243 ? 1.2344 0.8400 0.8802 0.0494  0.0095  -0.0522 243  GLU A OE2 
1781 N N   . ILE A 244 ? 0.6888 0.5354 0.5421 0.0602  -0.0216 -0.0554 244  ILE A N   
1782 C CA  . ILE A 244 ? 0.6608 0.5238 0.5305 0.0548  -0.0292 -0.0607 244  ILE A CA  
1783 C C   . ILE A 244 ? 0.7159 0.5871 0.5948 0.0683  -0.0240 -0.0576 244  ILE A C   
1784 O O   . ILE A 244 ? 0.7278 0.5862 0.5982 0.0687  -0.0242 -0.0592 244  ILE A O   
1785 C CB  . ILE A 244 ? 0.6603 0.5584 0.5583 0.0464  -0.0376 -0.0646 244  ILE A CB  
1786 C CG1 . ILE A 244 ? 0.6661 0.5602 0.5553 0.0313  -0.0438 -0.0652 244  ILE A CG1 
1787 C CG2 . ILE A 244 ? 0.6307 0.5456 0.5470 0.0468  -0.0421 -0.0680 244  ILE A CG2 
1788 C CD1 . ILE A 244 ? 0.6208 0.5507 0.5361 0.0266  -0.0486 -0.0664 244  ILE A CD1 
1789 N N   . ILE A 245 ? 0.6662 0.5599 0.5606 0.0780  -0.0196 -0.0516 245  ILE A N   
1790 C CA  . ILE A 245 ? 0.6480 0.5562 0.5519 0.0891  -0.0150 -0.0451 245  ILE A CA  
1791 C C   . ILE A 245 ? 0.7272 0.6037 0.6049 0.1011  -0.0049 -0.0400 245  ILE A C   
1792 O O   . ILE A 245 ? 0.7268 0.6054 0.6066 0.1048  -0.0042 -0.0391 245  ILE A O   
1793 C CB  . ILE A 245 ? 0.6558 0.5956 0.5767 0.0946  -0.0124 -0.0358 245  ILE A CB  
1794 C CG1 . ILE A 245 ? 0.6212 0.5887 0.5638 0.0817  -0.0219 -0.0425 245  ILE A CG1 
1795 C CG2 . ILE A 245 ? 0.6544 0.6105 0.5806 0.1075  -0.0054 -0.0228 245  ILE A CG2 
1796 C CD1 . ILE A 245 ? 0.6267 0.6219 0.5805 0.0810  -0.0214 -0.0350 245  ILE A CD1 
1797 N N   . ARG A 246 ? 0.7237 0.5670 0.5732 0.1066  0.0035  -0.0370 246  ARG A N   
1798 C CA  . ARG A 246 ? 0.7687 0.5713 0.5838 0.1192  0.0161  -0.0327 246  ARG A CA  
1799 C C   . ARG A 246 ? 0.8557 0.6295 0.6505 0.1073  0.0109  -0.0426 246  ARG A C   
1800 O O   . ARG A 246 ? 0.8766 0.6378 0.6595 0.1165  0.0175  -0.0401 246  ARG A O   
1801 C CB  . ARG A 246 ? 0.7904 0.5555 0.5734 0.1264  0.0270  -0.0280 246  ARG A CB  
1802 C CG  . ARG A 246 ? 0.8254 0.5437 0.5678 0.1460  0.0455  -0.0209 246  ARG A CG  
1803 C CD  . ARG A 246 ? 0.9423 0.6087 0.6424 0.1497  0.0561  -0.0189 246  ARG A CD  
1804 N NE  . ARG A 246 ? 1.0443 0.6694 0.7125 0.1243  0.0468  -0.0321 246  ARG A NE  
1805 C CZ  . ARG A 246 ? 1.2481 0.8265 0.8765 0.1158  0.0483  -0.0392 246  ARG A CZ  
1806 N NH1 . ARG A 246 ? 1.1552 0.7191 0.7701 0.1329  0.0600  -0.0356 246  ARG A NH1 
1807 N NH2 . ARG A 246 ? 1.0134 0.5618 0.6145 0.0887  0.0376  -0.0486 246  ARG A NH2 
1808 N N   . VAL A 247 ? 0.8171 0.5843 0.6081 0.0866  -0.0009 -0.0518 247  VAL A N   
1809 C CA  . VAL A 247 ? 0.8168 0.5614 0.5881 0.0715  -0.0079 -0.0587 247  VAL A CA  
1810 C C   . VAL A 247 ? 0.8546 0.6297 0.6538 0.0703  -0.0152 -0.0607 247  VAL A C   
1811 O O   . VAL A 247 ? 0.8786 0.6347 0.6602 0.0677  -0.0152 -0.0624 247  VAL A O   
1812 C CB  . VAL A 247 ? 0.8508 0.5838 0.6085 0.0487  -0.0181 -0.0634 247  VAL A CB  
1813 C CG1 . VAL A 247 ? 0.8571 0.5728 0.5943 0.0303  -0.0267 -0.0674 247  VAL A CG1 
1814 C CG2 . VAL A 247 ? 0.8734 0.5663 0.5952 0.0490  -0.0097 -0.0611 247  VAL A CG2 
1815 N N   . LEU A 248 ? 0.7662 0.5843 0.6044 0.0726  -0.0203 -0.0602 248  LEU A N   
1816 C CA  . LEU A 248 ? 0.7323 0.5758 0.5949 0.0717  -0.0264 -0.0617 248  LEU A CA  
1817 C C   . LEU A 248 ? 0.8116 0.6501 0.6689 0.0840  -0.0190 -0.0569 248  LEU A C   
1818 O O   . LEU A 248 ? 0.7939 0.6377 0.6574 0.0807  -0.0236 -0.0587 248  LEU A O   
1819 C CB  . LEU A 248 ? 0.6831 0.5638 0.5791 0.0717  -0.0308 -0.0621 248  LEU A CB  
1820 C CG  . LEU A 248 ? 0.7087 0.6033 0.6174 0.0608  -0.0386 -0.0669 248  LEU A CG  
1821 C CD1 . LEU A 248 ? 0.6698 0.5921 0.6020 0.0630  -0.0392 -0.0673 248  LEU A CD1 
1822 C CD2 . LEU A 248 ? 0.7232 0.6209 0.6364 0.0519  -0.0466 -0.0698 248  LEU A CD2 
1823 N N   . GLN A 249 ? 0.8075 0.6378 0.6535 0.0993  -0.0067 -0.0490 249  GLN A N   
1824 C CA  . GLN A 249 ? 0.8272 0.6574 0.6683 0.1148  0.0035  -0.0405 249  GLN A CA  
1825 C C   . GLN A 249 ? 0.9399 0.7240 0.7402 0.1201  0.0128  -0.0412 249  GLN A C   
1826 O O   . GLN A 249 ? 0.9507 0.7336 0.7448 0.1343  0.0226  -0.0337 249  GLN A O   
1827 C CB  . GLN A 249 ? 0.8391 0.6900 0.6903 0.1309  0.0136  -0.0276 249  GLN A CB  
1828 C CG  . GLN A 249 ? 0.8581 0.7569 0.7467 0.1243  0.0046  -0.0250 249  GLN A CG  
1829 C CD  . GLN A 249 ? 0.9335 0.8565 0.8313 0.1366  0.0127  -0.0105 249  GLN A CD  
1830 O OE1 . GLN A 249 ? 0.8258 0.7753 0.7342 0.1471  0.0184  0.0036  249  GLN A OE1 
1831 N NE2 . GLN A 249 ? 0.7479 0.6655 0.6421 0.1355  0.0133  -0.0114 249  GLN A NE2 
1832 N N   . LEU A 250 ? 0.9275 0.6739 0.6976 0.1071  0.0098  -0.0493 250  LEU A N   
1833 C CA  . LEU A 250 ? 0.9736 0.6675 0.6953 0.1069  0.0177  -0.0517 250  LEU A CA  
1834 C C   . LEU A 250 ? 1.0522 0.7476 0.7736 0.0957  0.0091  -0.0564 250  LEU A C   
1835 O O   . LEU A 250 ? 1.0116 0.7316 0.7561 0.0789  -0.0063 -0.0611 250  LEU A O   
1836 C CB  . LEU A 250 ? 1.0005 0.6510 0.6842 0.0926  0.0166  -0.0575 250  LEU A CB  
1837 C CG  . LEU A 250 ? 1.0554 0.6910 0.7279 0.1045  0.0277  -0.0523 250  LEU A CG  
1838 C CD1 . LEU A 250 ? 1.0865 0.6802 0.7216 0.0850  0.0237  -0.0584 250  LEU A CD1 
1839 C CD2 . LEU A 250 ? 1.0844 0.6937 0.7321 0.1328  0.0499  -0.0426 250  LEU A CD2 
1840 N N   . THR A 251 ? 1.0847 0.7551 0.7799 0.1069  0.0204  -0.0534 251  THR A N   
1841 C CA  . THR A 251 ? 1.1020 0.7702 0.7917 0.0981  0.0144  -0.0565 251  THR A CA  
1842 C C   . THR A 251 ? 1.2681 0.8738 0.8962 0.0901  0.0208  -0.0613 251  THR A C   
1843 O O   . THR A 251 ? 1.2824 0.8816 0.8994 0.0750  0.0122  -0.0651 251  THR A O   
1844 C CB  . THR A 251 ? 1.1266 0.8294 0.8451 0.1142  0.0189  -0.0486 251  THR A CB  
1845 O OG1 . THR A 251 ? 1.1649 0.8541 0.8664 0.1387  0.0387  -0.0391 251  THR A OG1 
1846 C CG2 . THR A 251 ? 1.0519 0.8109 0.8245 0.1125  0.0082  -0.0460 251  THR A CG2 
1847 N N   . SER A 252 ? 1.2978 0.8556 0.8832 0.0996  0.0360  -0.0606 252  SER A N   
1848 C CA  . SER A 252 ? 1.3840 0.8686 0.8988 0.0919  0.0451  -0.0659 252  SER A CA  
1849 C C   . SER A 252 ? 1.4954 0.9477 0.9851 0.0855  0.0475  -0.0680 252  SER A C   
1850 O O   . SER A 252 ? 1.4443 0.9348 0.9743 0.0936  0.0453  -0.0638 252  SER A O   
1851 C CB  . SER A 252 ? 1.4661 0.9169 0.9475 0.1189  0.0686  -0.0602 252  SER A CB  
1852 O OG  . SER A 252 ? 1.5953 1.0573 1.0905 0.1496  0.0859  -0.0493 252  SER A OG  
1853 N N   A TRP A 253 ? 1.5191 0.9027 0.9422 0.0689  0.0509  -0.0743 253  TRP A N   
1854 N N   B TRP A 253 ? 1.5556 0.9386 0.9788 0.0686  0.0509  -0.0742 253  TRP A N   
1855 C CA  A TRP A 253 ? 1.5552 0.8982 0.9434 0.0555  0.0512  -0.0772 253  TRP A CA  
1856 C CA  B TRP A 253 ? 1.6414 0.9586 0.9958 0.0523  0.0543  -0.0807 253  TRP A CA  
1857 C C   A TRP A 253 ? 1.6982 0.9525 1.0079 0.0685  0.0755  -0.0778 253  TRP A C   
1858 C C   B TRP A 253 ? 1.7260 1.0425 1.0687 0.0089  0.0305  -0.0869 253  TRP A C   
1859 O O   A TRP A 253 ? 1.7516 0.9582 1.0122 0.0680  0.0846  -0.0811 253  TRP A O   
1860 O O   B TRP A 253 ? 1.7280 1.0516 1.0654 -0.0112 0.0183  -0.0892 253  TRP A O   
1861 C CB  A TRP A 253 ? 1.5398 0.8846 0.9184 0.0130  0.0275  -0.0836 253  TRP A CB  
1862 C CB  B TRP A 253 ? 1.7132 0.9461 0.9952 0.0673  0.0792  -0.0808 253  TRP A CB  
1863 C CG  A TRP A 253 ? 1.5648 0.9024 0.9245 -0.0054 0.0188  -0.0871 253  TRP A CG  
1864 C CG  B TRP A 253 ? 1.8192 0.9651 1.0135 0.0527  0.0882  -0.0882 253  TRP A CG  
1865 C CD1 A TRP A 253 ? 1.6782 0.9456 0.9632 -0.0242 0.0226  -0.0924 253  TRP A CD1 
1866 C CD1 B TRP A 253 ? 1.9071 1.0078 1.0585 0.0754  0.1105  -0.0871 253  TRP A CD1 
1867 C CD2 A TRP A 253 ? 1.5009 0.9012 0.9140 -0.0065 0.0057  -0.0849 253  TRP A CD2 
1868 C CD2 B TRP A 253 ? 1.8820 0.9673 1.0119 0.0137  0.0785  -0.0967 253  TRP A CD2 
1869 N NE1 A TRP A 253 ? 1.6579 0.9452 0.9492 -0.0376 0.0117  -0.0931 253  TRP A NE1 
1870 N NE1 B TRP A 253 ? 1.9917 1.0046 1.0543 0.0521  0.1149  -0.0962 253  TRP A NE1 
1871 C CE2 A TRP A 253 ? 1.5910 0.9596 0.9615 -0.0257 0.0017  -0.0881 253  TRP A CE2 
1872 C CE2 B TRP A 253 ? 2.0204 1.0227 1.0677 0.0119  0.0944  -0.1020 253  TRP A CE2 
1873 C CE3 A TRP A 253 ? 1.4366 0.9124 0.9252 0.0065  -0.0023 -0.0804 253  TRP A CE3 
1874 C CE3 B TRP A 253 ? 1.8912 0.9864 1.0243 -0.0221 0.0573  -0.0993 253  TRP A CE3 
1875 C CZ2 A TRP A 253 ? 1.5429 0.9569 0.9480 -0.0311 -0.0104 -0.0858 253  TRP A CZ2 
1876 C CZ2 B TRP A 253 ? 2.0974 1.0238 1.0625 -0.0274 0.0884  -0.1107 253  TRP A CZ2 
1877 C CZ3 A TRP A 253 ? 1.4213 0.9360 0.9403 0.0016  -0.0130 -0.0789 253  TRP A CZ3 
1878 C CZ3 B TRP A 253 ? 1.9884 1.0162 1.0455 -0.0613 0.0503  -0.1059 253  TRP A CZ3 
1879 C CH2 A TRP A 253 ? 1.4689 0.9550 0.9486 -0.0163 -0.0172 -0.0810 253  TRP A CH2 
1880 C CH2 B TRP A 253 ? 2.0878 1.0302 1.0601 -0.0651 0.0653  -0.1120 253  TRP A CH2 
1881 N N   B ASP A 254 ? 1.6951 1.0065 1.0346 -0.0054 0.0240  -0.0875 254  ASP A N   
1882 C CA  B ASP A 254 ? 2.1535 1.4655 1.4796 -0.0467 0.0027  -0.0899 254  ASP A CA  
1883 C C   B ASP A 254 ? 2.5469 1.9424 1.9418 -0.0605 -0.0201 -0.0860 254  ASP A C   
1884 O O   B ASP A 254 ? 2.1018 1.5068 1.4878 -0.0947 -0.0383 -0.0848 254  ASP A O   
1885 C CB  B ASP A 254 ? 2.2058 1.4864 1.5068 -0.0542 0.0055  -0.0900 254  ASP A CB  
1886 N N   . VAL B 4   ? 1.1337 1.0880 0.8019 0.0457  0.1222  0.0393  2078 VAL B N   
1887 C CA  . VAL B 4   ? 1.1355 1.0617 0.7713 0.0265  0.0966  0.0403  2078 VAL B CA  
1888 C C   . VAL B 4   ? 1.1378 1.0537 0.7981 0.0349  0.0782  0.0353  2078 VAL B C   
1889 O O   . VAL B 4   ? 1.0958 1.0366 0.8060 0.0403  0.0692  0.0421  2078 VAL B O   
1890 C CB  . VAL B 4   ? 1.1617 1.1062 0.8082 0.0031  0.0777  0.0609  2078 VAL B CB  
1891 C CG1 . VAL B 4   ? 1.1901 1.1011 0.7865 -0.0211 0.0604  0.0652  2078 VAL B CG1 
1892 C CG2 . VAL B 4   ? 1.1645 1.1429 0.8216 0.0000  0.0939  0.0722  2078 VAL B CG2 
1893 N N   . VAL B 5   ? 1.1089 0.9866 0.7310 0.0346  0.0717  0.0242  2079 VAL B N   
1894 C CA  . VAL B 5   ? 1.0755 0.9427 0.7163 0.0426  0.0548  0.0205  2079 VAL B CA  
1895 C C   . VAL B 5   ? 1.0729 0.9504 0.7445 0.0334  0.0302  0.0350  2079 VAL B C   
1896 O O   . VAL B 5   ? 1.0268 0.9162 0.7345 0.0446  0.0244  0.0337  2079 VAL B O   
1897 C CB  . VAL B 5   ? 1.1638 0.9890 0.7620 0.0462  0.0524  0.0067  2079 VAL B CB  
1898 C CG1 . VAL B 5   ? 1.1731 0.9986 0.7803 0.0684  0.0765  -0.0100 2079 VAL B CG1 
1899 C CG2 . VAL B 5   ? 1.2226 1.0098 0.7529 0.0259  0.0483  0.0070  2079 VAL B CG2 
1900 N N   . LEU B 6   ? 1.0352 0.9077 0.6944 0.0127  0.0167  0.0499  2080 LEU B N   
1901 C CA  . LEU B 6   ? 0.9993 0.8812 0.6948 0.0055  -0.0028 0.0653  2080 LEU B CA  
1902 C C   . LEU B 6   ? 0.9716 0.8877 0.7171 0.0128  0.0021  0.0678  2080 LEU B C   
1903 O O   . LEU B 6   ? 0.9239 0.8457 0.7005 0.0199  -0.0049 0.0686  2080 LEU B O   
1904 C CB  . LEU B 6   ? 1.0272 0.8963 0.7065 -0.0199 -0.0194 0.0848  2080 LEU B CB  
1905 C CG  . LEU B 6   ? 1.1230 0.9587 0.7786 -0.0296 -0.0393 0.0936  2080 LEU B CG  
1906 C CD1 . LEU B 6   ? 1.1702 0.9915 0.8038 -0.0594 -0.0557 0.1157  2080 LEU B CD1 
1907 C CD2 . LEU B 6   ? 1.1054 0.9484 0.8060 -0.0192 -0.0501 0.1009  2080 LEU B CD2 
1908 N N   . ILE B 7   ? 0.9346 0.8713 0.6845 0.0111  0.0144  0.0693  2081 ILE B N   
1909 C CA  . ILE B 7   ? 0.8921 0.8590 0.6853 0.0158  0.0170  0.0737  2081 ILE B CA  
1910 C C   . ILE B 7   ? 0.9172 0.8906 0.7306 0.0344  0.0235  0.0624  2081 ILE B C   
1911 O O   . ILE B 7   ? 0.8825 0.8649 0.7267 0.0368  0.0159  0.0642  2081 ILE B O   
1912 C CB  . ILE B 7   ? 0.9444 0.9319 0.7340 0.0082  0.0274  0.0819  2081 ILE B CB  
1913 C CG1 . ILE B 7   ? 0.9560 0.9436 0.7415 -0.0151 0.0132  0.0987  2081 ILE B CG1 
1914 C CG2 . ILE B 7   ? 0.9284 0.9465 0.7594 0.0165  0.0323  0.0864  2081 ILE B CG2 
1915 C CD1 . ILE B 7   ? 1.0209 1.0203 0.7813 -0.0284 0.0222  0.1070  2081 ILE B CD1 
1916 N N   . ASN B 8   ? 0.9047 0.8693 0.6992 0.0458  0.0363  0.0509  2082 ASN B N   
1917 C CA  . ASN B 8   ? 0.8840 0.8556 0.7012 0.0609  0.0407  0.0434  2082 ASN B CA  
1918 C C   . ASN B 8   ? 0.8857 0.8462 0.7102 0.0628  0.0252  0.0400  2082 ASN B C   
1919 O O   . ASN B 8   ? 0.8525 0.8245 0.7037 0.0676  0.0214  0.0395  2082 ASN B O   
1920 C CB  . ASN B 8   ? 0.9823 0.9460 0.7829 0.0727  0.0591  0.0334  2082 ASN B CB  
1921 C CG  . ASN B 8   ? 1.4387 1.4220 1.2477 0.0772  0.0807  0.0382  2082 ASN B CG  
1922 O OD1 . ASN B 8   ? 1.4256 1.3986 1.2136 0.0856  0.1013  0.0300  2082 ASN B OD1 
1923 N ND2 . ASN B 8   ? 1.3436 1.3546 1.1848 0.0726  0.0775  0.0522  2082 ASN B ND2 
1924 N N   . ALA B 9   ? 0.8281 0.7661 0.6280 0.0571  0.0153  0.0402  2083 ALA B N   
1925 C CA  . ALA B 9   ? 0.7906 0.7201 0.5986 0.0587  0.0013  0.0412  2083 ALA B CA  
1926 C C   . ALA B 9   ? 0.8066 0.7468 0.6415 0.0537  -0.0047 0.0489  2083 ALA B C   
1927 O O   . ALA B 9   ? 0.7732 0.7158 0.6233 0.0587  -0.0089 0.0468  2083 ALA B O   
1928 C CB  . ALA B 9   ? 0.8171 0.7206 0.5960 0.0519  -0.0094 0.0457  2083 ALA B CB  
1929 N N   . VAL B 10  ? 0.7824 0.7286 0.6230 0.0434  -0.0044 0.0575  2084 VAL B N   
1930 C CA  . VAL B 10  ? 0.7591 0.7120 0.6276 0.0391  -0.0089 0.0636  2084 VAL B CA  
1931 C C   . VAL B 10  ? 0.8029 0.7692 0.6884 0.0453  -0.0049 0.0564  2084 VAL B C   
1932 O O   . VAL B 10  ? 0.8016 0.7641 0.6995 0.0469  -0.0080 0.0534  2084 VAL B O   
1933 C CB  . VAL B 10  ? 0.7983 0.7558 0.6742 0.0249  -0.0125 0.0768  2084 VAL B CB  
1934 C CG1 . VAL B 10  ? 0.7849 0.7480 0.6941 0.0224  -0.0159 0.0808  2084 VAL B CG1 
1935 C CG2 . VAL B 10  ? 0.8018 0.7433 0.6638 0.0139  -0.0212 0.0890  2084 VAL B CG2 
1936 N N   . LYS B 11  ? 0.7602 0.7399 0.6445 0.0481  0.0024  0.0550  2085 LYS B N   
1937 C CA  . LYS B 11  ? 0.7577 0.7512 0.6605 0.0510  0.0035  0.0545  2085 LYS B CA  
1938 C C   . LYS B 11  ? 0.8023 0.7903 0.7061 0.0568  0.0000  0.0468  2085 LYS B C   
1939 O O   . LYS B 11  ? 0.8068 0.7955 0.7211 0.0532  -0.0059 0.0467  2085 LYS B O   
1940 C CB  . LYS B 11  ? 0.8019 0.8120 0.7078 0.0548  0.0149  0.0589  2085 LYS B CB  
1941 C CG  . LYS B 11  ? 1.0677 1.0955 1.0011 0.0542  0.0133  0.0674  2085 LYS B CG  
1942 C CD  . LYS B 11  ? 1.2700 1.3139 1.2146 0.0628  0.0280  0.0728  2085 LYS B CD  
1943 C CE  . LYS B 11  ? 1.5089 1.5686 1.4544 0.0619  0.0401  0.0829  2085 LYS B CE  
1944 N NZ  . LYS B 11  ? 1.6380 1.7141 1.6006 0.0726  0.0589  0.0899  2085 LYS B NZ  
1945 N N   . ASP B 12  ? 0.7478 0.7288 0.6387 0.0636  0.0019  0.0412  2086 ASP B N   
1946 C CA  . ASP B 12  ? 0.7294 0.7087 0.6233 0.0678  -0.0033 0.0363  2086 ASP B CA  
1947 C C   . ASP B 12  ? 0.7515 0.7211 0.6433 0.0643  -0.0101 0.0347  2086 ASP B C   
1948 O O   . ASP B 12  ? 0.7278 0.6991 0.6235 0.0621  -0.0144 0.0322  2086 ASP B O   
1949 C CB  . ASP B 12  ? 0.7586 0.7301 0.6401 0.0752  -0.0027 0.0322  2086 ASP B CB  
1950 C CG  . ASP B 12  ? 0.9390 0.9157 0.8231 0.0821  0.0078  0.0300  2086 ASP B CG  
1951 O OD1 . ASP B 12  ? 0.9667 0.9584 0.8678 0.0820  0.0161  0.0348  2086 ASP B OD1 
1952 O OD2 . ASP B 12  ? 1.0008 0.9652 0.8717 0.0882  0.0083  0.0247  2086 ASP B OD2 
1953 N N   . VAL B 13  ? 0.7136 0.6724 0.6000 0.0624  -0.0102 0.0379  2087 VAL B N   
1954 C CA  . VAL B 13  ? 0.7144 0.6628 0.6039 0.0616  -0.0113 0.0383  2087 VAL B CA  
1955 C C   . VAL B 13  ? 0.7990 0.7450 0.6949 0.0564  -0.0101 0.0341  2087 VAL B C   
1956 O O   . VAL B 13  ? 0.8135 0.7522 0.7039 0.0562  -0.0097 0.0279  2087 VAL B O   
1957 C CB  . VAL B 13  ? 0.7525 0.6914 0.6447 0.0598  -0.0121 0.0484  2087 VAL B CB  
1958 C CG1 . VAL B 13  ? 0.7396 0.6689 0.6450 0.0608  -0.0083 0.0509  2087 VAL B CG1 
1959 C CG2 . VAL B 13  ? 0.7486 0.6829 0.6285 0.0627  -0.0179 0.0534  2087 VAL B CG2 
1960 N N   . ALA B 14  ? 0.7695 0.7205 0.6742 0.0509  -0.0106 0.0380  2088 ALA B N   
1961 C CA  . ALA B 14  ? 0.7822 0.7280 0.6932 0.0443  -0.0135 0.0361  2088 ALA B CA  
1962 C C   . ALA B 14  ? 0.8211 0.7681 0.7249 0.0406  -0.0188 0.0321  2088 ALA B C   
1963 O O   . ALA B 14  ? 0.8212 0.7518 0.7161 0.0346  -0.0220 0.0261  2088 ALA B O   
1964 C CB  . ALA B 14  ? 0.7885 0.7454 0.7141 0.0386  -0.0161 0.0456  2088 ALA B CB  
1965 N N   . LYS B 15  ? 0.7691 0.7328 0.6768 0.0428  -0.0198 0.0363  2089 LYS B N   
1966 C CA  . LYS B 15  ? 0.7731 0.7427 0.6833 0.0371  -0.0271 0.0390  2089 LYS B CA  
1967 C C   . LYS B 15  ? 0.8072 0.7655 0.7005 0.0352  -0.0299 0.0307  2089 LYS B C   
1968 O O   . LYS B 15  ? 0.8139 0.7626 0.6969 0.0238  -0.0382 0.0298  2089 LYS B O   
1969 C CB  . LYS B 15  ? 0.8001 0.7909 0.7271 0.0430  -0.0233 0.0469  2089 LYS B CB  
1970 C CG  . LYS B 15  ? 1.0768 1.0801 1.0234 0.0355  -0.0308 0.0593  2089 LYS B CG  
1971 C CD  . LYS B 15  ? 1.2683 1.2815 1.2322 0.0313  -0.0319 0.0726  2089 LYS B CD  
1972 C CE  . LYS B 15  ? 1.4498 1.4707 1.4341 0.0195  -0.0447 0.0898  2089 LYS B CE  
1973 N NZ  . LYS B 15  ? 1.5522 1.5839 1.5565 0.0147  -0.0488 0.1070  2089 LYS B NZ  
1974 N N   . ALA B 16  ? 0.7394 0.6975 0.6273 0.0444  -0.0244 0.0264  2090 ALA B N   
1975 C CA  . ALA B 16  ? 0.7324 0.6850 0.6068 0.0439  -0.0259 0.0213  2090 ALA B CA  
1976 C C   . ALA B 16  ? 0.7983 0.7285 0.6545 0.0403  -0.0207 0.0130  2090 ALA B C   
1977 O O   . ALA B 16  ? 0.8064 0.7280 0.6438 0.0326  -0.0232 0.0080  2090 ALA B O   
1978 C CB  . ALA B 16  ? 0.7229 0.6814 0.6004 0.0549  -0.0233 0.0230  2090 ALA B CB  
1979 N N   . LEU B 17  ? 0.7610 0.6804 0.6226 0.0443  -0.0132 0.0118  2091 LEU B N   
1980 C CA  . LEU B 17  ? 0.7814 0.6759 0.6314 0.0433  -0.0046 0.0032  2091 LEU B CA  
1981 C C   . LEU B 17  ? 0.8365 0.7132 0.6683 0.0297  -0.0119 -0.0035 2091 LEU B C   
1982 O O   . LEU B 17  ? 0.8605 0.7129 0.6653 0.0249  -0.0070 -0.0146 2091 LEU B O   
1983 C CB  . LEU B 17  ? 0.7722 0.6624 0.6433 0.0495  0.0027  0.0077  2091 LEU B CB  
1984 C CG  . LEU B 17  ? 0.8594 0.7238 0.7297 0.0528  0.0163  0.0005  2091 LEU B CG  
1985 C CD1 . LEU B 17  ? 0.8782 0.7376 0.7384 0.0612  0.0292  -0.0021 2091 LEU B CD1 
1986 C CD2 . LEU B 17  ? 0.8344 0.6989 0.7364 0.0558  0.0196  0.0101  2091 LEU B CD2 
1987 N N   . GLY B 18  ? 0.7707 0.6584 0.6156 0.0229  -0.0236 0.0049  2092 GLY B N   
1988 C CA  . GLY B 18  ? 0.7845 0.6582 0.6172 0.0074  -0.0367 0.0056  2092 GLY B CA  
1989 C C   . GLY B 18  ? 0.8402 0.7084 0.6478 -0.0045 -0.0447 0.0037  2092 GLY B C   
1990 O O   . GLY B 18  ? 0.8506 0.6889 0.6258 -0.0176 -0.0494 -0.0047 2092 GLY B O   
1991 N N   . ASP B 19  ? 0.8076 0.7019 0.6275 -0.0008 -0.0463 0.0109  2093 ASP B N   
1992 C CA  . ASP B 19  ? 0.8278 0.7238 0.6318 -0.0137 -0.0562 0.0132  2093 ASP B CA  
1993 C C   . ASP B 19  ? 0.9133 0.7868 0.6800 -0.0150 -0.0466 -0.0017 2093 ASP B C   
1994 O O   . ASP B 19  ? 0.9494 0.8064 0.6843 -0.0333 -0.0554 -0.0042 2093 ASP B O   
1995 C CB  . ASP B 19  ? 0.8170 0.7462 0.6496 -0.0065 -0.0585 0.0237  2093 ASP B CB  
1996 C CG  . ASP B 19  ? 0.9832 0.9346 0.8516 -0.0069 -0.0657 0.0398  2093 ASP B CG  
1997 O OD1 . ASP B 19  ? 1.0264 0.9714 0.8989 -0.0167 -0.0736 0.0476  2093 ASP B OD1 
1998 O OD2 . ASP B 19  ? 1.0280 1.0021 0.9216 0.0029  -0.0631 0.0457  2093 ASP B OD2 
1999 N N   . LEU B 20  ? 0.8535 0.7255 0.6239 0.0029  -0.0283 -0.0095 2094 LEU B N   
2000 C CA  . LEU B 20  ? 0.8837 0.7369 0.6249 0.0057  -0.0136 -0.0215 2094 LEU B CA  
2001 C C   . LEU B 20  ? 0.9858 0.7966 0.6896 -0.0041 -0.0078 -0.0366 2094 LEU B C   
2002 O O   . LEU B 20  ? 1.0253 0.8152 0.6870 -0.0163 -0.0059 -0.0457 2094 LEU B O   
2003 C CB  . LEU B 20  ? 0.8599 0.7224 0.6230 0.0269  0.0037  -0.0201 2094 LEU B CB  
2004 C CG  . LEU B 20  ? 0.9486 0.7958 0.6900 0.0332  0.0232  -0.0282 2094 LEU B CG  
2005 C CD1 . LEU B 20  ? 0.9525 0.8128 0.6737 0.0244  0.0169  -0.0257 2094 LEU B CD1 
2006 C CD2 . LEU B 20  ? 0.9575 0.8131 0.7300 0.0528  0.0382  -0.0205 2094 LEU B CD2 
2007 N N   . ILE B 21  ? 0.9492 0.7458 0.6663 -0.0004 -0.0062 -0.0390 2095 ILE B N   
2008 C CA  . ILE B 21  ? 0.9859 0.7380 0.6719 -0.0084 -0.0020 -0.0539 2095 ILE B CA  
2009 C C   . ILE B 21  ? 1.1002 0.8300 0.7455 -0.0347 -0.0229 -0.0550 2095 ILE B C   
2010 O O   . ILE B 21  ? 1.1542 0.8428 0.7486 -0.0453 -0.0168 -0.0714 2095 ILE B O   
2011 C CB  . ILE B 21  ? 0.9950 0.7422 0.7137 0.0009  0.0010  -0.0525 2095 ILE B CB  
2012 C CG1 . ILE B 21  ? 0.9733 0.7310 0.7228 0.0227  0.0237  -0.0518 2095 ILE B CG1 
2013 C CG2 . ILE B 21  ? 1.0356 0.7357 0.7260 -0.0100 -0.0018 -0.0661 2095 ILE B CG2 
2014 C CD1 . ILE B 21  ? 1.0575 0.8330 0.8549 0.0301  0.0202  -0.0395 2095 ILE B CD1 
2015 N N   . SER B 22  ? 1.0527 0.8088 0.7194 -0.0462 -0.0466 -0.0362 2096 SER B N   
2016 C CA  . SER B 22  ? 1.0941 0.8326 0.7302 -0.0745 -0.0710 -0.0295 2096 SER B CA  
2017 C C   . SER B 22  ? 1.1535 0.8875 0.7503 -0.0886 -0.0718 -0.0332 2096 SER B C   
2018 O O   . SER B 22  ? 1.2030 0.9038 0.7516 -0.1149 -0.0863 -0.0356 2096 SER B O   
2019 C CB  . SER B 22  ? 1.1102 0.8818 0.7901 -0.0813 -0.0932 -0.0035 2096 SER B CB  
2020 O OG  . SER B 22  ? 1.2443 1.0599 0.9594 -0.0712 -0.0904 0.0080  2096 SER B OG  
2021 N N   . ALA B 23  ? 1.0507 0.8162 0.6657 -0.0728 -0.0578 -0.0326 2097 ALA B N   
2022 C CA  . ALA B 23  ? 1.0521 0.8212 0.6369 -0.0840 -0.0576 -0.0339 2097 ALA B CA  
2023 C C   . ALA B 23  ? 1.1574 0.8830 0.6820 -0.0849 -0.0355 -0.0578 2097 ALA B C   
2024 O O   . ALA B 23  ? 1.1786 0.8927 0.6581 -0.1037 -0.0385 -0.0609 2097 ALA B O   
2025 C CB  . ALA B 23  ? 0.9957 0.8116 0.6232 -0.0653 -0.0512 -0.0240 2097 ALA B CB  
2026 N N   . THR B 24  ? 1.1313 0.8321 0.6565 -0.0656 -0.0127 -0.0737 2098 THR B N   
2027 C CA  . THR B 24  ? 1.1912 0.8480 0.6661 -0.0615 0.0151  -0.0975 2098 THR B CA  
2028 C C   . THR B 24  ? 1.3311 0.9307 0.7329 -0.0899 0.0059  -0.1125 2098 THR B C   
2029 O O   . THR B 24  ? 1.3963 0.9657 0.7398 -0.0968 0.0232  -0.1288 2098 THR B O   
2030 C CB  . THR B 24  ? 1.2284 0.8769 0.7350 -0.0326 0.0427  -0.1068 2098 THR B CB  
2031 O OG1 . THR B 24  ? 1.2443 0.8701 0.7614 -0.0359 0.0317  -0.1094 2098 THR B OG1 
2032 C CG2 . THR B 24  ? 1.1447 0.8443 0.7150 -0.0085 0.0501  -0.0902 2098 THR B CG2 
2033 N N   . LYS B 25  ? 1.2896 0.8726 0.6917 -0.1071 -0.0213 -0.1059 2099 LYS B N   
2034 C CA  . LYS B 25  ? 1.6564 1.1802 0.9878 -0.1383 -0.0376 -0.1163 2099 LYS B CA  
2035 C C   . LYS B 25  ? 2.0853 1.6225 1.4253 -0.1686 -0.0808 -0.0896 2099 LYS B C   
2036 O O   . LYS B 25  ? 1.5781 1.1490 0.9261 -0.1825 -0.0955 -0.0718 2099 LYS B O   
2037 C CB  . LYS B 25  ? 1.7306 1.1997 1.0429 -0.1305 -0.0252 -0.1379 2099 LYS B CB  
2038 C CG  . LYS B 25  ? 1.8066 1.3042 1.1946 -0.1004 -0.0153 -0.1323 2099 LYS B CG  
2039 C CD  . LYS B 25  ? 1.8984 1.3551 1.2783 -0.0793 0.0187  -0.1579 2099 LYS B CD  
2040 C CE  . LYS B 25  ? 1.9133 1.3821 1.2957 -0.0559 0.0581  -0.1680 2099 LYS B CE  
2041 N NZ  . LYS B 25  ? 2.0504 1.4841 1.4417 -0.0332 0.0923  -0.1874 2099 LYS B NZ  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1    ?    ?   ?   A . n 
A 1 2   PRO 2   2    ?    ?   ?   A . n 
A 1 3   VAL 3   3    3    VAL GLY A . n 
A 1 4   PHE 4   4    4    PHE PHE A . n 
A 1 5   HIS 5   5    5    HIS HIS A . n 
A 1 6   THR 6   6    6    THR THR A . n 
A 1 7   ARG 7   7    7    ARG ARG A . n 
A 1 8   THR 8   8    8    THR THR A . n 
A 1 9   ILE 9   9    9    ILE ILE A . n 
A 1 10  GLU 10  10   10   GLU GLU A . n 
A 1 11  SER 11  11   11   SER SER A . n 
A 1 12  ILE 12  12   12   ILE ILE A . n 
A 1 13  LEU 13  13   13   LEU LEU A . n 
A 1 14  GLU 14  14   14   GLU GLU A . n 
A 1 15  PRO 15  15   15   PRO PRO A . n 
A 1 16  VAL 16  16   16   VAL VAL A . n 
A 1 17  ALA 17  17   17   ALA ALA A . n 
A 1 18  GLN 18  18   18   GLN GLN A . n 
A 1 19  GLN 19  19   19   GLN GLN A . n 
A 1 20  ILE 20  20   20   ILE ILE A . n 
A 1 21  SER 21  21   21   SER SER A . n 
A 1 22  HIS 22  22   22   HIS HIS A . n 
A 1 23  LEU 23  23   23   LEU LEU A . n 
A 1 24  VAL 24  24   24   VAL VAL A . n 
A 1 25  ILE 25  25   25   ILE ILE A . n 
A 1 26  MET 26  26   26   MET MET A . n 
A 1 27  HIS 27  27   27   HIS HIS A . n 
A 1 28  GLU 28  28   28   GLU GLU A . n 
A 1 29  GLU 29  29   29   GLU GLU A . n 
A 1 30  GLY 30  30   30   GLY GLY A . n 
A 1 31  GLU 31  31   ?    ?   ?   A . n 
A 1 32  VAL 32  32   ?    ?   ?   A . n 
A 1 33  ASP 33  33   ?    ?   ?   A . n 
A 1 34  GLY 34  34   ?    ?   ?   A . n 
A 1 35  LYS 35  35   35   LYS LYS A . n 
A 1 36  ALA 36  36   36   ALA ALA A . n 
A 1 37  ILE 37  37   37   ILE ILE A . n 
A 1 38  PRO 38  38   38   PRO PRO A . n 
A 1 39  ASP 39  39   39   ASP ASP A . n 
A 1 40  LEU 40  40   40   LEU LEU A . n 
A 1 41  THR 41  41   41   THR THR A . n 
A 1 42  ALA 42  42   42   ALA ALA A . n 
A 1 43  PRO 43  43   43   PRO PRO A . n 
A 1 44  VAL 44  44   44   VAL VAL A . n 
A 1 45  ALA 45  45   45   ALA ALA A . n 
A 1 46  ALA 46  46   46   ALA ALA A . n 
A 1 47  VAL 47  47   47   VAL VAL A . n 
A 1 48  GLN 48  48   48   GLN GLN A . n 
A 1 49  ALA 49  49   49   ALA ALA A . n 
A 1 50  ALA 50  50   50   ALA ALA A . n 
A 1 51  VAL 51  51   51   VAL VAL A . n 
A 1 52  SER 52  52   52   SER SER A . n 
A 1 53  ASN 53  53   53   ASN ASN A . n 
A 1 54  LEU 54  54   54   LEU LEU A . n 
A 1 55  VAL 55  55   55   VAL VAL A . n 
A 1 56  ARG 56  56   56   ARG ARG A . n 
A 1 57  VAL 57  57   57   VAL VAL A . n 
A 1 58  GLY 58  58   58   GLY GLY A . n 
A 1 59  LYS 59  59   59   LYS LYS A . n 
A 1 60  GLU 60  60   60   GLU GLU A . n 
A 1 61  THR 61  61   61   THR THR A . n 
A 1 62  VAL 62  62   62   VAL VAL A . n 
A 1 63  GLN 63  63   63   GLN GLN A . n 
A 1 64  THR 64  64   64   THR THR A . n 
A 1 65  THR 65  65   65   THR THR A . n 
A 1 66  GLU 66  66   66   GLU GLU A . n 
A 1 67  ASP 67  67   67   ASP ASP A . n 
A 1 68  GLN 68  68   68   GLN GLN A . n 
A 1 69  ILE 69  69   69   ILE ILE A . n 
A 1 70  LEU 70  70   70   LEU LEU A . n 
A 1 71  LYS 71  71   71   LYS LYS A . n 
A 1 72  ARG 72  72   72   ARG ARG A . n 
A 1 73  ASP 73  73   73   ASP ASP A . n 
A 1 74  MET 74  74   74   MET MET A . n 
A 1 75  PRO 75  75   75   PRO PRO A . n 
A 1 76  PRO 76  76   76   PRO PRO A . n 
A 1 77  ALA 77  77   77   ALA ALA A . n 
A 1 78  PHE 78  78   78   PHE PHE A . n 
A 1 79  ILE 79  79   79   ILE ILE A . n 
A 1 80  LYS 80  80   80   LYS LYS A . n 
A 1 81  VAL 81  81   81   VAL VAL A . n 
A 1 82  GLU 82  82   82   GLU GLU A . n 
A 1 83  ASN 83  83   83   ASN ASN A . n 
A 1 84  ALA 84  84   84   ALA ALA A . n 
A 1 85  CYS 85  85   85   CYS CYS A . n 
A 1 86  THR 86  86   86   THR THR A . n 
A 1 87  LYS 87  87   87   LYS LYS A . n 
A 1 88  LEU 88  88   88   LEU LEU A . n 
A 1 89  VAL 89  89   89   VAL VAL A . n 
A 1 90  GLN 90  90   90   GLN GLN A . n 
A 1 91  ALA 91  91   91   ALA ALA A . n 
A 1 92  ALA 92  92   92   ALA ALA A . n 
A 1 93  GLN 93  93   93   GLN GLN A . n 
A 1 94  MET 94  94   94   MET MET A . n 
A 1 95  LEU 95  95   95   LEU LEU A . n 
A 1 96  GLN 96  96   96   GLN GLN A . n 
A 1 97  SER 97  97   97   SER SER A . n 
A 1 98  ASP 98  98   98   ASP ASP A . n 
A 1 99  PRO 99  99   99   PRO PRO A . n 
A 1 100 TYR 100 100  100  TYR TYR A . n 
A 1 101 SER 101 101  101  SER SER A . n 
A 1 102 VAL 102 102  102  VAL VAL A . n 
A 1 103 PRO 103 103  103  PRO PRO A . n 
A 1 104 ALA 104 104  104  ALA ALA A . n 
A 1 105 ARG 105 105  105  ARG ARG A . n 
A 1 106 ASP 106 106  106  ASP ASP A . n 
A 1 107 TYR 107 107  107  TYR TYR A . n 
A 1 108 LEU 108 108  108  LEU LEU A . n 
A 1 109 ILE 109 109  109  ILE ILE A . n 
A 1 110 ASP 110 110  110  ASP ASP A . n 
A 1 111 GLY 111 111  111  GLY GLY A . n 
A 1 112 SER 112 112  112  SER SER A . n 
A 1 113 ARG 113 113  113  ARG ARG A . n 
A 1 114 GLY 114 114  114  GLY GLY A . n 
A 1 115 ILE 115 115  115  ILE ILE A . n 
A 1 116 LEU 116 116  116  LEU LEU A . n 
A 1 117 SER 117 117  117  SER SER A . n 
A 1 118 GLY 118 118  118  GLY GLY A . n 
A 1 119 THR 119 119  119  THR THR A . n 
A 1 120 SER 120 120  120  SER SER A . n 
A 1 121 ASP 121 121  121  ASP ASP A . n 
A 1 122 LEU 122 122  122  LEU LEU A . n 
A 1 123 LEU 123 123  123  LEU LEU A . n 
A 1 124 LEU 124 124  124  LEU LEU A . n 
A 1 125 THR 125 125  125  THR THR A . n 
A 1 126 PHE 126 126  126  PHE PHE A . n 
A 1 127 ASP 127 127  127  ASP ASP A . n 
A 1 128 GLU 128 128  128  GLU GLU A . n 
A 1 129 ALA 129 129  129  ALA ALA A . n 
A 1 130 GLU 130 130  130  GLU GLU A . n 
A 1 131 VAL 131 131  131  VAL VAL A . n 
A 1 132 ARG 132 132  132  ARG ARG A . n 
A 1 133 LYS 133 133  133  LYS LYS A . n 
A 1 134 ILE 134 134  134  ILE ILE A . n 
A 1 135 ILE 135 135  135  ILE ILE A . n 
A 1 136 ARG 136 136  136  ARG ARG A . n 
A 1 137 VAL 137 137  137  VAL VAL A . n 
A 1 138 CYS 138 138  138  CYS CYS A . n 
A 1 139 LYS 139 139  139  LYS LYS A . n 
A 1 140 GLY 140 140  140  GLY GLY A . n 
A 1 141 ILE 141 141  141  ILE ILE A . n 
A 1 142 LEU 142 142  142  LEU LEU A . n 
A 1 143 GLU 143 143  143  GLU GLU A . n 
A 1 144 TYR 144 144  144  TYR TYR A . n 
A 1 145 LEU 145 145  145  LEU LEU A . n 
A 1 146 THR 146 146  146  THR THR A . n 
A 1 147 VAL 147 147  147  VAL VAL A . n 
A 1 148 ALA 148 148  148  ALA ALA A . n 
A 1 149 GLU 149 149  149  GLU GLU A . n 
A 1 150 VAL 150 150  150  VAL VAL A . n 
A 1 151 VAL 151 151  151  VAL VAL A . n 
A 1 152 GLU 152 152  152  GLU GLU A . n 
A 1 153 THR 153 153  153  THR THR A . n 
A 1 154 MET 154 154  154  MET MET A . n 
A 1 155 GLU 155 155  155  GLU GLU A . n 
A 1 156 ASP 156 156  156  ASP ASP A . n 
A 1 157 LEU 157 157  157  LEU LEU A . n 
A 1 158 VAL 158 158  158  VAL VAL A . n 
A 1 159 THR 159 159  159  THR THR A . n 
A 1 160 TYR 160 160  160  TYR TYR A . n 
A 1 161 THR 161 161  161  THR THR A . n 
A 1 162 LYS 162 162  162  LYS LYS A . n 
A 1 163 ASN 163 163  163  ASN ASN A . n 
A 1 164 LEU 164 164  164  LEU LEU A . n 
A 1 165 GLY 165 165  165  GLY GLY A . n 
A 1 166 PRO 166 166  166  PRO PRO A . n 
A 1 167 GLY 167 167  167  GLY GLY A . n 
A 1 168 MET 168 168  168  MET MET A . n 
A 1 169 THR 169 169  169  THR THR A . n 
A 1 170 LYS 170 170  170  LYS LYS A . n 
A 1 171 MET 171 171  171  MET MET A . n 
A 1 172 ALA 172 172  172  ALA ALA A . n 
A 1 173 LYS 173 173  173  LYS LYS A . n 
A 1 174 MET 174 174  174  MET MET A . n 
A 1 175 ILE 175 175  175  ILE ILE A . n 
A 1 176 ASP 176 176  176  ASP ASP A . n 
A 1 177 GLU 177 177  177  GLU GLU A . n 
A 1 178 ARG 178 178  178  ARG ARG A . n 
A 1 179 GLN 179 179  179  GLN GLN A . n 
A 1 180 GLN 180 180  180  GLN GLN A . n 
A 1 181 GLU 181 181  181  GLU GLU A . n 
A 1 182 LEU 182 182  182  LEU LEU A . n 
A 1 183 THR 183 183  183  THR THR A . n 
A 1 184 HIS 184 184  184  HIS HIS A . n 
A 1 185 GLN 185 185  185  GLN GLN A . n 
A 1 186 GLU 186 186  186  GLU GLU A . n 
A 1 187 HIS 187 187  187  HIS HIS A . n 
A 1 188 ARG 188 188  188  ARG ARG A . n 
A 1 189 VAL 189 189  189  VAL VAL A . n 
A 1 190 MET 190 190  190  MET MET A . n 
A 1 191 LEU 191 191  191  LEU LEU A . n 
A 1 192 VAL 192 192  192  VAL VAL A . n 
A 1 193 ASN 193 193  193  ASN ASN A . n 
A 1 194 SER 194 194  194  SER SER A . n 
A 1 195 MET 195 195  195  MET MET A . n 
A 1 196 ASN 196 196  196  ASN ASN A . n 
A 1 197 THR 197 197  197  THR THR A . n 
A 1 198 VAL 198 198  198  VAL VAL A . n 
A 1 199 LYS 199 199  199  LYS LYS A . n 
A 1 200 GLU 200 200  200  GLU GLU A . n 
A 1 201 LEU 201 201  201  LEU LEU A . n 
A 1 202 LEU 202 202  202  LEU LEU A . n 
A 1 203 PRO 203 203  203  PRO PRO A . n 
A 1 204 VAL 204 204  204  VAL VAL A . n 
A 1 205 LEU 205 205  205  LEU LEU A . n 
A 1 206 ILE 206 206  206  ILE ILE A . n 
A 1 207 SER 207 207  207  SER SER A . n 
A 1 208 ALA 208 208  208  ALA ALA A . n 
A 1 209 MET 209 209  209  MET MET A . n 
A 1 210 LYS 210 210  210  LYS LYS A . n 
A 1 211 ILE 211 211  211  ILE ILE A . n 
A 1 212 PHE 212 212  212  PHE PHE A . n 
A 1 213 VAL 213 213  213  VAL VAL A . n 
A 1 214 THR 214 214  214  THR THR A . n 
A 1 215 THR 215 215  215  THR THR A . n 
A 1 216 LYS 216 216  ?    ?   ?   A . n 
A 1 217 ASN 217 217  ?    ?   ?   A . n 
A 1 218 SER 218 218  ?    ?   ?   A . n 
A 1 219 LYS 219 219  ?    ?   ?   A . n 
A 1 220 ASN 220 220  ?    ?   ?   A . n 
A 1 221 GLN 221 221  221  GLN GLN A . n 
A 1 222 GLY 222 222  222  GLY GLY A . n 
A 1 223 ILE 223 223  223  ILE ILE A . n 
A 1 224 GLU 224 224  224  GLU GLU A . n 
A 1 225 GLU 225 225  225  GLU GLU A . n 
A 1 226 ALA 226 226  226  ALA ALA A . n 
A 1 227 LEU 227 227  227  LEU LEU A . n 
A 1 228 LYS 228 228  228  LYS LYS A . n 
A 1 229 ASN 229 229  229  ASN ASN A . n 
A 1 230 ARG 230 230  230  ARG ARG A . n 
A 1 231 ASN 231 231  231  ASN ASN A . n 
A 1 232 PHE 232 232  232  PHE PHE A . n 
A 1 233 THR 233 233  233  THR THR A . n 
A 1 234 VAL 234 234  234  VAL VAL A . n 
A 1 235 GLU 235 235  235  GLU GLU A . n 
A 1 236 LYS 236 236  236  LYS LYS A . n 
A 1 237 MET 237 237  237  MET MET A . n 
A 1 238 SER 238 238  238  SER SER A . n 
A 1 239 ALA 239 239  239  ALA ALA A . n 
A 1 240 GLU 240 240  240  GLU GLU A . n 
A 1 241 ILE 241 241  241  ILE ILE A . n 
A 1 242 ASN 242 242  242  ASN ASN A . n 
A 1 243 GLU 243 243  243  GLU GLU A . n 
A 1 244 ILE 244 244  244  ILE ILE A . n 
A 1 245 ILE 245 245  245  ILE ILE A . n 
A 1 246 ARG 246 246  246  ARG ARG A . n 
A 1 247 VAL 247 247  247  VAL VAL A . n 
A 1 248 LEU 248 248  248  LEU LEU A . n 
A 1 249 GLN 249 249  249  GLN GLN A . n 
A 1 250 LEU 250 250  250  LEU LEU A . n 
A 1 251 THR 251 251  251  THR THR A . n 
A 1 252 SER 252 252  252  SER SER A . n 
A 1 253 TRP 253 253  253  TRP TRP A . n 
A 1 254 ASP 254 254  254  ASP ASP A . n 
A 1 255 GLU 255 255  ?    ?   ?   A . n 
A 1 256 ASP 256 256  ?    ?   ?   A . n 
A 1 257 ALA 257 257  ?    ?   ?   A . n 
A 1 258 TRP 258 258  ?    ?   ?   A . n 
B 2 1   GLU 1   2075 ?    ?   ?   B . n 
B 2 2   THR 2   2076 ?    ?   ?   B . n 
B 2 3   GLN 3   2077 ?    ?   ?   B . n 
B 2 4   VAL 4   2078 2078 VAL VAL B . n 
B 2 5   VAL 5   2079 2079 VAL VAL B . n 
B 2 6   LEU 6   2080 2080 LEU LEU B . n 
B 2 7   ILE 7   2081 2081 ILE ILE B . n 
B 2 8   ASN 8   2082 2082 ASN ASN B . n 
B 2 9   ALA 9   2083 2083 ALA ALA B . n 
B 2 10  VAL 10  2084 2084 VAL VAL B . n 
B 2 11  LYS 11  2085 2085 LYS LYS B . n 
B 2 12  ASP 12  2086 2086 ASP ASP B . n 
B 2 13  VAL 13  2087 2087 VAL VAL B . n 
B 2 14  ALA 14  2088 2088 ALA ALA B . n 
B 2 15  LYS 15  2089 2089 LYS LYS B . n 
B 2 16  ALA 16  2090 2090 ALA ALA B . n 
B 2 17  LEU 17  2091 2091 LEU LEU B . n 
B 2 18  GLY 18  2092 2092 GLY GLY B . n 
B 2 19  ASP 19  2093 2093 ASP ASP B . n 
B 2 20  LEU 20  2094 2094 LEU LEU B . n 
B 2 21  ILE 21  2095 2095 ILE ILE B . n 
B 2 22  SER 22  2096 2096 SER SER B . n 
B 2 23  ALA 23  2097 2097 ALA ALA B . n 
B 2 24  THR 24  2098 2098 THR THR B . n 
B 2 25  LYS 25  2099 2099 LYS LYS B . n 
B 2 26  ALA 26  2100 ?    ?   ?   B . n 
B 2 27  ALA 27  2101 ?    ?   ?   B . n 
B 2 28  ALA 28  2102 ?    ?   ?   B . n 
B 2 29  GLY 29  2103 ?    ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2130  ? 
1 MORE         -27   ? 
1 'SSA (A^2)'  14130 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-02-29 
2 'Structure model' 1 1 2012-05-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 22.6428 18.0615 -32.4915 -0.2268 -0.3420 -0.3196 0.0757 -0.0395 -0.0573 0.9833 1.3344 4.2520 
0.5986 -0.7174 -2.0295 -0.0831 -0.0009 0.0481  -0.3024 -0.0765 -0.0149 0.3933 0.1201  0.1596  
'X-RAY DIFFRACTION' 2 ? refined 21.4196 27.7470 -51.0589 -0.0571 -0.1017 -0.1588 0.0484 -0.0161 0.0310  2.7845 4.0065 1.0852 
1.6797 0.8675  -2.9370 -0.0402 -0.0037 -0.2562 -0.1788 0.0989  0.1469  0.1936 -0.2419 -0.0587 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 3    A 254  '{ A|3 - A|254 }'     ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 2078 B 2099 '{ B|2078 - B|2099 }' ? ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
BUSTER   refinement       2.13.0                ? 1 
AutoPROC 'data scaling'   .                     ? 2 
XDS      'data reduction' '(VERSION December 6' ? 3 
SCALA    'data scaling'   .                     ? 4 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A VAL 3   ? CB  ? A VAL 3   CB  
2  1 Y 1 A VAL 3   ? CG1 ? A VAL 3   CG1 
3  1 Y 1 A VAL 3   ? CG2 ? A VAL 3   CG2 
4  1 Y 1 A GLU 28  ? CG  ? A GLU 28  CG  
5  1 Y 1 A GLU 28  ? CD  ? A GLU 28  CD  
6  1 Y 1 A GLU 28  ? OE1 ? A GLU 28  OE1 
7  1 Y 1 A GLU 28  ? OE2 ? A GLU 28  OE2 
8  1 Y 1 A GLU 29  ? CG  ? A GLU 29  CG  
9  1 Y 1 A GLU 29  ? CD  ? A GLU 29  CD  
10 1 Y 1 A GLU 29  ? OE1 ? A GLU 29  OE1 
11 1 Y 1 A GLU 29  ? OE2 ? A GLU 29  OE2 
12 1 Y 1 A GLU 66  ? CG  ? A GLU 66  CG  
13 1 Y 1 A GLU 66  ? CD  ? A GLU 66  CD  
14 1 Y 1 A GLU 66  ? OE1 ? A GLU 66  OE1 
15 1 Y 1 A GLU 66  ? OE2 ? A GLU 66  OE2 
16 1 Y 1 A LYS 87  ? CG  ? A LYS 87  CG  
17 1 Y 1 A LYS 87  ? CD  ? A LYS 87  CD  
18 1 Y 1 A LYS 87  ? CE  ? A LYS 87  CE  
19 1 Y 1 A LYS 87  ? NZ  ? A LYS 87  NZ  
20 1 Y 1 A ARG 105 ? CG  ? A ARG 105 CG  
21 1 Y 1 A ARG 105 ? CD  ? A ARG 105 CD  
22 1 Y 1 A ARG 105 ? NE  ? A ARG 105 NE  
23 1 Y 1 A ARG 105 ? CZ  ? A ARG 105 CZ  
24 1 Y 1 A ARG 105 ? NH1 ? A ARG 105 NH1 
25 1 Y 1 A ARG 105 ? NH2 ? A ARG 105 NH2 
26 1 Y 1 A GLU 181 ? CG  ? A GLU 181 CG  
27 1 Y 1 A GLU 181 ? CD  ? A GLU 181 CD  
28 1 Y 1 A GLU 181 ? OE1 ? A GLU 181 OE1 
29 1 Y 1 A GLU 181 ? OE2 ? A GLU 181 OE2 
30 1 Y 1 A GLN 221 ? CG  ? A GLN 221 CG  
31 1 Y 1 A GLN 221 ? CD  ? A GLN 221 CD  
32 1 Y 1 A GLN 221 ? OE1 ? A GLN 221 OE1 
33 1 Y 1 A GLN 221 ? NE2 ? A GLN 221 NE2 
34 1 Y 1 A LYS 228 ? CG  ? A LYS 228 CG  
35 1 Y 1 A LYS 228 ? CD  ? A LYS 228 CD  
36 1 Y 1 A LYS 228 ? CE  ? A LYS 228 CE  
37 1 Y 1 A LYS 228 ? NZ  ? A LYS 228 NZ  
38 1 Y 1 A ASP 254 ? CG  ? A ASP 254 CG  
39 1 Y 1 A ASP 254 ? OD1 ? A ASP 254 OD1 
40 1 Y 1 A ASP 254 ? OD2 ? A ASP 254 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1    ? A MET 1   
2  1 Y 1 A PRO 2    ? A PRO 2   
3  1 Y 1 A GLU 31   ? A GLU 31  
4  1 Y 1 A VAL 32   ? A VAL 32  
5  1 Y 1 A ASP 33   ? A ASP 33  
6  1 Y 1 A GLY 34   ? A GLY 34  
7  1 Y 1 A LYS 216  ? A LYS 216 
8  1 Y 1 A ASN 217  ? A ASN 217 
9  1 Y 1 A SER 218  ? A SER 218 
10 1 Y 1 A LYS 219  ? A LYS 219 
11 1 Y 1 A ASN 220  ? A ASN 220 
12 1 Y 1 A GLU 255  ? A GLU 255 
13 1 Y 1 A ASP 256  ? A ASP 256 
14 1 Y 1 A ALA 257  ? A ALA 257 
15 1 Y 1 A TRP 258  ? A TRP 258 
16 1 Y 1 B GLU 2075 ? B GLU 1   
17 1 Y 1 B THR 2076 ? B THR 2   
18 1 Y 1 B GLN 2077 ? B GLN 3   
19 1 Y 1 B ALA 2100 ? B ALA 26  
20 1 Y 1 B ALA 2101 ? B ALA 27  
21 1 Y 1 B ALA 2102 ? B ALA 28  
22 1 Y 1 B GLY 2103 ? B GLY 29  
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  301  2   HOH HOH A . 
C 3 HOH 2  302  6   HOH HOH A . 
C 3 HOH 3  303  8   HOH HOH A . 
C 3 HOH 4  304  9   HOH HOH A . 
C 3 HOH 5  305  1   HOH HOH A . 
C 3 HOH 6  306  2   HOH HOH A . 
C 3 HOH 7  307  3   HOH HOH A . 
C 3 HOH 8  308  5   HOH HOH A . 
C 3 HOH 9  309  6   HOH HOH A . 
C 3 HOH 10 310  7   HOH HOH A . 
C 3 HOH 11 311  10  HOH HOH A . 
C 3 HOH 12 312  11  HOH HOH A . 
C 3 HOH 13 313  13  HOH HOH A . 
C 3 HOH 14 314  14  HOH HOH A . 
C 3 HOH 15 315  15  HOH HOH A . 
C 3 HOH 16 316  17  HOH HOH A . 
C 3 HOH 17 317  18  HOH HOH A . 
C 3 HOH 18 318  22  HOH HOH A . 
C 3 HOH 19 319  23  HOH HOH A . 
C 3 HOH 20 320  25  HOH HOH A . 
C 3 HOH 21 321  27  HOH HOH A . 
C 3 HOH 22 322  28  HOH HOH A . 
C 3 HOH 23 323  29  HOH HOH A . 
C 3 HOH 24 324  30  HOH HOH A . 
C 3 HOH 25 325  31  HOH HOH A . 
C 3 HOH 26 326  36  HOH HOH A . 
C 3 HOH 27 327  37  HOH HOH A . 
C 3 HOH 28 328  38  HOH HOH A . 
C 3 HOH 29 329  39  HOH HOH A . 
C 3 HOH 30 330  41  HOH HOH A . 
C 3 HOH 31 331  45  HOH HOH A . 
C 3 HOH 32 332  46  HOH HOH A . 
C 3 HOH 33 333  49  HOH HOH A . 
C 3 HOH 34 334  50  HOH HOH A . 
C 3 HOH 35 335  51  HOH HOH A . 
C 3 HOH 36 336  52  HOH HOH A . 
C 3 HOH 37 337  54  HOH HOH A . 
C 3 HOH 38 338  55  HOH HOH A . 
C 3 HOH 39 339  61  HOH HOH A . 
C 3 HOH 40 340  62  HOH HOH A . 
C 3 HOH 41 341  64  HOH HOH A . 
C 3 HOH 42 342  65  HOH HOH A . 
C 3 HOH 43 343  68  HOH HOH A . 
C 3 HOH 44 344  70  HOH HOH A . 
C 3 HOH 45 345  72  HOH HOH A . 
C 3 HOH 46 346  74  HOH HOH A . 
C 3 HOH 47 347  75  HOH HOH A . 
C 3 HOH 48 348  77  HOH HOH A . 
C 3 HOH 49 349  78  HOH HOH A . 
C 3 HOH 50 350  79  HOH HOH A . 
C 3 HOH 51 351  80  HOH HOH A . 
C 3 HOH 52 352  82  HOH HOH A . 
C 3 HOH 53 353  84  HOH HOH A . 
C 3 HOH 54 354  85  HOH HOH A . 
C 3 HOH 55 355  89  HOH HOH A . 
C 3 HOH 56 356  95  HOH HOH A . 
C 3 HOH 57 357  96  HOH HOH A . 
C 3 HOH 58 358  99  HOH HOH A . 
D 3 HOH 1  2201 8   HOH HOH B . 
D 3 HOH 2  2202 16  HOH HOH B . 
D 3 HOH 3  2203 19  HOH HOH B . 
D 3 HOH 4  2204 100 HOH HOH B . 
#